3G2ZA

Ctx-m-9 class a beta-lactamase complexed with compound 2 (gz2)
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
262
structure length
262
Chain Sequence
b'TSAVQQKLAALEKSSGGRLGVALIDTADNTQVLYRGDERFPMCSTSKVMAAAAVLKQSETQKQLLNQPVEIKPADLVNYNPIAEKHVNGTMTLAELSAAALQYSDNTAMNKLIAQLGGPGGVTAFARAIGDETFRLDRTEPTLNTAIPGDPRDTTTPRAMAQTLRQLTLGHALGETQRAQLVTWLKGNTTGAASIRAGLPTSWTAGDKTGSGDYGTTNDIAVIWPQGRAPLVLVTYFTQPQQNAESRRDVLASAARIIAEGL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactamase CTX-M-9a
publication title Molecular docking and ligand specificity in fragment-based inhibitor discovery
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase/hydrolase inhibitor
total genus 93
structure length 262
sequence length 262
chains with identical sequence B
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2009-02-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 3g2zA00
1PWDA 3G30A 4OQHA 5FI7A 3N8SA 2BG1A 1H8YA 4YINA 3VSLA 5GHXA 4LCMA 2DNSA 5HX9A 4WEJA 3PBTA 4RVAA 4DE3A 5CEDA 3BM6A 4NK3A 4JF5A 5D3OA 3HUMA 5EE8A 2WGWB 2BLSA 4OONA 2JCHA 5CXWA 1GHMA 2C6WB 1VQQA 1ESIA 2UWXA 3GV9A 3VMAA 4X56A 4JXGA 3N8LA 2Y2NA 1EWZA 3O87A 5F83A 1KGEA 5DF7A 3GVBA 1CI8A 3SS5A 3M6BA 2EXAA 2C5WB 3Q07A 4OH0A 3UE1A 1NJ4A 4LV0A 1LL9A 3PAGA 4OQGA 3WRTA 5DTSA 3A3DA 2WKHA 4DE1A 2HP6A 4E3MA 4HBTA 3ZNYA 4OKPA 1KVLA 4P85A 3WWXA 4DKIA 4LV1A 3IH9A 2VGKA 1YQSA 3IF6B 4RYEA 5TFQA 1N4OA 3AGEA 3FV7A 1Q2QA 3N6IA 4DXBA 2ZQ8A 2ZM0A 3V50A 1IEMA 3BECA 3NBLA 3PTEA 5CTMA 5FQMA 1I5QA 5CGXA 1K56A 4U0XA 3V3RA 1Q2PA 4BQMA 1M40A 3HLWA 4E3NA 3RJUA 4EV4A 1XXMA 3A3FA 2ZQDA 2DRWA 2EFXA 3MBZA 3A3JA 4JF4A 5GLCA 1H8ZA 5BOHA 1ERQA 3BFDA 4XUXA 1QMFA 1C3BA 4OPYA 1NZUA 3WS4A 2RCXA 4ID4A 5J8XA 3Q81A 3FKVA 1BLPA 1TVFA 5HARA 1BT5A 1FOFA 1KGGA 4WZ5A 5HAPA 1HZOA 3OPPA 1MPLA 2HDUA 3IF5A 4R4RA 3ZG7B 1K4EA 4GD6A 3ZDJA 2Y2OA 3LO7A 5CHJA 2H0TA 1XGJA 3G34A 3G35A 3S4XA 4S2MA 3S22A 4GDBA 3IWQA 2Y2JA 4XUZA 2PBYA 3TOIA 1K38A 1ES3A 4WELA 2RL3A 1PZOA 3ISGA 3MXSA 4KZ5A 5CHUA 5DF8A 5FAPA 2WADA 2G2WA 4FD8A 5EOOA 4D2OA 4A5RA 4C75A 2V2FF 2WKEA 2Y2PA 3C5AA 3FYZA 4EQIA 3C4OA 3PBQA 1ERMA 3HUOA 3PBSA 4S2PA 4BLMA 1CK3A 4P6BA 1LLBA 1DJBA 2ZC5B 4OOLA 4WYYA 2XDMA 3WS5A 4CPKA 1BZAA 4DF6A 5HAQA 4KZ9A 4Q8IA 3BRMA 4KZ4A 2EFUA 3DW0A 5E2FA 1E3UD 2Y55A 3SH8A 1FR1A 3CZDA 1IYPA 1YM1A 2ZJ9A 3UDIA 1EI5A 1FCNA 4E3OA 1JWVA 3D4FA 2ZD8A 4N1XA 4MBFA 2IWBA 1MY8A 3ZGAB 1ALQA 2PU2A 1JWZA 1G6AA 4R1GA 2Z2LB 3G4PA 4KQOA 1K57A 4X53A 3G32A 4OVDA 2OLUA 4GOGA 2R9XA 2ZC3B 4OPQA 5GLBA 3ZHHA 4S2OA 5A93A 4MNRA 4KG6A 4RX3A 1ONGA 2P9VB 4GN2A 2J7VA 3BLMA 4IVKA 4MLLA 5EUAA 5E2EA 2X02A 5DTTA 4PMAA 4X55A 2J8YA 1JTDA 1FSWA 3OCNA 1BLSA 2OLVA 3GSGA 4L0LA 1YLZA 1FCOA 2WZZA 5CHMA 5DVAA 4ZAMA 2XH9A 1K54A 3WS1A 3HLFA 2EX8A 5L2FA 3BEBA 2XQZA 2VGJA 3IWIA 2XF3A 4DE0A 1OMEA 2Y2QA 1LI0A 4LV3A 3Q7VB 3ZG9B 1MXOA 2Y2MA 4HEFA 4HESA 5IHVA 4R3JA 2QMIA 4CJNA 1KE4A 1KVMA 5JYPA 2ZQ7A 4PM5A 1K4FA 1XPBA 3O3VA 3VP4A 2FFFB 1RCJA 5JYOA 4OQ0A 2Q9NA 2WK0A 1FQGA 3CG5A 3BFGA 1Z6FA 3N4IA 3QHYA 1H5XA 2JE5A 1XKZA 1YLYA 4O7DA 1IYOA 1U60A 4UA6A 1FCMA 3OC2A 3V5MA 3AGFA 2HDRA 1E4DA 2XK1A 1ES5A 1RP5A 4PM7A 1K6SA 4N1HA 3EQVA 3LEZA 1KGFA 3W4PA 5F1FA 1YMXA 1K6RA 3NY4A 2HP5A 4FH4A 1TDGA 4KZ3A 4ZJ1A 2XFSA 2QPNA 4WM9A 1NZOA 1PW1A 2H0YA 3DWZA 4ZJ3A 1BTLA 2IWCA 3OCLA 2P74A 4R23A 3W4OA 3I7JA 1PI4A 4S2JA 4X6TA 4B4XA 3FZCA 1DJCA 2WUQA 4P87A 1GA9A 2WKIA 5EVIA 4C3QA 5HW3A 2FFYA 1XGIA 5HAIA 4S2KA 4GKUA 1CI9A 4XXRA 3HREA 3N8RA 1XA7A 1KDWA 2V1ZA 2ZM2A 4M3KA 4R4SA 4DE2A 2JBFA 3NDGA 5GHZA 2Y2IA 2J9OA 3LY4A 1MWSA 3V39A 2Y59A 4WEKA 2CC1A 3VFFA 3UDXA 3BFEA 4OQIA 1ZG4A 1ONHA 2HDQA 3BFCA 4RX2A 4KZ7A 4Y0UA 1W5DA 4MBHA 1S6RA 1GHIA 3MKFA 4S2NA 2V20A 3HBRA 3SH7A 3O88A 1SHVA 4N9KA 3G2ZA 3HLCA 3VOZA 3W4QA 1BLHA 3GR2A 4FCFA 4BD1A 4Y0OA 4DDYA 3A3IA 4E6XA 5GL9A 1L2SA 2WGWA 1I2WA 5KMWA 4X69A 1K55A 1LI9A 2Z2MB 2ZC6B 2JC7A 4KZ8A 5HL1A 5EVLA 3Q7ZA 5GHYA 1PW8A 4ZDXA 4EWFA 3BLSA 3Q7VA 1PWCA 2PU4A 3CJMA 1SDNA 1HD8A 1BUEA 3N7WA 4WZ5C 1YLWA 4PM9A 1MBLA 1YT4A 2H5SA 1GCEA 5DTKA 1YLPA 5KSHA 2XGNA 4WMCD 2WAFA 1NY0A 1TEMA 4OP8A 2Y2HA 3JYIA 1SCWA 3IF6A 3QNCA 4RA7A 5AQ7A 4E3IA 1W79A 3B3XA 1EROA 1PI5A 4GDNA 4OPRA 1HVBA 3TG9A 4E6WA 1ZC2A 1IYQA 3ZVTA 5AQ9A 3MZFA 3P09A 2ZLYA 4E3LA 5CERA 1TDLA 3HLDA 3NCKA 1WE4A 5E43A 3ZNTA 3C4PA 3PBRA 1L0GA 3E2KA 3UDFA 1HTZA 3SOIA 4U3TA 4KZBA 5CGWA 1BULA 5TR7A 3ZFZA 2I72A 1E25A 1JWPA 1WYBA 3MXRA 2ZC7A 3OZHA 1O07A 2HP9A 3UE0A 4BL2A 3M2JA 3MZEA 3ZCZA 1GA0A 5KZHA 1I2SA 3NIAA 3OPLA 4R3BA 2WZXA 4OP5A 3ZVWA 4DDSA 4QB8A 3VP1A 3G31A 1MWTA 2Y2LA 5A92A 1J9MA 3NDEA 4DRTA 4JBFA 3FKWA 2XFTA 3O86A 3IH8A 1RGYA 3Q1FA 2GDNA 4IBRA 3NI9A 2G2UA 4FH2A 1W7FA 3MKEA 5FQIA 1FSYA 1PWGA 1K57C 2ZQ9A 4KQQA 4NETA 5I94A 1YMSA 2IWDA 3VSKA 3IWOA 5M18A 4LENA 4JXSA 1KE3A 5M1AA 3PBOA 1L0EA 1PZPA 4IVIA 5HFOA 1DJAA 3ITAA 3FWLA 1ESUA 4S2IA 2ZM8A 4QY5A 3A3EA 1VM1A 4ZTKA 3UE3A 4N92A 4HBUA 1K56D 5FQKA 4OOYA 3C7UA 3UY6A 1K54C 3HL9A 4ZJ2A 4KG2A 4Y0TA 5FASA 3GTCA 4E3KA 2Y91A 5EVID 4IBXA 1Y54A 3WS2A 5FI2A 3V3SA 3HVFA 4UA7A 3RXXA 4BL3A 4EUZA 2HPBA 4K0XA 4OLGA 4OLDA 4UA9A 1CEFA 3GMWA 4QU3A 3IXBA 4JXVA 3BFFA 5F82A 2OSUA 1BLCA 5EOEA 2HDSA 1IKGA 3SS3A 1QMEA 3GRJA 2XD5A 5A91A 4P0MA 5CRFA 1NYYA 3HLBA 4YFMA 5U47A 1SDEA 2J9PA 4UAAA 3RXWA 3S1YA 4OOMA 1W8QA 4KENB 4H8RA 4IEDA 3E2LA 4KQRA 4EBNA 3WRZA 4LCLA 4BD0A 4FSFA 4JF6A 3G2YA 3BYDA 1ES2A 4PPRA 1WYCA 2WGIA 1JTGA 1DY6A 5FSRA 3UPOA 1PIOA 4C6YA 3Q82A 3SS4A 1ES4A 2P9VA 5E2GA 3SH9A 4B4ZA 4KZ6A 4K0WA 5EVIC 3UPNA 1MKIA 1K25A 4JPMA 4X68A 4OPZA 3CMZA 4LV2A 5DF9A 4QD4A 5EECA 2B5RA 5FI6A 3AGDA 5FAQA 4K91A 4MBKA 2WAEA 4PM8A 1PYYA 3MZDA 1MWRA 4E3JA 4QJGA 4N9LA 3ITBA 4GB7A 2Y2KA 3TSGA 3NC8A 3IHAA 1L0DA 1IKIA 2XEPA 5E2HA 1N9BA 2Y4AA 1JVJA 4QHCA 1XX2A 2A3UA 2ZQCA 3EQUA 1SKFA 5KSCA 3IT9A 3GQZA 1BSGA 5FQ9A 3VFHA 4KZAA 3WS0A 4ZBEA 3HUNA 5FAOA 4S2NC 4MEZA 1G68A 2Y2GA 5F1GA 4GD8A 4Z9QA 5CGSA 4WZ4A 2OV5A 1MWUA 1AXBA 2Q9MA 3MFDA 4S2LA 3W8KA 2WGVA 3IHBA 3IXHA 1K55C 3PAEA 3VP0A 3QNBA 3M6HA 3UNWA 4GZBA 5TGFA 5FDHA 2QZ6A 3DTMA 2XLNA 2E8IA 1FR6A 3VOYA 2EX6A 3ZG0A 3PBNA 2EX9A 1S0WA 1NXYA 1KE0A 1XA1A 4BJPA 4EBLA 3P98A 5AQBA 4B88A 3OPHA 4WBGA 5GLDA 1W8YA 3ZG5A 3VP2A 1L0FA 1ZKJA 3M2KA 1XP4A 2ZMAA 1IYSA 2ZQAA 3DWKA 2H10A 2XD1A 5GLAA 5FA7A 5FQJA 3IF6C 3C7VA 1M6KA 2X01A 3IQAA 1IELA 4DXCA 3VP3A 1RGZA 5G18A 4GNUA 5CTNA 4BENA 2EX2A 3IXGA 1GHPA 3OPRA 5EVIB 4WMCA 3ZG8B 1CEGA 5FATA 5CEBA 1O7EA 1YLTA 4QY6A 5FQQA 3UPPA 1NYMA 5M19A 4UHUA 2WYXA 1YLJA 2ZC4B 5A90A 4KG5A 2DCFA 1KDSA 1LHYA 1NRFA 4PM6A 3IXDA 4R0QA 3UN7A 4Y7PA 3UO9A 4F94A 1ZG6A 2R9WA 5CECA 2X71A 4U0TA 3HLGA 1E3UA 2XR0A 3HLEA 1LL5A 3LY3A 5EPHA 4JKTA 2A49A 5AQAA 4EBPA 2EXBA 4JXWA 3LCEA 4JLFA
chains in the Genus database with same CATH superfamily
2PDRA 4OQHA 2BG1A 3NOPC 3PBTA 3BM6A 4NK3A 1VEUA 4OONA 3A0SA 2C6WB 4UQIS 1ESIA 2PD7A 2Y2NA 1KGEA 4LV0A 1LL9A 4D60A 1LSVA 3BQAA 5FL3A 2WKHA 4E3MA 4HBTA 4OKPA 4LV1A 2V1BA 3UE6A 4RYEA 3C2WA 2Q0OA 2ZM0A 4HJ6A 4AFIA 2V8FA 3NBLA 3PTEA 5FQMA 4R70A 2INWA 3HLWA 4E3NA 3RJUA 4EV4A 2XA7M 2JKTI 3CUEC 3W2ZA 2DRWA 3LYXA 1Y4OA 4M4XA 1KOUA 1VETB 5BOHA 4XUXA 5HWWA 2VLGA 2XSSA 5IS1A 1UGUA 2VGLM 2CMNA 1TVFA 5HARA 3MS6A 3ZG7B 1K4EA 2Y2OA 3LO7A 2H0TA 1XJ6A 1XGJA 4ME4A 1OPXA 1ACFA 1YSQA 4XUZA 3T4OA 1ES3A 3T4TA 4HY8A 5DF8A 1VB6A 4FD8A 5EOOA 3MMHA 4D2OA 3NULA 1ZTUA 2Y2PA 4XT2B 3PBQA 1ERMA 4S2PA 3DTIA 4HP4A 4BLMA 4P6BA 4GS9A 1DJBA 4R6LA 3MF0A 3K3CA 1BYWA 1BZAA 5L8MA 1TD5A 4Q8IA 3DW0A 1PNEA 4MN5A 2Y55A 1T1AA 2OAQ1 4N1XA 3ZGAB 1ALQA 2PU2A 3MQ0A 2YKFA 2Z2LB 3A0VA 5HSQA 4OPQA 4L9GA 4GHIA 1ONGA 2P9VB 4GN2A 3F1NA 2X02A 5DTTA 4PMAA 4X55A 2D01A 2J8YA 3PR6A 1BLSA 2OLVA 4BBUA 4ZAMA 2XH9A 4HH3A 5L2FA 3BEBA 2XQZA 2W3GA 2W3DA 2XF3A 2Y2QA 4IHQA 4LV3A 1MXOA 4HJ4A 4CJNA 5JYPA 3P01A 5JYOA 2VV6A 3N4IA 3JPUA 1LT0A 1XKZA 4GLQA 5TBMB 4I39A 3T1SA 3MQQA 4L9EA 2WKQA 2P04A 2HDRA 3AGFA 3LICA 4PM7A 1K6SA 3W4PA 3EQVA 3LEZA 1KGFA 2Y8HA 3NY4A 1TDGA 4KZ3A 2XFSA 2QPNA 1NZOA 1PW1A 2IWCA 4R23A 3I7JA 2QJ7A 2WKIA 5EM1A 5EVIA 1CI9A 2A24B 1KDWA 2QYBA 2JBFA 2Y2IA 5AVFA 1D7EA 3DAVA 2Y59A 4WEKA 1DP8A 3UDXA 4MBHA 4E04A 2V20A 3BY8A 3HLCA 3GR2A 4DDYA 4Y0OA 2L4RA 2K2NA 5HL1A 2H28A 4EWFA 3MR0A 3IS2A 2NUTC 3N7WA 1YLWA 2DMWA 2H5SA 1GCEA 2QJ5A 1YLPA 3FPVA 3DTKA 4WMCD 2WAFA 2G7UA 1S4SA 4E3IA 4RA7A 5AQ7A 2K7SA 3B3XA 1HVBA 4II7A 2Z6DA 1TDLA 3E4OA 3C4PA 2HZ5A 3UDFA 3ULFA 4U3TA 5CGWA 5TR7A 3ZFZA 2R78A 5EVEA 4JGPA 1O07A 3ZCZA 1I2SA 3NIAA 4MMNA 4R3BA 3ZVWA 1J3WA 3G31A 4JGOA 4DRTA 1EW0A 2PYRA 1TS8A 2XRNA 3U4LP 3NI9A 2G2UA 3LEQA 1F98A 1V9YA 4KQQA 3D72A 2IWDA 3VSKA 3T1RA 1OTIA 2OOLA 5HFOA 1DJAA 3FWLA 4S2IA 4QY5A 1D1JA 4B93A 2D02A 3S7QA 1K54C 5DJUA 2JKRM 4XT2A 1NLZA 2VKSA 5FI2A 4BL3A 2O9AA 4UA9A 2Y79A 3CWFA 3GMWA 4QU3A 2OWHA 2OSUA 4F3LB 2XD5A 5CRFA 3CI6A 4KQDA 4H8RA 3E2LA 4KQRA 4EBNA 5J4EA 3WRZA 1L3LA 4FSFA 2O9CA 1ES2A 2ZOIA 3UPOA 1PIOA 2P9VA 5E2GA 3UPNA 4OPZA 3CHWP 1G6OA 4K91A 4MBKA 3MZDA 1MWRA 2KX6A 2Y2KA 1JVJA 4YWZA 2ZQCA 3EQUA 2LB5A 5FQ9A 3VFHA 1OTDA 2M1CA 3HUNA 4YOFA 2P7JA 4Z9QA 5CGSA 4WZ4A 1IFQA 2Q9MA 3IHBA 3DTMA 3VOYA 2EX6A 4Y13A 3PBNA 4HHDA 1NXYA 1KE0A 1XA1A 1F9IA 3OPHA 3UB5P 2KDKA 3PYPA 3KSGA 1W63Q 1IYSA 2ZQAA 3DWKA 1S66L 3C7VA 2X01A 2A24A 1TS6A 5G18A 3K3DA 4GNUA 5DKLA 3DTEA 3ZG8B 3S7PA 5FATA 5M19A 4QY6A 4Y3IA 1S1YA 4ZRRA 2DCFA 1T1BA 3HLGA 2A49A 1CQAA 4EBPA 3LCEA 3E4PA 3LI9A 5FI7A 3VSLA 5GHXA 2DNSA 4RVAA 4B9OA 4JF5A 3HUMA 5CXWA 2UWXA 4X56A 3O87A 1CI8A 4CQHA 3Q07A 4DE1A 5TJJA 4P85A 3WWXA 4GS9B 1YQSA 3IF6B 4Q0HA 5TFQA 1P0ZA 2V8CA 3AGEA 2Z6CA 3V50A 1IEMA 3NHQA 1Q2PA 4HH2A 2ACGA 2VX8A 3A3FA 4UQIM 4EEPA 2EFXA 3MBZA 1MZUA 3H9WA 1OTBA 5GLCA 4HNBA 3FG8A 3UB6A 1CF0A 3BW6A 3WS4A 4ID4A 1HLUP 3IX4A 3LIBA 1BT5A 1FOFA 5HAPA 4LRYC 4LGWA 4R4RA 4Y15A 4RQ9A 1Y28A 5CHJA 2PRFA 4GDBA 4GW9A 3TOIA 1K38A 4WELA 5CHUA 4KZ5A 4EETB 3JVUA 2G2WA 2HGVA 3VE4A 4C75A 3G6OA 3FYZA 4EQIA 5L07A 4F3LA 1CK3A 1P9WA 1LLBA 2ZC5B 4OOLA 4WYYA 2XDMA 3WS5A 4CPKA 3MXQA 4LRZE 4KZ9A 4KZ4A 5E2FA 2EFUA 1E3UD 3CZDA 1YM1A 3D4FA 2ZD8A 2IWBA 2GJ3A 3K2NA 4KQOA 1K57A 3G32A 1MC0A 2OLUA 2R9XA 2ZC3B 4NKPA 4RX3A 4KG6A 2J7VA 3BLMA 3OBFA 5E2EA 5EUAA 3LIDA 1JTDA 1FSWA 3OCNA 3HLFA 4H6JB 4WF0A 2JHEA 1LI0A 4HEFA 2OAP1 3IS2B 2VA0A 1KVMA 4PM5A 1K4FA 2O99A 5EFWA 2Q9NA 3A0RA 3CG5A 3BFGA 1N9OA 3UMEA 5FEFA 1U60A 3HCYA 1WA9A 5HWVA 4JGRA 4N1HA 5F1FA 1OTEA 3BWLA 4FH4A 4WM9A 3DWZA 2H0YA 4ZJ3A 1BTLA 2P74A 3W4OA 4X6TA 2WUQA 4C3QA 5HW3A 4S2KA 1P97A 4XXRA 4HIAA 1XA7A 4R4SA 4DE2A 3NDGA 1H3QA 1MWSA 3BFEA 5F69A 3CPTB 4KZ7A 4Y0UA 1W5DA 3MKFA 1GHIA 2W0NA 3VOZA 1V9ZA 1BLHA 3W4QA 4BD1A 4QWOA 3A3IA 5GL9A 5KMWA 2ZC6B 4KZ8A 5EVLA 3Q7VA 1X0OA 2PU4A 3CJMA 1BUEA 4PM9A 3F1PA 4NEED 1P9RA 2JKGA 5KSHA 2VEAA 1NY0A 4OP8A 3QNCA 3IF6A 3UB9A 1EROA 1PI5A 4E6WA 1IYQA 3ZVTA 1YSPA 3MZFA 2ZLYA 4E3LA 5CERA 5E43A 3ZNTA 3E0YA 2B02A 2QKPA 2VK3A 3SOIA 4KZBA 4DMZA 2I72A 1PRQA 3QP4A 4FOFA 1E25A 1JWPA 1Z09A 3MXRA 2ZC7A 3U2AA 5KZHA 2WZXA 4PAUA 2Y2LA 3LGOA 3FKWA 2XFTA 3TRCA 3O86A 4IBRA 1FSYA 4NXFA 1GSVA 1YMSA 3VE3A 1ESUA 2J3WA 3CAXA 1VHMA 3UE3A 4N92A 5FQKA 5DFXA 4ETXA 2J3TD 3EOIA 3NOUC 5FASA 3GTCA 4IBXA 2O9BA 3RH8B 3V3SA 1OJGA 4UA7A 4EUZA 4OLGA 4OLDA 5HDDA 5F82A 2HDSA 1IKGA 1QMEA 3GRJA 4P0MA 4CLCD 4UAAA 4Y5FA 4OOMA 1W8QA 3BY9A 3R7WB 3NECA 3OLOA 4JF6A 3G2YA 1OJ5A 1WYCA 1JTGA 5HPFA 5FSRA 3Q82A 3SH9A 5EVIC 3B33A 4EU0A 2HJEA 4LV2A 3V67A 5EECA 2B5RA 4K08A 3AGDA 5FAQA 4H6JA 4I3IA 2WAEA 4NXGA 4PM8A 1PYYA 3KYEA 1ODVA 1XJ2A 4GB7A 3TSGA 2QWSA 3NC8A 1IKIA 2Y4AA 4QHCA 4PKYG 5KSCA 1BSGA 2K31A 3OOVA 3WS0A 1G68A 4CLCE 4GD8A 2OV5A 1MWUA 3MFDA 2WGVA 3IXHA 3PAEA 3QNBA 4G3KA 5HZHA 5FDHA 2QZ6A 4GJ4A 2XLNA 4HP9A 3ZG0A 2EX9A 3BQ8A 3D3OA 2GZAA 3ZG5A 1W8YA 3VP2A 1L0FA 1XP4A 2ZMAA 3E98A 2H10A 2XD1A 5GLAA 3L7HA 2V9AA 4DXCA 3VP3A 4EUVA 1RGZA 4HJ3A 3IXGA 5EM0A 3CLOA 4EXOA 1CEGA 5CEBA 5FQQA 3BJNA 2NUPC 1NYMA 2ZC4B 1KDSA 1LHYA 1NRFA 4PM6A 3IXDA 4R0QA 3CPTA 4Y7PA 5CECA 2W3HA 2JN7A 4U0TA 1E3UA 1LL5A 3MSHA 2EXBA 4LFUA 4JXWA 1CJFA 4CLCB 5M1AA 3G30A 3T4QA 5HX9A 5CEDA 3MFXA 5EE8A 2WGWB 2BLSA 1GHMA 4O8GA 3F1OB 1VQQA 1XFNA 4BWIA 3GV9A 4EESA 3VMAA 3N8LA 3SS5A 3GVBA 5F5YA 4OH0A 1NJ4A 4ARZA 3PAGA 2A2LA 4OQGA 3WRTA 3A3DA 3IBJA 2HP6A 3HJKA 1KVLA 2BTFP 5L09A 3FV7A 3N6IA 2ZQ8A 3T1QB 5MC7A 2L0WA 3BECA 4X1LA 3TE8A 5CGXA 1K56A 3LUQA 1FIKA 3GECA 1M40A 1NLYA 1XXMA 2ZQDA 3A3JA 4JF4A 1H8ZA 3BFDA 4R3AA 1QMFA 3QP2A 1NZUA 2PAVP 2RCXA 3LR4A 3FKVA 1BLPA 1KGGA 4WZ5A 4X25A 1YKDA 3OPPA 2HDUA 5HL6A 1TS0A 4GD6A 3G35A 3KX0X 3S22A 2WKRA 1S1ZA 3IWQA 5DJTA 1XFQA 2Y2JA 2RL3A 3ISGA 1GSXA 2WADA 2WKEA 3C5AA 4KUKA 3HUOA 5DFYA 1N9NA 3ZYTA 4DF6A 5HAQA 3R7WA 3BRMA 3LR3A 1IYPA 4E3OA 3UDIA 1FCNA 1JWVA 1GSWA 2V0WA 1G6AA 4R1GA 2ZMVA 4X53A 4UEYA 4GOGA 3ZHHA 5G4ZA 3RFBA 5EV0A 5A93A 4O01A 4MN7A 4P6ZS 2JKTM 1DP9A 2EWWA 2WZZA 1FCOA 4L0LA 2EX8A 4IUHA 3IWIA 3MJQA 1OMEA 3Q7VB 3EEAA 3ZG9B 2Y2MA 4HESA 2EA9A 5IHVA 3QP6A 2QMIA 1KE4A 4EEUA 2ZQ7A 1JNUA 2FFFB 1RCJA 4OQ0A 3F1PB 3QHYA 1H5XA 1UWNX 1FCMA 4I3AA 3V5MA 2XK1A 3TW8A 1RP5A 4ZJ1A 2VV8A 1PI4A 1W63M 4B4XA 3FZCA 1DJCA 4P87A 1K0KA 2FFYA 4GKUA 4NG2A 4FTXA 2ZM2A 4JGQA 3NOTC 4M3KA 2M7UA 5GHZA 2J3TC 1DP6A 3EGDC 3FC7A 1YAXA 3VFFA 2CC1A 4CLCA 1UWPX 4RX2A 3B47A 1S6RA 4S2NA 3S7NA 3O88A 1SHVA 1H0MA 4FCFA 2JKRI 4E6XA 2WGWA 1I2WA 1K55A 2Z2MB 3LIFA 1STZA 3F1OA 3VOLA 3BLSA 1SDNA 1HD8A 4QPRA 3UMDA 1MBLA 3PHYA 5DTKA 2VV7A 2XGNA 1TEMA 3JYIA 1SCWA 3EEHA 4GDNA 3TG9A 1NRJA 3H7WA 4MCWA 3PBRA 1HTZA 1ZHHB 1WYBA 3LFVA 3PXPA 3OZHA 2BASA 5HPIA 3MZEA 2QHKA 3OPLA 1MWTA 3LIAA 3NDEA 4JBFA 3IH8A 2GNXA 2ZMFA 3Q1FA 4FH2A 5FQIA 1PWGA 1K57C 2V1AA 4NETA 5I94A 3JVVA 5M18A 4LENA 1KE3A 1L0EA 1PZPA 4IVIA 3ITAA 2ZM8A 4ZTKA 5J3WA 2EWVA 1K56D 3T4JA 3UY6A 1T19A 4ZJ2A 3EWKA 4KG2A 3QP5A 2Y91A 1SZVA 3H82B 4WUJA 1PFLA 3RXXA 2HPBA 4I3JA 2IA2A 1H8MA 3BFFA 4MDZA 5EOEA 1BLCA 2B18A 3CUEA 5A91A 3L9KA 1NYYA 3HLBA 3VV4A 2J9PA 3S1YA 2ZOHA 4IEDA 2FZ0A 4BD0A 2W1TB 2VZWA 3BYDA 4PPRA 2PR6A 2KOIA 2WGIA 4Y2FA 1DY6A 4HI4A 4C6YA 3SS4A 1ES4A 4B4ZA 2E8JA 4KZ6A 4K0WA 3KYQA 2FH5A 4JPMA 3CMZA 5DF9A 3KYZA 1DRMA 4E3JA 4QJGA 3IHAA 1L0DA 5E2HA 1XX2A 1SKFA 3IT9A 5FEGA 4KZAA 2UV0E 1AWIA 3GDIA 4PKYA 3W8KA 3EGXC 4FUWA 3M6HA 3UNWA 4ARZB 3D9YA 5TGFA 1D06A 2J80A 2W1RA 4BJPA 1T1CA 4EBLA 1S67L 4EQ1A 4WBGA 5GLDA 3M2KA 5FA7A 3IF6C 1M6KA 3IQAA 5F6AA 3T1XA 2EX2A 1GHPA 2XROA 3OPRA 1YLTA 3UPPA 2WYXA 1YLJA 5A90A 4KG5A 3UO9A 4ESPA 4F94A 1ZG6A 5AJGA 3NJAA 4JKTA 5AQAA 1IOUA 4JLFA 1FILA 1PWDA 2W3FA 3KSFA 3N8SA 1H8YA 3C30A 4YINA 4LCMA 2ZL1B 4WEJA 3UB7A 3LR5A 4DE3A 5D3OA 2JCHA 2XA7S 3QP1A 3FPWA 4JXGA 5F83A 1EWZA 5DF7A 3M6BA 2EXAA 2C5WB 3UE1A 5DTSA 3ZNYA 4DKIA 3IH9A 2VGKA 2VGLS 4O0PA 3S7OA 1N4OA 3O5YA 1Q2QA 4DXBA 1T18A 3KSHA 5CTMA 1I5QA 4U0XA 1YPRA 2M7VA 3V3RA 4GCZA 5AVEA 4BQMA 5HD3A 1S4RA 2KLIA 3UB8A 1ERQA 4Z1WA 4I38A 1C3BA 4OPYA 3T4SA 4HQAA 5J8XA 3Q81A 1A0KA 2LB9A 1LSWA 1HZOA 3MQOA 1MPLA 3IF5A 4LRXC 2PBDP 3ZDJA 3S4XA 4BBVA 3G34A 3IBRA 4S2MA 3IX8A 3T4KA 2PBYA 3H82A 1PZOA 5FAPA 3MXSA 1F2KA 4A5RA 2V2FF 3C4OA 3PBSA 1N9LA 1OT9A 4KUOA 3SH8A 2W1TA 1FR1A 2ZJ9A 1EI5A 4MBFA 4Q0JA 1MY8A 1JWZA 3G4PA 1SKOB 4OVDA 5GLBA 4S2OA 1VETA 4MNRA 4IVKA 4MLLA 5DVAA 3GSGA 3R4KA 1YLZA 5CHMA 3WS1A 1K54A 4I5SA 5CX7A 2VGJA 4NXBA 4DE0A 4R3JA 2PD8A 3SW1A 5DKKA 1XPBA 3O3VA 3DBAA 3VP4A 2V0UA 2WK0A 1FQGA 2HJ9C 1Z6FA 2JE5A 1YLYA 2MJ6A 4O7DA 1IYOA 4UA6A 3H7WB 3OC2A 4P6ZM 3T4LA 1E4DA 1ES5A 5C5KA 3RTYA 1YMXA 1K6RA 4Y17A 2HP5A 3OCLA 4S2JA 5G4YA 1GA9A 1XGIA 1XJ3A 5HAIA 5K5BA 3HREA 3N8RA 2V1ZA 4L9FA 4EW7A 2J9OA 3LY4A 3V39A 4IJGA 4HOIA 1ZG4A 4OQIA 1ONHA 2HDQA 3BFCA 4EERA 1LL8A 2ZL1A 3HBRA 3SH7A 4N9KA 3ZQ5A 3G2ZA 3C8CA 4LPZA 5FDSA 5KIZA 1L2SA 3IX3A 4X69A 1LI9A 2JC7A 3Q7ZA 5GHYA 1PW8A 5LBRA 4ZDXA 1PWCA 2B95A 3T50A 4DJ3A 1VEUB 4IUKA 4WZ5C 1YT4A 3SZTA 4WL9A 3LR0A 5TBMA 4WN5A 2Y2HA 1W79A 4OPRA 1ZC2A 4ETZA 2AVXA 5AQ9A 3CITA 3P09A 3HLDA 3NCKA 1WE4A 1L0GA 2PYPA 3E2KA 3LI8A 1BULA 1MKMA 1OTAA 3HJIA 2HP9A 3UE0A 4BL2A 3M2JA 1GA0A 4OP5A 2PT7A 4DDSA 4QB8A 3VP1A 5IT5A 5A92A 1J9MA 4Q0IA 4R38A 4NXEA 1RGYA 2GDNA 4BBTA 2W3EA 1W7FA 3MKEA 2YKHA 2ZQ9A 2P08A 3IWOA 4JXSA 2WKPA 2I9VA 2L1MA 2OWJA 3PBOA 4WLAA 3A3EA 1VM1A 2PHYA 4HBUA 3C38A 3C7UA 4OOYA 1LSXA 3HL9A 4G3WA 5HD5A 4Y0TA 1NWZA 3KSIA 4E3KA 2O0YA 5EVID 2VJWA 1Y54A 3WS2A 3HVFA 4K0XA 2JKFA 1CEFA 4PHTA 3IXBA 2HF6A 4JXVA 3B42A 5HWTA 4DJ2A 2ZBBA 3SS3A 3ICYA 5U47A 4YFMA 1SDEA 5L10A 3RXWA 4KENB 1TS7A 4LCLA 5A8BA 1SKOA 2GX5A 3E4QA 4YNRA 1MKIA 1K25A 4X68A 4GHIB 4QD4A 3P7NA 5IU1A 1G28A 5FI6A 5HDSA 2HV1A 3KO6A 1TF1A 3F1NB 4N9LA 3ITBA 2XEPA 5J7EA 1N9BA 1F5MA 2A3UA 4CLCC 3GQZA 3T12B 4ZBEA 5FAOA 4S2NC 4MEZA 2Y2GA 5F1GA 1XJ4A 1AXBA 4S2LA 1K55C 3VP0A 3TJZC 4GZBA 2E8IA 1FR6A 2PR5A 1S0WA 1G5UA 3P98A 5HDCA 5AQBA 4B88A 4LLOB 3QP8A 1ZKJA 5I5LA 5FQJA 1IELA 2W27A 5CTNA 4BENA 5EVIB 4WMCA 1O7EA 4UHUA 5F68A 3LIEA 4X1MA 3UN7A 1OT6A 2R9WA 4BMWA 2X71A 4G3VA 2XR0A 3HLEA 5EPHA 3LY3A 4MN6A 4DN0A
chains in the Genus database with same CATH topology
1PWDA 3G30A 4OQHA 5FI7A 3N8SA 2BG1A 1H8YA 4YINA 3VSLA 5GHXA 4LCMA 2DNSA 5HX9A 4WEJA 3PBTA 4RVAA 4DE3A 5CEDA 3BM6A 4NK3A 4JF5A 5D3OA 3HUMA 5EE8A 2WGWB 2BLSA 4OONA 2JCHA 5CXWA 1GHMA 2C6WB 1VQQA 1ESIA 2UWXA 3GV9A 3VMAA 4X56A 4JXGA 3N8LA 2Y2NA 1EWZA 3O87A 5F83A 1KGEA 5DF7A 3GVBA 1CI8A 3SS5A 3M6BA 2EXAA 2C5WB 3Q07A 4OH0A 3UE1A 1NJ4A 4LV0A 1LL9A 3PAGA 4OQGA 3WRTA 5DTSA 3A3DA 2WKHA 4DE1A 2HP6A 4E3MA 4HBTA 3ZNYA 4OKPA 1KVLA 4P85A 3WWXA 4DKIA 4LV1A 3IH9A 2VGKA 1YQSA 3IF6B 4RYEA 5TFQA 1N4OA 3AGEA 3FV7A 1Q2QA 3N6IA 4DXBA 2ZQ8A 2ZM0A 3V50A 1IEMA 3BECA 3NBLA 3PTEA 5CTMA 5FQMA 1I5QA 5CGXA 1K56A 4U0XA 3V3RA 1Q2PA 4BQMA 1M40A 3HLWA 4E3NA 3RJUA 4EV4A 1XXMA 3A3FA 2ZQDA 2DRWA 2EFXA 3MBZA 3A3JA 4JF4A 5GLCA 1H8ZA 5BOHA 1ERQA 3BFDA 4XUXA 1QMFA 1C3BA 4OPYA 1NZUA 3WS4A 2RCXA 4ID4A 5J8XA 3Q81A 3FKVA 1BLPA 1TVFA 5HARA 1BT5A 1FOFA 1KGGA 4WZ5A 5HAPA 1HZOA 3OPPA 1MPLA 2HDUA 3IF5A 4R4RA 3ZG7B 1K4EA 4GD6A 3ZDJA 2Y2OA 3LO7A 5CHJA 2H0TA 1XGJA 3G34A 3G35A 3S4XA 4S2MA 3S22A 4GDBA 3IWQA 2Y2JA 4XUZA 2PBYA 3TOIA 1K38A 1ES3A 4WELA 2RL3A 1PZOA 3ISGA 3MXSA 4KZ5A 5CHUA 5DF8A 5FAPA 2WADA 2G2WA 4FD8A 5EOOA 4D2OA 4A5RA 4C75A 2V2FF 2WKEA 2Y2PA 3C5AA 3FYZA 4EQIA 3C4OA 3PBQA 1ERMA 3HUOA 3PBSA 4S2PA 4BLMA 1CK3A 4P6BA 1LLBA 1DJBA 2ZC5B 4OOLA 4WYYA 2XDMA 3WS5A 4CPKA 1BZAA 4DF6A 5HAQA 4KZ9A 4Q8IA 3BRMA 4KZ4A 2EFUA 3DW0A 5E2FA 1E3UD 2Y55A 3SH8A 1FR1A 3CZDA 1IYPA 1YM1A 2ZJ9A 3UDIA 1EI5A 1FCNA 4E3OA 1JWVA 3D4FA 2ZD8A 4N1XA 4MBFA 2IWBA 1MY8A 3ZGAB 1ALQA 2PU2A 1JWZA 1G6AA 4R1GA 2Z2LB 3G4PA 4KQOA 1K57A 4X53A 3G32A 4OVDA 2OLUA 4GOGA 2R9XA 2ZC3B 4OPQA 5GLBA 3ZHHA 4S2OA 5A93A 4MNRA 4KG6A 4RX3A 1ONGA 2P9VB 4GN2A 2J7VA 3BLMA 4IVKA 4MLLA 5EUAA 5E2EA 2X02A 5DTTA 4PMAA 4X55A 2J8YA 1JTDA 1FSWA 3OCNA 1BLSA 2OLVA 3GSGA 4L0LA 1YLZA 1FCOA 2WZZA 5CHMA 5DVAA 4ZAMA 2XH9A 1K54A 3WS1A 3HLFA 2EX8A 5L2FA 3BEBA 2XQZA 2VGJA 3IWIA 2XF3A 4DE0A 1OMEA 2Y2QA 1LI0A 4LV3A 3Q7VB 3ZG9B 1MXOA 2Y2MA 4HEFA 4HESA 5IHVA 4R3JA 2QMIA 4CJNA 1KE4A 1KVMA 5JYPA 2ZQ7A 4PM5A 1K4FA 1XPBA 3O3VA 3VP4A 2FFFB 1RCJA 5JYOA 4OQ0A 2Q9NA 2WK0A 1FQGA 3CG5A 3BFGA 1Z6FA 3N4IA 3QHYA 1H5XA 2JE5A 1XKZA 1YLYA 4O7DA 1IYOA 1U60A 4UA6A 1FCMA 3OC2A 3V5MA 3AGFA 2HDRA 1E4DA 2XK1A 1ES5A 1RP5A 4PM7A 1K6SA 4N1HA 3EQVA 3LEZA 1KGFA 3W4PA 5F1FA 1YMXA 1K6RA 3NY4A 2HP5A 4FH4A 1TDGA 4KZ3A 4ZJ1A 2XFSA 2QPNA 4WM9A 1NZOA 1PW1A 2H0YA 3DWZA 4ZJ3A 1BTLA 2IWCA 3OCLA 2P74A 4R23A 3W4OA 3I7JA 1PI4A 4S2JA 4X6TA 4B4XA 3FZCA 1DJCA 2WUQA 4P87A 1GA9A 2WKIA 5EVIA 4C3QA 5HW3A 2FFYA 1XGIA 5HAIA 4S2KA 4GKUA 1CI9A 4XXRA 3HREA 3N8RA 1XA7A 1KDWA 2V1ZA 2ZM2A 4M3KA 4R4SA 4DE2A 2JBFA 3NDGA 5GHZA 2Y2IA 2J9OA 3LY4A 1MWSA 3V39A 2Y59A 4WEKA 2CC1A 3VFFA 3UDXA 3BFEA 4OQIA 1ZG4A 1ONHA 2HDQA 3BFCA 4RX2A 4KZ7A 4Y0UA 1W5DA 4MBHA 1S6RA 1GHIA 3MKFA 4S2NA 2V20A 3HBRA 3SH7A 3O88A 1SHVA 4N9KA 3G2ZA 3HLCA 3VOZA 3W4QA 1BLHA 3GR2A 4FCFA 4BD1A 4Y0OA 4DDYA 3A3IA 4E6XA 5GL9A 1L2SA 2WGWA 1I2WA 5KMWA 4X69A 1K55A 1LI9A 2Z2MB 2ZC6B 2JC7A 4KZ8A 5HL1A 5EVLA 3Q7ZA 5GHYA 1PW8A 4ZDXA 4EWFA 3BLSA 3Q7VA 1PWCA 2PU4A 3CJMA 1SDNA 1HD8A 1BUEA 3N7WA 4WZ5C 1YLWA 4PM9A 1MBLA 1YT4A 2H5SA 1GCEA 5DTKA 1YLPA 5KSHA 2XGNA 4WMCD 2WAFA 1NY0A 1TEMA 4OP8A 2Y2HA 3JYIA 1SCWA 3IF6A 3QNCA 4RA7A 5AQ7A 4E3IA 1W79A 3B3XA 1EROA 1PI5A 4GDNA 4OPRA 1HVBA 3TG9A 4E6WA 1ZC2A 1IYQA 3ZVTA 5AQ9A 3MZFA 3P09A 2ZLYA 4E3LA 5CERA 1TDLA 3HLDA 3NCKA 1WE4A 5E43A 3ZNTA 3C4PA 3PBRA 1L0GA 3E2KA 3UDFA 1HTZA 3SOIA 4U3TA 4KZBA 5CGWA 1BULA 5TR7A 3ZFZA 2I72A 1E25A 1JWPA 1WYBA 3MXRA 2ZC7A 3OZHA 1O07A 2HP9A 3UE0A 4BL2A 3M2JA 3MZEA 3ZCZA 1GA0A 5KZHA 1I2SA 3NIAA 3OPLA 4R3BA 2WZXA 4OP5A 3ZVWA 4DDSA 4QB8A 3VP1A 3G31A 1MWTA 2Y2LA 5A92A 1J9MA 3NDEA 4DRTA 4JBFA 3FKWA 2XFTA 3O86A 3IH8A 1RGYA 3Q1FA 2GDNA 4IBRA 3NI9A 2G2UA 4FH2A 1W7FA 3MKEA 5FQIA 1FSYA 1PWGA 1K57C 2ZQ9A 4KQQA 4NETA 5I94A 1YMSA 2IWDA 3VSKA 3IWOA 5M18A 4LENA 4JXSA 1KE3A 5M1AA 3PBOA 1L0EA 1PZPA 4IVIA 5HFOA 1DJAA 3ITAA 3FWLA 1ESUA 4S2IA 2ZM8A 4QY5A 3A3EA 1VM1A 4ZTKA 3UE3A 4N92A 4HBUA 1K56D 5FQKA 4OOYA 3C7UA 3UY6A 1K54C 3HL9A 4ZJ2A 4KG2A 4Y0TA 5FASA 3GTCA 4E3KA 2Y91A 5EVID 4IBXA 1Y54A 3WS2A 5FI2A 3V3SA 3HVFA 4UA7A 3RXXA 4BL3A 4EUZA 2HPBA 4K0XA 4OLGA 4OLDA 4UA9A 1CEFA 3GMWA 4QU3A 3IXBA 4JXVA 3BFFA 5F82A 2OSUA 1BLCA 5EOEA 2HDSA 1IKGA 3SS3A 1QMEA 3GRJA 2XD5A 5A91A 4P0MA 5CRFA 1NYYA 3HLBA 4YFMA 5U47A 1SDEA 2J9PA 4UAAA 3RXWA 3S1YA 4OOMA 1W8QA 4KENB 4H8RA 4IEDA 3E2LA 4KQRA 4EBNA 3WRZA 4LCLA 4BD0A 4FSFA 4JF6A 3G2YA 3BYDA 1ES2A 4PPRA 1WYCA 2WGIA 1JTGA 1DY6A 5FSRA 3UPOA 1PIOA 4C6YA 3Q82A 3SS4A 1ES4A 2P9VA 5E2GA 3SH9A 4B4ZA 4KZ6A 4K0WA 5EVIC 3UPNA 1MKIA 1K25A 4JPMA 4X68A 4OPZA 3CMZA 4LV2A 5DF9A 4QD4A 5EECA 2B5RA 5FI6A 3AGDA 5FAQA 4K91A 4MBKA 2WAEA 4PM8A 1PYYA 3MZDA 1MWRA 4E3JA 4QJGA 4N9LA 3ITBA 4GB7A 2Y2KA 3TSGA 3NC8A 3IHAA 1L0DA 1IKIA 2XEPA 5E2HA 1N9BA 2Y4AA 1JVJA 4QHCA 1XX2A 2A3UA 2ZQCA 3EQUA 1SKFA 5KSCA 3IT9A 3GQZA 1BSGA 5FQ9A 3VFHA 4KZAA 3WS0A 4ZBEA 3HUNA 5FAOA 4S2NC 4MEZA 1G68A 2Y2GA 5F1GA 4GD8A 4Z9QA 5CGSA 4WZ4A 2OV5A 1MWUA 1AXBA 2Q9MA 3MFDA 4S2LA 3W8KA 2WGVA 3IHBA 3IXHA 1K55C 3PAEA 3VP0A 3QNBA 3M6HA 3UNWA 4GZBA 5TGFA 5FDHA 2QZ6A 3DTMA 2XLNA 2E8IA 1FR6A 3VOYA 2EX6A 3ZG0A 3PBNA 2EX9A 1S0WA 1NXYA 1KE0A 1XA1A 4BJPA 4EBLA 3P98A 5AQBA 4B88A 3OPHA 4WBGA 5GLDA 1W8YA 3ZG5A 3VP2A 1L0FA 1ZKJA 3M2KA 1XP4A 2ZMAA 1IYSA 2ZQAA 3DWKA 2H10A 2XD1A 5GLAA 5FA7A 5FQJA 3IF6C 3C7VA 1M6KA 2X01A 3IQAA 1IELA 4DXCA 3VP3A 1RGZA 5G18A 4GNUA 5CTNA 4BENA 2EX2A 3IXGA 1GHPA 3OPRA 5EVIB 4WMCA 3ZG8B 1CEGA 5FATA 5CEBA 1O7EA 1YLTA 4QY6A 5FQQA 3UPPA 1NYMA 5M19A 4UHUA 2WYXA 1YLJA 2ZC4B 5A90A 4KG5A 2DCFA 1KDSA 1LHYA 1NRFA 4PM6A 3IXDA 4R0QA 3UN7A 4Y7PA 3UO9A 4F94A 1ZG6A 2R9WA 5CECA 2X71A 4U0TA 3HLGA 1E3UA 2XR0A 3HLEA 1LL5A 3LY3A 5EPHA 4JKTA 2A49A 5AQAA 4EBPA 2EXBA 4JXWA 3LCEA 4JLFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PWD A;  3G30 A;  4OQH A;  5FI7 A;  3N8S A;  2BG1 A;  1H8Y A;  4YIN A;  3VSL A;  5GHX A;  4LCM A;  2DNS A;  5HX9 A;  4WEJ A;  3PBT A;  4RVA A;  4DE3 A;  5CED A;  3BM6 A;  4NK3 A;  4JF5 A;  5D3O A;  3HUM A;  5EE8 A;  2WGW B;  2BLS A;  4OON A;  2JCH A;  5CXW A;  1GHM A;  2C6W B;  1VQQ A;  1ESI A;  2UWX A;  3GV9 A;  3VMA A;  4X56 A;  4JXG A;  3N8L A;  2Y2N A;  1EWZ A;  3O87 A;  5F83 A;  1KGE A;  5DF7 A;  3GVB A;  1CI8 A;  3SS5 A;  3M6B A;  2EXA A;  2C5W B;  3Q07 A;  4OH0 A;  3UE1 A;  1NJ4 A;  4LV0 A;  1LL9 A;  3PAG A;  4OQG A;  3WRT A;  5DTS A;  3A3D A;  2WKH A;  4DE1 A;  2HP6 A;  4E3M A;  4HBT A;  3ZNY A;  4OKP A;  1KVL A;  4P85 A;  3WWX A;  4DKI A;  4LV1 A;  3IH9 A;  2VGK A;  1YQS A;  3IF6 B;  4RYE A;  5TFQ A;  1N4O A;  3AGE A;  3FV7 A;  1Q2Q A;  3N6I A;  4DXB A;  2ZQ8 A;  2ZM0 A;  3V50 A;  1IEM A;  3BEC A;  3NBL A;  3PTE A;  5CTM A;  5FQM A;  1I5Q A;  5CGX A;  1K56 A;  4U0X A;  3V3R A;  1Q2P A;  4BQM A;  1M40 A;  3HLW A;  4E3N A;  3RJU A;  4EV4 A;  1XXM A;  3A3F A;  2ZQD A;  2DRW A;  2EFX A;  3MBZ A;  3A3J A;  4JF4 A;  5GLC A;  1H8Z A;  5BOH A;  1ERQ A;  3BFD A;  4XUX A;  1QMF A;  1C3B A;  4OPY A;  1NZU A;  3WS4 A;  2RCX A;  4ID4 A;  5J8X A;  3Q81 A;  3FKV A;  1BLP A;  1TVF A;  5HAR A;  1BT5 A;  1FOF A;  1KGG A;  4WZ5 A;  5HAP A;  1HZO A;  3OPP A;  1MPL A;  2HDU A;  3IF5 A;  4R4R A;  3ZG7 B;  1K4E A;  4GD6 A;  3ZDJ A;  2Y2O A;  3LO7 A;  5CHJ A;  2H0T A;  1XGJ A;  3G34 A;  3G35 A;  3S4X A;  4S2M A;  3S22 A;  4GDB A;  3IWQ A;  2Y2J A;  4XUZ A;  2PBY A;  3TOI A;  1K38 A;  1ES3 A;  4WEL A;  2RL3 A;  1PZO A;  3ISG A;  3MXS A;  4KZ5 A;  5CHU A;  5DF8 A;  5FAP A;  2WAD A;  2G2W A;  4FD8 A;  5EOO A;  4D2O A;  4A5R A;  4C75 A;  2V2F F;  2WKE A;  2Y2P A;  3C5A A;  3FYZ A;  4EQI A;  3C4O A;  3PBQ A;  1ERM A;  3HUO A;  3PBS A;  4S2P A;  4BLM A;  1CK3 A;  4P6B A;  1LLB A;  1DJB A;  2ZC5 B;  4OOL A;  4WYY A;  2XDM A;  3WS5 A;  4CPK A;  1BZA A;  4DF6 A;  5HAQ A;  4KZ9 A;  4Q8I A;  3BRM A;  4KZ4 A;  2EFU A;  3DW0 A;  5E2F A;  1E3U D;  2Y55 A;  3SH8 A;  1FR1 A;  3CZD A;  1IYP A;  1YM1 A;  2ZJ9 A;  3UDI A;  1EI5 A;  1FCN A;  4E3O A;  1JWV A;  3D4F A;  2ZD8 A;  4N1X A;  4MBF A;  2IWB A;  1MY8 A;  3ZGA B;  1ALQ A;  2PU2 A;  1JWZ A;  1G6A A;  4R1G A;  2Z2L B;  3G4P A;  4KQO A;  1K57 A;  4X53 A;  3G32 A;  4OVD A;  2OLU A;  4GOG A;  2R9X A;  2ZC3 B;  4OPQ A;  5GLB A;  3ZHH A;  4S2O A;  5A93 A;  4MNR A;  4KG6 A;  4RX3 A;  1ONG A;  2P9V B;  4GN2 A;  2J7V A;  3BLM A;  4IVK A;  4MLL A;  5EUA A;  5E2E A;  2X02 A;  5DTT A;  4PMA A;  4X55 A;  2J8Y A;  1JTD A;  1FSW A;  3OCN A;  1BLS A;  2OLV A;  3GSG A;  4L0L A;  1YLZ A;  1FCO A;  2WZZ A;  5CHM A;  5DVA A;  4ZAM A;  2XH9 A;  1K54 A;  3WS1 A;  3HLF A;  2EX8 A;  5L2F A;  3BEB A;  2XQZ A;  2VGJ A;  3IWI A;  2XF3 A;  4DE0 A;  1OME A;  2Y2Q A;  1LI0 A;  4LV3 A;  3Q7V B;  3ZG9 B;  1MXO A;  2Y2M A;  4HEF A;  4HES A;  5IHV A;  4R3J A;  2QMI A;  4CJN A;  1KE4 A;  1KVM A;  5JYP A;  2ZQ7 A;  4PM5 A;  1K4F A;  1XPB A;  3O3V A;  3VP4 A;  2FFF B;  1RCJ A;  5JYO A;  4OQ0 A;  2Q9N A;  2WK0 A;  1FQG A;  3CG5 A;  3BFG A;  1Z6F A;  3N4I A;  3QHY A;  1H5X A;  2JE5 A;  1XKZ A;  1YLY A;  4O7D A;  1IYO A;  1U60 A;  4UA6 A;  1FCM A;  3OC2 A;  3V5M A;  3AGF A;  2HDR A;  1E4D A;  2XK1 A;  1ES5 A;  1RP5 A;  4PM7 A;  1K6S A;  4N1H A;  3EQV A;  3LEZ A;  1KGF A;  3W4P A;  5F1F A;  1YMX A;  1K6R A;  3NY4 A;  2HP5 A;  4FH4 A;  1TDG A;  4KZ3 A;  4ZJ1 A;  2XFS A;  2QPN A;  4WM9 A;  1NZO A;  1PW1 A;  2H0Y A;  3DWZ A;  4ZJ3 A;  1BTL A;  2IWC A;  3OCL A;  2P74 A;  4R23 A;  3W4O A;  3I7J A;  1PI4 A;  4S2J A;  4X6T A;  4B4X A;  3FZC A;  1DJC A;  2WUQ A;  4P87 A;  1GA9 A;  2WKI A;  5EVI A;  4C3Q A;  5HW3 A;  2FFY A;  1XGI A;  5HAI A;  4S2K A;  4GKU A;  1CI9 A;  4XXR A;  3HRE A;  3N8R A;  1XA7 A;  1KDW A;  2V1Z A;  2ZM2 A;  4M3K A;  4R4S A;  4DE2 A;  2JBF A;  3NDG A;  5GHZ A;  2Y2I A;  2J9O A;  3LY4 A;  1MWS A;  3V39 A;  2Y59 A;  4WEK A;  2CC1 A;  3VFF A;  3UDX A;  3BFE A;  4OQI A;  1ZG4 A;  1ONH A;  2HDQ A;  3BFC A;  4RX2 A;  4KZ7 A;  4Y0U A;  1W5D A;  4MBH A;  1S6R A;  1GHI A;  3MKF A;  4S2N A;  2V20 A;  3HBR A;  3SH7 A;  3O88 A;  1SHV A;  4N9K A;  3G2Z A;  3HLC A;  3VOZ A;  3W4Q A;  1BLH A;  3GR2 A;  4FCF A;  4BD1 A;  4Y0O A;  4DDY A;  3A3I A;  4E6X A;  5GL9 A;  1L2S A;  2WGW A;  1I2W A;  5KMW A;  4X69 A;  1K55 A;  1LI9 A;  2Z2M B;  2ZC6 B;  2JC7 A;  4KZ8 A;  5HL1 A;  5EVL A;  3Q7Z A;  5GHY A;  1PW8 A;  4ZDX A;  4EWF A;  3BLS A;  3Q7V A;  1PWC A;  2PU4 A;  3CJM A;  1SDN A;  1HD8 A;  1BUE A;  3N7W A;  4WZ5 C;  1YLW A;  4PM9 A;  1MBL A;  1YT4 A;  2H5S A;  1GCE A;  5DTK A;  1YLP A;  5KSH A;  2XGN A;  4WMC D;  2WAF A;  1NY0 A;  1TEM A;  4OP8 A;  2Y2H A;  3JYI A;  1SCW A;  3IF6 A;  3QNC A;  4RA7 A;  5AQ7 A;  4E3I A;  1W79 A;  3B3X A;  1ERO A;  1PI5 A;  4GDN A;  4OPR A;  1HVB A;  3TG9 A;  4E6W A;  1ZC2 A;  1IYQ A;  3ZVT A;  5AQ9 A;  3MZF A;  3P09 A;  2ZLY A;  4E3L A;  5CER A;  1TDL A;  3HLD A;  3NCK A;  1WE4 A;  5E43 A;  3ZNT A;  3C4P A;  3PBR A;  1L0G A;  3E2K A;  3UDF A;  1HTZ A;  3SOI A;  4U3T A;  4KZB A;  5CGW A;  1BUL A;  5TR7 A;  3ZFZ A;  2I72 A;  1E25 A;  1JWP A;  1WYB A;  3MXR A;  2ZC7 A;  3OZH A;  1O07 A;  2HP9 A;  3UE0 A;  4BL2 A;  3M2J A;  3MZE A;  3ZCZ A;  1GA0 A;  5KZH A;  1I2S A;  3NIA A;  3OPL A;  4R3B A;  2WZX A;  4OP5 A;  3ZVW A;  4DDS A;  4QB8 A;  3VP1 A;  3G31 A;  1MWT A;  2Y2L A;  5A92 A;  1J9M A;  3NDE A;  4DRT A;  4JBF A;  3FKW A;  2XFT A;  3O86 A;  3IH8 A;  1RGY A;  3Q1F A;  2GDN A;  4IBR A;  3NI9 A;  2G2U A;  4FH2 A;  1W7F A;  3MKE A;  5FQI A;  1FSY A;  1PWG A;  1K57 C;  2ZQ9 A;  4KQQ A;  4NET A;  5I94 A;  1YMS A;  2IWD A;  3VSK A;  3IWO A;  5M18 A;  4LEN A;  4JXS A;  1KE3 A;  5M1A A;  3PBO A;  1L0E A;  1PZP A;  4IVI A;  5HFO A;  1DJA A;  3ITA A;  3FWL A;  1ESU A;  4S2I A;  2ZM8 A;  4QY5 A;  3A3E A;  1VM1 A;  4ZTK A;  3UE3 A;  4N92 A;  4HBU A;  1K56 D;  5FQK A;  4OOY A;  3C7U A;  3UY6 A;  1K54 C;  3HL9 A;  4ZJ2 A;  4KG2 A;  4Y0T A;  5FAS A;  3GTC A;  4E3K A;  2Y91 A;  5EVI D;  4IBX A;  1Y54 A;  3WS2 A;  5FI2 A;  3V3S A;  3HVF A;  4UA7 A;  3RXX A;  4BL3 A;  4EUZ A;  2HPB A;  4K0X A;  4OLG A;  4OLD A;  4UA9 A;  1CEF A;  3GMW A;  4QU3 A;  3IXB A;  4JXV A;  3BFF A;  5F82 A;  2OSU A;  1BLC A;  5EOE A;  2HDS A;  1IKG A;  3SS3 A;  1QME A;  3GRJ A;  2XD5 A;  5A91 A;  4P0M A;  5CRF A;  1NYY A;  3HLB A;  4YFM A;  5U47 A;  1SDE A;  2J9P A;  4UAA A;  3RXW A;  3S1Y A;  4OOM A;  1W8Q A;  4KEN B;  4H8R A;  4IED A;  3E2L A;  4KQR A;  4EBN A;  3WRZ A;  4LCL A;  4BD0 A;  4FSF A;  4JF6 A;  3G2Y A;  3BYD A;  1ES2 A;  4PPR A;  1WYC A;  2WGI A;  1JTG A;  1DY6 A;  5FSR A;  3UPO A;  1PIO A;  4C6Y A;  3Q82 A;  3SS4 A;  1ES4 A;  2P9V A;  5E2G A;  3SH9 A;  4B4Z A;  4KZ6 A;  4K0W A;  5EVI C;  3UPN A;  1MKI A;  1K25 A;  4JPM A;  4X68 A;  4OPZ A;  3CMZ A;  4LV2 A;  5DF9 A;  4QD4 A;  5EEC A;  2B5R A;  5FI6 A;  3AGD A;  5FAQ A;  4K91 A;  4MBK A;  2WAE A;  4PM8 A;  1PYY A;  3MZD A;  1MWR A;  4E3J A;  4QJG A;  4N9L A;  3ITB A;  4GB7 A;  2Y2K A;  3TSG A;  3NC8 A;  3IHA A;  1L0D A;  1IKI A;  2XEP A;  5E2H A;  1N9B A;  2Y4A A;  1JVJ A;  4QHC A;  1XX2 A;  2A3U A;  2ZQC A;  3EQU A;  1SKF A;  5KSC A;  3IT9 A;  3GQZ A;  1BSG A;  5FQ9 A;  3VFH A;  4KZA A;  3WS0 A;  4ZBE A;  3HUN A;  5FAO A;  4S2N C;  4MEZ A;  1G68 A;  2Y2G A;  5F1G A;  4GD8 A;  4Z9Q A;  5CGS A;  4WZ4 A;  2OV5 A;  1MWU A;  1AXB A;  2Q9M A;  3MFD A;  4S2L A;  3W8K A;  2WGV A;  3IHB A;  3IXH A;  1K55 C;  3PAE A;  3VP0 A;  3QNB A;  3M6H A;  3UNW A;  4GZB A;  5TGF A;  5FDH A;  2QZ6 A;  3DTM A;  2XLN A;  2E8I A;  1FR6 A;  3VOY A;  2EX6 A;  3ZG0 A;  3PBN A;  2EX9 A;  1S0W A;  1NXY A;  1KE0 A;  1XA1 A;  4BJP A;  4EBL A;  3P98 A;  5AQB A;  4B88 A;  3OPH A;  4WBG A;  5GLD A;  1W8Y A;  3ZG5 A;  3VP2 A;  1L0F A;  1ZKJ A;  3M2K A;  1XP4 A;  2ZMA A;  1IYS A;  2ZQA A;  3DWK A;  2H10 A;  2XD1 A;  5GLA A;  5FA7 A;  5FQJ A;  3IF6 C;  3C7V A;  1M6K A;  2X01 A;  3IQA A;  1IEL A;  4DXC A;  3VP3 A;  1RGZ A;  5G18 A;  4GNU A;  5CTN A;  4BEN A;  2EX2 A;  3IXG A;  1GHP A;  3OPR A;  5EVI B;  4WMC A;  3ZG8 B;  1CEG A;  5FAT A;  5CEB A;  1O7E A;  1YLT A;  4QY6 A;  5FQQ A;  3UPP A;  1NYM A;  5M19 A;  4UHU A;  2WYX A;  1YLJ A;  2ZC4 B;  5A90 A;  4KG5 A;  2DCF A;  1KDS A;  1LHY A;  1NRF A;  4PM6 A;  3IXD A;  4R0Q A;  3UN7 A;  4Y7P A;  3UO9 A;  4F94 A;  1ZG6 A;  2R9W A;  5CEC A;  2X71 A;  4U0T A;  3HLG A;  1E3U A;  2XR0 A;  3HLE A;  1LL5 A;  3LY3 A;  5EPH A;  4JKT A;  2A49 A;  5AQA A;  4EBP A;  2EXB A;  4JXW A;  3LCE A;  4JLF A; 
#chains in the Genus database with same CATH topology
 2PDR A;  4OQH A;  2BG1 A;  3NOP C;  3PBT A;  3BM6 A;  4NK3 A;  1VEU A;  4OON A;  3A0S A;  2C6W B;  4UQI S;  1ESI A;  2PD7 A;  2Y2N A;  1KGE A;  4LV0 A;  1LL9 A;  4D60 A;  1LSV A;  3BQA A;  5FL3 A;  2WKH A;  4E3M A;  4HBT A;  4OKP A;  4LV1 A;  2V1B A;  3UE6 A;  4RYE A;  3C2W A;  2Q0O A;  2ZM0 A;  4HJ6 A;  4AFI A;  2V8F A;  3NBL A;  3PTE A;  5FQM A;  4R70 A;  2INW A;  3HLW A;  4E3N A;  3RJU A;  4EV4 A;  2XA7 M;  2JKT I;  3CUE C;  3W2Z A;  2DRW A;  3LYX A;  1Y4O A;  4M4X A;  1KOU A;  1VET B;  5BOH A;  4XUX A;  5HWW A;  2VLG A;  2XSS A;  5IS1 A;  1UGU A;  2VGL M;  2CMN A;  1TVF A;  5HAR A;  3MS6 A;  3ZG7 B;  1K4E A;  2Y2O A;  3LO7 A;  2H0T A;  1XJ6 A;  1XGJ A;  4ME4 A;  1OPX A;  1ACF A;  1YSQ A;  4XUZ A;  3T4O A;  1ES3 A;  3T4T A;  4HY8 A;  5DF8 A;  1VB6 A;  4FD8 A;  5EOO A;  3MMH A;  4D2O A;  3NUL A;  1ZTU A;  2Y2P A;  4XT2 B;  3PBQ A;  1ERM A;  4S2P A;  3DTI A;  4HP4 A;  4BLM A;  4P6B A;  4GS9 A;  1DJB A;  4R6L A;  3MF0 A;  3K3C A;  1BYW A;  1BZA A;  5L8M A;  1TD5 A;  4Q8I A;  3DW0 A;  1PNE A;  4MN5 A;  2Y55 A;  1T1A A;  2OAQ 1;  4N1X A;  3ZGA B;  1ALQ A;  2PU2 A;  3MQ0 A;  2YKF A;  2Z2L B;  3A0V A;  5HSQ A;  4OPQ A;  4L9G A;  4GHI A;  1ONG A;  2P9V B;  4GN2 A;  3F1N A;  2X02 A;  5DTT A;  4PMA A;  4X55 A;  2D01 A;  2J8Y A;  3PR6 A;  1BLS A;  2OLV A;  4BBU A;  4ZAM A;  2XH9 A;  4HH3 A;  5L2F A;  3BEB A;  2XQZ A;  2W3G A;  2W3D A;  2XF3 A;  2Y2Q A;  4IHQ A;  4LV3 A;  1MXO A;  4HJ4 A;  4CJN A;  5JYP A;  3P01 A;  5JYO A;  2VV6 A;  3N4I A;  3JPU A;  1LT0 A;  1XKZ A;  4GLQ A;  5TBM B;  4I39 A;  3T1S A;  3MQQ A;  4L9E A;  2WKQ A;  2P04 A;  2HDR A;  3AGF A;  3LIC A;  4PM7 A;  1K6S A;  3W4P A;  3EQV A;  3LEZ A;  1KGF A;  2Y8H A;  3NY4 A;  1TDG A;  4KZ3 A;  2XFS A;  2QPN A;  1NZO A;  1PW1 A;  2IWC A;  4R23 A;  3I7J A;  2QJ7 A;  2WKI A;  5EM1 A;  5EVI A;  1CI9 A;  2A24 B;  1KDW A;  2QYB A;  2JBF A;  2Y2I A;  5AVF A;  1D7E A;  3DAV A;  2Y59 A;  4WEK A;  1DP8 A;  3UDX A;  4MBH A;  4E04 A;  2V20 A;  3BY8 A;  3HLC A;  3GR2 A;  4DDY A;  4Y0O A;  2L4R A;  2K2N A;  5HL1 A;  2H28 A;  4EWF A;  3MR0 A;  3IS2 A;  2NUT C;  3N7W A;  1YLW A;  2DMW A;  2H5S A;  1GCE A;  2QJ5 A;  1YLP A;  3FPV A;  3DTK A;  4WMC D;  2WAF A;  2G7U A;  1S4S A;  4E3I A;  4RA7 A;  5AQ7 A;  2K7S A;  3B3X A;  1HVB A;  4II7 A;  2Z6D A;  1TDL A;  3E4O A;  3C4P A;  2HZ5 A;  3UDF A;  3ULF A;  4U3T A;  5CGW A;  5TR7 A;  3ZFZ A;  2R78 A;  5EVE A;  4JGP A;  1O07 A;  3ZCZ A;  1I2S A;  3NIA A;  4MMN A;  4R3B A;  3ZVW A;  1J3W A;  3G31 A;  4JGO A;  4DRT A;  1EW0 A;  2PYR A;  1TS8 A;  2XRN A;  3U4L P;  3NI9 A;  2G2U A;  3LEQ A;  1F98 A;  1V9Y A;  4KQQ A;  3D72 A;  2IWD A;  3VSK A;  3T1R A;  1OTI A;  2OOL A;  5HFO A;  1DJA A;  3FWL A;  4S2I A;  4QY5 A;  1D1J A;  4B93 A;  2D02 A;  3S7Q A;  1K54 C;  5DJU A;  2JKR M;  4XT2 A;  1NLZ A;  2VKS A;  5FI2 A;  4BL3 A;  2O9A A;  4UA9 A;  2Y79 A;  3CWF A;  3GMW A;  4QU3 A;  2OWH A;  2OSU A;  4F3L B;  2XD5 A;  5CRF A;  3CI6 A;  4KQD A;  4H8R A;  3E2L A;  4KQR A;  4EBN A;  5J4E A;  3WRZ A;  1L3L A;  4FSF A;  2O9C A;  1ES2 A;  2ZOI A;  3UPO A;  1PIO A;  2P9V A;  5E2G A;  3UPN A;  4OPZ A;  3CHW P;  1G6O A;  4K91 A;  4MBK A;  3MZD A;  1MWR A;  2KX6 A;  2Y2K A;  1JVJ A;  4YWZ A;  2ZQC A;  3EQU A;  2LB5 A;  5FQ9 A;  3VFH A;  1OTD A;  2M1C A;  3HUN A;  4YOF A;  2P7J A;  4Z9Q A;  5CGS A;  4WZ4 A;  1IFQ A;  2Q9M A;  3IHB A;  3DTM A;  3VOY A;  2EX6 A;  4Y13 A;  3PBN A;  4HHD A;  1NXY A;  1KE0 A;  1XA1 A;  1F9I A;  3OPH A;  3UB5 P;  2KDK A;  3PYP A;  3KSG A;  1W63 Q;  1IYS A;  2ZQA A;  3DWK A;  1S66 L;  3C7V A;  2X01 A;  2A24 A;  1TS6 A;  5G18 A;  3K3D A;  4GNU A;  5DKL A;  3DTE A;  3ZG8 B;  3S7P A;  5FAT A;  5M19 A;  4QY6 A;  4Y3I A;  1S1Y A;  4ZRR A;  2DCF A;  1T1B A;  3HLG A;  2A49 A;  1CQA A;  4EBP A;  3LCE A;  3E4P A;  3LI9 A;  5FI7 A;  3VSL A;  5GHX A;  2DNS A;  4RVA A;  4B9O A;  4JF5 A;  3HUM A;  5CXW A;  2UWX A;  4X56 A;  3O87 A;  1CI8 A;  4CQH A;  3Q07 A;  4DE1 A;  5TJJ A;  4P85 A;  3WWX A;  4GS9 B;  1YQS A;  3IF6 B;  4Q0H A;  5TFQ A;  1P0Z A;  2V8C A;  3AGE A;  2Z6C A;  3V50 A;  1IEM A;  3NHQ A;  1Q2P A;  4HH2 A;  2ACG A;  2VX8 A;  3A3F A;  4UQI M;  4EEP A;  2EFX A;  3MBZ A;  1MZU A;  3H9W A;  1OTB A;  5GLC A;  4HNB A;  3FG8 A;  3UB6 A;  1CF0 A;  3BW6 A;  3WS4 A;  4ID4 A;  1HLU P;  3IX4 A;  3LIB A;  1BT5 A;  1FOF A;  5HAP A;  4LRY C;  4LGW A;  4R4R A;  4Y15 A;  4RQ9 A;  1Y28 A;  5CHJ A;  2PRF A;  4GDB A;  4GW9 A;  3TOI A;  1K38 A;  4WEL A;  5CHU A;  4KZ5 A;  4EET B;  3JVU A;  2G2W A;  2HGV A;  3VE4 A;  4C75 A;  3G6O A;  3FYZ A;  4EQI A;  5L07 A;  4F3L A;  1CK3 A;  1P9W A;  1LLB A;  2ZC5 B;  4OOL A;  4WYY A;  2XDM A;  3WS5 A;  4CPK A;  3MXQ A;  4LRZ E;  4KZ9 A;  4KZ4 A;  5E2F A;  2EFU A;  1E3U D;  3CZD A;  1YM1 A;  3D4F A;  2ZD8 A;  2IWB A;  2GJ3 A;  3K2N A;  4KQO A;  1K57 A;  3G32 A;  1MC0 A;  2OLU A;  2R9X A;  2ZC3 B;  4NKP A;  4RX3 A;  4KG6 A;  2J7V A;  3BLM A;  3OBF A;  5E2E A;  5EUA A;  3LID A;  1JTD A;  1FSW A;  3OCN A;  3HLF A;  4H6J B;  4WF0 A;  2JHE A;  1LI0 A;  4HEF A;  2OAP 1;  3IS2 B;  2VA0 A;  1KVM A;  4PM5 A;  1K4F A;  2O99 A;  5EFW A;  2Q9N A;  3A0R A;  3CG5 A;  3BFG A;  1N9O A;  3UME A;  5FEF A;  1U60 A;  3HCY A;  1WA9 A;  5HWV A;  4JGR A;  4N1H A;  5F1F A;  1OTE A;  3BWL A;  4FH4 A;  4WM9 A;  3DWZ A;  2H0Y A;  4ZJ3 A;  1BTL A;  2P74 A;  3W4O A;  4X6T A;  2WUQ A;  4C3Q A;  5HW3 A;  4S2K A;  1P97 A;  4XXR A;  4HIA A;  1XA7 A;  4R4S A;  4DE2 A;  3NDG A;  1H3Q A;  1MWS A;  3BFE A;  5F69 A;  3CPT B;  4KZ7 A;  4Y0U A;  1W5D A;  3MKF A;  1GHI A;  2W0N A;  3VOZ A;  1V9Z A;  1BLH A;  3W4Q A;  4BD1 A;  4QWO A;  3A3I A;  5GL9 A;  5KMW A;  2ZC6 B;  4KZ8 A;  5EVL A;  3Q7V A;  1X0O A;  2PU4 A;  3CJM A;  1BUE A;  4PM9 A;  3F1P A;  4NEE D;  1P9R A;  2JKG A;  5KSH A;  2VEA A;  1NY0 A;  4OP8 A;  3QNC A;  3IF6 A;  3UB9 A;  1ERO A;  1PI5 A;  4E6W A;  1IYQ A;  3ZVT A;  1YSP A;  3MZF A;  2ZLY A;  4E3L A;  5CER A;  5E43 A;  3ZNT A;  3E0Y A;  2B02 A;  2QKP A;  2VK3 A;  3SOI A;  4KZB A;  4DMZ A;  2I72 A;  1PRQ A;  3QP4 A;  4FOF A;  1E25 A;  1JWP A;  1Z09 A;  3MXR A;  2ZC7 A;  3U2A A;  5KZH A;  2WZX A;  4PAU A;  2Y2L A;  3LGO A;  3FKW A;  2XFT A;  3TRC A;  3O86 A;  4IBR A;  1FSY A;  4NXF A;  1GSV A;  1YMS A;  3VE3 A;  1ESU A;  2J3W A;  3CAX A;  1VHM A;  3UE3 A;  4N92 A;  5FQK A;  5DFX A;  4ETX A;  2J3T D;  3EOI A;  3NOU C;  5FAS A;  3GTC A;  4IBX A;  2O9B A;  3RH8 B;  3V3S A;  1OJG A;  4UA7 A;  4EUZ A;  4OLG A;  4OLD A;  5HDD A;  5F82 A;  2HDS A;  1IKG A;  1QME A;  3GRJ A;  4P0M A;  4CLC D;  4UAA A;  4Y5F A;  4OOM A;  1W8Q A;  3BY9 A;  3R7W B;  3NEC A;  3OLO A;  4JF6 A;  3G2Y A;  1OJ5 A;  1WYC A;  1JTG A;  5HPF A;  5FSR A;  3Q82 A;  3SH9 A;  5EVI C;  3B33 A;  4EU0 A;  2HJE A;  4LV2 A;  3V67 A;  5EEC A;  2B5R A;  4K08 A;  3AGD A;  5FAQ A;  4H6J A;  4I3I A;  2WAE A;  4NXG A;  4PM8 A;  1PYY A;  3KYE A;  1ODV A;  1XJ2 A;  4GB7 A;  3TSG A;  2QWS A;  3NC8 A;  1IKI A;  2Y4A A;  4QHC A;  4PKY G;  5KSC A;  1BSG A;  2K31 A;  3OOV A;  3WS0 A;  1G68 A;  4CLC E;  4GD8 A;  2OV5 A;  1MWU A;  3MFD A;  2WGV A;  3IXH A;  3PAE A;  3QNB A;  4G3K A;  5HZH A;  5FDH A;  2QZ6 A;  4GJ4 A;  2XLN A;  4HP9 A;  3ZG0 A;  2EX9 A;  3BQ8 A;  3D3O A;  2GZA A;  3ZG5 A;  1W8Y A;  3VP2 A;  1L0F A;  1XP4 A;  2ZMA A;  3E98 A;  2H10 A;  2XD1 A;  5GLA A;  3L7H A;  2V9A A;  4DXC A;  3VP3 A;  4EUV A;  1RGZ A;  4HJ3 A;  3IXG A;  5EM0 A;  3CLO A;  4EXO A;  1CEG A;  5CEB A;  5FQQ A;  3BJN A;  2NUP C;  1NYM A;  2ZC4 B;  1KDS A;  1LHY A;  1NRF A;  4PM6 A;  3IXD A;  4R0Q A;  3CPT A;  4Y7P A;  5CEC A;  2W3H A;  2JN7 A;  4U0T A;  1E3U A;  1LL5 A;  3MSH A;  2EXB A;  4LFU A;  4JXW A;  1CJF A;  4CLC B;  5M1A A;  3G30 A;  3T4Q A;  5HX9 A;  5CED A;  3MFX A;  5EE8 A;  2WGW B;  2BLS A;  1GHM A;  4O8G A;  3F1O B;  1VQQ A;  1XFN A;  4BWI A;  3GV9 A;  4EES A;  3VMA A;  3N8L A;  3SS5 A;  3GVB A;  5F5Y A;  4OH0 A;  1NJ4 A;  4ARZ A;  3PAG A;  2A2L A;  4OQG A;  3WRT A;  3A3D A;  3IBJ A;  2HP6 A;  3HJK A;  1KVL A;  2BTF P;  5L09 A;  3FV7 A;  3N6I A;  2ZQ8 A;  3T1Q B;  5MC7 A;  2L0W A;  3BEC A;  4X1L A;  3TE8 A;  5CGX A;  1K56 A;  3LUQ A;  1FIK A;  3GEC A;  1M40 A;  1NLY A;  1XXM A;  2ZQD A;  3A3J A;  4JF4 A;  1H8Z A;  3BFD A;  4R3A A;  1QMF A;  3QP2 A;  1NZU A;  2PAV P;  2RCX A;  3LR4 A;  3FKV A;  1BLP A;  1KGG A;  4WZ5 A;  4X25 A;  1YKD A;  3OPP A;  2HDU A;  5HL6 A;  1TS0 A;  4GD6 A;  3G35 A;  3KX0 X;  3S22 A;  2WKR A;  1S1Z A;  3IWQ A;  5DJT A;  1XFQ A;  2Y2J A;  2RL3 A;  3ISG A;  1GSX A;  2WAD A;  2WKE A;  3C5A A;  4KUK A;  3HUO A;  5DFY A;  1N9N A;  3ZYT A;  4DF6 A;  5HAQ A;  3R7W A;  3BRM A;  3LR3 A;  1IYP A;  4E3O A;  3UDI A;  1FCN A;  1JWV A;  1GSW A;  2V0W A;  1G6A A;  4R1G A;  2ZMV A;  4X53 A;  4UEY A;  4GOG A;  3ZHH A;  5G4Z A;  3RFB A;  5EV0 A;  5A93 A;  4O01 A;  4MN7 A;  4P6Z S;  2JKT M;  1DP9 A;  2EWW A;  2WZZ A;  1FCO A;  4L0L A;  2EX8 A;  4IUH A;  3IWI A;  3MJQ A;  1OME A;  3Q7V B;  3EEA A;  3ZG9 B;  2Y2M A;  4HES A;  2EA9 A;  5IHV A;  3QP6 A;  2QMI A;  1KE4 A;  4EEU A;  2ZQ7 A;  1JNU A;  2FFF B;  1RCJ A;  4OQ0 A;  3F1P B;  3QHY A;  1H5X A;  1UWN X;  1FCM A;  4I3A A;  3V5M A;  2XK1 A;  3TW8 A;  1RP5 A;  4ZJ1 A;  2VV8 A;  1PI4 A;  1W63 M;  4B4X A;  3FZC A;  1DJC A;  4P87 A;  1K0K A;  2FFY A;  4GKU A;  4NG2 A;  4FTX A;  2ZM2 A;  4JGQ A;  3NOT C;  4M3K A;  2M7U A;  5GHZ A;  2J3T C;  1DP6 A;  3EGD C;  3FC7 A;  1YAX A;  3VFF A;  2CC1 A;  4CLC A;  1UWP X;  4RX2 A;  3B47 A;  1S6R A;  4S2N A;  3S7N A;  3O88 A;  1SHV A;  1H0M A;  4FCF A;  2JKR I;  4E6X A;  2WGW A;  1I2W A;  1K55 A;  2Z2M B;  3LIF A;  1STZ A;  3F1O A;  3VOL A;  3BLS A;  1SDN A;  1HD8 A;  4QPR A;  3UMD A;  1MBL A;  3PHY A;  5DTK A;  2VV7 A;  2XGN A;  1TEM A;  3JYI A;  1SCW A;  3EEH A;  4GDN A;  3TG9 A;  1NRJ A;  3H7W A;  4MCW A;  3PBR A;  1HTZ A;  1ZHH B;  1WYB A;  3LFV A;  3PXP A;  3OZH A;  2BAS A;  5HPI A;  3MZE A;  2QHK A;  3OPL A;  1MWT A;  3LIA A;  3NDE A;  4JBF A;  3IH8 A;  2GNX A;  2ZMF A;  3Q1F A;  4FH2 A;  5FQI A;  1PWG A;  1K57 C;  2V1A A;  4NET A;  5I94 A;  3JVV A;  5M18 A;  4LEN A;  1KE3 A;  1L0E A;  1PZP A;  4IVI A;  3ITA A;  2ZM8 A;  4ZTK A;  5J3W A;  2EWV A;  1K56 D;  3T4J A;  3UY6 A;  1T19 A;  4ZJ2 A;  3EWK A;  4KG2 A;  3QP5 A;  2Y91 A;  1SZV A;  3H82 B;  4WUJ A;  1PFL A;  3RXX A;  2HPB A;  4I3J A;  2IA2 A;  1H8M A;  3BFF A;  4MDZ A;  5EOE A;  1BLC A;  2B18 A;  3CUE A;  5A91 A;  3L9K A;  1NYY A;  3HLB A;  3VV4 A;  2J9P A;  3S1Y A;  2ZOH A;  4IED A;  2FZ0 A;  4BD0 A;  2W1T B;  2VZW A;  3BYD A;  4PPR A;  2PR6 A;  2KOI A;  2WGI A;  4Y2F A;  1DY6 A;  4HI4 A;  4C6Y A;  3SS4 A;  1ES4 A;  4B4Z A;  2E8J A;  4KZ6 A;  4K0W A;  3KYQ A;  2FH5 A;  4JPM A;  3CMZ A;  5DF9 A;  3KYZ A;  1DRM A;  4E3J A;  4QJG A;  3IHA A;  1L0D A;  5E2H A;  1XX2 A;  1SKF A;  3IT9 A;  5FEG A;  4KZA A;  2UV0 E;  1AWI A;  3GDI A;  4PKY A;  3W8K A;  3EGX C;  4FUW A;  3M6H A;  3UNW A;  4ARZ B;  3D9Y A;  5TGF A;  1D06 A;  2J80 A;  2W1R A;  4BJP A;  1T1C A;  4EBL A;  1S67 L;  4EQ1 A;  4WBG A;  5GLD A;  3M2K A;  5FA7 A;  3IF6 C;  1M6K A;  3IQA A;  5F6A A;  3T1X A;  2EX2 A;  1GHP A;  2XRO A;  3OPR A;  1YLT A;  3UPP A;  2WYX A;  1YLJ A;  5A90 A;  4KG5 A;  3UO9 A;  4ESP A;  4F94 A;  1ZG6 A;  5AJG A;  3NJA A;  4JKT A;  5AQA A;  1IOU A;  4JLF A;  1FIL A;  1PWD A;  2W3F A;  3KSF A;  3N8S A;  1H8Y A;  3C30 A;  4YIN A;  4LCM A;  2ZL1 B;  4WEJ A;  3UB7 A;  3LR5 A;  4DE3 A;  5D3O A;  2JCH A;  2XA7 S;  3QP1 A;  3FPW A;  4JXG A;  5F83 A;  1EWZ A;  5DF7 A;  3M6B A;  2EXA A;  2C5W B;  3UE1 A;  5DTS A;  3ZNY A;  4DKI A;  3IH9 A;  2VGK A;  2VGL S;  4O0P A;  3S7O A;  1N4O A;  3O5Y A;  1Q2Q A;  4DXB A;  1T18 A;  3KSH A;  5CTM A;  1I5Q A;  4U0X A;  1YPR A;  2M7V A;  3V3R A;  4GCZ A;  5AVE A;  4BQM A;  5HD3 A;  1S4R A;  2KLI A;  3UB8 A;  1ERQ A;  4Z1W A;  4I38 A;  1C3B A;  4OPY A;  3T4S A;  4HQA A;  5J8X A;  3Q81 A;  1A0K A;  2LB9 A;  1LSW A;  1HZO A;  3MQO A;  1MPL A;  3IF5 A;  4LRX C;  2PBD P;  3ZDJ A;  3S4X A;  4BBV A;  3G34 A;  3IBR A;  4S2M A;  3IX8 A;  3T4K A;  2PBY A;  3H82 A;  1PZO A;  5FAP A;  3MXS A;  1F2K A;  4A5R A;  2V2F F;  3C4O A;  3PBS A;  1N9L A;  1OT9 A;  4KUO A;  3SH8 A;  2W1T A;  1FR1 A;  2ZJ9 A;  1EI5 A;  4MBF A;  4Q0J A;  1MY8 A;  1JWZ A;  3G4P A;  1SKO B;  4OVD A;  5GLB A;  4S2O A;  1VET A;  4MNR A;  4IVK A;  4MLL A;  5DVA A;  3GSG A;  3R4K A;  1YLZ A;  5CHM A;  3WS1 A;  1K54 A;  4I5S A;  5CX7 A;  2VGJ A;  4NXB A;  4DE0 A;  4R3J A;  2PD8 A;  3SW1 A;  5DKK A;  1XPB A;  3O3V A;  3DBA A;  3VP4 A;  2V0U A;  2WK0 A;  1FQG A;  2HJ9 C;  1Z6F A;  2JE5 A;  1YLY A;  2MJ6 A;  4O7D A;  1IYO A;  4UA6 A;  3H7W B;  3OC2 A;  4P6Z M;  3T4L A;  1E4D A;  1ES5 A;  5C5K A;  3RTY A;  1YMX A;  1K6R A;  4Y17 A;  2HP5 A;  3OCL A;  4S2J A;  5G4Y A;  1GA9 A;  1XGI A;  1XJ3 A;  5HAI A;  5K5B A;  3HRE A;  3N8R A;  2V1Z A;  4L9F A;  4EW7 A;  2J9O A;  3LY4 A;  3V39 A;  4IJG A;  4HOI A;  1ZG4 A;  4OQI A;  1ONH A;  2HDQ A;  3BFC A;  4EER A;  1LL8 A;  2ZL1 A;  3HBR A;  3SH7 A;  4N9K A;  3ZQ5 A;  3G2Z A;  3C8C A;  4LPZ A;  5FDS A;  5KIZ A;  1L2S A;  3IX3 A;  4X69 A;  1LI9 A;  2JC7 A;  3Q7Z A;  5GHY A;  1PW8 A;  5LBR A;  4ZDX A;  1PWC A;  2B95 A;  3T50 A;  4DJ3 A;  1VEU B;  4IUK A;  4WZ5 C;  1YT4 A;  3SZT A;  4WL9 A;  3LR0 A;  5TBM A;  4WN5 A;  2Y2H A;  1W79 A;  4OPR A;  1ZC2 A;  4ETZ A;  2AVX A;  5AQ9 A;  3CIT A;  3P09 A;  3HLD A;  3NCK A;  1WE4 A;  1L0G A;  2PYP A;  3E2K A;  3LI8 A;  1BUL A;  1MKM A;  1OTA A;  3HJI A;  2HP9 A;  3UE0 A;  4BL2 A;  3M2J A;  1GA0 A;  4OP5 A;  2PT7 A;  4DDS A;  4QB8 A;  3VP1 A;  5IT5 A;  5A92 A;  1J9M A;  4Q0I A;  4R38 A;  4NXE A;  1RGY A;  2GDN A;  4BBT A;  2W3E A;  1W7F A;  3MKE A;  2YKH A;  2ZQ9 A;  2P08 A;  3IWO A;  4JXS A;  2WKP A;  2I9V A;  2L1M A;  2OWJ A;  3PBO A;  4WLA A;  3A3E A;  1VM1 A;  2PHY A;  4HBU A;  3C38 A;  3C7U A;  4OOY A;  1LSX A;  3HL9 A;  4G3W A;  5HD5 A;  4Y0T A;  1NWZ A;  3KSI A;  4E3K A;  2O0Y A;  5EVI D;  2VJW A;  1Y54 A;  3WS2 A;  3HVF A;  4K0X A;  2JKF A;  1CEF A;  4PHT A;  3IXB A;  2HF6 A;  4JXV A;  3B42 A;  5HWT A;  4DJ2 A;  2ZBB A;  3SS3 A;  3ICY A;  5U47 A;  4YFM A;  1SDE A;  5L10 A;  3RXW A;  4KEN B;  1TS7 A;  4LCL A;  5A8B A;  1SKO A;  2GX5 A;  3E4Q A;  4YNR A;  1MKI A;  1K25 A;  4X68 A;  4GHI B;  4QD4 A;  3P7N A;  5IU1 A;  1G28 A;  5FI6 A;  5HDS A;  2HV1 A;  3KO6 A;  1TF1 A;  3F1N B;  4N9L A;  3ITB A;  2XEP A;  5J7E A;  1N9B A;  1F5M A;  2A3U A;  4CLC C;  3GQZ A;  3T12 B;  4ZBE A;  5FAO A;  4S2N C;  4MEZ A;  2Y2G A;  5F1G A;  1XJ4 A;  1AXB A;  4S2L A;  1K55 C;  3VP0 A;  3TJZ C;  4GZB A;  2E8I A;  1FR6 A;  2PR5 A;  1S0W A;  1G5U A;  3P98 A;  5HDC A;  5AQB A;  4B88 A;  4LLO B;  3QP8 A;  1ZKJ A;  5I5L A;  5FQJ A;  1IEL A;  2W27 A;  5CTN A;  4BEN A;  5EVI B;  4WMC A;  1O7E A;  4UHU A;  5F68 A;  3LIE A;  4X1M A;  3UN7 A;  1OT6 A;  2R9W A;  4BMW A;  2X71 A;  4G3V A;  2XR0 A;  3HLE A;  5EPH A;  3LY3 A;  4MN6 A;  4DN0 A; 
#chains in the Genus database with same CATH homology
 1PWD A;  3G30 A;  4OQH A;  5FI7 A;  3N8S A;  2BG1 A;  1H8Y A;  4YIN A;  3VSL A;  5GHX A;  4LCM A;  2DNS A;  5HX9 A;  4WEJ A;  3PBT A;  4RVA A;  4DE3 A;  5CED A;  3BM6 A;  4NK3 A;  4JF5 A;  5D3O A;  3HUM A;  5EE8 A;  2WGW B;  2BLS A;  4OON A;  2JCH A;  5CXW A;  1GHM A;  2C6W B;  1VQQ A;  1ESI A;  2UWX A;  3GV9 A;  3VMA A;  4X56 A;  4JXG A;  3N8L A;  2Y2N A;  1EWZ A;  3O87 A;  5F83 A;  1KGE A;  5DF7 A;  3GVB A;  1CI8 A;  3SS5 A;  3M6B A;  2EXA A;  2C5W B;  3Q07 A;  4OH0 A;  3UE1 A;  1NJ4 A;  4LV0 A;  1LL9 A;  3PAG A;  4OQG A;  3WRT A;  5DTS A;  3A3D A;  2WKH A;  4DE1 A;  2HP6 A;  4E3M A;  4HBT A;  3ZNY A;  4OKP A;  1KVL A;  4P85 A;  3WWX A;  4DKI A;  4LV1 A;  3IH9 A;  2VGK A;  1YQS A;  3IF6 B;  4RYE A;  5TFQ A;  1N4O A;  3AGE A;  3FV7 A;  1Q2Q A;  3N6I A;  4DXB A;  2ZQ8 A;  2ZM0 A;  3V50 A;  1IEM A;  3BEC A;  3NBL A;  3PTE A;  5CTM A;  5FQM A;  1I5Q A;  5CGX A;  1K56 A;  4U0X A;  3V3R A;  1Q2P A;  4BQM A;  1M40 A;  3HLW A;  4E3N A;  3RJU A;  4EV4 A;  1XXM A;  3A3F A;  2ZQD A;  2DRW A;  2EFX A;  3MBZ A;  3A3J A;  4JF4 A;  5GLC A;  1H8Z A;  5BOH A;  1ERQ A;  3BFD A;  4XUX A;  1QMF A;  1C3B A;  4OPY A;  1NZU A;  3WS4 A;  2RCX A;  4ID4 A;  5J8X A;  3Q81 A;  3FKV A;  1BLP A;  1TVF A;  5HAR A;  1BT5 A;  1FOF A;  1KGG A;  4WZ5 A;  5HAP A;  1HZO A;  3OPP A;  1MPL A;  2HDU A;  3IF5 A;  4R4R A;  3ZG7 B;  1K4E A;  4GD6 A;  3ZDJ A;  2Y2O A;  3LO7 A;  5CHJ A;  2H0T A;  1XGJ A;  3G34 A;  3G35 A;  3S4X A;  4S2M A;  3S22 A;  4GDB A;  3IWQ A;  2Y2J A;  4XUZ A;  2PBY A;  3TOI A;  1K38 A;  1ES3 A;  4WEL A;  2RL3 A;  1PZO A;  3ISG A;  3MXS A;  4KZ5 A;  5CHU A;  5DF8 A;  5FAP A;  2WAD A;  2G2W A;  4FD8 A;  5EOO A;  4D2O A;  4A5R A;  4C75 A;  2V2F F;  2WKE A;  2Y2P A;  3C5A A;  3FYZ A;  4EQI A;  3C4O A;  3PBQ A;  1ERM A;  3HUO A;  3PBS A;  4S2P A;  4BLM A;  1CK3 A;  4P6B A;  1LLB A;  1DJB A;  2ZC5 B;  4OOL A;  4WYY A;  2XDM A;  3WS5 A;  4CPK A;  1BZA A;  4DF6 A;  5HAQ A;  4KZ9 A;  4Q8I A;  3BRM A;  4KZ4 A;  2EFU A;  3DW0 A;  5E2F A;  1E3U D;  2Y55 A;  3SH8 A;  1FR1 A;  3CZD A;  1IYP A;  1YM1 A;  2ZJ9 A;  3UDI A;  1EI5 A;  1FCN A;  4E3O A;  1JWV A;  3D4F A;  2ZD8 A;  4N1X A;  4MBF A;  2IWB A;  1MY8 A;  3ZGA B;  1ALQ A;  2PU2 A;  1JWZ A;  1G6A A;  4R1G A;  2Z2L B;  3G4P A;  4KQO A;  1K57 A;  4X53 A;  3G32 A;  4OVD A;  2OLU A;  4GOG A;  2R9X A;  2ZC3 B;  4OPQ A;  5GLB A;  3ZHH A;  4S2O A;  5A93 A;  4MNR A;  4KG6 A;  4RX3 A;  1ONG A;  2P9V B;  4GN2 A;  2J7V A;  3BLM A;  4IVK A;  4MLL A;  5EUA A;  5E2E A;  2X02 A;  5DTT A;  4PMA A;  4X55 A;  2J8Y A;  1JTD A;  1FSW A;  3OCN A;  1BLS A;  2OLV A;  3GSG A;  4L0L A;  1YLZ A;  1FCO A;  2WZZ A;  5CHM A;  5DVA A;  4ZAM A;  2XH9 A;  1K54 A;  3WS1 A;  3HLF A;  2EX8 A;  5L2F A;  3BEB A;  2XQZ A;  2VGJ A;  3IWI A;  2XF3 A;  4DE0 A;  1OME A;  2Y2Q A;  1LI0 A;  4LV3 A;  3Q7V B;  3ZG9 B;  1MXO A;  2Y2M A;  4HEF A;  4HES A;  5IHV A;  4R3J A;  2QMI A;  4CJN A;  1KE4 A;  1KVM A;  5JYP A;  2ZQ7 A;  4PM5 A;  1K4F A;  1XPB A;  3O3V A;  3VP4 A;  2FFF B;  1RCJ A;  5JYO A;  4OQ0 A;  2Q9N A;  2WK0 A;  1FQG A;  3CG5 A;  3BFG A;  1Z6F A;  3N4I A;  3QHY A;  1H5X A;  2JE5 A;  1XKZ A;  1YLY A;  4O7D A;  1IYO A;  1U60 A;  4UA6 A;  1FCM A;  3OC2 A;  3V5M A;  3AGF A;  2HDR A;  1E4D A;  2XK1 A;  1ES5 A;  1RP5 A;  4PM7 A;  1K6S A;  4N1H A;  3EQV A;  3LEZ A;  1KGF A;  3W4P A;  5F1F A;  1YMX A;  1K6R A;  3NY4 A;  2HP5 A;  4FH4 A;  1TDG A;  4KZ3 A;  4ZJ1 A;  2XFS A;  2QPN A;  4WM9 A;  1NZO A;  1PW1 A;  2H0Y A;  3DWZ A;  4ZJ3 A;  1BTL A;  2IWC A;  3OCL A;  2P74 A;  4R23 A;  3W4O A;  3I7J A;  1PI4 A;  4S2J A;  4X6T A;  4B4X A;  3FZC A;  1DJC A;  2WUQ A;  4P87 A;  1GA9 A;  2WKI A;  5EVI A;  4C3Q A;  5HW3 A;  2FFY A;  1XGI A;  5HAI A;  4S2K A;  4GKU A;  1CI9 A;  4XXR A;  3HRE A;  3N8R A;  1XA7 A;  1KDW A;  2V1Z A;  2ZM2 A;  4M3K A;  4R4S A;  4DE2 A;  2JBF A;  3NDG A;  5GHZ A;  2Y2I A;  2J9O A;  3LY4 A;  1MWS A;  3V39 A;  2Y59 A;  4WEK A;  2CC1 A;  3VFF A;  3UDX A;  3BFE A;  4OQI A;  1ZG4 A;  1ONH A;  2HDQ A;  3BFC A;  4RX2 A;  4KZ7 A;  4Y0U A;  1W5D A;  4MBH A;  1S6R A;  1GHI A;  3MKF A;  4S2N A;  2V20 A;  3HBR A;  3SH7 A;  3O88 A;  1SHV A;  4N9K A;  3G2Z A;  3HLC A;  3VOZ A;  3W4Q A;  1BLH A;  3GR2 A;  4FCF A;  4BD1 A;  4Y0O A;  4DDY A;  3A3I A;  4E6X A;  5GL9 A;  1L2S A;  2WGW A;  1I2W A;  5KMW A;  4X69 A;  1K55 A;  1LI9 A;  2Z2M B;  2ZC6 B;  2JC7 A;  4KZ8 A;  5HL1 A;  5EVL A;  3Q7Z A;  5GHY A;  1PW8 A;  4ZDX A;  4EWF A;  3BLS A;  3Q7V A;  1PWC A;  2PU4 A;  3CJM A;  1SDN A;  1HD8 A;  1BUE A;  3N7W A;  4WZ5 C;  1YLW A;  4PM9 A;  1MBL A;  1YT4 A;  2H5S A;  1GCE A;  5DTK A;  1YLP A;  5KSH A;  2XGN A;  4WMC D;  2WAF A;  1NY0 A;  1TEM A;  4OP8 A;  2Y2H A;  3JYI A;  1SCW A;  3IF6 A;  3QNC A;  4RA7 A;  5AQ7 A;  4E3I A;  1W79 A;  3B3X A;  1ERO A;  1PI5 A;  4GDN A;  4OPR A;  1HVB A;  3TG9 A;  4E6W A;  1ZC2 A;  1IYQ A;  3ZVT A;  5AQ9 A;  3MZF A;  3P09 A;  2ZLY A;  4E3L A;  5CER A;  1TDL A;  3HLD A;  3NCK A;  1WE4 A;  5E43 A;  3ZNT A;  3C4P A;  3PBR A;  1L0G A;  3E2K A;  3UDF A;  1HTZ A;  3SOI A;  4U3T A;  4KZB A;  5CGW A;  1BUL A;  5TR7 A;  3ZFZ A;  2I72 A;  1E25 A;  1JWP A;  1WYB A;  3MXR A;  2ZC7 A;  3OZH A;  1O07 A;  2HP9 A;  3UE0 A;  4BL2 A;  3M2J A;  3MZE A;  3ZCZ A;  1GA0 A;  5KZH A;  1I2S A;  3NIA A;  3OPL A;  4R3B A;  2WZX A;  4OP5 A;  3ZVW A;  4DDS A;  4QB8 A;  3VP1 A;  3G31 A;  1MWT A;  2Y2L A;  5A92 A;  1J9M A;  3NDE A;  4DRT A;  4JBF A;  3FKW A;  2XFT A;  3O86 A;  3IH8 A;  1RGY A;  3Q1F A;  2GDN A;  4IBR A;  3NI9 A;  2G2U A;  4FH2 A;  1W7F A;  3MKE A;  5FQI A;  1FSY A;  1PWG A;  1K57 C;  2ZQ9 A;  4KQQ A;  4NET A;  5I94 A;  1YMS A;  2IWD A;  3VSK A;  3IWO A;  5M18 A;  4LEN A;  4JXS A;  1KE3 A;  5M1A A;  3PBO A;  1L0E A;  1PZP A;  4IVI A;  5HFO A;  1DJA A;  3ITA A;  3FWL A;  1ESU A;  4S2I A;  2ZM8 A;  4QY5 A;  3A3E A;  1VM1 A;  4ZTK A;  3UE3 A;  4N92 A;  4HBU A;  1K56 D;  5FQK A;  4OOY A;  3C7U A;  3UY6 A;  1K54 C;  3HL9 A;  4ZJ2 A;  4KG2 A;  4Y0T A;  5FAS A;  3GTC A;  4E3K A;  2Y91 A;  5EVI D;  4IBX A;  1Y54 A;  3WS2 A;  5FI2 A;  3V3S A;  3HVF A;  4UA7 A;  3RXX A;  4BL3 A;  4EUZ A;  2HPB A;  4K0X A;  4OLG A;  4OLD A;  4UA9 A;  1CEF A;  3GMW A;  4QU3 A;  3IXB A;  4JXV A;  3BFF A;  5F82 A;  2OSU A;  1BLC A;  5EOE A;  2HDS A;  1IKG A;  3SS3 A;  1QME A;  3GRJ A;  2XD5 A;  5A91 A;  4P0M A;  5CRF A;  1NYY A;  3HLB A;  4YFM A;  5U47 A;  1SDE A;  2J9P A;  4UAA A;  3RXW A;  3S1Y A;  4OOM A;  1W8Q A;  4KEN B;  4H8R A;  4IED A;  3E2L A;  4KQR A;  4EBN A;  3WRZ A;  4LCL A;  4BD0 A;  4FSF A;  4JF6 A;  3G2Y A;  3BYD A;  1ES2 A;  4PPR A;  1WYC A;  2WGI A;  1JTG A;  1DY6 A;  5FSR A;  3UPO A;  1PIO A;  4C6Y A;  3Q82 A;  3SS4 A;  1ES4 A;  2P9V A;  5E2G A;  3SH9 A;  4B4Z A;  4KZ6 A;  4K0W A;  5EVI C;  3UPN A;  1MKI A;  1K25 A;  4JPM A;  4X68 A;  4OPZ A;  3CMZ A;  4LV2 A;  5DF9 A;  4QD4 A;  5EEC A;  2B5R A;  5FI6 A;  3AGD A;  5FAQ A;  4K91 A;  4MBK A;  2WAE A;  4PM8 A;  1PYY A;  3MZD A;  1MWR A;  4E3J A;  4QJG A;  4N9L A;  3ITB A;  4GB7 A;  2Y2K A;  3TSG A;  3NC8 A;  3IHA A;  1L0D A;  1IKI A;  2XEP A;  5E2H A;  1N9B A;  2Y4A A;  1JVJ A;  4QHC A;  1XX2 A;  2A3U A;  2ZQC A;  3EQU A;  1SKF A;  5KSC A;  3IT9 A;  3GQZ A;  1BSG A;  5FQ9 A;  3VFH A;  4KZA A;  3WS0 A;  4ZBE A;  3HUN A;  5FAO A;  4S2N C;  4MEZ A;  1G68 A;  2Y2G A;  5F1G A;  4GD8 A;  4Z9Q A;  5CGS A;  4WZ4 A;  2OV5 A;  1MWU A;  1AXB A;  2Q9M A;  3MFD A;  4S2L A;  3W8K A;  2WGV A;  3IHB A;  3IXH A;  1K55 C;  3PAE A;  3VP0 A;  3QNB A;  3M6H A;  3UNW A;  4GZB A;  5TGF A;  5FDH A;  2QZ6 A;  3DTM A;  2XLN A;  2E8I A;  1FR6 A;  3VOY A;  2EX6 A;  3ZG0 A;  3PBN A;  2EX9 A;  1S0W A;  1NXY A;  1KE0 A;  1XA1 A;  4BJP A;  4EBL A;  3P98 A;  5AQB A;  4B88 A;  3OPH A;  4WBG A;  5GLD A;  1W8Y A;  3ZG5 A;  3VP2 A;  1L0F A;  1ZKJ A;  3M2K A;  1XP4 A;  2ZMA A;  1IYS A;  2ZQA A;  3DWK A;  2H10 A;  2XD1 A;  5GLA A;  5FA7 A;  5FQJ A;  3IF6 C;  3C7V A;  1M6K A;  2X01 A;  3IQA A;  1IEL A;  4DXC A;  3VP3 A;  1RGZ A;  5G18 A;  4GNU A;  5CTN A;  4BEN A;  2EX2 A;  3IXG A;  1GHP A;  3OPR A;  5EVI B;  4WMC A;  3ZG8 B;  1CEG A;  5FAT A;  5CEB A;  1O7E A;  1YLT A;  4QY6 A;  5FQQ A;  3UPP A;  1NYM A;  5M19 A;  4UHU A;  2WYX A;  1YLJ A;  2ZC4 B;  5A90 A;  4KG5 A;  2DCF A;  1KDS A;  1LHY A;  1NRF A;  4PM6 A;  3IXD A;  4R0Q A;  3UN7 A;  4Y7P A;  3UO9 A;  4F94 A;  1ZG6 A;  2R9W A;  5CEC A;  2X71 A;  4U0T A;  3HLG A;  1E3U A;  2XR0 A;  3HLE A;  1LL5 A;  3LY3 A;  5EPH A;  4JKT A;  2A49 A;  5AQA A;  4EBP A;  2EXB A;  4JXW A;  3LCE A;  4JLF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...