3G2ZA

Ctx-m-9 class a beta-lactamase complexed with compound 2 (gz2)
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
262
structure length
262
Chain Sequence
TSAVQQKLAALEKSSGGRLGVALIDTADNTQVLYRGDERFPMCSTSKVMAAAAVLKQSETQKQLLNQPVEIKPADLVNYNPIAEKHVNGTMTLAELSAAALQYSDNTAMNKLIAQLGGPGGVTAFARAIGDETFRLDRTEPTLNTAIPGDPRDTTTPRAMAQTLRQLTLGHALGETQRAQLVTWLKGNTTGAASIRAGLPTSWTAGDKTGSGDYGTTNDIAVIWPQGRAPLVLVTYFTQPQQNAESRRDVLASAARIIAEGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular docking and ligand specificity in fragment-based inhibitor discovery
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Beta-lactamase CTX-M-9a
total genus 93
structure length 262
sequence length 262
chains with identical sequence B
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2009-02-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 3g2zA00
4B4XA 2EX8A 4LV0A 4X6TA 4UA7A 5G18A 1XPBA 1FCOA 4C6YA 1ES4A 3M6BA 3BFFA 4N9KA 3HLBA 2JE5A 4GDNA 4WM9A 2BG1A 4ZDXA 1CK3A 1M6KA 2J9OA 5TFQA 4H8RA 5KSCA 1HTZA 2OLUA 1RCJA 1I2SA 2OV5A 2Q9NA 2EFXA 2ZMAA 3Q81A 1S6RA 4S2MA 3VP4A 4LV2A 4JKTA 4R3BA 1RGYA 3HUNA 5DVAA 5HARA 1KVMA 3ZDJA 3UE3A 1IYPA 4JXSA 4OQIA 3FYZA 3MZDA 3Q82A 1SDEA 3N8LA 5CTMA 2EXBA 3ZG0A 3MKFA 4GB7A 4K0WA 1KGEA 3IH8A 4E6XA 3IH9A 2ZM8A 4QD4A 1K55A 1ES5A 3V5MA 3N4IA 3SS5A 4S2JA 3G2ZA 4S2IA 2HP9A 2J7VA 1BZAA 4NK3A 4KG2A 2XFTA 4U3TA 5D3OA 3W4OA 4IVKA 3P98A 1DJBA 4WZ4A 5FI2A 5HAQA 1FR6A 2FFYA 4U0TA 5EECA 4OPRA 2XGNA 1YMSA 3A3DA 2EFUA 1K25A 2ZC6B 3OPHA 4E3JA 1TVFA 4QY6A 3VP1A 1CI9A 3FWLA 4OH0A 2PU2A 1ZKJA 2QMIA 1KE0A 1Z6FA 2Y2JA 1IYSA 3JYIA 3AGFA 4WZ5A 1SCWA 1N4OA 3UPPA 1WE4A 1GHIA 1H8ZA 5M18A 1E4DA 1KGGA 3ZVWA 4XXRA 4P0MA 4BD1A 2EX6A 3BLMA 4GZBA 1NXYA 2CC1A 5HAIA 3VFFA 4JLFA 3OPLA 2A3UA 1XGJA 4BENA 4DDYA 4OONA 3BLSA 1MWSA 1IYQA 3S1YA 2ZM2A 3ZG9B 4E3KA 1SDNA 2GDNA 3ZGAB 1QMFA 1ESIA 3PBSA 4K0XA 3C7UA 4X53A 3GV9A 4EV4A 5FA7A 3SS3A 2ZM0A 4KZ8A 3NC8A 1M40A 1Q2PA 3HREA 4GN2A 3GVBA 3GTCA 4DE2A 2Y4AA 4ZBEA 1TDGA 1AXBA 1J9MA 1GA9A 1K38A 2Y2IA 4D2OA 2JBFA 3UE0A 2IWDA 1MWTA 1W8QA 2WZZA 1EI5A 3O87A 4XUZA 1MKIA 2XH9A 2H0YA 3BRMA 1FR1A 1PW8A 2XD5A 4WELA 2C6WB 2Z2LB 2WZXA 3HLGA 4B88A 1QMEA 4JF4A 1ERQA 4DXCA 2Q9MA 4KZ6A 1SKFA 2HDRA 4S2KA 1H5XA 4RX3A 3D4FA 2ZQ7A 5GHXA 5FAQA 4YINA 3WS0A 1KDWA 3CMZA 3DWKA 2A49A 5A92A 2HPBA 2WGVA 3IXBA 3MBZA 5F82A 2WUQA 1L2SA 5HFOA 2XDMA 5HL1A 2XQZA 1ZG4A 4RA7A 5E2GA 3V3RA 2OSUA 2WAEA 3UDXA 5E2FA 4WEKA 5HAPA 2R9WA 3N7WA 3BFGA 1HD8A 4BL3A 1NY0A 1TDLA 4DDSA 4DKIA 5E2HA 3HLWA 4OOYA 5U47A 5DTKA 2G2WA 4E6WA 3W4QA 2J9PA 1K56A 3G31A 3OPPA 4S2NA 5DTSA 4ZJ3A 4KQRA 2X02A 3WS4A 4P87A 5JYPA 3GSGA 1K6RA 1WYCA 2WGWB 4OQHA 5EUAA 3NDGA 2QPNA 3Q07A 4FD8A 4OQGA 4OPZA 1E25A 5DTTA 1FQGA 5EOOA 3A3IA 5AQAA 2XR0A 3UE1A 2JC7A 3DW0A 3N8SA 1MXOA 1PWDA 1L0FA 3E2LA 4KZ4A 3LEZA 3IXDA 1ES3A 4KG5A 3VSKA 4PMAA 3ZVTA 1ZG6A 1OMEA 1GA0A 4BJPA 5GLAA 2X01A 5BOHA 5FQIA 4ID4A 4DRTA 3ITBA 1HZOA 5FQ9A 4F94A 3PBRA 1YLWA 3IXHA 2E8IA 4OQ0A 2H10A 3MXSA 4MNRA 3VP0A 2WKEA 1YQSA 4Y0UA 2J8YA 2H0TA 4JBFA 1DJCA 2HP5A 5FAOA 2JCHA 2Y2GA 2ZC7A 1JWVA 3GMWA 4S2OA 1EROA 1PZOA 3BM6A 1KVLA 5DF7A 4RVAA 3SH8A 5HW3A 1YLPA 1CEFA 2WKHA 4DE0A 3BFEA 1CEGA 1G6AA 5EPHA 5FI6A 2XF3A 3UNWA 4OP5A 3UPNA 2EX2A 5CERA 1ONGA 1MWRA 4PPRA 5CHUA 3UPOA 1JTGA 5DF9A 5CXWA 3IQAA 3M6HA 3Q1FA 5EOEA 2R9XA 5EVID 1BLCA 1BT5A 3LY4A 3MXRA 4GDBA 5EVIA 4C75A 1E3UA 4K91A 2G2UA 4OLDA 4RX2A 4WMCD 5CGXA 3VSLA 1I2WA 4E3NA 1K55C 3WWXA 1PI5A 3IWOA 2ZQDA 4X56A 4E3MA 1WYBA 4QHCA 4R23A 4IVIA 4IBRA 4OVDA 1XA1A 3HUOA 1KE3A 2RCXA 3M2JA 4X68A 3VP2A 5KMWA 3M2KA 1XA7A 3I7JA 3IHBA 2H5SA 3N6IA 2VGJA 4E3LA 4R4RA 1C3BA 2WADA 3O86A 1PWCA 5EVIB 2Y2MA 4S2NC 2Y2NA 2DNSA 2Y2QA 3IWQA 3SS4A 4Z9QA 3TSGA 3UN7A 1N9BA 1VQQA 3TG9A 1EWZA 4KQOA 5GHZA 3PBQA 1G68A 1GCEA 1LHYA 1ES2A 1GHMA 1PW1A 5CGWA 1IELA 3SH7A 4WBGA 4S2PA 1NZOA 3ZG5A 4OLGA 4Y0TA 1BLPA 1IYOA 1NZUA 3ISGA 3IXGA 4EBLA 2V2FF 4RYEA 4WZ5C 1NRFA 3HLCA 3QNCA 4L0LA 3V3SA 2IWBA 4GNUA 1JWPA 4Y7PA 1W5DA 2Y2PA 5FSRA 1FOFA 5TR7A 4OPQA 3ZG7B 1KDSA 1ERMA 4MBHA 4N1HA 2IWCA 3MKEA 4OOMA 4LCLA 4XUXA 3ZFZA 1FCMA 3ZNTA 5GL9A 1GHPA 3FZCA 5EVIC 1RGZA 4GD6A 5FAPA 2WGWA 3G30A 3PAGA 3WS5A 2V20A 1TEMA 4OOLA 3AGDA 1O07A 4KZBA 3RJUA 4BL2A 2Y55A 4E3IA 5J8XA 3NY4A 4E3OA 3A3JA 1MWUA 1RP5A 4R1GA 3SH9A 1YLJA 3BYDA 3VOYA 4B4ZA 4CPKA 2WKIA 5JYOA 4GKUA 3EQVA 3ZNYA 5CRFA 1E3UD 3G34A 4GOGA 3LCEA 1LL9A 1Y54A 3V39A 5HX9A 3O88A 2X71A 3IF6A 3MZEA 3PTEA 4FCFA 3NI9A 3C5AA 4KG6A 5CGSA 1ONHA 4JXGA 4HBUA 3ZG8B 3NCKA 1FCNA 3ITAA 4U0XA 3G4PA 4OPYA 2WGIA 1XGIA 4JF6A 2HP6A 2P9VA 3FKVA 4GD8A 4R0QA 3A3EA 4IBXA 4QU3A 1ESUA 4A5RA 3B3XA 3C4OA 4N1XA 3PBTA 1VM1A 4PM9A 1LI0A 4PM7A 1BSGA 2ZQAA 2PU4A 2ZJ9A 3VMAA 2OLVA 1IEMA 1DJAA 2XFSA 3IF6C 4HBTA 3PBNA 3S22A 1FSWA 2HDQA 1BUEA 1L0EA 2V1ZA 3Q7VA 1ZC2A 1JTDA 4O7DA 4NETA 4FSFA 4ZAMA 1K54C 1YLZA 3HBRA 1XP4A 5IHVA 2XLNA 3NIAA 3Q7VB 3HLFA 4HEFA 3O3VA 4JPMA 4KZ9A 5AQ7A 3IT9A 1XX2A 2DCFA 5GLDA 2WAFA 5AQBA 3ZHHA 1W79A 4Y0OA 4DF6A 3OCLA 3VFHA 3BECA 4BD0A 5A93A 1PWGA 2DRWA 1PIOA 3OPRA 3GRJA 5EE8A 3CG5A 5CHJA 1I5QA 4ZJ1A 4WYYA 2EXAA 2C5WB 4JXWA 4BQMA 1XXMA 3IF6B 5L2FA 5M19A 1LL5A 4EWFA 3A3FA 2P74A 3HLEA 4PM6A 2XK1A 3FV7A 3S4XA 4LV3A 1LLBA 3IHAA 2Y59A 3VP3A 4JXVA 5F83A 4HESA 3OZHA 5CECA 3G2YA 2BLSA 3EQUA 3SOIA 1KGFA 3MZFA 4UHUA 5FI7A 3BFDA 4MBFA 2ZLYA 2Y2KA 2P9VB 2ZC5B 3C7VA 1DY6A 4IEDA 4KENB 4QY5A 1NYMA 2Y2OA 4M3KA 5FQKA 1Q2QA 4KQQA 5CEBA 2HDSA 3BFCA 1K6SA 2PBYA 3RXWA 3QHYA 5I94A 4R4SA 5GLBA 4C3QA 4MEZA 4KZAA 3LY3A 3W8KA 1SHVA 2ZQCA 4CJNA 1K57A 3WRZA 5GHYA 4X55A 4BLMA 3VOZA 4KZ7A 1CI8A 5F1GA 2ZC4B 4JF5A 3AGEA 1XKZA 2ZQ8A 3V50A 2HDUA 4KZ5A 5FATA 1JVJA 1K4EA 1BLHA 5EVLA 2I72A 3HLDA 3NDEA 1YMXA 4FH4A 3DTMA 4OKPA 5F1FA 1YM1A 1K56D 5FDHA 1H8YA 1NJ4A 3UO9A 5TGFA 3BEBA 4LENA 5E43A 5A91A 3HVFA 4DE3A 1MBLA 4LV1A 2ZQ9A 2B5RA 4QJGA 5KZHA 2Y2LA 5KSHA 3HL9A 1HVBA 2Y2HA 4DE1A 5A90A 3CZDA 3UY6A 3QNBA 4UA6A 3CJMA 3PBOA 4EBNA 1K4FA 1NYYA 2Z2MB 4P85A 4DXBA 4EQIA 4X69A 4EUZA 1L0DA 4PM5A 5FASA 1IKGA 5E2EA 3Q7ZA 4ZJ2A 4WEJA 1PZPA 1S0WA 1O7EA 4P6BA 2VGKA 2XD1A 4S2LA 5AQ9A 3HUMA 4N92A 2ZD8A 1MY8A 3N8RA 1PYYA 4MLLA 1JWZA 1YLTA 4YFMA 1FSYA 4QB8A 3G35A 5FQQA 4WMCA 3WRTA 2UWXA 3NBLA 3P09A 1BLSA 1IKIA 2XEPA 4LCMA 5CHMA 4OP8A 3UDFA 1ALQA 2WYXA 4N9LA 3PAEA 4MBKA 5FQMA 4UAAA 3G32A 1MPLA 1YLYA 5M1AA 3WS1A 4ZTKA 3E2KA 3DWZA 5FQJA 3WS2A 3GQZA 2Y91A 2WK0A 3OCNA 4UA9A 2ZC3B 4FH2A 4PM8A 5DF8A 3RXXA 5CEDA 2RL3A 3C4PA 1LI9A 4KZ3A 1BTLA 3TOIA 3OC2A 2FFFB 3W4PA 1W7FA 1L0GA 3IWIA 4R3JA 3LO7A 1W8YA 1KE4A 4Q8IA 3FKWA 3UDIA 4EBPA 1K54A 3ZCZA 2EX9A 2QZ6A 1YT4A 1K57C 3IF5A 5CTNA 1U60A 3GR2A 3MFDA 5GLCA 1PI4A 1BULA
chains in the Genus database with same CATH superfamily
4B4XA 2EX8A 4LV0A 4UA7A 4AFIA 4CLCB 3OLOA 2JKGA 4C6YA 3BFFA 4Y13A 4N9KA 3HLBA 5TFQA 3H7WA 1I2SA 2Q9NA 3ZDJA 4JKTA 5HARA 2VGLS 2VEAA 4KQDA 1A0KA 5EFWA 4K0WA 3IH8A 4ETZA 3N4IA 2HP9A 2EWVA 2XFTA 4U3TA 2M7UA 1DJBA 4NXFA 1FR6A 2FFYA 3A3DA 3E4PA 1K25A 3OPHA 4IJGA 4EERA 3MXQA 1D1JA 4WZ5A 3BQ8A 1GHIA 5M18A 4NXGA 4EU0A 3ZVWA 2EX6A 3BLMA 2V9AA 5DKKA 1XGJA 4DDYA 2A24B 2GDNA 3GV9A 5G4YA 4EV4A 5FA7A 3SS3A 4KZ8A 3NC8A 1M40A 4LRYC 4GN2A 3GVBA 4DE2A 3P7NA 4ZBEA 1TDGA 2Y2IA 4D2OA 2WZZA 3O87A 4XUZA 1MKIA 3BRMA 1FR1A 2YKHA 2Q9MA 1SKFA 2HDRA 4S2KA 3D4FA 2H28A 3LI8A 3DWKA 4Y3IA 5F82A 3IXBA 3U4LP 4Y15A 4ARZB 3V3RA 2OSUA 3EWKA 1G5UA 4II7A 1LSVA 4OOYA 5DTKA 4I38A 3WS4A 5JYPA 2X02A 1K6RA 2QPNA 4H6JB 5AQAA 1E25A 3UE1A 2XR0A 1L0FA 3LEZA 4KG5A 4KUOA 1MC0A 3MR0A 4BJPA 4IUKA 4DRTA 1OT9A 1P9WA 3T4TA 4F94A 3RTYA 2E8IA 2OWHA 5AVFA 4Y0UA 3UMDA 4JBFA 2HP5A 5FAOA 3MJQA 1JWVA 4EW7A 1KVLA 1FILA 3CITA 5DF7A 3SH8A 3BFEA 5EPHA 3UNWA 1ONGA 3UPOA 5DF9A 1JTGA 3Q1FA 3JPUA 5EOEA 2HJEA 4F3LA 1BT5A 4GDBA 5EVIA 1V9ZA 3VSLA 5L09A 4RX2A 2MJ6A 4EESA 4E3MA 1WYBA 4R23A 4IVIA 2W3GA 1KE3A 2RCXA 4X68A 3VP2A 1T1BA 4DJ3A 1CJFA 4S2NC 3TSGA 3UN7A 3RFBA 1LHYA 1PW1A 1ES2A 1GHMA 4PKYG 2ZBBA 3IXGA 2V2FF 2YKFA 4RYEA 3QNCA 4L0LA 4I3AA 2IWBA 1JWPA 4Y7PA 1W5DA 4QWOA 5FSRA 1FOFA 4OPQA 1KDSA 4EEPA 4YOFA 2JN7A 4N1HA 3MKEA 4OOMA 3MF0A 3ZFZA 3ZNTA 1DP8A 1GHPA 4NKPA 2GJ3A 5FAPA 3G30A 3WS5A 3KSGA 3AGDA 1O07A 4BWIA 5J8XA 3NY4A 4CLCE 4CPKA 3B33A 5JYOA 3UB7A 3G34A 1UWPX 3LCEA 1Y54A 2R78A 3NHQA 5HX9A 3LICA 3O88A 3QP2A 4G3VA 3C5AA 1F98A 1ONHA 2PAVP 4JXGA 2OWJA 2W1RA 4U0XA 1FCNA 1OTIA 3G4PA 4OPYA 2WGIA 3FKVA 4GD8A 3A3EA 4A5RA 4QU3A 4N1XA 4PM9A 4PM7A 3EGXC 1DJAA 1T1AA 2QHKA 3LR5A 1Z09A 4Y5FA 4NETA 4ZAMA 4Z1WA 5IHVA 2PD7A 1G6OA 4KZ9A 4O01A 4LGWA 5GLDA 2JKFA 2OOLA 4Y0OA 3OCLA 3R4KA 5EE8A 1I5QA 4ZJ1A 4BQMA 3IF6B 2W27A 2PDRA 2V0WA 2XK1A 3FV7A 3S4XA 1YSPA 2W3EA 3IHAA 3BWLA 5EVEA 5CECA 1TS6A 4UHUA 5FI7A 3H82A 4MBFA 1YSQA 2GNXA 2Y2KA 2P9VB 1DY6A 4QY5A 2Y2OA 4M3KA 2HDSA 3BFCA 4HP4A 3KX0X 5HPIA 4Q0HA 4M4XA 4YNRA 5J4EA 4KZAA 3W8KA 2ZQCA 1TS7A 5GHYA 4X55A 2XRNA 3VOZA 3AGEA 3V50A 2HDUA 5EVLA 4FH4A 4HJ4A 4O8GA 2ZOIA 5FDHA 4HHDA 2W3DA 4I5SA 4LV1A 2B5RA 4P6ZM 1HVBA 3UY6A 3TW8A 2Z2MB 1NYYA 2Y79A 1K0KA 2VA0A 4WEJA 4WUJA 3UE6A 2VGKA 2PYPA 2ZD8A 3H7WB 2WKQA 4WMCA 2J3TD 2D01A 3NBLA 1IOUA 3NOUC 5FQMA 4GW9A 4B93A 3GQZA 2Y91A 5HAPA 3OCNA 3C4PA 1S4SA 4KZ3A 1BTLA 3TOIA 1W7FA 3LO7A 3F1NB 3FKWA 4G3WA 4EBPA 2DMWA 1TF1A 4O0PA 3IF5A 3GR2A 4NEED 2K31A 4Y0TA 1PI4A 1BULA 4X6TA 2OAQ1 5G18A 1XPBA 2QYBA 3UMEA 2JE5A 1CK3A 3LFVA 2J9OA 1HTZA 2EFXA 2ZMAA 3VP4A 3HUNA 1KVMA 4OQIA 1NLZA 3MZDA 3Q82A 1SDEA 4G3KA 4IHQA 3SS5A 2J7VA 4JGQA 5HSQA 5D3OA 3W4OA 4WZ4A 2INWA 1PRQA 5EECA 4OPRA 2XGNA 3LIFA 4E3JA 2A2LA 2PU2A 3JYIA 1IYSA 3B47A 2GZAA 1N4OA 3UPPA 1WE4A 4L9FA 1E4DA 3L9KA 4GZBA 4JGPA 4NG2A 1WA9A 2CC1A 5HAIA 3OPLA 2A3UA 4ARZA 5CX7A 4OONA 4D60A 3S1YA 2ZM2A 1J3WA 4E3KA 4WLAA 3R7WB 1H0MA 4X53A 3LEQA 2OAP1 2L4RA 5HDDA 3GTCA 1P9RA 1K38A 5AVEA 3UE0A 1F9IA 1W8QA 2AVXA 2XH9A 2PT7A 2WZXA 1ERQA 4R6LA 4RX3A 2HV1A 3WS0A 1KDWA 2HPBA 3MBZA 3E4OA 2XDMA 1ZG4A 3DTKA 1ZTUA 3LIDA 3UDXA 4X25A 1S66L 1NY0A 1TDLA 5HD3A 3KSFA 1STZA 4R3AA 5DTSA 2ZMFA 3OPPA 1X0OA 4OQHA 4HOIA 2O0YA 2PR6A 4F3LB 1PWDA 1OTEA 3IXDA 4PMAA 3BY8A 1ZG6A 1GA0A 2X01A 5L10A 3IBJA 3T1QB 5FQ9A 2JHEA 3PBRA 3IXHA 2H10A 1ACFA 2J8YA 4XT2A 3UB5P 2JCHA 4BBVA 2ZC7A 3T1RA 3KSHA 3H9WA 5G4ZA 2BTFP 1CEGA 2J3TC 2ACGA 3VE3A 4OP5A 2EX2A 3UB8A 5CERA 4PPRA 1TS8A 3DTIA 3M6HA 2R9XA 3D3OA 1BLCA 2G2UA 2KX6A 1PI5A 2ZQDA 1P0ZA 4CQHA 3K2NA 1XA1A 3HUOA 3DTEA 3IX4A 3M2KA 1XA7A 3I7JA 3N6IA 2VGJA 4E3LA 2Y2MA 3OBFA 1VQQA 1EWZA 3PBQA 4NXBA 5CGWA 5A8BA 3SH7A 4WBGA 4OLGA 1BLPA 4ZRRA 4WZ5C 4P6ZS 2O9AA 1NRFA 3HLCA 1S1YA 3V3SA 4HNBA 3BW6A 4HH2A 3ZG7B 1ERMA 1Y4OA 2IWCA 3KYZA 4XUXA 3CPTA 3FZCA 5EVIC 1RGZA 2WGWA 4BL2A 3RJUA 1DP9A 2VX8A 4E3OA 1MWUA 1RP5A 3SH9A 4B4ZA 4GKUA 5CRFA 4LFUA 4GOGA 1AWIA 1OTBA 4NXEA 3PTEA 4FCFA 3NI9A 3ULFA 3QP4A 4HBUA 1XGIA 4JF6A 3S7OA 2Z6DA 1LI0A 2PU4A 5DJTA 3VMAA 2OLVA 4PKYA 3KYEA 1YPRA 3S22A 3S7PA 3PXPA 1YLZA 1XP4A 3NIAA 3LR3A 3MQ0A 5AQ7A 1XX2A 5AQBA 1OTDA 1W79A 5HD5A 3VFHA 3BECA 1PWGA 1PIOA 3E4QA 5M19A 3DBAA 3A3FA 4LV3A 2O99A 5LBRA 4MMNA 4EUVA 5F83A 3F1PB 4X1MA 1NRJA 3LR4A 3G2YA 1SKOB 2ZMVA 3MZFA 3C7VA 1NYMA 1Q2QA 4KQQA 5CEBA 2PBYA 4EXOA 5DFXA 3S7NA 5GLBA 5J7EA 3WRZA 4FOFA 2V8CA 5F1GA 2ZC4B 3RH8B 2ZQ8A 1XJ6A 1BLHA 2I72A 4OKPA 3DTMA 4DN0A 1YM1A 1K56D 3MS6A 2PD8A 5A91A 5E43A 4LENA 4DE3A 3A0SA 5KZHA 2Y2LA 1XFQA 4BMWA 3QNBA 4EBNA 3BJNA 5FASA 5FEGA 5E2EA 3F1OA 5AQ9A 4HP9A 1MY8A 2D02A 1JWZA 4HY8A 4YFMA 1FSYA 4QB8A 3G35A 5IU1A 3WRTA 2HF6A 2UWXA 3P09A 1IKIA 4OP8A 4N9LA 2WYXA 1MPLA 1YLYA 5M1AA 4ZTKA 3NOTC 4UA9A 4PM8A 4Q0JA 2RL3A 3OC2A 2FFFB 3W4PA 4CLCA 2VK3A 2W1TA 4GHIB 4Q8IA 3UDIA 3ZCZA 2EWWA 2EX9A 2QZ6A 1U60A 1T18A 1MKMA 5GLCA 1P97A 1VEUB 2PYRA 4HQAA 1H3QA 1FCOA 3VV4A 4ZDXA 4GDNA 2BG1A 1M6KA 2OV5A 1S4RA 3Q81A 1S6RA 4S2MA 2KDKA 4LV2A 5DVAA 2O9CA 3UE3A 4JXSA 2I9VA 3FYZA 4JGRA 5CTMA 2W3FA 3ZG0A 1UWNX 3MKFA 1KGEA 4CLCC 4E6XA 4QD4A 2VV7A 2K2NA 1K55A 4HH3A 2Y8HA 4S2JA 4S2IA 1BZAA 2XSSA 1PFLA 4IVKA 1D7EA 3QP1A 2P08A 5HAQA 3UB6A 1YMSA 2K7SA 1TVFA 3VP1A 1CI9A 4OH0A 1ZKJA 3A0RA 1KE0A 1Z6FA 2Y2JA 2JKTM 3AGFA 3W2ZA 1SCWA 1ODVA 1H8ZA 1KGGA 4WN5A 5HDSA 1T19A 4P0MA 4BD1A 1DP6A 5EM0A 2WKRA 4BENA 3ZG9B 5J3WA 2B18A 3ZGAB 1ESIA 3PBSA 4L9GA 3FPVA 1LT0A 3UB9A 3TE8A 1XJ3A 1GA9A 1IFQA 1W63M 2H0YA 4WELA 4B88A 4DXCA 4JF4A 1H5XA 1KOUA 2ZQ7A 3CMZA 4MN5A 1L2SA 5HFOA 5HL1A 2XQZA 5L8MA 3D72A 2WAEA 4WEKA 2R9WA 3T4JA 4BL3A 5E2HA 2V8FA 1N9LA 4E6WA 1K56A 4S2NA 4ZJ3A 3TJZC 1WYCA 2WGWB 5EUAA 3NDGA 3Q07A 4FD8A 4OQGA 4OPZA 5EOOA 3R7WA 3DW0A 4KZ4A 3MFXA 2B02A 1YAXA 1L3LA 3PR6A 3ZVTA 2XROA 1LSXA 1OMEA 5DFYA 1HZOA 3VP0A 4MNRA 2WKEA 1YQSA 3LUQA 1DJCA 4I3IA 2NUPC 5F68A 2Y2GA 3GMWA 3NULA 3BM6A 2VJWA 2W3HA 4RVAA 4JGOA 1CEFA 2WKHA 3H82B 3IBRA 3OOVA 2XF3A 4L9EA 1MWRA 3EGDC 4H6JA 5CXWA 2VV6A 3MXRA 3LI9A 1E3UA 4K91A 4WMCD 5CGXA 1K55C 3WWXA 3IWOA 4X56A 4DMZA 1VB6A 4IBRA 2LB5A 5KMWA 3M2JA 3NJAA 5EM1A 2JKTI 1C3BA 2WADA 5EVIB 2Y2NA 2Y2QA 3IWQA 3SS4A 3F1PA 2E8JA 4EETB 1GCEA 1IELA 3CI6A 4S2PA 4IUHA 4XT2B 1NZOA 3ZG5A 4ESPA 3MMHA 1NZUA 3ISGA 5HL6A 4DJ2A 2A24A 1V9YA 2KLIA 3T4OA 2ZL1A 4MBHA 2JKRM 5GL9A 3LIAA 4GD6A 2V20A 5C5KA 2Y55A 4E3IA 3LGOA 4R1GA 1YLJA 3BYDA 3ZNYA 1E3UD 3C2WA 3V39A 2X71A 3IF6A 5CGSA 3JVUA 3HJKA 3ITAA 3MQQA 1GSXA 1ESUA 3B3XA 2ZJ9A 3T1XA 1IEMA 3IF6C 4HBTA 1FSWA 3U2AA 1L0EA 2V1ZA 3Q7VA 1ZC2A 4UEYA 2L1MA 4O7DA 3IX8A 4FSFA 5I5LA 3EOIA 3KO6A 3C8CA 5HDCA 2XLNA 3Q7VB 3BY9A 1OJ5A 4HEFA 3O3VA 4JPMA 5MC7A 3IT9A 2DCFA 2WAFA 3ZHHA 3FG8A 3K3CA 4DF6A 5BOHA 2DRWA 3OPRA 3GRJA 2EXAA 2C5WB 4JXWA 1T1CA 1LL5A 2P74A 1W63Q 4PM6A 3E98A 1LLBA 1NLYA 2Y59A 3VP3A 4JXVA 4RQ9A 4MCWA 2BLSA 3EQUA 1KGFA 3T50A 3BFDA 2ZC5B 4GS9B 4PAUA 4IEDA 1G28A 3KYQA 4MN6A 3QHYA 4R4SA 4C3QA 4X1LA 3FPWA 4CJNA 2W0NA 1CI8A 2J3WA 4JF5A 4KZ5A 1JNUA 3K3DA 1JVJA 1K4EA 1F5MA 1YMXA 3NECA 1XJ4A 5DJUA 1H8YA 3T1SA 2W1TB 1MBLA 1D06A 5KSHA 3CLOA 3HL9A 5A90A 4MDZA 4UA6A 4R70A 3CJMA 3PBOA 1K4FA 4P85A 2FH5A 1XFNA 4X69A 4EUZA 3SW1A 4MN7A 1IKGA 2GX5A 3Q7ZA 2VLGA 1BYWA 1O7EA 3LIEA 2XD1A 4S2LA 4N92A 3N8RA 5FQQA 2HZ5A 2XEPA 4LCMA 5CHMA 1Y28A 3UDFA 1ALQA 4UQIM 4UAAA 3G32A 5EV0A 3WS1A 3SZTA 3E2KA 5L07A 3QP6A 5FQJA 3QP8A 3WS2A 2B95A 4FH2A 3RXXA 5DF8A 4CLCD 4ETXA 1LI9A 2IA2A 4B9OA 1L0GA 3IWIA 4R3JA 2PHYA 1KE4A 4Y2FA 3BQAA 3GECA 1K57C 5CTNA 2QKPA 3LYXA 3T4KA 2G7UA 1ES4A 3M6BA 3VE4A 2L0WA 2P7JA 4WM9A 1OJGA 5KSCA 4H8RA 4HIAA 2OLUA 1RCJA 1YKDA 3CUEA 4R3BA 1RGYA 3KSIA 1UGUA 1IYPA 3QP5A 3N8LA 2EXBA 4GB7A 3IH9A 2ZM8A 3ICYA 1ES5A 3V5MA 3D9YA 1N9OA 3L7HA 3G2ZA 3IS2B 2QWSA 4NK3A 5FDSA 4KG2A 3F1NA 3P98A 5FI2A 1DRMA 4U0TA 2EFUA 2ZC6B 4HJ3A 4QY6A 2V1BA 3FWLA 2QMIA 3IX3A 3ZQ5A 5TJJA 2HGVA 2Q0OA 2QJ5A 3JVVA 4XXRA 3O5YA 1LL8A 1NXYA 2ZOHA 1CQAA 3VFFA 2M1CA 4JLFA 4UQIS 1EW0A 3G6OA 3CHWP 4QPRA 3T4SA 3BLSA 1MWSA 1IYQA 1SDNA 1QMFA 4K0XA 3C7UA 4KUKA 2ZM0A 2XA7M 1VEUA 1Q2PA 3HREA 1GSVA 1TS0A 2Y4AA 2P04A 1AXBA 1J9MA 4EQ1A 3VOLA 2JBFA 3FC7A 2IWDA 1MWTA 4HI4A 1EI5A 5KIZA 1OTAA 1PW8A 2XD5A 2C6WB 2Z2LB 3HLGA 1QMEA 4KZ6A 3HCYA 3C30A 5GHXA 5FAQA 4YINA 5A92A 2A49A 2WGVA 2WUQA 3HJIA 2O9BA 4RA7A 2LB9A 5E2GA 5HWTA 5E2FA 2VZWA 4I39A 2CMNA 3N7WA 3BFGA 1HD8A 4DDSA 4DKIA 3HLWA 3LR0A 4GCZA 5U47A 2G2WA 2JKRI 2J9PA 3W4QA 3NOPC 3PHYA 3G31A 5K5BA 4KQRA 4P87A 3GSGA 1XJ2A 3EEAA 5DTTA 1FQGA 3A3IA 3TRCA 2JC7A 4PHTA 3V67A 5FL3A 3N8SA 1MXOA 3E2LA 1ES3A 3VSKA 5HPFA 5HWWA 3E0YA 2PR5A 5GLAA 5FQIA 4ID4A 3ITBA 1S67L 4LRZE 4OQ0A 1YLWA 3MXSA 4GLQA 2Z6CA 4R38A 5IS1A 2H0TA 1VHMA 4S2OA 1EROA 1PZOA 1H8MA 5HW3A 1YLPA 4DE0A 3P01A 1G6AA 5F69A 5FI6A 3UPNA 1NWZA 2V1AA 5CHUA 4FUWA 3IQAA 4K08A 5EVID 2EA9A 3LY4A 4C75A 2PRFA 2ZL1B 4OLDA 1I2WA 1HLUP 4E3NA 4LRXC 4BBTA 4YWZA 4QHCA 4OVDA 4E04A 3T4LA 3IHBA 2H5SA 4R4RA 3O86A 1PWCA 3CUEC 5F6AA 2DNSA 4Z9QA 1OPXA 1N9BA 3TG9A 4KQOA 5GHZA 1G68A 4FTXA 3S7QA 1IYOA 4EBLA 4WL9A 4GNUA 4WF0A 2Y2PA 2VV8A 5TR7A 5F5YA 4LCLA 1FCMA 2VGLM 3PAGA 1TEMA 1CF0A 4KZBA 4OOLA 5IT5A 4ME4A 1OT6A 3C38A 2V0UA 3A3JA 3VOYA 2WKIA 3EQVA 1LL9A 3CPTB 2UV0E 3A0VA 2QJ7A 3MZEA 4KG6A 3ZG8B 3NCKA 5HZHA 3CAXA 2HP6A 4LPZA 2P9VA 4R0QA 4IBXA 3C4OA 1MZUA 1ZHHB 3PBTA 1VM1A 1BSGA 2ZQAA 2HJ9C 2XFSA 3PBNA 2HDQA 3DAVA 1BUEA 1S1ZA 1JTDA 1LSWA 1K54C 3HBRA 2M7VA 2FZ0A 5DKLA 3HLFA 4LLOB 2VKSA 4BD0A 5A93A 3CG5A 5CHJA 2XA7S 4WYYA 1XXMA 4I3JA 5L2FA 4HJ6A 2NUTC 4EWFA 3HLEA 5AJGA 4HESA 3OZHA 3SOIA 4GJ4A 2ZLYA 4KENB 5FQKA 1K6SA 3PYPA 3RXWA 3T12B 5I94A 2WKPA 4MEZA 3B42A 3IS2A 3LY3A 1SHVA 2PBDP 1SKOA 1GSWA 1K57A 4BBUA 4BLMA 3LIBA 4KZ7A 4Y17A 1XKZA 5FATA 3NDEA 3HLDA 5F1FA 1NJ4A 3UO9A 3ZYTA 5TGFA 2J80A 3BEBA 3HVFA 3T4QA 2ZQ9A 4QJGA 4EEUA 2Y2HA 4DE1A 3CZDA 4DXBA 5TBMA 1SZVA 4EQIA 1L0DA 4PM5A 3MQOA 4ZJ2A 1PZPA 1S0WA 5TBMB 4P6BA 3GDIA 2KOIA 1F2KA 3HUMA 1PYYA 4MLLA 3CWFA 1YLTA 3MSHA 1BLSA 4GS9A 1TD5A 1N9NA 3PAEA 4MBKA 4GHIA 3F1OB 1VETA 5HWVA 3DWZA 2WK0A 1FIKA 2ZC3B 5CEDA 5FEFA 1VETB 1PNEA 2BASA 1W8YA 3EEHA 1K54A 4Q0IA 1YT4A 3MFDA
chains in the Genus database with same CATH topology
4B4XA 2EX8A 4LV0A 4X6TA 4UA7A 5G18A 1XPBA 1FCOA 4C6YA 1ES4A 3M6BA 3BFFA 4N9KA 3HLBA 2JE5A 4GDNA 4WM9A 2BG1A 4ZDXA 1CK3A 1M6KA 2J9OA 5TFQA 4H8RA 5KSCA 1HTZA 2OLUA 1RCJA 1I2SA 2OV5A 2Q9NA 2EFXA 2ZMAA 3Q81A 1S6RA 4S2MA 3VP4A 4LV2A 4JKTA 4R3BA 1RGYA 3HUNA 5DVAA 5HARA 1KVMA 3ZDJA 3UE3A 1IYPA 4JXSA 4OQIA 3FYZA 3MZDA 3Q82A 1SDEA 3N8LA 5CTMA 2EXBA 3ZG0A 3MKFA 4GB7A 4K0WA 1KGEA 3IH8A 4E6XA 3IH9A 2ZM8A 4QD4A 1K55A 1ES5A 3V5MA 3N4IA 3SS5A 4S2JA 3G2ZA 4S2IA 2HP9A 2J7VA 1BZAA 4NK3A 4KG2A 2XFTA 4U3TA 5D3OA 3W4OA 4IVKA 3P98A 1DJBA 4WZ4A 5FI2A 5HAQA 1FR6A 2FFYA 4U0TA 5EECA 4OPRA 2XGNA 1YMSA 3A3DA 2EFUA 1K25A 2ZC6B 3OPHA 4E3JA 1TVFA 4QY6A 3VP1A 1CI9A 3FWLA 4OH0A 2PU2A 1ZKJA 2QMIA 1KE0A 1Z6FA 2Y2JA 1IYSA 3JYIA 3AGFA 4WZ5A 1SCWA 1N4OA 3UPPA 1WE4A 1GHIA 1H8ZA 5M18A 1E4DA 1KGGA 3ZVWA 4XXRA 4P0MA 4BD1A 2EX6A 3BLMA 4GZBA 1NXYA 2CC1A 5HAIA 3VFFA 4JLFA 3OPLA 2A3UA 1XGJA 4BENA 4DDYA 4OONA 3BLSA 1MWSA 1IYQA 3S1YA 2ZM2A 3ZG9B 4E3KA 1SDNA 2GDNA 3ZGAB 1QMFA 1ESIA 3PBSA 4K0XA 3C7UA 4X53A 3GV9A 4EV4A 5FA7A 3SS3A 2ZM0A 4KZ8A 3NC8A 1M40A 1Q2PA 3HREA 4GN2A 3GVBA 3GTCA 4DE2A 2Y4AA 4ZBEA 1TDGA 1AXBA 1J9MA 1GA9A 1K38A 2Y2IA 4D2OA 2JBFA 3UE0A 2IWDA 1MWTA 1W8QA 2WZZA 1EI5A 3O87A 4XUZA 1MKIA 2XH9A 2H0YA 3BRMA 1FR1A 1PW8A 2XD5A 4WELA 2C6WB 2Z2LB 2WZXA 3HLGA 4B88A 1QMEA 4JF4A 1ERQA 4DXCA 2Q9MA 4KZ6A 1SKFA 2HDRA 4S2KA 1H5XA 4RX3A 3D4FA 2ZQ7A 5GHXA 5FAQA 4YINA 3WS0A 1KDWA 3CMZA 3DWKA 2A49A 5A92A 2HPBA 2WGVA 3IXBA 3MBZA 5F82A 2WUQA 1L2SA 5HFOA 2XDMA 5HL1A 2XQZA 1ZG4A 4RA7A 5E2GA 3V3RA 2OSUA 2WAEA 3UDXA 5E2FA 4WEKA 5HAPA 2R9WA 3N7WA 3BFGA 1HD8A 4BL3A 1NY0A 1TDLA 4DDSA 4DKIA 5E2HA 3HLWA 4OOYA 5U47A 5DTKA 2G2WA 4E6WA 3W4QA 2J9PA 1K56A 3G31A 3OPPA 4S2NA 5DTSA 4ZJ3A 4KQRA 2X02A 3WS4A 4P87A 5JYPA 3GSGA 1K6RA 1WYCA 2WGWB 4OQHA 5EUAA 3NDGA 2QPNA 3Q07A 4FD8A 4OQGA 4OPZA 1E25A 5DTTA 1FQGA 5EOOA 3A3IA 5AQAA 2XR0A 3UE1A 2JC7A 3DW0A 3N8SA 1MXOA 1PWDA 1L0FA 3E2LA 4KZ4A 3LEZA 3IXDA 1ES3A 4KG5A 3VSKA 4PMAA 3ZVTA 1ZG6A 1OMEA 1GA0A 4BJPA 5GLAA 2X01A 5BOHA 5FQIA 4ID4A 4DRTA 3ITBA 1HZOA 5FQ9A 4F94A 3PBRA 1YLWA 3IXHA 2E8IA 4OQ0A 2H10A 3MXSA 4MNRA 3VP0A 2WKEA 1YQSA 4Y0UA 2J8YA 2H0TA 4JBFA 1DJCA 2HP5A 5FAOA 2JCHA 2Y2GA 2ZC7A 1JWVA 3GMWA 4S2OA 1EROA 1PZOA 3BM6A 1KVLA 5DF7A 4RVAA 3SH8A 5HW3A 1YLPA 1CEFA 2WKHA 4DE0A 3BFEA 1CEGA 1G6AA 5EPHA 5FI6A 2XF3A 3UNWA 4OP5A 3UPNA 2EX2A 5CERA 1ONGA 1MWRA 4PPRA 5CHUA 3UPOA 1JTGA 5DF9A 5CXWA 3IQAA 3M6HA 3Q1FA 5EOEA 2R9XA 5EVID 1BLCA 1BT5A 3LY4A 3MXRA 4GDBA 5EVIA 4C75A 1E3UA 4K91A 2G2UA 4OLDA 4RX2A 4WMCD 5CGXA 3VSLA 1I2WA 4E3NA 1K55C 3WWXA 1PI5A 3IWOA 2ZQDA 4X56A 4E3MA 1WYBA 4QHCA 4R23A 4IVIA 4IBRA 4OVDA 1XA1A 3HUOA 1KE3A 2RCXA 3M2JA 4X68A 3VP2A 5KMWA 3M2KA 1XA7A 3I7JA 3IHBA 2H5SA 3N6IA 2VGJA 4E3LA 4R4RA 1C3BA 2WADA 3O86A 1PWCA 5EVIB 2Y2MA 4S2NC 2Y2NA 2DNSA 2Y2QA 3IWQA 3SS4A 4Z9QA 3TSGA 3UN7A 1N9BA 1VQQA 3TG9A 1EWZA 4KQOA 5GHZA 3PBQA 1G68A 1GCEA 1LHYA 1ES2A 1GHMA 1PW1A 5CGWA 1IELA 3SH7A 4WBGA 4S2PA 1NZOA 3ZG5A 4OLGA 4Y0TA 1BLPA 1IYOA 1NZUA 3ISGA 3IXGA 4EBLA 2V2FF 4RYEA 4WZ5C 1NRFA 3HLCA 3QNCA 4L0LA 3V3SA 2IWBA 4GNUA 1JWPA 4Y7PA 1W5DA 2Y2PA 5FSRA 1FOFA 5TR7A 4OPQA 3ZG7B 1KDSA 1ERMA 4MBHA 4N1HA 2IWCA 3MKEA 4OOMA 4LCLA 4XUXA 3ZFZA 1FCMA 3ZNTA 5GL9A 1GHPA 3FZCA 5EVIC 1RGZA 4GD6A 5FAPA 2WGWA 3G30A 3PAGA 3WS5A 2V20A 1TEMA 4OOLA 3AGDA 1O07A 4KZBA 3RJUA 4BL2A 2Y55A 4E3IA 5J8XA 3NY4A 4E3OA 3A3JA 1MWUA 1RP5A 4R1GA 3SH9A 1YLJA 3BYDA 3VOYA 4B4ZA 4CPKA 2WKIA 5JYOA 4GKUA 3EQVA 3ZNYA 5CRFA 1E3UD 3G34A 4GOGA 3LCEA 1LL9A 1Y54A 3V39A 5HX9A 3O88A 2X71A 3IF6A 3MZEA 3PTEA 4FCFA 3NI9A 3C5AA 4KG6A 5CGSA 1ONHA 4JXGA 4HBUA 3ZG8B 3NCKA 1FCNA 3ITAA 4U0XA 3G4PA 4OPYA 2WGIA 1XGIA 4JF6A 2HP6A 2P9VA 3FKVA 4GD8A 4R0QA 3A3EA 4IBXA 4QU3A 1ESUA 4A5RA 3B3XA 3C4OA 4N1XA 3PBTA 1VM1A 4PM9A 1LI0A 4PM7A 1BSGA 2ZQAA 2PU4A 2ZJ9A 3VMAA 2OLVA 1IEMA 1DJAA 2XFSA 3IF6C 4HBTA 3PBNA 3S22A 1FSWA 2HDQA 1BUEA 1L0EA 2V1ZA 3Q7VA 1ZC2A 1JTDA 4O7DA 4NETA 4FSFA 4ZAMA 1K54C 1YLZA 3HBRA 1XP4A 5IHVA 2XLNA 3NIAA 3Q7VB 3HLFA 4HEFA 3O3VA 4JPMA 4KZ9A 5AQ7A 3IT9A 1XX2A 2DCFA 5GLDA 2WAFA 5AQBA 3ZHHA 1W79A 4Y0OA 4DF6A 3OCLA 3VFHA 3BECA 4BD0A 5A93A 1PWGA 2DRWA 1PIOA 3OPRA 3GRJA 5EE8A 3CG5A 5CHJA 1I5QA 4ZJ1A 4WYYA 2EXAA 2C5WB 4JXWA 4BQMA 1XXMA 3IF6B 5L2FA 5M19A 1LL5A 4EWFA 3A3FA 2P74A 3HLEA 4PM6A 2XK1A 3FV7A 3S4XA 4LV3A 1LLBA 3IHAA 2Y59A 3VP3A 4JXVA 5F83A 4HESA 3OZHA 5CECA 3G2YA 2BLSA 3EQUA 3SOIA 1KGFA 3MZFA 4UHUA 5FI7A 3BFDA 4MBFA 2ZLYA 2Y2KA 2P9VB 2ZC5B 3C7VA 1DY6A 4IEDA 4KENB 4QY5A 1NYMA 2Y2OA 4M3KA 5FQKA 1Q2QA 4KQQA 5CEBA 2HDSA 3BFCA 1K6SA 2PBYA 3RXWA 3QHYA 5I94A 4R4SA 5GLBA 4C3QA 4MEZA 4KZAA 3LY3A 3W8KA 1SHVA 2ZQCA 4CJNA 1K57A 3WRZA 5GHYA 4X55A 4BLMA 3VOZA 4KZ7A 1CI8A 5F1GA 2ZC4B 4JF5A 3AGEA 1XKZA 2ZQ8A 3V50A 2HDUA 4KZ5A 5FATA 1JVJA 1K4EA 1BLHA 5EVLA 2I72A 3HLDA 3NDEA 1YMXA 4FH4A 3DTMA 4OKPA 5F1FA 1YM1A 1K56D 5FDHA 1H8YA 1NJ4A 3UO9A 5TGFA 3BEBA 4LENA 5E43A 5A91A 3HVFA 4DE3A 1MBLA 4LV1A 2ZQ9A 2B5RA 4QJGA 5KZHA 2Y2LA 5KSHA 3HL9A 1HVBA 2Y2HA 4DE1A 5A90A 3CZDA 3UY6A 3QNBA 4UA6A 3CJMA 3PBOA 4EBNA 1K4FA 1NYYA 2Z2MB 4P85A 4DXBA 4EQIA 4X69A 4EUZA 1L0DA 4PM5A 5FASA 1IKGA 5E2EA 3Q7ZA 4ZJ2A 4WEJA 1PZPA 1S0WA 1O7EA 4P6BA 2VGKA 2XD1A 4S2LA 5AQ9A 3HUMA 4N92A 2ZD8A 1MY8A 3N8RA 1PYYA 4MLLA 1JWZA 1YLTA 4YFMA 1FSYA 4QB8A 3G35A 5FQQA 4WMCA 3WRTA 2UWXA 3NBLA 3P09A 1BLSA 1IKIA 2XEPA 4LCMA 5CHMA 4OP8A 3UDFA 1ALQA 2WYXA 4N9LA 3PAEA 4MBKA 5FQMA 4UAAA 3G32A 1MPLA 1YLYA 5M1AA 3WS1A 4ZTKA 3E2KA 3DWZA 5FQJA 3WS2A 3GQZA 2Y91A 2WK0A 3OCNA 4UA9A 2ZC3B 4FH2A 4PM8A 5DF8A 3RXXA 5CEDA 2RL3A 3C4PA 1LI9A 4KZ3A 1BTLA 3TOIA 3OC2A 2FFFB 3W4PA 1W7FA 1L0GA 3IWIA 4R3JA 3LO7A 1W8YA 1KE4A 4Q8IA 3FKWA 3UDIA 4EBPA 1K54A 3ZCZA 2EX9A 2QZ6A 1YT4A 1K57C 3IF5A 5CTNA 1U60A 3GR2A 3MFDA 5GLCA 1PI4A 1BULA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4B4X A;  2EX8 A;  4LV0 A;  4X6T A;  4UA7 A;  5G18 A;  1XPB A;  1FCO A;  4C6Y A;  1ES4 A;  3M6B A;  3BFF A;  4N9K A;  3HLB A;  2JE5 A;  4GDN A;  4WM9 A;  2BG1 A;  4ZDX A;  1CK3 A;  1M6K A;  2J9O A;  5TFQ A;  4H8R A;  5KSC A;  1HTZ A;  2OLU A;  1RCJ A;  1I2S A;  2OV5 A;  2Q9N A;  2EFX A;  2ZMA A;  3Q81 A;  1S6R A;  4S2M A;  3VP4 A;  4LV2 A;  4JKT A;  4R3B A;  1RGY A;  3HUN A;  5DVA A;  5HAR A;  1KVM A;  3ZDJ A;  3UE3 A;  1IYP A;  4JXS A;  4OQI A;  3FYZ A;  3MZD A;  3Q82 A;  1SDE A;  3N8L A;  5CTM A;  2EXB A;  3ZG0 A;  3MKF A;  4GB7 A;  4K0W A;  1KGE A;  3IH8 A;  4E6X A;  3IH9 A;  2ZM8 A;  4QD4 A;  1K55 A;  1ES5 A;  3V5M A;  3N4I A;  3SS5 A;  4S2J A;  3G2Z A;  4S2I A;  2HP9 A;  2J7V A;  1BZA A;  4NK3 A;  4KG2 A;  2XFT A;  4U3T A;  5D3O A;  3W4O A;  4IVK A;  3P98 A;  1DJB A;  4WZ4 A;  5FI2 A;  5HAQ A;  1FR6 A;  2FFY A;  4U0T A;  5EEC A;  4OPR A;  2XGN A;  1YMS A;  3A3D A;  2EFU A;  1K25 A;  2ZC6 B;  3OPH A;  4E3J A;  1TVF A;  4QY6 A;  3VP1 A;  1CI9 A;  3FWL A;  4OH0 A;  2PU2 A;  1ZKJ A;  2QMI A;  1KE0 A;  1Z6F A;  2Y2J A;  1IYS A;  3JYI A;  3AGF A;  4WZ5 A;  1SCW A;  1N4O A;  3UPP A;  1WE4 A;  1GHI A;  1H8Z A;  5M18 A;  1E4D A;  1KGG A;  3ZVW A;  4XXR A;  4P0M A;  4BD1 A;  2EX6 A;  3BLM A;  4GZB A;  1NXY A;  2CC1 A;  5HAI A;  3VFF A;  4JLF A;  3OPL A;  2A3U A;  1XGJ A;  4BEN A;  4DDY A;  4OON A;  3BLS A;  1MWS A;  1IYQ A;  3S1Y A;  2ZM2 A;  3ZG9 B;  4E3K A;  1SDN A;  2GDN A;  3ZGA B;  1QMF A;  1ESI A;  3PBS A;  4K0X A;  3C7U A;  4X53 A;  3GV9 A;  4EV4 A;  5FA7 A;  3SS3 A;  2ZM0 A;  4KZ8 A;  3NC8 A;  1M40 A;  1Q2P A;  3HRE A;  4GN2 A;  3GVB A;  3GTC A;  4DE2 A;  2Y4A A;  4ZBE A;  1TDG A;  1AXB A;  1J9M A;  1GA9 A;  1K38 A;  2Y2I A;  4D2O A;  2JBF A;  3UE0 A;  2IWD A;  1MWT A;  1W8Q A;  2WZZ A;  1EI5 A;  3O87 A;  4XUZ A;  1MKI A;  2XH9 A;  2H0Y A;  3BRM A;  1FR1 A;  1PW8 A;  2XD5 A;  4WEL A;  2C6W B;  2Z2L B;  2WZX A;  3HLG A;  4B88 A;  1QME A;  4JF4 A;  1ERQ A;  4DXC A;  2Q9M A;  4KZ6 A;  1SKF A;  2HDR A;  4S2K A;  1H5X A;  4RX3 A;  3D4F A;  2ZQ7 A;  5GHX A;  5FAQ A;  4YIN A;  3WS0 A;  1KDW A;  3CMZ A;  3DWK A;  2A49 A;  5A92 A;  2HPB A;  2WGV A;  3IXB A;  3MBZ A;  5F82 A;  2WUQ A;  1L2S A;  5HFO A;  2XDM A;  5HL1 A;  2XQZ A;  1ZG4 A;  4RA7 A;  5E2G A;  3V3R A;  2OSU A;  2WAE A;  3UDX A;  5E2F A;  4WEK A;  5HAP A;  2R9W A;  3N7W A;  3BFG A;  1HD8 A;  4BL3 A;  1NY0 A;  1TDL A;  4DDS A;  4DKI A;  5E2H A;  3HLW A;  4OOY A;  5U47 A;  5DTK A;  2G2W A;  4E6W A;  3W4Q A;  2J9P A;  1K56 A;  3G31 A;  3OPP A;  4S2N A;  5DTS A;  4ZJ3 A;  4KQR A;  2X02 A;  3WS4 A;  4P87 A;  5JYP A;  3GSG A;  1K6R A;  1WYC A;  2WGW B;  4OQH A;  5EUA A;  3NDG A;  2QPN A;  3Q07 A;  4FD8 A;  4OQG A;  4OPZ A;  1E25 A;  5DTT A;  1FQG A;  5EOO A;  3A3I A;  5AQA A;  2XR0 A;  3UE1 A;  2JC7 A;  3DW0 A;  3N8S A;  1MXO A;  1PWD A;  1L0F A;  3E2L A;  4KZ4 A;  3LEZ A;  3IXD A;  1ES3 A;  4KG5 A;  3VSK A;  4PMA A;  3ZVT A;  1ZG6 A;  1OME A;  1GA0 A;  4BJP A;  5GLA A;  2X01 A;  5BOH A;  5FQI A;  4ID4 A;  4DRT A;  3ITB A;  1HZO A;  5FQ9 A;  4F94 A;  3PBR A;  1YLW A;  3IXH A;  2E8I A;  4OQ0 A;  2H10 A;  3MXS A;  4MNR A;  3VP0 A;  2WKE A;  1YQS A;  4Y0U A;  2J8Y A;  2H0T A;  4JBF A;  1DJC A;  2HP5 A;  5FAO A;  2JCH A;  2Y2G A;  2ZC7 A;  1JWV A;  3GMW A;  4S2O A;  1ERO A;  1PZO A;  3BM6 A;  1KVL A;  5DF7 A;  4RVA A;  3SH8 A;  5HW3 A;  1YLP A;  1CEF A;  2WKH A;  4DE0 A;  3BFE A;  1CEG A;  1G6A A;  5EPH A;  5FI6 A;  2XF3 A;  3UNW A;  4OP5 A;  3UPN A;  2EX2 A;  5CER A;  1ONG A;  1MWR A;  4PPR A;  5CHU A;  3UPO A;  1JTG A;  5DF9 A;  5CXW A;  3IQA A;  3M6H A;  3Q1F A;  5EOE A;  2R9X A;  5EVI D;  1BLC A;  1BT5 A;  3LY4 A;  3MXR A;  4GDB A;  5EVI A;  4C75 A;  1E3U A;  4K91 A;  2G2U A;  4OLD A;  4RX2 A;  4WMC D;  5CGX A;  3VSL A;  1I2W A;  4E3N A;  1K55 C;  3WWX A;  1PI5 A;  3IWO A;  2ZQD A;  4X56 A;  4E3M A;  1WYB A;  4QHC A;  4R23 A;  4IVI A;  4IBR A;  4OVD A;  1XA1 A;  3HUO A;  1KE3 A;  2RCX A;  3M2J A;  4X68 A;  3VP2 A;  5KMW A;  3M2K A;  1XA7 A;  3I7J A;  3IHB A;  2H5S A;  3N6I A;  2VGJ A;  4E3L A;  4R4R A;  1C3B A;  2WAD A;  3O86 A;  1PWC A;  5EVI B;  2Y2M A;  4S2N C;  2Y2N A;  2DNS A;  2Y2Q A;  3IWQ A;  3SS4 A;  4Z9Q A;  3TSG A;  3UN7 A;  1N9B A;  1VQQ A;  3TG9 A;  1EWZ A;  4KQO A;  5GHZ A;  3PBQ A;  1G68 A;  1GCE A;  1LHY A;  1ES2 A;  1GHM A;  1PW1 A;  5CGW A;  1IEL A;  3SH7 A;  4WBG A;  4S2P A;  1NZO A;  3ZG5 A;  4OLG A;  4Y0T A;  1BLP A;  1IYO A;  1NZU A;  3ISG A;  3IXG A;  4EBL A;  2V2F F;  4RYE A;  4WZ5 C;  1NRF A;  3HLC A;  3QNC A;  4L0L A;  3V3S A;  2IWB A;  4GNU A;  1JWP A;  4Y7P A;  1W5D A;  2Y2P A;  5FSR A;  1FOF A;  5TR7 A;  4OPQ A;  3ZG7 B;  1KDS A;  1ERM A;  4MBH A;  4N1H A;  2IWC A;  3MKE A;  4OOM A;  4LCL A;  4XUX A;  3ZFZ A;  1FCM A;  3ZNT A;  5GL9 A;  1GHP A;  3FZC A;  5EVI C;  1RGZ A;  4GD6 A;  5FAP A;  2WGW A;  3G30 A;  3PAG A;  3WS5 A;  2V20 A;  1TEM A;  4OOL A;  3AGD A;  1O07 A;  4KZB A;  3RJU A;  4BL2 A;  2Y55 A;  4E3I A;  5J8X A;  3NY4 A;  4E3O A;  3A3J A;  1MWU A;  1RP5 A;  4R1G A;  3SH9 A;  1YLJ A;  3BYD A;  3VOY A;  4B4Z A;  4CPK A;  2WKI A;  5JYO A;  4GKU A;  3EQV A;  3ZNY A;  5CRF A;  1E3U D;  3G34 A;  4GOG A;  3LCE A;  1LL9 A;  1Y54 A;  3V39 A;  5HX9 A;  3O88 A;  2X71 A;  3IF6 A;  3MZE A;  3PTE A;  4FCF A;  3NI9 A;  3C5A A;  4KG6 A;  5CGS A;  1ONH A;  4JXG A;  4HBU A;  3ZG8 B;  3NCK A;  1FCN A;  3ITA A;  4U0X A;  3G4P A;  4OPY A;  2WGI A;  1XGI A;  4JF6 A;  2HP6 A;  2P9V A;  3FKV A;  4GD8 A;  4R0Q A;  3A3E A;  4IBX A;  4QU3 A;  1ESU A;  4A5R A;  3B3X A;  3C4O A;  4N1X A;  3PBT A;  1VM1 A;  4PM9 A;  1LI0 A;  4PM7 A;  1BSG A;  2ZQA A;  2PU4 A;  2ZJ9 A;  3VMA A;  2OLV A;  1IEM A;  1DJA A;  2XFS A;  3IF6 C;  4HBT A;  3PBN A;  3S22 A;  1FSW A;  2HDQ A;  1BUE A;  1L0E A;  2V1Z A;  3Q7V A;  1ZC2 A;  1JTD A;  4O7D A;  4NET A;  4FSF A;  4ZAM A;  1K54 C;  1YLZ A;  3HBR A;  1XP4 A;  5IHV A;  2XLN A;  3NIA A;  3Q7V B;  3HLF A;  4HEF A;  3O3V A;  4JPM A;  4KZ9 A;  5AQ7 A;  3IT9 A;  1XX2 A;  2DCF A;  5GLD A;  2WAF A;  5AQB A;  3ZHH A;  1W79 A;  4Y0O A;  4DF6 A;  3OCL A;  3VFH A;  3BEC A;  4BD0 A;  5A93 A;  1PWG A;  2DRW A;  1PIO A;  3OPR A;  3GRJ A;  5EE8 A;  3CG5 A;  5CHJ A;  1I5Q A;  4ZJ1 A;  4WYY A;  2EXA A;  2C5W B;  4JXW A;  4BQM A;  1XXM A;  3IF6 B;  5L2F A;  5M19 A;  1LL5 A;  4EWF A;  3A3F A;  2P74 A;  3HLE A;  4PM6 A;  2XK1 A;  3FV7 A;  3S4X A;  4LV3 A;  1LLB A;  3IHA A;  2Y59 A;  3VP3 A;  4JXV A;  5F83 A;  4HES A;  3OZH A;  5CEC A;  3G2Y A;  2BLS A;  3EQU A;  3SOI A;  1KGF A;  3MZF A;  4UHU A;  5FI7 A;  3BFD A;  4MBF A;  2ZLY A;  2Y2K A;  2P9V B;  2ZC5 B;  3C7V A;  1DY6 A;  4IED A;  4KEN B;  4QY5 A;  1NYM A;  2Y2O A;  4M3K A;  5FQK A;  1Q2Q A;  4KQQ A;  5CEB A;  2HDS A;  3BFC A;  1K6S A;  2PBY A;  3RXW A;  3QHY A;  5I94 A;  4R4S A;  5GLB A;  4C3Q A;  4MEZ A;  4KZA A;  3LY3 A;  3W8K A;  1SHV A;  2ZQC A;  4CJN A;  1K57 A;  3WRZ A;  5GHY A;  4X55 A;  4BLM A;  3VOZ A;  4KZ7 A;  1CI8 A;  5F1G A;  2ZC4 B;  4JF5 A;  3AGE A;  1XKZ A;  2ZQ8 A;  3V50 A;  2HDU A;  4KZ5 A;  5FAT A;  1JVJ A;  1K4E A;  1BLH A;  5EVL A;  2I72 A;  3HLD A;  3NDE A;  1YMX A;  4FH4 A;  3DTM A;  4OKP A;  5F1F A;  1YM1 A;  1K56 D;  5FDH A;  1H8Y A;  1NJ4 A;  3UO9 A;  5TGF A;  3BEB A;  4LEN A;  5E43 A;  5A91 A;  3HVF A;  4DE3 A;  1MBL A;  4LV1 A;  2ZQ9 A;  2B5R A;  4QJG A;  5KZH A;  2Y2L A;  5KSH A;  3HL9 A;  1HVB A;  2Y2H A;  4DE1 A;  5A90 A;  3CZD A;  3UY6 A;  3QNB A;  4UA6 A;  3CJM A;  3PBO A;  4EBN A;  1K4F A;  1NYY A;  2Z2M B;  4P85 A;  4DXB A;  4EQI A;  4X69 A;  4EUZ A;  1L0D A;  4PM5 A;  5FAS A;  1IKG A;  5E2E A;  3Q7Z A;  4ZJ2 A;  4WEJ A;  1PZP A;  1S0W A;  1O7E A;  4P6B A;  2VGK A;  2XD1 A;  4S2L A;  5AQ9 A;  3HUM A;  4N92 A;  2ZD8 A;  1MY8 A;  3N8R A;  1PYY A;  4MLL A;  1JWZ A;  1YLT A;  4YFM A;  1FSY A;  4QB8 A;  3G35 A;  5FQQ A;  4WMC A;  3WRT A;  2UWX A;  3NBL A;  3P09 A;  1BLS A;  1IKI A;  2XEP A;  4LCM A;  5CHM A;  4OP8 A;  3UDF A;  1ALQ A;  2WYX A;  4N9L A;  3PAE A;  4MBK A;  5FQM A;  4UAA A;  3G32 A;  1MPL A;  1YLY A;  5M1A A;  3WS1 A;  4ZTK A;  3E2K A;  3DWZ A;  5FQJ A;  3WS2 A;  3GQZ A;  2Y91 A;  2WK0 A;  3OCN A;  4UA9 A;  2ZC3 B;  4FH2 A;  4PM8 A;  5DF8 A;  3RXX A;  5CED A;  2RL3 A;  3C4P A;  1LI9 A;  4KZ3 A;  1BTL A;  3TOI A;  3OC2 A;  2FFF B;  3W4P A;  1W7F A;  1L0G A;  3IWI A;  4R3J A;  3LO7 A;  1W8Y A;  1KE4 A;  4Q8I A;  3FKW A;  3UDI A;  4EBP A;  1K54 A;  3ZCZ A;  2EX9 A;  2QZ6 A;  1YT4 A;  1K57 C;  3IF5 A;  5CTN A;  1U60 A;  3GR2 A;  3MFD A;  5GLC A;  1PI4 A;  1BUL A; 
#chains in the Genus database with same CATH topology
 4B4X A;  2EX8 A;  4LV0 A;  4UA7 A;  4AFI A;  4CLC B;  3OLO A;  2JKG A;  4C6Y A;  3BFF A;  4Y13 A;  4N9K A;  3HLB A;  5TFQ A;  3H7W A;  1I2S A;  2Q9N A;  3ZDJ A;  4JKT A;  5HAR A;  2VGL S;  2VEA A;  4KQD A;  1A0K A;  5EFW A;  4K0W A;  3IH8 A;  4ETZ A;  3N4I A;  2HP9 A;  2EWV A;  2XFT A;  4U3T A;  2M7U A;  1DJB A;  4NXF A;  1FR6 A;  2FFY A;  3A3D A;  3E4P A;  1K25 A;  3OPH A;  4IJG A;  4EER A;  3MXQ A;  1D1J A;  4WZ5 A;  3BQ8 A;  1GHI A;  5M18 A;  4NXG A;  4EU0 A;  3ZVW A;  2EX6 A;  3BLM A;  2V9A A;  5DKK A;  1XGJ A;  4DDY A;  2A24 B;  2GDN A;  3GV9 A;  5G4Y A;  4EV4 A;  5FA7 A;  3SS3 A;  4KZ8 A;  3NC8 A;  1M40 A;  4LRY C;  4GN2 A;  3GVB A;  4DE2 A;  3P7N A;  4ZBE A;  1TDG A;  2Y2I A;  4D2O A;  2WZZ A;  3O87 A;  4XUZ A;  1MKI A;  3BRM A;  1FR1 A;  2YKH A;  2Q9M A;  1SKF A;  2HDR A;  4S2K A;  3D4F A;  2H28 A;  3LI8 A;  3DWK A;  4Y3I A;  5F82 A;  3IXB A;  3U4L P;  4Y15 A;  4ARZ B;  3V3R A;  2OSU A;  3EWK A;  1G5U A;  4II7 A;  1LSV A;  4OOY A;  5DTK A;  4I38 A;  3WS4 A;  5JYP A;  2X02 A;  1K6R A;  2QPN A;  4H6J B;  5AQA A;  1E25 A;  3UE1 A;  2XR0 A;  1L0F A;  3LEZ A;  4KG5 A;  4KUO A;  1MC0 A;  3MR0 A;  4BJP A;  4IUK A;  4DRT A;  1OT9 A;  1P9W A;  3T4T A;  4F94 A;  3RTY A;  2E8I A;  2OWH A;  5AVF A;  4Y0U A;  3UMD A;  4JBF A;  2HP5 A;  5FAO A;  3MJQ A;  1JWV A;  4EW7 A;  1KVL A;  1FIL A;  3CIT A;  5DF7 A;  3SH8 A;  3BFE A;  5EPH A;  3UNW A;  1ONG A;  3UPO A;  5DF9 A;  1JTG A;  3Q1F A;  3JPU A;  5EOE A;  2HJE A;  4F3L A;  1BT5 A;  4GDB A;  5EVI A;  1V9Z A;  3VSL A;  5L09 A;  4RX2 A;  2MJ6 A;  4EES A;  4E3M A;  1WYB A;  4R23 A;  4IVI A;  2W3G A;  1KE3 A;  2RCX A;  4X68 A;  3VP2 A;  1T1B A;  4DJ3 A;  1CJF A;  4S2N C;  3TSG A;  3UN7 A;  3RFB A;  1LHY A;  1PW1 A;  1ES2 A;  1GHM A;  4PKY G;  2ZBB A;  3IXG A;  2V2F F;  2YKF A;  4RYE A;  3QNC A;  4L0L A;  4I3A A;  2IWB A;  1JWP A;  4Y7P A;  1W5D A;  4QWO A;  5FSR A;  1FOF A;  4OPQ A;  1KDS A;  4EEP A;  4YOF A;  2JN7 A;  4N1H A;  3MKE A;  4OOM A;  3MF0 A;  3ZFZ A;  3ZNT A;  1DP8 A;  1GHP A;  4NKP A;  2GJ3 A;  5FAP A;  3G30 A;  3WS5 A;  3KSG A;  3AGD A;  1O07 A;  4BWI A;  5J8X A;  3NY4 A;  4CLC E;  4CPK A;  3B33 A;  5JYO A;  3UB7 A;  3G34 A;  1UWP X;  3LCE A;  1Y54 A;  2R78 A;  3NHQ A;  5HX9 A;  3LIC A;  3O88 A;  3QP2 A;  4G3V A;  3C5A A;  1F98 A;  1ONH A;  2PAV P;  4JXG A;  2OWJ A;  2W1R A;  4U0X A;  1FCN A;  1OTI A;  3G4P A;  4OPY A;  2WGI A;  3FKV A;  4GD8 A;  3A3E A;  4A5R A;  4QU3 A;  4N1X A;  4PM9 A;  4PM7 A;  3EGX C;  1DJA A;  1T1A A;  2QHK A;  3LR5 A;  1Z09 A;  4Y5F A;  4NET A;  4ZAM A;  4Z1W A;  5IHV A;  2PD7 A;  1G6O A;  4KZ9 A;  4O01 A;  4LGW A;  5GLD A;  2JKF A;  2OOL A;  4Y0O A;  3OCL A;  3R4K A;  5EE8 A;  1I5Q A;  4ZJ1 A;  4BQM A;  3IF6 B;  2W27 A;  2PDR A;  2V0W A;  2XK1 A;  3FV7 A;  3S4X A;  1YSP A;  2W3E A;  3IHA A;  3BWL A;  5EVE A;  5CEC A;  1TS6 A;  4UHU A;  5FI7 A;  3H82 A;  4MBF A;  1YSQ A;  2GNX A;  2Y2K A;  2P9V B;  1DY6 A;  4QY5 A;  2Y2O A;  4M3K A;  2HDS A;  3BFC A;  4HP4 A;  3KX0 X;  5HPI A;  4Q0H A;  4M4X A;  4YNR A;  5J4E A;  4KZA A;  3W8K A;  2ZQC A;  1TS7 A;  5GHY A;  4X55 A;  2XRN A;  3VOZ A;  3AGE A;  3V50 A;  2HDU A;  5EVL A;  4FH4 A;  4HJ4 A;  4O8G A;  2ZOI A;  5FDH A;  4HHD A;  2W3D A;  4I5S A;  4LV1 A;  2B5R A;  4P6Z M;  1HVB A;  3UY6 A;  3TW8 A;  2Z2M B;  1NYY A;  2Y79 A;  1K0K A;  2VA0 A;  4WEJ A;  4WUJ A;  3UE6 A;  2VGK A;  2PYP A;  2ZD8 A;  3H7W B;  2WKQ A;  4WMC A;  2J3T D;  2D01 A;  3NBL A;  1IOU A;  3NOU C;  5FQM A;  4GW9 A;  4B93 A;  3GQZ A;  2Y91 A;  5HAP A;  3OCN A;  3C4P A;  1S4S A;  4KZ3 A;  1BTL A;  3TOI A;  1W7F A;  3LO7 A;  3F1N B;  3FKW A;  4G3W A;  4EBP A;  2DMW A;  1TF1 A;  4O0P A;  3IF5 A;  3GR2 A;  4NEE D;  2K31 A;  4Y0T A;  1PI4 A;  1BUL A;  4X6T A;  2OAQ 1;  5G18 A;  1XPB A;  2QYB A;  3UME A;  2JE5 A;  1CK3 A;  3LFV A;  2J9O A;  1HTZ A;  2EFX A;  2ZMA A;  3VP4 A;  3HUN A;  1KVM A;  4OQI A;  1NLZ A;  3MZD A;  3Q82 A;  1SDE A;  4G3K A;  4IHQ A;  3SS5 A;  2J7V A;  4JGQ A;  5HSQ A;  5D3O A;  3W4O A;  4WZ4 A;  2INW A;  1PRQ A;  5EEC A;  4OPR A;  2XGN A;  3LIF A;  4E3J A;  2A2L A;  2PU2 A;  3JYI A;  1IYS A;  3B47 A;  2GZA A;  1N4O A;  3UPP A;  1WE4 A;  4L9F A;  1E4D A;  3L9K A;  4GZB A;  4JGP A;  4NG2 A;  1WA9 A;  2CC1 A;  5HAI A;  3OPL A;  2A3U A;  4ARZ A;  5CX7 A;  4OON A;  4D60 A;  3S1Y A;  2ZM2 A;  1J3W A;  4E3K A;  4WLA A;  3R7W B;  1H0M A;  4X53 A;  3LEQ A;  2OAP 1;  2L4R A;  5HDD A;  3GTC A;  1P9R A;  1K38 A;  5AVE A;  3UE0 A;  1F9I A;  1W8Q A;  2AVX A;  2XH9 A;  2PT7 A;  2WZX A;  1ERQ A;  4R6L A;  4RX3 A;  2HV1 A;  3WS0 A;  1KDW A;  2HPB A;  3MBZ A;  3E4O A;  2XDM A;  1ZG4 A;  3DTK A;  1ZTU A;  3LID A;  3UDX A;  4X25 A;  1S66 L;  1NY0 A;  1TDL A;  5HD3 A;  3KSF A;  1STZ A;  4R3A A;  5DTS A;  2ZMF A;  3OPP A;  1X0O A;  4OQH A;  4HOI A;  2O0Y A;  2PR6 A;  4F3L B;  1PWD A;  1OTE A;  3IXD A;  4PMA A;  3BY8 A;  1ZG6 A;  1GA0 A;  2X01 A;  5L10 A;  3IBJ A;  3T1Q B;  5FQ9 A;  2JHE A;  3PBR A;  3IXH A;  2H10 A;  1ACF A;  2J8Y A;  4XT2 A;  3UB5 P;  2JCH A;  4BBV A;  2ZC7 A;  3T1R A;  3KSH A;  3H9W A;  5G4Z A;  2BTF P;  1CEG A;  2J3T C;  2ACG A;  3VE3 A;  4OP5 A;  2EX2 A;  3UB8 A;  5CER A;  4PPR A;  1TS8 A;  3DTI A;  3M6H A;  2R9X A;  3D3O A;  1BLC A;  2G2U A;  2KX6 A;  1PI5 A;  2ZQD A;  1P0Z A;  4CQH A;  3K2N A;  1XA1 A;  3HUO A;  3DTE A;  3IX4 A;  3M2K A;  1XA7 A;  3I7J A;  3N6I A;  2VGJ A;  4E3L A;  2Y2M A;  3OBF A;  1VQQ A;  1EWZ A;  3PBQ A;  4NXB A;  5CGW A;  5A8B A;  3SH7 A;  4WBG A;  4OLG A;  1BLP A;  4ZRR A;  4WZ5 C;  4P6Z S;  2O9A A;  1NRF A;  3HLC A;  1S1Y A;  3V3S A;  4HNB A;  3BW6 A;  4HH2 A;  3ZG7 B;  1ERM A;  1Y4O A;  2IWC A;  3KYZ A;  4XUX A;  3CPT A;  3FZC A;  5EVI C;  1RGZ A;  2WGW A;  4BL2 A;  3RJU A;  1DP9 A;  2VX8 A;  4E3O A;  1MWU A;  1RP5 A;  3SH9 A;  4B4Z A;  4GKU A;  5CRF A;  4LFU A;  4GOG A;  1AWI A;  1OTB A;  4NXE A;  3PTE A;  4FCF A;  3NI9 A;  3ULF A;  3QP4 A;  4HBU A;  1XGI A;  4JF6 A;  3S7O A;  2Z6D A;  1LI0 A;  2PU4 A;  5DJT A;  3VMA A;  2OLV A;  4PKY A;  3KYE A;  1YPR A;  3S22 A;  3S7P A;  3PXP A;  1YLZ A;  1XP4 A;  3NIA A;  3LR3 A;  3MQ0 A;  5AQ7 A;  1XX2 A;  5AQB A;  1OTD A;  1W79 A;  5HD5 A;  3VFH A;  3BEC A;  1PWG A;  1PIO A;  3E4Q A;  5M19 A;  3DBA A;  3A3F A;  4LV3 A;  2O99 A;  5LBR A;  4MMN A;  4EUV A;  5F83 A;  3F1P B;  4X1M A;  1NRJ A;  3LR4 A;  3G2Y A;  1SKO B;  2ZMV A;  3MZF A;  3C7V A;  1NYM A;  1Q2Q A;  4KQQ A;  5CEB A;  2PBY A;  4EXO A;  5DFX A;  3S7N A;  5GLB A;  5J7E A;  3WRZ A;  4FOF A;  2V8C A;  5F1G A;  2ZC4 B;  3RH8 B;  2ZQ8 A;  1XJ6 A;  1BLH A;  2I72 A;  4OKP A;  3DTM A;  4DN0 A;  1YM1 A;  1K56 D;  3MS6 A;  2PD8 A;  5A91 A;  5E43 A;  4LEN A;  4DE3 A;  3A0S A;  5KZH A;  2Y2L A;  1XFQ A;  4BMW A;  3QNB A;  4EBN A;  3BJN A;  5FAS A;  5FEG A;  5E2E A;  3F1O A;  5AQ9 A;  4HP9 A;  1MY8 A;  2D02 A;  1JWZ A;  4HY8 A;  4YFM A;  1FSY A;  4QB8 A;  3G35 A;  5IU1 A;  3WRT A;  2HF6 A;  2UWX A;  3P09 A;  1IKI A;  4OP8 A;  4N9L A;  2WYX A;  1MPL A;  1YLY A;  5M1A A;  4ZTK A;  3NOT C;  4UA9 A;  4PM8 A;  4Q0J A;  2RL3 A;  3OC2 A;  2FFF B;  3W4P A;  4CLC A;  2VK3 A;  2W1T A;  4GHI B;  4Q8I A;  3UDI A;  3ZCZ A;  2EWW A;  2EX9 A;  2QZ6 A;  1U60 A;  1T18 A;  1MKM A;  5GLC A;  1P97 A;  1VEU B;  2PYR A;  4HQA A;  1H3Q A;  1FCO A;  3VV4 A;  4ZDX A;  4GDN A;  2BG1 A;  1M6K A;  2OV5 A;  1S4R A;  3Q81 A;  1S6R A;  4S2M A;  2KDK A;  4LV2 A;  5DVA A;  2O9C A;  3UE3 A;  4JXS A;  2I9V A;  3FYZ A;  4JGR A;  5CTM A;  2W3F A;  3ZG0 A;  1UWN X;  3MKF A;  1KGE A;  4CLC C;  4E6X A;  4QD4 A;  2VV7 A;  2K2N A;  1K55 A;  4HH3 A;  2Y8H A;  4S2J A;  4S2I A;  1BZA A;  2XSS A;  1PFL A;  4IVK A;  1D7E A;  3QP1 A;  2P08 A;  5HAQ A;  3UB6 A;  1YMS A;  2K7S A;  1TVF A;  3VP1 A;  1CI9 A;  4OH0 A;  1ZKJ A;  3A0R A;  1KE0 A;  1Z6F A;  2Y2J A;  2JKT M;  3AGF A;  3W2Z A;  1SCW A;  1ODV A;  1H8Z A;  1KGG A;  4WN5 A;  5HDS A;  1T19 A;  4P0M A;  4BD1 A;  1DP6 A;  5EM0 A;  2WKR A;  4BEN A;  3ZG9 B;  5J3W A;  2B18 A;  3ZGA B;  1ESI A;  3PBS A;  4L9G A;  3FPV A;  1LT0 A;  3UB9 A;  3TE8 A;  1XJ3 A;  1GA9 A;  1IFQ A;  1W63 M;  2H0Y A;  4WEL A;  4B88 A;  4DXC A;  4JF4 A;  1H5X A;  1KOU A;  2ZQ7 A;  3CMZ A;  4MN5 A;  1L2S A;  5HFO A;  5HL1 A;  2XQZ A;  5L8M A;  3D72 A;  2WAE A;  4WEK A;  2R9W A;  3T4J A;  4BL3 A;  5E2H A;  2V8F A;  1N9L A;  4E6W A;  1K56 A;  4S2N A;  4ZJ3 A;  3TJZ C;  1WYC A;  2WGW B;  5EUA A;  3NDG A;  3Q07 A;  4FD8 A;  4OQG A;  4OPZ A;  5EOO A;  3R7W A;  3DW0 A;  4KZ4 A;  3MFX A;  2B02 A;  1YAX A;  1L3L A;  3PR6 A;  3ZVT A;  2XRO A;  1LSX A;  1OME A;  5DFY A;  1HZO A;  3VP0 A;  4MNR A;  2WKE A;  1YQS A;  3LUQ A;  1DJC A;  4I3I A;  2NUP C;  5F68 A;  2Y2G A;  3GMW A;  3NUL A;  3BM6 A;  2VJW A;  2W3H A;  4RVA A;  4JGO A;  1CEF A;  2WKH A;  3H82 B;  3IBR A;  3OOV A;  2XF3 A;  4L9E A;  1MWR A;  3EGD C;  4H6J A;  5CXW A;  2VV6 A;  3MXR A;  3LI9 A;  1E3U A;  4K91 A;  4WMC D;  5CGX A;  1K55 C;  3WWX A;  3IWO A;  4X56 A;  4DMZ A;  1VB6 A;  4IBR A;  2LB5 A;  5KMW A;  3M2J A;  3NJA A;  5EM1 A;  2JKT I;  1C3B A;  2WAD A;  5EVI B;  2Y2N A;  2Y2Q A;  3IWQ A;  3SS4 A;  3F1P A;  2E8J A;  4EET B;  1GCE A;  1IEL A;  3CI6 A;  4S2P A;  4IUH A;  4XT2 B;  1NZO A;  3ZG5 A;  4ESP A;  3MMH A;  1NZU A;  3ISG A;  5HL6 A;  4DJ2 A;  2A24 A;  1V9Y A;  2KLI A;  3T4O A;  2ZL1 A;  4MBH A;  2JKR M;  5GL9 A;  3LIA A;  4GD6 A;  2V20 A;  5C5K A;  2Y55 A;  4E3I A;  3LGO A;  4R1G A;  1YLJ A;  3BYD A;  3ZNY A;  1E3U D;  3C2W A;  3V39 A;  2X71 A;  3IF6 A;  5CGS A;  3JVU A;  3HJK A;  3ITA A;  3MQQ A;  1GSX A;  1ESU A;  3B3X A;  2ZJ9 A;  3T1X A;  1IEM A;  3IF6 C;  4HBT A;  1FSW A;  3U2A A;  1L0E A;  2V1Z A;  3Q7V A;  1ZC2 A;  4UEY A;  2L1M A;  4O7D A;  3IX8 A;  4FSF A;  5I5L A;  3EOI A;  3KO6 A;  3C8C A;  5HDC A;  2XLN A;  3Q7V B;  3BY9 A;  1OJ5 A;  4HEF A;  3O3V A;  4JPM A;  5MC7 A;  3IT9 A;  2DCF A;  2WAF A;  3ZHH A;  3FG8 A;  3K3C A;  4DF6 A;  5BOH A;  2DRW A;  3OPR A;  3GRJ A;  2EXA A;  2C5W B;  4JXW A;  1T1C A;  1LL5 A;  2P74 A;  1W63 Q;  4PM6 A;  3E98 A;  1LLB A;  1NLY A;  2Y59 A;  3VP3 A;  4JXV A;  4RQ9 A;  4MCW A;  2BLS A;  3EQU A;  1KGF A;  3T50 A;  3BFD A;  2ZC5 B;  4GS9 B;  4PAU A;  4IED A;  1G28 A;  3KYQ A;  4MN6 A;  3QHY A;  4R4S A;  4C3Q A;  4X1L A;  3FPW A;  4CJN A;  2W0N A;  1CI8 A;  2J3W A;  4JF5 A;  4KZ5 A;  1JNU A;  3K3D A;  1JVJ A;  1K4E A;  1F5M A;  1YMX A;  3NEC A;  1XJ4 A;  5DJU A;  1H8Y A;  3T1S A;  2W1T B;  1MBL A;  1D06 A;  5KSH A;  3CLO A;  3HL9 A;  5A90 A;  4MDZ A;  4UA6 A;  4R70 A;  3CJM A;  3PBO A;  1K4F A;  4P85 A;  2FH5 A;  1XFN A;  4X69 A;  4EUZ A;  3SW1 A;  4MN7 A;  1IKG A;  2GX5 A;  3Q7Z A;  2VLG A;  1BYW A;  1O7E A;  3LIE A;  2XD1 A;  4S2L A;  4N92 A;  3N8R A;  5FQQ A;  2HZ5 A;  2XEP A;  4LCM A;  5CHM A;  1Y28 A;  3UDF A;  1ALQ A;  4UQI M;  4UAA A;  3G32 A;  5EV0 A;  3WS1 A;  3SZT A;  3E2K A;  5L07 A;  3QP6 A;  5FQJ A;  3QP8 A;  3WS2 A;  2B95 A;  4FH2 A;  3RXX A;  5DF8 A;  4CLC D;  4ETX A;  1LI9 A;  2IA2 A;  4B9O A;  1L0G A;  3IWI A;  4R3J A;  2PHY A;  1KE4 A;  4Y2F A;  3BQA A;  3GEC A;  1K57 C;  5CTN A;  2QKP A;  3LYX A;  3T4K A;  2G7U A;  1ES4 A;  3M6B A;  3VE4 A;  2L0W A;  2P7J A;  4WM9 A;  1OJG A;  5KSC A;  4H8R A;  4HIA A;  2OLU A;  1RCJ A;  1YKD A;  3CUE A;  4R3B A;  1RGY A;  3KSI A;  1UGU A;  1IYP A;  3QP5 A;  3N8L A;  2EXB A;  4GB7 A;  3IH9 A;  2ZM8 A;  3ICY A;  1ES5 A;  3V5M A;  3D9Y A;  1N9O A;  3L7H A;  3G2Z A;  3IS2 B;  2QWS A;  4NK3 A;  5FDS A;  4KG2 A;  3F1N A;  3P98 A;  5FI2 A;  1DRM A;  4U0T A;  2EFU A;  2ZC6 B;  4HJ3 A;  4QY6 A;  2V1B A;  3FWL A;  2QMI A;  3IX3 A;  3ZQ5 A;  5TJJ A;  2HGV A;  2Q0O A;  2QJ5 A;  3JVV A;  4XXR A;  3O5Y A;  1LL8 A;  1NXY A;  2ZOH A;  1CQA A;  3VFF A;  2M1C A;  4JLF A;  4UQI S;  1EW0 A;  3G6O A;  3CHW P;  4QPR A;  3T4S A;  3BLS A;  1MWS A;  1IYQ A;  1SDN A;  1QMF A;  4K0X A;  3C7U A;  4KUK A;  2ZM0 A;  2XA7 M;  1VEU A;  1Q2P A;  3HRE A;  1GSV A;  1TS0 A;  2Y4A A;  2P04 A;  1AXB A;  1J9M A;  4EQ1 A;  3VOL A;  2JBF A;  3FC7 A;  2IWD A;  1MWT A;  4HI4 A;  1EI5 A;  5KIZ A;  1OTA A;  1PW8 A;  2XD5 A;  2C6W B;  2Z2L B;  3HLG A;  1QME A;  4KZ6 A;  3HCY A;  3C30 A;  5GHX A;  5FAQ A;  4YIN A;  5A92 A;  2A49 A;  2WGV A;  2WUQ A;  3HJI A;  2O9B A;  4RA7 A;  2LB9 A;  5E2G A;  5HWT A;  5E2F A;  2VZW A;  4I39 A;  2CMN A;  3N7W A;  3BFG A;  1HD8 A;  4DDS A;  4DKI A;  3HLW A;  3LR0 A;  4GCZ A;  5U47 A;  2G2W A;  2JKR I;  2J9P A;  3W4Q A;  3NOP C;  3PHY A;  3G31 A;  5K5B A;  4KQR A;  4P87 A;  3GSG A;  1XJ2 A;  3EEA A;  5DTT A;  1FQG A;  3A3I A;  3TRC A;  2JC7 A;  4PHT A;  3V67 A;  5FL3 A;  3N8S A;  1MXO A;  3E2L A;  1ES3 A;  3VSK A;  5HPF A;  5HWW A;  3E0Y A;  2PR5 A;  5GLA A;  5FQI A;  4ID4 A;  3ITB A;  1S67 L;  4LRZ E;  4OQ0 A;  1YLW A;  3MXS A;  4GLQ A;  2Z6C A;  4R38 A;  5IS1 A;  2H0T A;  1VHM A;  4S2O A;  1ERO A;  1PZO A;  1H8M A;  5HW3 A;  1YLP A;  4DE0 A;  3P01 A;  1G6A A;  5F69 A;  5FI6 A;  3UPN A;  1NWZ A;  2V1A A;  5CHU A;  4FUW A;  3IQA A;  4K08 A;  5EVI D;  2EA9 A;  3LY4 A;  4C75 A;  2PRF A;  2ZL1 B;  4OLD A;  1I2W A;  1HLU P;  4E3N A;  4LRX C;  4BBT A;  4YWZ A;  4QHC A;  4OVD A;  4E04 A;  3T4L A;  3IHB A;  2H5S A;  4R4R A;  3O86 A;  1PWC A;  3CUE C;  5F6A A;  2DNS A;  4Z9Q A;  1OPX A;  1N9B A;  3TG9 A;  4KQO A;  5GHZ A;  1G68 A;  4FTX A;  3S7Q A;  1IYO A;  4EBL A;  4WL9 A;  4GNU A;  4WF0 A;  2Y2P A;  2VV8 A;  5TR7 A;  5F5Y A;  4LCL A;  1FCM A;  2VGL M;  3PAG A;  1TEM A;  1CF0 A;  4KZB A;  4OOL A;  5IT5 A;  4ME4 A;  1OT6 A;  3C38 A;  2V0U A;  3A3J A;  3VOY A;  2WKI A;  3EQV A;  1LL9 A;  3CPT B;  2UV0 E;  3A0V A;  2QJ7 A;  3MZE A;  4KG6 A;  3ZG8 B;  3NCK A;  5HZH A;  3CAX A;  2HP6 A;  4LPZ A;  2P9V A;  4R0Q A;  4IBX A;  3C4O A;  1MZU A;  1ZHH B;  3PBT A;  1VM1 A;  1BSG A;  2ZQA A;  2HJ9 C;  2XFS A;  3PBN A;  2HDQ A;  3DAV A;  1BUE A;  1S1Z A;  1JTD A;  1LSW A;  1K54 C;  3HBR A;  2M7V A;  2FZ0 A;  5DKL A;  3HLF A;  4LLO B;  2VKS A;  4BD0 A;  5A93 A;  3CG5 A;  5CHJ A;  2XA7 S;  4WYY A;  1XXM A;  4I3J A;  5L2F A;  4HJ6 A;  2NUT C;  4EWF A;  3HLE A;  5AJG A;  4HES A;  3OZH A;  3SOI A;  4GJ4 A;  2ZLY A;  4KEN B;  5FQK A;  1K6S A;  3PYP A;  3RXW A;  3T12 B;  5I94 A;  2WKP A;  4MEZ A;  3B42 A;  3IS2 A;  3LY3 A;  1SHV A;  2PBD P;  1SKO A;  1GSW A;  1K57 A;  4BBU A;  4BLM A;  3LIB A;  4KZ7 A;  4Y17 A;  1XKZ A;  5FAT A;  3NDE A;  3HLD A;  5F1F A;  1NJ4 A;  3UO9 A;  3ZYT A;  5TGF A;  2J80 A;  3BEB A;  3HVF A;  3T4Q A;  2ZQ9 A;  4QJG A;  4EEU A;  2Y2H A;  4DE1 A;  3CZD A;  4DXB A;  5TBM A;  1SZV A;  4EQI A;  1L0D A;  4PM5 A;  3MQO A;  4ZJ2 A;  1PZP A;  1S0W A;  5TBM B;  4P6B A;  3GDI A;  2KOI A;  1F2K A;  3HUM A;  1PYY A;  4MLL A;  3CWF A;  1YLT A;  3MSH A;  1BLS A;  4GS9 A;  1TD5 A;  1N9N A;  3PAE A;  4MBK A;  4GHI A;  3F1O B;  1VET A;  5HWV A;  3DWZ A;  2WK0 A;  1FIK A;  2ZC3 B;  5CED A;  5FEF A;  1VET B;  1PNE A;  2BAS A;  1W8Y A;  3EEH A;  1K54 A;  4Q0I A;  1YT4 A;  3MFD A; 
#chains in the Genus database with same CATH homology
 4B4X A;  2EX8 A;  4LV0 A;  4X6T A;  4UA7 A;  5G18 A;  1XPB A;  1FCO A;  4C6Y A;  1ES4 A;  3M6B A;  3BFF A;  4N9K A;  3HLB A;  2JE5 A;  4GDN A;  4WM9 A;  2BG1 A;  4ZDX A;  1CK3 A;  1M6K A;  2J9O A;  5TFQ A;  4H8R A;  5KSC A;  1HTZ A;  2OLU A;  1RCJ A;  1I2S A;  2OV5 A;  2Q9N A;  2EFX A;  2ZMA A;  3Q81 A;  1S6R A;  4S2M A;  3VP4 A;  4LV2 A;  4JKT A;  4R3B A;  1RGY A;  3HUN A;  5DVA A;  5HAR A;  1KVM A;  3ZDJ A;  3UE3 A;  1IYP A;  4JXS A;  4OQI A;  3FYZ A;  3MZD A;  3Q82 A;  1SDE A;  3N8L A;  5CTM A;  2EXB A;  3ZG0 A;  3MKF A;  4GB7 A;  4K0W A;  1KGE A;  3IH8 A;  4E6X A;  3IH9 A;  2ZM8 A;  4QD4 A;  1K55 A;  1ES5 A;  3V5M A;  3N4I A;  3SS5 A;  4S2J A;  3G2Z A;  4S2I A;  2HP9 A;  2J7V A;  1BZA A;  4NK3 A;  4KG2 A;  2XFT A;  4U3T A;  5D3O A;  3W4O A;  4IVK A;  3P98 A;  1DJB A;  4WZ4 A;  5FI2 A;  5HAQ A;  1FR6 A;  2FFY A;  4U0T A;  5EEC A;  4OPR A;  2XGN A;  1YMS A;  3A3D A;  2EFU A;  1K25 A;  2ZC6 B;  3OPH A;  4E3J A;  1TVF A;  4QY6 A;  3VP1 A;  1CI9 A;  3FWL A;  4OH0 A;  2PU2 A;  1ZKJ A;  2QMI A;  1KE0 A;  1Z6F A;  2Y2J A;  1IYS A;  3JYI A;  3AGF A;  4WZ5 A;  1SCW A;  1N4O A;  3UPP A;  1WE4 A;  1GHI A;  1H8Z A;  5M18 A;  1E4D A;  1KGG A;  3ZVW A;  4XXR A;  4P0M A;  4BD1 A;  2EX6 A;  3BLM A;  4GZB A;  1NXY A;  2CC1 A;  5HAI A;  3VFF A;  4JLF A;  3OPL A;  2A3U A;  1XGJ A;  4BEN A;  4DDY A;  4OON A;  3BLS A;  1MWS A;  1IYQ A;  3S1Y A;  2ZM2 A;  3ZG9 B;  4E3K A;  1SDN A;  2GDN A;  3ZGA B;  1QMF A;  1ESI A;  3PBS A;  4K0X A;  3C7U A;  4X53 A;  3GV9 A;  4EV4 A;  5FA7 A;  3SS3 A;  2ZM0 A;  4KZ8 A;  3NC8 A;  1M40 A;  1Q2P A;  3HRE A;  4GN2 A;  3GVB A;  3GTC A;  4DE2 A;  2Y4A A;  4ZBE A;  1TDG A;  1AXB A;  1J9M A;  1GA9 A;  1K38 A;  2Y2I A;  4D2O A;  2JBF A;  3UE0 A;  2IWD A;  1MWT A;  1W8Q A;  2WZZ A;  1EI5 A;  3O87 A;  4XUZ A;  1MKI A;  2XH9 A;  2H0Y A;  3BRM A;  1FR1 A;  1PW8 A;  2XD5 A;  4WEL A;  2C6W B;  2Z2L B;  2WZX A;  3HLG A;  4B88 A;  1QME A;  4JF4 A;  1ERQ A;  4DXC A;  2Q9M A;  4KZ6 A;  1SKF A;  2HDR A;  4S2K A;  1H5X A;  4RX3 A;  3D4F A;  2ZQ7 A;  5GHX A;  5FAQ A;  4YIN A;  3WS0 A;  1KDW A;  3CMZ A;  3DWK A;  2A49 A;  5A92 A;  2HPB A;  2WGV A;  3IXB A;  3MBZ A;  5F82 A;  2WUQ A;  1L2S A;  5HFO A;  2XDM A;  5HL1 A;  2XQZ A;  1ZG4 A;  4RA7 A;  5E2G A;  3V3R A;  2OSU A;  2WAE A;  3UDX A;  5E2F A;  4WEK A;  5HAP A;  2R9W A;  3N7W A;  3BFG A;  1HD8 A;  4BL3 A;  1NY0 A;  1TDL A;  4DDS A;  4DKI A;  5E2H A;  3HLW A;  4OOY A;  5U47 A;  5DTK A;  2G2W A;  4E6W A;  3W4Q A;  2J9P A;  1K56 A;  3G31 A;  3OPP A;  4S2N A;  5DTS A;  4ZJ3 A;  4KQR A;  2X02 A;  3WS4 A;  4P87 A;  5JYP A;  3GSG A;  1K6R A;  1WYC A;  2WGW B;  4OQH A;  5EUA A;  3NDG A;  2QPN A;  3Q07 A;  4FD8 A;  4OQG A;  4OPZ A;  1E25 A;  5DTT A;  1FQG A;  5EOO A;  3A3I A;  5AQA A;  2XR0 A;  3UE1 A;  2JC7 A;  3DW0 A;  3N8S A;  1MXO A;  1PWD A;  1L0F A;  3E2L A;  4KZ4 A;  3LEZ A;  3IXD A;  1ES3 A;  4KG5 A;  3VSK A;  4PMA A;  3ZVT A;  1ZG6 A;  1OME A;  1GA0 A;  4BJP A;  5GLA A;  2X01 A;  5BOH A;  5FQI A;  4ID4 A;  4DRT A;  3ITB A;  1HZO A;  5FQ9 A;  4F94 A;  3PBR A;  1YLW A;  3IXH A;  2E8I A;  4OQ0 A;  2H10 A;  3MXS A;  4MNR A;  3VP0 A;  2WKE A;  1YQS A;  4Y0U A;  2J8Y A;  2H0T A;  4JBF A;  1DJC A;  2HP5 A;  5FAO A;  2JCH A;  2Y2G A;  2ZC7 A;  1JWV A;  3GMW A;  4S2O A;  1ERO A;  1PZO A;  3BM6 A;  1KVL A;  5DF7 A;  4RVA A;  3SH8 A;  5HW3 A;  1YLP A;  1CEF A;  2WKH A;  4DE0 A;  3BFE A;  1CEG A;  1G6A A;  5EPH A;  5FI6 A;  2XF3 A;  3UNW A;  4OP5 A;  3UPN A;  2EX2 A;  5CER A;  1ONG A;  1MWR A;  4PPR A;  5CHU A;  3UPO A;  1JTG A;  5DF9 A;  5CXW A;  3IQA A;  3M6H A;  3Q1F A;  5EOE A;  2R9X A;  5EVI D;  1BLC A;  1BT5 A;  3LY4 A;  3MXR A;  4GDB A;  5EVI A;  4C75 A;  1E3U A;  4K91 A;  2G2U A;  4OLD A;  4RX2 A;  4WMC D;  5CGX A;  3VSL A;  1I2W A;  4E3N A;  1K55 C;  3WWX A;  1PI5 A;  3IWO A;  2ZQD A;  4X56 A;  4E3M A;  1WYB A;  4QHC A;  4R23 A;  4IVI A;  4IBR A;  4OVD A;  1XA1 A;  3HUO A;  1KE3 A;  2RCX A;  3M2J A;  4X68 A;  3VP2 A;  5KMW A;  3M2K A;  1XA7 A;  3I7J A;  3IHB A;  2H5S A;  3N6I A;  2VGJ A;  4E3L A;  4R4R A;  1C3B A;  2WAD A;  3O86 A;  1PWC A;  5EVI B;  2Y2M A;  4S2N C;  2Y2N A;  2DNS A;  2Y2Q A;  3IWQ A;  3SS4 A;  4Z9Q A;  3TSG A;  3UN7 A;  1N9B A;  1VQQ A;  3TG9 A;  1EWZ A;  4KQO A;  5GHZ A;  3PBQ A;  1G68 A;  1GCE A;  1LHY A;  1ES2 A;  1GHM A;  1PW1 A;  5CGW A;  1IEL A;  3SH7 A;  4WBG A;  4S2P A;  1NZO A;  3ZG5 A;  4OLG A;  4Y0T A;  1BLP A;  1IYO A;  1NZU A;  3ISG A;  3IXG A;  4EBL A;  2V2F F;  4RYE A;  4WZ5 C;  1NRF A;  3HLC A;  3QNC A;  4L0L A;  3V3S A;  2IWB A;  4GNU A;  1JWP A;  4Y7P A;  1W5D A;  2Y2P A;  5FSR A;  1FOF A;  5TR7 A;  4OPQ A;  3ZG7 B;  1KDS A;  1ERM A;  4MBH A;  4N1H A;  2IWC A;  3MKE A;  4OOM A;  4LCL A;  4XUX A;  3ZFZ A;  1FCM A;  3ZNT A;  5GL9 A;  1GHP A;  3FZC A;  5EVI C;  1RGZ A;  4GD6 A;  5FAP A;  2WGW A;  3G30 A;  3PAG A;  3WS5 A;  2V20 A;  1TEM A;  4OOL A;  3AGD A;  1O07 A;  4KZB A;  3RJU A;  4BL2 A;  2Y55 A;  4E3I A;  5J8X A;  3NY4 A;  4E3O A;  3A3J A;  1MWU A;  1RP5 A;  4R1G A;  3SH9 A;  1YLJ A;  3BYD A;  3VOY A;  4B4Z A;  4CPK A;  2WKI A;  5JYO A;  4GKU A;  3EQV A;  3ZNY A;  5CRF A;  1E3U D;  3G34 A;  4GOG A;  3LCE A;  1LL9 A;  1Y54 A;  3V39 A;  5HX9 A;  3O88 A;  2X71 A;  3IF6 A;  3MZE A;  3PTE A;  4FCF A;  3NI9 A;  3C5A A;  4KG6 A;  5CGS A;  1ONH A;  4JXG A;  4HBU A;  3ZG8 B;  3NCK A;  1FCN A;  3ITA A;  4U0X A;  3G4P A;  4OPY A;  2WGI A;  1XGI A;  4JF6 A;  2HP6 A;  2P9V A;  3FKV A;  4GD8 A;  4R0Q A;  3A3E A;  4IBX A;  4QU3 A;  1ESU A;  4A5R A;  3B3X A;  3C4O A;  4N1X A;  3PBT A;  1VM1 A;  4PM9 A;  1LI0 A;  4PM7 A;  1BSG A;  2ZQA A;  2PU4 A;  2ZJ9 A;  3VMA A;  2OLV A;  1IEM A;  1DJA A;  2XFS A;  3IF6 C;  4HBT A;  3PBN A;  3S22 A;  1FSW A;  2HDQ A;  1BUE A;  1L0E A;  2V1Z A;  3Q7V A;  1ZC2 A;  1JTD A;  4O7D A;  4NET A;  4FSF A;  4ZAM A;  1K54 C;  1YLZ A;  3HBR A;  1XP4 A;  5IHV A;  2XLN A;  3NIA A;  3Q7V B;  3HLF A;  4HEF A;  3O3V A;  4JPM A;  4KZ9 A;  5AQ7 A;  3IT9 A;  1XX2 A;  2DCF A;  5GLD A;  2WAF A;  5AQB A;  3ZHH A;  1W79 A;  4Y0O A;  4DF6 A;  3OCL A;  3VFH A;  3BEC A;  4BD0 A;  5A93 A;  1PWG A;  2DRW A;  1PIO A;  3OPR A;  3GRJ A;  5EE8 A;  3CG5 A;  5CHJ A;  1I5Q A;  4ZJ1 A;  4WYY A;  2EXA A;  2C5W B;  4JXW A;  4BQM A;  1XXM A;  3IF6 B;  5L2F A;  5M19 A;  1LL5 A;  4EWF A;  3A3F A;  2P74 A;  3HLE A;  4PM6 A;  2XK1 A;  3FV7 A;  3S4X A;  4LV3 A;  1LLB A;  3IHA A;  2Y59 A;  3VP3 A;  4JXV A;  5F83 A;  4HES A;  3OZH A;  5CEC A;  3G2Y A;  2BLS A;  3EQU A;  3SOI A;  1KGF A;  3MZF A;  4UHU A;  5FI7 A;  3BFD A;  4MBF A;  2ZLY A;  2Y2K A;  2P9V B;  2ZC5 B;  3C7V A;  1DY6 A;  4IED A;  4KEN B;  4QY5 A;  1NYM A;  2Y2O A;  4M3K A;  5FQK A;  1Q2Q A;  4KQQ A;  5CEB A;  2HDS A;  3BFC A;  1K6S A;  2PBY A;  3RXW A;  3QHY A;  5I94 A;  4R4S A;  5GLB A;  4C3Q A;  4MEZ A;  4KZA A;  3LY3 A;  3W8K A;  1SHV A;  2ZQC A;  4CJN A;  1K57 A;  3WRZ A;  5GHY A;  4X55 A;  4BLM A;  3VOZ A;  4KZ7 A;  1CI8 A;  5F1G A;  2ZC4 B;  4JF5 A;  3AGE A;  1XKZ A;  2ZQ8 A;  3V50 A;  2HDU A;  4KZ5 A;  5FAT A;  1JVJ A;  1K4E A;  1BLH A;  5EVL A;  2I72 A;  3HLD A;  3NDE A;  1YMX A;  4FH4 A;  3DTM A;  4OKP A;  5F1F A;  1YM1 A;  1K56 D;  5FDH A;  1H8Y A;  1NJ4 A;  3UO9 A;  5TGF A;  3BEB A;  4LEN A;  5E43 A;  5A91 A;  3HVF A;  4DE3 A;  1MBL A;  4LV1 A;  2ZQ9 A;  2B5R A;  4QJG A;  5KZH A;  2Y2L A;  5KSH A;  3HL9 A;  1HVB A;  2Y2H A;  4DE1 A;  5A90 A;  3CZD A;  3UY6 A;  3QNB A;  4UA6 A;  3CJM A;  3PBO A;  4EBN A;  1K4F A;  1NYY A;  2Z2M B;  4P85 A;  4DXB A;  4EQI A;  4X69 A;  4EUZ A;  1L0D A;  4PM5 A;  5FAS A;  1IKG A;  5E2E A;  3Q7Z A;  4ZJ2 A;  4WEJ A;  1PZP A;  1S0W A;  1O7E A;  4P6B A;  2VGK A;  2XD1 A;  4S2L A;  5AQ9 A;  3HUM A;  4N92 A;  2ZD8 A;  1MY8 A;  3N8R A;  1PYY A;  4MLL A;  1JWZ A;  1YLT A;  4YFM A;  1FSY A;  4QB8 A;  3G35 A;  5FQQ A;  4WMC A;  3WRT A;  2UWX A;  3NBL A;  3P09 A;  1BLS A;  1IKI A;  2XEP A;  4LCM A;  5CHM A;  4OP8 A;  3UDF A;  1ALQ A;  2WYX A;  4N9L A;  3PAE A;  4MBK A;  5FQM A;  4UAA A;  3G32 A;  1MPL A;  1YLY A;  5M1A A;  3WS1 A;  4ZTK A;  3E2K A;  3DWZ A;  5FQJ A;  3WS2 A;  3GQZ A;  2Y91 A;  2WK0 A;  3OCN A;  4UA9 A;  2ZC3 B;  4FH2 A;  4PM8 A;  5DF8 A;  3RXX A;  5CED A;  2RL3 A;  3C4P A;  1LI9 A;  4KZ3 A;  1BTL A;  3TOI A;  3OC2 A;  2FFF B;  3W4P A;  1W7F A;  1L0G A;  3IWI A;  4R3J A;  3LO7 A;  1W8Y A;  1KE4 A;  4Q8I A;  3FKW A;  3UDI A;  4EBP A;  1K54 A;  3ZCZ A;  2EX9 A;  2QZ6 A;  1YT4 A;  1K57 C;  3IF5 A;  5CTN A;  1U60 A;  3GR2 A;  3MFD A;  5GLC A;  1PI4 A;  1BUL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...