3G2ZA

Ctx-m-9 class a beta-lactamase complexed with compound 2 (gz2)
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
262
structure length
262
Chain Sequence
TSAVQQKLAALEKSSGGRLGVALIDTADNTQVLYRGDERFPMCSTSKVMAAAAVLKQSETQKQLLNQPVEIKPADLVNYNPIAEKHVNGTMTLAELSAAALQYSDNTAMNKLIAQLGGPGGVTAFARAIGDETFRLDRTEPTLNTAIPGDPRDTTTPRAMAQTLRQLTLGHALGETQRAQLVTWLKGNTTGAASIRAGLPTSWTAGDKTGSGDYGTTNDIAVIWPQGRAPLVLVTYFTQPQQNAESRRDVLASAARIIAEGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactamase CTX-M-9a
publication title Molecular docking and ligand specificity in fragment-based inhibitor discovery
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase/hydrolase inhibitor
total genus 93
structure length 262
sequence length 262
chains with identical sequence B
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2009-02-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 3g2zA00
1MPLA 1QMFA 4WEJA 5FATA 3ZNTA 4QJGA 4U3TA 4PM7A 4OQ0A 3MBZA 5CERA 5FQ9A 2Y2GA 3BFGA 4QU3A 2HDUA 3HREA 5GLBA 3NC8A 1PW8A 1BZAA 2ZQ7A 1K6SA 2EFUA 1ZG6A 2H5SA 4ZAMA 4N9LA 3PBRA 3HL9A 4JPMA 4EBLA 2BLSA 5F1FA 3GV9A 4X53A 3S22A 3ZVTA 1YLYA 4JBFA 1VM1A 2H0TA 5EVIA 2Y2JA 3WS0A 4GD8A 4LENA 1LL9A 4OPQA 5M1AA 3NBLA 5E2FA 3FWLA 4FCFA 1KVMA 3G32A 3IQAA 4GDBA 1N9BA 3C7VA 3G2ZA 3WS1A 3GRJA 2XGNA 3BRMA 1BSGA 3G2YA 3IXBA 4S2IA 2ZC3B 4KQOA 4LCMA 3V3SA 1ERMA 1FR6A 3O3VA 4OPRA 1I5QA 4BL2A 3IWQA 4BL3A 2P9VB 1BLSA 2R9WA 2XEPA 4KENB 4R1GA 4RA7A 1Q2QA 3IWOA 5E43A 1XP4A 1HTZA 4K0XA 4ZTKA 3WS4A 4XUXA 5EECA 2PBYA 4P6BA 1IYSA 1GHIA 2Y2QA 4GDNA 2BG1A 2DCFA 1XA7A 4KZ9A 5FQIA 1AXBA 3Q82A 1HVBA 3C5AA 5EVID 3IWIA 4C6YA 4MBKA 4FH2A 3NDEA 4U0XA 3ZFZA 3UO9A 3VP4A 1PZPA 1SDNA 3NY4A 2EX9A 4L0LA 1K57C 3Q81A 4S2PA 3WRTA 3ZG9B 3SS5A 4WYYA 1PWCA 2WKEA 3GSGA 3A3FA 3UE0A 5JYOA 2OV5A 3IHBA 5EE8A 3BECA 1YLWA 3HLBA 4IBRA 4DE2A 1ESUA 4GKUA 1YM1A 2V20A 3FZCA 4GZBA 3D4FA 1K56D 1KE3A 2PU2A 5CRFA 1PZOA 2J9PA 1PI4A 3PAEA 4S2KA 1IELA 3G30A 5DTKA 5FQJA 2Q9NA 5EUAA 4DE0A 4WMCA 3BEBA 1E3UA 2ZM2A 5A93A 4E3KA 3CZDA 3FKVA 3RXWA 2WUQA 4Y0TA 3E2KA 4S2LA 4KQQA 2Y2HA 5HAIA 1YLJA 3FKWA 5CEDA 4E6XA 5F83A 4DE3A 3V5MA 5AQBA 3DTMA 4N1XA 1NZOA 3UPNA 3HLWA 4JLFA 4DDSA 3Q7VB 1DJAA 2QZ6A 4QY5A 3TG9A 2XD1A 4WEKA 3HLEA 1IYQA 5DVAA 3IT9A 3SH9A 3ZG8B 4WZ4A 4X69A 3MZFA 1IKIA 5J8XA 4EUZA 1ZG4A 3UDFA 1XGIA 3LO7A 3PBSA 5FQMA 1NY0A 4N92A 1ESIA 2X01A 4WBGA 1LL5A 4JXVA 4X56A 2HDQA 1PYYA 3UDXA 2ZM8A 4WELA 2EFXA 2XDMA 3A3JA 1BTLA 4R4SA 4DXBA 2J8YA 2Z2MB 1JTGA 4LV1A 4WMCD 5DF7A 2I72A 4OPZA 1E3UD 1W79A 5EVIB 1KGGA 1PI5A 3OPRA 1M6KA 4RX3A 2ZQ9A 3UN7A 5DTTA 3QNCA 3W8KA 1ZC2A 2X71A 4JXWA 4OVDA 1NYMA 3FV7A 1K38A 4NETA 4DXCA 3ZG5A 4OONA 1ERQA 5A90A 3OPPA 1YQSA 2Y2IA 1NRFA 1W8QA 2VGKA 4RVAA 5GHYA 1S6RA 3CJMA 3ITBA 3W4PA 5EPHA 4IVKA 1EROA 3UE1A 4KZ3A 4ZJ3A 1MY8A 3UPPA 1SKFA 4UA6A 3CG5A 2EX6A 4FSFA 4GNUA 4KZ5A 5GHXA 4CPKA 4UA7A 1W8YA 4EBNA 2ZQCA 3IXDA 4QD4A 2ZMAA 4PM9A 2JE5A 2ZC7A 1KE0A 4OKPA 3G4PA 4IBXA 5DF8A 4OLGA 1RGZA 1W5DA 3NIAA 1K55A 4OQIA 4EBPA 5JYPA 1K4EA 2Y91A 3A3EA 1NZUA 3HUNA 1E25A 4FH4A 4KZAA 4OOLA 3M2KA 1K55C 4E3IA 1FCOA 3C7UA 1PIOA 1FR1A 3HLCA 2RL3A 4ID4A 4HESA 4KZ8A 1MWTA 3RJUA 1GA0A 1OMEA 3VSKA 4NK3A 3G35A 1K25A 5CGWA 1Q2PA 5G18A 3TOIA 3IF5A 3SOIA 5FI6A 1IKGA 1CEFA 2P74A 5HAPA 1ALQA 3BFDA 4BJPA 5FQKA 4O7DA 2XK1A 1ES4A 1GCEA 5HARA 1FSYA 4KZ7A 1CI9A 4PMAA 4R0QA 2J7VA 2ZD8A 5CTMA 5FAOA 2HDRA 4QB8A 3S1YA 3G34A 1K57A 3W4OA 1VQQA 3AGEA 2ZQ8A 2A49A 1K4FA 1BT5A 4EQIA 3MKFA 4X68A 5GLAA 4MLLA 3IF6C 1G68A 2RCXA 2Z2LB 2C6WB 4RX2A 3BFFA 3VP3A 3B3XA 4KQRA 1KDSA 3MZDA 1W7FA 3S4XA 4EV4A 4FD8A 1MWSA 5CGXA 4PM5A 2ZJ9A 4P85A 4IEDA 4OPYA 4JF4A 5CEBA 5M18A 4LV0A 5M19A 4E3NA 1KGEA 2V1ZA 4S2NA 4HEFA 3VOZA 3V39A 4F94A 4EWFA 4UHUA 1MWRA 5CHMA 3NCKA 4RYEA 4BENA 4ZBEA 4WZ5A 3VSLA 4BQMA 4DF6A 1PWDA 3N7WA 3MXRA 4KZ4A 4S2NC 1H8ZA 1FCNA 1S0WA 1MKIA 1PW1A 1O7EA 3GMWA 3Q7ZA 4S2JA 5IHVA 5HW3A 2WZXA 3OPLA 4LV2A 5L2FA 4WZ5C 3VMAA 4YINA 4ZJ2A 5GHZA 4MNRA 5EOEA 1RCJA 3MKEA 3UNWA 1BLCA 2IWBA 2V2FF 4GB7A 4QY6A 4WM9A 4N9KA 2FFYA 4P0MA 1JWVA 3RXXA 3IXHA 4UA9A 2XFTA 2Y59A 2OLUA 3PBNA 4CJNA 4Y7PA 5CGSA 3BFCA 3P98A 4DDYA 5I94A 2Y55A 1CI8A 5AQ9A 3N8LA 4JF5A 4BD0A 2WK0A 3QNBA 1WYCA 5DF9A 3I7JA 1K6RA 3HUOA 3N8SA 3OZHA 3SH8A 3JYIA 4N1HA 2WZZA 5A92A 2OSUA 5KSCA 2R9XA 4BD1A 3EQUA 3BM6A 3C4PA 3OCLA 3WRZA 3IH8A 3LY3A 4OQGA 3LCEA 4OOMA 1ES5A 1TDLA 1U60A 2C5WB 3PTEA 4H8RA 4JF6A 4X6TA 3OCNA 4E3MA 1FOFA 2QMIA 3PAGA 1PWGA 2WKIA 1MBLA 2H0YA 3NDGA 4XUZA 4Y0OA 5TFQA 2EX8A 1NYYA 3IXGA 4OLDA 4Y0UA 3BLMA 3UY6A 1I2SA 3BYDA 4DRTA 2X02A 5FA7A 3O86A 1JWPA 3M2JA 2XH9A 3HLFA 1JWZA 2WGIA 3ZG7B 1FCMA 4B88A 1DJCA 2ZC5B 1YLPA 4LV3A 1GHMA 2HDSA 1EI5A 2B5RA 4S2OA 5CHJA 4E3OA 4OQHA 1NJ4A 2WKHA 3LY4A 3MXSA 1L0GA 4C3QA 1Y54A 3P09A 4E3LA 2Y2LA 3HLGA 1ONHA 3GQZA 1YMSA 2HP9A 1SHVA 3BLSA 1LLBA 4M3KA 5FI7A 2HPBA 4R3JA 2XLNA 4KG2A 5DTSA 3ZNYA 5GLDA 5GL9A 1XA1A 2IWCA 1XXMA 2EXAA 4GOGA 5TR7A 1FSWA 1E4DA 1L0DA 4B4XA 5BOHA 3VP1A 3N8RA 3WS5A 1ZKJA 2WAFA 1N4OA 1H8YA 4K0WA 4BLMA 4E6WA 2ZC4B 1GHPA 2CC1A 4K91A 1C3BA 2Y2MA 3PBQA 2ZM0A 3DWZA 3GR2A 4MBHA 3HVFA 1HD8A 4JKTA 1IYPA 2DNSA 3PBOA 4JXSA 2XR0A 2Y2PA 4MBFA 1XX2A 2WGWA 5EVIC 3WWXA 5FDHA 4PM8A 5FQQA 3FYZA 1JTDA 1GA9A 3IF6A 1O07A 3OPHA 3OC2A 3LEZA 2Y2NA 1CK3A 4KZ6A 1RP5A 2OLVA 1KVLA 1Z6FA 2EXBA 1K56A 4PPRA 1YT4A 3EQVA 3Q1FA 1CEGA 3A3DA 1BULA 1L0FA 2XF3A 4JXGA 4DE1A 1QMEA 3SH7A 3VOYA 5KZHA 1M40A 2WYXA 3ZGAB 4KZBA 3HBRA 3SS3A 2G2WA 3DW0A 3ZDJA 3PBTA 5FASA 5E2GA 1FQGA 3UDIA 5TGFA 5E2EA 4DKIA 5FAPA 3ZVWA 2Y2KA 4Z9QA 5U47A 4IVIA 1KE4A 1XGJA 4U0TA 5CECA 4XXRA 3HUMA 1YLTA 2WGVA 1TEMA 5HFOA 3N6IA 4KG5A 3VP0A 3Q07A 2Y4AA 1YLZA 3WS2A 4C75A 3AGFA 4R3BA 1TVFA 1IYOA 3DWKA 2UWXA 1BUEA 2G2UA 1JVJA 1ES2A 1RGYA 2ZQDA 3IH9A 2Q9MA 4YFMA 3A3IA 5D3OA 4D2OA 3GTCA 4OP8A 1EWZA 3VP2A 2JC7A 1WYBA 1G6AA 3IHAA 1ES3A 1LI9A 2P9VA 4HBUA 4KG6A 5EVLA 5F1GA 4ZJ1A 3UE3A 3AGDA 3M6HA 1ONGA 3ZCZA 2ZC6B 4E3JA 3C4OA 1SDEA 5AQ7A 4ZDXA 2WADA 5F82A 3BFEA 1XPBA 4X55A 1DJBA 3E2LA 5CTNA 3CMZA 4Q8IA 3HLDA 1DY6A 3W4QA 2JBFA 4PM6A 2XD5A 3ISGA 5FI2A 1KDWA 4MEZA 1K54A 3G31A 3TSGA 5KMWA 2HP5A 5HL1A 5KSHA 3M6BA 4R4RA 4GN2A 1XKZA 4LCLA 4R23A 1J9MA 3MFDA 4P87A 1K54C 4OH0A 1L2SA 3V3RA 5GLCA 5HAQA 2EX2A 4UAAA 1YMXA 1NXYA 2IWDA 2FFFB 5AQAA 1WE4A 1LI0A 2QPNA 1L0EA 4OP5A 3SS4A 2VGJA 3NI9A 1HZOA 3GVBA 3VFHA 3ITAA 2J9OA 5CHUA 5EOOA 2Y2OA 3O88A 1IEMA 4S2MA 5CXWA 2GDNA 1MXOA 1H5XA 2DRWA 2E8IA 2HP6A 2PU4A 3O87A 5FSRA 3UPOA 2WAEA 5A91A 1SCWA 2H10A 3ZHHA 1TDGA 5E2HA 4A5RA 3QHYA 4B4ZA 3N4IA 3V50A 1MWUA 1BLPA 2JCHA 2ZLYA 3VFFA 4GD6A 2WGWB 1LHYA 5FAQA 3MZEA 1KGFA 4OOYA 4HBTA 5HX9A 3ZG0A 1I2WA 2XFSA 2ZQAA 3IF6B 1BLHA 4QHCA 2A3UA 3Q7VA 2XQZA
chains in the Genus database with same CATH superfamily
3ZNTA 3MBZA 5CERA 2Y2GA 4QU3A 4PHTA 2EFUA 4N9LA 3HL9A 1VM1A 5EVIA 3WS0A 1LL9A 5E2FA 1KVMA 4GDBA 3C7VA 3KYZA 3WS1A 3GRJA 1BSGA 3G2YA 2ZMFA 3IXBA 4KQOA 3V3SA 4NXFA 3MF0A 2P9VB 2EWVA 3IWOA 4DMZA 1HTZA 4ZTKA 1N9LA 4XUXA 2PBYA 4ZRRA 3JPUA 1IYSA 3VE3A 2Y2QA 2L4RA 1XA7A 4KZ9A 2VEAA 3Q82A 3T1QB 3C5AA 4C6YA 3NDEA 3BY8A 5EM0A 1SDNA 4L0LA 1K57C 3SS5A 4WYYA 3LYXA 3GSGA 5JYOA 5EE8A 3BECA 1YLWA 3MMHA 4G3KA 5HDSA 3HJKA 4F3LA 4GKUA 2V20A 3FZCA 3PHYA 3MS6A 1K56D 2PU2A 1PZOA 1PI4A 3E98A 3G30A 5DTKA 2Q9NA 4WMCA 4NXEA 1E3UA 3FKVA 3RXWA 2WUQA 1FILA 1V9YA 3E4QA 4KQQA 2Y2HA 4HI4A 5HAIA 3FKWA 5CEDA 4E6XA 4DE3A 3V5MA 5AQBA 3DTMA 3P01A 4HH2A 4YOFA 1DJAA 4QY5A 4HP4A 3SH9A 1IKIA 2ACGA 4EUZA 1ZG4A 2JKGA 1XGIA 5FQMA 1ESIA 4WBGA 4JXVA 4WELA 3DTEA 5HL6A 2GNXA 2GX5A 3A3JA 4CLCE 4DXBA 4Y2FA 5DF7A 2I72A 1W79A 3FPWA 3OPRA 4FOFA 2ZQ9A 4L9FA 3ZG5A 3IX4A 1ERQA 5AVFA 3OPPA 2Y2IA 3A0VA 2D02A 3EOIA 2O9CA 3CG5A 2EX6A 5GHXA 2MJ6A 4UA7A 1W8YA 4BMWA 4PM9A 4OKPA 3G4PA 3H7WB 4IBXA 1RGZA 3S7NA 1K55A 4HP9A 1K4EA 3T12B 2WKPA 1E25A 3C7UA 2QJ7A 1OMEA 3D72A 3KSHA 2P74A 1ALQA 4GS9A 5DJTA 4XT2B 4O7DA 2XK1A 4B93A 1NWZA 5DJUA 3KYEA 4HY8A 4IUHA 2K7SA 2ZD8A 2HDRA 3G34A 2PYRA 4D60A 1K57A 3S7PA 1VQQA 4EEPA 4BWIA 1S1ZA 1G68A 2C6WB 1YSQA 4RX2A 3EGDC 2V8CA 1BYWA 1W7FA 4P85A 1K0KA 4LV0A 1KGEA 4HEFA 3VOZA 4EWFA 3NCKA 2V0WA 4BENA 4WZ5A 3VSLA 4S2NC 3W2ZA 1MKIA 1PW1A 5IHVA 2WZXA 4LV2A 5L2FA 3KSIA 4BBTA 3PYPA 2G7UA 5EOEA 5HWTA 1BLCA 4HJ3A 2V2FF 2GZAA 5DKKA 4UA9A 3UMEA 1PRQA 4EW7A 1STZA 3PBNA 5CGSA 1T1AA 2BTFP 1CI8A 4ETZA 3N8LA 3UB8A 1WYCA 5DF9A 3N8SA 3HUOA 3OZHA 1W63M 4N1HA 1VB6A 3EQUA 3EEAA 3OCLA 4OQGA 1VEUA 4G3WA 2C5WB 3PTEA 4JF6A 3OCNA 4MMNA 1PWGA 2H0YA 3VV4A 3KSGA 1ODVA 4Y0UA 3UY6A 1XFNA 4DRTA 1I2SA 3CI6A 2X02A 3IBRA 4PKYA 4EERA 4I3AA 4YNRA 2HGVA 1F98A 2HDSA 4S2OA 1L0GA 1Y54A 2Y2LA 3RH8B 1IFQA 2JKRM 4H6JA 1NRJA 5L10A 5FI7A 2HPBA 5DTSA 2IWCA 2EXAA 1FSWA 4GHIB 3WS5A 1ZKJA 1GHPA 4K91A 2Y2MA 3PBQA 4CQHA 4MBFA 1XX2A 5FDHA 3FYZA 3C8CA 3OPHA 3LEZA 4KZ6A 1RP5A 1TF1A 4E04A 1K56A 3Q1FA 1BULA 2L0WA 5F69A 1QMEA 1M40A 3ZDJA 3MXQA 3C38A 4WUJA 4IVIA 1XGJA 4U0TA 3MFXA 3VP0A 1YLZA 2Y79A 1TVFA 1IYOA 3DWKA 1JVJA 1ES2A 5D3OA 2Q9MA 2YKFA 3A3IA 3ICYA 2YKHA 5EVLA 4KG6A 4ZJ1A 2VGLS 5L07A 3UE3A 1ONGA 2JKTM 2QWSA 2VZWA 2ZC6B 1SDEA 2WADA 2M7VA 3HLDA 2XD5A 3ISGA 5KMWA 5HL1A 5KSHA 4R4RA 1XKZA 4R23A 1XJ6A 4ARZB 1K54C 5CX7A 3V3RA 3LIDA 1OTEA 2O9BA 4UAAA 1LSWA 2W1TA 2XA7S 3NI9A 3GVBA 2J9OA 5CHUA 2Y2OA 1H5XA 2E8IA 3O87A 2WAEA 1OTAA 4A5RA 1TDGA 5E2HA 3V50A 2JCHA 1BLPA 3IS2A 3CUEC 5IU1A 2JKRI 5FAQA 1KGFA 4HBTA 3ZG0A 2L1MA 2QKPA 3Q7VA 4QJGA 3IX8A 2GJ3A 1ACFA 3BFGA 2HDUA 4I39A 1PW8A 2ZQ7A 3BQ8A 1K6SA 1ZG6A 4ZAMA 1IOUA 5F1FA 4X53A 2K2NA 1YLYA 4JBFA 2H0TA 2Y2JA 4O0PA 1V9ZA 3T4SA 5M1AA 3NOUC 4IHQA 4GJ4A 4FCFA 3H82B 3G32A 4Q0IA 1OT9A 5HD5A 2KOIA 1W63Q 4OPRA 3IX3A 2ZL1A 1BLSA 3S7QA 4R1GA 1XP4A 3WS4A 2O99A 4P6BA 2EWWA 3OBFA 2DCFA 3GECA 3ZFZA 3UO9A 3VP4A 4S2PA 3WRTA 1PWCA 3UE0A 1VHMA 1YM1A 3P7NA 1KE3A 2J9PA 1IELA 3F1OB 2W0NA 2W1RA 3CZDA 4Y0TA 5KIZA 1S1YA 4S2LA 1GSWA 5DKLA 4BBVA 4JLFA 5TBMB 2QZ6A 3LI8A 4WEKA 1KOUA 3HLEA 5DVAA 3ZG8B 3LIAA 3DBAA 3UDXA 2ZM8A 2EFXA 1NLYA 2Z2MB 1JTGA 5EVIB 4OPZA 2W27A 1KGGA 1PI5A 3QNCA 3W8KA 2X71A 2ZOIA 4JXWA 5C5KA 1W8QA 4NXBA 5GHYA 1S6RA 3CJMA 4IVKA 3S7OA 3JVUA 2B95A 4KZ3A 5DFYA 1SKFA 2E8JA 2JE5A 2A24A 3NIAA 3DTKA 1NZUA 4P6ZS 1LSXA 4OOLA 2HF6A 1K55C 1FCOA 1PIOA 1FR1A 4ID4A 4KZ8A 3RJUA 3KSFA 5G18A 3SOIA 5FI6A 5HAPA 3BFDA 5FQKA 1MZUA 1ES4A 2OOLA 2W3FA 1CI9A 4PMAA 4R0QA 1T18A 2VKSA 3W4OA 3AGEA 2ZQ8A 4NG2A 1BT5A 4EQIA 3D3OA 4B9OA 4MLLA 5EVEA 2PRFA 4HH3A 3VP3A 3MZDA 3S4XA 4FD8A 1MWSA 1TS0A 3F1NA 1SKOA 5EFWA 3MXRA 4KZ4A 3UB5P 1FCNA 1O7EA 4S2JA 3D9YA 4WZ5C 3VMAA 4YINA 4EESA 2B18A 5GHZA 4JGQA 1RCJA 3T4JA 3LR0A 4CLCA 4GB7A 4QY6A 4WM9A 2FFYA 1JWVA 3IXHA 4M4XA 1OTDA 3QP5A 3A0RA 4BBUA 5AVEA 3LEQA 2W3GA 2WK0A 3QNBA 1K6RA 1OJ5A 2EA9A 3SZTA 4BD1A 4HOIA 1TS8A 3TJZC 4OOMA 1U60A 4GS9B 1FOFA 2PAVP 4Y0OA 4XUZA 2EX8A 4HNBA 3IXGA 3BLMA 5FA7A 3O86A 2KDKA 2XH9A 2WGIA 3ZG7B 2W3HA 1FCMA 2J3TD 4LV3A 1GHMA 1EI5A 3ULFA 5CHJA 4E3OA 3LY4A 2WKHA 2BASA 3DAVA 3MXSA 4C3QA 3UB9A 4E3LA 2P04A 3GQZA 1YMSA 3LR4A 1LLBA 2XLNA 5GLDA 1XA1A 4GOGA 1L0DA 4O01A 4B4XA 4BLMA 1N4OA 4E6WA 2V8FA 1C3BA 4LRZE 4MBHA 3GR2A 4JKTA 2XR0A 2Y2PA 2WGWA 3EWKA 4PM8A 1JTDA 4MN6A 1GA9A 4K08A 3EGXC 5HPIA 2O0YA 1CK3A 1VETA 2OLVA 4II7A 4FUWA 2QHKA 2M1CA 4Y3IA 4JXGA 4DE1A 1TS6A 3SH7A 3VOYA 4LFUA 3ZGAB 4JGRA 3DW0A 5E2GA 3ZVWA 1LT0A 5U47A 3LIBA 1WA9A 4R3AA 2FH5A 3F1PA 1YLTA 4C75A 3AGFA 2ZQDA 2G2UA 1RGYA 5J3WA 4D2OA 4XT2A 2JC7A 1WYBA 1G6AA 5F1GA 1LI9A 1G28A 1VEUB 1XJ3A 3ZCZA 3C4OA 4WLAA 3T4KA 1XPBA 3CLOA 1D06A 3W4QA 3G31A 4X1LA 5I5LA 2QJ5A 5FEFA 1H0MA 1L2SA 5GLCA 3CPTA 2VK3A 3EEHA 4H6JB 1WE4A 1LI0A 2QPNA 4OP5A 4PKYG 3UE6A 2VGJA 1HZOA 4EEUA 3VFHA 3O88A 2GDNA 2DRWA 3UPOA 1SCWA 1H3QA 1MWUA 2ZLYA 2XRNA 3ZYTA 4UEYA 5HX9A 2ZQAA 4QHCA 1MPLA 5FATA 4PM7A 1UGUA 1OJGA 3HREA 5GLBA 2H5SA 3PBRA 4JPMA 3S22A 4GD8A 4OPQA 2VJWA 4GW9A 4JGOA 1N9BA 4Y13A 3BRMA 4S2IA 4LCMA 1ERMA 4UQIM 1F5MA 1I5QA 3MJQA 2DMWA 4BL2A 3IWQA 2R9WA 4RA7A 3B47A 2W3DA 3O5YA 3HJIA 1GHIA 4GDNA 4NXGA 1A0KA 2BG1A 5FQIA 1AXBA 1UWPX 5EVID 3IWIA 4FH2A 4U0XA 1PZPA 3NY4A 3BY9A 1CQAA 2PDRA 2PR6A 5J4EA 5HD3A 3IHBA 3NULA 3JVVA 2KLIA 2W1TB 1YAXA 3LGOA 4GZBA 3D4FA 5CRFA 3PAEA 4DE0A 5EUAA 5A93A 3CHWP 4E3KA 3E2KA 3T1RA 1YPRA 5F83A 1NZOA 2P08A 3HLWA 2NUTC 2PYPA 3QP8A 3Q7VB 3TG9A 2XD1A 1DP8A 1IYQA 3IT9A 4WZ4A 3FC7A 5J8XA 3BJNA 3LO7A 4G3VA 4N92A 1PFLA 2X01A 4GLQA 2XROA 1T1BA 1OPXA 2XDMA 4ME4A 1BTLA 2R78A 4R4SA 1MC0A 4WMCD 1E3UD 2NUPC 5DTTA 1CF0A 3FV7A 2Q0OA 4NETA 4OONA 3FPVA 5A90A 1YQSA 1N9OA 2VGKA 3ITBA 3KYQA 1MY8A 4QPRA 3UPPA 2ZL1B 4UA6A 1OT6A 4KZ5A 2HZ5A 4CPKA 2VA0A 2ZMAA 1DP9A 1YKDA 2J3WA 5DF8A 4OLGA 4HIAA 4OQIA 3T4TA 4EBPA 2Y91A 2V1AA 3A3EA 3E4PA 4KZAA 3M2KA 1S4SA 2P7JA 3HLCA 2A2LA 1TS7A 3VSKA 3G35A 1Q2PA 3TOIA 3IF5A 3UB6A 1IKGA 4MN5A 4Y17A 4BJPA 4IJGA 3UB7A 5HARA 3A0SA 1FSYA 3MR0A 2J7VA 5FAOA 4QB8A 3S1YA 3ZQ5A 4MCWA 2WKQA 2A49A 2W3EA 3LR3A 2OAP1 3MKFA 5GLAA 5FL3A 1AWIA 3IF6C 2RCXA 5J7EA 3B3XA 4O8GA 2IA2A 4EV4A 5MC7A 5CGXA 4AFIA 2ZJ9A 4IEDA 3T4QA 4ETXA 5HSQA 5CEBA 4E3NA 2V1ZA 3LICA 3T50A 4F94A 3MQ0A 5F5YA 1MWRA 4BQMA 4ZBEA 1PWDA 3N7WA 2PBDP 3SW1A 4ZJ2A 2OAQ1 3MKEA 3UNWA 4PAUA 4HQAA 2Y8HA 1P9WA 2XFTA 2A24B 4LLOB 2Y59A 1L3LA 2OLUA 4CLCC 5I94A 3P98A 3T4OA 4JF5A 2H28A 1LL8A 2OSUA 2R9XA 5KSCA 3WRZA 3LY3A 3LCEA 1D1JA 4LRXC 2J80A 1ES5A 1TDLA 3RFBA 4E3MA 3NOTC 3PAGA 3NOPC 1MBLA 5F6AA 4Y5FA 2AVXA 5L09A 3QP6A 1NYYA 4OLDA 4WL9A 3C2WA 3M2JA 2Z6CA 1JWZA 1DJCA 2ZC5B 5TBMA 1EW0A 4DJ2A 1DP6A 3V67A 1NLZA 2HP9A 3BLSA 4KG2A 3ZVTA 1XXMA 2V1BA 4X25A 4F3LB 2OWJA 3VP1A 5EM1A 5BOHA 4K0WA 1H8YA 2CC1A 2HJ9C 1T19A 3BW6A 3F1NB 3R7WA 3DWZA 2VV7A 1SKOB 1HD8A 3WWXA 5FQQA 3IF6A 1O07A 3OC2A 2ZMVA 1KVLA 1D7EA 1YT4A 3EQVA 4R6LA 1L0FA 3LR5A 4I38A 1LSVA 2D01A 5KZHA 4KZBA 3SS3A 4CLCB 2G2WA 3K3DA 1FQGA 3UDIA 4KQDA 5FAPA 1KE4A 2ZOHA 1GSXA 5CECA 4KG5A 3Q07A 3WS2A 2UWXA 1BUEA 3IH9A 4YFMA 3R4KA 3L7HA 1EWZA 2P9VA 3AGDA 3M6HA 4E3JA 2JN7A 4X1MA 5F68A 4ZDXA 4X55A 3E2LA 5CTNA 3CMZA 1DY6A 5FI2A 1KDWA 4MEZA 2V9AA 3TSGA 4GN2A 3T1XA 4P87A 4OH0A 1P97A 4IUKA 2IWDA 4FTXA 2FFFB 5AQAA 4NEED 2HV1A 1MKMA 1IEMA 5CXWA 1S4RA 3LFVA 2HP6A 2PU4A 3TW8A 2H10A 3N4IA 2WGWB 3MQOA 4OOYA 2KX6A 1I2WA 2XFSA 1BLHA 2A3UA 1QMFA 4WEJA 1VETB 4U3TA 4OQ0A 5FQ9A 1T1CA 5TJJA 3NC8A 3VE4A 1BZAA 4EBLA 2OWHA 3LIFA 2BLSA 3GV9A 4LENA 3TE8A 3NBLA 3F1PB 3FWLA 3IQAA 2I9VA 3G2ZA 2XGNA 3DTIA 1CJFA 2ZC3B 1FR6A 3O3VA 4BL3A 4KENB 2XEPA 1Q2QA 5E43A 3PR6A 1S67L 4K0XA 2UV0E 5EECA 3H7WA 3BQAA 3CITA 5L8MA 2JHEA 1HVBA 5G4ZA 4MBKA 2V0UA 3VOLA 4HHDA 5HWWA 2EX9A 2WKRA 3Q81A 3ZG9B 2WKEA 3CPTB 3A3FA 1S66L 2OV5A 3HLBA 4IBRA 4DE2A 1ESUA 3OLOA 3QP4A 2JKFA 4RQ9A 4S2KA 4LPZA 2VV8A 2LB9A 5FQJA 3BEBA 3CAXA 2ZM2A 4L9GA 1YLJA 4EQ1A 4Q0HA 4MN7A 3UPNA 4N1XA 2PT7A 5DFXA 4DDSA 3K3CA 4X69A 3MZFA 3UDFA 3PBSA 1NY0A 3NJAA 1LL5A 4X56A 2HDQA 1PYYA 3HCYA 2J8YA 4LV1A 5HDDA 4RX3A 1M6KA 1F9IA 3UN7A 3TRCA 5LBRA 1ZC2A 4OVDA 1NYMA 1K38A 4DXCA 2J3TC 1NRFA 3CWFA 4RVAA 3T4LA 1UWNX 3W4PA 5EPHA 3UE1A 1EROA 4ZJ3A 2M7UA 4FSFA 4GNUA 4EBNA 2ZQCA 3IXDA 4QD4A 2VGLM 2ZC7A 1KE0A 5HWVA 1W5DA 5JYPA 3HUNA 4FH4A 4Y15A 5G4YA 4E3IA 4WF0A 2RL3A 4HESA 1MWTA 1GA0A 4NK3A 1K25A 5CGWA 1CEFA 4WN5A 4HJ4A 2QYBA 2XA7M 2PR5A 2O9AA 1GCEA 4LRYC 3B42A 4KZ7A 1FIKA 1PNEA 1ZTUA 5CTMA 1G6OA 5HZHA 1K4FA 3MQQA 4X68A 3LI9A 2Z2LB 3BFFA 5EV0A 2CMNA 2PD8A 4KQRA 1KDSA 2VLGA 1OTIA 3E0YA 4PM5A 4GHIA 4OPYA 4JF4A 2Z6DA 4EU0A 5M18A 1Y28A 5M19A 4S2NA 3V39A 3FG8A 4UHUA 5CHMA 4RYEA 4DF6A 3IS2B 5FDSA 1H8ZA 1S0WA 3Q7ZA 3GMWA 5HW3A 3OPLA 4I3JA 4HJ6A 3E4OA 3GDIA 4MNRA 2B02A 1N9NA 5IS1A 4I5SA 2INWA 2IWBA 3QP2A 4N9KA 4P0MA 3RXXA 5HPFA 4CJNA 3B33A 4Y7PA 3BFCA 4DDYA 2FZ0A 2Y55A 5AQ9A 3PXPA 4BD0A 3I7JA 4YWZA 1J3WA 4JGPA 3SH8A 3JYIA 4UQIS 2ZBBA 3LUQA 2WZZA 4KUOA 5A92A 1Y4OA 3QP1A 3BM6A 3C4PA 3IH8A 3KO6A 1P9RA 3H9WA 1XFQA 4H8RA 4X6TA 1G5UA 2QMIA 4CLCD 2WKIA 3NDGA 5TFQA 2PD7A 3C30A 5A8BA 1GSVA 3T1SA 3BYDA 4GCZA 2HJEA 1JWPA 3HLFA 3MSHA 4B88A 3G6OA 5HDCA 1YLPA 4ARZA 2B5RA 5FEGA 2LB5A 4OQHA 5IT5A 1NJ4A 3OOVA 3UMDA 3P09A 3HLGA 1ONHA 3KX0X 1XJ2A 1DRMA 1SHVA 4M3KA 4R3JA 3ZNYA 5GL9A 5TR7A 1E4DA 2VX8A 3N8RA 2WAFA 4LGWA 2ZC4B 4QWOA 2ZM0A 4MDZA 1XJ4A 3HVFA 4EUVA 1IYPA 2DNSA 3PBOA 4JXSA 5EVIC 1X0OA 2PHYA 2Y2NA 5AJGA 2EXBA 1Z6FA 4DN0A 2XSSA 3K2NA 4PPRA 4EETB 1CEGA 3A3DA 1H8MA 2XF3A 2WYXA 3HBRA 4R70A 3PBTA 5FASA 5TGFA 5E2EA 4DKIA 1P0ZA 2Y2KA 4Z9QA 4XXRA 3HUMA 3H82A 2WGVA 1TEMA 5HFOA 3N6IA 2JKTI 2Y4AA 4P6ZM 4Q0JA 4R3BA 1SZVA 3NHQA 3GTCA 3VP2A 4HBUA 3IHAA 1ES3A 1JNUA 2K31A 4ESPA 1F2KA 5AQ7A 4KUKA 5F82A 3BFEA 4R38A 1DJBA 3U4LP 4Q8IA 4EXOA 2JBFA 4PM6A 3IBJA 2VV6A 1K54A 4I3IA 2HP5A 1TD5A 5K5BA 3M6BA 4LCLA 1J9MA 3MFDA 3BWLA 1HLUP 5HAQA 4NKPA 2EX2A 1YMXA 1NXYA 3L9KA 3U2AA 1L0EA 3RTYA 3SS4A 1OTBA 3ITAA 5EOOA 1YSPA 4L9EA 4S2MA 3F1OA 3CUEA 1Z09A 1MXOA 5FSRA 3R7WB 5A91A 4Z1WA 3ZHHA 4B4ZA 3QHYA 4DJ3A 3VFFA 4GD6A 1LHYA 3MZEA 3LIEA 2XQZA 1ZHHB 3IF6B 4OP8A 3NECA
chains in the Genus database with same CATH topology
1MPLA 1QMFA 4WEJA 5FATA 3ZNTA 4QJGA 4U3TA 4PM7A 4OQ0A 3MBZA 5CERA 5FQ9A 2Y2GA 3BFGA 4QU3A 2HDUA 3HREA 5GLBA 3NC8A 1PW8A 1BZAA 2ZQ7A 1K6SA 2EFUA 1ZG6A 2H5SA 4ZAMA 4N9LA 3PBRA 3HL9A 4JPMA 4EBLA 2BLSA 5F1FA 3GV9A 4X53A 3S22A 3ZVTA 1YLYA 4JBFA 1VM1A 2H0TA 5EVIA 2Y2JA 3WS0A 4GD8A 4LENA 1LL9A 4OPQA 5M1AA 3NBLA 5E2FA 3FWLA 4FCFA 1KVMA 3G32A 3IQAA 4GDBA 1N9BA 3C7VA 3G2ZA 3WS1A 3GRJA 2XGNA 3BRMA 1BSGA 3G2YA 3IXBA 4S2IA 2ZC3B 4KQOA 4LCMA 3V3SA 1ERMA 1FR6A 3O3VA 4OPRA 1I5QA 4BL2A 3IWQA 4BL3A 2P9VB 1BLSA 2R9WA 2XEPA 4KENB 4R1GA 4RA7A 1Q2QA 3IWOA 5E43A 1XP4A 1HTZA 4K0XA 4ZTKA 3WS4A 4XUXA 5EECA 2PBYA 4P6BA 1IYSA 1GHIA 2Y2QA 4GDNA 2BG1A 2DCFA 1XA7A 4KZ9A 5FQIA 1AXBA 3Q82A 1HVBA 3C5AA 5EVID 3IWIA 4C6YA 4MBKA 4FH2A 3NDEA 4U0XA 3ZFZA 3UO9A 3VP4A 1PZPA 1SDNA 3NY4A 2EX9A 4L0LA 1K57C 3Q81A 4S2PA 3WRTA 3ZG9B 3SS5A 4WYYA 1PWCA 2WKEA 3GSGA 3A3FA 3UE0A 5JYOA 2OV5A 3IHBA 5EE8A 3BECA 1YLWA 3HLBA 4IBRA 4DE2A 1ESUA 4GKUA 1YM1A 2V20A 3FZCA 4GZBA 3D4FA 1K56D 1KE3A 2PU2A 5CRFA 1PZOA 2J9PA 1PI4A 3PAEA 4S2KA 1IELA 3G30A 5DTKA 5FQJA 2Q9NA 5EUAA 4DE0A 4WMCA 3BEBA 1E3UA 2ZM2A 5A93A 4E3KA 3CZDA 3FKVA 3RXWA 2WUQA 4Y0TA 3E2KA 4S2LA 4KQQA 2Y2HA 5HAIA 1YLJA 3FKWA 5CEDA 4E6XA 5F83A 4DE3A 3V5MA 5AQBA 3DTMA 4N1XA 1NZOA 3UPNA 3HLWA 4JLFA 4DDSA 3Q7VB 1DJAA 2QZ6A 4QY5A 3TG9A 2XD1A 4WEKA 3HLEA 1IYQA 5DVAA 3IT9A 3SH9A 3ZG8B 4WZ4A 4X69A 3MZFA 1IKIA 5J8XA 4EUZA 1ZG4A 3UDFA 1XGIA 3LO7A 3PBSA 5FQMA 1NY0A 4N92A 1ESIA 2X01A 4WBGA 1LL5A 4JXVA 4X56A 2HDQA 1PYYA 3UDXA 2ZM8A 4WELA 2EFXA 2XDMA 3A3JA 1BTLA 4R4SA 4DXBA 2J8YA 2Z2MB 1JTGA 4LV1A 4WMCD 5DF7A 2I72A 4OPZA 1E3UD 1W79A 5EVIB 1KGGA 1PI5A 3OPRA 1M6KA 4RX3A 2ZQ9A 3UN7A 5DTTA 3QNCA 3W8KA 1ZC2A 2X71A 4JXWA 4OVDA 1NYMA 3FV7A 1K38A 4NETA 4DXCA 3ZG5A 4OONA 1ERQA 5A90A 3OPPA 1YQSA 2Y2IA 1NRFA 1W8QA 2VGKA 4RVAA 5GHYA 1S6RA 3CJMA 3ITBA 3W4PA 5EPHA 4IVKA 1EROA 3UE1A 4KZ3A 4ZJ3A 1MY8A 3UPPA 1SKFA 4UA6A 3CG5A 2EX6A 4FSFA 4GNUA 4KZ5A 5GHXA 4CPKA 4UA7A 1W8YA 4EBNA 2ZQCA 3IXDA 4QD4A 2ZMAA 4PM9A 2JE5A 2ZC7A 1KE0A 4OKPA 3G4PA 4IBXA 5DF8A 4OLGA 1RGZA 1W5DA 3NIAA 1K55A 4OQIA 4EBPA 5JYPA 1K4EA 2Y91A 3A3EA 1NZUA 3HUNA 1E25A 4FH4A 4KZAA 4OOLA 3M2KA 1K55C 4E3IA 1FCOA 3C7UA 1PIOA 1FR1A 3HLCA 2RL3A 4ID4A 4HESA 4KZ8A 1MWTA 3RJUA 1GA0A 1OMEA 3VSKA 4NK3A 3G35A 1K25A 5CGWA 1Q2PA 5G18A 3TOIA 3IF5A 3SOIA 5FI6A 1IKGA 1CEFA 2P74A 5HAPA 1ALQA 3BFDA 4BJPA 5FQKA 4O7DA 2XK1A 1ES4A 1GCEA 5HARA 1FSYA 4KZ7A 1CI9A 4PMAA 4R0QA 2J7VA 2ZD8A 5CTMA 5FAOA 2HDRA 4QB8A 3S1YA 3G34A 1K57A 3W4OA 1VQQA 3AGEA 2ZQ8A 2A49A 1K4FA 1BT5A 4EQIA 3MKFA 4X68A 5GLAA 4MLLA 3IF6C 1G68A 2RCXA 2Z2LB 2C6WB 4RX2A 3BFFA 3VP3A 3B3XA 4KQRA 1KDSA 3MZDA 1W7FA 3S4XA 4EV4A 4FD8A 1MWSA 5CGXA 4PM5A 2ZJ9A 4P85A 4IEDA 4OPYA 4JF4A 5CEBA 5M18A 4LV0A 5M19A 4E3NA 1KGEA 2V1ZA 4S2NA 4HEFA 3VOZA 3V39A 4F94A 4EWFA 4UHUA 1MWRA 5CHMA 3NCKA 4RYEA 4BENA 4ZBEA 4WZ5A 3VSLA 4BQMA 4DF6A 1PWDA 3N7WA 3MXRA 4KZ4A 4S2NC 1H8ZA 1FCNA 1S0WA 1MKIA 1PW1A 1O7EA 3GMWA 3Q7ZA 4S2JA 5IHVA 5HW3A 2WZXA 3OPLA 4LV2A 5L2FA 4WZ5C 3VMAA 4YINA 4ZJ2A 5GHZA 4MNRA 5EOEA 1RCJA 3MKEA 3UNWA 1BLCA 2IWBA 2V2FF 4GB7A 4QY6A 4WM9A 4N9KA 2FFYA 4P0MA 1JWVA 3RXXA 3IXHA 4UA9A 2XFTA 2Y59A 2OLUA 3PBNA 4CJNA 4Y7PA 5CGSA 3BFCA 3P98A 4DDYA 5I94A 2Y55A 1CI8A 5AQ9A 3N8LA 4JF5A 4BD0A 2WK0A 3QNBA 1WYCA 5DF9A 3I7JA 1K6RA 3HUOA 3N8SA 3OZHA 3SH8A 3JYIA 4N1HA 2WZZA 5A92A 2OSUA 5KSCA 2R9XA 4BD1A 3EQUA 3BM6A 3C4PA 3OCLA 3WRZA 3IH8A 3LY3A 4OQGA 3LCEA 4OOMA 1ES5A 1TDLA 1U60A 2C5WB 3PTEA 4H8RA 4JF6A 4X6TA 3OCNA 4E3MA 1FOFA 2QMIA 3PAGA 1PWGA 2WKIA 1MBLA 2H0YA 3NDGA 4XUZA 4Y0OA 5TFQA 2EX8A 1NYYA 3IXGA 4OLDA 4Y0UA 3BLMA 3UY6A 1I2SA 3BYDA 4DRTA 2X02A 5FA7A 3O86A 1JWPA 3M2JA 2XH9A 3HLFA 1JWZA 2WGIA 3ZG7B 1FCMA 4B88A 1DJCA 2ZC5B 1YLPA 4LV3A 1GHMA 2HDSA 1EI5A 2B5RA 4S2OA 5CHJA 4E3OA 4OQHA 1NJ4A 2WKHA 3LY4A 3MXSA 1L0GA 4C3QA 1Y54A 3P09A 4E3LA 2Y2LA 3HLGA 1ONHA 3GQZA 1YMSA 2HP9A 1SHVA 3BLSA 1LLBA 4M3KA 5FI7A 2HPBA 4R3JA 2XLNA 4KG2A 5DTSA 3ZNYA 5GLDA 5GL9A 1XA1A 2IWCA 1XXMA 2EXAA 4GOGA 5TR7A 1FSWA 1E4DA 1L0DA 4B4XA 5BOHA 3VP1A 3N8RA 3WS5A 1ZKJA 2WAFA 1N4OA 1H8YA 4K0WA 4BLMA 4E6WA 2ZC4B 1GHPA 2CC1A 4K91A 1C3BA 2Y2MA 3PBQA 2ZM0A 3DWZA 3GR2A 4MBHA 3HVFA 1HD8A 4JKTA 1IYPA 2DNSA 3PBOA 4JXSA 2XR0A 2Y2PA 4MBFA 1XX2A 2WGWA 5EVIC 3WWXA 5FDHA 4PM8A 5FQQA 3FYZA 1JTDA 1GA9A 3IF6A 1O07A 3OPHA 3OC2A 3LEZA 2Y2NA 1CK3A 4KZ6A 1RP5A 2OLVA 1KVLA 1Z6FA 2EXBA 1K56A 4PPRA 1YT4A 3EQVA 3Q1FA 1CEGA 3A3DA 1BULA 1L0FA 2XF3A 4JXGA 4DE1A 1QMEA 3SH7A 3VOYA 5KZHA 1M40A 2WYXA 3ZGAB 4KZBA 3HBRA 3SS3A 2G2WA 3DW0A 3ZDJA 3PBTA 5FASA 5E2GA 1FQGA 3UDIA 5TGFA 5E2EA 4DKIA 5FAPA 3ZVWA 2Y2KA 4Z9QA 5U47A 4IVIA 1KE4A 1XGJA 4U0TA 5CECA 4XXRA 3HUMA 1YLTA 2WGVA 1TEMA 5HFOA 3N6IA 4KG5A 3VP0A 3Q07A 2Y4AA 1YLZA 3WS2A 4C75A 3AGFA 4R3BA 1TVFA 1IYOA 3DWKA 2UWXA 1BUEA 2G2UA 1JVJA 1ES2A 1RGYA 2ZQDA 3IH9A 2Q9MA 4YFMA 3A3IA 5D3OA 4D2OA 3GTCA 4OP8A 1EWZA 3VP2A 2JC7A 1WYBA 1G6AA 3IHAA 1ES3A 1LI9A 2P9VA 4HBUA 4KG6A 5EVLA 5F1GA 4ZJ1A 3UE3A 3AGDA 3M6HA 1ONGA 3ZCZA 2ZC6B 4E3JA 3C4OA 1SDEA 5AQ7A 4ZDXA 2WADA 5F82A 3BFEA 1XPBA 4X55A 1DJBA 3E2LA 5CTNA 3CMZA 4Q8IA 3HLDA 1DY6A 3W4QA 2JBFA 4PM6A 2XD5A 3ISGA 5FI2A 1KDWA 4MEZA 1K54A 3G31A 3TSGA 5KMWA 2HP5A 5HL1A 5KSHA 3M6BA 4R4RA 4GN2A 1XKZA 4LCLA 4R23A 1J9MA 3MFDA 4P87A 1K54C 4OH0A 1L2SA 3V3RA 5GLCA 5HAQA 2EX2A 4UAAA 1YMXA 1NXYA 2IWDA 2FFFB 5AQAA 1WE4A 1LI0A 2QPNA 1L0EA 4OP5A 3SS4A 2VGJA 3NI9A 1HZOA 3GVBA 3VFHA 3ITAA 2J9OA 5CHUA 5EOOA 2Y2OA 3O88A 1IEMA 4S2MA 5CXWA 2GDNA 1MXOA 1H5XA 2DRWA 2E8IA 2HP6A 2PU4A 3O87A 5FSRA 3UPOA 2WAEA 5A91A 1SCWA 2H10A 3ZHHA 1TDGA 5E2HA 4A5RA 3QHYA 4B4ZA 3N4IA 3V50A 1MWUA 1BLPA 2JCHA 2ZLYA 3VFFA 4GD6A 2WGWB 1LHYA 5FAQA 3MZEA 1KGFA 4OOYA 4HBTA 5HX9A 3ZG0A 1I2WA 2XFSA 2ZQAA 3IF6B 1BLHA 4QHCA 2A3UA 3Q7VA 2XQZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MPL A;  1QMF A;  4WEJ A;  5FAT A;  3ZNT A;  4QJG A;  4U3T A;  4PM7 A;  4OQ0 A;  3MBZ A;  5CER A;  5FQ9 A;  2Y2G A;  3BFG A;  4QU3 A;  2HDU A;  3HRE A;  5GLB A;  3NC8 A;  1PW8 A;  1BZA A;  2ZQ7 A;  1K6S A;  2EFU A;  1ZG6 A;  2H5S A;  4ZAM A;  4N9L A;  3PBR A;  3HL9 A;  4JPM A;  4EBL A;  2BLS A;  5F1F A;  3GV9 A;  4X53 A;  3S22 A;  3ZVT A;  1YLY A;  4JBF A;  1VM1 A;  2H0T A;  5EVI A;  2Y2J A;  3WS0 A;  4GD8 A;  4LEN A;  1LL9 A;  4OPQ A;  5M1A A;  3NBL A;  5E2F A;  3FWL A;  4FCF A;  1KVM A;  3G32 A;  3IQA A;  4GDB A;  1N9B A;  3C7V A;  3G2Z A;  3WS1 A;  3GRJ A;  2XGN A;  3BRM A;  1BSG A;  3G2Y A;  3IXB A;  4S2I A;  2ZC3 B;  4KQO A;  4LCM A;  3V3S A;  1ERM A;  1FR6 A;  3O3V A;  4OPR A;  1I5Q A;  4BL2 A;  3IWQ A;  4BL3 A;  2P9V B;  1BLS A;  2R9W A;  2XEP A;  4KEN B;  4R1G A;  4RA7 A;  1Q2Q A;  3IWO A;  5E43 A;  1XP4 A;  1HTZ A;  4K0X A;  4ZTK A;  3WS4 A;  4XUX A;  5EEC A;  2PBY A;  4P6B A;  1IYS A;  1GHI A;  2Y2Q A;  4GDN A;  2BG1 A;  2DCF A;  1XA7 A;  4KZ9 A;  5FQI A;  1AXB A;  3Q82 A;  1HVB A;  3C5A A;  5EVI D;  3IWI A;  4C6Y A;  4MBK A;  4FH2 A;  3NDE A;  4U0X A;  3ZFZ A;  3UO9 A;  3VP4 A;  1PZP A;  1SDN A;  3NY4 A;  2EX9 A;  4L0L A;  1K57 C;  3Q81 A;  4S2P A;  3WRT A;  3ZG9 B;  3SS5 A;  4WYY A;  1PWC A;  2WKE A;  3GSG A;  3A3F A;  3UE0 A;  5JYO A;  2OV5 A;  3IHB A;  5EE8 A;  3BEC A;  1YLW A;  3HLB A;  4IBR A;  4DE2 A;  1ESU A;  4GKU A;  1YM1 A;  2V20 A;  3FZC A;  4GZB A;  3D4F A;  1K56 D;  1KE3 A;  2PU2 A;  5CRF A;  1PZO A;  2J9P A;  1PI4 A;  3PAE A;  4S2K A;  1IEL A;  3G30 A;  5DTK A;  5FQJ A;  2Q9N A;  5EUA A;  4DE0 A;  4WMC A;  3BEB A;  1E3U A;  2ZM2 A;  5A93 A;  4E3K A;  3CZD A;  3FKV A;  3RXW A;  2WUQ A;  4Y0T A;  3E2K A;  4S2L A;  4KQQ A;  2Y2H A;  5HAI A;  1YLJ A;  3FKW A;  5CED A;  4E6X A;  5F83 A;  4DE3 A;  3V5M A;  5AQB A;  3DTM A;  4N1X A;  1NZO A;  3UPN A;  3HLW A;  4JLF A;  4DDS A;  3Q7V B;  1DJA A;  2QZ6 A;  4QY5 A;  3TG9 A;  2XD1 A;  4WEK A;  3HLE A;  1IYQ A;  5DVA A;  3IT9 A;  3SH9 A;  3ZG8 B;  4WZ4 A;  4X69 A;  3MZF A;  1IKI A;  5J8X A;  4EUZ A;  1ZG4 A;  3UDF A;  1XGI A;  3LO7 A;  3PBS A;  5FQM A;  1NY0 A;  4N92 A;  1ESI A;  2X01 A;  4WBG A;  1LL5 A;  4JXV A;  4X56 A;  2HDQ A;  1PYY A;  3UDX A;  2ZM8 A;  4WEL A;  2EFX A;  2XDM A;  3A3J A;  1BTL A;  4R4S A;  4DXB A;  2J8Y A;  2Z2M B;  1JTG A;  4LV1 A;  4WMC D;  5DF7 A;  2I72 A;  4OPZ A;  1E3U D;  1W79 A;  5EVI B;  1KGG A;  1PI5 A;  3OPR A;  1M6K A;  4RX3 A;  2ZQ9 A;  3UN7 A;  5DTT A;  3QNC A;  3W8K A;  1ZC2 A;  2X71 A;  4JXW A;  4OVD A;  1NYM A;  3FV7 A;  1K38 A;  4NET A;  4DXC A;  3ZG5 A;  4OON A;  1ERQ A;  5A90 A;  3OPP A;  1YQS A;  2Y2I A;  1NRF A;  1W8Q A;  2VGK A;  4RVA A;  5GHY A;  1S6R A;  3CJM A;  3ITB A;  3W4P A;  5EPH A;  4IVK A;  1ERO A;  3UE1 A;  4KZ3 A;  4ZJ3 A;  1MY8 A;  3UPP A;  1SKF A;  4UA6 A;  3CG5 A;  2EX6 A;  4FSF A;  4GNU A;  4KZ5 A;  5GHX A;  4CPK A;  4UA7 A;  1W8Y A;  4EBN A;  2ZQC A;  3IXD A;  4QD4 A;  2ZMA A;  4PM9 A;  2JE5 A;  2ZC7 A;  1KE0 A;  4OKP A;  3G4P A;  4IBX A;  5DF8 A;  4OLG A;  1RGZ A;  1W5D A;  3NIA A;  1K55 A;  4OQI A;  4EBP A;  5JYP A;  1K4E A;  2Y91 A;  3A3E A;  1NZU A;  3HUN A;  1E25 A;  4FH4 A;  4KZA A;  4OOL A;  3M2K A;  1K55 C;  4E3I A;  1FCO A;  3C7U A;  1PIO A;  1FR1 A;  3HLC A;  2RL3 A;  4ID4 A;  4HES A;  4KZ8 A;  1MWT A;  3RJU A;  1GA0 A;  1OME A;  3VSK A;  4NK3 A;  3G35 A;  1K25 A;  5CGW A;  1Q2P A;  5G18 A;  3TOI A;  3IF5 A;  3SOI A;  5FI6 A;  1IKG A;  1CEF A;  2P74 A;  5HAP A;  1ALQ A;  3BFD A;  4BJP A;  5FQK A;  4O7D A;  2XK1 A;  1ES4 A;  1GCE A;  5HAR A;  1FSY A;  4KZ7 A;  1CI9 A;  4PMA A;  4R0Q A;  2J7V A;  2ZD8 A;  5CTM A;  5FAO A;  2HDR A;  4QB8 A;  3S1Y A;  3G34 A;  1K57 A;  3W4O A;  1VQQ A;  3AGE A;  2ZQ8 A;  2A49 A;  1K4F A;  1BT5 A;  4EQI A;  3MKF A;  4X68 A;  5GLA A;  4MLL A;  3IF6 C;  1G68 A;  2RCX A;  2Z2L B;  2C6W B;  4RX2 A;  3BFF A;  3VP3 A;  3B3X A;  4KQR A;  1KDS A;  3MZD A;  1W7F A;  3S4X A;  4EV4 A;  4FD8 A;  1MWS A;  5CGX A;  4PM5 A;  2ZJ9 A;  4P85 A;  4IED A;  4OPY A;  4JF4 A;  5CEB A;  5M18 A;  4LV0 A;  5M19 A;  4E3N A;  1KGE A;  2V1Z A;  4S2N A;  4HEF A;  3VOZ A;  3V39 A;  4F94 A;  4EWF A;  4UHU A;  1MWR A;  5CHM A;  3NCK A;  4RYE A;  4BEN A;  4ZBE A;  4WZ5 A;  3VSL A;  4BQM A;  4DF6 A;  1PWD A;  3N7W A;  3MXR A;  4KZ4 A;  4S2N C;  1H8Z A;  1FCN A;  1S0W A;  1MKI A;  1PW1 A;  1O7E A;  3GMW A;  3Q7Z A;  4S2J A;  5IHV A;  5HW3 A;  2WZX A;  3OPL A;  4LV2 A;  5L2F A;  4WZ5 C;  3VMA A;  4YIN A;  4ZJ2 A;  5GHZ A;  4MNR A;  5EOE A;  1RCJ A;  3MKE A;  3UNW A;  1BLC A;  2IWB A;  2V2F F;  4GB7 A;  4QY6 A;  4WM9 A;  4N9K A;  2FFY A;  4P0M A;  1JWV A;  3RXX A;  3IXH A;  4UA9 A;  2XFT A;  2Y59 A;  2OLU A;  3PBN A;  4CJN A;  4Y7P A;  5CGS A;  3BFC A;  3P98 A;  4DDY A;  5I94 A;  2Y55 A;  1CI8 A;  5AQ9 A;  3N8L A;  4JF5 A;  4BD0 A;  2WK0 A;  3QNB A;  1WYC A;  5DF9 A;  3I7J A;  1K6R A;  3HUO A;  3N8S A;  3OZH A;  3SH8 A;  3JYI A;  4N1H A;  2WZZ A;  5A92 A;  2OSU A;  5KSC A;  2R9X A;  4BD1 A;  3EQU A;  3BM6 A;  3C4P A;  3OCL A;  3WRZ A;  3IH8 A;  3LY3 A;  4OQG A;  3LCE A;  4OOM A;  1ES5 A;  1TDL A;  1U60 A;  2C5W B;  3PTE A;  4H8R A;  4JF6 A;  4X6T A;  3OCN A;  4E3M A;  1FOF A;  2QMI A;  3PAG A;  1PWG A;  2WKI A;  1MBL A;  2H0Y A;  3NDG A;  4XUZ A;  4Y0O A;  5TFQ A;  2EX8 A;  1NYY A;  3IXG A;  4OLD A;  4Y0U A;  3BLM A;  3UY6 A;  1I2S A;  3BYD A;  4DRT A;  2X02 A;  5FA7 A;  3O86 A;  1JWP A;  3M2J A;  2XH9 A;  3HLF A;  1JWZ A;  2WGI A;  3ZG7 B;  1FCM A;  4B88 A;  1DJC A;  2ZC5 B;  1YLP A;  4LV3 A;  1GHM A;  2HDS A;  1EI5 A;  2B5R A;  4S2O A;  5CHJ A;  4E3O A;  4OQH A;  1NJ4 A;  2WKH A;  3LY4 A;  3MXS A;  1L0G A;  4C3Q A;  1Y54 A;  3P09 A;  4E3L A;  2Y2L A;  3HLG A;  1ONH A;  3GQZ A;  1YMS A;  2HP9 A;  1SHV A;  3BLS A;  1LLB A;  4M3K A;  5FI7 A;  2HPB A;  4R3J A;  2XLN A;  4KG2 A;  5DTS A;  3ZNY A;  5GLD A;  5GL9 A;  1XA1 A;  2IWC A;  1XXM A;  2EXA A;  4GOG A;  5TR7 A;  1FSW A;  1E4D A;  1L0D A;  4B4X A;  5BOH A;  3VP1 A;  3N8R A;  3WS5 A;  1ZKJ A;  2WAF A;  1N4O A;  1H8Y A;  4K0W A;  4BLM A;  4E6W A;  2ZC4 B;  1GHP A;  2CC1 A;  4K91 A;  1C3B A;  2Y2M A;  3PBQ A;  2ZM0 A;  3DWZ A;  3GR2 A;  4MBH A;  3HVF A;  1HD8 A;  4JKT A;  1IYP A;  2DNS A;  3PBO A;  4JXS A;  2XR0 A;  2Y2P A;  4MBF A;  1XX2 A;  2WGW A;  5EVI C;  3WWX A;  5FDH A;  4PM8 A;  5FQQ A;  3FYZ A;  1JTD A;  1GA9 A;  3IF6 A;  1O07 A;  3OPH A;  3OC2 A;  3LEZ A;  2Y2N A;  1CK3 A;  4KZ6 A;  1RP5 A;  2OLV A;  1KVL A;  1Z6F A;  2EXB A;  1K56 A;  4PPR A;  1YT4 A;  3EQV A;  3Q1F A;  1CEG A;  3A3D A;  1BUL A;  1L0F A;  2XF3 A;  4JXG A;  4DE1 A;  1QME A;  3SH7 A;  3VOY A;  5KZH A;  1M40 A;  2WYX A;  3ZGA B;  4KZB A;  3HBR A;  3SS3 A;  2G2W A;  3DW0 A;  3ZDJ A;  3PBT A;  5FAS A;  5E2G A;  1FQG A;  3UDI A;  5TGF A;  5E2E A;  4DKI A;  5FAP A;  3ZVW A;  2Y2K A;  4Z9Q A;  5U47 A;  4IVI A;  1KE4 A;  1XGJ A;  4U0T A;  5CEC A;  4XXR A;  3HUM A;  1YLT A;  2WGV A;  1TEM A;  5HFO A;  3N6I A;  4KG5 A;  3VP0 A;  3Q07 A;  2Y4A A;  1YLZ A;  3WS2 A;  4C75 A;  3AGF A;  4R3B A;  1TVF A;  1IYO A;  3DWK A;  2UWX A;  1BUE A;  2G2U A;  1JVJ A;  1ES2 A;  1RGY A;  2ZQD A;  3IH9 A;  2Q9M A;  4YFM A;  3A3I A;  5D3O A;  4D2O A;  3GTC A;  4OP8 A;  1EWZ A;  3VP2 A;  2JC7 A;  1WYB A;  1G6A A;  3IHA A;  1ES3 A;  1LI9 A;  2P9V A;  4HBU A;  4KG6 A;  5EVL A;  5F1G A;  4ZJ1 A;  3UE3 A;  3AGD A;  3M6H A;  1ONG A;  3ZCZ A;  2ZC6 B;  4E3J A;  3C4O A;  1SDE A;  5AQ7 A;  4ZDX A;  2WAD A;  5F82 A;  3BFE A;  1XPB A;  4X55 A;  1DJB A;  3E2L A;  5CTN A;  3CMZ A;  4Q8I A;  3HLD A;  1DY6 A;  3W4Q A;  2JBF A;  4PM6 A;  2XD5 A;  3ISG A;  5FI2 A;  1KDW A;  4MEZ A;  1K54 A;  3G31 A;  3TSG A;  5KMW A;  2HP5 A;  5HL1 A;  5KSH A;  3M6B A;  4R4R A;  4GN2 A;  1XKZ A;  4LCL A;  4R23 A;  1J9M A;  3MFD A;  4P87 A;  1K54 C;  4OH0 A;  1L2S A;  3V3R A;  5GLC A;  5HAQ A;  2EX2 A;  4UAA A;  1YMX A;  1NXY A;  2IWD A;  2FFF B;  5AQA A;  1WE4 A;  1LI0 A;  2QPN A;  1L0E A;  4OP5 A;  3SS4 A;  2VGJ A;  3NI9 A;  1HZO A;  3GVB A;  3VFH A;  3ITA A;  2J9O A;  5CHU A;  5EOO A;  2Y2O A;  3O88 A;  1IEM A;  4S2M A;  5CXW A;  2GDN A;  1MXO A;  1H5X A;  2DRW A;  2E8I A;  2HP6 A;  2PU4 A;  3O87 A;  5FSR A;  3UPO A;  2WAE A;  5A91 A;  1SCW A;  2H10 A;  3ZHH A;  1TDG A;  5E2H A;  4A5R A;  3QHY A;  4B4Z A;  3N4I A;  3V50 A;  1MWU A;  1BLP A;  2JCH A;  2ZLY A;  3VFF A;  4GD6 A;  2WGW B;  1LHY A;  5FAQ A;  3MZE A;  1KGF A;  4OOY A;  4HBT A;  5HX9 A;  3ZG0 A;  1I2W A;  2XFS A;  2ZQA A;  3IF6 B;  1BLH A;  4QHC A;  2A3U A;  3Q7V A;  2XQZ A; 
#chains in the Genus database with same CATH topology
 3ZNT A;  3MBZ A;  5CER A;  2Y2G A;  4QU3 A;  4PHT A;  2EFU A;  4N9L A;  3HL9 A;  1VM1 A;  5EVI A;  3WS0 A;  1LL9 A;  5E2F A;  1KVM A;  4GDB A;  3C7V A;  3KYZ A;  3WS1 A;  3GRJ A;  1BSG A;  3G2Y A;  2ZMF A;  3IXB A;  4KQO A;  3V3S A;  4NXF A;  3MF0 A;  2P9V B;  2EWV A;  3IWO A;  4DMZ A;  1HTZ A;  4ZTK A;  1N9L A;  4XUX A;  2PBY A;  4ZRR A;  3JPU A;  1IYS A;  3VE3 A;  2Y2Q A;  2L4R A;  1XA7 A;  4KZ9 A;  2VEA A;  3Q82 A;  3T1Q B;  3C5A A;  4C6Y A;  3NDE A;  3BY8 A;  5EM0 A;  1SDN A;  4L0L A;  1K57 C;  3SS5 A;  4WYY A;  3LYX A;  3GSG A;  5JYO A;  5EE8 A;  3BEC A;  1YLW A;  3MMH A;  4G3K A;  5HDS A;  3HJK A;  4F3L A;  4GKU A;  2V20 A;  3FZC A;  3PHY A;  3MS6 A;  1K56 D;  2PU2 A;  1PZO A;  1PI4 A;  3E98 A;  3G30 A;  5DTK A;  2Q9N A;  4WMC A;  4NXE A;  1E3U A;  3FKV A;  3RXW A;  2WUQ A;  1FIL A;  1V9Y A;  3E4Q A;  4KQQ A;  2Y2H A;  4HI4 A;  5HAI A;  3FKW A;  5CED A;  4E6X A;  4DE3 A;  3V5M A;  5AQB A;  3DTM A;  3P01 A;  4HH2 A;  4YOF A;  1DJA A;  4QY5 A;  4HP4 A;  3SH9 A;  1IKI A;  2ACG A;  4EUZ A;  1ZG4 A;  2JKG A;  1XGI A;  5FQM A;  1ESI A;  4WBG A;  4JXV A;  4WEL A;  3DTE A;  5HL6 A;  2GNX A;  2GX5 A;  3A3J A;  4CLC E;  4DXB A;  4Y2F A;  5DF7 A;  2I72 A;  1W79 A;  3FPW A;  3OPR A;  4FOF A;  2ZQ9 A;  4L9F A;  3ZG5 A;  3IX4 A;  1ERQ A;  5AVF A;  3OPP A;  2Y2I A;  3A0V A;  2D02 A;  3EOI A;  2O9C A;  3CG5 A;  2EX6 A;  5GHX A;  2MJ6 A;  4UA7 A;  1W8Y A;  4BMW A;  4PM9 A;  4OKP A;  3G4P A;  3H7W B;  4IBX A;  1RGZ A;  3S7N A;  1K55 A;  4HP9 A;  1K4E A;  3T12 B;  2WKP A;  1E25 A;  3C7U A;  2QJ7 A;  1OME A;  3D72 A;  3KSH A;  2P74 A;  1ALQ A;  4GS9 A;  5DJT A;  4XT2 B;  4O7D A;  2XK1 A;  4B93 A;  1NWZ A;  5DJU A;  3KYE A;  4HY8 A;  4IUH A;  2K7S A;  2ZD8 A;  2HDR A;  3G34 A;  2PYR A;  4D60 A;  1K57 A;  3S7P A;  1VQQ A;  4EEP A;  4BWI A;  1S1Z A;  1G68 A;  2C6W B;  1YSQ A;  4RX2 A;  3EGD C;  2V8C A;  1BYW A;  1W7F A;  4P85 A;  1K0K A;  4LV0 A;  1KGE A;  4HEF A;  3VOZ A;  4EWF A;  3NCK A;  2V0W A;  4BEN A;  4WZ5 A;  3VSL A;  4S2N C;  3W2Z A;  1MKI A;  1PW1 A;  5IHV A;  2WZX A;  4LV2 A;  5L2F A;  3KSI A;  4BBT A;  3PYP A;  2G7U A;  5EOE A;  5HWT A;  1BLC A;  4HJ3 A;  2V2F F;  2GZA A;  5DKK A;  4UA9 A;  3UME A;  1PRQ A;  4EW7 A;  1STZ A;  3PBN A;  5CGS A;  1T1A A;  2BTF P;  1CI8 A;  4ETZ A;  3N8L A;  3UB8 A;  1WYC A;  5DF9 A;  3N8S A;  3HUO A;  3OZH A;  1W63 M;  4N1H A;  1VB6 A;  3EQU A;  3EEA A;  3OCL A;  4OQG A;  1VEU A;  4G3W A;  2C5W B;  3PTE A;  4JF6 A;  3OCN A;  4MMN A;  1PWG A;  2H0Y A;  3VV4 A;  3KSG A;  1ODV A;  4Y0U A;  3UY6 A;  1XFN A;  4DRT A;  1I2S A;  3CI6 A;  2X02 A;  3IBR A;  4PKY A;  4EER A;  4I3A A;  4YNR A;  2HGV A;  1F98 A;  2HDS A;  4S2O A;  1L0G A;  1Y54 A;  2Y2L A;  3RH8 B;  1IFQ A;  2JKR M;  4H6J A;  1NRJ A;  5L10 A;  5FI7 A;  2HPB A;  5DTS A;  2IWC A;  2EXA A;  1FSW A;  4GHI B;  3WS5 A;  1ZKJ A;  1GHP A;  4K91 A;  2Y2M A;  3PBQ A;  4CQH A;  4MBF A;  1XX2 A;  5FDH A;  3FYZ A;  3C8C A;  3OPH A;  3LEZ A;  4KZ6 A;  1RP5 A;  1TF1 A;  4E04 A;  1K56 A;  3Q1F A;  1BUL A;  2L0W A;  5F69 A;  1QME A;  1M40 A;  3ZDJ A;  3MXQ A;  3C38 A;  4WUJ A;  4IVI A;  1XGJ A;  4U0T A;  3MFX A;  3VP0 A;  1YLZ A;  2Y79 A;  1TVF A;  1IYO A;  3DWK A;  1JVJ A;  1ES2 A;  5D3O A;  2Q9M A;  2YKF A;  3A3I A;  3ICY A;  2YKH A;  5EVL A;  4KG6 A;  4ZJ1 A;  2VGL S;  5L07 A;  3UE3 A;  1ONG A;  2JKT M;  2QWS A;  2VZW A;  2ZC6 B;  1SDE A;  2WAD A;  2M7V A;  3HLD A;  2XD5 A;  3ISG A;  5KMW A;  5HL1 A;  5KSH A;  4R4R A;  1XKZ A;  4R23 A;  1XJ6 A;  4ARZ B;  1K54 C;  5CX7 A;  3V3R A;  3LID A;  1OTE A;  2O9B A;  4UAA A;  1LSW A;  2W1T A;  2XA7 S;  3NI9 A;  3GVB A;  2J9O A;  5CHU A;  2Y2O A;  1H5X A;  2E8I A;  3O87 A;  2WAE A;  1OTA A;  4A5R A;  1TDG A;  5E2H A;  3V50 A;  2JCH A;  1BLP A;  3IS2 A;  3CUE C;  5IU1 A;  2JKR I;  5FAQ A;  1KGF A;  4HBT A;  3ZG0 A;  2L1M A;  2QKP A;  3Q7V A;  4QJG A;  3IX8 A;  2GJ3 A;  1ACF A;  3BFG A;  2HDU A;  4I39 A;  1PW8 A;  2ZQ7 A;  3BQ8 A;  1K6S A;  1ZG6 A;  4ZAM A;  1IOU A;  5F1F A;  4X53 A;  2K2N A;  1YLY A;  4JBF A;  2H0T A;  2Y2J A;  4O0P A;  1V9Z A;  3T4S A;  5M1A A;  3NOU C;  4IHQ A;  4GJ4 A;  4FCF A;  3H82 B;  3G32 A;  4Q0I A;  1OT9 A;  5HD5 A;  2KOI A;  1W63 Q;  4OPR A;  3IX3 A;  2ZL1 A;  1BLS A;  3S7Q A;  4R1G A;  1XP4 A;  3WS4 A;  2O99 A;  4P6B A;  2EWW A;  3OBF A;  2DCF A;  3GEC A;  3ZFZ A;  3UO9 A;  3VP4 A;  4S2P A;  3WRT A;  1PWC A;  3UE0 A;  1VHM A;  1YM1 A;  3P7N A;  1KE3 A;  2J9P A;  1IEL A;  3F1O B;  2W0N A;  2W1R A;  3CZD A;  4Y0T A;  5KIZ A;  1S1Y A;  4S2L A;  1GSW A;  5DKL A;  4BBV A;  4JLF A;  5TBM B;  2QZ6 A;  3LI8 A;  4WEK A;  1KOU A;  3HLE A;  5DVA A;  3ZG8 B;  3LIA A;  3DBA A;  3UDX A;  2ZM8 A;  2EFX A;  1NLY A;  2Z2M B;  1JTG A;  5EVI B;  4OPZ A;  2W27 A;  1KGG A;  1PI5 A;  3QNC A;  3W8K A;  2X71 A;  2ZOI A;  4JXW A;  5C5K A;  1W8Q A;  4NXB A;  5GHY A;  1S6R A;  3CJM A;  4IVK A;  3S7O A;  3JVU A;  2B95 A;  4KZ3 A;  5DFY A;  1SKF A;  2E8J A;  2JE5 A;  2A24 A;  3NIA A;  3DTK A;  1NZU A;  4P6Z S;  1LSX A;  4OOL A;  2HF6 A;  1K55 C;  1FCO A;  1PIO A;  1FR1 A;  4ID4 A;  4KZ8 A;  3RJU A;  3KSF A;  5G18 A;  3SOI A;  5FI6 A;  5HAP A;  3BFD A;  5FQK A;  1MZU A;  1ES4 A;  2OOL A;  2W3F A;  1CI9 A;  4PMA A;  4R0Q A;  1T18 A;  2VKS A;  3W4O A;  3AGE A;  2ZQ8 A;  4NG2 A;  1BT5 A;  4EQI A;  3D3O A;  4B9O A;  4MLL A;  5EVE A;  2PRF A;  4HH3 A;  3VP3 A;  3MZD A;  3S4X A;  4FD8 A;  1MWS A;  1TS0 A;  3F1N A;  1SKO A;  5EFW A;  3MXR A;  4KZ4 A;  3UB5 P;  1FCN A;  1O7E A;  4S2J A;  3D9Y A;  4WZ5 C;  3VMA A;  4YIN A;  4EES A;  2B18 A;  5GHZ A;  4JGQ A;  1RCJ A;  3T4J A;  3LR0 A;  4CLC A;  4GB7 A;  4QY6 A;  4WM9 A;  2FFY A;  1JWV A;  3IXH A;  4M4X A;  1OTD A;  3QP5 A;  3A0R A;  4BBU A;  5AVE A;  3LEQ A;  2W3G A;  2WK0 A;  3QNB A;  1K6R A;  1OJ5 A;  2EA9 A;  3SZT A;  4BD1 A;  4HOI A;  1TS8 A;  3TJZ C;  4OOM A;  1U60 A;  4GS9 B;  1FOF A;  2PAV P;  4Y0O A;  4XUZ A;  2EX8 A;  4HNB A;  3IXG A;  3BLM A;  5FA7 A;  3O86 A;  2KDK A;  2XH9 A;  2WGI A;  3ZG7 B;  2W3H A;  1FCM A;  2J3T D;  4LV3 A;  1GHM A;  1EI5 A;  3ULF A;  5CHJ A;  4E3O A;  3LY4 A;  2WKH A;  2BAS A;  3DAV A;  3MXS A;  4C3Q A;  3UB9 A;  4E3L A;  2P04 A;  3GQZ A;  1YMS A;  3LR4 A;  1LLB A;  2XLN A;  5GLD A;  1XA1 A;  4GOG A;  1L0D A;  4O01 A;  4B4X A;  4BLM A;  1N4O A;  4E6W A;  2V8F A;  1C3B A;  4LRZ E;  4MBH A;  3GR2 A;  4JKT A;  2XR0 A;  2Y2P A;  2WGW A;  3EWK A;  4PM8 A;  1JTD A;  4MN6 A;  1GA9 A;  4K08 A;  3EGX C;  5HPI A;  2O0Y A;  1CK3 A;  1VET A;  2OLV A;  4II7 A;  4FUW A;  2QHK A;  2M1C A;  4Y3I A;  4JXG A;  4DE1 A;  1TS6 A;  3SH7 A;  3VOY A;  4LFU A;  3ZGA B;  4JGR A;  3DW0 A;  5E2G A;  3ZVW A;  1LT0 A;  5U47 A;  3LIB A;  1WA9 A;  4R3A A;  2FH5 A;  3F1P A;  1YLT A;  4C75 A;  3AGF A;  2ZQD A;  2G2U A;  1RGY A;  5J3W A;  4D2O A;  4XT2 A;  2JC7 A;  1WYB A;  1G6A A;  5F1G A;  1LI9 A;  1G28 A;  1VEU B;  1XJ3 A;  3ZCZ A;  3C4O A;  4WLA A;  3T4K A;  1XPB A;  3CLO A;  1D06 A;  3W4Q A;  3G31 A;  4X1L A;  5I5L A;  2QJ5 A;  5FEF A;  1H0M A;  1L2S A;  5GLC A;  3CPT A;  2VK3 A;  3EEH A;  4H6J B;  1WE4 A;  1LI0 A;  2QPN A;  4OP5 A;  4PKY G;  3UE6 A;  2VGJ A;  1HZO A;  4EEU A;  3VFH A;  3O88 A;  2GDN A;  2DRW A;  3UPO A;  1SCW A;  1H3Q A;  1MWU A;  2ZLY A;  2XRN A;  3ZYT A;  4UEY A;  5HX9 A;  2ZQA A;  4QHC A;  1MPL A;  5FAT A;  4PM7 A;  1UGU A;  1OJG A;  3HRE A;  5GLB A;  2H5S A;  3PBR A;  4JPM A;  3S22 A;  4GD8 A;  4OPQ A;  2VJW A;  4GW9 A;  4JGO A;  1N9B A;  4Y13 A;  3BRM A;  4S2I A;  4LCM A;  1ERM A;  4UQI M;  1F5M A;  1I5Q A;  3MJQ A;  2DMW A;  4BL2 A;  3IWQ A;  2R9W A;  4RA7 A;  3B47 A;  2W3D A;  3O5Y A;  3HJI A;  1GHI A;  4GDN A;  4NXG A;  1A0K A;  2BG1 A;  5FQI A;  1AXB A;  1UWP X;  5EVI D;  3IWI A;  4FH2 A;  4U0X A;  1PZP A;  3NY4 A;  3BY9 A;  1CQA A;  2PDR A;  2PR6 A;  5J4E A;  5HD3 A;  3IHB A;  3NUL A;  3JVV A;  2KLI A;  2W1T B;  1YAX A;  3LGO A;  4GZB A;  3D4F A;  5CRF A;  3PAE A;  4DE0 A;  5EUA A;  5A93 A;  3CHW P;  4E3K A;  3E2K A;  3T1R A;  1YPR A;  5F83 A;  1NZO A;  2P08 A;  3HLW A;  2NUT C;  2PYP A;  3QP8 A;  3Q7V B;  3TG9 A;  2XD1 A;  1DP8 A;  1IYQ A;  3IT9 A;  4WZ4 A;  3FC7 A;  5J8X A;  3BJN A;  3LO7 A;  4G3V A;  4N92 A;  1PFL A;  2X01 A;  4GLQ A;  2XRO A;  1T1B A;  1OPX A;  2XDM A;  4ME4 A;  1BTL A;  2R78 A;  4R4S A;  1MC0 A;  4WMC D;  1E3U D;  2NUP C;  5DTT A;  1CF0 A;  3FV7 A;  2Q0O A;  4NET A;  4OON A;  3FPV A;  5A90 A;  1YQS A;  1N9O A;  2VGK A;  3ITB A;  3KYQ A;  1MY8 A;  4QPR A;  3UPP A;  2ZL1 B;  4UA6 A;  1OT6 A;  4KZ5 A;  2HZ5 A;  4CPK A;  2VA0 A;  2ZMA A;  1DP9 A;  1YKD A;  2J3W A;  5DF8 A;  4OLG A;  4HIA A;  4OQI A;  3T4T A;  4EBP A;  2Y91 A;  2V1A A;  3A3E A;  3E4P A;  4KZA A;  3M2K A;  1S4S A;  2P7J A;  3HLC A;  2A2L A;  1TS7 A;  3VSK A;  3G35 A;  1Q2P A;  3TOI A;  3IF5 A;  3UB6 A;  1IKG A;  4MN5 A;  4Y17 A;  4BJP A;  4IJG A;  3UB7 A;  5HAR A;  3A0S A;  1FSY A;  3MR0 A;  2J7V A;  5FAO A;  4QB8 A;  3S1Y A;  3ZQ5 A;  4MCW A;  2WKQ A;  2A49 A;  2W3E A;  3LR3 A;  2OAP 1;  3MKF A;  5GLA A;  5FL3 A;  1AWI A;  3IF6 C;  2RCX A;  5J7E A;  3B3X A;  4O8G A;  2IA2 A;  4EV4 A;  5MC7 A;  5CGX A;  4AFI A;  2ZJ9 A;  4IED A;  3T4Q A;  4ETX A;  5HSQ A;  5CEB A;  4E3N A;  2V1Z A;  3LIC A;  3T50 A;  4F94 A;  3MQ0 A;  5F5Y A;  1MWR A;  4BQM A;  4ZBE A;  1PWD A;  3N7W A;  2PBD P;  3SW1 A;  4ZJ2 A;  2OAQ 1;  3MKE A;  3UNW A;  4PAU A;  4HQA A;  2Y8H A;  1P9W A;  2XFT A;  2A24 B;  4LLO B;  2Y59 A;  1L3L A;  2OLU A;  4CLC C;  5I94 A;  3P98 A;  3T4O A;  4JF5 A;  2H28 A;  1LL8 A;  2OSU A;  2R9X A;  5KSC A;  3WRZ A;  3LY3 A;  3LCE A;  1D1J A;  4LRX C;  2J80 A;  1ES5 A;  1TDL A;  3RFB A;  4E3M A;  3NOT C;  3PAG A;  3NOP C;  1MBL A;  5F6A A;  4Y5F A;  2AVX A;  5L09 A;  3QP6 A;  1NYY A;  4OLD A;  4WL9 A;  3C2W A;  3M2J A;  2Z6C A;  1JWZ A;  1DJC A;  2ZC5 B;  5TBM A;  1EW0 A;  4DJ2 A;  1DP6 A;  3V67 A;  1NLZ A;  2HP9 A;  3BLS A;  4KG2 A;  3ZVT A;  1XXM A;  2V1B A;  4X25 A;  4F3L B;  2OWJ A;  3VP1 A;  5EM1 A;  5BOH A;  4K0W A;  1H8Y A;  2CC1 A;  2HJ9 C;  1T19 A;  3BW6 A;  3F1N B;  3R7W A;  3DWZ A;  2VV7 A;  1SKO B;  1HD8 A;  3WWX A;  5FQQ A;  3IF6 A;  1O07 A;  3OC2 A;  2ZMV A;  1KVL A;  1D7E A;  1YT4 A;  3EQV A;  4R6L A;  1L0F A;  3LR5 A;  4I38 A;  1LSV A;  2D01 A;  5KZH A;  4KZB A;  3SS3 A;  4CLC B;  2G2W A;  3K3D A;  1FQG A;  3UDI A;  4KQD A;  5FAP A;  1KE4 A;  2ZOH A;  1GSX A;  5CEC A;  4KG5 A;  3Q07 A;  3WS2 A;  2UWX A;  1BUE A;  3IH9 A;  4YFM A;  3R4K A;  3L7H A;  1EWZ A;  2P9V A;  3AGD A;  3M6H A;  4E3J A;  2JN7 A;  4X1M A;  5F68 A;  4ZDX A;  4X55 A;  3E2L A;  5CTN A;  3CMZ A;  1DY6 A;  5FI2 A;  1KDW A;  4MEZ A;  2V9A A;  3TSG A;  4GN2 A;  3T1X A;  4P87 A;  4OH0 A;  1P97 A;  4IUK A;  2IWD A;  4FTX A;  2FFF B;  5AQA A;  4NEE D;  2HV1 A;  1MKM A;  1IEM A;  5CXW A;  1S4R A;  3LFV A;  2HP6 A;  2PU4 A;  3TW8 A;  2H10 A;  3N4I A;  2WGW B;  3MQO A;  4OOY A;  2KX6 A;  1I2W A;  2XFS A;  1BLH A;  2A3U A;  1QMF A;  4WEJ A;  1VET B;  4U3T A;  4OQ0 A;  5FQ9 A;  1T1C A;  5TJJ A;  3NC8 A;  3VE4 A;  1BZA A;  4EBL A;  2OWH A;  3LIF A;  2BLS A;  3GV9 A;  4LEN A;  3TE8 A;  3NBL A;  3F1P B;  3FWL A;  3IQA A;  2I9V A;  3G2Z A;  2XGN A;  3DTI A;  1CJF A;  2ZC3 B;  1FR6 A;  3O3V A;  4BL3 A;  4KEN B;  2XEP A;  1Q2Q A;  5E43 A;  3PR6 A;  1S67 L;  4K0X A;  2UV0 E;  5EEC A;  3H7W A;  3BQA A;  3CIT A;  5L8M A;  2JHE A;  1HVB A;  5G4Z A;  4MBK A;  2V0U A;  3VOL A;  4HHD A;  5HWW A;  2EX9 A;  2WKR A;  3Q81 A;  3ZG9 B;  2WKE A;  3CPT B;  3A3F A;  1S66 L;  2OV5 A;  3HLB A;  4IBR A;  4DE2 A;  1ESU A;  3OLO A;  3QP4 A;  2JKF A;  4RQ9 A;  4S2K A;  4LPZ A;  2VV8 A;  2LB9 A;  5FQJ A;  3BEB A;  3CAX A;  2ZM2 A;  4L9G A;  1YLJ A;  4EQ1 A;  4Q0H A;  4MN7 A;  3UPN A;  4N1X A;  2PT7 A;  5DFX A;  4DDS A;  3K3C A;  4X69 A;  3MZF A;  3UDF A;  3PBS A;  1NY0 A;  3NJA A;  1LL5 A;  4X56 A;  2HDQ A;  1PYY A;  3HCY A;  2J8Y A;  4LV1 A;  5HDD A;  4RX3 A;  1M6K A;  1F9I A;  3UN7 A;  3TRC A;  5LBR A;  1ZC2 A;  4OVD A;  1NYM A;  1K38 A;  4DXC A;  2J3T C;  1NRF A;  3CWF A;  4RVA A;  3T4L A;  1UWN X;  3W4P A;  5EPH A;  3UE1 A;  1ERO A;  4ZJ3 A;  2M7U A;  4FSF A;  4GNU A;  4EBN A;  2ZQC A;  3IXD A;  4QD4 A;  2VGL M;  2ZC7 A;  1KE0 A;  5HWV A;  1W5D A;  5JYP A;  3HUN A;  4FH4 A;  4Y15 A;  5G4Y A;  4E3I A;  4WF0 A;  2RL3 A;  4HES A;  1MWT A;  1GA0 A;  4NK3 A;  1K25 A;  5CGW A;  1CEF A;  4WN5 A;  4HJ4 A;  2QYB A;  2XA7 M;  2PR5 A;  2O9A A;  1GCE A;  4LRY C;  3B42 A;  4KZ7 A;  1FIK A;  1PNE A;  1ZTU A;  5CTM A;  1G6O A;  5HZH A;  1K4F A;  3MQQ A;  4X68 A;  3LI9 A;  2Z2L B;  3BFF A;  5EV0 A;  2CMN A;  2PD8 A;  4KQR A;  1KDS A;  2VLG A;  1OTI A;  3E0Y A;  4PM5 A;  4GHI A;  4OPY A;  4JF4 A;  2Z6D A;  4EU0 A;  5M18 A;  1Y28 A;  5M19 A;  4S2N A;  3V39 A;  3FG8 A;  4UHU A;  5CHM A;  4RYE A;  4DF6 A;  3IS2 B;  5FDS A;  1H8Z A;  1S0W A;  3Q7Z A;  3GMW A;  5HW3 A;  3OPL A;  4I3J A;  4HJ6 A;  3E4O A;  3GDI A;  4MNR A;  2B02 A;  1N9N A;  5IS1 A;  4I5S A;  2INW A;  2IWB A;  3QP2 A;  4N9K A;  4P0M A;  3RXX A;  5HPF A;  4CJN A;  3B33 A;  4Y7P A;  3BFC A;  4DDY A;  2FZ0 A;  2Y55 A;  5AQ9 A;  3PXP A;  4BD0 A;  3I7J A;  4YWZ A;  1J3W A;  4JGP A;  3SH8 A;  3JYI A;  4UQI S;  2ZBB A;  3LUQ A;  2WZZ A;  4KUO A;  5A92 A;  1Y4O A;  3QP1 A;  3BM6 A;  3C4P A;  3IH8 A;  3KO6 A;  1P9R A;  3H9W A;  1XFQ A;  4H8R A;  4X6T A;  1G5U A;  2QMI A;  4CLC D;  2WKI A;  3NDG A;  5TFQ A;  2PD7 A;  3C30 A;  5A8B A;  1GSV A;  3T1S A;  3BYD A;  4GCZ A;  2HJE A;  1JWP A;  3HLF A;  3MSH A;  4B88 A;  3G6O A;  5HDC A;  1YLP A;  4ARZ A;  2B5R A;  5FEG A;  2LB5 A;  4OQH A;  5IT5 A;  1NJ4 A;  3OOV A;  3UMD A;  3P09 A;  3HLG A;  1ONH A;  3KX0 X;  1XJ2 A;  1DRM A;  1SHV A;  4M3K A;  4R3J A;  3ZNY A;  5GL9 A;  5TR7 A;  1E4D A;  2VX8 A;  3N8R A;  2WAF A;  4LGW A;  2ZC4 B;  4QWO A;  2ZM0 A;  4MDZ A;  1XJ4 A;  3HVF A;  4EUV A;  1IYP A;  2DNS A;  3PBO A;  4JXS A;  5EVI C;  1X0O A;  2PHY A;  2Y2N A;  5AJG A;  2EXB A;  1Z6F A;  4DN0 A;  2XSS A;  3K2N A;  4PPR A;  4EET B;  1CEG A;  3A3D A;  1H8M A;  2XF3 A;  2WYX A;  3HBR A;  4R70 A;  3PBT A;  5FAS A;  5TGF A;  5E2E A;  4DKI A;  1P0Z A;  2Y2K A;  4Z9Q A;  4XXR A;  3HUM A;  3H82 A;  2WGV A;  1TEM A;  5HFO A;  3N6I A;  2JKT I;  2Y4A A;  4P6Z M;  4Q0J A;  4R3B A;  1SZV A;  3NHQ A;  3GTC A;  3VP2 A;  4HBU A;  3IHA A;  1ES3 A;  1JNU A;  2K31 A;  4ESP A;  1F2K A;  5AQ7 A;  4KUK A;  5F82 A;  3BFE A;  4R38 A;  1DJB A;  3U4L P;  4Q8I A;  4EXO A;  2JBF A;  4PM6 A;  3IBJ A;  2VV6 A;  1K54 A;  4I3I A;  2HP5 A;  1TD5 A;  5K5B A;  3M6B A;  4LCL A;  1J9M A;  3MFD A;  3BWL A;  1HLU P;  5HAQ A;  4NKP A;  2EX2 A;  1YMX A;  1NXY A;  3L9K A;  3U2A A;  1L0E A;  3RTY A;  3SS4 A;  1OTB A;  3ITA A;  5EOO A;  1YSP A;  4L9E A;  4S2M A;  3F1O A;  3CUE A;  1Z09 A;  1MXO A;  5FSR A;  3R7W B;  5A91 A;  4Z1W A;  3ZHH A;  4B4Z A;  3QHY A;  4DJ3 A;  3VFF A;  4GD6 A;  1LHY A;  3MZE A;  3LIE A;  2XQZ A;  1ZHH B;  3IF6 B;  4OP8 A;  3NEC A; 
#chains in the Genus database with same CATH homology
 1MPL A;  1QMF A;  4WEJ A;  5FAT A;  3ZNT A;  4QJG A;  4U3T A;  4PM7 A;  4OQ0 A;  3MBZ A;  5CER A;  5FQ9 A;  2Y2G A;  3BFG A;  4QU3 A;  2HDU A;  3HRE A;  5GLB A;  3NC8 A;  1PW8 A;  1BZA A;  2ZQ7 A;  1K6S A;  2EFU A;  1ZG6 A;  2H5S A;  4ZAM A;  4N9L A;  3PBR A;  3HL9 A;  4JPM A;  4EBL A;  2BLS A;  5F1F A;  3GV9 A;  4X53 A;  3S22 A;  3ZVT A;  1YLY A;  4JBF A;  1VM1 A;  2H0T A;  5EVI A;  2Y2J A;  3WS0 A;  4GD8 A;  4LEN A;  1LL9 A;  4OPQ A;  5M1A A;  3NBL A;  5E2F A;  3FWL A;  4FCF A;  1KVM A;  3G32 A;  3IQA A;  4GDB A;  1N9B A;  3C7V A;  3G2Z A;  3WS1 A;  3GRJ A;  2XGN A;  3BRM A;  1BSG A;  3G2Y A;  3IXB A;  4S2I A;  2ZC3 B;  4KQO A;  4LCM A;  3V3S A;  1ERM A;  1FR6 A;  3O3V A;  4OPR A;  1I5Q A;  4BL2 A;  3IWQ A;  4BL3 A;  2P9V B;  1BLS A;  2R9W A;  2XEP A;  4KEN B;  4R1G A;  4RA7 A;  1Q2Q A;  3IWO A;  5E43 A;  1XP4 A;  1HTZ A;  4K0X A;  4ZTK A;  3WS4 A;  4XUX A;  5EEC A;  2PBY A;  4P6B A;  1IYS A;  1GHI A;  2Y2Q A;  4GDN A;  2BG1 A;  2DCF A;  1XA7 A;  4KZ9 A;  5FQI A;  1AXB A;  3Q82 A;  1HVB A;  3C5A A;  5EVI D;  3IWI A;  4C6Y A;  4MBK A;  4FH2 A;  3NDE A;  4U0X A;  3ZFZ A;  3UO9 A;  3VP4 A;  1PZP A;  1SDN A;  3NY4 A;  2EX9 A;  4L0L A;  1K57 C;  3Q81 A;  4S2P A;  3WRT A;  3ZG9 B;  3SS5 A;  4WYY A;  1PWC A;  2WKE A;  3GSG A;  3A3F A;  3UE0 A;  5JYO A;  2OV5 A;  3IHB A;  5EE8 A;  3BEC A;  1YLW A;  3HLB A;  4IBR A;  4DE2 A;  1ESU A;  4GKU A;  1YM1 A;  2V20 A;  3FZC A;  4GZB A;  3D4F A;  1K56 D;  1KE3 A;  2PU2 A;  5CRF A;  1PZO A;  2J9P A;  1PI4 A;  3PAE A;  4S2K A;  1IEL A;  3G30 A;  5DTK A;  5FQJ A;  2Q9N A;  5EUA A;  4DE0 A;  4WMC A;  3BEB A;  1E3U A;  2ZM2 A;  5A93 A;  4E3K A;  3CZD A;  3FKV A;  3RXW A;  2WUQ A;  4Y0T A;  3E2K A;  4S2L A;  4KQQ A;  2Y2H A;  5HAI A;  1YLJ A;  3FKW A;  5CED A;  4E6X A;  5F83 A;  4DE3 A;  3V5M A;  5AQB A;  3DTM A;  4N1X A;  1NZO A;  3UPN A;  3HLW A;  4JLF A;  4DDS A;  3Q7V B;  1DJA A;  2QZ6 A;  4QY5 A;  3TG9 A;  2XD1 A;  4WEK A;  3HLE A;  1IYQ A;  5DVA A;  3IT9 A;  3SH9 A;  3ZG8 B;  4WZ4 A;  4X69 A;  3MZF A;  1IKI A;  5J8X A;  4EUZ A;  1ZG4 A;  3UDF A;  1XGI A;  3LO7 A;  3PBS A;  5FQM A;  1NY0 A;  4N92 A;  1ESI A;  2X01 A;  4WBG A;  1LL5 A;  4JXV A;  4X56 A;  2HDQ A;  1PYY A;  3UDX A;  2ZM8 A;  4WEL A;  2EFX A;  2XDM A;  3A3J A;  1BTL A;  4R4S A;  4DXB A;  2J8Y A;  2Z2M B;  1JTG A;  4LV1 A;  4WMC D;  5DF7 A;  2I72 A;  4OPZ A;  1E3U D;  1W79 A;  5EVI B;  1KGG A;  1PI5 A;  3OPR A;  1M6K A;  4RX3 A;  2ZQ9 A;  3UN7 A;  5DTT A;  3QNC A;  3W8K A;  1ZC2 A;  2X71 A;  4JXW A;  4OVD A;  1NYM A;  3FV7 A;  1K38 A;  4NET A;  4DXC A;  3ZG5 A;  4OON A;  1ERQ A;  5A90 A;  3OPP A;  1YQS A;  2Y2I A;  1NRF A;  1W8Q A;  2VGK A;  4RVA A;  5GHY A;  1S6R A;  3CJM A;  3ITB A;  3W4P A;  5EPH A;  4IVK A;  1ERO A;  3UE1 A;  4KZ3 A;  4ZJ3 A;  1MY8 A;  3UPP A;  1SKF A;  4UA6 A;  3CG5 A;  2EX6 A;  4FSF A;  4GNU A;  4KZ5 A;  5GHX A;  4CPK A;  4UA7 A;  1W8Y A;  4EBN A;  2ZQC A;  3IXD A;  4QD4 A;  2ZMA A;  4PM9 A;  2JE5 A;  2ZC7 A;  1KE0 A;  4OKP A;  3G4P A;  4IBX A;  5DF8 A;  4OLG A;  1RGZ A;  1W5D A;  3NIA A;  1K55 A;  4OQI A;  4EBP A;  5JYP A;  1K4E A;  2Y91 A;  3A3E A;  1NZU A;  3HUN A;  1E25 A;  4FH4 A;  4KZA A;  4OOL A;  3M2K A;  1K55 C;  4E3I A;  1FCO A;  3C7U A;  1PIO A;  1FR1 A;  3HLC A;  2RL3 A;  4ID4 A;  4HES A;  4KZ8 A;  1MWT A;  3RJU A;  1GA0 A;  1OME A;  3VSK A;  4NK3 A;  3G35 A;  1K25 A;  5CGW A;  1Q2P A;  5G18 A;  3TOI A;  3IF5 A;  3SOI A;  5FI6 A;  1IKG A;  1CEF A;  2P74 A;  5HAP A;  1ALQ A;  3BFD A;  4BJP A;  5FQK A;  4O7D A;  2XK1 A;  1ES4 A;  1GCE A;  5HAR A;  1FSY A;  4KZ7 A;  1CI9 A;  4PMA A;  4R0Q A;  2J7V A;  2ZD8 A;  5CTM A;  5FAO A;  2HDR A;  4QB8 A;  3S1Y A;  3G34 A;  1K57 A;  3W4O A;  1VQQ A;  3AGE A;  2ZQ8 A;  2A49 A;  1K4F A;  1BT5 A;  4EQI A;  3MKF A;  4X68 A;  5GLA A;  4MLL A;  3IF6 C;  1G68 A;  2RCX A;  2Z2L B;  2C6W B;  4RX2 A;  3BFF A;  3VP3 A;  3B3X A;  4KQR A;  1KDS A;  3MZD A;  1W7F A;  3S4X A;  4EV4 A;  4FD8 A;  1MWS A;  5CGX A;  4PM5 A;  2ZJ9 A;  4P85 A;  4IED A;  4OPY A;  4JF4 A;  5CEB A;  5M18 A;  4LV0 A;  5M19 A;  4E3N A;  1KGE A;  2V1Z A;  4S2N A;  4HEF A;  3VOZ A;  3V39 A;  4F94 A;  4EWF A;  4UHU A;  1MWR A;  5CHM A;  3NCK A;  4RYE A;  4BEN A;  4ZBE A;  4WZ5 A;  3VSL A;  4BQM A;  4DF6 A;  1PWD A;  3N7W A;  3MXR A;  4KZ4 A;  4S2N C;  1H8Z A;  1FCN A;  1S0W A;  1MKI A;  1PW1 A;  1O7E A;  3GMW A;  3Q7Z A;  4S2J A;  5IHV A;  5HW3 A;  2WZX A;  3OPL A;  4LV2 A;  5L2F A;  4WZ5 C;  3VMA A;  4YIN A;  4ZJ2 A;  5GHZ A;  4MNR A;  5EOE A;  1RCJ A;  3MKE A;  3UNW A;  1BLC A;  2IWB A;  2V2F F;  4GB7 A;  4QY6 A;  4WM9 A;  4N9K A;  2FFY A;  4P0M A;  1JWV A;  3RXX A;  3IXH A;  4UA9 A;  2XFT A;  2Y59 A;  2OLU A;  3PBN A;  4CJN A;  4Y7P A;  5CGS A;  3BFC A;  3P98 A;  4DDY A;  5I94 A;  2Y55 A;  1CI8 A;  5AQ9 A;  3N8L A;  4JF5 A;  4BD0 A;  2WK0 A;  3QNB A;  1WYC A;  5DF9 A;  3I7J A;  1K6R A;  3HUO A;  3N8S A;  3OZH A;  3SH8 A;  3JYI A;  4N1H A;  2WZZ A;  5A92 A;  2OSU A;  5KSC A;  2R9X A;  4BD1 A;  3EQU A;  3BM6 A;  3C4P A;  3OCL A;  3WRZ A;  3IH8 A;  3LY3 A;  4OQG A;  3LCE A;  4OOM A;  1ES5 A;  1TDL A;  1U60 A;  2C5W B;  3PTE A;  4H8R A;  4JF6 A;  4X6T A;  3OCN A;  4E3M A;  1FOF A;  2QMI A;  3PAG A;  1PWG A;  2WKI A;  1MBL A;  2H0Y A;  3NDG A;  4XUZ A;  4Y0O A;  5TFQ A;  2EX8 A;  1NYY A;  3IXG A;  4OLD A;  4Y0U A;  3BLM A;  3UY6 A;  1I2S A;  3BYD A;  4DRT A;  2X02 A;  5FA7 A;  3O86 A;  1JWP A;  3M2J A;  2XH9 A;  3HLF A;  1JWZ A;  2WGI A;  3ZG7 B;  1FCM A;  4B88 A;  1DJC A;  2ZC5 B;  1YLP A;  4LV3 A;  1GHM A;  2HDS A;  1EI5 A;  2B5R A;  4S2O A;  5CHJ A;  4E3O A;  4OQH A;  1NJ4 A;  2WKH A;  3LY4 A;  3MXS A;  1L0G A;  4C3Q A;  1Y54 A;  3P09 A;  4E3L A;  2Y2L A;  3HLG A;  1ONH A;  3GQZ A;  1YMS A;  2HP9 A;  1SHV A;  3BLS A;  1LLB A;  4M3K A;  5FI7 A;  2HPB A;  4R3J A;  2XLN A;  4KG2 A;  5DTS A;  3ZNY A;  5GLD A;  5GL9 A;  1XA1 A;  2IWC A;  1XXM A;  2EXA A;  4GOG A;  5TR7 A;  1FSW A;  1E4D A;  1L0D A;  4B4X A;  5BOH A;  3VP1 A;  3N8R A;  3WS5 A;  1ZKJ A;  2WAF A;  1N4O A;  1H8Y A;  4K0W A;  4BLM A;  4E6W A;  2ZC4 B;  1GHP A;  2CC1 A;  4K91 A;  1C3B A;  2Y2M A;  3PBQ A;  2ZM0 A;  3DWZ A;  3GR2 A;  4MBH A;  3HVF A;  1HD8 A;  4JKT A;  1IYP A;  2DNS A;  3PBO A;  4JXS A;  2XR0 A;  2Y2P A;  4MBF A;  1XX2 A;  2WGW A;  5EVI C;  3WWX A;  5FDH A;  4PM8 A;  5FQQ A;  3FYZ A;  1JTD A;  1GA9 A;  3IF6 A;  1O07 A;  3OPH A;  3OC2 A;  3LEZ A;  2Y2N A;  1CK3 A;  4KZ6 A;  1RP5 A;  2OLV A;  1KVL A;  1Z6F A;  2EXB A;  1K56 A;  4PPR A;  1YT4 A;  3EQV A;  3Q1F A;  1CEG A;  3A3D A;  1BUL A;  1L0F A;  2XF3 A;  4JXG A;  4DE1 A;  1QME A;  3SH7 A;  3VOY A;  5KZH A;  1M40 A;  2WYX A;  3ZGA B;  4KZB A;  3HBR A;  3SS3 A;  2G2W A;  3DW0 A;  3ZDJ A;  3PBT A;  5FAS A;  5E2G A;  1FQG A;  3UDI A;  5TGF A;  5E2E A;  4DKI A;  5FAP A;  3ZVW A;  2Y2K A;  4Z9Q A;  5U47 A;  4IVI A;  1KE4 A;  1XGJ A;  4U0T A;  5CEC A;  4XXR A;  3HUM A;  1YLT A;  2WGV A;  1TEM A;  5HFO A;  3N6I A;  4KG5 A;  3VP0 A;  3Q07 A;  2Y4A A;  1YLZ A;  3WS2 A;  4C75 A;  3AGF A;  4R3B A;  1TVF A;  1IYO A;  3DWK A;  2UWX A;  1BUE A;  2G2U A;  1JVJ A;  1ES2 A;  1RGY A;  2ZQD A;  3IH9 A;  2Q9M A;  4YFM A;  3A3I A;  5D3O A;  4D2O A;  3GTC A;  4OP8 A;  1EWZ A;  3VP2 A;  2JC7 A;  1WYB A;  1G6A A;  3IHA A;  1ES3 A;  1LI9 A;  2P9V A;  4HBU A;  4KG6 A;  5EVL A;  5F1G A;  4ZJ1 A;  3UE3 A;  3AGD A;  3M6H A;  1ONG A;  3ZCZ A;  2ZC6 B;  4E3J A;  3C4O A;  1SDE A;  5AQ7 A;  4ZDX A;  2WAD A;  5F82 A;  3BFE A;  1XPB A;  4X55 A;  1DJB A;  3E2L A;  5CTN A;  3CMZ A;  4Q8I A;  3HLD A;  1DY6 A;  3W4Q A;  2JBF A;  4PM6 A;  2XD5 A;  3ISG A;  5FI2 A;  1KDW A;  4MEZ A;  1K54 A;  3G31 A;  3TSG A;  5KMW A;  2HP5 A;  5HL1 A;  5KSH A;  3M6B A;  4R4R A;  4GN2 A;  1XKZ A;  4LCL A;  4R23 A;  1J9M A;  3MFD A;  4P87 A;  1K54 C;  4OH0 A;  1L2S A;  3V3R A;  5GLC A;  5HAQ A;  2EX2 A;  4UAA A;  1YMX A;  1NXY A;  2IWD A;  2FFF B;  5AQA A;  1WE4 A;  1LI0 A;  2QPN A;  1L0E A;  4OP5 A;  3SS4 A;  2VGJ A;  3NI9 A;  1HZO A;  3GVB A;  3VFH A;  3ITA A;  2J9O A;  5CHU A;  5EOO A;  2Y2O A;  3O88 A;  1IEM A;  4S2M A;  5CXW A;  2GDN A;  1MXO A;  1H5X A;  2DRW A;  2E8I A;  2HP6 A;  2PU4 A;  3O87 A;  5FSR A;  3UPO A;  2WAE A;  5A91 A;  1SCW A;  2H10 A;  3ZHH A;  1TDG A;  5E2H A;  4A5R A;  3QHY A;  4B4Z A;  3N4I A;  3V50 A;  1MWU A;  1BLP A;  2JCH A;  2ZLY A;  3VFF A;  4GD6 A;  2WGW B;  1LHY A;  5FAQ A;  3MZE A;  1KGF A;  4OOY A;  4HBT A;  5HX9 A;  3ZG0 A;  1I2W A;  2XFS A;  2ZQA A;  3IF6 B;  1BLH A;  4QHC A;  2A3U A;  3Q7V A;  2XQZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...