1G5UA

Latex profilin hevb8
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
130
structure length
130
Chain Sequence
SWQTYVDDHLMCDIDGHRLTAAAIIGHDGSVWAQSSSFPQFKSDEVAAVMKDFDEPGSLAPTGLHLGGTKYMVIQGEPGAVIRGKKGSGGITVKRTGQALIIGIYDEPLTPGQCNMIVERLGDYLLDQGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Allergen
molecule keywords PROFILIN
publication title A Comparative Structural Analysis of Allergen Profilins HEVB8 and BETV2
rcsb
source organism Hevea brasiliensis
total genus 28
structure length 130
sequence length 130
chains with identical sequence B
ec nomenclature
pdb deposition date 2000-11-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00235 Profilin Profilin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.30 Alpha Beta 2-Layer Sandwich Beta-Lactamase Dynein light chain 2a, cytoplasmic 1g5uA00
1F2KA 2V8FA 2V8CA 4X1MA 3MS6A 1VEUA 1HLUP 1AWIA 1SKOB 3L9KA 4ESPA 3CPTB 3DAVA 1Z09A 3KYEA 3MSHA 4D60A 2JKFA 5FEFA 3T1XA 2ZL1A 5FDSA 2HZ5A 3T1RA 3T12B 3UB5P 4QWOA 1ACFA 1SKOA 3CHWP 1PRQA 2ACGA 3CPTA 2PRFA 4X1LA 1VETB 2BTFP 1PFLA 3LEQA 5EM1A 5EM0A 3U4LP 3LGOA 2JKGA 5EVEA 4FTXA 2PBDP 3D9YA 3T1QB 1CF0A 1J3WA 1SZVA 1K0KA 3NECA 1VEUB 1Y4OA 3NULA 1CQAA 3L7HA 2PAVP 5EV0A 3T1SA 4FUWA 1VETA 1D1JA 1PNEA 1FIKA 1G5UA 2ZL1B 1CJFA 1A0KA 4X25A 2B95A 2E8JA 2VK3A 1FILA 1YPRA 5FEGA
chains in the Genus database with same CATH superfamily
1QMFA 4WEJA 4O01A 4WBGA 4DE2A 3PBTA 2AVXA 2WADA 2VV6A 4EBLA 2HJ9C 2NUPC 5DKKA 1IYOA 3A0VA 1S66L 4KZBA 3UPPA 4A5RA 3RJUA 4P6ZM 4I39A 3F1PB 3MBZA 3IX4A 1UWNX 3Q81A 5TBMA 3RFBA 3DTMA 1YLWA 4B9OA 1Y54A 3WS1A 1H5XA 3IX3A 3S22A 3LO7A 4EBNA 2WK0A 4S2PA 3R4KA 5HL1A 3DWKA 4CLCB 4IUKA 1UWPX 2PBYA 3HUMA 1K55C 3HVFA 4G3WA 4IBRA 5J4EA 3SH7A 3O5YA 2Y2IA 2WAEA 3ZDJA 4MN6A 4DJ3A 1YLTA 2XLNA 2HPBA 1XPBA 2Y4AA 4BWIA 1CF0A 3T4QA 3IWIA 1D7EA 4EEUA 4E3IA 1S67L 1MWRA 1VM1A 4GW9A 3AGEA 4M3KA 1Q2QA 1OTEA 3IX8A 2HDQA 3FZCA 1S0WA 2EWWA 1XJ3A 2W1RA 3LIBA 2LB9A 1NYYA 1PIOA 5HWWA 1L2SA 2WUQA 2V1ZA 4Y13A 3QP4A 2J7VA 4E3LA 3H7WA 4HESA 3W2ZA 2Y2NA 2ZMFA 4JGPA 5A8BA 1OT9A 5CECA 4GB7A 1SKFA 1Z09A 4IBXA 2VLGA 3Q07A 1UGUA 1YLPA 5FAOA 1KGFA 4EWFA 4NETA 2K31A 3WRZA 1KDSA 3SS5A 4K91A 3TW8A 2KLIA 1ACFA 1NRJA 4XT2A 4OQ0A 3MF0A 4ZTKA 3I7JA 1DJBA 4DN0A 1K4EA 2PRFA 2ZM2A 4BD0A 3CJMA 3LYXA 3JVUA 2YKFA 3VOZA 2G7UA 3ICYA 2PT7A 2XROA 2UV0E 5E2FA 3G32A 1KE4A 2JHEA 4PM7A 1MBLA 4HJ4A 2FH5A 4YNRA 4U3TA 2VGLM 1MPLA 2E8IA 3SOIA 1YLJA 1BLCA 5G4ZA 3RTYA 5JYPA 2J3TC 2KX6A 3T1SA 1VETA 4L9FA 2Y2PA 1DP8A 1F98A 4MN7A 3GMWA 2OLVA 4UA7A 5E2EA 5GL9A 3SH8A 1TVFA 3S7QA 2DCFA 2Q0OA 3GRJA 2HJEA 1ES2A 3RH8B 2FFFB 3IBJA 1G6AA 3KO6A 2WKHA 1W7FA 4CLCC 4JPMA 5AJGA 2W0NA 2C5WB 1BLPA 1AWIA 2GX5A 3CI6A 1BZAA 4DMZA 2H10A 3ZG5A 4ZDXA 3DAVA 1K38A 2M1CA 4UQIS 2ZMAA 2HGVA 4O0PA 2JBFA 3NJAA 3NOUC 2XA7S 3VV4A 1YKDA 4OVDA 2K7SA 5HDDA 1WE4A 4DDSA 3GV9A 1XJ4A 4DXBA 3C8CA 2DNSA 3PBOA 4HNBA 1X0OA 1L0GA 2EX8A 1L3LA 4JXWA 2ACGA 2D01A 3CPTA 4XUZA 5FATA 1DRMA 2ZQAA 3HREA 1TF1A 2NUTC 2PYRA 4WN5A 4JGOA 5GHYA 2ZJ9A 1IKIA 2OAQ1 3VP1A 5DF9A 1LSWA 4LENA 4ZJ3A 5L8MA 1VEUB 4ARZA 2XEPA 1BUEA 3ZG9B 3FV7A 3C4PA 1P9WA 2WKQA 1K4FA 2BG1A 4BBUA 1SDNA 1JWVA 4R38A 5HW3A 4HEFA 2ZL1B 1WA9A 1EWZA 2D02A 3P7NA 1KE0A 2WKRA 2Y2HA 3CUEC 3ZCZA 3IS2A 4KQRA 1MC0A 1F2KA 1TEMA 3LIFA 3IF6A 3OPLA 3UB7A 1OTIA 4FH4A 3A3IA 4N1XA 4M4XA 3ISGA 3OCNA 2Y2MA 5DFXA 2VGJA 2JKFA 2P9VB 5FDSA 4Y7PA 3LICA 3G35A 1ERMA 3BQ8A 2PD8A 3ZNYA 1RCJA 4LV0A 4Z9QA 5FAPA 4I38A 3A0RA 1CEGA 1ZTUA 1SKOA 1JWPA 1HTZA 3O88A 4S2IA 3W4OA 2EX9A 5F1GA 2PU2A 4GJ4A 4OLDA 3M2JA 3VOLA 2JKGA 5G18A 3UO9A 1DY6A 4OQIA 2L1MA 2W27A 4OQGA 4E3MA 3QP2A 4LLOB 3O87A 4DE3A 5HSQA 5HWVA 5FSRA 4IEDA 4UEYA 4FH2A 3E2LA 1H8ZA 3MZEA 3V5MA 2B02A 2H28A 3V67A 1KVLA 4C75A 5KIZA 2QMIA 3MFDA 5CRFA 1ALQA 3ITBA 3UDIA 1NRFA 1G28A 1GSWA 2XR0A 4RX2A 3IF6C 3C2WA 4P85A 5F1FA 4E3NA 2V8CA 3G2YA 3LY4A 1NJ4A 2GDNA 5E2GA 3UNWA 5J7EA 5HAQA 3HLDA 3NOTC 1NYMA 5DTTA 2OV5A 2GJ3A 4X56A 3NI9A 5CEDA 3R7WB 1PZOA 2FFYA 2ZLYA 1SDEA 4JF4A 4H6JB 4JGRA 3HLFA 2OWHA 2RCXA 4G3KA 4F94A 5FQIA 2KDKA 3BW6A 3UE6A 3TSGA 3UE1A 1G68A 2ZBBA 4R0QA 4N9LA 1YLYA 5EVIA 5HPFA 3BFDA 2W3GA 5IT5A 4PM8A 3UE0A 2QZ6A 1Z6FA 5EM0A 3OCLA 3N4IA 4LCLA 5GLAA 1E3UD 5EVID 1BLHA 5DJUA 3UY6A 5FQKA 4QPRA 3KX0X 4X6TA 1P0ZA 4JKTA 3NULA 3LR5A 2VEAA 1L0DA 4RYEA 1GSVA 3GVBA 1GCEA 2V9AA 4WL9A 2HP9A 5J8XA 3VOYA 4EEPA 3BECA 3TE8A 1JNUA 2B95A 5TBMB 4O8GA 3ZNTA 4KZ4A 2Z2MB 3HLGA 2KOIA 1K56A 3QNCA 4L0LA 4GNUA 4PPRA 3MQQA 4B88A 3OPPA 4ID4A 3WRTA 3QP5A 2IA2A 4UA9A 4D60A 1GA0A 3IHBA 4II7A 4YWZA 4EERA 3AGFA 4HH2A 1T1CA 5FI2A 2ZC3B 3H82B 2XD5A 3UB5P 3V3RA 3DWZA 1NY0A 2K2NA 2J9PA 1K54A 1MKIA 1T19A 5GHXA 1ERQA 1ES5A 4RX3A 5EVIC 2JN7A 5TFQA 3GECA 1FR1A 1W5DA 2VJWA 3MXQA 5C5KA 2XK1A 2ZQDA 3RXXA 3A3DA 3N8RA 1XA7A 1L0FA 2XA7M 1H8MA 4MN5A 3BRMA 4R4RA 5JYOA 5HX9A 1VHMA 3UMDA 3CWFA 3H7WB 5AQAA 3EOIA 4GHIA 1S4RA 4CLCE 4Q0HA 5CHJA 2VGKA 4N9KA 1XFNA 3IHAA 3WS0A 4OP8A 1DP9A 4BLMA 3GSGA 3M6HA 3MJQA 4BMWA 3H82A 4E3KA 2A2LA 1IYPA 2Y8HA 3FYZA 2E8JA 4B4XA 2VZWA 2V1AA 1I5QA 3K2NA 2O0YA 4EV4A 3QHYA 3NBLA 4XT2B 4WEKA 3UB9A 4HY8A 1C3BA 3JYIA 3QP6A 4H8RA 2J8YA 1W79A 4ZRRA 5CX7A 3T1XA 3LI8A 4GZBA 4OOMA 5HDCA 5F83A 3T1RA 4OOLA 5F6AA 1K54C 1XGJA 3NDGA 2ZQCA 3IH9A 5F69A 3T4LA 5EFWA 2CC1A 3T4OA 3MFXA 2XQZA 1KVMA 1OTBA 3TOIA 3LIEA 4KZAA 1XA1A 4PM9A 1VETB 4S2OA 4YOFA 4PAUA 1ONGA 3S7PA 1MWUA 3LGOA 1EW0A 4GN2A 1NLYA 3WS2A 1I2SA 3BLMA 4KUOA 3A3JA 3FC7A 5F5YA 3T1QB 2O9CA 4WM9A 4NXBA 2WZZA 3BYDA 2XH9A 5HD5A 1K0KA 3NY4A 3UDXA 3PAGA 4FD8A 4BD1A 3HLBA 4KZ8A 3Q7ZA 1PZPA 5HFOA 1OMEA 4GD8A 1ONHA 3JPUA 2EXAA 4N1HA 5FI6A 5EECA 3LY3A 4HH3A 4B4ZA 3BY9A 3ITAA 3VFHA 4S2NA 5GLBA 3VSLA 4X25A 4EUVA 2VK3A 2QYBA 1K6RA 3KSIA 1LI9A 2Y79A 1TS8A 4JGQA 2WGWA 4GD6A 4L9EA 2WKIA 3L9KA 3F1OA 2WKEA 3CITA 3CPTB 5E43A 4ZBEA 1QMEA 2W3HA 5LBRA 2OAP1 2R78A 5IS1A 2HZ5A 3C5AA 3EQVA 4K0WA 5A90A 4XXRA 1V9ZA 3BWLA 3BEBA 3KSFA 3NCKA 4IVIA 5IHVA 2Y2OA 2JE5A 4ZAMA 1AXBA 1XJ2A 3FPVA 4ARZB 4DDYA 2PD7A 4HOIA 5HAPA 3A3EA 3EGXC 3HCYA 1W8YA 5AQBA 4X1LA 4ZJ1A 3Q82A 4I3JA 4HBTA 3HUOA 4E3JA 2BTFP 1PFLA 3N6IA 1O7EA 3LR0A 2ZOIA 3IQAA 5IU1A 3T4SA 3C38A 4FTXA 2I9VA 3C7VA 3EQUA 3IS2B 1KGEA 5CHMA 4P6ZS 1Q2PA 3IF6B 4QY6A 5CTNA 5EOOA 3N7WA 3NHQA 5AQ9A 1F5MA 4NG2A 2EXBA 4R4SA 4JBFA 4WZ5A 5F82A 1K57A 4S2NC 3IXGA 3KYZA 4Q0IA 4I3AA 3PXPA 3C7UA 2EFUA 2A49A 3N8SA 5FI7A 1XX2A 4UA6A 1T1BA 1SKOB 1STZA 1VB6A 3PBQA 3SS4A 1N9LA 2JKTI 2HDUA 2PHYA 4LRYC 4NXGA 1N4OA 2JCHA 4Y2FA 1BSGA 4E6WA 4QB8A 1HD8A 5MC7A 3E4OA 1LL8A 5FAQA 5BOHA 2ZQ7A 3ZQ5A 2WGIA 4F3LA 2M7VA 4DXCA 5GHZA 2QKPA 3VE3A 3ZVWA 3S4XA 2Q9NA 1PRQA 1WYCA 5DTSA 4S2LA 4R3JA 3TJZC 2PU4A 5G4YA 2VX8A 4BBVA 1JTGA 2I72A 4DKIA 4KG6A 3FPWA 1ODVA 2ZC6B 4LGWA 3TG9A 2V0WA 3UE3A 2Y59A 1PW8A 1N9NA 3D9YA 2HDRA 1PI5A 2H0TA 1KOUA 1O07A 4R6LA 5KSCA 1J3WA 1H0MA 3CLOA 3NECA 1RGZA 2R9XA 3UMEA 1CK3A 4MCWA 3PTEA 2B18A 1TS6A 4Q0JA 3QP8A 1K57C 2W1TA 3D3OA 1FIKA 3C30A 5EPHA 1P9RA 3LR3A 3PR6A 3W4QA 3LR4A 2HV1A 3KSHA 2WZXA 1P97A 4PM6A 2EWVA 4GCZA 1M40A 4ESPA 1ZG6A 5EVIB 2G2WA 4P0MA 1PWDA 2VGLS 3O86A 4KZ5A 4GS9A 5HDSA 4ME4A 2XD1A 4Y17A 3FWLA 5DTKA 2O9AA 3ZFZA 2PR6A 2ZOHA 4QHCA 1YM1A 2M7UA 2ZQ8A 1PWCA 3VMAA 4U0TA 3DBAA 2Y91A 2P7JA 5CEBA 3LFVA 1ZHHB 2HF6A 3E4PA 3QP1A 4Y5FA 1HZOA 3E0YA 4BENA 2J80A 3ZVTA 3GR2A 3G4PA 4C6YA 4IJGA 2Y2LA 3PBNA 4X69A 1XP4A 2INWA 4EW7A 3LIDA 5EUAA 1W63M 2WAFA 4HHDA 4OONA 3GQZA 5I94A 1E3UA 5DF8A 5AQ7A 5CXWA 1WYBA 3DTEA 4QD4A 4OOYA 4HI4A 2Y55A 1MKMA 1H8YA 2ZM0A 4GOGA 1D1JA 4LRZE 2O99A 3BLSA 1CJFA 3S7OA 3BFEA 4U0XA 3WWXA 1LL5A 3Q7VA 4IUHA 3P09A 2P04A 4EQIA 1YPRA 3VP0A 1JTDA 3B3XA 5FQMA 3N8LA 1ZG4A 4MMNA 4OQHA 4OPZA 3VP2A 4EU0A 2XDMA 2VV7A 3DTKA 3V39A 3HL9A 4S2JA 1JWZA 1E25A 3PAEA 2B5RA 3WS5A 5M18A 5EVLA 1LT0A 2QPNA 2A24A 4Y0TA 1MWTA 2ZC4B 4PKYG 4OP5A 3W4PA 4FOFA 4HP9A 4EESA 1OTAA 3G34A 2R9WA 3HJKA 4EBPA 2EX6A 3MQOA 1N9BA 3QNBA 4QU3A 2Y2JA 3E98A 5L10A 2OWJA 3OZHA 4KQQA 4GHIB 4FSFA 3WS4A 5EOEA 3T4KA 2Y2KA 1XXMA 1ZKJA 4CPKA 3KSGA 3B47A 4ZJ2A 1NXYA 4EUZA 1IOUA 4HIAA 2BLSA 4C3QA 1YSPA 1T1AA 3T4JA 4HBUA 3W8KA 4B93A 1S6RA 4MEZA 4HJ3A 4GLQA 5I5LA 4JXGA 3EEHA 4UQIM 4BQMA 4NXFA 1LL9A 5E2HA 5U47A 1ESUA 3B42A 1W8QA 1CI9A 1YT4A 3M2KA 2V0UA 4R3BA 3G6OA 4KZ6A 3FKWA 4Y0UA 4S2MA 1W63Q 1FCMA 1XKZA 1TS0A 1CI8A 2W3EA 1M6KA 3EEAA 2X01A 3M6BA 4WUJA 3UB8A 1V9YA 2V8FA 4S2KA 1MXOA 3F1NA 4N92A 4P87A 1PWGA 4R3AA 5K5BA 5L09A 1FCNA 3G31A 1GHMA 1HLUP 4KG5A 3IXBA 2CMNA 2W3DA 1H3QA 1YAXA 5FDHA 3IH8A 1SHVA 2OSUA 4OH0A 4Q8IA 1ES4A 1IYQA 2WYXA 4OPYA 5A91A 3IT9A 4LFUA 4JF6A 2VKSA 2WKPA 4KZ3A 3A3FA 4D2OA 3FG8A 1K6SA 4QJGA 4LV3A 3OLOA 2VA0A 3TRCA 4RVAA 1OPXA 2QWSA 2WGVA 4NK3A 3V3SA 1BYWA 3ZG8B 4Y15A 3IF5A 4WF0A 3B33A 4WYYA 3UB6A 3F1PA 3NOPC 4K08A 1MY8A 5CGWA 4PKYA 5HD3A 5TGFA 4I3IA 4E3OA 4HQAA 2WGWB 5DKLA 3UPOA 1XJ6A 1OJGA 2J3TD 3F1OB 4LV2A 2PAVP 4OPRA 5HZHA 5J3WA 5TR7A 4CLCA 1EROA 3SW1A 4HP4A 1ES3A 4L9GA 3IWOA 1PNEA 5KZHA 1G5UA 4LRXC 4PMAA 1K25A 5DVAA 1A0KA 3ULFA 4CLCD 4DE1A 2ZM8A 3BFCA 4WELA 4O7DA 1RP5A 2ZD8A 4NKPA 4KQDA 2Z6CA 3IXDA 3T50A 2H5SA 3HLEA 2EA9A 5HPIA 2Y2QA 5HARA 3OC2A 4ETZA 5GLDA 3G30A 4X68A 4GDNA 3VFFA 3UN7A 5A93A 4MDZA 2V1BA 1FSYA 1S4SA 2ZC7A 5EE8A 5CHUA 2IWDA 3CG5A 2IWBA 3NDEA 1FOFA 1GHIA 4Y0OA 3PHYA 2W3FA 3BFGA 2JKRI 1IYSA 2PDRA 3CHWP 2X02A 1OT6A 3IXHA 3LI9A 5DFYA 1YMSA 2PYPA 3D72A 1ESIA 5CGSA 1GA9A 1VQQA 5EM1A 3EWKA 5FQ9A 3ZYTA 2PR5A 5KSHA 3LEZA 3IBRA 3HBRA 4JXSA 1S1ZA 3PBRA 4KG2A 5F68A 3CUEA 4MNRA 3SH9A 3S7NA 3DW0A 4AFIA 4G3VA 2IWCA 1DP6A 2QJ7A 4BL3A 2OOLA 3BJNA 1N9OA 1LI0A 4BJPA 2ZQ9A 4F3LB 3BM6A 2Z2LB 1LSXA 1NLZA 3SS3A 3DTIA 1IEMA 2XFSA 4RQ9A 3IWQA 3ZHHA 2P08A 3O3VA 2OLUA 1BLSA 1KE3A 1YSQA 5CGXA 3P01A 2O9BA 5DF7A 4CQHA 4DRTA 2G2UA 4MBHA 4RA7A 2BASA 4LPZA 2MJ6A 2GZAA 3T12B 3JVVA 3GDIA 4WZ4A 5FL3A 4R1GA 4QWOA 4GKUA 3ZG0A 1TDGA 1JVJA 1XFQA 2ZMVA 3OPHA 2C6WB 1TS7A 4EQ1A 3MXSA 1KDWA 3S1YA 2FZ0A 3MZFA 3LIAA 2W1TB 2V2FF 3BFFA 3HUNA 4YINA 2JC7A 4PHTA 1PYYA 5HWTA 2EX2A 4KZ9A 2DMWA 3A0SA 2V20A 3LUQA 3MXRA 4Y3IA 5AVFA 4NEED 3U2AA 4YFMA 1CQAA 5M1AA 1FCOA 5AVEA 5A92A 1PI4A 5EV0A 3K3CA 3LCEA 4GS9B 4FUWA 3C4OA 3PYPA 1IKGA 1IFQA 4NXEA 4X55A 3OBFA 5DJTA 1F9IA 2QJ5A 2GNXA 1EI5A 3OOVA 3SZTA 5FEGA 1E4DA 4JLFA 4MBKA 4KZ7A 5HAIA 3ZG7B 5TJJA 4X1MA 3PBSA 1VEUA 4WZ5C 1HVBA 1LSVA 4R70A 3E2KA 2XF3A 1YMXA 2HP6A 2J3WA 4EETB 1TDLA 5FEFA 5FQJA 1PW1A 2ZL1A 3MKFA 3VP4A 4HJ6A 4UHUA 3MZDA 4ETXA 4E04A 1G6OA 1XGIA 3BQAA 4MLLA 2XGNA 1GHPA 3K3DA 2XSSA 1FSWA 5M19A 1I2WA 3H9WA 3CMZA 2ZC5B 4DE0A 1ZC2A 4EXOA 2P9VA 3LEQA 3T4TA 2XRNA 4GDBA 4MBFA 5EVEA 1MWSA 1BTLA 3Q7VB 3E4QA 2P74A 2PBDP 3Q1FA 4OLGA 5FASA 4Z1WA 3VSKA 4JXVA 1BULA 1YQSA 4JF5A 4WMCA 4WLAA 1SZVA 3NIAA 1MZUA 4X53A 1OTDA 3KYQA 1OJ5A 3CAXA 1IELA 3UDFA 4P6BA 2DRWA 3V50A 1Y28A 3AGDA 4CJNA 4QY5A 1T18A 1GSXA 1RGYA 1SCWA 2JKRM 2Y2GA 2A24B 4WMCD 3HJIA 4LV1A 5FQQA 1S1YA 4DJ2A 1FILA 4KENB 3MMHA 3UPNA 5CTMA 5L07A 3MS6A 2X71A 4K0XA 1U60A 5CERA 5KMWA 1TD5A 1LLBA 4IHQA 2Q9MA 3KYEA 3MSHA 3VP3A 2J9OA 2XFTA 4UAAA 1NZOA 3MR0A 2Z6DA 1DJAA 4BBTA 3ZGAB 1L0EA 2H0YA 5HL6A 3FKVA 4DF6A 3D4FA 4I5SA 2YKHA 1LHYA 5GLCA 3VE4A 2RL3A 5FA7A 5L2FA 3GTCA 4XUXA 1CEFA 2LB5A 2VV8A 4LCMA 3R7WA 4E6XA 3MKEA 1FQGA 1KGGA 1DJCA 2HDSA 1K55A 1J9MA 3U4LP 4BL2A 1BT5A 4KUKA 2UWXA 4H6JA 2QHKA 5D3OA 3G2ZA 1FR6A 3CZDA 2L0WA 2HP5A 2A3UA 1D06A 3BY8A 3RXWA 1NWZA 2EFXA 1YLZA 3F1NB 3EGDC 3OPRA 1Y4OA 3HLCA 3L7HA 3P98A 1NZUA 4IVKA 3NC8A 4OKPA 4FCFA 3MQ0A 4R23A 4KQOA 2L4RA 2JKTM 4PM5A 1K56D 4OPQA 3HLWA
chains in the Genus database with same CATH topology
1F2KA 2V8FA 2V8CA 4X1MA 3MS6A 1VEUA 1HLUP 1AWIA 1SKOB 3L9KA 4ESPA 3CPTB 3DAVA 1Z09A 3KYEA 3MSHA 4D60A 2JKFA 5FEFA 3T1XA 2ZL1A 5FDSA 2HZ5A 3T1RA 3T12B 3UB5P 4QWOA 1ACFA 1SKOA 3CHWP 1PRQA 2ACGA 3CPTA 2PRFA 4X1LA 1VETB 2BTFP 1PFLA 3LEQA 5EM1A 5EM0A 3U4LP 3LGOA 2JKGA 5EVEA 4FTXA 2PBDP 3D9YA 3T1QB 1CF0A 1J3WA 1SZVA 1K0KA 3NECA 1VEUB 1Y4OA 3NULA 1CQAA 3L7HA 2PAVP 5EV0A 3T1SA 4FUWA 1VETA 1D1JA 1PNEA 1FIKA 1G5UA 2ZL1B 1CJFA 1A0KA 4X25A 2B95A 2E8JA 2VK3A 1FILA 1YPRA 5FEGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1F2K A;  2V8F A;  2V8C A;  4X1M A;  3MS6 A;  1VEU A;  1HLU P;  1AWI A;  1SKO B;  3L9K A;  4ESP A;  3CPT B;  3DAV A;  1Z09 A;  3KYE A;  3MSH A;  4D60 A;  2JKF A;  5FEF A;  3T1X A;  2ZL1 A;  5FDS A;  2HZ5 A;  3T1R A;  3T12 B;  3UB5 P;  4QWO A;  1ACF A;  1SKO A;  3CHW P;  1PRQ A;  2ACG A;  3CPT A;  2PRF A;  4X1L A;  1VET B;  2BTF P;  1PFL A;  3LEQ A;  5EM1 A;  5EM0 A;  3U4L P;  3LGO A;  2JKG A;  5EVE A;  4FTX A;  2PBD P;  3D9Y A;  3T1Q B;  1CF0 A;  1J3W A;  1SZV A;  1K0K A;  3NEC A;  1VEU B;  1Y4O A;  3NUL A;  1CQA A;  3L7H A;  2PAV P;  5EV0 A;  3T1S A;  4FUW A;  1VET A;  1D1J A;  1PNE A;  1FIK A;  1G5U A;  2ZL1 B;  1CJF A;  1A0K A;  4X25 A;  2B95 A;  2E8J A;  2VK3 A;  1FIL A;  1YPR A;  5FEG A; 
#chains in the Genus database with same CATH topology
 1QMF A;  4WEJ A;  4O01 A;  4WBG A;  4DE2 A;  3PBT A;  2AVX A;  2WAD A;  2VV6 A;  4EBL A;  2HJ9 C;  2NUP C;  5DKK A;  1IYO A;  3A0V A;  1S66 L;  4KZB A;  3UPP A;  4A5R A;  3RJU A;  4P6Z M;  4I39 A;  3F1P B;  3MBZ A;  3IX4 A;  1UWN X;  3Q81 A;  5TBM A;  3RFB A;  3DTM A;  1YLW A;  4B9O A;  1Y54 A;  3WS1 A;  1H5X A;  3IX3 A;  3S22 A;  3LO7 A;  4EBN A;  2WK0 A;  4S2P A;  3R4K A;  5HL1 A;  3DWK A;  4CLC B;  4IUK A;  1UWP X;  2PBY A;  3HUM A;  1K55 C;  3HVF A;  4G3W A;  4IBR A;  5J4E A;  3SH7 A;  3O5Y A;  2Y2I A;  2WAE A;  3ZDJ A;  4MN6 A;  4DJ3 A;  1YLT A;  2XLN A;  2HPB A;  1XPB A;  2Y4A A;  4BWI A;  1CF0 A;  3T4Q A;  3IWI A;  1D7E A;  4EEU A;  4E3I A;  1S67 L;  1MWR A;  1VM1 A;  4GW9 A;  3AGE A;  4M3K A;  1Q2Q A;  1OTE A;  3IX8 A;  2HDQ A;  3FZC A;  1S0W A;  2EWW A;  1XJ3 A;  2W1R A;  3LIB A;  2LB9 A;  1NYY A;  1PIO A;  5HWW A;  1L2S A;  2WUQ A;  2V1Z A;  4Y13 A;  3QP4 A;  2J7V A;  4E3L A;  3H7W A;  4HES A;  3W2Z A;  2Y2N A;  2ZMF A;  4JGP A;  5A8B A;  1OT9 A;  5CEC A;  4GB7 A;  1SKF A;  1Z09 A;  4IBX A;  2VLG A;  3Q07 A;  1UGU A;  1YLP A;  5FAO A;  1KGF A;  4EWF A;  4NET A;  2K31 A;  3WRZ A;  1KDS A;  3SS5 A;  4K91 A;  3TW8 A;  2KLI A;  1ACF A;  1NRJ A;  4XT2 A;  4OQ0 A;  3MF0 A;  4ZTK A;  3I7J A;  1DJB A;  4DN0 A;  1K4E A;  2PRF A;  2ZM2 A;  4BD0 A;  3CJM A;  3LYX A;  3JVU A;  2YKF A;  3VOZ A;  2G7U A;  3ICY A;  2PT7 A;  2XRO A;  2UV0 E;  5E2F A;  3G32 A;  1KE4 A;  2JHE A;  4PM7 A;  1MBL A;  4HJ4 A;  2FH5 A;  4YNR A;  4U3T A;  2VGL M;  1MPL A;  2E8I A;  3SOI A;  1YLJ A;  1BLC A;  5G4Z A;  3RTY A;  5JYP A;  2J3T C;  2KX6 A;  3T1S A;  1VET A;  4L9F A;  2Y2P A;  1DP8 A;  1F98 A;  4MN7 A;  3GMW A;  2OLV A;  4UA7 A;  5E2E A;  5GL9 A;  3SH8 A;  1TVF A;  3S7Q A;  2DCF A;  2Q0O A;  3GRJ A;  2HJE A;  1ES2 A;  3RH8 B;  2FFF B;  3IBJ A;  1G6A A;  3KO6 A;  2WKH A;  1W7F A;  4CLC C;  4JPM A;  5AJG A;  2W0N A;  2C5W B;  1BLP A;  1AWI A;  2GX5 A;  3CI6 A;  1BZA A;  4DMZ A;  2H10 A;  3ZG5 A;  4ZDX A;  3DAV A;  1K38 A;  2M1C A;  4UQI S;  2ZMA A;  2HGV A;  4O0P A;  2JBF A;  3NJA A;  3NOU C;  2XA7 S;  3VV4 A;  1YKD A;  4OVD A;  2K7S A;  5HDD A;  1WE4 A;  4DDS A;  3GV9 A;  1XJ4 A;  4DXB A;  3C8C A;  2DNS A;  3PBO A;  4HNB A;  1X0O A;  1L0G A;  2EX8 A;  1L3L A;  4JXW A;  2ACG A;  2D01 A;  3CPT A;  4XUZ A;  5FAT A;  1DRM A;  2ZQA A;  3HRE A;  1TF1 A;  2NUT C;  2PYR A;  4WN5 A;  4JGO A;  5GHY A;  2ZJ9 A;  1IKI A;  2OAQ 1;  3VP1 A;  5DF9 A;  1LSW A;  4LEN A;  4ZJ3 A;  5L8M A;  1VEU B;  4ARZ A;  2XEP A;  1BUE A;  3ZG9 B;  3FV7 A;  3C4P A;  1P9W A;  2WKQ A;  1K4F A;  2BG1 A;  4BBU A;  1SDN A;  1JWV A;  4R38 A;  5HW3 A;  4HEF A;  2ZL1 B;  1WA9 A;  1EWZ A;  2D02 A;  3P7N A;  1KE0 A;  2WKR A;  2Y2H A;  3CUE C;  3ZCZ A;  3IS2 A;  4KQR A;  1MC0 A;  1F2K A;  1TEM A;  3LIF A;  3IF6 A;  3OPL A;  3UB7 A;  1OTI A;  4FH4 A;  3A3I A;  4N1X A;  4M4X A;  3ISG A;  3OCN A;  2Y2M A;  5DFX A;  2VGJ A;  2JKF A;  2P9V B;  5FDS A;  4Y7P A;  3LIC A;  3G35 A;  1ERM A;  3BQ8 A;  2PD8 A;  3ZNY A;  1RCJ A;  4LV0 A;  4Z9Q A;  5FAP A;  4I38 A;  3A0R A;  1CEG A;  1ZTU A;  1SKO A;  1JWP A;  1HTZ A;  3O88 A;  4S2I A;  3W4O A;  2EX9 A;  5F1G A;  2PU2 A;  4GJ4 A;  4OLD A;  3M2J A;  3VOL A;  2JKG A;  5G18 A;  3UO9 A;  1DY6 A;  4OQI A;  2L1M A;  2W27 A;  4OQG A;  4E3M A;  3QP2 A;  4LLO B;  3O87 A;  4DE3 A;  5HSQ A;  5HWV A;  5FSR A;  4IED A;  4UEY A;  4FH2 A;  3E2L A;  1H8Z A;  3MZE A;  3V5M A;  2B02 A;  2H28 A;  3V67 A;  1KVL A;  4C75 A;  5KIZ A;  2QMI A;  3MFD A;  5CRF A;  1ALQ A;  3ITB A;  3UDI A;  1NRF A;  1G28 A;  1GSW A;  2XR0 A;  4RX2 A;  3IF6 C;  3C2W A;  4P85 A;  5F1F A;  4E3N A;  2V8C A;  3G2Y A;  3LY4 A;  1NJ4 A;  2GDN A;  5E2G A;  3UNW A;  5J7E A;  5HAQ A;  3HLD A;  3NOT C;  1NYM A;  5DTT A;  2OV5 A;  2GJ3 A;  4X56 A;  3NI9 A;  5CED A;  3R7W B;  1PZO A;  2FFY A;  2ZLY A;  1SDE A;  4JF4 A;  4H6J B;  4JGR A;  3HLF A;  2OWH A;  2RCX A;  4G3K A;  4F94 A;  5FQI A;  2KDK A;  3BW6 A;  3UE6 A;  3TSG A;  3UE1 A;  1G68 A;  2ZBB A;  4R0Q A;  4N9L A;  1YLY A;  5EVI A;  5HPF A;  3BFD A;  2W3G A;  5IT5 A;  4PM8 A;  3UE0 A;  2QZ6 A;  1Z6F A;  5EM0 A;  3OCL A;  3N4I A;  4LCL A;  5GLA A;  1E3U D;  5EVI D;  1BLH A;  5DJU A;  3UY6 A;  5FQK A;  4QPR A;  3KX0 X;  4X6T A;  1P0Z A;  4JKT A;  3NUL A;  3LR5 A;  2VEA A;  1L0D A;  4RYE A;  1GSV A;  3GVB A;  1GCE A;  2V9A A;  4WL9 A;  2HP9 A;  5J8X A;  3VOY A;  4EEP A;  3BEC A;  3TE8 A;  1JNU A;  2B95 A;  5TBM B;  4O8G A;  3ZNT A;  4KZ4 A;  2Z2M B;  3HLG A;  2KOI A;  1K56 A;  3QNC A;  4L0L A;  4GNU A;  4PPR A;  3MQQ A;  4B88 A;  3OPP A;  4ID4 A;  3WRT A;  3QP5 A;  2IA2 A;  4UA9 A;  4D60 A;  1GA0 A;  3IHB A;  4II7 A;  4YWZ A;  4EER A;  3AGF A;  4HH2 A;  1T1C A;  5FI2 A;  2ZC3 B;  3H82 B;  2XD5 A;  3UB5 P;  3V3R A;  3DWZ A;  1NY0 A;  2K2N A;  2J9P A;  1K54 A;  1MKI A;  1T19 A;  5GHX A;  1ERQ A;  1ES5 A;  4RX3 A;  5EVI C;  2JN7 A;  5TFQ A;  3GEC A;  1FR1 A;  1W5D A;  2VJW A;  3MXQ A;  5C5K A;  2XK1 A;  2ZQD A;  3RXX A;  3A3D A;  3N8R A;  1XA7 A;  1L0F A;  2XA7 M;  1H8M A;  4MN5 A;  3BRM A;  4R4R A;  5JYO A;  5HX9 A;  1VHM A;  3UMD A;  3CWF A;  3H7W B;  5AQA A;  3EOI A;  4GHI A;  1S4R A;  4CLC E;  4Q0H A;  5CHJ A;  2VGK A;  4N9K A;  1XFN A;  3IHA A;  3WS0 A;  4OP8 A;  1DP9 A;  4BLM A;  3GSG A;  3M6H A;  3MJQ A;  4BMW A;  3H82 A;  4E3K A;  2A2L A;  1IYP A;  2Y8H A;  3FYZ A;  2E8J A;  4B4X A;  2VZW A;  2V1A A;  1I5Q A;  3K2N A;  2O0Y A;  4EV4 A;  3QHY A;  3NBL A;  4XT2 B;  4WEK A;  3UB9 A;  4HY8 A;  1C3B A;  3JYI A;  3QP6 A;  4H8R A;  2J8Y A;  1W79 A;  4ZRR A;  5CX7 A;  3T1X A;  3LI8 A;  4GZB A;  4OOM A;  5HDC A;  5F83 A;  3T1R A;  4OOL A;  5F6A A;  1K54 C;  1XGJ A;  3NDG A;  2ZQC A;  3IH9 A;  5F69 A;  3T4L A;  5EFW A;  2CC1 A;  3T4O A;  3MFX A;  2XQZ A;  1KVM A;  1OTB A;  3TOI A;  3LIE A;  4KZA A;  1XA1 A;  4PM9 A;  1VET B;  4S2O A;  4YOF A;  4PAU A;  1ONG A;  3S7P A;  1MWU A;  3LGO A;  1EW0 A;  4GN2 A;  1NLY A;  3WS2 A;  1I2S A;  3BLM A;  4KUO A;  3A3J A;  3FC7 A;  5F5Y A;  3T1Q B;  2O9C A;  4WM9 A;  4NXB A;  2WZZ A;  3BYD A;  2XH9 A;  5HD5 A;  1K0K A;  3NY4 A;  3UDX A;  3PAG A;  4FD8 A;  4BD1 A;  3HLB A;  4KZ8 A;  3Q7Z A;  1PZP A;  5HFO A;  1OME A;  4GD8 A;  1ONH A;  3JPU A;  2EXA A;  4N1H A;  5FI6 A;  5EEC A;  3LY3 A;  4HH3 A;  4B4Z A;  3BY9 A;  3ITA A;  3VFH A;  4S2N A;  5GLB A;  3VSL A;  4X25 A;  4EUV A;  2VK3 A;  2QYB A;  1K6R A;  3KSI A;  1LI9 A;  2Y79 A;  1TS8 A;  4JGQ A;  2WGW A;  4GD6 A;  4L9E A;  2WKI A;  3L9K A;  3F1O A;  2WKE A;  3CIT A;  3CPT B;  5E43 A;  4ZBE A;  1QME A;  2W3H A;  5LBR A;  2OAP 1;  2R78 A;  5IS1 A;  2HZ5 A;  3C5A A;  3EQV A;  4K0W A;  5A90 A;  4XXR A;  1V9Z A;  3BWL A;  3BEB A;  3KSF A;  3NCK A;  4IVI A;  5IHV A;  2Y2O A;  2JE5 A;  4ZAM A;  1AXB A;  1XJ2 A;  3FPV A;  4ARZ B;  4DDY A;  2PD7 A;  4HOI A;  5HAP A;  3A3E A;  3EGX C;  3HCY A;  1W8Y A;  5AQB A;  4X1L A;  4ZJ1 A;  3Q82 A;  4I3J A;  4HBT A;  3HUO A;  4E3J A;  2BTF P;  1PFL A;  3N6I A;  1O7E A;  3LR0 A;  2ZOI A;  3IQA A;  5IU1 A;  3T4S A;  3C38 A;  4FTX A;  2I9V A;  3C7V A;  3EQU A;  3IS2 B;  1KGE A;  5CHM A;  4P6Z S;  1Q2P A;  3IF6 B;  4QY6 A;  5CTN A;  5EOO A;  3N7W A;  3NHQ A;  5AQ9 A;  1F5M A;  4NG2 A;  2EXB A;  4R4S A;  4JBF A;  4WZ5 A;  5F82 A;  1K57 A;  4S2N C;  3IXG A;  3KYZ A;  4Q0I A;  4I3A A;  3PXP A;  3C7U A;  2EFU A;  2A49 A;  3N8S A;  5FI7 A;  1XX2 A;  4UA6 A;  1T1B A;  1SKO B;  1STZ A;  1VB6 A;  3PBQ A;  3SS4 A;  1N9L A;  2JKT I;  2HDU A;  2PHY A;  4LRY C;  4NXG A;  1N4O A;  2JCH A;  4Y2F A;  1BSG A;  4E6W A;  4QB8 A;  1HD8 A;  5MC7 A;  3E4O A;  1LL8 A;  5FAQ A;  5BOH A;  2ZQ7 A;  3ZQ5 A;  2WGI A;  4F3L A;  2M7V A;  4DXC A;  5GHZ A;  2QKP A;  3VE3 A;  3ZVW A;  3S4X A;  2Q9N A;  1PRQ A;  1WYC A;  5DTS A;  4S2L A;  4R3J A;  3TJZ C;  2PU4 A;  5G4Y A;  2VX8 A;  4BBV A;  1JTG A;  2I72 A;  4DKI A;  4KG6 A;  3FPW A;  1ODV A;  2ZC6 B;  4LGW A;  3TG9 A;  2V0W A;  3UE3 A;  2Y59 A;  1PW8 A;  1N9N A;  3D9Y A;  2HDR A;  1PI5 A;  2H0T A;  1KOU A;  1O07 A;  4R6L A;  5KSC A;  1J3W A;  1H0M A;  3CLO A;  3NEC A;  1RGZ A;  2R9X A;  3UME A;  1CK3 A;  4MCW A;  3PTE A;  2B18 A;  1TS6 A;  4Q0J A;  3QP8 A;  1K57 C;  2W1T A;  3D3O A;  1FIK A;  3C30 A;  5EPH A;  1P9R A;  3LR3 A;  3PR6 A;  3W4Q A;  3LR4 A;  2HV1 A;  3KSH A;  2WZX A;  1P97 A;  4PM6 A;  2EWV A;  4GCZ A;  1M40 A;  4ESP A;  1ZG6 A;  5EVI B;  2G2W A;  4P0M A;  1PWD A;  2VGL S;  3O86 A;  4KZ5 A;  4GS9 A;  5HDS A;  4ME4 A;  2XD1 A;  4Y17 A;  3FWL A;  5DTK A;  2O9A A;  3ZFZ A;  2PR6 A;  2ZOH A;  4QHC A;  1YM1 A;  2M7U A;  2ZQ8 A;  1PWC A;  3VMA A;  4U0T A;  3DBA A;  2Y91 A;  2P7J A;  5CEB A;  3LFV A;  1ZHH B;  2HF6 A;  3E4P A;  3QP1 A;  4Y5F A;  1HZO A;  3E0Y A;  4BEN A;  2J80 A;  3ZVT A;  3GR2 A;  3G4P A;  4C6Y A;  4IJG A;  2Y2L A;  3PBN A;  4X69 A;  1XP4 A;  2INW A;  4EW7 A;  3LID A;  5EUA A;  1W63 M;  2WAF A;  4HHD A;  4OON A;  3GQZ A;  5I94 A;  1E3U A;  5DF8 A;  5AQ7 A;  5CXW A;  1WYB A;  3DTE A;  4QD4 A;  4OOY A;  4HI4 A;  2Y55 A;  1MKM A;  1H8Y A;  2ZM0 A;  4GOG A;  1D1J A;  4LRZ E;  2O99 A;  3BLS A;  1CJF A;  3S7O A;  3BFE A;  4U0X A;  3WWX A;  1LL5 A;  3Q7V A;  4IUH A;  3P09 A;  2P04 A;  4EQI A;  1YPR A;  3VP0 A;  1JTD A;  3B3X A;  5FQM A;  3N8L A;  1ZG4 A;  4MMN A;  4OQH A;  4OPZ A;  3VP2 A;  4EU0 A;  2XDM A;  2VV7 A;  3DTK A;  3V39 A;  3HL9 A;  4S2J A;  1JWZ A;  1E25 A;  3PAE A;  2B5R A;  3WS5 A;  5M18 A;  5EVL A;  1LT0 A;  2QPN A;  2A24 A;  4Y0T A;  1MWT A;  2ZC4 B;  4PKY G;  4OP5 A;  3W4P A;  4FOF A;  4HP9 A;  4EES A;  1OTA A;  3G34 A;  2R9W A;  3HJK A;  4EBP A;  2EX6 A;  3MQO A;  1N9B A;  3QNB A;  4QU3 A;  2Y2J A;  3E98 A;  5L10 A;  2OWJ A;  3OZH A;  4KQQ A;  4GHI B;  4FSF A;  3WS4 A;  5EOE A;  3T4K A;  2Y2K A;  1XXM A;  1ZKJ A;  4CPK A;  3KSG A;  3B47 A;  4ZJ2 A;  1NXY A;  4EUZ A;  1IOU A;  4HIA A;  2BLS A;  4C3Q A;  1YSP A;  1T1A A;  3T4J A;  4HBU A;  3W8K A;  4B93 A;  1S6R A;  4MEZ A;  4HJ3 A;  4GLQ A;  5I5L A;  4JXG A;  3EEH A;  4UQI M;  4BQM A;  4NXF A;  1LL9 A;  5E2H A;  5U47 A;  1ESU A;  3B42 A;  1W8Q A;  1CI9 A;  1YT4 A;  3M2K A;  2V0U A;  4R3B A;  3G6O A;  4KZ6 A;  3FKW A;  4Y0U A;  4S2M A;  1W63 Q;  1FCM A;  1XKZ A;  1TS0 A;  1CI8 A;  2W3E A;  1M6K A;  3EEA A;  2X01 A;  3M6B A;  4WUJ A;  3UB8 A;  1V9Y A;  2V8F A;  4S2K A;  1MXO A;  3F1N A;  4N92 A;  4P87 A;  1PWG A;  4R3A A;  5K5B A;  5L09 A;  1FCN A;  3G31 A;  1GHM A;  1HLU P;  4KG5 A;  3IXB A;  2CMN A;  2W3D A;  1H3Q A;  1YAX A;  5FDH A;  3IH8 A;  1SHV A;  2OSU A;  4OH0 A;  4Q8I A;  1ES4 A;  1IYQ A;  2WYX A;  4OPY A;  5A91 A;  3IT9 A;  4LFU A;  4JF6 A;  2VKS A;  2WKP A;  4KZ3 A;  3A3F A;  4D2O A;  3FG8 A;  1K6S A;  4QJG A;  4LV3 A;  3OLO A;  2VA0 A;  3TRC A;  4RVA A;  1OPX A;  2QWS A;  2WGV A;  4NK3 A;  3V3S A;  1BYW A;  3ZG8 B;  4Y15 A;  3IF5 A;  4WF0 A;  3B33 A;  4WYY A;  3UB6 A;  3F1P A;  3NOP C;  4K08 A;  1MY8 A;  5CGW A;  4PKY A;  5HD3 A;  5TGF A;  4I3I A;  4E3O A;  4HQA A;  2WGW B;  5DKL A;  3UPO A;  1XJ6 A;  1OJG A;  2J3T D;  3F1O B;  4LV2 A;  2PAV P;  4OPR A;  5HZH A;  5J3W A;  5TR7 A;  4CLC A;  1ERO A;  3SW1 A;  4HP4 A;  1ES3 A;  4L9G A;  3IWO A;  1PNE A;  5KZH A;  1G5U A;  4LRX C;  4PMA A;  1K25 A;  5DVA A;  1A0K A;  3ULF A;  4CLC D;  4DE1 A;  2ZM8 A;  3BFC A;  4WEL A;  4O7D A;  1RP5 A;  2ZD8 A;  4NKP A;  4KQD A;  2Z6C A;  3IXD A;  3T50 A;  2H5S A;  3HLE A;  2EA9 A;  5HPI A;  2Y2Q A;  5HAR A;  3OC2 A;  4ETZ A;  5GLD A;  3G30 A;  4X68 A;  4GDN A;  3VFF A;  3UN7 A;  5A93 A;  4MDZ A;  2V1B A;  1FSY A;  1S4S A;  2ZC7 A;  5EE8 A;  5CHU A;  2IWD A;  3CG5 A;  2IWB A;  3NDE A;  1FOF A;  1GHI A;  4Y0O A;  3PHY A;  2W3F A;  3BFG A;  2JKR I;  1IYS A;  2PDR A;  3CHW P;  2X02 A;  1OT6 A;  3IXH A;  3LI9 A;  5DFY A;  1YMS A;  2PYP A;  3D72 A;  1ESI A;  5CGS A;  1GA9 A;  1VQQ A;  5EM1 A;  3EWK A;  5FQ9 A;  3ZYT A;  2PR5 A;  5KSH A;  3LEZ A;  3IBR A;  3HBR A;  4JXS A;  1S1Z A;  3PBR A;  4KG2 A;  5F68 A;  3CUE A;  4MNR A;  3SH9 A;  3S7N A;  3DW0 A;  4AFI A;  4G3V A;  2IWC A;  1DP6 A;  2QJ7 A;  4BL3 A;  2OOL A;  3BJN A;  1N9O A;  1LI0 A;  4BJP A;  2ZQ9 A;  4F3L B;  3BM6 A;  2Z2L B;  1LSX A;  1NLZ A;  3SS3 A;  3DTI A;  1IEM A;  2XFS A;  4RQ9 A;  3IWQ A;  3ZHH A;  2P08 A;  3O3V A;  2OLU A;  1BLS A;  1KE3 A;  1YSQ A;  5CGX A;  3P01 A;  2O9B A;  5DF7 A;  4CQH A;  4DRT A;  2G2U A;  4MBH A;  4RA7 A;  2BAS A;  4LPZ A;  2MJ6 A;  2GZA A;  3T12 B;  3JVV A;  3GDI A;  4WZ4 A;  5FL3 A;  4R1G A;  4QWO A;  4GKU A;  3ZG0 A;  1TDG A;  1JVJ A;  1XFQ A;  2ZMV A;  3OPH A;  2C6W B;  1TS7 A;  4EQ1 A;  3MXS A;  1KDW A;  3S1Y A;  2FZ0 A;  3MZF A;  3LIA A;  2W1T B;  2V2F F;  3BFF A;  3HUN A;  4YIN A;  2JC7 A;  4PHT A;  1PYY A;  5HWT A;  2EX2 A;  4KZ9 A;  2DMW A;  3A0S A;  2V20 A;  3LUQ A;  3MXR A;  4Y3I A;  5AVF A;  4NEE D;  3U2A A;  4YFM A;  1CQA A;  5M1A A;  1FCO A;  5AVE A;  5A92 A;  1PI4 A;  5EV0 A;  3K3C A;  3LCE A;  4GS9 B;  4FUW A;  3C4O A;  3PYP A;  1IKG A;  1IFQ A;  4NXE A;  4X55 A;  3OBF A;  5DJT A;  1F9I A;  2QJ5 A;  2GNX A;  1EI5 A;  3OOV A;  3SZT A;  5FEG A;  1E4D A;  4JLF A;  4MBK A;  4KZ7 A;  5HAI A;  3ZG7 B;  5TJJ A;  4X1M A;  3PBS A;  1VEU A;  4WZ5 C;  1HVB A;  1LSV A;  4R70 A;  3E2K A;  2XF3 A;  1YMX A;  2HP6 A;  2J3W A;  4EET B;  1TDL A;  5FEF A;  5FQJ A;  1PW1 A;  2ZL1 A;  3MKF A;  3VP4 A;  4HJ6 A;  4UHU A;  3MZD A;  4ETX A;  4E04 A;  1G6O A;  1XGI A;  3BQA A;  4MLL A;  2XGN A;  1GHP A;  3K3D A;  2XSS A;  1FSW A;  5M19 A;  1I2W A;  3H9W A;  3CMZ A;  2ZC5 B;  4DE0 A;  1ZC2 A;  4EXO A;  2P9V A;  3LEQ A;  3T4T A;  2XRN A;  4GDB A;  4MBF A;  5EVE A;  1MWS A;  1BTL A;  3Q7V B;  3E4Q A;  2P74 A;  2PBD P;  3Q1F A;  4OLG A;  5FAS A;  4Z1W A;  3VSK A;  4JXV A;  1BUL A;  1YQS A;  4JF5 A;  4WMC A;  4WLA A;  1SZV A;  3NIA A;  1MZU A;  4X53 A;  1OTD A;  3KYQ A;  1OJ5 A;  3CAX A;  1IEL A;  3UDF A;  4P6B A;  2DRW A;  3V50 A;  1Y28 A;  3AGD A;  4CJN A;  4QY5 A;  1T18 A;  1GSX A;  1RGY A;  1SCW A;  2JKR M;  2Y2G A;  2A24 B;  4WMC D;  3HJI A;  4LV1 A;  5FQQ A;  1S1Y A;  4DJ2 A;  1FIL A;  4KEN B;  3MMH A;  3UPN A;  5CTM A;  5L07 A;  3MS6 A;  2X71 A;  4K0X A;  1U60 A;  5CER A;  5KMW A;  1TD5 A;  1LLB A;  4IHQ A;  2Q9M A;  3KYE A;  3MSH A;  3VP3 A;  2J9O A;  2XFT A;  4UAA A;  1NZO A;  3MR0 A;  2Z6D A;  1DJA A;  4BBT A;  3ZGA B;  1L0E A;  2H0Y A;  5HL6 A;  3FKV A;  4DF6 A;  3D4F A;  4I5S A;  2YKH A;  1LHY A;  5GLC A;  3VE4 A;  2RL3 A;  5FA7 A;  5L2F A;  3GTC A;  4XUX A;  1CEF A;  2LB5 A;  2VV8 A;  4LCM A;  3R7W A;  4E6X A;  3MKE A;  1FQG A;  1KGG A;  1DJC A;  2HDS A;  1K55 A;  1J9M A;  3U4L P;  4BL2 A;  1BT5 A;  4KUK A;  2UWX A;  4H6J A;  2QHK A;  5D3O A;  3G2Z A;  1FR6 A;  3CZD A;  2L0W A;  2HP5 A;  2A3U A;  1D06 A;  3BY8 A;  3RXW A;  1NWZ A;  2EFX A;  1YLZ A;  3F1N B;  3EGD C;  3OPR A;  1Y4O A;  3HLC A;  3L7H A;  3P98 A;  1NZU A;  4IVK A;  3NC8 A;  4OKP A;  4FCF A;  3MQ0 A;  4R23 A;  4KQO A;  2L4R A;  2JKT M;  4PM5 A;  1K56 D;  4OPQ A;  3HLW A; 
#chains in the Genus database with same CATH homology
 1F2K A;  2V8F A;  2V8C A;  4X1M A;  3MS6 A;  1VEU A;  1HLU P;  1AWI A;  1SKO B;  3L9K A;  4ESP A;  3CPT B;  3DAV A;  1Z09 A;  3KYE A;  3MSH A;  4D60 A;  2JKF A;  5FEF A;  3T1X A;  2ZL1 A;  5FDS A;  2HZ5 A;  3T1R A;  3T12 B;  3UB5 P;  4QWO A;  1ACF A;  1SKO A;  3CHW P;  1PRQ A;  2ACG A;  3CPT A;  2PRF A;  4X1L A;  1VET B;  2BTF P;  1PFL A;  3LEQ A;  5EM1 A;  5EM0 A;  3U4L P;  3LGO A;  2JKG A;  5EVE A;  4FTX A;  2PBD P;  3D9Y A;  3T1Q B;  1CF0 A;  1J3W A;  1SZV A;  1K0K A;  3NEC A;  1VEU B;  1Y4O A;  3NUL A;  1CQA A;  3L7H A;  2PAV P;  5EV0 A;  3T1S A;  4FUW A;  1VET A;  1D1J A;  1PNE A;  1FIK A;  1G5U A;  2ZL1 B;  1CJF A;  1A0K A;  4X25 A;  2B95 A;  2E8J A;  2VK3 A;  1FIL A;  1YPR A;  5FEG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...