1J3WA

Structure of gliding protein-mglb from thermus thermophilus hb8
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
134
structure length
134
Chain Sequence
LVLYGAPYERAVEVLEETLRETGARYALLIDRKGFVLAHKEALWAPKPPPLDTLATLVAGNAAATQALAKLLGEARFQEEVHQGERMGLYVDEAGEHALLVLVFDETAPLGKVKLHGKRASEALARIAEEALAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Giding protein-mglB
publication title Structure of Gliding protein-mglB from Thermus THermophilus HB8
rcsb
source organism Thermus thermophilus
total genus 39
structure length 134
sequence length 134
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2003-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03259 Robl_LC7 Roadblock/LC7 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.30 Alpha Beta 2-Layer Sandwich Beta-Lactamase Dynein light chain 2a, cytoplasmic 1j3wA00
2PAVP 3CPTB 3MS6A 1PFLA 1AWIA 4X1MA 2BTFP 3DAVA 3U4LP 4X25A 1SKOB 2V8FA 4ESPA 1A0KA 1VETA 3NECA 1J3WA 1SKOA 1CJFA 1CF0A 1ACFA 1F2KA 1SZVA 2V8CA 3MSHA 5FEFA 4FTXA 3CPTA 5EM1A 1FILA 2JKGA 2HZ5A 3NULA 3LGOA 4QWOA 4X1LA 4D60A 1D1JA 4FUWA 1Y4OA 5EVEA 5FEGA 1VEUB 2PBDP 2JKFA 3L7HA 3T1QB 2ZL1B 3KYEA 2E8JA 1FIKA 2VK3A 3D9YA 2ZL1A 3LEQA 1PNEA 3CHWP 3T12B 3UB5P 5FDSA 3T1SA 5EV0A 1G5UA 1PRQA 1K0KA 1Z09A 1YPRA 2ACGA 1VETB 3T1XA 2B95A 1CQAA 1VEUA 2PRFA 5EM0A 1HLUP 3T1RA 3L9KA
chains in the Genus database with same CATH superfamily
1ES4A 2VJWA 1MKIA 3T4OA 5EOEA 4EU0A 3KSFA 3LIDA 4P85A 4DE3A 4IHQA 2Z6DA 2EX2A 1IEMA 3BQ8A 3UE0A 4ZRRA 1NRJA 2ZC6B 1NLYA 4MMNA 1OTAA 2WKIA 5JYOA 2PD7A 3C7UA 4GD6A 5EECA 1JWPA 3TSGA 2OLUA 3JVUA 4JKTA 1RGYA 1N9BA 3IH8A 1Q2QA 3GQZA 4OP5A 2Y79A 3JYIA 1QMFA 1LL9A 2WGWB 2VLGA 1W5DA 4GHIB 4WN5A 5G18A 2J3WA 3W2ZA 4LENA 1KE0A 5EVID 1YLZA 2L0WA 4S2LA 1OT6A 3C8CA 5A93A 4EBNA 2Y2HA 3CG5A 2XGNA 3ZCZA 5KSHA 2ZQ8A 3B33A 3KSGA 1LLBA 3LY3A 5HFOA 3FG8A 1XJ4A 1VB6A 4WM9A 1WYBA 5GLAA 3NOTC 5G4ZA 1ZG6A 5CXWA 4FH2A 4DE0A 3UDIA 3R7WB 5CRFA 3UE6A 2R78A 1ZHHB 1KDSA 5AQBA 2GZAA 1NZOA 3EGXC 3V3SA 1IYOA 3CI6A 4CLCA 2WKPA 4R70A 3KO6A 4HP9A 2X01A 5A91A 1CEGA 1Z6FA 3WRZA 1XKZA 3N7WA 4P6ZS 2CMNA 1HD8A 5D3OA 5HWVA 1MXOA 2P04A 3BW6A 5LBRA 1I2WA 1TS6A 1MWRA 5FQ9A 3HUOA 3BY8A 4I39A 5GLDA 4YOFA 3C2WA 4O7DA 2IA2A 5HX9A 3VOYA 2H10A 1OTEA 1XGJA 2W0NA 4JXGA 3QHYA 2FH5A 3SH7A 2V0WA 5FDHA 3OBFA 4B9OA 3U2AA 4GOGA 5FQKA 2WKRA 4EWFA 1VM1A 3HUMA 5HDSA 4XUXA 3GMWA 3IF6C 5TBMA 4BL2A 4Q8IA 2VGLS 3FWLA 5HAIA 1FSYA 4Z9QA 3NJAA 5CEBA 2PHYA 4LLOB 1HZOA 2Y2GA 3DTKA 3S7QA 3NBLA 4HESA 5C5KA 3Q81A 1T1CA 3P7NA 1K25A 3F1PB 1EI5A 3SS3A 3TW8A 3LUQA 3UE1A 2FFFB 1ES3A 3TRCA 1LSWA 3P98A 2P74A 3W4OA 3LEZA 5TR7A 1SKOB 3SS5A 4PM8A 5HD5A 1XFNA 2ZLYA 1O07A 3BRMA 3IWQA 4WELA 4LFUA 1KVMA 2XQZA 3F1OA 2D02A 1IKGA 2W1TA 2XR0A 3N8RA 4HH3A 1BLHA 5DFXA 2BG1A 3MQQA 1I2SA 4FTXA 4ETXA 3I7JA 1PWCA 4Y2FA 4PPRA 5EM1A 1P97A 1PZPA 5TJJA 2MJ6A 4ZJ2A 1K54A 4FH4A 1WA9A 2L1MA 1T1BA 3UB9A 3N8SA 4IUHA 4QJGA 1Y4OA 4H8RA 5FASA 3A3FA 5F1FA 1P9WA 3F1NA 1DRMA 3K3CA 3UB7A 2XH9A 1EROA 4L9GA 2Q9MA 4HI4A 4DKIA 2H0TA 3TG9A 1PI5A 5E43A 2W3DA 2DRWA 5DF8A 3MMHA 2A49A 5TFQA 3ZFZA 2P7JA 2A24B 3G4PA 4PM7A 4BD1A 2P9VA 3FZCA 4NKPA 5CGSA 3DTMA 4U0TA 3KSHA 2EXAA 4Q0HA 5DTSA 3A0VA 4E3LA 4NEED 1YLTA 1YLPA 4I38A 2RCXA 2VKSA 4XXRA 3ZG0A 2WYXA 4DDYA 4JGPA 2JC7A 1IKIA 2Y2LA 1TEMA 1TD5A 2K31A 5F5YA 4O8GA 2GNXA 2V8FA 1SKFA 4EESA 4Y13A 4N9KA 2XA7S 4ETZA 3UPPA 5FAOA 3O86A 2Y2KA 3LR5A 3N4IA 2AVXA 5J7EA 5CGWA 1ES5A 4YWZA 3T4JA 4OQIA 3C5AA 5FSRA 3UO9A 5HPFA 4KZ3A 2JKGA 4X6TA 3Q7ZA 3BY9A 3TE8A 1VHMA 2WKHA 2Z2MB 2V2FF 3VV4A 1JWZA 1GSWA 1SDNA 4B88A 4BBUA 1K4EA 1Y54A 1S1ZA 3FYZA 3V3RA 3O5YA 4Y0UA 3ZYTA 5HSQA 1ODVA 1P9RA 1C3BA 2ZL1A 1CI8A 2I72A 5GHZA 1N4OA 3MZDA 5EVIA 1BSGA 1YT4A 2O99A 4BJPA 3UB5P 3IH9A 1VQQA 3LFVA 5HPIA 3DBAA 3QP6A 4S2NA 3CWFA 4MNRA 4OQHA 4OPZA 3NHQA 3IX3A 4B4XA 1L0GA 4Z1WA 2OSUA 3OC2A 4EUVA 4HIAA 3P09A 4HBTA 2I9VA 3LYXA 3R4KA 2KLIA 1STZA 2Y2OA 3A3IA 4FD8A 3UPOA 2O9BA 3GVBA 4C6YA 1W8YA 1MKMA 4MLLA 3SS4A 5DVAA 2G2UA 1PW1A 2J8YA 1SDEA 2OAQ1 5DJTA 2KDKA 1TS0A 4Y7PA 3Q7VA 3PR6A 2ZM8A 3PBQA 4UHUA 4R38A 4DE1A 3PXPA 2PR6A 5MC7A 1U60A 2JN7A 4C75A 4OOLA 3C4PA 3CPTA 1T1AA 2R9XA 5JYPA 2HJ9C 3EWKA 3ZGAB 3IS2A 4Y0OA 2Y2IA 2ZC3B 4NXEA 2JKRI 1F98A 3FC7A 3MZEA 4CJNA 1N9LA 4HNBA 1LT0A 4CLCB 1FIKA 3MXSA 2M7VA 5FI6A 4JF5A 3MKFA 3FKVA 3G34A 4IJGA 1JNUA 1K0KA 4QY6A 4BWIA 1DJCA 2NUPC 4Y15A 3NDGA 1IYSA 1VEUA 3LIAA 4EERA 4DRTA 4E3JA 2QJ7A 4RX2A 3MKEA 2PYPA 4KZ7A 1KGFA 3B3XA 4A5RA 4Y3IA 3S7NA 3PBSA 1L2SA 4WZ5A 4ESPA 1LI0A 5FAPA 3ZVWA 4S2KA 5HW3A 1BLPA 2OWHA 4KZ4A 3NECA 2O9CA 5AQAA 1LHYA 3IF6A 5CECA 1CJFA 1P0ZA 4GCZA 4U3TA 3HVFA 4LRYC 4N1XA 1GHIA 3O87A 4B4ZA 2HDQA 4GLQA 3G35A 1L0FA 4HHDA 2XEPA 4X1LA 1D1JA 3LIFA 3UPNA 2ZOHA 3ZG5A 4CPKA 2FZ0A 2WZXA 3N8LA 5CHMA 3T1QB 1YMXA 3SH8A 4LV2A 3HLWA 5EVLA 3IXBA 1PYYA 5L09A 3IBRA 5HDCA 3RH8B 2VGJA 1E3UA 3ZQ5A 1J9MA 2XFSA 2ZC7A 2KX6A 3QP5A 3MQOA 4HOIA 1IELA 3VOZA 3QNCA 4ZJ3A 3G2ZA 1NY0A 4S2OA 3SZTA 2W1TB 1LSVA 5FQQA 1ONHA 1HLUP 4P87A 2WZZA 3T4SA 5KMWA 3H7WA 4MEZA 3P01A 5A90A 1YLJA 4R3BA 5DKLA 4X1MA 2J7VA 3KX0X 3GECA 4X25A 4MN5A 2P08A 1D06A 5J8XA 3C30A 1GHPA 3F1NB 3D72A 4R0QA 4XT2A 1KVLA 4OONA 3IQAA 1KE3A 2EX6A 4OQGA 1L0EA 4E3IA 2HDSA 3LI9A 5F83A 4NG2A 5L2FA 1ERMA 2P9VB 5I5LA 3OZHA 4JLFA 1FCMA 4YINA 4GS9B 4GKUA 4G3KA 1GSXA 2ZM2A 4WL9A 4KZ6A 4BENA 4GN2A 4H6JB 4O01A 4K08A 3CITA 3BFCA 3OLOA 2XF3A 5BOHA 4QB8A 5L10A 3M6BA 4L0LA 1IYQA 1G68A 1PZOA 3DTEA 1YMSA 3G31A 1UGUA 3GRJA 1YPRA 3OOVA 5KIZA 2WK0A 2PYRA 3T1XA 4JGQA 2QPNA 1V9YA 2Y2PA 2OAP1 3IWIA 4EQIA 2V9AA 3IHBA 3V5MA 3M2JA 4KZ5A 3V39A 2FFYA 2VGKA 3MS6A 4OP8A 3FPVA 3E4QA 1PFLA 3G32A 3VSLA 4R6LA 5FQMA 4DMZA 4CLCE 2RL3A 4OPQA 5L8MA 3VSKA 5L07A 4LV1A 3EQVA 3GTCA 2G7UA 1EW0A 4QU3A 1OTBA 5HZHA 2JKTI 2O0YA 3KSIA 2HGVA 3H82B 4U0XA 3RXXA 1K6RA 3VE4A 1NYYA 2V1ZA 3ICYA 5GLBA 2V1AA 3LCEA 3MSHA 4ZJ1A 1FOFA 4QY5A 2PT7A 3B47A 5EVIB 1EWZA 5M19A 4HJ6A 3NY4A 3NULA 4IBRA 4X68A 2WGWA 4JXWA 3VP1A 5A8BA 1LL8A 4WBGA 4R3JA 1YAXA 3W4PA 5FEGA 4GHIA 1XGIA 2ZOIA 3UN7A 2XDMA 1MY8A 2WAEA 1UWNX 3A3DA 4HP4A 1E25A 1XXMA 3SW1A 1ES2A 4KZ9A 3C7VA 3MR0A 3VFHA 2Y91A 5CTMA 1BLSA 3WS4A 1F9IA 2YKHA 3T12B 4N92A 2ZMAA 3JPUA 1K55C 3PBNA 2HJEA 3PBRA 4DXCA 5CX7A 5TGFA 3IWOA 4KUOA 1E3UD 1L0DA 4KZBA 3ULFA 4S2PA 1QMEA 4PHTA 2Y2NA 5I94A 5K5BA 3LO7A 5GHYA 4O0PA 3UDFA 1CI9A 1YLWA 3VMAA 1TDGA 3CPTB 5F6AA 3A3JA 4IVKA 2BASA 2QHKA 2VV8A 3VOLA 3IS2B 3U4LP 2W3FA 2D01A 4WZ4A 1E4DA 3ITAA 4ZBEA 3WWXA 4KQDA 4FCFA 4M4XA 3WS1A 1FSWA 2DCFA 2HP6A 1XA1A 4YFMA 2WGVA 4NXFA 3O3VA 1W63M 4RX3A 1FCNA 2ZC5B 4S2IA 1D7EA 5E2FA 2EX9A 4KZAA 3HREA 4Q0JA 3PAGA 3BYDA 3GDIA 2X71A 1T19A 1VEUB 3B42A 3CMZA 4IBXA 4ZAMA 5J3WA 3L7HA 2ZM0A 5FAQA 5GLCA 4C3QA 2QJ5A 3S7OA 5FATA 3A0RA 1CK3A 2W1RA 3SH9A 1K57C 3A3EA 2B02A 1PNEA 3IF5A 1BT5A 1Z09A 1DP9A 5CERA 3CLOA 2JKRM 2Y4AA 1GSVA 3BFDA 1PI4A 4K0WA 1IYPA 1SCWA 3K2NA 1OMEA 5A92A 4B93A 2B5RA 4KQRA 5HARA 3HLBA 1DP8A 4OLGA 3S4XA 4UA6A 2EWWA 5HWWA 1YSPA 2J3TC 1HTZA 1S67L 3HBRA 3WS0A 3RJUA 3EEAA 4UAAA 2YKFA 4QD4A 1AWIA 3HLDA 4GW9A 3LR4A 2Z2LB 1S1YA 4EBPA 5EUAA 1W79A 1WYCA 2NUTC 4E3MA 3LIEA 4RQ9A 5FI2A 4HQAA 3OCNA 2GX5A 1SKOA 3HLGA 2IWBA 3RXWA 1XFQA 3PBTA 3WRTA 1H8MA 3NOPC 3OPHA 4FOFA 1FR6A 1KGEA 2O9AA 2J3TD 3VE3A 4FSFA 5F82A 3ZNYA 1NRFA 2ZQAA 4JPMA 1FILA 2H28A 3BLMA 1TDLA 3UDXA 4LPZA 2E8IA 3T4TA 5EVEA 3N6IA 2H0YA 4PAUA 1HVBA 1LL5A 2HF6A 3IX8A 4DE2A 2E8JA 3BFEA 3DW0A 3H7WB 3WS2A 2VK3A 3MZFA 2K2NA 4IEDA 4NXBA 4MBFA 3CHWP 1OTIA 5KSCA 4OPYA 4OQ0A 4Q0IA 3TJZC 1ZG4A 3IBJA 4E3NA 2B95A 3MXRA 4ARZA 3ZHHA 4ZTKA 3FKWA 1S4RA 1W8QA 1BUEA 4DXBA 3NI9A 1BULA 4ME4A 3Q07A 1XPBA 3D3OA 3MFDA 1OJ5A 3G6OA 4II7A 2XK1A 2UWXA 1YLYA 2K7SA 4KG5A 3QP2A 1K56A 3PYPA 4PKYG 4HH2A 3T50A 3MBZA 1G6OA 1X0OA 2X02A 3EGDC 2Y59A 4KZ8A 4E3KA 1ZC2A 3W8KA 3V67A 4R23A 2V1BA 5M1AA 1CF0A 2L4RA 3BJNA 2XFTA 3IHAA 4MN7A 4UQIM 1F2KA 2V8CA 1YSQA 3PBOA 1BZAA 1OT9A 4DF6A 1BYWA 2OWJA 1BLCA 3LGOA 3GR2A 4S2JA 1ZTUA 1NLZA 2CC1A 1IFQA 3JVVA 3LY4A 3WS5A 4LCMA 2C6WB 2UV0E 1JTDA 1XJ3A 5TBMB 3ISGA 3LI8A 5EOOA 3E98A 1NYMA 1FQGA 4OPRA 1L3LA 2XA7M 1W63Q 3MFXA 4N9LA 1H8YA 3CUEC 3HJKA 3A0SA 5G4YA 2V20A 1KOUA 3PHYA 5HWTA 2ZMVA 3ZNTA 3QP1A 5FI7A 3HCYA 4WLAA 3TOIA 3K3DA 5IS1A 4BMWA 4JBFA 1RGZA 2BLSA 5DJUA 5EVIC 3BFGA 1MWSA 1TVFA 4S2NC 4E3OA 1N9NA 5E2HA 3BM6A 3LR0A 5F69A 3DWZA 1LSXA 4QHCA 1Y28A 3IXHA 3HLFA 3LR3A 3QP4A 1BTLA 3DAVA 5U47A 3F1OB 5AQ7A 4JGRA 3ITBA 2ZQCA 2HDRA 4NXGA 3IXGA 1ACFA 4JF4A 4KQOA 4HY8A 1K55A 4EEPA 4PKYA 2WKEA 2ZQDA 4K0XA 3NIAA 4KQQA 2PR5A 4QPRA 5E2GA 3C4OA 1K6SA 2EWVA 4KG6A 3BLSA 5J4EA 2OV5A 4D60A 2Z6CA 4WMCD 2Y2JA 4HEFA 3AGEA 5EPHA 3MF0A 2JKFA 2JKTM 2QMIA 2G2WA 2Y2QA 2IWDA 4MDZA 4X69A 1MWTA 1ZKJA 1G6AA 4PM6A 2J9OA 4GJ4A 1RP5A 2QWSA 4GDBA 1G5UA 1TF1A 1PRQA 4BL3A 5AJGA 4NETA 2VV6A 4R4RA 4F3LA 1KE4A 2J9PA 3ZG9B 1CQAA 5HL1A 1AXBA 3H9WA 4JGOA 1XP4A 2ZD8A 4HJ3A 3L9KA 3E0YA 4UA9A 3VP4A 3AGDA 4EV4A 3VP2A 2HP5A 2WUQA 2KOIA 1WE4A 4D2OA 3PTEA 2GDNA 4MN6A 5E2EA 1JWVA 3UB6A 5HDDA 5FL3A 5FQIA 4OKPA 1K56D 3GSGA 3UNWA 1A0KA 1VETA 2HV1A 2ZJ9A 3IXDA 4KG2A 4WUJA 1K57A 2EA9A 4DJ2A 1ESIA 4LV0A 4DN0A 4X55A 3UMDA 2HP9A 1MWUA 4WZ5C 3UY6A 4AFIA 2WAFA 4JXSA 1GA0A 2HZ5A 4ZDXA 1DJAA 1MBLA 3UB8A 4I3IA 3E2LA 1MZUA 1H3QA 2EX8A 2W27A 5AQ9A 4WF0A 3BWLA 3M6HA 2ZL1B 2R9WA 3DWKA 3KYEA 5FQJA 3G30A 5HAPA 4WEJA 4PMAA 3ZG8B 4DJ3A 2GJ3A 2VEAA 5CGXA 5FDSA 3Q1FA 4OH0A 3W4QA 1TS7A 1GCEA 2Q0OA 4HBUA 1ALQA 1JVJA 4X53A 4GB7A 3RTYA 4M3KA 4DDSA 4I3AA 1LI9A 1H8ZA 3E2KA 1PWDA 1XJ6A 5EM0A 3T1RA 3HLCA 3HUNA 3ZG7B 3QP8A 5AVFA 5EFWA 2PAVP 4RVAA 5DF9A 2WADA 1H0MA 5CHUA 5HAQA 1DY6A 4K91A 2XROA 4EETB 4IUKA 4JXVA 3OPPA 3Q7VB 4PM9A 1ERQA 3R7WA 1T18A 3IT9A 1JTGA 5GL9A 4E6WA 2ZQ7A 2ZBBA 1ESUA 3EQUA 3UE3A 3OPRA 2EFUA 3NOUC 1IOUA 2PDRA 4I5SA 1I5QA 5HD3A 3G2YA 4KUKA 2OLVA 4R4SA 5FEFA 4LGWA 4BQMA 2WGIA 1YM1A 3NDEA 4UEYA 4QWOA 4YNRA 5IT5A 4CLCC 3HLEA 2XRNA 1NJ4A 1H5XA 1FCOA 4R1GA 4UQIS 3EOIA 3BQAA 4BBTA 3KYQA 4RA7A 4ARZB 4OOMA 4GS9A 4EEUA 4GNUA 2DMWA 2XD5A 4H6JA 3V50A 1M40A 3HJIA 4F94A 2A2LA 2INWA 1K38A 3NC8A 4S2MA 3T1SA 2JBFA 2PBYA 3NCKA 4EXOA 2PU2A 5IHVA 4CLCD 3CJMA 1OTDA 1XX2A 1KGGA 5DTTA 4RYEA 2QYBA 3E4OA 2OOLA 4EBLA 4P6ZM 3VP3A 4N1HA 4BBVA 4BD0A 4WYYA 3VFFA 3O88A 4X56A 5F1GA 3S22A 4IVIA 1GA9A 2LB9A 3IX4A 3AGFA 1PIOA 2PD8A 5IU1A 2B18A 3IF6B 1G28A 3ZDJA 2EXBA 2A3UA 2VZWA 1J3WA 4G3VA 4MBKA 2PU4A 1S0WA 3CUEA 4E6XA 5DKKA 3F1PA 1SZVA 4KENB 3H82A 4G3WA 2W3EA 1YKDA 2ZMFA 1XJ2A 3MXQA 4MBHA 3FV7A 4I3JA 4ID4A 1KDWA 2Y2MA 3ZVTA 2VGLM 3M2KA 1V9ZA 1YQSA 3FPWA 4FUWA 1TS8A 3E4PA 4WEKA 2W3GA 2PBDP 2ZQ9A 2J80A 2VA0A 2C5WB 2VV7A 1ONGA 2Y8HA 3PAEA 3BEBA 1S6RA 2JCHA 2XLNA 1MC0A 3BECA 3GV9A 3T4LA 3T4QA 4EQ1A 1N9OA 3MQ0A 4WMCA 5GHXA 1UWPX 5EV0A 2IWCA 4UA7A 1CEFA 3D4FA 4MCWA 3RFBA 5EE8A 2W3HA 5HL6A 1O7EA 1NXYA 1K54C 5AVEA 1XA7A 4R3AA 1S4SA 1FR1A 4Y0TA 2JE5A 4JF6A 2QKPA 5FA7A 4L9FA 3LICA 4LCLA 2H5SA 4OVDA 5F68A 2V0UA 4XUZA 1PWGA 2HDUA 5DFYA 4LRZE 1F5MA 1RCJA 2A24A 3HL9A 2M7UA 2BTFP 3BFFA 1DJBA 1W7FA 2VX8A 4EW7A 4XT2B 3QNBA 4OLDA 3SOIA 3DTIA 3S7PA 2QZ6A 2Y55A 4L9EA 1M6KA 1PW8A 1MPLA 2M1CA 3Q82A 4P0MA 2LB5A 3S1YA 5CTNA 3VP0A 1DP6A 2ZC4B 1OPXA 3T4KA 4LV3A 2XD1A 4CQHA 4EUZA 4F3LB 4BLMA 4HJ4A 4Y17A 3LIBA 2EFXA 3CAXA 2XSSA 5DTKA 3C38A 5CEDA 2Q9NA 3OCLA 1Q2PA 4GD8A 4LRXC 1NWZA 3MJQA 3D9YA 2DNSA 4PM5A 5M18A 1K4FA 5DF7A 3EEHA 2JHEA 3LEQA 3CZDA 3OPLA 4E04A 4NK3A 2HPBA 4GZBA 4Y5FA 3KYZA 2ACGA 1VETB 1NZUA 1OJGA 4GDNA 1S66L 3UMEA 4P6BA 5KZHA 5CHJA 2PRFA 1SHVA 1GHMA 4OOYA 2WKQA
chains in the Genus database with same CATH topology
2PAVP 3CPTB 3MS6A 1PFLA 1AWIA 4X1MA 2BTFP 3DAVA 3U4LP 4X25A 1SKOB 2V8FA 4ESPA 1A0KA 1VETA 3NECA 1J3WA 1SKOA 1CJFA 1CF0A 1ACFA 1F2KA 1SZVA 2V8CA 3MSHA 5FEFA 4FTXA 3CPTA 5EM1A 1FILA 2JKGA 2HZ5A 3NULA 3LGOA 4QWOA 4X1LA 4D60A 1D1JA 4FUWA 1Y4OA 5EVEA 5FEGA 1VEUB 2PBDP 2JKFA 3L7HA 3T1QB 2ZL1B 3KYEA 2E8JA 1FIKA 2VK3A 3D9YA 2ZL1A 3LEQA 1PNEA 3CHWP 3T12B 3UB5P 5FDSA 3T1SA 5EV0A 1G5UA 1PRQA 1K0KA 1Z09A 1YPRA 2ACGA 1VETB 3T1XA 2B95A 1CQAA 1VEUA 2PRFA 5EM0A 1HLUP 3T1RA 3L9KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PAV P;  3CPT B;  3MS6 A;  1PFL A;  1AWI A;  4X1M A;  2BTF P;  3DAV A;  3U4L P;  4X25 A;  1SKO B;  2V8F A;  4ESP A;  1A0K A;  1VET A;  3NEC A;  1J3W A;  1SKO A;  1CJF A;  1CF0 A;  1ACF A;  1F2K A;  1SZV A;  2V8C A;  3MSH A;  5FEF A;  4FTX A;  3CPT A;  5EM1 A;  1FIL A;  2JKG A;  2HZ5 A;  3NUL A;  3LGO A;  4QWO A;  4X1L A;  4D60 A;  1D1J A;  4FUW A;  1Y4O A;  5EVE A;  5FEG A;  1VEU B;  2PBD P;  2JKF A;  3L7H A;  3T1Q B;  2ZL1 B;  3KYE A;  2E8J A;  1FIK A;  2VK3 A;  3D9Y A;  2ZL1 A;  3LEQ A;  1PNE A;  3CHW P;  3T12 B;  3UB5 P;  5FDS A;  3T1S A;  5EV0 A;  1G5U A;  1PRQ A;  1K0K A;  1Z09 A;  1YPR A;  2ACG A;  1VET B;  3T1X A;  2B95 A;  1CQA A;  1VEU A;  2PRF A;  5EM0 A;  1HLU P;  3T1R A;  3L9K A; 
#chains in the Genus database with same CATH topology
 1ES4 A;  2VJW A;  1MKI A;  3T4O A;  5EOE A;  4EU0 A;  3KSF A;  3LID A;  4P85 A;  4DE3 A;  4IHQ A;  2Z6D A;  2EX2 A;  1IEM A;  3BQ8 A;  3UE0 A;  4ZRR A;  1NRJ A;  2ZC6 B;  1NLY A;  4MMN A;  1OTA A;  2WKI A;  5JYO A;  2PD7 A;  3C7U A;  4GD6 A;  5EEC A;  1JWP A;  3TSG A;  2OLU A;  3JVU A;  4JKT A;  1RGY A;  1N9B A;  3IH8 A;  1Q2Q A;  3GQZ A;  4OP5 A;  2Y79 A;  3JYI A;  1QMF A;  1LL9 A;  2WGW B;  2VLG A;  1W5D A;  4GHI B;  4WN5 A;  5G18 A;  2J3W A;  3W2Z A;  4LEN A;  1KE0 A;  5EVI D;  1YLZ A;  2L0W A;  4S2L A;  1OT6 A;  3C8C A;  5A93 A;  4EBN A;  2Y2H A;  3CG5 A;  2XGN A;  3ZCZ A;  5KSH A;  2ZQ8 A;  3B33 A;  3KSG A;  1LLB A;  3LY3 A;  5HFO A;  3FG8 A;  1XJ4 A;  1VB6 A;  4WM9 A;  1WYB A;  5GLA A;  3NOT C;  5G4Z A;  1ZG6 A;  5CXW A;  4FH2 A;  4DE0 A;  3UDI A;  3R7W B;  5CRF A;  3UE6 A;  2R78 A;  1ZHH B;  1KDS A;  5AQB A;  2GZA A;  1NZO A;  3EGX C;  3V3S A;  1IYO A;  3CI6 A;  4CLC A;  2WKP A;  4R70 A;  3KO6 A;  4HP9 A;  2X01 A;  5A91 A;  1CEG A;  1Z6F A;  3WRZ A;  1XKZ A;  3N7W A;  4P6Z S;  2CMN A;  1HD8 A;  5D3O A;  5HWV A;  1MXO A;  2P04 A;  3BW6 A;  5LBR A;  1I2W A;  1TS6 A;  1MWR A;  5FQ9 A;  3HUO A;  3BY8 A;  4I39 A;  5GLD A;  4YOF A;  3C2W A;  4O7D A;  2IA2 A;  5HX9 A;  3VOY A;  2H10 A;  1OTE A;  1XGJ A;  2W0N A;  4JXG A;  3QHY A;  2FH5 A;  3SH7 A;  2V0W A;  5FDH A;  3OBF A;  4B9O A;  3U2A A;  4GOG A;  5FQK A;  2WKR A;  4EWF A;  1VM1 A;  3HUM A;  5HDS A;  4XUX A;  3GMW A;  3IF6 C;  5TBM A;  4BL2 A;  4Q8I A;  2VGL S;  3FWL A;  5HAI A;  1FSY A;  4Z9Q A;  3NJA A;  5CEB A;  2PHY A;  4LLO B;  1HZO A;  2Y2G A;  3DTK A;  3S7Q A;  3NBL A;  4HES A;  5C5K A;  3Q81 A;  1T1C A;  3P7N A;  1K25 A;  3F1P B;  1EI5 A;  3SS3 A;  3TW8 A;  3LUQ A;  3UE1 A;  2FFF B;  1ES3 A;  3TRC A;  1LSW A;  3P98 A;  2P74 A;  3W4O A;  3LEZ A;  5TR7 A;  1SKO B;  3SS5 A;  4PM8 A;  5HD5 A;  1XFN A;  2ZLY A;  1O07 A;  3BRM A;  3IWQ A;  4WEL A;  4LFU A;  1KVM A;  2XQZ A;  3F1O A;  2D02 A;  1IKG A;  2W1T A;  2XR0 A;  3N8R A;  4HH3 A;  1BLH A;  5DFX A;  2BG1 A;  3MQQ A;  1I2S A;  4FTX A;  4ETX A;  3I7J A;  1PWC A;  4Y2F A;  4PPR A;  5EM1 A;  1P97 A;  1PZP A;  5TJJ A;  2MJ6 A;  4ZJ2 A;  1K54 A;  4FH4 A;  1WA9 A;  2L1M A;  1T1B A;  3UB9 A;  3N8S A;  4IUH A;  4QJG A;  1Y4O A;  4H8R A;  5FAS A;  3A3F A;  5F1F A;  1P9W A;  3F1N A;  1DRM A;  3K3C A;  3UB7 A;  2XH9 A;  1ERO A;  4L9G A;  2Q9M A;  4HI4 A;  4DKI A;  2H0T A;  3TG9 A;  1PI5 A;  5E43 A;  2W3D A;  2DRW A;  5DF8 A;  3MMH A;  2A49 A;  5TFQ A;  3ZFZ A;  2P7J A;  2A24 B;  3G4P A;  4PM7 A;  4BD1 A;  2P9V A;  3FZC A;  4NKP A;  5CGS A;  3DTM A;  4U0T A;  3KSH A;  2EXA A;  4Q0H A;  5DTS A;  3A0V A;  4E3L A;  4NEE D;  1YLT A;  1YLP A;  4I38 A;  2RCX A;  2VKS A;  4XXR A;  3ZG0 A;  2WYX A;  4DDY A;  4JGP A;  2JC7 A;  1IKI A;  2Y2L A;  1TEM A;  1TD5 A;  2K31 A;  5F5Y A;  4O8G A;  2GNX A;  2V8F A;  1SKF A;  4EES A;  4Y13 A;  4N9K A;  2XA7 S;  4ETZ A;  3UPP A;  5FAO A;  3O86 A;  2Y2K A;  3LR5 A;  3N4I A;  2AVX A;  5J7E A;  5CGW A;  1ES5 A;  4YWZ A;  3T4J A;  4OQI A;  3C5A A;  5FSR A;  3UO9 A;  5HPF A;  4KZ3 A;  2JKG A;  4X6T A;  3Q7Z A;  3BY9 A;  3TE8 A;  1VHM A;  2WKH A;  2Z2M B;  2V2F F;  3VV4 A;  1JWZ A;  1GSW A;  1SDN A;  4B88 A;  4BBU A;  1K4E A;  1Y54 A;  1S1Z A;  3FYZ A;  3V3R A;  3O5Y A;  4Y0U A;  3ZYT A;  5HSQ A;  1ODV A;  1P9R A;  1C3B A;  2ZL1 A;  1CI8 A;  2I72 A;  5GHZ A;  1N4O A;  3MZD A;  5EVI A;  1BSG A;  1YT4 A;  2O99 A;  4BJP A;  3UB5 P;  3IH9 A;  1VQQ A;  3LFV A;  5HPI A;  3DBA A;  3QP6 A;  4S2N A;  3CWF A;  4MNR A;  4OQH A;  4OPZ A;  3NHQ A;  3IX3 A;  4B4X A;  1L0G A;  4Z1W A;  2OSU A;  3OC2 A;  4EUV A;  4HIA A;  3P09 A;  4HBT A;  2I9V A;  3LYX A;  3R4K A;  2KLI A;  1STZ A;  2Y2O A;  3A3I A;  4FD8 A;  3UPO A;  2O9B A;  3GVB A;  4C6Y A;  1W8Y A;  1MKM A;  4MLL A;  3SS4 A;  5DVA A;  2G2U A;  1PW1 A;  2J8Y A;  1SDE A;  2OAQ 1;  5DJT A;  2KDK A;  1TS0 A;  4Y7P A;  3Q7V A;  3PR6 A;  2ZM8 A;  3PBQ A;  4UHU A;  4R38 A;  4DE1 A;  3PXP A;  2PR6 A;  5MC7 A;  1U60 A;  2JN7 A;  4C75 A;  4OOL A;  3C4P A;  3CPT A;  1T1A A;  2R9X A;  5JYP A;  2HJ9 C;  3EWK A;  3ZGA B;  3IS2 A;  4Y0O A;  2Y2I A;  2ZC3 B;  4NXE A;  2JKR I;  1F98 A;  3FC7 A;  3MZE A;  4CJN A;  1N9L A;  4HNB A;  1LT0 A;  4CLC B;  1FIK A;  3MXS A;  2M7V A;  5FI6 A;  4JF5 A;  3MKF A;  3FKV A;  3G34 A;  4IJG A;  1JNU A;  1K0K A;  4QY6 A;  4BWI A;  1DJC A;  2NUP C;  4Y15 A;  3NDG A;  1IYS A;  1VEU A;  3LIA A;  4EER A;  4DRT A;  4E3J A;  2QJ7 A;  4RX2 A;  3MKE A;  2PYP A;  4KZ7 A;  1KGF A;  3B3X A;  4A5R A;  4Y3I A;  3S7N A;  3PBS A;  1L2S A;  4WZ5 A;  4ESP A;  1LI0 A;  5FAP A;  3ZVW A;  4S2K A;  5HW3 A;  1BLP A;  2OWH A;  4KZ4 A;  3NEC A;  2O9C A;  5AQA A;  1LHY A;  3IF6 A;  5CEC A;  1CJF A;  1P0Z A;  4GCZ A;  4U3T A;  3HVF A;  4LRY C;  4N1X A;  1GHI A;  3O87 A;  4B4Z A;  2HDQ A;  4GLQ A;  3G35 A;  1L0F A;  4HHD A;  2XEP A;  4X1L A;  1D1J A;  3LIF A;  3UPN A;  2ZOH A;  3ZG5 A;  4CPK A;  2FZ0 A;  2WZX A;  3N8L A;  5CHM A;  3T1Q B;  1YMX A;  3SH8 A;  4LV2 A;  3HLW A;  5EVL A;  3IXB A;  1PYY A;  5L09 A;  3IBR A;  5HDC A;  3RH8 B;  2VGJ A;  1E3U A;  3ZQ5 A;  1J9M A;  2XFS A;  2ZC7 A;  2KX6 A;  3QP5 A;  3MQO A;  4HOI A;  1IEL A;  3VOZ A;  3QNC A;  4ZJ3 A;  3G2Z A;  1NY0 A;  4S2O A;  3SZT A;  2W1T B;  1LSV A;  5FQQ A;  1ONH A;  1HLU P;  4P87 A;  2WZZ A;  3T4S A;  5KMW A;  3H7W A;  4MEZ A;  3P01 A;  5A90 A;  1YLJ A;  4R3B A;  5DKL A;  4X1M A;  2J7V A;  3KX0 X;  3GEC A;  4X25 A;  4MN5 A;  2P08 A;  1D06 A;  5J8X A;  3C30 A;  1GHP A;  3F1N B;  3D72 A;  4R0Q A;  4XT2 A;  1KVL A;  4OON A;  3IQA A;  1KE3 A;  2EX6 A;  4OQG A;  1L0E A;  4E3I A;  2HDS A;  3LI9 A;  5F83 A;  4NG2 A;  5L2F A;  1ERM A;  2P9V B;  5I5L A;  3OZH A;  4JLF A;  1FCM A;  4YIN A;  4GS9 B;  4GKU A;  4G3K A;  1GSX A;  2ZM2 A;  4WL9 A;  4KZ6 A;  4BEN A;  4GN2 A;  4H6J B;  4O01 A;  4K08 A;  3CIT A;  3BFC A;  3OLO A;  2XF3 A;  5BOH A;  4QB8 A;  5L10 A;  3M6B A;  4L0L A;  1IYQ A;  1G68 A;  1PZO A;  3DTE A;  1YMS A;  3G31 A;  1UGU A;  3GRJ A;  1YPR A;  3OOV A;  5KIZ A;  2WK0 A;  2PYR A;  3T1X A;  4JGQ A;  2QPN A;  1V9Y A;  2Y2P A;  2OAP 1;  3IWI A;  4EQI A;  2V9A A;  3IHB A;  3V5M A;  3M2J A;  4KZ5 A;  3V39 A;  2FFY A;  2VGK A;  3MS6 A;  4OP8 A;  3FPV A;  3E4Q A;  1PFL A;  3G32 A;  3VSL A;  4R6L A;  5FQM A;  4DMZ A;  4CLC E;  2RL3 A;  4OPQ A;  5L8M A;  3VSK A;  5L07 A;  4LV1 A;  3EQV A;  3GTC A;  2G7U A;  1EW0 A;  4QU3 A;  1OTB A;  5HZH A;  2JKT I;  2O0Y A;  3KSI A;  2HGV A;  3H82 B;  4U0X A;  3RXX A;  1K6R A;  3VE4 A;  1NYY A;  2V1Z A;  3ICY A;  5GLB A;  2V1A A;  3LCE A;  3MSH A;  4ZJ1 A;  1FOF A;  4QY5 A;  2PT7 A;  3B47 A;  5EVI B;  1EWZ A;  5M19 A;  4HJ6 A;  3NY4 A;  3NUL A;  4IBR A;  4X68 A;  2WGW A;  4JXW A;  3VP1 A;  5A8B A;  1LL8 A;  4WBG A;  4R3J A;  1YAX A;  3W4P A;  5FEG A;  4GHI A;  1XGI A;  2ZOI A;  3UN7 A;  2XDM A;  1MY8 A;  2WAE A;  1UWN X;  3A3D A;  4HP4 A;  1E25 A;  1XXM A;  3SW1 A;  1ES2 A;  4KZ9 A;  3C7V A;  3MR0 A;  3VFH A;  2Y91 A;  5CTM A;  1BLS A;  3WS4 A;  1F9I A;  2YKH A;  3T12 B;  4N92 A;  2ZMA A;  3JPU A;  1K55 C;  3PBN A;  2HJE A;  3PBR A;  4DXC A;  5CX7 A;  5TGF A;  3IWO A;  4KUO A;  1E3U D;  1L0D A;  4KZB A;  3ULF A;  4S2P A;  1QME A;  4PHT A;  2Y2N A;  5I94 A;  5K5B A;  3LO7 A;  5GHY A;  4O0P A;  3UDF A;  1CI9 A;  1YLW A;  3VMA A;  1TDG A;  3CPT B;  5F6A A;  3A3J A;  4IVK A;  2BAS A;  2QHK A;  2VV8 A;  3VOL A;  3IS2 B;  3U4L P;  2W3F A;  2D01 A;  4WZ4 A;  1E4D A;  3ITA A;  4ZBE A;  3WWX A;  4KQD A;  4FCF A;  4M4X A;  3WS1 A;  1FSW A;  2DCF A;  2HP6 A;  1XA1 A;  4YFM A;  2WGV A;  4NXF A;  3O3V A;  1W63 M;  4RX3 A;  1FCN A;  2ZC5 B;  4S2I A;  1D7E A;  5E2F A;  2EX9 A;  4KZA A;  3HRE A;  4Q0J A;  3PAG A;  3BYD A;  3GDI A;  2X71 A;  1T19 A;  1VEU B;  3B42 A;  3CMZ A;  4IBX A;  4ZAM A;  5J3W A;  3L7H A;  2ZM0 A;  5FAQ A;  5GLC A;  4C3Q A;  2QJ5 A;  3S7O A;  5FAT A;  3A0R A;  1CK3 A;  2W1R A;  3SH9 A;  1K57 C;  3A3E A;  2B02 A;  1PNE A;  3IF5 A;  1BT5 A;  1Z09 A;  1DP9 A;  5CER A;  3CLO A;  2JKR M;  2Y4A A;  1GSV A;  3BFD A;  1PI4 A;  4K0W A;  1IYP A;  1SCW A;  3K2N A;  1OME A;  5A92 A;  4B93 A;  2B5R A;  4KQR A;  5HAR A;  3HLB A;  1DP8 A;  4OLG A;  3S4X A;  4UA6 A;  2EWW A;  5HWW A;  1YSP A;  2J3T C;  1HTZ A;  1S67 L;  3HBR A;  3WS0 A;  3RJU A;  3EEA A;  4UAA A;  2YKF A;  4QD4 A;  1AWI A;  3HLD A;  4GW9 A;  3LR4 A;  2Z2L B;  1S1Y A;  4EBP A;  5EUA A;  1W79 A;  1WYC A;  2NUT C;  4E3M A;  3LIE A;  4RQ9 A;  5FI2 A;  4HQA A;  3OCN A;  2GX5 A;  1SKO A;  3HLG A;  2IWB A;  3RXW A;  1XFQ A;  3PBT A;  3WRT A;  1H8M A;  3NOP C;  3OPH A;  4FOF A;  1FR6 A;  1KGE A;  2O9A A;  2J3T D;  3VE3 A;  4FSF A;  5F82 A;  3ZNY A;  1NRF A;  2ZQA A;  4JPM A;  1FIL A;  2H28 A;  3BLM A;  1TDL A;  3UDX A;  4LPZ A;  2E8I A;  3T4T A;  5EVE A;  3N6I A;  2H0Y A;  4PAU A;  1HVB A;  1LL5 A;  2HF6 A;  3IX8 A;  4DE2 A;  2E8J A;  3BFE A;  3DW0 A;  3H7W B;  3WS2 A;  2VK3 A;  3MZF A;  2K2N A;  4IED A;  4NXB A;  4MBF A;  3CHW P;  1OTI A;  5KSC A;  4OPY A;  4OQ0 A;  4Q0I A;  3TJZ C;  1ZG4 A;  3IBJ A;  4E3N A;  2B95 A;  3MXR A;  4ARZ A;  3ZHH A;  4ZTK A;  3FKW A;  1S4R A;  1W8Q A;  1BUE A;  4DXB A;  3NI9 A;  1BUL A;  4ME4 A;  3Q07 A;  1XPB A;  3D3O A;  3MFD A;  1OJ5 A;  3G6O A;  4II7 A;  2XK1 A;  2UWX A;  1YLY A;  2K7S A;  4KG5 A;  3QP2 A;  1K56 A;  3PYP A;  4PKY G;  4HH2 A;  3T50 A;  3MBZ A;  1G6O A;  1X0O A;  2X02 A;  3EGD C;  2Y59 A;  4KZ8 A;  4E3K A;  1ZC2 A;  3W8K A;  3V67 A;  4R23 A;  2V1B A;  5M1A A;  1CF0 A;  2L4R A;  3BJN A;  2XFT A;  3IHA A;  4MN7 A;  4UQI M;  1F2K A;  2V8C A;  1YSQ A;  3PBO A;  1BZA A;  1OT9 A;  4DF6 A;  1BYW A;  2OWJ A;  1BLC A;  3LGO A;  3GR2 A;  4S2J A;  1ZTU A;  1NLZ A;  2CC1 A;  1IFQ A;  3JVV A;  3LY4 A;  3WS5 A;  4LCM A;  2C6W B;  2UV0 E;  1JTD A;  1XJ3 A;  5TBM B;  3ISG A;  3LI8 A;  5EOO A;  3E98 A;  1NYM A;  1FQG A;  4OPR A;  1L3L A;  2XA7 M;  1W63 Q;  3MFX A;  4N9L A;  1H8Y A;  3CUE C;  3HJK A;  3A0S A;  5G4Y A;  2V20 A;  1KOU A;  3PHY A;  5HWT A;  2ZMV A;  3ZNT A;  3QP1 A;  5FI7 A;  3HCY A;  4WLA A;  3TOI A;  3K3D A;  5IS1 A;  4BMW A;  4JBF A;  1RGZ A;  2BLS A;  5DJU A;  5EVI C;  3BFG A;  1MWS A;  1TVF A;  4S2N C;  4E3O A;  1N9N A;  5E2H A;  3BM6 A;  3LR0 A;  5F69 A;  3DWZ A;  1LSX A;  4QHC A;  1Y28 A;  3IXH A;  3HLF A;  3LR3 A;  3QP4 A;  1BTL A;  3DAV A;  5U47 A;  3F1O B;  5AQ7 A;  4JGR A;  3ITB A;  2ZQC A;  2HDR A;  4NXG A;  3IXG A;  1ACF A;  4JF4 A;  4KQO A;  4HY8 A;  1K55 A;  4EEP A;  4PKY A;  2WKE A;  2ZQD A;  4K0X A;  3NIA A;  4KQQ A;  2PR5 A;  4QPR A;  5E2G A;  3C4O A;  1K6S A;  2EWV A;  4KG6 A;  3BLS A;  5J4E A;  2OV5 A;  4D60 A;  2Z6C A;  4WMC D;  2Y2J A;  4HEF A;  3AGE A;  5EPH A;  3MF0 A;  2JKF A;  2JKT M;  2QMI A;  2G2W A;  2Y2Q A;  2IWD A;  4MDZ A;  4X69 A;  1MWT A;  1ZKJ A;  1G6A A;  4PM6 A;  2J9O A;  4GJ4 A;  1RP5 A;  2QWS A;  4GDB A;  1G5U A;  1TF1 A;  1PRQ A;  4BL3 A;  5AJG A;  4NET A;  2VV6 A;  4R4R A;  4F3L A;  1KE4 A;  2J9P A;  3ZG9 B;  1CQA A;  5HL1 A;  1AXB A;  3H9W A;  4JGO A;  1XP4 A;  2ZD8 A;  4HJ3 A;  3L9K A;  3E0Y A;  4UA9 A;  3VP4 A;  3AGD A;  4EV4 A;  3VP2 A;  2HP5 A;  2WUQ A;  2KOI A;  1WE4 A;  4D2O A;  3PTE A;  2GDN A;  4MN6 A;  5E2E A;  1JWV A;  3UB6 A;  5HDD A;  5FL3 A;  5FQI A;  4OKP A;  1K56 D;  3GSG A;  3UNW A;  1A0K A;  1VET A;  2HV1 A;  2ZJ9 A;  3IXD A;  4KG2 A;  4WUJ A;  1K57 A;  2EA9 A;  4DJ2 A;  1ESI A;  4LV0 A;  4DN0 A;  4X55 A;  3UMD A;  2HP9 A;  1MWU A;  4WZ5 C;  3UY6 A;  4AFI A;  2WAF A;  4JXS A;  1GA0 A;  2HZ5 A;  4ZDX A;  1DJA A;  1MBL A;  3UB8 A;  4I3I A;  3E2L A;  1MZU A;  1H3Q A;  2EX8 A;  2W27 A;  5AQ9 A;  4WF0 A;  3BWL A;  3M6H A;  2ZL1 B;  2R9W A;  3DWK A;  3KYE A;  5FQJ A;  3G30 A;  5HAP A;  4WEJ A;  4PMA A;  3ZG8 B;  4DJ3 A;  2GJ3 A;  2VEA A;  5CGX A;  5FDS A;  3Q1F A;  4OH0 A;  3W4Q A;  1TS7 A;  1GCE A;  2Q0O A;  4HBU A;  1ALQ A;  1JVJ A;  4X53 A;  4GB7 A;  3RTY A;  4M3K A;  4DDS A;  4I3A A;  1LI9 A;  1H8Z A;  3E2K A;  1PWD A;  1XJ6 A;  5EM0 A;  3T1R A;  3HLC A;  3HUN A;  3ZG7 B;  3QP8 A;  5AVF A;  5EFW A;  2PAV P;  4RVA A;  5DF9 A;  2WAD A;  1H0M A;  5CHU A;  5HAQ A;  1DY6 A;  4K91 A;  2XRO A;  4EET B;  4IUK A;  4JXV A;  3OPP A;  3Q7V B;  4PM9 A;  1ERQ A;  3R7W A;  1T18 A;  3IT9 A;  1JTG A;  5GL9 A;  4E6W A;  2ZQ7 A;  2ZBB A;  1ESU A;  3EQU A;  3UE3 A;  3OPR A;  2EFU A;  3NOU C;  1IOU A;  2PDR A;  4I5S A;  1I5Q A;  5HD3 A;  3G2Y A;  4KUK A;  2OLV A;  4R4S A;  5FEF A;  4LGW A;  4BQM A;  2WGI A;  1YM1 A;  3NDE A;  4UEY A;  4QWO A;  4YNR A;  5IT5 A;  4CLC C;  3HLE A;  2XRN A;  1NJ4 A;  1H5X A;  1FCO A;  4R1G A;  4UQI S;  3EOI A;  3BQA A;  4BBT A;  3KYQ A;  4RA7 A;  4ARZ B;  4OOM A;  4GS9 A;  4EEU A;  4GNU A;  2DMW A;  2XD5 A;  4H6J A;  3V50 A;  1M40 A;  3HJI A;  4F94 A;  2A2L A;  2INW A;  1K38 A;  3NC8 A;  4S2M A;  3T1S A;  2JBF A;  2PBY A;  3NCK A;  4EXO A;  2PU2 A;  5IHV A;  4CLC D;  3CJM A;  1OTD A;  1XX2 A;  1KGG A;  5DTT A;  4RYE A;  2QYB A;  3E4O A;  2OOL A;  4EBL A;  4P6Z M;  3VP3 A;  4N1H A;  4BBV A;  4BD0 A;  4WYY A;  3VFF A;  3O88 A;  4X56 A;  5F1G A;  3S22 A;  4IVI A;  1GA9 A;  2LB9 A;  3IX4 A;  3AGF A;  1PIO A;  2PD8 A;  5IU1 A;  2B18 A;  3IF6 B;  1G28 A;  3ZDJ A;  2EXB A;  2A3U A;  2VZW A;  1J3W A;  4G3V A;  4MBK A;  2PU4 A;  1S0W A;  3CUE A;  4E6X A;  5DKK A;  3F1P A;  1SZV A;  4KEN B;  3H82 A;  4G3W A;  2W3E A;  1YKD A;  2ZMF A;  1XJ2 A;  3MXQ A;  4MBH A;  3FV7 A;  4I3J A;  4ID4 A;  1KDW A;  2Y2M A;  3ZVT A;  2VGL M;  3M2K A;  1V9Z A;  1YQS A;  3FPW A;  4FUW A;  1TS8 A;  3E4P A;  4WEK A;  2W3G A;  2PBD P;  2ZQ9 A;  2J80 A;  2VA0 A;  2C5W B;  2VV7 A;  1ONG A;  2Y8H A;  3PAE A;  3BEB A;  1S6R A;  2JCH A;  2XLN A;  1MC0 A;  3BEC A;  3GV9 A;  3T4L A;  3T4Q A;  4EQ1 A;  1N9O A;  3MQ0 A;  4WMC A;  5GHX A;  1UWP X;  5EV0 A;  2IWC A;  4UA7 A;  1CEF A;  3D4F A;  4MCW A;  3RFB A;  5EE8 A;  2W3H A;  5HL6 A;  1O7E A;  1NXY A;  1K54 C;  5AVE A;  1XA7 A;  4R3A A;  1S4S A;  1FR1 A;  4Y0T A;  2JE5 A;  4JF6 A;  2QKP A;  5FA7 A;  4L9F A;  3LIC A;  4LCL A;  2H5S A;  4OVD A;  5F68 A;  2V0U A;  4XUZ A;  1PWG A;  2HDU A;  5DFY A;  4LRZ E;  1F5M A;  1RCJ A;  2A24 A;  3HL9 A;  2M7U A;  2BTF P;  3BFF A;  1DJB A;  1W7F A;  2VX8 A;  4EW7 A;  4XT2 B;  3QNB A;  4OLD A;  3SOI A;  3DTI A;  3S7P A;  2QZ6 A;  2Y55 A;  4L9E A;  1M6K A;  1PW8 A;  1MPL A;  2M1C A;  3Q82 A;  4P0M A;  2LB5 A;  3S1Y A;  5CTN A;  3VP0 A;  1DP6 A;  2ZC4 B;  1OPX A;  3T4K A;  4LV3 A;  2XD1 A;  4CQH A;  4EUZ A;  4F3L B;  4BLM A;  4HJ4 A;  4Y17 A;  3LIB A;  2EFX A;  3CAX A;  2XSS A;  5DTK A;  3C38 A;  5CED A;  2Q9N A;  3OCL A;  1Q2P A;  4GD8 A;  4LRX C;  1NWZ A;  3MJQ A;  3D9Y A;  2DNS A;  4PM5 A;  5M18 A;  1K4F A;  5DF7 A;  3EEH A;  2JHE A;  3LEQ A;  3CZD A;  3OPL A;  4E04 A;  4NK3 A;  2HPB A;  4GZB A;  4Y5F A;  3KYZ A;  2ACG A;  1VET B;  1NZU A;  1OJG A;  4GDN A;  1S66 L;  3UME A;  4P6B A;  5KZH A;  5CHJ A;  2PRF A;  1SHV A;  1GHM A;  4OOY A;  2WKQ A; 
#chains in the Genus database with same CATH homology
 2PAV P;  3CPT B;  3MS6 A;  1PFL A;  1AWI A;  4X1M A;  2BTF P;  3DAV A;  3U4L P;  4X25 A;  1SKO B;  2V8F A;  4ESP A;  1A0K A;  1VET A;  3NEC A;  1J3W A;  1SKO A;  1CJF A;  1CF0 A;  1ACF A;  1F2K A;  1SZV A;  2V8C A;  3MSH A;  5FEF A;  4FTX A;  3CPT A;  5EM1 A;  1FIL A;  2JKG A;  2HZ5 A;  3NUL A;  3LGO A;  4QWO A;  4X1L A;  4D60 A;  1D1J A;  4FUW A;  1Y4O A;  5EVE A;  5FEG A;  1VEU B;  2PBD P;  2JKF A;  3L7H A;  3T1Q B;  2ZL1 B;  3KYE A;  2E8J A;  1FIK A;  2VK3 A;  3D9Y A;  2ZL1 A;  3LEQ A;  1PNE A;  3CHW P;  3T12 B;  3UB5 P;  5FDS A;  3T1S A;  5EV0 A;  1G5U A;  1PRQ A;  1K0K A;  1Z09 A;  1YPR A;  2ACG A;  1VET B;  3T1X A;  2B95 A;  1CQA A;  1VEU A;  2PRF A;  5EM0 A;  1HLU P;  3T1R A;  3L9K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...