3G2ZA

Ctx-m-9 class a beta-lactamase complexed with compound 2 (gz2)
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
262
structure length
262
Chain Sequence
TSAVQQKLAALEKSSGGRLGVALIDTADNTQVLYRGDERFPMCSTSKVMAAAAVLKQSETQKQLLNQPVEIKPADLVNYNPIAEKHVNGTMTLAELSAAALQYSDNTAMNKLIAQLGGPGGVTAFARAIGDETFRLDRTEPTLNTAIPGDPRDTTTPRAMAQTLRQLTLGHALGETQRAQLVTWLKGNTTGAASIRAGLPTSWTAGDKTGSGDYGTTNDIAVIWPQGRAPLVLVTYFTQPQQNAESRRDVLASAARIIAEGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular docking and ligand specificity in fragment-based inhibitor discovery
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Beta-lactamase CTX-M-9a
total genus 93
structure length 262
sequence length 262
chains with identical sequence B
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2009-02-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 3g2zA00
1IYOA 1MWSA 4WM9A 4JBFA 1LI9A 3QHYA 4X55A 5FQ9A 2GDNA 2A3UA 2HDSA 2EXAA 4BL3A 5G18A 1CEGA 1JVJA 4PM5A 4FD8A 4PPRA 1L0DA 3IXDA 4X69A 5FAQA 3VFHA 4XUZA 4DE3A 2ZM2A 3VOZA 4MNRA 1ES5A 1LHYA 1K57A 2Q9NA 3Q7VA 4GDBA 5F1GA 5HARA 1BLSA 2DCFA 1YLYA 5FQMA 3WS0A 3C7VA 4S2NC 2Y4AA 3IF5A 5EVIA 5A93A 3ZNTA 4KZ3A 2EFUA 2ZQ9A 1E3UD 1MWRA 3W4OA 4S2LA 3I7JA 2XD1A 2PBYA 2RL3A 4OPYA 4GOGA 4D2OA 4PM6A 4Y0UA 5TGFA 1L0FA 4R4RA 2WKEA 1VQQA 5EECA 1DJAA 3CMZA 4KG5A 4WMCD 3VP0A 4WZ4A 4XXRA 4A5RA 2IWCA 1L2SA 4WZ5C 3FKVA 1GHIA 2C5WB 5EUAA 1YLPA 5DF7A 4ZTKA 3S22A 2OLVA 4ZBEA 5HAQA 1BT5A 2XH9A 2ZM8A 3OC2A 4DE2A 4OOYA 3Q7ZA 1MKIA 1MPLA 1YT4A 2PU2A 4KZ5A 5GLAA 5FDHA 5TR7A 1XXMA 3C4PA 1DJBA 3SOIA 4EUZA 4ZJ1A 5J8XA 4E3JA 4HESA 4UA7A 4WEKA 1GA0A 1PW1A 1SDEA 1XKZA 4H8RA 4GD6A 2XEPA 2ZD8A 2X71A 2XLNA 4X68A 4Y0TA 1W79A 1BLPA 2ZC6B 5F1FA 4S2JA 3WRZA 3MZDA 4CPKA 3MKEA 4JF5A 1FCNA 5CEBA 5JYOA 4MLLA 4E3OA 1I2WA 4DXCA 2R9XA 5CHMA 3ITAA 1PI5A 3O88A 4S2NA 1FQGA 4UA9A 5GHYA 1U60A 3BFEA 4BL2A 1GCEA 1ERQA 1BULA 2WKHA 3IHBA 3OPRA 4F94A 1HVBA 3UDIA 1JWPA 1PWGA 3IHAA 4FH2A 4R3JA 2WKIA 2ZQ7A 3GSGA 1YQSA 2VGJA 3UPOA 4P85A 2Y2JA 1M6KA 1WYCA 3FV7A 1XP4A 4WBGA 1EI5A 2V1ZA 3NI9A 1PIOA 1GHMA 3HUMA 5F83A 2HP6A 1IYSA 1O07A 3M6BA 2QPNA 5EVIB 1SKFA 2WGWB 1SDNA 3N6IA 4E3IA 4S2PA 3BRMA 4C6YA 4K0XA 2J9OA 4QB8A 2Y2LA 1XA7A 4ZAMA 5A90A 2ZLYA 5HX9A 2I72A 3V39A 1CK3A 1H5XA 4OQIA 3M2JA 1K25A 3OZHA 3M2KA 3G34A 1MBLA 3N4IA 2X01A 4E3MA 5M18A 4P0MA 3OCNA 1KE3A 2HDUA 5DF9A 5CECA 4KQOA 2E8IA 3O86A 5GL9A 1YMXA 5EE8A 2XDMA 3EQVA 4KZ6A 1H8ZA 4B88A 4OH0A 3AGEA 1XX2A 4EWFA 1ALQA 1XGIA 1NXYA 3E2LA 3HLEA 1K54C 2JC7A 4EBPA 4JXWA 5FASA 1H8YA 1KGFA 1MY8A 3SS5A 4R3BA 2H0TA 1MXOA 5M19A 4WYYA 2Y91A 1K57C 5DVAA 1YLJA 4OKPA 1JWZA 4ZJ2A 2XGNA 3Q1FA 3G2ZA 2WK0A 5AQ7A 3SS3A 1G68A 3VP4A 5FQJA 4JXVA 5FSRA 1KE4A 3UE1A 2J7VA 3V3RA 3HL9A 1K6RA 4P87A 2J9PA 5GLBA 3SH9A 2WZZA 1L0EA 4LV1A 2Y2NA 2RCXA 3TOIA 3MZEA 4OONA 5GLCA 3WS1A 1TDLA 4RX3A 3HLDA 3TG9A 1ZG6A 4BD1A 2BG1A 4NK3A 1JTDA 5AQAA 3ZGAB 2JCHA 1K54A 1IEMA 1QMEA 3FYZA 4DE1A 1W7FA 2XR0A 2ZQAA 2IWBA 5M1AA 1MWUA 5EVIC 3MKFA 3UE0A 3TSGA 2WZXA 3ZCZA 1RCJA 1TVFA 4DF6A 3E2KA 4E3LA 1ZG4A 2ZM0A 4IVKA 5KSHA 3ZG5A 1TDGA 2EX6A 4U0XA 4K91A 5HAPA 4OPZA 3S4XA 3DWZA 3V5MA 2R9WA 2ZMAA 1NZUA 1C3BA 2WGVA 1E3UA 1Q2PA 5DTKA 2QZ6A 3G32A 4LV2A 3BLSA 1WE4A 3UPNA 2XFTA 3ITBA 1FSWA 4IEDA 3O3VA 4JF4A 4JPMA 4XUXA 4JKTA 4EV4A 2H10A 3CZDA 3PBRA 4KZ7A 4DXBA 5HW3A 4R23A 4CJNA 2QMIA 3W4PA 4ID4A 3HVFA 3NDEA 3LY4A 4BJPA 1ONGA 2X02A 1PZOA 3NIAA 1K38A 2Y2MA 5L2FA 3ZFZA 4O7DA 1FR6A 3G31A 1BLHA 3HLBA 1BTLA 1W8QA 3CJMA 4MBFA 4PM7A 1IYQA 1E25A 4OLGA 5D3OA 2JBFA 3DWKA 1GA9A 4E3NA 5U47A 3IF6C 2WAFA 3OPPA 5EVID 1K56A 3P98A 1YMSA 2Z2LB 3PBQA 2P9VA 3HLGA 2FFYA 4X56A 1FCOA 3GQZA 1KVLA 4RVAA 1K6SA 1K4FA 1NRFA 4EBLA 2ZQDA 1SCWA 2EFXA 4MEZA 4R4SA 3O87A 3ZG7B 4KENB 4WMCA 4OVDA 2ZQ8A 4LV0A 3HUOA 3VOYA 4JLFA 1N4OA 4OLDA 3G30A 2EX9A 4X53A 4ZJ3A 3RJUA 5I94A 5E2FA 5DTSA 5GHXA 3LO7A 3N7WA 4DDYA 1PWDA 4X6TA 1IKIA 3ZVTA 3IH9A 1YLZA 4JF6A 3OPHA 3QNBA 4ZDXA 5HL1A 3N8LA 3UO9A 3UDXA 4GB7A 4S2MA 1XGJA 3BLMA 4BENA 2A49A 2V20A 3ZVWA 4BQMA 3VFFA 4N9KA 2ZC4B 3A3IA 4M3KA 2XD5A 3VMAA 5A92A 3B3XA 1FSYA 1K56D 3IT9A 2EXBA 1S6RA 4LV3A 3A3JA 1KGGA 3PTEA 5KMWA 3A3DA 3FWLA 4OQGA 1LLBA 4PMAA 1I2SA 2P9VB 2ZC7A 3AGDA 5F82A 3IXGA 3OPLA 3V3SA 3PBSA 3CG5A 3GRJA 4OP8A 1J9MA 1NJ4A 2PU4A 5FI6A 1IYPA 1XA1A 5CTNA 3WWXA 1RGYA 4QD4A 4NETA 1BSGA 1KVMA 1HZOA 2HPBA 4GD8A 2ZQCA 2B5RA 3M6HA 3HLCA 4DDSA 4U0TA 1YLWA 3LCEA 2DNSA 4S2KA 3SH8A 4OQHA 2J8YA 4Y0OA 1BUEA 4LENA 5E2EA 3MBZA 3UE3A 4GKUA 3UDFA 4FCFA 5IHVA 4OPRA 5BOHA 2Y55A 1CEFA 3GR2A 2Y2IA 2H0YA 3IQAA 2Y2KA 4JXGA 5FI7A 4R0QA 4LCMA 5FQIA 3DTMA 4EQIA 4QJGA 4RX2A 2WAEA 3HBRA 4QHCA 3N8RA 1NYMA 3V50A 4WZ5A 1QMFA 3ZNYA 4JXSA 5JYPA 4PM8A 5CGXA 1K55A 3MFDA 2HDRA 4OOLA 1KE0A 1ZC2A 2OSUA 4RYEA 1BZAA 1PI4A 3Q7VB 4HBUA 1YM1A 3IH8A 1YLTA 5FA7A 1NYYA 2H5SA 4KZ4A 1OMEA 4MBHA 3WRTA 3A3FA 3P09A 5FI2A 4GN2A 1SHVA 5CGSA 1Z6FA 3FZCA 4FH4A 3BFGA 1K55C 4BLMA 1E4DA 1Q2QA 2XQZA 3MXSA 3VP3A 2BLSA 3VSKA 1M40A 4DKIA 2Y59A 3RXXA 3FKWA 5EPHA 4EBNA 2EX2A 1BLCA 4E6XA 3BYDA 4KZ8A 1ERMA 4KZAA 1FOFA 3IWOA 1VM1A 4QU3A 5HFOA 5CRFA 3VP2A 4KZBA 3UPPA 4GDNA 3S1YA 1LL5A 5E2HA 1CI9A 3BFFA 4Y7PA 3LEZA 2UWXA 5E43A 4N92A 1PZPA 3C7UA 3PBNA 3VSLA 2XFSA 1N9BA 2WYXA 3HUNA 2CC1A 4MBKA 1NY0A 2HP9A 3PAGA 1W8YA 4P6BA 4Q8IA 1NZOA 3ZG0A 1EWZA 5DTTA 3PAEA 2ZC3B 1LI0A 5CEDA 3PBTA 2Y2HA 1EROA 1PYYA 2IWDA 2WGWA 2XF3A 1DJCA 4QY5A 5DF8A 3W8KA 2G2WA 4K0WA 1S0WA 1KDSA 3IF6B 1I5QA 2WGIA 3BECA 3VP1A 1FR1A 4E6WA 2WUQA 1RGZA 2HP5A 3GTCA 4KG6A 3SH7A 1ZKJA 3GVBA 4KG2A 4S2IA 4WELA 3GV9A 3BFDA 4B4XA 4YFMA 1L0GA 3NDGA 3Q07A 5E2GA 3UY6A 5KZHA 5CHUA 4RA7A 1ES4A 2OV5A 1ESUA 3NCKA 3MXRA 4B4ZA 1KDWA 2C6WB 4IBRA 3AGFA 1PW8A 5EOOA 4DE0A 4KQRA 3PBOA 1W5DA 3JYIA 3BM6A 2ZJ9A 3WS5A 5CTMA 3WS4A 1AXBA 2ZC5B 1MWTA 3N8SA 3ZHHA 1Y54A 3UN7A 3D4FA 3BFCA 1ES3A 3OCLA 4UHUA 4PM9A 5EVLA 1FCMA 1CI8A 4KQQA 3BEBA 2HDQA 4HBTA 3ZG9B 1O7EA 2V2FF 3MZFA 4QY6A 3IXHA 1ES2A 1LL9A 3HREA 3UNWA 2Y2GA 3NC8A 4R1GA 1G6AA 5KSCA 3ISGA 5HAIA 5FATA 1KGEA 1IKGA 3NY4A 3HLFA 3ZG8B 3G35A 3NBLA 1JWVA 1RP5A 4LCLA 4YINA 4BD0A 5FAPA 1HTZA 2Y2OA 3C5AA 4FSFA 1PWCA 2Y2PA 3IF6A 4U3TA 4C3QA 3LY3A 5GHZA 2Q9MA 3GMWA 5GLDA 4UAAA 5AQ9A 4HEFA 3IWQA 1HD8A 1K4EA 2EX8A 4UA6A 3DW0A 2P74A 2DRWA 5CGWA 4Z9QA 1XPBA 3G4PA 5EOEA 5TFQA 3A3EA 5A91A 4N1XA 2OLUA 1TEMA 2VGKA 5CHJA 4L0LA 3ZDJA 2JE5A 1GHPA 3SS4A 2Y2QA 3RXWA 4KZ9A 1WYBA 4GZBA 3IXBA 4DRTA 4IBXA 2WADA 3W4QA 4OP5A 3HLWA 5AQBA 2XK1A 1ONHA 2FFFB 4N9LA 1ESIA 3G2YA 3C4OA 1JTGA 1DY6A 5CXWA 4S2OA 5FQKA 4GNUA 4E3KA 3QNCA 1IELA 2G2UA 5CERA 2Z2MB 3EQUA 3IWIA 3Q81A 4IVIA 4OQ0A 4OOMA 5FQQA 3Q82A 3WS2A 4WEJA 4OPQA 4C75A 5FAOA 4N1HA
chains in the Genus database with same CATH superfamily
2JKTM 1MWSA 4WM9A 4JBFA 4X55A 2GJ3A 2V0UA 3KSGA 4BL3A 3EEAA 1DRMA 3NOUC 5F6AA 3F1OB 5FAQA 4I5SA 4XUZA 2A24A 3F1NB 3KYZA 4WF0A 4MN5A 2DCFA 1YLYA 4S2NC 3IF5A 2QKPA 3ZNTA 1H3QA 1NLZA 1E3UD 1MWRA 3C30A 2PBYA 4HJ3A 4OPYA 4Y0UA 3RFBA 5EECA 1DJAA 3CMZA 4WMCD 4XXRA 4A5RA 1L2SA 5IT5A 2C5WB 5DF7A 1BT5A 2XH9A 2ZM8A 3OC2A 4DE2A 1MPLA 1YT4A 1XXMA 3O5YA 5J8XA 2W1RA 2V1AA 4HESA 4E3JA 1GA0A 1PW1A 2XLNA 4MMNA 1XFQA 3MZDA 3PYPA 4CPKA 3D3OA 3KX0X 4E3OA 3VE4A 5CHMA 1XJ3A 3ITAA 1PI5A 5L8MA 4S2NA 1FQGA 3BFEA 4JGRA 1ZTUA 2ZQ7A 3LUQA 3T50A 1P97A 1XP4A 1OTBA 3M6BA 4R6LA 3N6IA 4K0XA 4HH3A 2J9OA 4QB8A 4YNRA 2Y2LA 1XA7A 4ZAMA 4LFUA 1CK3A 1H5XA 3M2JA 5MC7A 3N4IA 5M18A 1KE3A 1VETA 2I9VA 2WKPA 4KQOA 5EE8A 3EQVA 4B88A 3IX3A 1XGIA 2JC7A 1H8YA 1MY8A 4R3BA 3QP6A 1K57C 5DVAA 3IBJA 3Q1FA 3SS3A 5FQJA 3EGXC 1KE4A 2J7VA 4X25A 1K6RA 4P87A 2WZZA 1L0EA 3EEHA 4ESPA 4OONA 5GLCA 3P01A 4EEPA 2BG1A 1JTDA 3ZGAB 4LLOB 2JCHA 1QMEA 5DKLA 1X0OA 2ZQAA 2IWBA 3CLOA 3UE0A 3OBFA 2ZM0A 4U0XA 1C3BA 2WGVA 5EM1A 2QJ7A 4FOFA 1WE4A 3ITBA 3NHQA 4JPMA 4XUXA 4JF4A 2ZOHA 4KZ7A 1V9YA 3QP2A 3LEQA 2QMIA 1K38A 3ZFZA 3A0RA 1S4RA 5D3OA 2JBFA 2Y79A 3DWKA 1K56A 2PR5A 1YMSA 2Z2LB 4AFIA 3F1PA 3HLGA 3GQZA 4P6ZM 4EXOA 4DN0A 1NRFA 4R4SA 5DJTA 4JLFA 4K08A 1PWDA 3P7NA 3IH9A 4JF6A 3LR5A 3FC7A 4GB7A 4S2MA 5HWTA 1XGJA 3BLMA 4BENA 2A49A 2J3TD 3KSFA 3VFFA 2ZC4B 2XD5A 3VMAA 5A92A 1YSQA 3MMHA 3LIDA 1LLBA 4Y5FA 1SZVA 2BTFP 2K7SA 3AGDA 2B18A 3UE6A 3GRJA 3MF0A 4QD4A 3IBRA 3T4OA 4HHDA 2B5RA 4U0TA 4S2KA 4JGOA 3MBZA 4GHIA 3UE3A 3LIEA 3ICYA 3GR2A 3IQAA 4QJGA 3DTMA 4X1LA 3ZNYA 5J3WA 3GDIA 2VV7A 2EWWA 1ZC2A 2OSUA 1BZAA 1PI4A 1YM1A 3IH8A 5A8BA 2AVXA 1NYYA 1P0ZA 2H5SA 3A3FA 3T1QB 4GN2A 1SHVA 1Z6FA 1VB6A 1E4DA 1Q2QA 3VP3A 4DKIA 3VSKA 3FKWA 4Y2FA 2OWHA 2EX2A 1N9OA 3A0SA 1ZHHB 1VM1A 5HFOA 3UPPA 4UEYA 3S1YA 4Y7PA 2M7UA 3LEZA 3T1SA 4YOFA 3PBNA 1F98A 1N9BA 3HUNA 3PAGA 4P6ZS 1W8YA 4Q8IA 1NZOA 3MQQA 4JGPA 1EWZA 5DTTA 3NJAA 5HWVA 1UWPX 4HH2A 1DJCA 4UQIS 4QY5A 2L1MA 3IF6B 3JPUA 2WGIA 3LI9A 3BECA 4HNBA 3VP1A 1FR1A 2NUTC 1RGZA 2HP5A 3GTCA 2VK3A 4WELA 3BFDA 1XJ2A 3NDGA 3UY6A 4RA7A 3NCKA 3LFVA 1KDWA 2C6WB 4QWOA 1T19A 3PBOA 3BM6A 2ZJ9A 5CTMA 1AXBA 2ZC5B 1LL8A 3UN7A 3D4FA 4PM9A 2HDQA 1YPRA 4HBTA 1VEUA 2V2FF 4NXGA 1ES2A 3H7WA 2O9BA 4JGQA 2YKHA 5AJGA 2EA9A 1OTIA 1IKGA 3IX4A 3ZG8B 2JKFA 2JN7A 1RP5A 5C5KA 1HTZA 4FSFA 4IHQA 4LRYC 4II7A 4U3TA 4C3QA 5GLDA 3CWFA 4LPZA 2OAP1 4BWIA 4NG2A 3FG8A 1HD8A 1K4EA 2P74A 5EVEA 1XPBA 2JHEA 5EOEA 5TFQA 4HOIA 3S7QA 2OLUA 5K5BA 3RTYA 3RXWA 5EV0A 3IXBA 4DRTA 1OT9A 3C8CA 4I3IA 2FFFB 4N9LA 1ESIA 1JTGA 4E3KA 4IVIA 4OOMA 4OQ0A 3Q82A 4OPQA 4N1HA 1SKOA 5FQ9A 1LI9A 2GDNA 5HL6A 4PPRA 1L0DA 4X69A 1ES5A 2Q9NA 1K57A 4GDBA 5F1GA 1BLSA 5HD3A 5FQMA 3C7VA 1P9RA 5DJUA 2EFUA 4KUKA 2DMWA 4S2LA 3I7JA 5TBMB 2O9CA 4GOGA 1ACFA 4PM6A 2W0NA 4R4RA 3LI8A 4BMWA 1VQQA 3QP4A 3VP0A 2GZAA 1GHIA 4ZTKA 5EUAA 1YLPA 1TD5A 2K2NA 5F5YA 4ZBEA 2J3WA 5HAQA 4UQIM 4OOYA 5GLAA 5FDHA 1DJBA 3KO6A 3FPWA 4ZJ1A 4WEKA 1XKZA 4GD6A 2XEPA 4X68A 4Y0TA 2QHKA 1W79A 1BLPA 3WRZA 5CEBA 5JYOA 2LB9A 2R9XA 4NKPA 1U60A 1ERQA 1BULA 2WKHA 3JVUA 3OPRA 3E98A 1HVBA 4F94A 1JWPA 3IHAA 1YQSA 2VGJA 2Y2JA 1WYCA 3LGOA 1DP8A 2V1ZA 5F83A 3CAXA 2HP6A 1O07A 1SKFA 1SDNA 1Y28A 4Q0JA 2L4RA 2I72A 3V39A 4OQIA 2PR6A 1K25A 3OZHA 2ZOIA 3M2KA 2V1BA 3OCNA 3BW6A 2E8IA 2XDMA 4KZ6A 1NXYA 1K54C 4CLCE 4WL9A 4I39A 5FASA 1T1AA 3SS5A 2H0TA 1ODVA 3VOLA 5M19A 4WYYA 2PHYA 1JWZA 2VX8A 2FH5A 5AQ7A 2CMNA 3MQ0A 4EW7A 2VJWA 3VP4A 4IUKA 3V3RA 3T1RA 3SH9A 2Y2NA 2RCXA 3U2AA 1Z09A 3WS1A 2V8CA 4NK3A 3BJNA 1K54A 4DE1A 2XR0A 3ZCZA 1MWUA 4E3LA 3E4OA 5FDSA 2EX6A 5HAPA 4OPZA 1E3UA 2QZ6A 3G32A 5LBRA 2ZMFA 5HW3A 4R23A 2VGLS 3HVFA 3LY4A 4BJPA 4NEED 2X02A 4E04A 3NIAA 3PXPA 3F1OA 2Y2MA 1S66L 4O7DA 2IA2A 1BTLA 3CJMA 3MQOA 4E3NA 1NWZA 3OPPA 5EVID 4KQDA 3P98A 4O8GA 4X56A 2EWVA 1FCOA 2FZ0A 1K6SA 1K4FA 1PRQA 2ZQDA 4OLDA 4X53A 2EX9A 5I94A 3DBAA 5E2FA 2VEAA 1YAXA 3LO7A 3N7WA 4X6TA 1GSXA 1YLZA 4ZDXA 2PYRA 2V20A 4G3WA 4N9KA 5DFYA 3IT9A 3PTEA 5KMWA 3E0YA 2P9VB 2ZC7A 3CPTA 5F82A 3IXGA 3T1XA 3PBSA 3DTEA 2PU4A 3WWXA 1OTEA 2PT7A 2HPBA 2ZQCA 3HLCA 4MN6A 3V67A 1YLWA 3L9KA 2DNSA 4OQHA 4Y0OA 1BUEA 2P08A 4CLCA 2W3HA 2XROA 4OPRA 3UMEA 5BOHA 1OJGA 1CEFA 2Y2KA 4LCMA 4EQIA 1TF1A 1NYMA 3V50A 4WZ5A 2W3EA 5CGXA 3MFDA 1KE0A 3MR0A 2V0WA 2XSSA 4HBUA 1YLTA 1G28A 3NULA 3WRTA 3HCYA 3EWKA 4PKYG 3FZCA 3MXQA 4FH4A 2MJ6A 4BLMA 2XQZA 1L3LA 4KZ8A 3IWOA 4GDNA 3BY9A 5TBMA 2UWXA 3H82B 1TS6A 2D01A 2B02A 3C7UA 2XFSA 3T4QA 2WYXA 2PYPA 3UB5P 3S7PA 2IWDA 2A2LA 2WGWA 2XF3A 4EQ1A 1S0WA 1NRJA 4E6WA 3SH7A 1W63M 1ZKJA 4B4XA 3Q07A 4BBUA 2YKFA 1ESUA 3MXRA 4B4ZA 5EOOA 3JYIA 3WS5A 3WS4A 4EU0A 1BYWA 1MWTA 3ZHHA 3MFXA 4Q0HA 4B93A 1MKMA 3E4QA 3HREA 3UNWA 4FTXA 5KSCA 3L7HA 5FATA 3NY4A 3G35A 2K31A 3PHYA 4YINA 1XJ4A 3UB8A 1PWCA 2PDRA 5J4EA 3LY3A 2Q9MA 3GMWA 3LR4A 5AQ9A 1G5UA 3S7NA 3CITA 4UA6A 5A91A 4N1XA 2VGKA 2P7JA 3IX8A 1IFQA 2JE5A 2Z6DA 3ZDJA 2Y2QA 4KZ9A 4CQHA 2WADA 3W4QA 4HQAA 2INWA 3G2YA 3C4OA 4Y3IA 3TRCA 1DY6A 4GLQA 4S2OA 5CXWA 1IELA 2G2UA 3EQUA 3Q81A 5FQQA 3WS2A 5FAOA 3QHYA 2A3UA 5KIZA 2EXAA 4ARZB 2HZ5A 2OAQ1 4FD8A 2XA7M 1V9ZA 3VFHA 4MNRA 1LHYA 3Q7VA 5HARA 5A93A 5FEGA 3W4OA 2XD1A 2RL3A 4EERA 4D2OA 5TGFA 4KG5A 4WZ5C 3FKVA 2BASA 3S22A 1F9IA 1JNUA 2OLVA 1PFLA 2PU2A 3T4SA 1LSVA 3C4PA 2PBDP 3SOIA 4EUZA 4UA7A 1SDEA 1CQAA 4WN5A 5F1FA 2ZD8A 2X71A 2G7UA 4S2JA 4ARZA 3OLOA 1FCNA 1I2WA 3VE3A 3O88A 1VETB 4UA9A 4BBVA 1GCEA 3IHBA 1PWGA 4R3JA 2WKIA 1M6KA 3FV7A 1LSWA 3HJIA 2Q0OA 1GHMA 5EVIB 2QPNA 3DTIA 3KSHA 4B9OA 5A90A 3TW8A 2ZLYA 2W1TB 5HX9A 5L07A 4MDZA 5I5LA 3G34A 2X01A 4E3MA 4P0MA 4Z1WA 5DF9A 1DP6A 1YMXA 1H8ZA 4OH0A 3AGEA 3HLEA 4BBTA 4JXWA 2L0WA 3KYQA 3EGDC 1MXOA 2J80A 4ZJ2A 2XGNA 4EESA 4Y17A 5HDCA 1G68A 2ZBBA 4JXVA 3UE1A 2UV0E 5GLBA 4F3LB 4WUJA 5HD5A 1TDLA 1TS7A 3HLDA 3TG9A 4BD1A 1H0MA 5AQAA 3GECA 1IEMA 3FYZA 1W7FA 4HI4A 2WKQA 2VLGA 3MKFA 3TSGA 2WZXA 1RCJA 1TVFA 4DF6A 3E2KA 1ZG4A 4IVKA 5KSHA 3FPVA 1TDGA 4L9FA 4K91A 5EFWA 3S4XA 3DWZA 1NZUA 1Q2PA 2W1TA 4LV2A 3BWLA 3BLSA 3UPNA 2XFTA 1FSWA 4EV4A 3O3VA 1YSPA 3CZDA 3PBRA 1UGUA 4HJ4A 2W3DA 4Y13A 3W4PA 4ID4A 3NDEA 3T4TA 3R7WA 1CJFA 1PZOA 2GX5A 3ZQ5A 5L2FA 1FR6A 1BLHA 5J7EA 1IYQA 1E25A 3R4KA 4OLGA 2QWSA 3BQAA 2V8FA 5U47A 3IF6C 4ETZA 3T4LA 3PBQA 2P9VA 1S1ZA 4RVAA 4M4XA 4EBLA 2EFXA 3O87A 3ZG7B 2HGVA 4KENB 4OVDA 2ZQ8A 4LV0A 1CF0A 4WMCA 5DKKA 1N4OA 3VOYA 3ZVWA 3RJUA 2PD8A 3U4LP 3LIBA 4PHTA 5GHXA 4L9GA 3ZVTA 3QNBA 5AVFA 3N8LA 2GNXA 3A3IA 1FSYA 1K56D 4DJ3A 2EXBA 1S6RA 3UB6A 3A3JA 1KGGA 4EETB 3A3DA 3FWLA 4OQGA 4XT2B 5HZHA 3IS2B 3OPLA 4CLCC 3NOTC 1XFNA 4OP8A 1J9MA 1NJ4A 4GCZA 5FI6A 1XA1A 5CTNA 1RGYA 4NETA 1BSGA 3LYXA 1KVMA 1HZOA 3CI6A 3M6HA 3SH8A 4LENA 3B47A 4GKUA 3UDFA 4FCFA 4L9EA 5IHVA 1H8MA 2Y55A 1F5MA 3HBRA 4QHCA 1QMFA 4HY8A 4JXSA 5JYPA 4PM8A 1T18A 1K55A 4OOLA 3MJQA 4D60A 5IS1A 1WA9A 3D72A 3CUEC 4MBHA 3T4JA 4GS9B 1T1BA 3P09A 4NXBA 1D1JA 2R78A 5CGSA 3MXSA 1AWIA 2VZWA 2Y59A 3RXXA 2ACGA 1BLCA 4Q0IA 1ERMA 4KZAA 5CRFA 3VP2A 4KZBA 1LL5A 1OPXA 4IJGA 1CI9A 3BFFA 5E43A 1KOUA 3G6OA 3W2ZA 4MN7A 4MBKA 2HP9A 4HJ6A 3MS6A 2HJEA 4HP4A 3ZG0A 2VKSA 1LT0A 3NOPC 1LI0A 3CUEA 3PBTA 2Y2HA 1EROA 1PYYA 2G2WA 4O01A 1VEUB 1FILA 1I5QA 3ZYTA 1S67L 3UMDA 1N9NA 4KG2A 2PD7A 4S2IA 3GV9A 3K3DA 3DAVA 1GSWA 1D06A 5E2GA 5FEFA 1OJ5A 1ES4A 4WLAA 4IBRA 3AGFA 1PW8A 1W5DA 1TS0A 3H82A 2JKTI 3HJKA 3TJZC 4DJ2A 3N8SA 1Y54A 3C38A 4UHUA 3VV4A 3JVVA 5F68A 1FCMA 1CI8A 1GSVA 2VV8A 2ZMVA 1LL9A 2Y2GA 2W3FA 1PNEA 3ISGA 2HV1A 5HPIA 1KGEA 2B95A 3SZTA 3NBLA 4O0PA 3ULFA 5G4YA 3K3CA 3BQ8A 3C5AA 2Y2PA 3IF6A 5GHZA 4HEFA 3IWQA 2VA0A 5TJJA 2VV6A 2Y8HA 3A3EA 2ZL1B 1TEMA 2JKGA 5CHJA 4KUOA 3IS2A 5HDSA 3LR3A 4I3AA 4OP5A 3HLWA 5AQBA 2XK1A 1G6OA 5CERA 2Z2MB 3IWIA 4C75A 1IYOA 2HJ9C 2HDSA 5G18A 1CEGA 1JVJA 4PM5A 4R3AA 3IXDA 3R7WB 4R38A 4DE3A 2ZM2A 3VOZA 4LRZE 3WS0A 2Y4AA 5EVIA 3F1PB 4KZ3A 2ZQ9A 2XA7S 4ZRRA 1L0FA 2WKEA 2P04A 4WZ4A 2IWCA 1MZUA 3Q7ZA 1MKIA 4KZ5A 4LRXC 5TR7A 4LGWA 4H8RA 2Z6CA 2ZC6B 3MKEA 4JF5A 4MLLA 4EEUA 4DXCA 4PKYA 4XT2A 3E4PA 5GHYA 3H9WA 4BL2A 3UDIA 4G3VA 4FH2A 3GSGA 3UPOA 4P85A 4WBGA 1EI5A 3NI9A 1PIOA 3HUMA 1IYSA 2WGWB 4E3IA 4S2PA 3BRMA 4C6YA 1D7EA 3C2WA 3LIAA 1UWNX 1MBLA 3KYEA 1YKDA 2HDUA 5CECA 3O86A 1OT6A 5GL9A 4EWFA 3T12B 1XX2A 1ALQA 3E2LA 2PAVP 4EBPA 1KGFA 1P9WA 1MC0A 4Y15A 4GS9A 2Y91A 1YLJA 1K0KA 2WKRA 4OKPA 3G2ZA 2WK0A 1XJ6A 4EUVA 1S1YA 5FSRA 3HL9A 2M7VA 2J9PA 4LV1A 2OOLA 3TOIA 3MZEA 1TS8A 2E8JA 2JKRM 4GJ4A 4H6JB 4RX3A 1ZG6A 5M1AA 2O99A 5EVIC 3F1NA 4RQ9A 3ZG5A 3V5MA 2R9WA 2ZMAA 5DTKA 1S4SA 4DMZA 4I3JA 3QP5A 4IEDA 4FUWA 4JKTA 2H10A 4DXBA 4CJNA 2A24B 1ONGA 2OWJA 4NXFA 2O0YA 3G31A 3HLBA 1W8QA 3SW1A 4MBFA 4PM7A 1GA9A 4F3LA 4QPRA 2WAFA 4IUHA 4GW9A 2FFYA 1KVLA 1SCWA 4MEZA 3HUOA 3G30A 4ZJ3A 4GHIB 5DTSA 4DDYA 1IKIA 1LSXA 1OTAA 1NLYA 3OPHA 5HL1A 3UO9A 3UDXA 4BQMA 5IU1A 4M3KA 5G4ZA 3B3XA 4HP9A 2JKRI 4LV3A 4PMAA 1I2SA 3V3SA 3CG5A 3TE8A 2V9AA 3NECA 1IYPA 4GD8A 4DDSA 1SKOB 1OTDA 3LCEA 2J8YA 5E2EA 3EOIA 1W63Q 1N9LA 3RH8B 2Y2IA 2H0YA 4JXGA 4MCWA 5FQIA 5FI7A 4R0QA 4RX2A 2HF6A 2WAEA 3N8RA 2HDRA 1IOUA 2QJ5A 4RYEA 2XRNA 5HPFA 3UB7A 2O9AA 3Q7VB 3S7OA 4H6JA 5FA7A 4X1MA 3LR0A 2ZL1A 4KZ4A 1OMEA 4ME4A 5FI2A 4HIAA 3BFGA 1K55C 2BLSA 1FIKA 1M40A 4EBNA 2PRFA 5EPHA 3H7WB 3CPTB 1T1CA 4E6XA 5F69A 3BYDA 3B33A 1F2KA 2KX6A 1VHMA 1FOFA 4QU3A 3QP8A 5HWWA 3K2NA 5E2HA 1Y4OA 4N92A 1PZPA 3VSLA 5AVEA 2J3TC 2CC1A 1NY0A 4P6BA 3PAEA 2M1CA 2ZC3B 3BY8A 2QYBA 5CEDA 2D02A 4G3KA 3T4KA 5DF8A 3OOVA 3W8KA 4K0WA 1KDSA 3CHWP 2WUQA 4KG6A 3GVBA 1EW0A 3A0VA 4YFMA 1L0GA 3LICA 1A0KA 5KZHA 5CHUA 2OV5A 2W27A 3UB9A 2VGLM 2KLIA 4DE0A 4KQRA 5CX7A 5FL3A 3DTKA 5HDDA 3QP1A 2W3GA 4CLCD 2KDKA 3BFCA 1ES3A 3OCLA 5EVLA 4KQQA 3BEBA 3ZG9B 1O7EA 3MZFA 4QY6A 4YWZA 3IXHA 3NC8A 3B42A 4R1GA 2H28A 4R70A 1G6AA 3D9YA 1HLUP 5HAIA 3HLFA 2LB5A 1JWVA 4LCLA 3KSIA 4BD0A 5FAPA 5EM0A 2Y2OA 4NXEA 4CLCB 1J3WA 3PR6A 4UAAA 5DFXA 5L09A 2EX8A 3MSHA 3DW0A 5CGWA 2DRWA 4Z9QA 3G4PA 2KOIA 1STZA 5L10A 4L0LA 1GHPA 3SS4A 1WYBA 4GZBA 4IBXA 4PAUA 4I38A 1ONHA 3LIFA 1DP9A 5FQKA 4GNUA 3QNCA 4ETXA 4WEJA 2NUPC 5HSQA
chains in the Genus database with same CATH topology
1IYOA 1MWSA 4WM9A 4JBFA 1LI9A 3QHYA 4X55A 5FQ9A 2GDNA 2A3UA 2HDSA 2EXAA 4BL3A 5G18A 1CEGA 1JVJA 4PM5A 4FD8A 4PPRA 1L0DA 3IXDA 4X69A 5FAQA 3VFHA 4XUZA 4DE3A 2ZM2A 3VOZA 4MNRA 1ES5A 1LHYA 1K57A 2Q9NA 3Q7VA 4GDBA 5F1GA 5HARA 1BLSA 2DCFA 1YLYA 5FQMA 3WS0A 3C7VA 4S2NC 2Y4AA 3IF5A 5EVIA 5A93A 3ZNTA 4KZ3A 2EFUA 2ZQ9A 1E3UD 1MWRA 3W4OA 4S2LA 3I7JA 2XD1A 2PBYA 2RL3A 4OPYA 4GOGA 4D2OA 4PM6A 4Y0UA 5TGFA 1L0FA 4R4RA 2WKEA 1VQQA 5EECA 1DJAA 3CMZA 4KG5A 4WMCD 3VP0A 4WZ4A 4XXRA 4A5RA 2IWCA 1L2SA 4WZ5C 3FKVA 1GHIA 2C5WB 5EUAA 1YLPA 5DF7A 4ZTKA 3S22A 2OLVA 4ZBEA 5HAQA 1BT5A 2XH9A 2ZM8A 3OC2A 4DE2A 4OOYA 3Q7ZA 1MKIA 1MPLA 1YT4A 2PU2A 4KZ5A 5GLAA 5FDHA 5TR7A 1XXMA 3C4PA 1DJBA 3SOIA 4EUZA 4ZJ1A 5J8XA 4E3JA 4HESA 4UA7A 4WEKA 1GA0A 1PW1A 1SDEA 1XKZA 4H8RA 4GD6A 2XEPA 2ZD8A 2X71A 2XLNA 4X68A 4Y0TA 1W79A 1BLPA 2ZC6B 5F1FA 4S2JA 3WRZA 3MZDA 4CPKA 3MKEA 4JF5A 1FCNA 5CEBA 5JYOA 4MLLA 4E3OA 1I2WA 4DXCA 2R9XA 5CHMA 3ITAA 1PI5A 3O88A 4S2NA 1FQGA 4UA9A 5GHYA 1U60A 3BFEA 4BL2A 1GCEA 1ERQA 1BULA 2WKHA 3IHBA 3OPRA 4F94A 1HVBA 3UDIA 1JWPA 1PWGA 3IHAA 4FH2A 4R3JA 2WKIA 2ZQ7A 3GSGA 1YQSA 2VGJA 3UPOA 4P85A 2Y2JA 1M6KA 1WYCA 3FV7A 1XP4A 4WBGA 1EI5A 2V1ZA 3NI9A 1PIOA 1GHMA 3HUMA 5F83A 2HP6A 1IYSA 1O07A 3M6BA 2QPNA 5EVIB 1SKFA 2WGWB 1SDNA 3N6IA 4E3IA 4S2PA 3BRMA 4C6YA 4K0XA 2J9OA 4QB8A 2Y2LA 1XA7A 4ZAMA 5A90A 2ZLYA 5HX9A 2I72A 3V39A 1CK3A 1H5XA 4OQIA 3M2JA 1K25A 3OZHA 3M2KA 3G34A 1MBLA 3N4IA 2X01A 4E3MA 5M18A 4P0MA 3OCNA 1KE3A 2HDUA 5DF9A 5CECA 4KQOA 2E8IA 3O86A 5GL9A 1YMXA 5EE8A 2XDMA 3EQVA 4KZ6A 1H8ZA 4B88A 4OH0A 3AGEA 1XX2A 4EWFA 1ALQA 1XGIA 1NXYA 3E2LA 3HLEA 1K54C 2JC7A 4EBPA 4JXWA 5FASA 1H8YA 1KGFA 1MY8A 3SS5A 4R3BA 2H0TA 1MXOA 5M19A 4WYYA 2Y91A 1K57C 5DVAA 1YLJA 4OKPA 1JWZA 4ZJ2A 2XGNA 3Q1FA 3G2ZA 2WK0A 5AQ7A 3SS3A 1G68A 3VP4A 5FQJA 4JXVA 5FSRA 1KE4A 3UE1A 2J7VA 3V3RA 3HL9A 1K6RA 4P87A 2J9PA 5GLBA 3SH9A 2WZZA 1L0EA 4LV1A 2Y2NA 2RCXA 3TOIA 3MZEA 4OONA 5GLCA 3WS1A 1TDLA 4RX3A 3HLDA 3TG9A 1ZG6A 4BD1A 2BG1A 4NK3A 1JTDA 5AQAA 3ZGAB 2JCHA 1K54A 1IEMA 1QMEA 3FYZA 4DE1A 1W7FA 2XR0A 2ZQAA 2IWBA 5M1AA 1MWUA 5EVIC 3MKFA 3UE0A 3TSGA 2WZXA 3ZCZA 1RCJA 1TVFA 4DF6A 3E2KA 4E3LA 1ZG4A 2ZM0A 4IVKA 5KSHA 3ZG5A 1TDGA 2EX6A 4U0XA 4K91A 5HAPA 4OPZA 3S4XA 3DWZA 3V5MA 2R9WA 2ZMAA 1NZUA 1C3BA 2WGVA 1E3UA 1Q2PA 5DTKA 2QZ6A 3G32A 4LV2A 3BLSA 1WE4A 3UPNA 2XFTA 3ITBA 1FSWA 4IEDA 3O3VA 4JF4A 4JPMA 4XUXA 4JKTA 4EV4A 2H10A 3CZDA 3PBRA 4KZ7A 4DXBA 5HW3A 4R23A 4CJNA 2QMIA 3W4PA 4ID4A 3HVFA 3NDEA 3LY4A 4BJPA 1ONGA 2X02A 1PZOA 3NIAA 1K38A 2Y2MA 5L2FA 3ZFZA 4O7DA 1FR6A 3G31A 1BLHA 3HLBA 1BTLA 1W8QA 3CJMA 4MBFA 4PM7A 1IYQA 1E25A 4OLGA 5D3OA 2JBFA 3DWKA 1GA9A 4E3NA 5U47A 3IF6C 2WAFA 3OPPA 5EVID 1K56A 3P98A 1YMSA 2Z2LB 3PBQA 2P9VA 3HLGA 2FFYA 4X56A 1FCOA 3GQZA 1KVLA 4RVAA 1K6SA 1K4FA 1NRFA 4EBLA 2ZQDA 1SCWA 2EFXA 4MEZA 4R4SA 3O87A 3ZG7B 4KENB 4WMCA 4OVDA 2ZQ8A 4LV0A 3HUOA 3VOYA 4JLFA 1N4OA 4OLDA 3G30A 2EX9A 4X53A 4ZJ3A 3RJUA 5I94A 5E2FA 5DTSA 5GHXA 3LO7A 3N7WA 4DDYA 1PWDA 4X6TA 1IKIA 3ZVTA 3IH9A 1YLZA 4JF6A 3OPHA 3QNBA 4ZDXA 5HL1A 3N8LA 3UO9A 3UDXA 4GB7A 4S2MA 1XGJA 3BLMA 4BENA 2A49A 2V20A 3ZVWA 4BQMA 3VFFA 4N9KA 2ZC4B 3A3IA 4M3KA 2XD5A 3VMAA 5A92A 3B3XA 1FSYA 1K56D 3IT9A 2EXBA 1S6RA 4LV3A 3A3JA 1KGGA 3PTEA 5KMWA 3A3DA 3FWLA 4OQGA 1LLBA 4PMAA 1I2SA 2P9VB 2ZC7A 3AGDA 5F82A 3IXGA 3OPLA 3V3SA 3PBSA 3CG5A 3GRJA 4OP8A 1J9MA 1NJ4A 2PU4A 5FI6A 1IYPA 1XA1A 5CTNA 3WWXA 1RGYA 4QD4A 4NETA 1BSGA 1KVMA 1HZOA 2HPBA 4GD8A 2ZQCA 2B5RA 3M6HA 3HLCA 4DDSA 4U0TA 1YLWA 3LCEA 2DNSA 4S2KA 3SH8A 4OQHA 2J8YA 4Y0OA 1BUEA 4LENA 5E2EA 3MBZA 3UE3A 4GKUA 3UDFA 4FCFA 5IHVA 4OPRA 5BOHA 2Y55A 1CEFA 3GR2A 2Y2IA 2H0YA 3IQAA 2Y2KA 4JXGA 5FI7A 4R0QA 4LCMA 5FQIA 3DTMA 4EQIA 4QJGA 4RX2A 2WAEA 3HBRA 4QHCA 3N8RA 1NYMA 3V50A 4WZ5A 1QMFA 3ZNYA 4JXSA 5JYPA 4PM8A 5CGXA 1K55A 3MFDA 2HDRA 4OOLA 1KE0A 1ZC2A 2OSUA 4RYEA 1BZAA 1PI4A 3Q7VB 4HBUA 1YM1A 3IH8A 1YLTA 5FA7A 1NYYA 2H5SA 4KZ4A 1OMEA 4MBHA 3WRTA 3A3FA 3P09A 5FI2A 4GN2A 1SHVA 5CGSA 1Z6FA 3FZCA 4FH4A 3BFGA 1K55C 4BLMA 1E4DA 1Q2QA 2XQZA 3MXSA 3VP3A 2BLSA 3VSKA 1M40A 4DKIA 2Y59A 3RXXA 3FKWA 5EPHA 4EBNA 2EX2A 1BLCA 4E6XA 3BYDA 4KZ8A 1ERMA 4KZAA 1FOFA 3IWOA 1VM1A 4QU3A 5HFOA 5CRFA 3VP2A 4KZBA 3UPPA 4GDNA 3S1YA 1LL5A 5E2HA 1CI9A 3BFFA 4Y7PA 3LEZA 2UWXA 5E43A 4N92A 1PZPA 3C7UA 3PBNA 3VSLA 2XFSA 1N9BA 2WYXA 3HUNA 2CC1A 4MBKA 1NY0A 2HP9A 3PAGA 1W8YA 4P6BA 4Q8IA 1NZOA 3ZG0A 1EWZA 5DTTA 3PAEA 2ZC3B 1LI0A 5CEDA 3PBTA 2Y2HA 1EROA 1PYYA 2IWDA 2WGWA 2XF3A 1DJCA 4QY5A 5DF8A 3W8KA 2G2WA 4K0WA 1S0WA 1KDSA 3IF6B 1I5QA 2WGIA 3BECA 3VP1A 1FR1A 4E6WA 2WUQA 1RGZA 2HP5A 3GTCA 4KG6A 3SH7A 1ZKJA 3GVBA 4KG2A 4S2IA 4WELA 3GV9A 3BFDA 4B4XA 4YFMA 1L0GA 3NDGA 3Q07A 5E2GA 3UY6A 5KZHA 5CHUA 4RA7A 1ES4A 2OV5A 1ESUA 3NCKA 3MXRA 4B4ZA 1KDWA 2C6WB 4IBRA 3AGFA 1PW8A 5EOOA 4DE0A 4KQRA 3PBOA 1W5DA 3JYIA 3BM6A 2ZJ9A 3WS5A 5CTMA 3WS4A 1AXBA 2ZC5B 1MWTA 3N8SA 3ZHHA 1Y54A 3UN7A 3D4FA 3BFCA 1ES3A 3OCLA 4UHUA 4PM9A 5EVLA 1FCMA 1CI8A 4KQQA 3BEBA 2HDQA 4HBTA 3ZG9B 1O7EA 2V2FF 3MZFA 4QY6A 3IXHA 1ES2A 1LL9A 3HREA 3UNWA 2Y2GA 3NC8A 4R1GA 1G6AA 5KSCA 3ISGA 5HAIA 5FATA 1KGEA 1IKGA 3NY4A 3HLFA 3ZG8B 3G35A 3NBLA 1JWVA 1RP5A 4LCLA 4YINA 4BD0A 5FAPA 1HTZA 2Y2OA 3C5AA 4FSFA 1PWCA 2Y2PA 3IF6A 4U3TA 4C3QA 3LY3A 5GHZA 2Q9MA 3GMWA 5GLDA 4UAAA 5AQ9A 4HEFA 3IWQA 1HD8A 1K4EA 2EX8A 4UA6A 3DW0A 2P74A 2DRWA 5CGWA 4Z9QA 1XPBA 3G4PA 5EOEA 5TFQA 3A3EA 5A91A 4N1XA 2OLUA 1TEMA 2VGKA 5CHJA 4L0LA 3ZDJA 2JE5A 1GHPA 3SS4A 2Y2QA 3RXWA 4KZ9A 1WYBA 4GZBA 3IXBA 4DRTA 4IBXA 2WADA 3W4QA 4OP5A 3HLWA 5AQBA 2XK1A 1ONHA 2FFFB 4N9LA 1ESIA 3G2YA 3C4OA 1JTGA 1DY6A 5CXWA 4S2OA 5FQKA 4GNUA 4E3KA 3QNCA 1IELA 2G2UA 5CERA 2Z2MB 3EQUA 3IWIA 3Q81A 4IVIA 4OQ0A 4OOMA 5FQQA 3Q82A 3WS2A 4WEJA 4OPQA 4C75A 5FAOA 4N1HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IYO A;  1MWS A;  4WM9 A;  4JBF A;  1LI9 A;  3QHY A;  4X55 A;  5FQ9 A;  2GDN A;  2A3U A;  2HDS A;  2EXA A;  4BL3 A;  5G18 A;  1CEG A;  1JVJ A;  4PM5 A;  4FD8 A;  4PPR A;  1L0D A;  3IXD A;  4X69 A;  5FAQ A;  3VFH A;  4XUZ A;  4DE3 A;  2ZM2 A;  3VOZ A;  4MNR A;  1ES5 A;  1LHY A;  1K57 A;  2Q9N A;  3Q7V A;  4GDB A;  5F1G A;  5HAR A;  1BLS A;  2DCF A;  1YLY A;  5FQM A;  3WS0 A;  3C7V A;  4S2N C;  2Y4A A;  3IF5 A;  5EVI A;  5A93 A;  3ZNT A;  4KZ3 A;  2EFU A;  2ZQ9 A;  1E3U D;  1MWR A;  3W4O A;  4S2L A;  3I7J A;  2XD1 A;  2PBY A;  2RL3 A;  4OPY A;  4GOG A;  4D2O A;  4PM6 A;  4Y0U A;  5TGF A;  1L0F A;  4R4R A;  2WKE A;  1VQQ A;  5EEC A;  1DJA A;  3CMZ A;  4KG5 A;  4WMC D;  3VP0 A;  4WZ4 A;  4XXR A;  4A5R A;  2IWC A;  1L2S A;  4WZ5 C;  3FKV A;  1GHI A;  2C5W B;  5EUA A;  1YLP A;  5DF7 A;  4ZTK A;  3S22 A;  2OLV A;  4ZBE A;  5HAQ A;  1BT5 A;  2XH9 A;  2ZM8 A;  3OC2 A;  4DE2 A;  4OOY A;  3Q7Z A;  1MKI A;  1MPL A;  1YT4 A;  2PU2 A;  4KZ5 A;  5GLA A;  5FDH A;  5TR7 A;  1XXM A;  3C4P A;  1DJB A;  3SOI A;  4EUZ A;  4ZJ1 A;  5J8X A;  4E3J A;  4HES A;  4UA7 A;  4WEK A;  1GA0 A;  1PW1 A;  1SDE A;  1XKZ A;  4H8R A;  4GD6 A;  2XEP A;  2ZD8 A;  2X71 A;  2XLN A;  4X68 A;  4Y0T A;  1W79 A;  1BLP A;  2ZC6 B;  5F1F A;  4S2J A;  3WRZ A;  3MZD A;  4CPK A;  3MKE A;  4JF5 A;  1FCN A;  5CEB A;  5JYO A;  4MLL A;  4E3O A;  1I2W A;  4DXC A;  2R9X A;  5CHM A;  3ITA A;  1PI5 A;  3O88 A;  4S2N A;  1FQG A;  4UA9 A;  5GHY A;  1U60 A;  3BFE A;  4BL2 A;  1GCE A;  1ERQ A;  1BUL A;  2WKH A;  3IHB A;  3OPR A;  4F94 A;  1HVB A;  3UDI A;  1JWP A;  1PWG A;  3IHA A;  4FH2 A;  4R3J A;  2WKI A;  2ZQ7 A;  3GSG A;  1YQS A;  2VGJ A;  3UPO A;  4P85 A;  2Y2J A;  1M6K A;  1WYC A;  3FV7 A;  1XP4 A;  4WBG A;  1EI5 A;  2V1Z A;  3NI9 A;  1PIO A;  1GHM A;  3HUM A;  5F83 A;  2HP6 A;  1IYS A;  1O07 A;  3M6B A;  2QPN A;  5EVI B;  1SKF A;  2WGW B;  1SDN A;  3N6I A;  4E3I A;  4S2P A;  3BRM A;  4C6Y A;  4K0X A;  2J9O A;  4QB8 A;  2Y2L A;  1XA7 A;  4ZAM A;  5A90 A;  2ZLY A;  5HX9 A;  2I72 A;  3V39 A;  1CK3 A;  1H5X A;  4OQI A;  3M2J A;  1K25 A;  3OZH A;  3M2K A;  3G34 A;  1MBL A;  3N4I A;  2X01 A;  4E3M A;  5M18 A;  4P0M A;  3OCN A;  1KE3 A;  2HDU A;  5DF9 A;  5CEC A;  4KQO A;  2E8I A;  3O86 A;  5GL9 A;  1YMX A;  5EE8 A;  2XDM A;  3EQV A;  4KZ6 A;  1H8Z A;  4B88 A;  4OH0 A;  3AGE A;  1XX2 A;  4EWF A;  1ALQ A;  1XGI A;  1NXY A;  3E2L A;  3HLE A;  1K54 C;  2JC7 A;  4EBP A;  4JXW A;  5FAS A;  1H8Y A;  1KGF A;  1MY8 A;  3SS5 A;  4R3B A;  2H0T A;  1MXO A;  5M19 A;  4WYY A;  2Y91 A;  1K57 C;  5DVA A;  1YLJ A;  4OKP A;  1JWZ A;  4ZJ2 A;  2XGN A;  3Q1F A;  3G2Z A;  2WK0 A;  5AQ7 A;  3SS3 A;  1G68 A;  3VP4 A;  5FQJ A;  4JXV A;  5FSR A;  1KE4 A;  3UE1 A;  2J7V A;  3V3R A;  3HL9 A;  1K6R A;  4P87 A;  2J9P A;  5GLB A;  3SH9 A;  2WZZ A;  1L0E A;  4LV1 A;  2Y2N A;  2RCX A;  3TOI A;  3MZE A;  4OON A;  5GLC A;  3WS1 A;  1TDL A;  4RX3 A;  3HLD A;  3TG9 A;  1ZG6 A;  4BD1 A;  2BG1 A;  4NK3 A;  1JTD A;  5AQA A;  3ZGA B;  2JCH A;  1K54 A;  1IEM A;  1QME A;  3FYZ A;  4DE1 A;  1W7F A;  2XR0 A;  2ZQA A;  2IWB A;  5M1A A;  1MWU A;  5EVI C;  3MKF A;  3UE0 A;  3TSG A;  2WZX A;  3ZCZ A;  1RCJ A;  1TVF A;  4DF6 A;  3E2K A;  4E3L A;  1ZG4 A;  2ZM0 A;  4IVK A;  5KSH A;  3ZG5 A;  1TDG A;  2EX6 A;  4U0X A;  4K91 A;  5HAP A;  4OPZ A;  3S4X A;  3DWZ A;  3V5M A;  2R9W A;  2ZMA A;  1NZU A;  1C3B A;  2WGV A;  1E3U A;  1Q2P A;  5DTK A;  2QZ6 A;  3G32 A;  4LV2 A;  3BLS A;  1WE4 A;  3UPN A;  2XFT A;  3ITB A;  1FSW A;  4IED A;  3O3V A;  4JF4 A;  4JPM A;  4XUX A;  4JKT A;  4EV4 A;  2H10 A;  3CZD A;  3PBR A;  4KZ7 A;  4DXB A;  5HW3 A;  4R23 A;  4CJN A;  2QMI A;  3W4P A;  4ID4 A;  3HVF A;  3NDE A;  3LY4 A;  4BJP A;  1ONG A;  2X02 A;  1PZO A;  3NIA A;  1K38 A;  2Y2M A;  5L2F A;  3ZFZ A;  4O7D A;  1FR6 A;  3G31 A;  1BLH A;  3HLB A;  1BTL A;  1W8Q A;  3CJM A;  4MBF A;  4PM7 A;  1IYQ A;  1E25 A;  4OLG A;  5D3O A;  2JBF A;  3DWK A;  1GA9 A;  4E3N A;  5U47 A;  3IF6 C;  2WAF A;  3OPP A;  5EVI D;  1K56 A;  3P98 A;  1YMS A;  2Z2L B;  3PBQ A;  2P9V A;  3HLG A;  2FFY A;  4X56 A;  1FCO A;  3GQZ A;  1KVL A;  4RVA A;  1K6S A;  1K4F A;  1NRF A;  4EBL A;  2ZQD A;  1SCW A;  2EFX A;  4MEZ A;  4R4S A;  3O87 A;  3ZG7 B;  4KEN B;  4WMC A;  4OVD A;  2ZQ8 A;  4LV0 A;  3HUO A;  3VOY A;  4JLF A;  1N4O A;  4OLD A;  3G30 A;  2EX9 A;  4X53 A;  4ZJ3 A;  3RJU A;  5I94 A;  5E2F A;  5DTS A;  5GHX A;  3LO7 A;  3N7W A;  4DDY A;  1PWD A;  4X6T A;  1IKI A;  3ZVT A;  3IH9 A;  1YLZ A;  4JF6 A;  3OPH A;  3QNB A;  4ZDX A;  5HL1 A;  3N8L A;  3UO9 A;  3UDX A;  4GB7 A;  4S2M A;  1XGJ A;  3BLM A;  4BEN A;  2A49 A;  2V20 A;  3ZVW A;  4BQM A;  3VFF A;  4N9K A;  2ZC4 B;  3A3I A;  4M3K A;  2XD5 A;  3VMA A;  5A92 A;  3B3X A;  1FSY A;  1K56 D;  3IT9 A;  2EXB A;  1S6R A;  4LV3 A;  3A3J A;  1KGG A;  3PTE A;  5KMW A;  3A3D A;  3FWL A;  4OQG A;  1LLB A;  4PMA A;  1I2S A;  2P9V B;  2ZC7 A;  3AGD A;  5F82 A;  3IXG A;  3OPL A;  3V3S A;  3PBS A;  3CG5 A;  3GRJ A;  4OP8 A;  1J9M A;  1NJ4 A;  2PU4 A;  5FI6 A;  1IYP A;  1XA1 A;  5CTN A;  3WWX A;  1RGY A;  4QD4 A;  4NET A;  1BSG A;  1KVM A;  1HZO A;  2HPB A;  4GD8 A;  2ZQC A;  2B5R A;  3M6H A;  3HLC A;  4DDS A;  4U0T A;  1YLW A;  3LCE A;  2DNS A;  4S2K A;  3SH8 A;  4OQH A;  2J8Y A;  4Y0O A;  1BUE A;  4LEN A;  5E2E A;  3MBZ A;  3UE3 A;  4GKU A;  3UDF A;  4FCF A;  5IHV A;  4OPR A;  5BOH A;  2Y55 A;  1CEF A;  3GR2 A;  2Y2I A;  2H0Y A;  3IQA A;  2Y2K A;  4JXG A;  5FI7 A;  4R0Q A;  4LCM A;  5FQI A;  3DTM A;  4EQI A;  4QJG A;  4RX2 A;  2WAE A;  3HBR A;  4QHC A;  3N8R A;  1NYM A;  3V50 A;  4WZ5 A;  1QMF A;  3ZNY A;  4JXS A;  5JYP A;  4PM8 A;  5CGX A;  1K55 A;  3MFD A;  2HDR A;  4OOL A;  1KE0 A;  1ZC2 A;  2OSU A;  4RYE A;  1BZA A;  1PI4 A;  3Q7V B;  4HBU A;  1YM1 A;  3IH8 A;  1YLT A;  5FA7 A;  1NYY A;  2H5S A;  4KZ4 A;  1OME A;  4MBH A;  3WRT A;  3A3F A;  3P09 A;  5FI2 A;  4GN2 A;  1SHV A;  5CGS A;  1Z6F A;  3FZC A;  4FH4 A;  3BFG A;  1K55 C;  4BLM A;  1E4D A;  1Q2Q A;  2XQZ A;  3MXS A;  3VP3 A;  2BLS A;  3VSK A;  1M40 A;  4DKI A;  2Y59 A;  3RXX A;  3FKW A;  5EPH A;  4EBN A;  2EX2 A;  1BLC A;  4E6X A;  3BYD A;  4KZ8 A;  1ERM A;  4KZA A;  1FOF A;  3IWO A;  1VM1 A;  4QU3 A;  5HFO A;  5CRF A;  3VP2 A;  4KZB A;  3UPP A;  4GDN A;  3S1Y A;  1LL5 A;  5E2H A;  1CI9 A;  3BFF A;  4Y7P A;  3LEZ A;  2UWX A;  5E43 A;  4N92 A;  1PZP A;  3C7U A;  3PBN A;  3VSL A;  2XFS A;  1N9B A;  2WYX A;  3HUN A;  2CC1 A;  4MBK A;  1NY0 A;  2HP9 A;  3PAG A;  1W8Y A;  4P6B A;  4Q8I A;  1NZO A;  3ZG0 A;  1EWZ A;  5DTT A;  3PAE A;  2ZC3 B;  1LI0 A;  5CED A;  3PBT A;  2Y2H A;  1ERO A;  1PYY A;  2IWD A;  2WGW A;  2XF3 A;  1DJC A;  4QY5 A;  5DF8 A;  3W8K A;  2G2W A;  4K0W A;  1S0W A;  1KDS A;  3IF6 B;  1I5Q A;  2WGI A;  3BEC A;  3VP1 A;  1FR1 A;  4E6W A;  2WUQ A;  1RGZ A;  2HP5 A;  3GTC A;  4KG6 A;  3SH7 A;  1ZKJ A;  3GVB A;  4KG2 A;  4S2I A;  4WEL A;  3GV9 A;  3BFD A;  4B4X A;  4YFM A;  1L0G A;  3NDG A;  3Q07 A;  5E2G A;  3UY6 A;  5KZH A;  5CHU A;  4RA7 A;  1ES4 A;  2OV5 A;  1ESU A;  3NCK A;  3MXR A;  4B4Z A;  1KDW A;  2C6W B;  4IBR A;  3AGF A;  1PW8 A;  5EOO A;  4DE0 A;  4KQR A;  3PBO A;  1W5D A;  3JYI A;  3BM6 A;  2ZJ9 A;  3WS5 A;  5CTM A;  3WS4 A;  1AXB A;  2ZC5 B;  1MWT A;  3N8S A;  3ZHH A;  1Y54 A;  3UN7 A;  3D4F A;  3BFC A;  1ES3 A;  3OCL A;  4UHU A;  4PM9 A;  5EVL A;  1FCM A;  1CI8 A;  4KQQ A;  3BEB A;  2HDQ A;  4HBT A;  3ZG9 B;  1O7E A;  2V2F F;  3MZF A;  4QY6 A;  3IXH A;  1ES2 A;  1LL9 A;  3HRE A;  3UNW A;  2Y2G A;  3NC8 A;  4R1G A;  1G6A A;  5KSC A;  3ISG A;  5HAI A;  5FAT A;  1KGE A;  1IKG A;  3NY4 A;  3HLF A;  3ZG8 B;  3G35 A;  3NBL A;  1JWV A;  1RP5 A;  4LCL A;  4YIN A;  4BD0 A;  5FAP A;  1HTZ A;  2Y2O A;  3C5A A;  4FSF A;  1PWC A;  2Y2P A;  3IF6 A;  4U3T A;  4C3Q A;  3LY3 A;  5GHZ A;  2Q9M A;  3GMW A;  5GLD A;  4UAA A;  5AQ9 A;  4HEF A;  3IWQ A;  1HD8 A;  1K4E A;  2EX8 A;  4UA6 A;  3DW0 A;  2P74 A;  2DRW A;  5CGW A;  4Z9Q A;  1XPB A;  3G4P A;  5EOE A;  5TFQ A;  3A3E A;  5A91 A;  4N1X A;  2OLU A;  1TEM A;  2VGK A;  5CHJ A;  4L0L A;  3ZDJ A;  2JE5 A;  1GHP A;  3SS4 A;  2Y2Q A;  3RXW A;  4KZ9 A;  1WYB A;  4GZB A;  3IXB A;  4DRT A;  4IBX A;  2WAD A;  3W4Q A;  4OP5 A;  3HLW A;  5AQB A;  2XK1 A;  1ONH A;  2FFF B;  4N9L A;  1ESI A;  3G2Y A;  3C4O A;  1JTG A;  1DY6 A;  5CXW A;  4S2O A;  5FQK A;  4GNU A;  4E3K A;  3QNC A;  1IEL A;  2G2U A;  5CER A;  2Z2M B;  3EQU A;  3IWI A;  3Q81 A;  4IVI A;  4OQ0 A;  4OOM A;  5FQQ A;  3Q82 A;  3WS2 A;  4WEJ A;  4OPQ A;  4C75 A;  5FAO A;  4N1H A; 
#chains in the Genus database with same CATH topology
 2JKT M;  1MWS A;  4WM9 A;  4JBF A;  4X55 A;  2GJ3 A;  2V0U A;  3KSG A;  4BL3 A;  3EEA A;  1DRM A;  3NOU C;  5F6A A;  3F1O B;  5FAQ A;  4I5S A;  4XUZ A;  2A24 A;  3F1N B;  3KYZ A;  4WF0 A;  4MN5 A;  2DCF A;  1YLY A;  4S2N C;  3IF5 A;  2QKP A;  3ZNT A;  1H3Q A;  1NLZ A;  1E3U D;  1MWR A;  3C30 A;  2PBY A;  4HJ3 A;  4OPY A;  4Y0U A;  3RFB A;  5EEC A;  1DJA A;  3CMZ A;  4WMC D;  4XXR A;  4A5R A;  1L2S A;  5IT5 A;  2C5W B;  5DF7 A;  1BT5 A;  2XH9 A;  2ZM8 A;  3OC2 A;  4DE2 A;  1MPL A;  1YT4 A;  1XXM A;  3O5Y A;  5J8X A;  2W1R A;  2V1A A;  4HES A;  4E3J A;  1GA0 A;  1PW1 A;  2XLN A;  4MMN A;  1XFQ A;  3MZD A;  3PYP A;  4CPK A;  3D3O A;  3KX0 X;  4E3O A;  3VE4 A;  5CHM A;  1XJ3 A;  3ITA A;  1PI5 A;  5L8M A;  4S2N A;  1FQG A;  3BFE A;  4JGR A;  1ZTU A;  2ZQ7 A;  3LUQ A;  3T50 A;  1P97 A;  1XP4 A;  1OTB A;  3M6B A;  4R6L A;  3N6I A;  4K0X A;  4HH3 A;  2J9O A;  4QB8 A;  4YNR A;  2Y2L A;  1XA7 A;  4ZAM A;  4LFU A;  1CK3 A;  1H5X A;  3M2J A;  5MC7 A;  3N4I A;  5M18 A;  1KE3 A;  1VET A;  2I9V A;  2WKP A;  4KQO A;  5EE8 A;  3EQV A;  4B88 A;  3IX3 A;  1XGI A;  2JC7 A;  1H8Y A;  1MY8 A;  4R3B A;  3QP6 A;  1K57 C;  5DVA A;  3IBJ A;  3Q1F A;  3SS3 A;  5FQJ A;  3EGX C;  1KE4 A;  2J7V A;  4X25 A;  1K6R A;  4P87 A;  2WZZ A;  1L0E A;  3EEH A;  4ESP A;  4OON A;  5GLC A;  3P01 A;  4EEP A;  2BG1 A;  1JTD A;  3ZGA B;  4LLO B;  2JCH A;  1QME A;  5DKL A;  1X0O A;  2ZQA A;  2IWB A;  3CLO A;  3UE0 A;  3OBF A;  2ZM0 A;  4U0X A;  1C3B A;  2WGV A;  5EM1 A;  2QJ7 A;  4FOF A;  1WE4 A;  3ITB A;  3NHQ A;  4JPM A;  4XUX A;  4JF4 A;  2ZOH A;  4KZ7 A;  1V9Y A;  3QP2 A;  3LEQ A;  2QMI A;  1K38 A;  3ZFZ A;  3A0R A;  1S4R A;  5D3O A;  2JBF A;  2Y79 A;  3DWK A;  1K56 A;  2PR5 A;  1YMS A;  2Z2L B;  4AFI A;  3F1P A;  3HLG A;  3GQZ A;  4P6Z M;  4EXO A;  4DN0 A;  1NRF A;  4R4S A;  5DJT A;  4JLF A;  4K08 A;  1PWD A;  3P7N A;  3IH9 A;  4JF6 A;  3LR5 A;  3FC7 A;  4GB7 A;  4S2M A;  5HWT A;  1XGJ A;  3BLM A;  4BEN A;  2A49 A;  2J3T D;  3KSF A;  3VFF A;  2ZC4 B;  2XD5 A;  3VMA A;  5A92 A;  1YSQ A;  3MMH A;  3LID A;  1LLB A;  4Y5F A;  1SZV A;  2BTF P;  2K7S A;  3AGD A;  2B18 A;  3UE6 A;  3GRJ A;  3MF0 A;  4QD4 A;  3IBR A;  3T4O A;  4HHD A;  2B5R A;  4U0T A;  4S2K A;  4JGO A;  3MBZ A;  4GHI A;  3UE3 A;  3LIE A;  3ICY A;  3GR2 A;  3IQA A;  4QJG A;  3DTM A;  4X1L A;  3ZNY A;  5J3W A;  3GDI A;  2VV7 A;  2EWW A;  1ZC2 A;  2OSU A;  1BZA A;  1PI4 A;  1YM1 A;  3IH8 A;  5A8B A;  2AVX A;  1NYY A;  1P0Z A;  2H5S A;  3A3F A;  3T1Q B;  4GN2 A;  1SHV A;  1Z6F A;  1VB6 A;  1E4D A;  1Q2Q A;  3VP3 A;  4DKI A;  3VSK A;  3FKW A;  4Y2F A;  2OWH A;  2EX2 A;  1N9O A;  3A0S A;  1ZHH B;  1VM1 A;  5HFO A;  3UPP A;  4UEY A;  3S1Y A;  4Y7P A;  2M7U A;  3LEZ A;  3T1S A;  4YOF A;  3PBN A;  1F98 A;  1N9B A;  3HUN A;  3PAG A;  4P6Z S;  1W8Y A;  4Q8I A;  1NZO A;  3MQQ A;  4JGP A;  1EWZ A;  5DTT A;  3NJA A;  5HWV A;  1UWP X;  4HH2 A;  1DJC A;  4UQI S;  4QY5 A;  2L1M A;  3IF6 B;  3JPU A;  2WGI A;  3LI9 A;  3BEC A;  4HNB A;  3VP1 A;  1FR1 A;  2NUT C;  1RGZ A;  2HP5 A;  3GTC A;  2VK3 A;  4WEL A;  3BFD A;  1XJ2 A;  3NDG A;  3UY6 A;  4RA7 A;  3NCK A;  3LFV A;  1KDW A;  2C6W B;  4QWO A;  1T19 A;  3PBO A;  3BM6 A;  2ZJ9 A;  5CTM A;  1AXB A;  2ZC5 B;  1LL8 A;  3UN7 A;  3D4F A;  4PM9 A;  2HDQ A;  1YPR A;  4HBT A;  1VEU A;  2V2F F;  4NXG A;  1ES2 A;  3H7W A;  2O9B A;  4JGQ A;  2YKH A;  5AJG A;  2EA9 A;  1OTI A;  1IKG A;  3IX4 A;  3ZG8 B;  2JKF A;  2JN7 A;  1RP5 A;  5C5K A;  1HTZ A;  4FSF A;  4IHQ A;  4LRY C;  4II7 A;  4U3T A;  4C3Q A;  5GLD A;  3CWF A;  4LPZ A;  2OAP 1;  4BWI A;  4NG2 A;  3FG8 A;  1HD8 A;  1K4E A;  2P74 A;  5EVE A;  1XPB A;  2JHE A;  5EOE A;  5TFQ A;  4HOI A;  3S7Q A;  2OLU A;  5K5B A;  3RTY A;  3RXW A;  5EV0 A;  3IXB A;  4DRT A;  1OT9 A;  3C8C A;  4I3I A;  2FFF B;  4N9L A;  1ESI A;  1JTG A;  4E3K A;  4IVI A;  4OOM A;  4OQ0 A;  3Q82 A;  4OPQ A;  4N1H A;  1SKO A;  5FQ9 A;  1LI9 A;  2GDN A;  5HL6 A;  4PPR A;  1L0D A;  4X69 A;  1ES5 A;  2Q9N A;  1K57 A;  4GDB A;  5F1G A;  1BLS A;  5HD3 A;  5FQM A;  3C7V A;  1P9R A;  5DJU A;  2EFU A;  4KUK A;  2DMW A;  4S2L A;  3I7J A;  5TBM B;  2O9C A;  4GOG A;  1ACF A;  4PM6 A;  2W0N A;  4R4R A;  3LI8 A;  4BMW A;  1VQQ A;  3QP4 A;  3VP0 A;  2GZA A;  1GHI A;  4ZTK A;  5EUA A;  1YLP A;  1TD5 A;  2K2N A;  5F5Y A;  4ZBE A;  2J3W A;  5HAQ A;  4UQI M;  4OOY A;  5GLA A;  5FDH A;  1DJB A;  3KO6 A;  3FPW A;  4ZJ1 A;  4WEK A;  1XKZ A;  4GD6 A;  2XEP A;  4X68 A;  4Y0T A;  2QHK A;  1W79 A;  1BLP A;  3WRZ A;  5CEB A;  5JYO A;  2LB9 A;  2R9X A;  4NKP A;  1U60 A;  1ERQ A;  1BUL A;  2WKH A;  3JVU A;  3OPR A;  3E98 A;  1HVB A;  4F94 A;  1JWP A;  3IHA A;  1YQS A;  2VGJ A;  2Y2J A;  1WYC A;  3LGO A;  1DP8 A;  2V1Z A;  5F83 A;  3CAX A;  2HP6 A;  1O07 A;  1SKF A;  1SDN A;  1Y28 A;  4Q0J A;  2L4R A;  2I72 A;  3V39 A;  4OQI A;  2PR6 A;  1K25 A;  3OZH A;  2ZOI A;  3M2K A;  2V1B A;  3OCN A;  3BW6 A;  2E8I A;  2XDM A;  4KZ6 A;  1NXY A;  1K54 C;  4CLC E;  4WL9 A;  4I39 A;  5FAS A;  1T1A A;  3SS5 A;  2H0T A;  1ODV A;  3VOL A;  5M19 A;  4WYY A;  2PHY A;  1JWZ A;  2VX8 A;  2FH5 A;  5AQ7 A;  2CMN A;  3MQ0 A;  4EW7 A;  2VJW A;  3VP4 A;  4IUK A;  3V3R A;  3T1R A;  3SH9 A;  2Y2N A;  2RCX A;  3U2A A;  1Z09 A;  3WS1 A;  2V8C A;  4NK3 A;  3BJN A;  1K54 A;  4DE1 A;  2XR0 A;  3ZCZ A;  1MWU A;  4E3L A;  3E4O A;  5FDS A;  2EX6 A;  5HAP A;  4OPZ A;  1E3U A;  2QZ6 A;  3G32 A;  5LBR A;  2ZMF A;  5HW3 A;  4R23 A;  2VGL S;  3HVF A;  3LY4 A;  4BJP A;  4NEE D;  2X02 A;  4E04 A;  3NIA A;  3PXP A;  3F1O A;  2Y2M A;  1S66 L;  4O7D A;  2IA2 A;  1BTL A;  3CJM A;  3MQO A;  4E3N A;  1NWZ A;  3OPP A;  5EVI D;  4KQD A;  3P98 A;  4O8G A;  4X56 A;  2EWV A;  1FCO A;  2FZ0 A;  1K6S A;  1K4F A;  1PRQ A;  2ZQD A;  4OLD A;  4X53 A;  2EX9 A;  5I94 A;  3DBA A;  5E2F A;  2VEA A;  1YAX A;  3LO7 A;  3N7W A;  4X6T A;  1GSX A;  1YLZ A;  4ZDX A;  2PYR A;  2V20 A;  4G3W A;  4N9K A;  5DFY A;  3IT9 A;  3PTE A;  5KMW A;  3E0Y A;  2P9V B;  2ZC7 A;  3CPT A;  5F82 A;  3IXG A;  3T1X A;  3PBS A;  3DTE A;  2PU4 A;  3WWX A;  1OTE A;  2PT7 A;  2HPB A;  2ZQC A;  3HLC A;  4MN6 A;  3V67 A;  1YLW A;  3L9K A;  2DNS A;  4OQH A;  4Y0O A;  1BUE A;  2P08 A;  4CLC A;  2W3H A;  2XRO A;  4OPR A;  3UME A;  5BOH A;  1OJG A;  1CEF A;  2Y2K A;  4LCM A;  4EQI A;  1TF1 A;  1NYM A;  3V50 A;  4WZ5 A;  2W3E A;  5CGX A;  3MFD A;  1KE0 A;  3MR0 A;  2V0W A;  2XSS A;  4HBU A;  1YLT A;  1G28 A;  3NUL A;  3WRT A;  3HCY A;  3EWK A;  4PKY G;  3FZC A;  3MXQ A;  4FH4 A;  2MJ6 A;  4BLM A;  2XQZ A;  1L3L A;  4KZ8 A;  3IWO A;  4GDN A;  3BY9 A;  5TBM A;  2UWX A;  3H82 B;  1TS6 A;  2D01 A;  2B02 A;  3C7U A;  2XFS A;  3T4Q A;  2WYX A;  2PYP A;  3UB5 P;  3S7P A;  2IWD A;  2A2L A;  2WGW A;  2XF3 A;  4EQ1 A;  1S0W A;  1NRJ A;  4E6W A;  3SH7 A;  1W63 M;  1ZKJ A;  4B4X A;  3Q07 A;  4BBU A;  2YKF A;  1ESU A;  3MXR A;  4B4Z A;  5EOO A;  3JYI A;  3WS5 A;  3WS4 A;  4EU0 A;  1BYW A;  1MWT A;  3ZHH A;  3MFX A;  4Q0H A;  4B93 A;  1MKM A;  3E4Q A;  3HRE A;  3UNW A;  4FTX A;  5KSC A;  3L7H A;  5FAT A;  3NY4 A;  3G35 A;  2K31 A;  3PHY A;  4YIN A;  1XJ4 A;  3UB8 A;  1PWC A;  2PDR A;  5J4E A;  3LY3 A;  2Q9M A;  3GMW A;  3LR4 A;  5AQ9 A;  1G5U A;  3S7N A;  3CIT A;  4UA6 A;  5A91 A;  4N1X A;  2VGK A;  2P7J A;  3IX8 A;  1IFQ A;  2JE5 A;  2Z6D A;  3ZDJ A;  2Y2Q A;  4KZ9 A;  4CQH A;  2WAD A;  3W4Q A;  4HQA A;  2INW A;  3G2Y A;  3C4O A;  4Y3I A;  3TRC A;  1DY6 A;  4GLQ A;  4S2O A;  5CXW A;  1IEL A;  2G2U A;  3EQU A;  3Q81 A;  5FQQ A;  3WS2 A;  5FAO A;  3QHY A;  2A3U A;  5KIZ A;  2EXA A;  4ARZ B;  2HZ5 A;  2OAQ 1;  4FD8 A;  2XA7 M;  1V9Z A;  3VFH A;  4MNR A;  1LHY A;  3Q7V A;  5HAR A;  5A93 A;  5FEG A;  3W4O A;  2XD1 A;  2RL3 A;  4EER A;  4D2O A;  5TGF A;  4KG5 A;  4WZ5 C;  3FKV A;  2BAS A;  3S22 A;  1F9I A;  1JNU A;  2OLV A;  1PFL A;  2PU2 A;  3T4S A;  1LSV A;  3C4P A;  2PBD P;  3SOI A;  4EUZ A;  4UA7 A;  1SDE A;  1CQA A;  4WN5 A;  5F1F A;  2ZD8 A;  2X71 A;  2G7U A;  4S2J A;  4ARZ A;  3OLO A;  1FCN A;  1I2W A;  3VE3 A;  3O88 A;  1VET B;  4UA9 A;  4BBV A;  1GCE A;  3IHB A;  1PWG A;  4R3J A;  2WKI A;  1M6K A;  3FV7 A;  1LSW A;  3HJI A;  2Q0O A;  1GHM A;  5EVI B;  2QPN A;  3DTI A;  3KSH A;  4B9O A;  5A90 A;  3TW8 A;  2ZLY A;  2W1T B;  5HX9 A;  5L07 A;  4MDZ A;  5I5L A;  3G34 A;  2X01 A;  4E3M A;  4P0M A;  4Z1W A;  5DF9 A;  1DP6 A;  1YMX A;  1H8Z A;  4OH0 A;  3AGE A;  3HLE A;  4BBT A;  4JXW A;  2L0W A;  3KYQ A;  3EGD C;  1MXO A;  2J80 A;  4ZJ2 A;  2XGN A;  4EES A;  4Y17 A;  5HDC A;  1G68 A;  2ZBB A;  4JXV A;  3UE1 A;  2UV0 E;  5GLB A;  4F3L B;  4WUJ A;  5HD5 A;  1TDL A;  1TS7 A;  3HLD A;  3TG9 A;  4BD1 A;  1H0M A;  5AQA A;  3GEC A;  1IEM A;  3FYZ A;  1W7F A;  4HI4 A;  2WKQ A;  2VLG A;  3MKF A;  3TSG A;  2WZX A;  1RCJ A;  1TVF A;  4DF6 A;  3E2K A;  1ZG4 A;  4IVK A;  5KSH A;  3FPV A;  1TDG A;  4L9F A;  4K91 A;  5EFW A;  3S4X A;  3DWZ A;  1NZU A;  1Q2P A;  2W1T A;  4LV2 A;  3BWL A;  3BLS A;  3UPN A;  2XFT A;  1FSW A;  4EV4 A;  3O3V A;  1YSP A;  3CZD A;  3PBR A;  1UGU A;  4HJ4 A;  2W3D A;  4Y13 A;  3W4P A;  4ID4 A;  3NDE A;  3T4T A;  3R7W A;  1CJF A;  1PZO A;  2GX5 A;  3ZQ5 A;  5L2F A;  1FR6 A;  1BLH A;  5J7E A;  1IYQ A;  1E25 A;  3R4K A;  4OLG A;  2QWS A;  3BQA A;  2V8F A;  5U47 A;  3IF6 C;  4ETZ A;  3T4L A;  3PBQ A;  2P9V A;  1S1Z A;  4RVA A;  4M4X A;  4EBL A;  2EFX A;  3O87 A;  3ZG7 B;  2HGV A;  4KEN B;  4OVD A;  2ZQ8 A;  4LV0 A;  1CF0 A;  4WMC A;  5DKK A;  1N4O A;  3VOY A;  3ZVW A;  3RJU A;  2PD8 A;  3U4L P;  3LIB A;  4PHT A;  5GHX A;  4L9G A;  3ZVT A;  3QNB A;  5AVF A;  3N8L A;  2GNX A;  3A3I A;  1FSY A;  1K56 D;  4DJ3 A;  2EXB A;  1S6R A;  3UB6 A;  3A3J A;  1KGG A;  4EET B;  3A3D A;  3FWL A;  4OQG A;  4XT2 B;  5HZH A;  3IS2 B;  3OPL A;  4CLC C;  3NOT C;  1XFN A;  4OP8 A;  1J9M A;  1NJ4 A;  4GCZ A;  5FI6 A;  1XA1 A;  5CTN A;  1RGY A;  4NET A;  1BSG A;  3LYX A;  1KVM A;  1HZO A;  3CI6 A;  3M6H A;  3SH8 A;  4LEN A;  3B47 A;  4GKU A;  3UDF A;  4FCF A;  4L9E A;  5IHV A;  1H8M A;  2Y55 A;  1F5M A;  3HBR A;  4QHC A;  1QMF A;  4HY8 A;  4JXS A;  5JYP A;  4PM8 A;  1T18 A;  1K55 A;  4OOL A;  3MJQ A;  4D60 A;  5IS1 A;  1WA9 A;  3D72 A;  3CUE C;  4MBH A;  3T4J A;  4GS9 B;  1T1B A;  3P09 A;  4NXB A;  1D1J A;  2R78 A;  5CGS A;  3MXS A;  1AWI A;  2VZW A;  2Y59 A;  3RXX A;  2ACG A;  1BLC A;  4Q0I A;  1ERM A;  4KZA A;  5CRF A;  3VP2 A;  4KZB A;  1LL5 A;  1OPX A;  4IJG A;  1CI9 A;  3BFF A;  5E43 A;  1KOU A;  3G6O A;  3W2Z A;  4MN7 A;  4MBK A;  2HP9 A;  4HJ6 A;  3MS6 A;  2HJE A;  4HP4 A;  3ZG0 A;  2VKS A;  1LT0 A;  3NOP C;  1LI0 A;  3CUE A;  3PBT A;  2Y2H A;  1ERO A;  1PYY A;  2G2W A;  4O01 A;  1VEU B;  1FIL A;  1I5Q A;  3ZYT A;  1S67 L;  3UMD A;  1N9N A;  4KG2 A;  2PD7 A;  4S2I A;  3GV9 A;  3K3D A;  3DAV A;  1GSW A;  1D06 A;  5E2G A;  5FEF A;  1OJ5 A;  1ES4 A;  4WLA A;  4IBR A;  3AGF A;  1PW8 A;  1W5D A;  1TS0 A;  3H82 A;  2JKT I;  3HJK A;  3TJZ C;  4DJ2 A;  3N8S A;  1Y54 A;  3C38 A;  4UHU A;  3VV4 A;  3JVV A;  5F68 A;  1FCM A;  1CI8 A;  1GSV A;  2VV8 A;  2ZMV A;  1LL9 A;  2Y2G A;  2W3F A;  1PNE A;  3ISG A;  2HV1 A;  5HPI A;  1KGE A;  2B95 A;  3SZT A;  3NBL A;  4O0P A;  3ULF A;  5G4Y A;  3K3C A;  3BQ8 A;  3C5A A;  2Y2P A;  3IF6 A;  5GHZ A;  4HEF A;  3IWQ A;  2VA0 A;  5TJJ A;  2VV6 A;  2Y8H A;  3A3E A;  2ZL1 B;  1TEM A;  2JKG A;  5CHJ A;  4KUO A;  3IS2 A;  5HDS A;  3LR3 A;  4I3A A;  4OP5 A;  3HLW A;  5AQB A;  2XK1 A;  1G6O A;  5CER A;  2Z2M B;  3IWI A;  4C75 A;  1IYO A;  2HJ9 C;  2HDS A;  5G18 A;  1CEG A;  1JVJ A;  4PM5 A;  4R3A A;  3IXD A;  3R7W B;  4R38 A;  4DE3 A;  2ZM2 A;  3VOZ A;  4LRZ E;  3WS0 A;  2Y4A A;  5EVI A;  3F1P B;  4KZ3 A;  2ZQ9 A;  2XA7 S;  4ZRR A;  1L0F A;  2WKE A;  2P04 A;  4WZ4 A;  2IWC A;  1MZU A;  3Q7Z A;  1MKI A;  4KZ5 A;  4LRX C;  5TR7 A;  4LGW A;  4H8R A;  2Z6C A;  2ZC6 B;  3MKE A;  4JF5 A;  4MLL A;  4EEU A;  4DXC A;  4PKY A;  4XT2 A;  3E4P A;  5GHY A;  3H9W A;  4BL2 A;  3UDI A;  4G3V A;  4FH2 A;  3GSG A;  3UPO A;  4P85 A;  4WBG A;  1EI5 A;  3NI9 A;  1PIO A;  3HUM A;  1IYS A;  2WGW B;  4E3I A;  4S2P A;  3BRM A;  4C6Y A;  1D7E A;  3C2W A;  3LIA A;  1UWN X;  1MBL A;  3KYE A;  1YKD A;  2HDU A;  5CEC A;  3O86 A;  1OT6 A;  5GL9 A;  4EWF A;  3T12 B;  1XX2 A;  1ALQ A;  3E2L A;  2PAV P;  4EBP A;  1KGF A;  1P9W A;  1MC0 A;  4Y15 A;  4GS9 A;  2Y91 A;  1YLJ A;  1K0K A;  2WKR A;  4OKP A;  3G2Z A;  2WK0 A;  1XJ6 A;  4EUV A;  1S1Y A;  5FSR A;  3HL9 A;  2M7V A;  2J9P A;  4LV1 A;  2OOL A;  3TOI A;  3MZE A;  1TS8 A;  2E8J A;  2JKR M;  4GJ4 A;  4H6J B;  4RX3 A;  1ZG6 A;  5M1A A;  2O99 A;  5EVI C;  3F1N A;  4RQ9 A;  3ZG5 A;  3V5M A;  2R9W A;  2ZMA A;  5DTK A;  1S4S A;  4DMZ A;  4I3J A;  3QP5 A;  4IED A;  4FUW A;  4JKT A;  2H10 A;  4DXB A;  4CJN A;  2A24 B;  1ONG A;  2OWJ A;  4NXF A;  2O0Y A;  3G31 A;  3HLB A;  1W8Q A;  3SW1 A;  4MBF A;  4PM7 A;  1GA9 A;  4F3L A;  4QPR A;  2WAF A;  4IUH A;  4GW9 A;  2FFY A;  1KVL A;  1SCW A;  4MEZ A;  3HUO A;  3G30 A;  4ZJ3 A;  4GHI B;  5DTS A;  4DDY A;  1IKI A;  1LSX A;  1OTA A;  1NLY A;  3OPH A;  5HL1 A;  3UO9 A;  3UDX A;  4BQM A;  5IU1 A;  4M3K A;  5G4Z A;  3B3X A;  4HP9 A;  2JKR I;  4LV3 A;  4PMA A;  1I2S A;  3V3S A;  3CG5 A;  3TE8 A;  2V9A A;  3NEC A;  1IYP A;  4GD8 A;  4DDS A;  1SKO B;  1OTD A;  3LCE A;  2J8Y A;  5E2E A;  3EOI A;  1W63 Q;  1N9L A;  3RH8 B;  2Y2I A;  2H0Y A;  4JXG A;  4MCW A;  5FQI A;  5FI7 A;  4R0Q A;  4RX2 A;  2HF6 A;  2WAE A;  3N8R A;  2HDR A;  1IOU A;  2QJ5 A;  4RYE A;  2XRN A;  5HPF A;  3UB7 A;  2O9A A;  3Q7V B;  3S7O A;  4H6J A;  5FA7 A;  4X1M A;  3LR0 A;  2ZL1 A;  4KZ4 A;  1OME A;  4ME4 A;  5FI2 A;  4HIA A;  3BFG A;  1K55 C;  2BLS A;  1FIK A;  1M40 A;  4EBN A;  2PRF A;  5EPH A;  3H7W B;  3CPT B;  1T1C A;  4E6X A;  5F69 A;  3BYD A;  3B33 A;  1F2K A;  2KX6 A;  1VHM A;  1FOF A;  4QU3 A;  3QP8 A;  5HWW A;  3K2N A;  5E2H A;  1Y4O A;  4N92 A;  1PZP A;  3VSL A;  5AVE A;  2J3T C;  2CC1 A;  1NY0 A;  4P6B A;  3PAE A;  2M1C A;  2ZC3 B;  3BY8 A;  2QYB A;  5CED A;  2D02 A;  4G3K A;  3T4K A;  5DF8 A;  3OOV A;  3W8K A;  4K0W A;  1KDS A;  3CHW P;  2WUQ A;  4KG6 A;  3GVB A;  1EW0 A;  3A0V A;  4YFM A;  1L0G A;  3LIC A;  1A0K A;  5KZH A;  5CHU A;  2OV5 A;  2W27 A;  3UB9 A;  2VGL M;  2KLI A;  4DE0 A;  4KQR A;  5CX7 A;  5FL3 A;  3DTK A;  5HDD A;  3QP1 A;  2W3G A;  4CLC D;  2KDK A;  3BFC A;  1ES3 A;  3OCL A;  5EVL A;  4KQQ A;  3BEB A;  3ZG9 B;  1O7E A;  3MZF A;  4QY6 A;  4YWZ A;  3IXH A;  3NC8 A;  3B42 A;  4R1G A;  2H28 A;  4R70 A;  1G6A A;  3D9Y A;  1HLU P;  5HAI A;  3HLF A;  2LB5 A;  1JWV A;  4LCL A;  3KSI A;  4BD0 A;  5FAP A;  5EM0 A;  2Y2O A;  4NXE A;  4CLC B;  1J3W A;  3PR6 A;  4UAA A;  5DFX A;  5L09 A;  2EX8 A;  3MSH A;  3DW0 A;  5CGW A;  2DRW A;  4Z9Q A;  3G4P A;  2KOI A;  1STZ A;  5L10 A;  4L0L A;  1GHP A;  3SS4 A;  1WYB A;  4GZB A;  4IBX A;  4PAU A;  4I38 A;  1ONH A;  3LIF A;  1DP9 A;  5FQK A;  4GNU A;  3QNC A;  4ETX A;  4WEJ A;  2NUP C;  5HSQ A; 
#chains in the Genus database with same CATH homology
 1IYO A;  1MWS A;  4WM9 A;  4JBF A;  1LI9 A;  3QHY A;  4X55 A;  5FQ9 A;  2GDN A;  2A3U A;  2HDS A;  2EXA A;  4BL3 A;  5G18 A;  1CEG A;  1JVJ A;  4PM5 A;  4FD8 A;  4PPR A;  1L0D A;  3IXD A;  4X69 A;  5FAQ A;  3VFH A;  4XUZ A;  4DE3 A;  2ZM2 A;  3VOZ A;  4MNR A;  1ES5 A;  1LHY A;  1K57 A;  2Q9N A;  3Q7V A;  4GDB A;  5F1G A;  5HAR A;  1BLS A;  2DCF A;  1YLY A;  5FQM A;  3WS0 A;  3C7V A;  4S2N C;  2Y4A A;  3IF5 A;  5EVI A;  5A93 A;  3ZNT A;  4KZ3 A;  2EFU A;  2ZQ9 A;  1E3U D;  1MWR A;  3W4O A;  4S2L A;  3I7J A;  2XD1 A;  2PBY A;  2RL3 A;  4OPY A;  4GOG A;  4D2O A;  4PM6 A;  4Y0U A;  5TGF A;  1L0F A;  4R4R A;  2WKE A;  1VQQ A;  5EEC A;  1DJA A;  3CMZ A;  4KG5 A;  4WMC D;  3VP0 A;  4WZ4 A;  4XXR A;  4A5R A;  2IWC A;  1L2S A;  4WZ5 C;  3FKV A;  1GHI A;  2C5W B;  5EUA A;  1YLP A;  5DF7 A;  4ZTK A;  3S22 A;  2OLV A;  4ZBE A;  5HAQ A;  1BT5 A;  2XH9 A;  2ZM8 A;  3OC2 A;  4DE2 A;  4OOY A;  3Q7Z A;  1MKI A;  1MPL A;  1YT4 A;  2PU2 A;  4KZ5 A;  5GLA A;  5FDH A;  5TR7 A;  1XXM A;  3C4P A;  1DJB A;  3SOI A;  4EUZ A;  4ZJ1 A;  5J8X A;  4E3J A;  4HES A;  4UA7 A;  4WEK A;  1GA0 A;  1PW1 A;  1SDE A;  1XKZ A;  4H8R A;  4GD6 A;  2XEP A;  2ZD8 A;  2X71 A;  2XLN A;  4X68 A;  4Y0T A;  1W79 A;  1BLP A;  2ZC6 B;  5F1F A;  4S2J A;  3WRZ A;  3MZD A;  4CPK A;  3MKE A;  4JF5 A;  1FCN A;  5CEB A;  5JYO A;  4MLL A;  4E3O A;  1I2W A;  4DXC A;  2R9X A;  5CHM A;  3ITA A;  1PI5 A;  3O88 A;  4S2N A;  1FQG A;  4UA9 A;  5GHY A;  1U60 A;  3BFE A;  4BL2 A;  1GCE A;  1ERQ A;  1BUL A;  2WKH A;  3IHB A;  3OPR A;  4F94 A;  1HVB A;  3UDI A;  1JWP A;  1PWG A;  3IHA A;  4FH2 A;  4R3J A;  2WKI A;  2ZQ7 A;  3GSG A;  1YQS A;  2VGJ A;  3UPO A;  4P85 A;  2Y2J A;  1M6K A;  1WYC A;  3FV7 A;  1XP4 A;  4WBG A;  1EI5 A;  2V1Z A;  3NI9 A;  1PIO A;  1GHM A;  3HUM A;  5F83 A;  2HP6 A;  1IYS A;  1O07 A;  3M6B A;  2QPN A;  5EVI B;  1SKF A;  2WGW B;  1SDN A;  3N6I A;  4E3I A;  4S2P A;  3BRM A;  4C6Y A;  4K0X A;  2J9O A;  4QB8 A;  2Y2L A;  1XA7 A;  4ZAM A;  5A90 A;  2ZLY A;  5HX9 A;  2I72 A;  3V39 A;  1CK3 A;  1H5X A;  4OQI A;  3M2J A;  1K25 A;  3OZH A;  3M2K A;  3G34 A;  1MBL A;  3N4I A;  2X01 A;  4E3M A;  5M18 A;  4P0M A;  3OCN A;  1KE3 A;  2HDU A;  5DF9 A;  5CEC A;  4KQO A;  2E8I A;  3O86 A;  5GL9 A;  1YMX A;  5EE8 A;  2XDM A;  3EQV A;  4KZ6 A;  1H8Z A;  4B88 A;  4OH0 A;  3AGE A;  1XX2 A;  4EWF A;  1ALQ A;  1XGI A;  1NXY A;  3E2L A;  3HLE A;  1K54 C;  2JC7 A;  4EBP A;  4JXW A;  5FAS A;  1H8Y A;  1KGF A;  1MY8 A;  3SS5 A;  4R3B A;  2H0T A;  1MXO A;  5M19 A;  4WYY A;  2Y91 A;  1K57 C;  5DVA A;  1YLJ A;  4OKP A;  1JWZ A;  4ZJ2 A;  2XGN A;  3Q1F A;  3G2Z A;  2WK0 A;  5AQ7 A;  3SS3 A;  1G68 A;  3VP4 A;  5FQJ A;  4JXV A;  5FSR A;  1KE4 A;  3UE1 A;  2J7V A;  3V3R A;  3HL9 A;  1K6R A;  4P87 A;  2J9P A;  5GLB A;  3SH9 A;  2WZZ A;  1L0E A;  4LV1 A;  2Y2N A;  2RCX A;  3TOI A;  3MZE A;  4OON A;  5GLC A;  3WS1 A;  1TDL A;  4RX3 A;  3HLD A;  3TG9 A;  1ZG6 A;  4BD1 A;  2BG1 A;  4NK3 A;  1JTD A;  5AQA A;  3ZGA B;  2JCH A;  1K54 A;  1IEM A;  1QME A;  3FYZ A;  4DE1 A;  1W7F A;  2XR0 A;  2ZQA A;  2IWB A;  5M1A A;  1MWU A;  5EVI C;  3MKF A;  3UE0 A;  3TSG A;  2WZX A;  3ZCZ A;  1RCJ A;  1TVF A;  4DF6 A;  3E2K A;  4E3L A;  1ZG4 A;  2ZM0 A;  4IVK A;  5KSH A;  3ZG5 A;  1TDG A;  2EX6 A;  4U0X A;  4K91 A;  5HAP A;  4OPZ A;  3S4X A;  3DWZ A;  3V5M A;  2R9W A;  2ZMA A;  1NZU A;  1C3B A;  2WGV A;  1E3U A;  1Q2P A;  5DTK A;  2QZ6 A;  3G32 A;  4LV2 A;  3BLS A;  1WE4 A;  3UPN A;  2XFT A;  3ITB A;  1FSW A;  4IED A;  3O3V A;  4JF4 A;  4JPM A;  4XUX A;  4JKT A;  4EV4 A;  2H10 A;  3CZD A;  3PBR A;  4KZ7 A;  4DXB A;  5HW3 A;  4R23 A;  4CJN A;  2QMI A;  3W4P A;  4ID4 A;  3HVF A;  3NDE A;  3LY4 A;  4BJP A;  1ONG A;  2X02 A;  1PZO A;  3NIA A;  1K38 A;  2Y2M A;  5L2F A;  3ZFZ A;  4O7D A;  1FR6 A;  3G31 A;  1BLH A;  3HLB A;  1BTL A;  1W8Q A;  3CJM A;  4MBF A;  4PM7 A;  1IYQ A;  1E25 A;  4OLG A;  5D3O A;  2JBF A;  3DWK A;  1GA9 A;  4E3N A;  5U47 A;  3IF6 C;  2WAF A;  3OPP A;  5EVI D;  1K56 A;  3P98 A;  1YMS A;  2Z2L B;  3PBQ A;  2P9V A;  3HLG A;  2FFY A;  4X56 A;  1FCO A;  3GQZ A;  1KVL A;  4RVA A;  1K6S A;  1K4F A;  1NRF A;  4EBL A;  2ZQD A;  1SCW A;  2EFX A;  4MEZ A;  4R4S A;  3O87 A;  3ZG7 B;  4KEN B;  4WMC A;  4OVD A;  2ZQ8 A;  4LV0 A;  3HUO A;  3VOY A;  4JLF A;  1N4O A;  4OLD A;  3G30 A;  2EX9 A;  4X53 A;  4ZJ3 A;  3RJU A;  5I94 A;  5E2F A;  5DTS A;  5GHX A;  3LO7 A;  3N7W A;  4DDY A;  1PWD A;  4X6T A;  1IKI A;  3ZVT A;  3IH9 A;  1YLZ A;  4JF6 A;  3OPH A;  3QNB A;  4ZDX A;  5HL1 A;  3N8L A;  3UO9 A;  3UDX A;  4GB7 A;  4S2M A;  1XGJ A;  3BLM A;  4BEN A;  2A49 A;  2V20 A;  3ZVW A;  4BQM A;  3VFF A;  4N9K A;  2ZC4 B;  3A3I A;  4M3K A;  2XD5 A;  3VMA A;  5A92 A;  3B3X A;  1FSY A;  1K56 D;  3IT9 A;  2EXB A;  1S6R A;  4LV3 A;  3A3J A;  1KGG A;  3PTE A;  5KMW A;  3A3D A;  3FWL A;  4OQG A;  1LLB A;  4PMA A;  1I2S A;  2P9V B;  2ZC7 A;  3AGD A;  5F82 A;  3IXG A;  3OPL A;  3V3S A;  3PBS A;  3CG5 A;  3GRJ A;  4OP8 A;  1J9M A;  1NJ4 A;  2PU4 A;  5FI6 A;  1IYP A;  1XA1 A;  5CTN A;  3WWX A;  1RGY A;  4QD4 A;  4NET A;  1BSG A;  1KVM A;  1HZO A;  2HPB A;  4GD8 A;  2ZQC A;  2B5R A;  3M6H A;  3HLC A;  4DDS A;  4U0T A;  1YLW A;  3LCE A;  2DNS A;  4S2K A;  3SH8 A;  4OQH A;  2J8Y A;  4Y0O A;  1BUE A;  4LEN A;  5E2E A;  3MBZ A;  3UE3 A;  4GKU A;  3UDF A;  4FCF A;  5IHV A;  4OPR A;  5BOH A;  2Y55 A;  1CEF A;  3GR2 A;  2Y2I A;  2H0Y A;  3IQA A;  2Y2K A;  4JXG A;  5FI7 A;  4R0Q A;  4LCM A;  5FQI A;  3DTM A;  4EQI A;  4QJG A;  4RX2 A;  2WAE A;  3HBR A;  4QHC A;  3N8R A;  1NYM A;  3V50 A;  4WZ5 A;  1QMF A;  3ZNY A;  4JXS A;  5JYP A;  4PM8 A;  5CGX A;  1K55 A;  3MFD A;  2HDR A;  4OOL A;  1KE0 A;  1ZC2 A;  2OSU A;  4RYE A;  1BZA A;  1PI4 A;  3Q7V B;  4HBU A;  1YM1 A;  3IH8 A;  1YLT A;  5FA7 A;  1NYY A;  2H5S A;  4KZ4 A;  1OME A;  4MBH A;  3WRT A;  3A3F A;  3P09 A;  5FI2 A;  4GN2 A;  1SHV A;  5CGS A;  1Z6F A;  3FZC A;  4FH4 A;  3BFG A;  1K55 C;  4BLM A;  1E4D A;  1Q2Q A;  2XQZ A;  3MXS A;  3VP3 A;  2BLS A;  3VSK A;  1M40 A;  4DKI A;  2Y59 A;  3RXX A;  3FKW A;  5EPH A;  4EBN A;  2EX2 A;  1BLC A;  4E6X A;  3BYD A;  4KZ8 A;  1ERM A;  4KZA A;  1FOF A;  3IWO A;  1VM1 A;  4QU3 A;  5HFO A;  5CRF A;  3VP2 A;  4KZB A;  3UPP A;  4GDN A;  3S1Y A;  1LL5 A;  5E2H A;  1CI9 A;  3BFF A;  4Y7P A;  3LEZ A;  2UWX A;  5E43 A;  4N92 A;  1PZP A;  3C7U A;  3PBN A;  3VSL A;  2XFS A;  1N9B A;  2WYX A;  3HUN A;  2CC1 A;  4MBK A;  1NY0 A;  2HP9 A;  3PAG A;  1W8Y A;  4P6B A;  4Q8I A;  1NZO A;  3ZG0 A;  1EWZ A;  5DTT A;  3PAE A;  2ZC3 B;  1LI0 A;  5CED A;  3PBT A;  2Y2H A;  1ERO A;  1PYY A;  2IWD A;  2WGW A;  2XF3 A;  1DJC A;  4QY5 A;  5DF8 A;  3W8K A;  2G2W A;  4K0W A;  1S0W A;  1KDS A;  3IF6 B;  1I5Q A;  2WGI A;  3BEC A;  3VP1 A;  1FR1 A;  4E6W A;  2WUQ A;  1RGZ A;  2HP5 A;  3GTC A;  4KG6 A;  3SH7 A;  1ZKJ A;  3GVB A;  4KG2 A;  4S2I A;  4WEL A;  3GV9 A;  3BFD A;  4B4X A;  4YFM A;  1L0G A;  3NDG A;  3Q07 A;  5E2G A;  3UY6 A;  5KZH A;  5CHU A;  4RA7 A;  1ES4 A;  2OV5 A;  1ESU A;  3NCK A;  3MXR A;  4B4Z A;  1KDW A;  2C6W B;  4IBR A;  3AGF A;  1PW8 A;  5EOO A;  4DE0 A;  4KQR A;  3PBO A;  1W5D A;  3JYI A;  3BM6 A;  2ZJ9 A;  3WS5 A;  5CTM A;  3WS4 A;  1AXB A;  2ZC5 B;  1MWT A;  3N8S A;  3ZHH A;  1Y54 A;  3UN7 A;  3D4F A;  3BFC A;  1ES3 A;  3OCL A;  4UHU A;  4PM9 A;  5EVL A;  1FCM A;  1CI8 A;  4KQQ A;  3BEB A;  2HDQ A;  4HBT A;  3ZG9 B;  1O7E A;  2V2F F;  3MZF A;  4QY6 A;  3IXH A;  1ES2 A;  1LL9 A;  3HRE A;  3UNW A;  2Y2G A;  3NC8 A;  4R1G A;  1G6A A;  5KSC A;  3ISG A;  5HAI A;  5FAT A;  1KGE A;  1IKG A;  3NY4 A;  3HLF A;  3ZG8 B;  3G35 A;  3NBL A;  1JWV A;  1RP5 A;  4LCL A;  4YIN A;  4BD0 A;  5FAP A;  1HTZ A;  2Y2O A;  3C5A A;  4FSF A;  1PWC A;  2Y2P A;  3IF6 A;  4U3T A;  4C3Q A;  3LY3 A;  5GHZ A;  2Q9M A;  3GMW A;  5GLD A;  4UAA A;  5AQ9 A;  4HEF A;  3IWQ A;  1HD8 A;  1K4E A;  2EX8 A;  4UA6 A;  3DW0 A;  2P74 A;  2DRW A;  5CGW A;  4Z9Q A;  1XPB A;  3G4P A;  5EOE A;  5TFQ A;  3A3E A;  5A91 A;  4N1X A;  2OLU A;  1TEM A;  2VGK A;  5CHJ A;  4L0L A;  3ZDJ A;  2JE5 A;  1GHP A;  3SS4 A;  2Y2Q A;  3RXW A;  4KZ9 A;  1WYB A;  4GZB A;  3IXB A;  4DRT A;  4IBX A;  2WAD A;  3W4Q A;  4OP5 A;  3HLW A;  5AQB A;  2XK1 A;  1ONH A;  2FFF B;  4N9L A;  1ESI A;  3G2Y A;  3C4O A;  1JTG A;  1DY6 A;  5CXW A;  4S2O A;  5FQK A;  4GNU A;  4E3K A;  3QNC A;  1IEL A;  2G2U A;  5CER A;  2Z2M B;  3EQU A;  3IWI A;  3Q81 A;  4IVI A;  4OQ0 A;  4OOM A;  5FQQ A;  3Q82 A;  3WS2 A;  4WEJ A;  4OPQ A;  4C75 A;  5FAO A;  4N1H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...