1J3WA

Structure of gliding protein-mglb from thermus thermophilus hb8
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
134
structure length
134
Chain Sequence
LVLYGAPYERAVEVLEETLRETGARYALLIDRKGFVLAHKEALWAPKPPPLDTLATLVAGNAAATQALAKLLGEARFQEEVHQGERMGLYVDEAGEHALLVLVFDETAPLGKVKLHGKRASEALARIAEEALAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Giding protein-mglB
publication title Structure of Gliding protein-mglB from Thermus THermophilus HB8
rcsb
source organism Thermus thermophilus
molecule tags Structural genomics, unknown function
total genus 39
structure length 134
sequence length 134
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2003-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03259 Robl_LC7 Roadblock/LC7 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.30 Alpha Beta 2-Layer Sandwich Beta-Lactamase Dynein light chain 2a, cytoplasmic 1j3wA00
1CF0A 1ACFA 4X1MA 1K0KA 1SKOB 3L7HA 2JKFA 1PRQA 3KYEA 5EV0A 3U4LP 1VEUB 1D1JA 5EVEA 2V8CA 5FEFA 1FIKA 4QWOA 1G5UA 2B95A 1CQAA 4D60A 4FUWA 3UB5P 3NECA 1YPRA 3CPTA 5EM0A 3T1XA 1VETB 1SKOA 1Y4OA 4X25A 1A0KA 1VEUA 1Z09A 1FILA 1F2KA 3MSHA 3T12B 2PRFA 2ACGA 2BTFP 3T1SA 1PNEA 3DAVA 1CJFA 5EM1A 2E8JA 1PFLA 3T1RA 3LEQA 1J3WA 1HLUP 2VK3A 5FDSA 1VETA 3NULA 3D9YA 1SZVA 2JKGA 2PBDP 2HZ5A 2ZL1B 3CHWP 3T1QB 2PAVP 2ZL1A 2V8FA 1AWIA 3L9KA 3LGOA 3MS6A 4X1LA 4ESPA 5FEGA 3CPTB 4FTXA
chains in the Genus database with same CATH superfamily
3A3FA 5EUAA 1SKOB 4UQIM 1MY8A 3IXGA 5EV0A 3DBAA 1L3LA 1OTIA 4ZJ3A 3DTIA 5EOOA 3OLOA 1JWZA 1K54C 4OLGA 2FH5A 4S2JA 1S6RA 5F82A 5HZHA 3V3SA 1H8YA 3PBSA 3U2AA 3UB6A 3RFBA 5DF8A 1IFQA 3UB8A 2HP9A 1ALQA 2Y2HA 4JPMA 1VETB 4WMCA 2D01A 2Q9MA 3B33A 1VM1A 4EQ1A 2WK0A 4X25A 4BBVA 4WF0A 2EX6A 3MQ0A 2XLNA 4ID4A 2VV7A 4ZAMA 5CHUA 2O99A 4JXSA 2J3WA 1XFNA 3HVFA 1LSWA 1Y28A 5IS1A 3P01A 3MMHA 2E8JA 3ZNYA 2P9VA 3HLDA 4BBUA 4O8GA 2DMWA 4KZ4A 5KZHA 5FAPA 3PAGA 3S7OA 2ZC5B 4PMAA 1GCEA 4MDZA 2P08A 2H0YA 3CZDA 1YT4A 4DKIA 3GDIA 1TF1A 4II7A 4MEZA 1FSYA 4MBKA 2D02A 3GMWA 5CHJA 3QP5A 3MF0A 3IH9A 2PBYA 4ZJ2A 4R70A 3JVUA 4JKTA 5TFQA 3GRJA 4KG2A 2K2NA 3FC7A 5CX7A 3IQAA 1KDSA 4HBUA 3T4JA 4KZAA 5GLAA 2J3TD 4DXCA 4X1MA 5FA7A 2E8IA 4L9FA 4KZBA 1OT6A 4QY6A 4Y3IA 1JVJA 1SHVA 2WGWB 3M2JA 4LENA 4NKPA 4DMZA 2XDMA 1KDWA 3F1PA 4PM7A 2ZM8A 5EOEA 3BQ8A 2WAEA 2W0NA 3DW0A 3LUQA 1V9ZA 2ZMAA 3IH8A 3O5YA 1L2SA 3OOVA 2KLIA 1FSWA 2IWDA 2PR6A 5CXWA 5DTTA 5J4EA 3NJAA 4PAUA 4RA7A 3N7WA 1TS0A 2WKHA 1XP4A 3UE1A 1K55C 2XR0A 4S2NC 1ESIA 3R7WA 4OPRA 3IF5A 4LLOB 1EWZA 1TS8A 4EU0A 4GS9B 2PR5A 2ZM2A 4CPKA 1T1BA 3G30A 3ZHHA 2Q0OA 1S66L 4EUZA 2JBFA 4HQAA 4OQ0A 5F69A 3IT9A 2J9OA 1MPLA 2Y2GA 2IWBA 1ES4A 2A49A 3G35A 2ZC7A 4LFUA 4RVAA 1MZUA 4OQIA 5EFWA 3W4OA 4CJNA 1TDLA 2XQZA 5CEDA 3NIAA 5HARA 2Z6DA 4ZDXA 3IF6B 3VP2A 3CUEC 2B18A 1MXOA 2J3TC 3NCKA 2B5RA 1RP5A 1ERQA 3KX0X 4WZ4A 1K56A 4XT2B 4X53A 4HP9A 1K54A 2EA9A 2M7UA 1LSVA 3T1XA 1YM1A 2XD5A 1K6RA 4R6LA 4EEPA 3JPUA 4R38A 2MJ6A 1NRJA 4JGOA 3UDIA 4EETB 5HW3A 3PXPA 3N8RA 4R4SA 4Q0JA 3C4PA 2PD7A 1S4SA 5KSHA 3T12B 3CAXA 3F1OA 4EBLA 2EX8A 3TW8A 3H7WB 4MLLA 3UDFA 3T1RA 1MBLA 1BLSA 1HVBA 4WBGA 4JLFA 4NXGA 1RCJA 2Z6CA 5IU1A 4UQIS 1TS6A 3Q1FA 3NULA 3F1NB 4EERA 3ZG9B 3D9YA 1GA9A 3OCLA 4UAAA 4C3QA 3NDGA 2V20A 3FWLA 3BLMA 2EFUA 1KGEA 2M7VA 1P97A 3Q81A 3BFEA 4RX2A 1IYSA 3BY9A 1D06A 4Q0HA 1EROA 2J8YA 1OTDA 3BFDA 3NBLA 5TGFA 3UO9A 3TOIA 3K3CA 1N9NA 2Y91A 1E3UD 1DP9A 5GLDA 2G7UA 4WN5A 3TJZC 3IHBA 2W3EA 3AGEA 2WGVA 1O07A 3HLCA 3G2ZA 5DKLA 2WKIA 1P0ZA 3FG8A 5JYPA 4D60A 3UB5P 4DRTA 2XFSA 5FSRA 3RJUA 2XGNA 1NJ4A 1TVFA 3QP2A 5DF9A 3TRCA 2EXAA 2A3UA 1T1AA 4Y0OA 2OAP1 4GHIB 1FCMA 1M6KA 3WS2A 1OJ5A 2ZOHA 3MSHA 4BMWA 4WLAA 5J7EA 2J7VA 2RCXA 3T4KA 1ERMA 2W1RA 5CTMA 1S4RA 2H0TA 3FV7A 4HEFA 3EQUA 4S2NA 1I5QA 3Q7VB 3GECA 4N9LA 2JC7A 4XUXA 3HL9A 1OTBA 1DJAA 4I5SA 3AGFA 3HBRA 2FZ0A 2WAFA 2EFXA 2V1ZA 1T18A 2H28A 3ULFA 1BLHA 2XRNA 4RYEA 5F5YA 4EWFA 3C8CA 3CHWP 5FAQA 4PM6A 3S1YA 3PBNA 4Y15A 2ZC3B 2V8FA 3Q07A 3L9KA 4OOMA 5J8XA 4X1LA 3C7UA 3D3OA 5FEGA 1KOUA 1T1CA 2VX8A 3P09A 2Y8HA 3MQOA 3C5AA 2ZMVA 1PWDA 4M4XA 3D72A 4PPRA 4DDYA 2YKFA 2Y2LA 2B95A 1L0FA 5FQQA 5HWTA 4JGQA 2BG1A 1SKFA 1YSQA 1NLZA 3DTMA 2V9AA 1ONHA 4MN6A 4HBTA 3VFHA 4K08A 3CPTA 1K38A 2VGLM 1AXBA 4CLCD 4R1GA 1D7EA 5FI2A 3C30A 5DVAA 1Z09A 3CG5A 3ISGA 4RQ9A 3IWOA 3PHYA 2QPNA 3BRMA 1BLCA 1XXMA 4E04A 4GN2A 3SOIA 2PU2A 3NC8A 1WA9A 5HAQA 1BYWA 2L1MA 2UWXA 3OPHA 4ZRRA 3LR5A 3GTCA 2K31A 1HLUP 3IX8A 2Z2MB 1YQSA 1ES2A 1N4OA 2W3DA 2W3HA 2PBDP 3OPRA 3ZVWA 5IT5A 3A3JA 3Q7ZA 2ZLYA 3UDXA 1S1YA 4NXFA 4BD0A 1XJ6A 3NHQA 3B3XA 2PAVP 2ZL1A 3C7VA 4BWIA 5TBMA 3BJNA 1AWIA 3MZEA 1KVMA 3LIEA 1GSWA 1SDNA 3IBJA 3ZG8B 1J3WA 4FTXA 4GDNA 3VE3A 1CF0A 1XA7A 1ACFA 1DY6A 4N92A 3KYEA 1KGFA 3U4LP 1Z6FA 2P74A 2ZQAA 4E3LA 3LY3A 3H82B 3VSLA 4PM8A 3A0SA 2Y2MA 3QP4A 4RX3A 3F1OB 5FQMA 4KUOA 4YINA 4GJ4A 3PAEA 3M6HA 3LR3A 4S2OA 2B02A 1CEGA 1ZG4A 1L0DA 2DRWA 3N4IA 5A93A 4IVKA 2UV0E 3ZGAB 4O7DA 3E2KA 1W63Q 1U60A 1L0GA 3C38A 2WKRA 1A0KA 1XGJA 3T4QA 1MWRA 3IWIA 1F2KA 3ZCZA 2R9WA 5D3OA 2DNSA 3LO7A 5IHVA 4YFMA 1P9WA 1MKMA 4QY5A 4JXVA 3KYZA 2BLSA 1MWSA 1BSGA 4IHQA 3DAVA 1OT9A 4GKUA 4HJ3A 1SCWA 2Y2QA 3IWQA 4HJ6A 5E43A 4F3LA 3T4TA 3HLWA 4EBNA 1K57C 2KDKA 4BJPA 2HV1A 2NUPC 3S22A 3IBRA 5FQ9A 3FPWA 4UA7A 5AVFA 4X55A 3T4OA 3KSHA 2C5WB 3W2ZA 4LRYC 4LGWA 3MXRA 4OOLA 3QNCA 2JKTI 1PWGA 4Y2FA 4MN5A 2ZQCA 1H0MA 2A24A 3BFGA 5GL9A 3FPVA 2CMNA 1UGUA 3CI6A 4OP5A 1PI5A 1OTAA 1IEMA 1MWUA 4E6WA 1PIOA 4BQMA 3LICA 4IJGA 4I38A 1BT5A 3UPOA 4E3KA 2Y2JA 1G68A 5L09A 2GDNA 1PI4A 2LB5A 2LB9A 3G31A 4GB7A 4B4ZA 5U47A 3UN7A 1E3UA 1NWZA 3D4FA 4Q0IA 3MBZA 1E4DA 4ETZA 2IWCA 3GR2A 4B88A 4KZ3A 4GD8A 5EVID 4GD6A 2WKEA 5HAIA 4PHTA 3WRZA 1NXYA 2X01A 2QJ5A 1IYPA 2VKSA 1S67L 4K91A 1BLPA 3BQAA 4QU3A 3A0RA 3VP0A 4JXGA 4WUJA 3PR6A 3MFXA 1H8ZA 4WYYA 2XSSA 3QHYA 3R4KA 1Y54A 5CGWA 1CK3A 3A0VA 1XX2A 1L0EA 4H8RA 3VP4A 3T1QB 3ZQ5A 4NETA 5CGSA 2ZOIA 4D2OA 3SS5A 1YLZA 2ZBBA 3BFCA 3CITA 4ZBEA 1X0OA 1MKIA 3CPTB 1LL5A 1K4FA 4Y7PA 1NZOA 3VE4A 4A5RA 4GOGA 2JKFA 4HY8A 2PT7A 5CECA 2O9BA 3KSGA 5CTNA 3V5MA 4QWOA 4S2PA 3B42A 3P7NA 3PBQA 5HSQA 4G3KA 3IS2A 2H10A 2VZWA 3DTKA 1XPBA 2GNXA 5EE8A 1W5DA 4IEDA 2HGVA 1LT0A 3GSGA 5HPIA 4HIAA 1XA1A 2WUQA 1VHMA 4FOFA 3BYDA 2O9AA 4K0WA 2EXBA 1OTEA 3KO6A 4CLCA 1O7EA 3K2NA 5AQBA 1GHMA 1PW1A 5EVIC 5TJJA 3VP3A 3W8KA 3UMDA 4CLCE 4M3KA 3EGXC 1NRFA 4FH4A 1MWTA 2ZQ7A 4LCMA 3EEHA 3G6OA 1K57A 3HUMA 2P04A 3ZVTA 3LFVA 4LPZA 5A92A 1LL9A 3KYQA 4LV0A 4U3TA 4IUHA 4UA9A 3VMAA 3MXSA 4ZJ1A 3MR0A 4B93A 3M2KA 1PRQA 3IX4A 1KE4A 5M19A 4E6XA 2QKPA 5EVEA 3UNWA 5E2EA 2AVXA 4OQGA 4OQHA 4E3OA 4C75A 5F6AA 1IKGA 1CQAA 4IUKA 4DXBA 4LV2A 2HF6A 2HP5A 4X69A 3V3RA 2V2FF 2V1BA 3BWLA 4N1HA 3LR0A 2VV8A 5E2HA 2X02A 3ZG0A 3OPLA 2OAQ1 3DWKA 2WGIA 1EW0A 2OLUA 4ARZA 1PYYA 5I5LA 3FKVA 4EUVA 3E4QA 1PZOA 3HUOA 3RXWA 2P9VB 4NEED 2I9VA 1ONGA 4R23A 3G4PA 4CQHA 5HL1A 1PFLA 4HH2A 1ODVA 3KSIA 5FDSA 3VOZA 1XGIA 3O86A 2WKQA 1PW8A 2L0WA 3RTYA 1QMFA 3FZCA 4H6JA 1DP6A 5L8MA 1H3QA 2WZXA 4X68A 5F68A 4OOYA 3LIDA 1UWPX 5TR7A 4R3AA 5FI7A 2OWHA 5EECA 3HREA 4P6BA 3VOYA 2JHEA 3ICYA 4S2LA 4HP4A 3UE6A 3MQQA 4QD4A 1FOFA 3NOPC 5AQ9A 2Y2OA 5FL3A 3PYPA 1YLPA 5I94A 5E2FA 4GLQA 3E98A 2KOIA 1BTLA 1CI9A 1JWPA 5LBRA 2R9XA 3F1PB 5HDDA 1JNUA 3E4PA 2ZJ9A 4WEKA 5KSCA 2WGWA 3UY6A 4E3NA 2JKRI 4O0PA 5FATA 4ZTKA 2W3FA 3OPPA 3PBOA 3NOUC 4B9OA 3RH8B 2VJWA 1LSXA 4I39A 5A91A 2INWA 4Y0UA 3N8LA 3R7WB 5GHXA 5EPHA 3ITAA 4EEUA 3WS5A 2W1TA 4KQOA 4QHCA 1LHYA 4XUZA 3H9WA 1TD5A 4OPQA 3T1SA 5HX9A 2VLGA 1OJGA 1E25A 2V0UA 4OP8A 2Z2LB 4MMNA 1G6AA 2ZC4B 3IXDA 1IYOA 1UWNX 4KENB 5CGXA 5EVIA 1PWCA 1TEMA 4JBFA 4DE3A 4N9KA 3NDEA 2XFTA 4KUKA 4DDSA 2QMIA 4Z9QA 3IS2B 3OC2A 3MS6A 2QZ6A 2IA2A 4NXEA 3NY4A 5G18A 2OSUA 4JGPA 3UMEA 5GLBA 1WYCA 4DN0A 4R4RA 1JTGA 1N9BA 3C4OA 1KVLA 3HLGA 4KQDA 4JXWA 5CRFA 4I3AA 3LIAA 2OV5A 4R3BA 3ZG7B 1W63M 4L0LA 4DE2A 5HFOA 4MN7A 3WRTA 2Y2KA 3UB7A 2DCFA 4WM9A 5A8BA 2XD1A 1NZUA 3SH7A 4XT2A 3BECA 3EEAA 2ZQ8A 2QHKA 2PD8A 5DTKA 3EOIA 2Y2NA 4HJ4A 1VEUA 2M1CA 3QP6A 5GLCA 4LCLA 4S2IA 3FKWA 1WYBA 4MCWA 1XJ4A 3NI9A 3CMZA 1K6SA 2GJ3A 4NK3A 2PRFA 4JF5A 2ZQ9A 3SH9A 1T19A 1LL8A 3HCYA 1Q2PA 2I72A 3H7WA 4BD1A 1JTDA 1ZC2A 5DFYA 4FSFA 3S7QA 2VEAA 4CLCC 1FCOA 4WZ5C 4GW9A 4OVDA 3F1NA 2JCHA 5AVEA 4Y17A 2EX9A 2Y79A 1G28A 5GHZA 1HD8A 4U0TA 1C3BA 5AJGA 3EGDC 3W4QA 3DWZA 3SH8A 1IELA 5KMWA 3LCEA 4L9EA 2HJEA 4PM5A 4WL9A 1SDEA 1YMSA 1W8QA 2P7JA 3VOLA 3ITBA 5DJTA 1GA0A 4AFIA 4HNBA 4ARZB 4KQQA 4P85A 5CERA 2RL3A 1BULA 3UB9A 5L10A 3MJQA 1JWVA 5FASA 2WYXA 1LLBA 2GX5A 3ZDJA 1KE3A 4FUWA 4UEYA 3P98A 4P87A 5E2GA 2W3GA 1LI9A 1RGZA 4QB8A 5HD3A 2Y2PA 3G2YA 3IXHA 1EI5A 4H6JB 5MC7A 1FILA 3WS1A 5DF7A 1YLYA 4KZ7A 4MBHA 2Y55A 3I7JA 4LRZE 5FQKA 1ZHHB 4GHIA 4PKYG 4EBPA 1PNEA 4UHUA 5HWWA 2FFFB 1GSXA 4WEJA 3MZFA 2PYPA 2VK3A 4QJGA 2C6WB 3UPNA 2HJ9C 4FCFA 1ZG6A 2XF3A 3Q7VA 2EX2A 3EWKA 3A3EA 2HZ5A 1M40A 3PBTA 4DE1A 4IVIA 4X6TA 1GHIA 4O01A 3PTEA 5EVLA 4DF6A 4G3VA 1TDGA 1XKZA 2QJ7A 1GHPA 3OZHA 4FD8A 3UPPA 3O3VA 1N9LA 1CEFA 5AQAA 1WE4A 4EESA 3IXBA 1YKDA 4QPRA 2XA7M 3G34A 3JYIA 2OLVA 1BUEA 1K0KA 3VFFA 3WWXA 3VV4A 1ES3A 1GSVA 2X71A 1KE0A 3LI8A 1H5XA 3SZTA 3GV9A 1FIKA 2G2UA 2W1TB 4YNRA 3ZNTA 3C2WA 4P6ZM 2A2LA 4I3IA 2VGLS 4R3JA 2FFYA 3ZYTA 2PHYA 4MNRA 4UA6A 2ZD8A 5EM0A 2ZM0A 4DE0A 1ESUA 4KZ8A 3TG9A 5EVIB 1OPXA 2WKPA 3MFDA 3CJMA 4LV1A 3HUNA 4EW7A 2QYBA 5FAOA 3MXQA 2PU4A 3MZDA 2XK1A 3N6IA 5FI6A 4PKYA 1W79A 1IKIA 4HHDA 4Y0TA 4GZBA 4HESA 5DTSA 2Y59A 4NG2A 3V50A 5HD5A 2JKRM 4C6YA 4EQIA 4IBRA 3OBFA 2ZL1B 5TBMB 4BL2A 3A3DA 3CLOA 3LIBA 4WZ5A 2HDRA 4Y13A 5FQIA 4BLMA 5M18A 2YKHA 3O88A 2G2WA 4P0MA 4GCZA 4ESPA 2XH9A 5F83A 1FR1A 4L9GA 4KZ6A 1XJ2A 5JYOA 3B47A 4JF4A 1VEUB 2J80A 1YLJA 3FYZA 1NLYA 1F98A 4WMCD 1IYQA 3OCNA 3T50A 2V8CA 4K0XA 3H82A 1FR6A 5G4ZA 1Q2QA 1XFQA 5G4YA 4HH3A 4R0QA 4Y5FA 4BL3A 3IF6C 4U0XA 1DRMA 5HAPA 3TE8A 2GZAA 3GQZA 5DJUA 2VV6A 5CEBA 2Y4AA 2PDRA 1SKOA 2PYRA 1Y4OA 4OONA 3DTEA 3EQVA 1G6OA 1K25A 2Q9NA 1W7FA 2EWVA 4E3JA 4F3LB 3IHAA 4IBXA 4FH2A 1TS7A 3LEQA 2VGKA 3BW6A 1S0WA 1VQQA 3O87A 1VETA 3IX3A 3S7NA 3N8SA 4OPZA 3HJKA 5HDSA 3SS3A 1I2WA 1MC0A 1IOUA 3T4SA 3BFFA 1F5MA 1P9RA 2OWJA 4F94A 3LEZA 2OOLA 4KG5A 1W8YA 3QP1A 2A24B 2W27A 1DJBA 4EV4A 3HJIA 3MKEA 3HLBA 4GDBA 5FDHA 3SW1A 2Y2IA 1OMEA 1HTZA 3MKFA 1DJCA 4N1XA 2K7SA 4B4XA 1N9OA 2CC1A 2HP6A 5C5KA 1G5UA 4OPYA 1I2SA 4DJ2A 2KX6A 4KQRA 2JN7A 4KZ9A 5F1FA 4KZ5A 5BOHA 3S4XA 3E0YA 1K55A 4YWZA 3NOTC 3LR4A 5L2FA 1FQGA 4E3MA 5F1GA 2QWSA 5M1AA 3HLFA 2NUTC 3ZFZA 5GHYA 2HDUA 4Q8IA 2HPBA 4OKPA 2O9CA 1YLWA 5L07A 2R78A 2ZC6B 4NXBA 3BLSA 3LIFA 5DKKA 2XA7S 4BBTA 4DJ3A 1VB6A 5HL6A 2XROA 1K4EA 4KG6A 3RXXA 1YLTA 2V1AA 1PZPA 3S7PA 4PM9A 4ETXA 3E4OA 4MBFA 2XEPA 2ZMFA 1NYYA 2EWWA 4S2KA 4S2MA 5K5BA 4HOIA 1ZTUA 3WS0A 2JKTM 4EXOA 3HLEA 4LV3A 1ES5A 4JF6A 3QP8A 4OH0A 2V0WA 3QNBA 4Z1WA 4P6ZS 3K3DA 1XJ3A 2ZQDA 1H8MA 4BENA 3CUEA 1FCNA 1K56D 4GS9A 2BASA 4LRXC 3SS4A 3L7HA 1NYMA 1CI8A 5FQJA 4E3IA 1D1JA 5HDCA 4XXRA 5FEFA 3PBRA 3JVVA 3T4LA 3BY8A 2L4RA 1YAXA 4OLDA 1F9IA 5CHMA 3M6BA 1YMXA 2VA0A 4HI4A 2WZZA 3AGDA 2H5SA 3G32A 3E2LA 3NECA 1YPRA 3LI9A 3UE3A 3V39A 4I3JA 4ME4A 2JE5A 3IF6A 3UE0A 3BEBA 1QMEA 3VSKA 1BZAA 3KSFA 4YOFA 1V9YA 4WELA 3W4PA 4X56A 1YSPA 2J9PA 1KGGA 4CLCB 4G3WA 5A90A 3Q82A 3BM6A 3LY4A 1J9MA 4JGRA 3VP1A 3WS4A 2ACGA 2BTFP 3ZG5A 3TSGA 1CJFA 5EM1A 1LI0A 5AQ7A 5HWVA 3LYXA 2WADA 3CWFA 5J3WA 4GNUA 1SZVA 1STZA 2JKGA 3GVBA 1RGYA 5KIZA 1NY0A 5DFXA 1S1ZA 2O0YA 3A3IA 1DP8A 1ZKJA 2HDQA 1HZOA 3V67A 3LGOA 2HDSA 5HPFA 2VGJA
chains in the Genus database with same CATH topology
1CF0A 1ACFA 4X1MA 1K0KA 1SKOB 3L7HA 2JKFA 1PRQA 3KYEA 5EV0A 3U4LP 1VEUB 1D1JA 5EVEA 2V8CA 5FEFA 1FIKA 4QWOA 1G5UA 2B95A 1CQAA 4D60A 4FUWA 3UB5P 3NECA 1YPRA 3CPTA 5EM0A 3T1XA 1VETB 1SKOA 1Y4OA 4X25A 1A0KA 1VEUA 1Z09A 1FILA 1F2KA 3MSHA 3T12B 2PRFA 2ACGA 2BTFP 3T1SA 1PNEA 3DAVA 1CJFA 5EM1A 2E8JA 1PFLA 3T1RA 3LEQA 1J3WA 1HLUP 2VK3A 5FDSA 1VETA 3NULA 3D9YA 1SZVA 2JKGA 2PBDP 2HZ5A 2ZL1B 3CHWP 3T1QB 2PAVP 2ZL1A 2V8FA 1AWIA 3L9KA 3LGOA 3MS6A 4X1LA 4ESPA 5FEGA 3CPTB 4FTXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CF0 A;  1ACF A;  4X1M A;  1K0K A;  1SKO B;  3L7H A;  2JKF A;  1PRQ A;  3KYE A;  5EV0 A;  3U4L P;  1VEU B;  1D1J A;  5EVE A;  2V8C A;  5FEF A;  1FIK A;  4QWO A;  1G5U A;  2B95 A;  1CQA A;  4D60 A;  4FUW A;  3UB5 P;  3NEC A;  1YPR A;  3CPT A;  5EM0 A;  3T1X A;  1VET B;  1SKO A;  1Y4O A;  4X25 A;  1A0K A;  1VEU A;  1Z09 A;  1FIL A;  1F2K A;  3MSH A;  3T12 B;  2PRF A;  2ACG A;  2BTF P;  3T1S A;  1PNE A;  3DAV A;  1CJF A;  5EM1 A;  2E8J A;  1PFL A;  3T1R A;  3LEQ A;  1J3W A;  1HLU P;  2VK3 A;  5FDS A;  1VET A;  3NUL A;  3D9Y A;  1SZV A;  2JKG A;  2PBD P;  2HZ5 A;  2ZL1 B;  3CHW P;  3T1Q B;  2PAV P;  2ZL1 A;  2V8F A;  1AWI A;  3L9K A;  3LGO A;  3MS6 A;  4X1L A;  4ESP A;  5FEG A;  3CPT B;  4FTX A; 
#chains in the Genus database with same CATH topology
 3A3F A;  5EUA A;  1SKO B;  4UQI M;  1MY8 A;  3IXG A;  5EV0 A;  3DBA A;  1L3L A;  1OTI A;  4ZJ3 A;  3DTI A;  5EOO A;  3OLO A;  1JWZ A;  1K54 C;  4OLG A;  2FH5 A;  4S2J A;  1S6R A;  5F82 A;  5HZH A;  3V3S A;  1H8Y A;  3PBS A;  3U2A A;  3UB6 A;  3RFB A;  5DF8 A;  1IFQ A;  3UB8 A;  2HP9 A;  1ALQ A;  2Y2H A;  4JPM A;  1VET B;  4WMC A;  2D01 A;  2Q9M A;  3B33 A;  1VM1 A;  4EQ1 A;  2WK0 A;  4X25 A;  4BBV A;  4WF0 A;  2EX6 A;  3MQ0 A;  2XLN A;  4ID4 A;  2VV7 A;  4ZAM A;  5CHU A;  2O99 A;  4JXS A;  2J3W A;  1XFN A;  3HVF A;  1LSW A;  1Y28 A;  5IS1 A;  3P01 A;  3MMH A;  2E8J A;  3ZNY A;  2P9V A;  3HLD A;  4BBU A;  4O8G A;  2DMW A;  4KZ4 A;  5KZH A;  5FAP A;  3PAG A;  3S7O A;  2ZC5 B;  4PMA A;  1GCE A;  4MDZ A;  2P08 A;  2H0Y A;  3CZD A;  1YT4 A;  4DKI A;  3GDI A;  1TF1 A;  4II7 A;  4MEZ A;  1FSY A;  4MBK A;  2D02 A;  3GMW A;  5CHJ A;  3QP5 A;  3MF0 A;  3IH9 A;  2PBY A;  4ZJ2 A;  4R70 A;  3JVU A;  4JKT A;  5TFQ A;  3GRJ A;  4KG2 A;  2K2N A;  3FC7 A;  5CX7 A;  3IQA A;  1KDS A;  4HBU A;  3T4J A;  4KZA A;  5GLA A;  2J3T D;  4DXC A;  4X1M A;  5FA7 A;  2E8I A;  4L9F A;  4KZB A;  1OT6 A;  4QY6 A;  4Y3I A;  1JVJ A;  1SHV A;  2WGW B;  3M2J A;  4LEN A;  4NKP A;  4DMZ A;  2XDM A;  1KDW A;  3F1P A;  4PM7 A;  2ZM8 A;  5EOE A;  3BQ8 A;  2WAE A;  2W0N A;  3DW0 A;  3LUQ A;  1V9Z A;  2ZMA A;  3IH8 A;  3O5Y A;  1L2S A;  3OOV A;  2KLI A;  1FSW A;  2IWD A;  2PR6 A;  5CXW A;  5DTT A;  5J4E A;  3NJA A;  4PAU A;  4RA7 A;  3N7W A;  1TS0 A;  2WKH A;  1XP4 A;  3UE1 A;  1K55 C;  2XR0 A;  4S2N C;  1ESI A;  3R7W A;  4OPR A;  3IF5 A;  4LLO B;  1EWZ A;  1TS8 A;  4EU0 A;  4GS9 B;  2PR5 A;  2ZM2 A;  4CPK A;  1T1B A;  3G30 A;  3ZHH A;  2Q0O A;  1S66 L;  4EUZ A;  2JBF A;  4HQA A;  4OQ0 A;  5F69 A;  3IT9 A;  2J9O A;  1MPL A;  2Y2G A;  2IWB A;  1ES4 A;  2A49 A;  3G35 A;  2ZC7 A;  4LFU A;  4RVA A;  1MZU A;  4OQI A;  5EFW A;  3W4O A;  4CJN A;  1TDL A;  2XQZ A;  5CED A;  3NIA A;  5HAR A;  2Z6D A;  4ZDX A;  3IF6 B;  3VP2 A;  3CUE C;  2B18 A;  1MXO A;  2J3T C;  3NCK A;  2B5R A;  1RP5 A;  1ERQ A;  3KX0 X;  4WZ4 A;  1K56 A;  4XT2 B;  4X53 A;  4HP9 A;  1K54 A;  2EA9 A;  2M7U A;  1LSV A;  3T1X A;  1YM1 A;  2XD5 A;  1K6R A;  4R6L A;  4EEP A;  3JPU A;  4R38 A;  2MJ6 A;  1NRJ A;  4JGO A;  3UDI A;  4EET B;  5HW3 A;  3PXP A;  3N8R A;  4R4S A;  4Q0J A;  3C4P A;  2PD7 A;  1S4S A;  5KSH A;  3T12 B;  3CAX A;  3F1O A;  4EBL A;  2EX8 A;  3TW8 A;  3H7W B;  4MLL A;  3UDF A;  3T1R A;  1MBL A;  1BLS A;  1HVB A;  4WBG A;  4JLF A;  4NXG A;  1RCJ A;  2Z6C A;  5IU1 A;  4UQI S;  1TS6 A;  3Q1F A;  3NUL A;  3F1N B;  4EER A;  3ZG9 B;  3D9Y A;  1GA9 A;  3OCL A;  4UAA A;  4C3Q A;  3NDG A;  2V20 A;  3FWL A;  3BLM A;  2EFU A;  1KGE A;  2M7V A;  1P97 A;  3Q81 A;  3BFE A;  4RX2 A;  1IYS A;  3BY9 A;  1D06 A;  4Q0H A;  1ERO A;  2J8Y A;  1OTD A;  3BFD A;  3NBL A;  5TGF A;  3UO9 A;  3TOI A;  3K3C A;  1N9N A;  2Y91 A;  1E3U D;  1DP9 A;  5GLD A;  2G7U A;  4WN5 A;  3TJZ C;  3IHB A;  2W3E A;  3AGE A;  2WGV A;  1O07 A;  3HLC A;  3G2Z A;  5DKL A;  2WKI A;  1P0Z A;  3FG8 A;  5JYP A;  4D60 A;  3UB5 P;  4DRT A;  2XFS A;  5FSR A;  3RJU A;  2XGN A;  1NJ4 A;  1TVF A;  3QP2 A;  5DF9 A;  3TRC A;  2EXA A;  2A3U A;  1T1A A;  4Y0O A;  2OAP 1;  4GHI B;  1FCM A;  1M6K A;  3WS2 A;  1OJ5 A;  2ZOH A;  3MSH A;  4BMW A;  4WLA A;  5J7E A;  2J7V A;  2RCX A;  3T4K A;  1ERM A;  2W1R A;  5CTM A;  1S4R A;  2H0T A;  3FV7 A;  4HEF A;  3EQU A;  4S2N A;  1I5Q A;  3Q7V B;  3GEC A;  4N9L A;  2JC7 A;  4XUX A;  3HL9 A;  1OTB A;  1DJA A;  4I5S A;  3AGF A;  3HBR A;  2FZ0 A;  2WAF A;  2EFX A;  2V1Z A;  1T18 A;  2H28 A;  3ULF A;  1BLH A;  2XRN A;  4RYE A;  5F5Y A;  4EWF A;  3C8C A;  3CHW P;  5FAQ A;  4PM6 A;  3S1Y A;  3PBN A;  4Y15 A;  2ZC3 B;  2V8F A;  3Q07 A;  3L9K A;  4OOM A;  5J8X A;  4X1L A;  3C7U A;  3D3O A;  5FEG A;  1KOU A;  1T1C A;  2VX8 A;  3P09 A;  2Y8H A;  3MQO A;  3C5A A;  2ZMV A;  1PWD A;  4M4X A;  3D72 A;  4PPR A;  4DDY A;  2YKF A;  2Y2L A;  2B95 A;  1L0F A;  5FQQ A;  5HWT A;  4JGQ A;  2BG1 A;  1SKF A;  1YSQ A;  1NLZ A;  3DTM A;  2V9A A;  1ONH A;  4MN6 A;  4HBT A;  3VFH A;  4K08 A;  3CPT A;  1K38 A;  2VGL M;  1AXB A;  4CLC D;  4R1G A;  1D7E A;  5FI2 A;  3C30 A;  5DVA A;  1Z09 A;  3CG5 A;  3ISG A;  4RQ9 A;  3IWO A;  3PHY A;  2QPN A;  3BRM A;  1BLC A;  1XXM A;  4E04 A;  4GN2 A;  3SOI A;  2PU2 A;  3NC8 A;  1WA9 A;  5HAQ A;  1BYW A;  2L1M A;  2UWX A;  3OPH A;  4ZRR A;  3LR5 A;  3GTC A;  2K31 A;  1HLU P;  3IX8 A;  2Z2M B;  1YQS A;  1ES2 A;  1N4O A;  2W3D A;  2W3H A;  2PBD P;  3OPR A;  3ZVW A;  5IT5 A;  3A3J A;  3Q7Z A;  2ZLY A;  3UDX A;  1S1Y A;  4NXF A;  4BD0 A;  1XJ6 A;  3NHQ A;  3B3X A;  2PAV P;  2ZL1 A;  3C7V A;  4BWI A;  5TBM A;  3BJN A;  1AWI A;  3MZE A;  1KVM A;  3LIE A;  1GSW A;  1SDN A;  3IBJ A;  3ZG8 B;  1J3W A;  4FTX A;  4GDN A;  3VE3 A;  1CF0 A;  1XA7 A;  1ACF A;  1DY6 A;  4N92 A;  3KYE A;  1KGF A;  3U4L P;  1Z6F A;  2P74 A;  2ZQA A;  4E3L A;  3LY3 A;  3H82 B;  3VSL A;  4PM8 A;  3A0S A;  2Y2M A;  3QP4 A;  4RX3 A;  3F1O B;  5FQM A;  4KUO A;  4YIN A;  4GJ4 A;  3PAE A;  3M6H A;  3LR3 A;  4S2O A;  2B02 A;  1CEG A;  1ZG4 A;  1L0D A;  2DRW A;  3N4I A;  5A93 A;  4IVK A;  2UV0 E;  3ZGA B;  4O7D A;  3E2K A;  1W63 Q;  1U60 A;  1L0G A;  3C38 A;  2WKR A;  1A0K A;  1XGJ A;  3T4Q A;  1MWR A;  3IWI A;  1F2K A;  3ZCZ A;  2R9W A;  5D3O A;  2DNS A;  3LO7 A;  5IHV A;  4YFM A;  1P9W A;  1MKM A;  4QY5 A;  4JXV A;  3KYZ A;  2BLS A;  1MWS A;  1BSG A;  4IHQ A;  3DAV A;  1OT9 A;  4GKU A;  4HJ3 A;  1SCW A;  2Y2Q A;  3IWQ A;  4HJ6 A;  5E43 A;  4F3L A;  3T4T A;  3HLW A;  4EBN A;  1K57 C;  2KDK A;  4BJP A;  2HV1 A;  2NUP C;  3S22 A;  3IBR A;  5FQ9 A;  3FPW A;  4UA7 A;  5AVF A;  4X55 A;  3T4O A;  3KSH A;  2C5W B;  3W2Z A;  4LRY C;  4LGW A;  3MXR A;  4OOL A;  3QNC A;  2JKT I;  1PWG A;  4Y2F A;  4MN5 A;  2ZQC A;  1H0M A;  2A24 A;  3BFG A;  5GL9 A;  3FPV A;  2CMN A;  1UGU A;  3CI6 A;  4OP5 A;  1PI5 A;  1OTA A;  1IEM A;  1MWU A;  4E6W A;  1PIO A;  4BQM A;  3LIC A;  4IJG A;  4I38 A;  1BT5 A;  3UPO A;  4E3K A;  2Y2J A;  1G68 A;  5L09 A;  2GDN A;  1PI4 A;  2LB5 A;  2LB9 A;  3G31 A;  4GB7 A;  4B4Z A;  5U47 A;  3UN7 A;  1E3U A;  1NWZ A;  3D4F A;  4Q0I A;  3MBZ A;  1E4D A;  4ETZ A;  2IWC A;  3GR2 A;  4B88 A;  4KZ3 A;  4GD8 A;  5EVI D;  4GD6 A;  2WKE A;  5HAI A;  4PHT A;  3WRZ A;  1NXY A;  2X01 A;  2QJ5 A;  1IYP A;  2VKS A;  1S67 L;  4K91 A;  1BLP A;  3BQA A;  4QU3 A;  3A0R A;  3VP0 A;  4JXG A;  4WUJ A;  3PR6 A;  3MFX A;  1H8Z A;  4WYY A;  2XSS A;  3QHY A;  3R4K A;  1Y54 A;  5CGW A;  1CK3 A;  3A0V A;  1XX2 A;  1L0E A;  4H8R A;  3VP4 A;  3T1Q B;  3ZQ5 A;  4NET A;  5CGS A;  2ZOI A;  4D2O A;  3SS5 A;  1YLZ A;  2ZBB A;  3BFC A;  3CIT A;  4ZBE A;  1X0O A;  1MKI A;  3CPT B;  1LL5 A;  1K4F A;  4Y7P A;  1NZO A;  3VE4 A;  4A5R A;  4GOG A;  2JKF A;  4HY8 A;  2PT7 A;  5CEC A;  2O9B A;  3KSG A;  5CTN A;  3V5M A;  4QWO A;  4S2P A;  3B42 A;  3P7N A;  3PBQ A;  5HSQ A;  4G3K A;  3IS2 A;  2H10 A;  2VZW A;  3DTK A;  1XPB A;  2GNX A;  5EE8 A;  1W5D A;  4IED A;  2HGV A;  1LT0 A;  3GSG A;  5HPI A;  4HIA A;  1XA1 A;  2WUQ A;  1VHM A;  4FOF A;  3BYD A;  2O9A A;  4K0W A;  2EXB A;  1OTE A;  3KO6 A;  4CLC A;  1O7E A;  3K2N A;  5AQB A;  1GHM A;  1PW1 A;  5EVI C;  5TJJ A;  3VP3 A;  3W8K A;  3UMD A;  4CLC E;  4M3K A;  3EGX C;  1NRF A;  4FH4 A;  1MWT A;  2ZQ7 A;  4LCM A;  3EEH A;  3G6O A;  1K57 A;  3HUM A;  2P04 A;  3ZVT A;  3LFV A;  4LPZ A;  5A92 A;  1LL9 A;  3KYQ A;  4LV0 A;  4U3T A;  4IUH A;  4UA9 A;  3VMA A;  3MXS A;  4ZJ1 A;  3MR0 A;  4B93 A;  3M2K A;  1PRQ A;  3IX4 A;  1KE4 A;  5M19 A;  4E6X A;  2QKP A;  5EVE A;  3UNW A;  5E2E A;  2AVX A;  4OQG A;  4OQH A;  4E3O A;  4C75 A;  5F6A A;  1IKG A;  1CQA A;  4IUK A;  4DXB A;  4LV2 A;  2HF6 A;  2HP5 A;  4X69 A;  3V3R A;  2V2F F;  2V1B A;  3BWL A;  4N1H A;  3LR0 A;  2VV8 A;  5E2H A;  2X02 A;  3ZG0 A;  3OPL A;  2OAQ 1;  3DWK A;  2WGI A;  1EW0 A;  2OLU A;  4ARZ A;  1PYY A;  5I5L A;  3FKV A;  4EUV A;  3E4Q A;  1PZO A;  3HUO A;  3RXW A;  2P9V B;  4NEE D;  2I9V A;  1ONG A;  4R23 A;  3G4P A;  4CQH A;  5HL1 A;  1PFL A;  4HH2 A;  1ODV A;  3KSI A;  5FDS A;  3VOZ A;  1XGI A;  3O86 A;  2WKQ A;  1PW8 A;  2L0W A;  3RTY A;  1QMF A;  3FZC A;  4H6J A;  1DP6 A;  5L8M A;  1H3Q A;  2WZX A;  4X68 A;  5F68 A;  4OOY A;  3LID A;  1UWP X;  5TR7 A;  4R3A A;  5FI7 A;  2OWH A;  5EEC A;  3HRE A;  4P6B A;  3VOY A;  2JHE A;  3ICY A;  4S2L A;  4HP4 A;  3UE6 A;  3MQQ A;  4QD4 A;  1FOF A;  3NOP C;  5AQ9 A;  2Y2O A;  5FL3 A;  3PYP A;  1YLP A;  5I94 A;  5E2F A;  4GLQ A;  3E98 A;  2KOI A;  1BTL A;  1CI9 A;  1JWP A;  5LBR A;  2R9X A;  3F1P B;  5HDD A;  1JNU A;  3E4P A;  2ZJ9 A;  4WEK A;  5KSC A;  2WGW A;  3UY6 A;  4E3N A;  2JKR I;  4O0P A;  5FAT A;  4ZTK A;  2W3F A;  3OPP A;  3PBO A;  3NOU C;  4B9O A;  3RH8 B;  2VJW A;  1LSX A;  4I39 A;  5A91 A;  2INW A;  4Y0U A;  3N8L A;  3R7W B;  5GHX A;  5EPH A;  3ITA A;  4EEU A;  3WS5 A;  2W1T A;  4KQO A;  4QHC A;  1LHY A;  4XUZ A;  3H9W A;  1TD5 A;  4OPQ A;  3T1S A;  5HX9 A;  2VLG A;  1OJG A;  1E25 A;  2V0U A;  4OP8 A;  2Z2L B;  4MMN A;  1G6A A;  2ZC4 B;  3IXD A;  1IYO A;  1UWN X;  4KEN B;  5CGX A;  5EVI A;  1PWC A;  1TEM A;  4JBF A;  4DE3 A;  4N9K A;  3NDE A;  2XFT A;  4KUK A;  4DDS A;  2QMI A;  4Z9Q A;  3IS2 B;  3OC2 A;  3MS6 A;  2QZ6 A;  2IA2 A;  4NXE A;  3NY4 A;  5G18 A;  2OSU A;  4JGP A;  3UME A;  5GLB A;  1WYC A;  4DN0 A;  4R4R A;  1JTG A;  1N9B A;  3C4O A;  1KVL A;  3HLG A;  4KQD A;  4JXW A;  5CRF A;  4I3A A;  3LIA A;  2OV5 A;  4R3B A;  3ZG7 B;  1W63 M;  4L0L A;  4DE2 A;  5HFO A;  4MN7 A;  3WRT A;  2Y2K A;  3UB7 A;  2DCF A;  4WM9 A;  5A8B A;  2XD1 A;  1NZU A;  3SH7 A;  4XT2 A;  3BEC A;  3EEA A;  2ZQ8 A;  2QHK A;  2PD8 A;  5DTK A;  3EOI A;  2Y2N A;  4HJ4 A;  1VEU A;  2M1C A;  3QP6 A;  5GLC A;  4LCL A;  4S2I A;  3FKW A;  1WYB A;  4MCW A;  1XJ4 A;  3NI9 A;  3CMZ A;  1K6S A;  2GJ3 A;  4NK3 A;  2PRF A;  4JF5 A;  2ZQ9 A;  3SH9 A;  1T19 A;  1LL8 A;  3HCY A;  1Q2P A;  2I72 A;  3H7W A;  4BD1 A;  1JTD A;  1ZC2 A;  5DFY A;  4FSF A;  3S7Q A;  2VEA A;  4CLC C;  1FCO A;  4WZ5 C;  4GW9 A;  4OVD A;  3F1N A;  2JCH A;  5AVE A;  4Y17 A;  2EX9 A;  2Y79 A;  1G28 A;  5GHZ A;  1HD8 A;  4U0T A;  1C3B A;  5AJG A;  3EGD C;  3W4Q A;  3DWZ A;  3SH8 A;  1IEL A;  5KMW A;  3LCE A;  4L9E A;  2HJE A;  4PM5 A;  4WL9 A;  1SDE A;  1YMS A;  1W8Q A;  2P7J A;  3VOL A;  3ITB A;  5DJT A;  1GA0 A;  4AFI A;  4HNB A;  4ARZ B;  4KQQ A;  4P85 A;  5CER A;  2RL3 A;  1BUL A;  3UB9 A;  5L10 A;  3MJQ A;  1JWV A;  5FAS A;  2WYX A;  1LLB A;  2GX5 A;  3ZDJ A;  1KE3 A;  4FUW A;  4UEY A;  3P98 A;  4P87 A;  5E2G A;  2W3G A;  1LI9 A;  1RGZ A;  4QB8 A;  5HD3 A;  2Y2P A;  3G2Y A;  3IXH A;  1EI5 A;  4H6J B;  5MC7 A;  1FIL A;  3WS1 A;  5DF7 A;  1YLY A;  4KZ7 A;  4MBH A;  2Y55 A;  3I7J A;  4LRZ E;  5FQK A;  1ZHH B;  4GHI A;  4PKY G;  4EBP A;  1PNE A;  4UHU A;  5HWW A;  2FFF B;  1GSX A;  4WEJ A;  3MZF A;  2PYP A;  2VK3 A;  4QJG A;  2C6W B;  3UPN A;  2HJ9 C;  4FCF A;  1ZG6 A;  2XF3 A;  3Q7V A;  2EX2 A;  3EWK A;  3A3E A;  2HZ5 A;  1M40 A;  3PBT A;  4DE1 A;  4IVI A;  4X6T A;  1GHI A;  4O01 A;  3PTE A;  5EVL A;  4DF6 A;  4G3V A;  1TDG A;  1XKZ A;  2QJ7 A;  1GHP A;  3OZH A;  4FD8 A;  3UPP A;  3O3V A;  1N9L A;  1CEF A;  5AQA A;  1WE4 A;  4EES A;  3IXB A;  1YKD A;  4QPR A;  2XA7 M;  3G34 A;  3JYI A;  2OLV A;  1BUE A;  1K0K A;  3VFF A;  3WWX A;  3VV4 A;  1ES3 A;  1GSV A;  2X71 A;  1KE0 A;  3LI8 A;  1H5X A;  3SZT A;  3GV9 A;  1FIK A;  2G2U A;  2W1T B;  4YNR A;  3ZNT A;  3C2W A;  4P6Z M;  2A2L A;  4I3I A;  2VGL S;  4R3J A;  2FFY A;  3ZYT A;  2PHY A;  4MNR A;  4UA6 A;  2ZD8 A;  5EM0 A;  2ZM0 A;  4DE0 A;  1ESU A;  4KZ8 A;  3TG9 A;  5EVI B;  1OPX A;  2WKP A;  3MFD A;  3CJM A;  4LV1 A;  3HUN A;  4EW7 A;  2QYB A;  5FAO A;  3MXQ A;  2PU4 A;  3MZD A;  2XK1 A;  3N6I A;  5FI6 A;  4PKY A;  1W79 A;  1IKI A;  4HHD A;  4Y0T A;  4GZB A;  4HES A;  5DTS A;  2Y59 A;  4NG2 A;  3V50 A;  5HD5 A;  2JKR M;  4C6Y A;  4EQI A;  4IBR A;  3OBF A;  2ZL1 B;  5TBM B;  4BL2 A;  3A3D A;  3CLO A;  3LIB A;  4WZ5 A;  2HDR A;  4Y13 A;  5FQI A;  4BLM A;  5M18 A;  2YKH A;  3O88 A;  2G2W A;  4P0M A;  4GCZ A;  4ESP A;  2XH9 A;  5F83 A;  1FR1 A;  4L9G A;  4KZ6 A;  1XJ2 A;  5JYO A;  3B47 A;  4JF4 A;  1VEU B;  2J80 A;  1YLJ A;  3FYZ A;  1NLY A;  1F98 A;  4WMC D;  1IYQ A;  3OCN A;  3T50 A;  2V8C A;  4K0X A;  3H82 A;  1FR6 A;  5G4Z A;  1Q2Q A;  1XFQ A;  5G4Y A;  4HH3 A;  4R0Q A;  4Y5F A;  4BL3 A;  3IF6 C;  4U0X A;  1DRM A;  5HAP A;  3TE8 A;  2GZA A;  3GQZ A;  5DJU A;  2VV6 A;  5CEB A;  2Y4A A;  2PDR A;  1SKO A;  2PYR A;  1Y4O A;  4OON A;  3DTE A;  3EQV A;  1G6O A;  1K25 A;  2Q9N A;  1W7F A;  2EWV A;  4E3J A;  4F3L B;  3IHA A;  4IBX A;  4FH2 A;  1TS7 A;  3LEQ A;  2VGK A;  3BW6 A;  1S0W A;  1VQQ A;  3O87 A;  1VET A;  3IX3 A;  3S7N A;  3N8S A;  4OPZ A;  3HJK A;  5HDS A;  3SS3 A;  1I2W A;  1MC0 A;  1IOU A;  3T4S A;  3BFF A;  1F5M A;  1P9R A;  2OWJ A;  4F94 A;  3LEZ A;  2OOL A;  4KG5 A;  1W8Y A;  3QP1 A;  2A24 B;  2W27 A;  1DJB A;  4EV4 A;  3HJI A;  3MKE A;  3HLB A;  4GDB A;  5FDH A;  3SW1 A;  2Y2I A;  1OME A;  1HTZ A;  3MKF A;  1DJC A;  4N1X A;  2K7S A;  4B4X A;  1N9O A;  2CC1 A;  2HP6 A;  5C5K A;  1G5U A;  4OPY A;  1I2S A;  4DJ2 A;  2KX6 A;  4KQR A;  2JN7 A;  4KZ9 A;  5F1F A;  4KZ5 A;  5BOH A;  3S4X A;  3E0Y A;  1K55 A;  4YWZ A;  3NOT C;  3LR4 A;  5L2F A;  1FQG A;  4E3M A;  5F1G A;  2QWS A;  5M1A A;  3HLF A;  2NUT C;  3ZFZ A;  5GHY A;  2HDU A;  4Q8I A;  2HPB A;  4OKP A;  2O9C A;  1YLW A;  5L07 A;  2R78 A;  2ZC6 B;  4NXB A;  3BLS A;  3LIF A;  5DKK A;  2XA7 S;  4BBT A;  4DJ3 A;  1VB6 A;  5HL6 A;  2XRO A;  1K4E A;  4KG6 A;  3RXX A;  1YLT A;  2V1A A;  1PZP A;  3S7P A;  4PM9 A;  4ETX A;  3E4O A;  4MBF A;  2XEP A;  2ZMF A;  1NYY A;  2EWW A;  4S2K A;  4S2M A;  5K5B A;  4HOI A;  1ZTU A;  3WS0 A;  2JKT M;  4EXO A;  3HLE A;  4LV3 A;  1ES5 A;  4JF6 A;  3QP8 A;  4OH0 A;  2V0W A;  3QNB A;  4Z1W A;  4P6Z S;  3K3D A;  1XJ3 A;  2ZQD A;  1H8M A;  4BEN A;  3CUE A;  1FCN A;  1K56 D;  4GS9 A;  2BAS A;  4LRX C;  3SS4 A;  3L7H A;  1NYM A;  1CI8 A;  5FQJ A;  4E3I A;  1D1J A;  5HDC A;  4XXR A;  5FEF A;  3PBR A;  3JVV A;  3T4L A;  3BY8 A;  2L4R A;  1YAX A;  4OLD A;  1F9I A;  5CHM A;  3M6B A;  1YMX A;  2VA0 A;  4HI4 A;  2WZZ A;  3AGD A;  2H5S A;  3G32 A;  3E2L A;  3NEC A;  1YPR A;  3LI9 A;  3UE3 A;  3V39 A;  4I3J A;  4ME4 A;  2JE5 A;  3IF6 A;  3UE0 A;  3BEB A;  1QME A;  3VSK A;  1BZA A;  3KSF A;  4YOF A;  1V9Y A;  4WEL A;  3W4P A;  4X56 A;  1YSP A;  2J9P A;  1KGG A;  4CLC B;  4G3W A;  5A90 A;  3Q82 A;  3BM6 A;  3LY4 A;  1J9M A;  4JGR A;  3VP1 A;  3WS4 A;  2ACG A;  2BTF P;  3ZG5 A;  3TSG A;  1CJF A;  5EM1 A;  1LI0 A;  5AQ7 A;  5HWV A;  3LYX A;  2WAD A;  3CWF A;  5J3W A;  4GNU A;  1SZV A;  1STZ A;  2JKG A;  3GVB A;  1RGY A;  5KIZ A;  1NY0 A;  5DFX A;  1S1Z A;  2O0Y A;  3A3I A;  1DP8 A;  1ZKJ A;  2HDQ A;  1HZO A;  3V67 A;  3LGO A;  2HDS A;  5HPF A;  2VGJ A; 
#chains in the Genus database with same CATH homology
 1CF0 A;  1ACF A;  4X1M A;  1K0K A;  1SKO B;  3L7H A;  2JKF A;  1PRQ A;  3KYE A;  5EV0 A;  3U4L P;  1VEU B;  1D1J A;  5EVE A;  2V8C A;  5FEF A;  1FIK A;  4QWO A;  1G5U A;  2B95 A;  1CQA A;  4D60 A;  4FUW A;  3UB5 P;  3NEC A;  1YPR A;  3CPT A;  5EM0 A;  3T1X A;  1VET B;  1SKO A;  1Y4O A;  4X25 A;  1A0K A;  1VEU A;  1Z09 A;  1FIL A;  1F2K A;  3MSH A;  3T12 B;  2PRF A;  2ACG A;  2BTF P;  3T1S A;  1PNE A;  3DAV A;  1CJF A;  5EM1 A;  2E8J A;  1PFL A;  3T1R A;  3LEQ A;  1J3W A;  1HLU P;  2VK3 A;  5FDS A;  1VET A;  3NUL A;  3D9Y A;  1SZV A;  2JKG A;  2PBD P;  2HZ5 A;  2ZL1 B;  3CHW P;  3T1Q B;  2PAV P;  2ZL1 A;  2V8F A;  1AWI A;  3L9K A;  3LGO A;  3MS6 A;  4X1L A;  4ESP A;  5FEG A;  3CPT B;  4FTX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...