1G5UA

Latex profilin hevb8
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
130
structure length
130
Chain Sequence
SWQTYVDDHLMCDIDGHRLTAAAIIGHDGSVWAQSSSFPQFKSDEVAAVMKDFDEPGSLAPTGLHLGGTKYMVIQGEPGAVIRGKKGSGGITVKRTGQALIIGIYDEPLTPGQCNMIVERLGDYLLDQGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PROFILIN
publication title A Comparative Structural Analysis of Allergen Profilins HEVB8 and BETV2
rcsb
source organism Hevea brasiliensis
molecule tags Allergen
total genus 28
structure length 130
sequence length 130
chains with identical sequence B
ec nomenclature
pdb deposition date 2000-11-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00235 Profilin Profilin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.30 Alpha Beta 2-Layer Sandwich Beta-Lactamase Dynein light chain 2a, cytoplasmic 1g5uA00
1CJFA 3LEQA 2VK3A 4X1MA 1HLUP 4QWOA 5EVEA 1YPRA 3D9YA 2JKGA 3MS6A 2ZL1B 3DAVA 1Z09A 3T12B 1ACFA 3UB5P 1K0KA 1D1JA 4X25A 4FUWA 1J3WA 4X1LA 3CPTB 4D60A 1VETB 3T1XA 3CHWP 2PBDP 1SKOB 3NULA 2E8JA 5FDSA 1CQAA 5EM1A 1PNEA 2ZL1A 3L7HA 2ACGA 5EM0A 3NECA 4ESPA 2BTFP 1SZVA 2V8FA 3T1RA 1VETA 1FIKA 1A0KA 1PRQA 2JKFA 1SKOA 1PFLA 5EV0A 2HZ5A 5FEFA 1F2KA 3KYEA 1FILA 1VEUB 1AWIA 3L9KA 4FTXA 2PAVP 3MSHA 1Y4OA 2V8CA 3T1SA 5FEGA 3CPTA 3LGOA 1G5UA 2B95A 3T1QB 1CF0A 1VEUA 3U4LP 2PRFA
chains in the Genus database with same CATH superfamily
4X1MA 3HLBA 2Z2MB 3IBJA 3FZCA 3P01A 3KSGA 3O5YA 5G18A 4Y7PA 3MF0A 4PPRA 3VV4A 3HUNA 5HFOA 2XGNA 2JKGA 1EWZA 3MS6A 4OP5A 4QD4A 3BFDA 1OT9A 3IHAA 4N1XA 4E3IA 1UWNX 4OOLA 5G4YA 5FI6A 4E6XA 3PBSA 3MR0A 4JLFA 1N9BA 1MBLA 4R3BA 4GD8A 4Y15A 3MFXA 2ZOIA 1YSQA 3LR3A 4KZ4A 4HY8A 1ERMA 3R4KA 1XJ4A 3CHWP 4FSFA 3BECA 5DKKA 3PXPA 1OMEA 4JPMA 2W1RA 3P09A 4WZ5C 2BLSA 1TDLA 4S2IA 1BLPA 3MMHA 1A0KA 2V1ZA 3IF5A 2H0YA 3U2AA 2JCHA 1TF1A 4GLQA 4E04A 2O9AA 5A8BA 4O0PA 5J4EA 4PKYA 1ZC2A 3MSHA 3M6HA 3JPUA 2PR6A 3T1SA 5JYOA 5FL3A 4U0XA 1S6RA 4QJGA 4IBRA 4DKIA 4GKUA 3N4IA 2L1MA 4WF0A 4P6ZM 4XT2A 3HUOA 3LIFA 1KVMA 1K55C 1TVFA 4JF4A 4HBTA 1GHPA 3UDXA 4RQ9A 5LBRA 4HJ6A 4WEKA 4MBFA 4KQDA 2H0TA 3V3RA 2XD1A 1BYWA 5IU1A 1KDWA 3E4OA 2Y2GA 4JF5A 1VHMA 4K0WA 5CRFA 2WGVA 4YINA 2M7VA 3TRCA 3GSGA 3OPHA 3ZNYA 1KOUA 2QYBA 5FA7A 2MJ6A 2ZQAA 4EU0A 1XJ3A 3QP1A 3T1XA 1T1AA 1NRJA 4GNUA 3OOVA 3BY9A 3A3DA 1MWRA 1L0FA 2VGLM 3E4QA 4LFUA 1XFNA 3BM6A 1XP4A 1SDEA 1F98A 3VP2A 2VX8A 2W3DA 3IQAA 4JXVA 4DXBA 3PR6A 4KZ8A 3E0YA 4OQIA 1IELA 4CLCC 3DTMA 4I3JA 3C30A 3E4PA 1BSGA 4O8GA 2EXAA 4WELA 3NC8A 1FR1A 2EA9A 1P97A 1SCWA 3Q81A 3WS4A 2ZC6B 4UA6A 3ZGAB 3R7WA 4CQHA 4OOYA 3OBFA 4JKTA 3MJQA 2NUTC 3FYZA 4EQIA 3M6BA 1IKIA 1K38A 4IEDA 5CERA 4R1GA 2VK3A 2XROA 1ALQA 3ZG0A 1CK3A 4NK3A 4MN5A 1XA1A 1YPRA 2W3HA 1TDGA 2VV7A 3A0SA 5EPHA 3W4OA 2C5WB 3G4PA 4L9EA 1NZOA 1XA7A 4JXWA 4R3JA 5HAQA 4C75A 3T4SA 4XXRA 3HLGA 5CGSA 2OAQ1 5GHZA 2Y55A 5HPIA 2XH9A 4DDYA 4GDBA 1K0KA 3S7OA 4OP8A 2D02A 3KX0X 2YKHA 4E3NA 1V9ZA 1LI0A 3D3OA 3NULA 1V9YA 3TJZC 5EE8A 2W3EA 3BLSA 2ZQ8A 3RH8B 3CUEC 3ZHHA 1UGUA 4DE3A 3HLEA 4DMZA 2Y91A 4II7A 3V39A 2P7JA 2RCXA 3IWQA 3MXRA 4FOFA 4XT2B 3VP0A 4LCMA 3IF6C 5AQ9A 3GR2A 3DTEA 1HZOA 2FZ0A 3IX8A 2V8CA 4B4XA 4OPZA 1H0MA 5FQJA 2WGWA 2V20A 3T50A 3IH9A 2Z2LB 4ZBEA 4JGPA 2G2WA 4WMCD 3HREA 2Y2HA 2EX2A 2Y2JA 3G35A 2G7UA 1CEGA 1VEUA 3NDGA 2PRFA 2X02A 3BFGA 3LEQA 3VOLA 1S4SA 3OPRA 5EVIA 4F3LA 3HJKA 3V67A 2W0NA 4NKPA 1NWZA 2GX5A 1I2SA 2ZM8A 4MCWA 2WKQA 3FC7A 5HSQA 4JXGA 1MWSA 3UE0A 2WAEA 1GHIA 3VOZA 2VEAA 4EWFA 1YQSA 3IT9A 1XPBA 4BWIA 4HHDA 3CPTB 2WKPA 3EQVA 5E2HA 3FG8A 2C6WB 3C38A 3CLOA 2OAP1 3PAGA 3MXSA 2OV5A 5J8XA 1VM1A 2K2NA 1PI4A 5U47A 2PD7A 3G34A 2W1TA 4FH4A 4ZRRA 4JGRA 1IEMA 3RFBA 1E25A 1NLZA 3W8KA 1ES5A 2VGKA 3P98A 3LYXA 3LCEA 2Z6DA 1EROA 1P0ZA 3T1RA 1PIOA 1VETA 5TBMA 5F68A 3K3CA 4EBLA 1YLPA 3HCYA 4HNBA 2A49A 4BD1A 4HESA 3C4OA 1E4DA 4ARZB 2KOIA 2PAVP 4WZ5A 4YNRA 3G30A 2CC1A 1GHMA 3C8CA 3W2ZA 1T19A 4WM9A 2HDRA 1RP5A 4Y3IA 3ZCZA 4Y5FA 1TEMA 5FQQA 4R0QA 2QPNA 5IHVA 3NIAA 4QB8A 3PYPA 2O9CA 5GHYA 4MDZA 3A3JA 3Q7ZA 4S2OA 2ZQ9A 2QHKA 3GDIA 2Z6CA 2BASA 2ZLYA 1MWTA 1Z09A 3UNWA 4OQGA 3ZG7B 4B9OA 1K55A 3T12B 3E2KA 1NYMA 5CHMA 2P08A 2XA7M 2OOLA 1NXYA 2WKHA 3PBQA 4S2KA 5CGXA 3BQ8A 2HJ9C 2UWXA 4X56A 2B02A 1ONHA 2EXBA 5HW3A 3NOTC 1IYPA 2ACGA 3JYIA 1N9OA 1W7FA 1CI9A 4WBGA 3DWKA 1PRQA 1KGEA 3OCLA 4S2JA 1PFLA 2J80A 4OPQA 4KENB 1E3UA 4Y0OA 1VEUB 1MPLA 1AWIA 4UA7A 4FTXA 4D2OA 5A90A 4Z1WA 1TD5A 5FQ9A 4GDNA 1XXMA 3K3DA 1MWUA 3LIDA 4IVKA 4LRYC 1U60A 3HBRA 4PMAA 4CLCA 1WYBA 3WS2A 3Q7VA 4R23A 1CF0A 3FKVA 3PHYA 2ZMAA 1S67L 4HJ3A 3MQQA 1TS6A 2WKIA 5EOEA 4X69A 1IYOA 1Y54A 3OZHA 1OJGA 2QJ5A 5J3WA 1K6RA 3KO6A 1DP8A 2WGIA 4EESA 5J7EA 4HP9A 3CZDA 2DMWA 3K2NA 1ACFA 4MBKA 3BFFA 5G4ZA 3C4PA 3D72A 4MLLA 1J3WA 1K54C 1VETB 5TBMB 3BQAA 3KYZA 3CJMA 4P87A 3NI9A 1O07A 1CQAA 5HZHA 2ZL1A 5HWWA 4I3IA 4ESPA 3ICYA 4EUVA 4E3LA 3IHBA 1W5DA 2V8FA 1PW1A 4I5SA 2ZQCA 3WRZA 4WEJA 1W63Q 1X0OA 2ZM0A 5C5KA 3EWKA 2FFFB 3CITA 3KYEA 1FILA 4I3AA 3UN7A 1T1BA 3TW8A 1LL8A 4IVIA 5DTKA 3ZQ5A 1NYYA 4LCLA 3W4QA 3CUEA 2G2UA 3DW0A 3B33A 3F1OA 4M4XA 2XQZA 2KLIA 3WS1A 4K08A 3EGDC 2GNXA 4Q0IA 1S1YA 3HJIA 2DRWA 2J9OA 2O9BA 4O01A 1OTEA 4BQMA 3G31A 3MKFA 1PW8A 3IF6A 3E2LA 1HLUP 4QWOA 5FAQA 3LY3A 5DJUA 2VA0A 1AXBA 2BG1A 2B18A 1DY6A 4Q8IA 4GD6A 5AVEA 1YT4A 2K31A 2A24A 3DAVA 3BRMA 1FQGA 2EWVA 4N9LA 1TS7A 4R6LA 4U0TA 2GJ3A 4Q0HA 4WLAA 3G2YA 2HDQA 4FUWA 3T4KA 3MFDA 4FH2A 5CHUA 3H7WA 3QP8A 1VB6A 3UDIA 3N8SA 1BLHA 3GECA 1NRFA 4JGQA 2J9PA 2PU2A 2ZBBA 4BJPA 1FOFA 1PNEA 3L7HA 3LIAA 3VSKA 3MZFA 5FATA 2QWSA 5EUAA 3SZTA 1OTBA 4BLMA 1W8QA 4KG2A 5EVID 4BBUA 4K91A 4CLCB 1ERQA 5HD5A 1W8YA 4I39A 2HZ5A 3Q7VB 2VGLS 4MNRA 1LSWA 2JHEA 2HJEA 5E43A 1JNUA 3B3XA 3BW6A 1Y4OA 2X71A 5M1AA 3T4JA 3CPTA 3LY4A 3QP6A 1W63M 2B5RA 3HLFA 4XUXA 2Q0OA 4JGOA 2Y2MA 3QP2A 4RVAA 1K56D 4GZBA 2EWWA 3G32A 5KZHA 4R70A 5EVEA 2HPBA 2OWJA 1PI5A 1P9WA 4OONA 1JWPA 2QJ7A 5D3OA 1G6AA 2HP9A 3E98A 3LO7A 1DRMA 2WADA 5IS1A 2ZL1B 1WA9A 4LV1A 3M2JA 4KQQA 4HBUA 3IS2A 4FCFA 4G3WA 3UB5P 4ARZA 2ZC5B 4IBXA 3M2KA 1JVJA 1KGFA 3OPLA 1YM1A 2W3GA 1T1CA 2WYXA 3PBNA 5TFQA 3LFVA 1W79A 5FDSA 1GSWA 3T4TA 3Q07A 4JBFA 2BTFP 1S66L 1OTDA 3A3IA 3F1OB 1LI9A 5GLAA 4S2NC 4FD8A 2VJWA 4UQIS 1LSVA 4NXEA 4H8RA 3ZG5A 4PM9A 5E2EA 3V3SA 1JTGA 3S7NA 2ZQ7A 5DF8A 1DP9A 4X68A 5EV0A 3AGFA 3N8LA 1KE4A 4NG2A 1L2SA 4HEFA 2I9VA 3VP3A 3IF6B 2WAFA 5L8MA 2ZQDA 5AQAA 3MXQA 5FEGA 3TOIA 1BLCA 5CGWA 3A0VA 4DE0A 2B95A 4BD0A 3FWLA 4E3OA 5L2FA 3BYDA 2A24B 5F5YA 1FCMA 1ZHHB 3WS5A 3OLOA 5FDHA 1GCEA 3SH8A 5FQKA 4P6BA 3V50A 3VE4A 1F5MA 3H7WB 4GCZA 2VLGA 4IUKA 5EFWA 3MZDA 3LR4A 1KE0A 3IXHA 4DF6A 2FFYA 3VE3A 3IXGA 5F82A 2P9VA 3W4PA 4OOMA 4CLCE 4Y0TA 3G6OA 3H9WA 3O87A 4BBVA 4OPYA 3IWIA 1IFQA 3VMAA 3HLWA 1YSPA 4DXCA 5F83A 1TS8A 2EX9A 3CAXA 4KQOA 3O88A 1IYQA 5F69A 4JXSA 3EGXC 5AQ7A 4WYYA 2ZC4B 4EERA 1GA9A 4GOGA 2IWDA 4ZDXA 2I72A 4ZTKA 1CEFA 2V0WA 2QMIA 1K54A 5I94A 1SKOA 5L09A 2OSUA 1LL5A 3BFCA 3NOPC 1BUEA 3F1NA 4QPRA 3L9KA 2DNSA 2Y2KA 3AGEA 1J9MA 5AJGA 5HL1A 5A92A 4CJNA 4CPKA 5CX7A 1K4FA 1KGGA 1GA0A 1ES3A 5DJTA 1ZTUA 3LGOA 2PD8A 1BTLA 1OJ5A 1Q2QA 2PYRA 3QNCA 4HJ4A 1O7EA 4PM7A 3PBRA 5GLCA 4QY6A 4P85A 1YLYA 2VV8A 3IS2B 1CJFA 2Q9MA 1CI8A 4LGWA 2HP5A 5HARA 3GTCA 5DFYA 3KSFA 4IUHA 3Q1FA 3CG5A 4S2LA 3HLDA 1WE4A 1XJ6A 3C5AA 3CI6A 4GN2A 3IXBA 2Y4AA 3MZEA 3T4OA 3BFEA 1YLWA 3NY4A 3G2ZA 3UMEA 4BL3A 3ZDJA 1Z6FA 4L0LA 1RGZA 3DWZA 1K6SA 4ETZA 2PHYA 3TE8A 3VP1A 5HL6A 1LLBA 3NECA 2WKRA 4UAAA 5HPFA 4WUJA 3LI9A 1EI5A 4ZJ1A 3ZFZA 2Y59A 4LV2A 2XA7S 2K7SA 3DBAA 4LRZE 4B4ZA 4LV0A 2XRNA 2JKFA 1NY0A 4IJGA 1H8MA 3CMZA 5EOOA 4HI4A 1QMFA 5FAPA 5BOHA 2AVXA 2HDUA 4U3TA 4KZ5A 1LT0A 4PAUA 2ZD8A 2VV6A 2V1BA 5A91A 1MC0A 3UPPA 3WWXA 3SOIA 2D01A 3EOIA 1IYSA 3N6IA 1YLJA 2LB5A 5HDSA 4LLOB 2HGVA 2P9VB 3MQOA 1JTDA 2Y2NA 1DJAA 5I5LA 1L3LA 1HD8A 2RL3A 3P7NA 1QMEA 3LR5A 1RCJA 3ZVTA 1K57C 2PT7A 3V5MA 4PHTA 5HWTA 4KZ7A 3T4QA 1MXOA 2E8IA 2Q9NA 2R9WA 1MKIA 2NUPC 2HP6A 3NJAA 4OPRA 1SKOB 4DN0A 3D4FA 3SS3A 4EBNA 4L9FA 4H6JA 4R38A 3F1NB 4NEED 3HL9A 4DJ3A 4MN7A 3B47A 5EM0A 1Y28A 2W27A 2IWBA 2ZJ9A 5GLDA 5HWVA 5FSRA 4OLGA 2M7UA 3FV7A 3B42A 2V2FF 4E6WA 1M6KA 2IA2A 3UE1A 1I2WA 4QHCA 3DTKA 4KZ6A 2H5SA 1T18A 2GZAA 3A0RA 4BL2A 1SHVA 3UY6A 4S2NA 4Z9QA 3O86A 1HTZA 4NETA 4EQ1A 3SW1A 3S4XA 3HUMA 1IOUA 5IT5A 3HVFA 2ZMVA 4QU3A 2INWA 3UE3A 3TG9A 5HD3A 3GV9A 3GRJA 5DTSA 4NXBA 4M3KA 2HF6A 2XR0A 1PWDA 1PYYA 3FPVA 3SS4A 4X55A 1GSXA 1WYCA 2JKRI 3EEAA 3PBTA 4Y0UA 3ULFA 1NZUA 3SS5A 1D06A 1ZG4A 4OH0A 4DE1A 1UWPX 1D1JA 3LIBA 4WZ4A 5FASA 1XJ2A 2JC7A 2H28A 2WZZA 1C3BA 3UDFA 1LL9A 4HOIA 2ZM2A 1OT6A 2LB9A 4P6ZS 3UMDA 2HDSA 1H8YA 3VFFA 1YAXA 1PWCA 3BWLA 3BY8A 2J3WA 4RA7A 1FIKA 3UPOA 1N9LA 3ZG9B 1S0WA 3LIEA 1FSWA 1K4EA 4KG5A 1FCOA 4KZAA 3S7QA 3MQ0A 2XF3A 3LI8A 1ESUA 1K25A 1F9IA 1XGIA 5GL9A 2JN7A 3S22A 4S2MA 1Q2PA 4MBHA 2JKTI 4GS9A 4WL9A 3ITBA 5HDCA 3PBOA 4YOFA 3ITAA 2XFSA 2W3FA 1S1ZA 3VSLA 2VKSA 2J3TD 1KDSA 2JBFA 4ZAMA 3BLMA 2X01A 1MKMA 4RX3A 1BULA 3PTEA 3IX4A 1YMXA 2PR5A 4RYEA 5FQIA 2YKFA 3C7UA 4H6JB 3QP4A 3A3FA 3GMWA 2JE5A 1FSYA 4A5RA 4PM8A 5CTMA 1LSXA 3UB9A 3EQUA 4ZJ3A 4UEYA 3SH9A 2VGJA 4X1LA 3DTIA 4DJ2A 4KG6A 2A2LA 4N1HA 4K0XA 1NJ4A 2FH5A 4R4SA 2ZOHA 1EW0A 4C6YA 5HAPA 4GJ4A 4N92A 1HVBA 3IBRA 2V0UA 3MBZA 4BMWA 3IWOA 5JYPA 2PBYA 5FEFA 4G3VA 5TR7A 2XD5A 3QNBA 4HIAA 1ZG6A 3LUQA 4BENA 2XFTA 4R4RA 1RGYA 1L0DA 3BEBA 5FI2A 5M19A 1G28A 1G6OA 1BZAA 4XUZA 4WN5A 3ZVWA 5CTNA 4OLDA 5TJJA 4PM5A 5GLBA 2QKPA 5DF9A 3ZYTA 1YMSA 4L9GA 3VOYA 3QP5A 4UQIM 5M18A 4YFMA 4E3KA 2VZWA 2ZC3B 5FI7A 4EXOA 4Y17A 3IH8A 3VP4A 1S4RA 4EW7A 4OQHA 2GDNA 4C3QA 2EFUA 3H82A 3JVVA 1FCNA 5E2GA 4YWZA 1ZKJA 3UPNA 3ISGA 3F1PA 4X25A 2WUQA 2XEPA 4D60A 4OVDA 3IXDA 2Y2LA 4MN6A 1DP6A 1PWGA 4HQAA 5KSHA 3NCKA 1I5QA 4R3AA 4DRTA 1K57A 2IWCA 4KQRA 2OLVA 4EEPA 3OPPA 5DTTA 4GW9A 1E3UD 5DFXA 1YKDA 5E2FA 1ES4A 4GB7A 4EETB 4KZ3A 5K5BA 1NLYA 4NXFA 4IHQA 5EVLA 4GS9B 1H5XA 4NXGA 2R78A 2CMNA 3N8RA 4ZJ2A 4CLCD 5FQMA 4GHIA 2R9XA 3A3EA 3QHYA 3SH7A 3NBLA 4ID4A 3LR0A 3FKWA 4LV3A 5F6AA 3CWFA 3OCNA 3NDEA 1ODVA 2L4RA 3N7WA 3AGDA 3EEHA 3C2WA 1ONGA 4G3KA 2XLNA 1L0GA 3WRTA 3S7PA 3ZNTA 1IKGA 4QY5A 1JWVA 2L0WA 4P0MA 4HH3A 2JKRM 1FR6A 1K56A 4X6TA 4DE2A 3RJUA 3PAEA 4PKYG 4LPZA 1H3QA 4EBPA 3RTYA 2ZMFA 3KSIA 3T4LA 3I7JA 1N4OA 1P9RA 5AVFA 5L07A 3R7WB 3RXWA 2PBDP 3LICA 1SKFA 2KDKA 4O7DA 2E8JA 2OWHA 5DVAA 4B93A 5CEDA 1XX2A 3GQZA 1G68A 4OKPA 3LEZA 5A93A 2Y2QA 5L10A 4LRXC 3NOUC 4KUKA 4UHUA 2J7VA 2WZXA 5HAIA 3UE6A 5CECA 2V9AA 5FAOA 4HH2A 4Y2FA 2PU4A 2DCFA 3IX3A 1BT5A 1YLTA 4KZBA 5GHXA 4E3JA 1M40A 2H10A 3KSHA 1GSVA 1TS0A 1STZA 2HV1A 2KX6A 2EX8A 2PYPA 3TSGA 5F1FA 2JKTM 3UB7A 4E3MA 1OTAA 2P74A 1OTIA 1MY8A 2Y2OA 4EV4A 4LENA 1YLZA 3H82B 4HP4A 5DF7A 3RXXA 1XGJA 3C7VA 2P04A 3MKEA 3U4LP 2O99A 3NHQA 4KUOA 4EUZA 3F1PB 2WKEA 1BLSA 3D9YA 4Y13A 3GVBA 3O3VA 2EX6A 4ME4A 5TGFA 3UB6A 2OLUA 1SDNA 1PZPA 4F94A 3OC2A 2QZ6A 1ES2A 2WK0A 1DJCA 4Q0JA 2EFXA 3WS0A 5KIZA 1PZOA 4B88A 3UO9A 2M1CA 2Y2PA 2WGWB 4WMCA 1JWZA 1KVLA 1KE3A 4EEUA 3FPWA 4I38A 4DDSA 3HLCA 4ETXA 4UA9A 1N9NA 2PDRA 5EM1A 1MZUA 5KMWA 2UV0E 4JF6A 5CHJA 4GHIB 2XK1A 2ZC7A 3JVUA 5EVIB 4F3LB 1OPXA 1SZVA 3BJNA 2J8YA 2Y2IA 1LHYA 2Y8HA 2XDMA 1XKZA 5KSCA 4X53A 4N9KA 1VQQA 1XFQA 3UB8A 1L0EA 1F2KA 2Y79A 4PM6A 3Q82A 5F1GA 5EVIC 4MEZA 5MC7A 2V1AA 2XSSA 4BBTA 5CEBA 5AQBA 1DJBA 5HX9A 3ZG8B 4MMNA 3VFHA 4OQ0A 2J3TC 3S1YA 1G5UA 5HDDA 2A3UA 4S2PA 1D7EA 4RX2A 3T1QB 4KZ9A 2O0YA 5CXWA 4AFIA 5DKLA 1ESIA 1H8ZA 2W1TB 3KYQA 5EECA
chains in the Genus database with same CATH topology
1CJFA 3LEQA 2VK3A 4X1MA 1HLUP 4QWOA 5EVEA 1YPRA 3D9YA 2JKGA 3MS6A 2ZL1B 3DAVA 1Z09A 3T12B 1ACFA 3UB5P 1K0KA 1D1JA 4X25A 4FUWA 1J3WA 4X1LA 3CPTB 4D60A 1VETB 3T1XA 3CHWP 2PBDP 1SKOB 3NULA 2E8JA 5FDSA 1CQAA 5EM1A 1PNEA 2ZL1A 3L7HA 2ACGA 5EM0A 3NECA 4ESPA 2BTFP 1SZVA 2V8FA 3T1RA 1VETA 1FIKA 1A0KA 1PRQA 2JKFA 1SKOA 1PFLA 5EV0A 2HZ5A 5FEFA 1F2KA 3KYEA 1FILA 1VEUB 1AWIA 3L9KA 4FTXA 2PAVP 3MSHA 1Y4OA 2V8CA 3T1SA 5FEGA 3CPTA 3LGOA 1G5UA 2B95A 3T1QB 1CF0A 1VEUA 3U4LP 2PRFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CJF A;  3LEQ A;  2VK3 A;  4X1M A;  1HLU P;  4QWO A;  5EVE A;  1YPR A;  3D9Y A;  2JKG A;  3MS6 A;  2ZL1 B;  3DAV A;  1Z09 A;  3T12 B;  1ACF A;  3UB5 P;  1K0K A;  1D1J A;  4X25 A;  4FUW A;  1J3W A;  4X1L A;  3CPT B;  4D60 A;  1VET B;  3T1X A;  3CHW P;  2PBD P;  1SKO B;  3NUL A;  2E8J A;  5FDS A;  1CQA A;  5EM1 A;  1PNE A;  2ZL1 A;  3L7H A;  2ACG A;  5EM0 A;  3NEC A;  4ESP A;  2BTF P;  1SZV A;  2V8F A;  3T1R A;  1VET A;  1FIK A;  1A0K A;  1PRQ A;  2JKF A;  1SKO A;  1PFL A;  5EV0 A;  2HZ5 A;  5FEF A;  1F2K A;  3KYE A;  1FIL A;  1VEU B;  1AWI A;  3L9K A;  4FTX A;  2PAV P;  3MSH A;  1Y4O A;  2V8C A;  3T1S A;  5FEG A;  3CPT A;  3LGO A;  1G5U A;  2B95 A;  3T1Q B;  1CF0 A;  1VEU A;  3U4L P;  2PRF A; 
#chains in the Genus database with same CATH topology
 4X1M A;  3HLB A;  2Z2M B;  3IBJ A;  3FZC A;  3P01 A;  3KSG A;  3O5Y A;  5G18 A;  4Y7P A;  3MF0 A;  4PPR A;  3VV4 A;  3HUN A;  5HFO A;  2XGN A;  2JKG A;  1EWZ A;  3MS6 A;  4OP5 A;  4QD4 A;  3BFD A;  1OT9 A;  3IHA A;  4N1X A;  4E3I A;  1UWN X;  4OOL A;  5G4Y A;  5FI6 A;  4E6X A;  3PBS A;  3MR0 A;  4JLF A;  1N9B A;  1MBL A;  4R3B A;  4GD8 A;  4Y15 A;  3MFX A;  2ZOI A;  1YSQ A;  3LR3 A;  4KZ4 A;  4HY8 A;  1ERM A;  3R4K A;  1XJ4 A;  3CHW P;  4FSF A;  3BEC A;  5DKK A;  3PXP A;  1OME A;  4JPM A;  2W1R A;  3P09 A;  4WZ5 C;  2BLS A;  1TDL A;  4S2I A;  1BLP A;  3MMH A;  1A0K A;  2V1Z A;  3IF5 A;  2H0Y A;  3U2A A;  2JCH A;  1TF1 A;  4GLQ A;  4E04 A;  2O9A A;  5A8B A;  4O0P A;  5J4E A;  4PKY A;  1ZC2 A;  3MSH A;  3M6H A;  3JPU A;  2PR6 A;  3T1S A;  5JYO A;  5FL3 A;  4U0X A;  1S6R A;  4QJG A;  4IBR A;  4DKI A;  4GKU A;  3N4I A;  2L1M A;  4WF0 A;  4P6Z M;  4XT2 A;  3HUO A;  3LIF A;  1KVM A;  1K55 C;  1TVF A;  4JF4 A;  4HBT A;  1GHP A;  3UDX A;  4RQ9 A;  5LBR A;  4HJ6 A;  4WEK A;  4MBF A;  4KQD A;  2H0T A;  3V3R A;  2XD1 A;  1BYW A;  5IU1 A;  1KDW A;  3E4O A;  2Y2G A;  4JF5 A;  1VHM A;  4K0W A;  5CRF A;  2WGV A;  4YIN A;  2M7V A;  3TRC A;  3GSG A;  3OPH A;  3ZNY A;  1KOU A;  2QYB A;  5FA7 A;  2MJ6 A;  2ZQA A;  4EU0 A;  1XJ3 A;  3QP1 A;  3T1X A;  1T1A A;  1NRJ A;  4GNU A;  3OOV A;  3BY9 A;  3A3D A;  1MWR A;  1L0F A;  2VGL M;  3E4Q A;  4LFU A;  1XFN A;  3BM6 A;  1XP4 A;  1SDE A;  1F98 A;  3VP2 A;  2VX8 A;  2W3D A;  3IQA A;  4JXV A;  4DXB A;  3PR6 A;  4KZ8 A;  3E0Y A;  4OQI A;  1IEL A;  4CLC C;  3DTM A;  4I3J A;  3C30 A;  3E4P A;  1BSG A;  4O8G A;  2EXA A;  4WEL A;  3NC8 A;  1FR1 A;  2EA9 A;  1P97 A;  1SCW A;  3Q81 A;  3WS4 A;  2ZC6 B;  4UA6 A;  3ZGA B;  3R7W A;  4CQH A;  4OOY A;  3OBF A;  4JKT A;  3MJQ A;  2NUT C;  3FYZ A;  4EQI A;  3M6B A;  1IKI A;  1K38 A;  4IED A;  5CER A;  4R1G A;  2VK3 A;  2XRO A;  1ALQ A;  3ZG0 A;  1CK3 A;  4NK3 A;  4MN5 A;  1XA1 A;  1YPR A;  2W3H A;  1TDG A;  2VV7 A;  3A0S A;  5EPH A;  3W4O A;  2C5W B;  3G4P A;  4L9E A;  1NZO A;  1XA7 A;  4JXW A;  4R3J A;  5HAQ A;  4C75 A;  3T4S A;  4XXR A;  3HLG A;  5CGS A;  2OAQ 1;  5GHZ A;  2Y55 A;  5HPI A;  2XH9 A;  4DDY A;  4GDB A;  1K0K A;  3S7O A;  4OP8 A;  2D02 A;  3KX0 X;  2YKH A;  4E3N A;  1V9Z A;  1LI0 A;  3D3O A;  3NUL A;  1V9Y A;  3TJZ C;  5EE8 A;  2W3E A;  3BLS A;  2ZQ8 A;  3RH8 B;  3CUE C;  3ZHH A;  1UGU A;  4DE3 A;  3HLE A;  4DMZ A;  2Y91 A;  4II7 A;  3V39 A;  2P7J A;  2RCX A;  3IWQ A;  3MXR A;  4FOF A;  4XT2 B;  3VP0 A;  4LCM A;  3IF6 C;  5AQ9 A;  3GR2 A;  3DTE A;  1HZO A;  2FZ0 A;  3IX8 A;  2V8C A;  4B4X A;  4OPZ A;  1H0M A;  5FQJ A;  2WGW A;  2V20 A;  3T50 A;  3IH9 A;  2Z2L B;  4ZBE A;  4JGP A;  2G2W A;  4WMC D;  3HRE A;  2Y2H A;  2EX2 A;  2Y2J A;  3G35 A;  2G7U A;  1CEG A;  1VEU A;  3NDG A;  2PRF A;  2X02 A;  3BFG A;  3LEQ A;  3VOL A;  1S4S A;  3OPR A;  5EVI A;  4F3L A;  3HJK A;  3V67 A;  2W0N A;  4NKP A;  1NWZ A;  2GX5 A;  1I2S A;  2ZM8 A;  4MCW A;  2WKQ A;  3FC7 A;  5HSQ A;  4JXG A;  1MWS A;  3UE0 A;  2WAE A;  1GHI A;  3VOZ A;  2VEA A;  4EWF A;  1YQS A;  3IT9 A;  1XPB A;  4BWI A;  4HHD A;  3CPT B;  2WKP A;  3EQV A;  5E2H A;  3FG8 A;  2C6W B;  3C38 A;  3CLO A;  2OAP 1;  3PAG A;  3MXS A;  2OV5 A;  5J8X A;  1VM1 A;  2K2N A;  1PI4 A;  5U47 A;  2PD7 A;  3G34 A;  2W1T A;  4FH4 A;  4ZRR A;  4JGR A;  1IEM A;  3RFB A;  1E25 A;  1NLZ A;  3W8K A;  1ES5 A;  2VGK A;  3P98 A;  3LYX A;  3LCE A;  2Z6D A;  1ERO A;  1P0Z A;  3T1R A;  1PIO A;  1VET A;  5TBM A;  5F68 A;  3K3C A;  4EBL A;  1YLP A;  3HCY A;  4HNB A;  2A49 A;  4BD1 A;  4HES A;  3C4O A;  1E4D A;  4ARZ B;  2KOI A;  2PAV P;  4WZ5 A;  4YNR A;  3G30 A;  2CC1 A;  1GHM A;  3C8C A;  3W2Z A;  1T19 A;  4WM9 A;  2HDR A;  1RP5 A;  4Y3I A;  3ZCZ A;  4Y5F A;  1TEM A;  5FQQ A;  4R0Q A;  2QPN A;  5IHV A;  3NIA A;  4QB8 A;  3PYP A;  2O9C A;  5GHY A;  4MDZ A;  3A3J A;  3Q7Z A;  4S2O A;  2ZQ9 A;  2QHK A;  3GDI A;  2Z6C A;  2BAS A;  2ZLY A;  1MWT A;  1Z09 A;  3UNW A;  4OQG A;  3ZG7 B;  4B9O A;  1K55 A;  3T12 B;  3E2K A;  1NYM A;  5CHM A;  2P08 A;  2XA7 M;  2OOL A;  1NXY A;  2WKH A;  3PBQ A;  4S2K A;  5CGX A;  3BQ8 A;  2HJ9 C;  2UWX A;  4X56 A;  2B02 A;  1ONH A;  2EXB A;  5HW3 A;  3NOT C;  1IYP A;  2ACG A;  3JYI A;  1N9O A;  1W7F A;  1CI9 A;  4WBG A;  3DWK A;  1PRQ A;  1KGE A;  3OCL A;  4S2J A;  1PFL A;  2J80 A;  4OPQ A;  4KEN B;  1E3U A;  4Y0O A;  1VEU B;  1MPL A;  1AWI A;  4UA7 A;  4FTX A;  4D2O A;  5A90 A;  4Z1W A;  1TD5 A;  5FQ9 A;  4GDN A;  1XXM A;  3K3D A;  1MWU A;  3LID A;  4IVK A;  4LRY C;  1U60 A;  3HBR A;  4PMA A;  4CLC A;  1WYB A;  3WS2 A;  3Q7V A;  4R23 A;  1CF0 A;  3FKV A;  3PHY A;  2ZMA A;  1S67 L;  4HJ3 A;  3MQQ A;  1TS6 A;  2WKI A;  5EOE A;  4X69 A;  1IYO A;  1Y54 A;  3OZH A;  1OJG A;  2QJ5 A;  5J3W A;  1K6R A;  3KO6 A;  1DP8 A;  2WGI A;  4EES A;  5J7E A;  4HP9 A;  3CZD A;  2DMW A;  3K2N A;  1ACF A;  4MBK A;  3BFF A;  5G4Z A;  3C4P A;  3D72 A;  4MLL A;  1J3W A;  1K54 C;  1VET B;  5TBM B;  3BQA A;  3KYZ A;  3CJM A;  4P87 A;  3NI9 A;  1O07 A;  1CQA A;  5HZH A;  2ZL1 A;  5HWW A;  4I3I A;  4ESP A;  3ICY A;  4EUV A;  4E3L A;  3IHB A;  1W5D A;  2V8F A;  1PW1 A;  4I5S A;  2ZQC A;  3WRZ A;  4WEJ A;  1W63 Q;  1X0O A;  2ZM0 A;  5C5K A;  3EWK A;  2FFF B;  3CIT A;  3KYE A;  1FIL A;  4I3A A;  3UN7 A;  1T1B A;  3TW8 A;  1LL8 A;  4IVI A;  5DTK A;  3ZQ5 A;  1NYY A;  4LCL A;  3W4Q A;  3CUE A;  2G2U A;  3DW0 A;  3B33 A;  3F1O A;  4M4X A;  2XQZ A;  2KLI A;  3WS1 A;  4K08 A;  3EGD C;  2GNX A;  4Q0I A;  1S1Y A;  3HJI A;  2DRW A;  2J9O A;  2O9B A;  4O01 A;  1OTE A;  4BQM A;  3G31 A;  3MKF A;  1PW8 A;  3IF6 A;  3E2L A;  1HLU P;  4QWO A;  5FAQ A;  3LY3 A;  5DJU A;  2VA0 A;  1AXB A;  2BG1 A;  2B18 A;  1DY6 A;  4Q8I A;  4GD6 A;  5AVE A;  1YT4 A;  2K31 A;  2A24 A;  3DAV A;  3BRM A;  1FQG A;  2EWV A;  4N9L A;  1TS7 A;  4R6L A;  4U0T A;  2GJ3 A;  4Q0H A;  4WLA A;  3G2Y A;  2HDQ A;  4FUW A;  3T4K A;  3MFD A;  4FH2 A;  5CHU A;  3H7W A;  3QP8 A;  1VB6 A;  3UDI A;  3N8S A;  1BLH A;  3GEC A;  1NRF A;  4JGQ A;  2J9P A;  2PU2 A;  2ZBB A;  4BJP A;  1FOF A;  1PNE A;  3L7H A;  3LIA A;  3VSK A;  3MZF A;  5FAT A;  2QWS A;  5EUA A;  3SZT A;  1OTB A;  4BLM A;  1W8Q A;  4KG2 A;  5EVI D;  4BBU A;  4K91 A;  4CLC B;  1ERQ A;  5HD5 A;  1W8Y A;  4I39 A;  2HZ5 A;  3Q7V B;  2VGL S;  4MNR A;  1LSW A;  2JHE A;  2HJE A;  5E43 A;  1JNU A;  3B3X A;  3BW6 A;  1Y4O A;  2X71 A;  5M1A A;  3T4J A;  3CPT A;  3LY4 A;  3QP6 A;  1W63 M;  2B5R A;  3HLF A;  4XUX A;  2Q0O A;  4JGO A;  2Y2M A;  3QP2 A;  4RVA A;  1K56 D;  4GZB A;  2EWW A;  3G32 A;  5KZH A;  4R70 A;  5EVE A;  2HPB A;  2OWJ A;  1PI5 A;  1P9W A;  4OON A;  1JWP A;  2QJ7 A;  5D3O A;  1G6A A;  2HP9 A;  3E98 A;  3LO7 A;  1DRM A;  2WAD A;  5IS1 A;  2ZL1 B;  1WA9 A;  4LV1 A;  3M2J A;  4KQQ A;  4HBU A;  3IS2 A;  4FCF A;  4G3W A;  3UB5 P;  4ARZ A;  2ZC5 B;  4IBX A;  3M2K A;  1JVJ A;  1KGF A;  3OPL A;  1YM1 A;  2W3G A;  1T1C A;  2WYX A;  3PBN A;  5TFQ A;  3LFV A;  1W79 A;  5FDS A;  1GSW A;  3T4T A;  3Q07 A;  4JBF A;  2BTF P;  1S66 L;  1OTD A;  3A3I A;  3F1O B;  1LI9 A;  5GLA A;  4S2N C;  4FD8 A;  2VJW A;  4UQI S;  1LSV A;  4NXE A;  4H8R A;  3ZG5 A;  4PM9 A;  5E2E A;  3V3S A;  1JTG A;  3S7N A;  2ZQ7 A;  5DF8 A;  1DP9 A;  4X68 A;  5EV0 A;  3AGF A;  3N8L A;  1KE4 A;  4NG2 A;  1L2S A;  4HEF A;  2I9V A;  3VP3 A;  3IF6 B;  2WAF A;  5L8M A;  2ZQD A;  5AQA A;  3MXQ A;  5FEG A;  3TOI A;  1BLC A;  5CGW A;  3A0V A;  4DE0 A;  2B95 A;  4BD0 A;  3FWL A;  4E3O A;  5L2F A;  3BYD A;  2A24 B;  5F5Y A;  1FCM A;  1ZHH B;  3WS5 A;  3OLO A;  5FDH A;  1GCE A;  3SH8 A;  5FQK A;  4P6B A;  3V50 A;  3VE4 A;  1F5M A;  3H7W B;  4GCZ A;  2VLG A;  4IUK A;  5EFW A;  3MZD A;  3LR4 A;  1KE0 A;  3IXH A;  4DF6 A;  2FFY A;  3VE3 A;  3IXG A;  5F82 A;  2P9V A;  3W4P A;  4OOM A;  4CLC E;  4Y0T A;  3G6O A;  3H9W A;  3O87 A;  4BBV A;  4OPY A;  3IWI A;  1IFQ A;  3VMA A;  3HLW A;  1YSP A;  4DXC A;  5F83 A;  1TS8 A;  2EX9 A;  3CAX A;  4KQO A;  3O88 A;  1IYQ A;  5F69 A;  4JXS A;  3EGX C;  5AQ7 A;  4WYY A;  2ZC4 B;  4EER A;  1GA9 A;  4GOG A;  2IWD A;  4ZDX A;  2I72 A;  4ZTK A;  1CEF A;  2V0W A;  2QMI A;  1K54 A;  5I94 A;  1SKO A;  5L09 A;  2OSU A;  1LL5 A;  3BFC A;  3NOP C;  1BUE A;  3F1N A;  4QPR A;  3L9K A;  2DNS A;  2Y2K A;  3AGE A;  1J9M A;  5AJG A;  5HL1 A;  5A92 A;  4CJN A;  4CPK A;  5CX7 A;  1K4F A;  1KGG A;  1GA0 A;  1ES3 A;  5DJT A;  1ZTU A;  3LGO A;  2PD8 A;  1BTL A;  1OJ5 A;  1Q2Q A;  2PYR A;  3QNC A;  4HJ4 A;  1O7E A;  4PM7 A;  3PBR A;  5GLC A;  4QY6 A;  4P85 A;  1YLY A;  2VV8 A;  3IS2 B;  1CJF A;  2Q9M A;  1CI8 A;  4LGW A;  2HP5 A;  5HAR A;  3GTC A;  5DFY A;  3KSF A;  4IUH A;  3Q1F A;  3CG5 A;  4S2L A;  3HLD A;  1WE4 A;  1XJ6 A;  3C5A A;  3CI6 A;  4GN2 A;  3IXB A;  2Y4A A;  3MZE A;  3T4O A;  3BFE A;  1YLW A;  3NY4 A;  3G2Z A;  3UME A;  4BL3 A;  3ZDJ A;  1Z6F A;  4L0L A;  1RGZ A;  3DWZ A;  1K6S A;  4ETZ A;  2PHY A;  3TE8 A;  3VP1 A;  5HL6 A;  1LLB A;  3NEC A;  2WKR A;  4UAA A;  5HPF A;  4WUJ A;  3LI9 A;  1EI5 A;  4ZJ1 A;  3ZFZ A;  2Y59 A;  4LV2 A;  2XA7 S;  2K7S A;  3DBA A;  4LRZ E;  4B4Z A;  4LV0 A;  2XRN A;  2JKF A;  1NY0 A;  4IJG A;  1H8M A;  3CMZ A;  5EOO A;  4HI4 A;  1QMF A;  5FAP A;  5BOH A;  2AVX A;  2HDU A;  4U3T A;  4KZ5 A;  1LT0 A;  4PAU A;  2ZD8 A;  2VV6 A;  2V1B A;  5A91 A;  1MC0 A;  3UPP A;  3WWX A;  3SOI A;  2D01 A;  3EOI A;  1IYS A;  3N6I A;  1YLJ A;  2LB5 A;  5HDS A;  4LLO B;  2HGV A;  2P9V B;  3MQO A;  1JTD A;  2Y2N A;  1DJA A;  5I5L A;  1L3L A;  1HD8 A;  2RL3 A;  3P7N A;  1QME A;  3LR5 A;  1RCJ A;  3ZVT A;  1K57 C;  2PT7 A;  3V5M A;  4PHT A;  5HWT A;  4KZ7 A;  3T4Q A;  1MXO A;  2E8I A;  2Q9N A;  2R9W A;  1MKI A;  2NUP C;  2HP6 A;  3NJA A;  4OPR A;  1SKO B;  4DN0 A;  3D4F A;  3SS3 A;  4EBN A;  4L9F A;  4H6J A;  4R38 A;  3F1N B;  4NEE D;  3HL9 A;  4DJ3 A;  4MN7 A;  3B47 A;  5EM0 A;  1Y28 A;  2W27 A;  2IWB A;  2ZJ9 A;  5GLD A;  5HWV A;  5FSR A;  4OLG A;  2M7U A;  3FV7 A;  3B42 A;  2V2F F;  4E6W A;  1M6K A;  2IA2 A;  3UE1 A;  1I2W A;  4QHC A;  3DTK A;  4KZ6 A;  2H5S A;  1T18 A;  2GZA A;  3A0R A;  4BL2 A;  1SHV A;  3UY6 A;  4S2N A;  4Z9Q A;  3O86 A;  1HTZ A;  4NET A;  4EQ1 A;  3SW1 A;  3S4X A;  3HUM A;  1IOU A;  5IT5 A;  3HVF A;  2ZMV A;  4QU3 A;  2INW A;  3UE3 A;  3TG9 A;  5HD3 A;  3GV9 A;  3GRJ A;  5DTS A;  4NXB A;  4M3K A;  2HF6 A;  2XR0 A;  1PWD A;  1PYY A;  3FPV A;  3SS4 A;  4X55 A;  1GSX A;  1WYC A;  2JKR I;  3EEA A;  3PBT A;  4Y0U A;  3ULF A;  1NZU A;  3SS5 A;  1D06 A;  1ZG4 A;  4OH0 A;  4DE1 A;  1UWP X;  1D1J A;  3LIB A;  4WZ4 A;  5FAS A;  1XJ2 A;  2JC7 A;  2H28 A;  2WZZ A;  1C3B A;  3UDF A;  1LL9 A;  4HOI A;  2ZM2 A;  1OT6 A;  2LB9 A;  4P6Z S;  3UMD A;  2HDS A;  1H8Y A;  3VFF A;  1YAX A;  1PWC A;  3BWL A;  3BY8 A;  2J3W A;  4RA7 A;  1FIK A;  3UPO A;  1N9L A;  3ZG9 B;  1S0W A;  3LIE A;  1FSW A;  1K4E A;  4KG5 A;  1FCO A;  4KZA A;  3S7Q A;  3MQ0 A;  2XF3 A;  3LI8 A;  1ESU A;  1K25 A;  1F9I A;  1XGI A;  5GL9 A;  2JN7 A;  3S22 A;  4S2M A;  1Q2P A;  4MBH A;  2JKT I;  4GS9 A;  4WL9 A;  3ITB A;  5HDC A;  3PBO A;  4YOF A;  3ITA A;  2XFS A;  2W3F A;  1S1Z A;  3VSL A;  2VKS A;  2J3T D;  1KDS A;  2JBF A;  4ZAM A;  3BLM A;  2X01 A;  1MKM A;  4RX3 A;  1BUL A;  3PTE A;  3IX4 A;  1YMX A;  2PR5 A;  4RYE A;  5FQI A;  2YKF A;  3C7U A;  4H6J B;  3QP4 A;  3A3F A;  3GMW A;  2JE5 A;  1FSY A;  4A5R A;  4PM8 A;  5CTM A;  1LSX A;  3UB9 A;  3EQU A;  4ZJ3 A;  4UEY A;  3SH9 A;  2VGJ A;  4X1L A;  3DTI A;  4DJ2 A;  4KG6 A;  2A2L A;  4N1H A;  4K0X A;  1NJ4 A;  2FH5 A;  4R4S A;  2ZOH A;  1EW0 A;  4C6Y A;  5HAP A;  4GJ4 A;  4N92 A;  1HVB A;  3IBR A;  2V0U A;  3MBZ A;  4BMW A;  3IWO A;  5JYP A;  2PBY A;  5FEF A;  4G3V A;  5TR7 A;  2XD5 A;  3QNB A;  4HIA A;  1ZG6 A;  3LUQ A;  4BEN A;  2XFT A;  4R4R A;  1RGY A;  1L0D A;  3BEB A;  5FI2 A;  5M19 A;  1G28 A;  1G6O A;  1BZA A;  4XUZ A;  4WN5 A;  3ZVW A;  5CTN A;  4OLD A;  5TJJ A;  4PM5 A;  5GLB A;  2QKP A;  5DF9 A;  3ZYT A;  1YMS A;  4L9G A;  3VOY A;  3QP5 A;  4UQI M;  5M18 A;  4YFM A;  4E3K A;  2VZW A;  2ZC3 B;  5FI7 A;  4EXO A;  4Y17 A;  3IH8 A;  3VP4 A;  1S4R A;  4EW7 A;  4OQH A;  2GDN A;  4C3Q A;  2EFU A;  3H82 A;  3JVV A;  1FCN A;  5E2G A;  4YWZ A;  1ZKJ A;  3UPN A;  3ISG A;  3F1P A;  4X25 A;  2WUQ A;  2XEP A;  4D60 A;  4OVD A;  3IXD A;  2Y2L A;  4MN6 A;  1DP6 A;  1PWG A;  4HQA A;  5KSH A;  3NCK A;  1I5Q A;  4R3A A;  4DRT A;  1K57 A;  2IWC A;  4KQR A;  2OLV A;  4EEP A;  3OPP A;  5DTT A;  4GW9 A;  1E3U D;  5DFX A;  1YKD A;  5E2F A;  1ES4 A;  4GB7 A;  4EET B;  4KZ3 A;  5K5B A;  1NLY A;  4NXF A;  4IHQ A;  5EVL A;  4GS9 B;  1H5X A;  4NXG A;  2R78 A;  2CMN A;  3N8R A;  4ZJ2 A;  4CLC D;  5FQM A;  4GHI A;  2R9X A;  3A3E A;  3QHY A;  3SH7 A;  3NBL A;  4ID4 A;  3LR0 A;  3FKW A;  4LV3 A;  5F6A A;  3CWF A;  3OCN A;  3NDE A;  1ODV A;  2L4R A;  3N7W A;  3AGD A;  3EEH A;  3C2W A;  1ONG A;  4G3K A;  2XLN A;  1L0G A;  3WRT A;  3S7P A;  3ZNT A;  1IKG A;  4QY5 A;  1JWV A;  2L0W A;  4P0M A;  4HH3 A;  2JKR M;  1FR6 A;  1K56 A;  4X6T A;  4DE2 A;  3RJU A;  3PAE A;  4PKY G;  4LPZ A;  1H3Q A;  4EBP A;  3RTY A;  2ZMF A;  3KSI A;  3T4L A;  3I7J A;  1N4O A;  1P9R A;  5AVF A;  5L07 A;  3R7W B;  3RXW A;  2PBD P;  3LIC A;  1SKF A;  2KDK A;  4O7D A;  2E8J A;  2OWH A;  5DVA A;  4B93 A;  5CED A;  1XX2 A;  3GQZ A;  1G68 A;  4OKP A;  3LEZ A;  5A93 A;  2Y2Q A;  5L10 A;  4LRX C;  3NOU C;  4KUK A;  4UHU A;  2J7V A;  2WZX A;  5HAI A;  3UE6 A;  5CEC A;  2V9A A;  5FAO A;  4HH2 A;  4Y2F A;  2PU4 A;  2DCF A;  3IX3 A;  1BT5 A;  1YLT A;  4KZB A;  5GHX A;  4E3J A;  1M40 A;  2H10 A;  3KSH A;  1GSV A;  1TS0 A;  1STZ A;  2HV1 A;  2KX6 A;  2EX8 A;  2PYP A;  3TSG A;  5F1F A;  2JKT M;  3UB7 A;  4E3M A;  1OTA A;  2P74 A;  1OTI A;  1MY8 A;  2Y2O A;  4EV4 A;  4LEN A;  1YLZ A;  3H82 B;  4HP4 A;  5DF7 A;  3RXX A;  1XGJ A;  3C7V A;  2P04 A;  3MKE A;  3U4L P;  2O99 A;  3NHQ A;  4KUO A;  4EUZ A;  3F1P B;  2WKE A;  1BLS A;  3D9Y A;  4Y13 A;  3GVB A;  3O3V A;  2EX6 A;  4ME4 A;  5TGF A;  3UB6 A;  2OLU A;  1SDN A;  1PZP A;  4F94 A;  3OC2 A;  2QZ6 A;  1ES2 A;  2WK0 A;  1DJC A;  4Q0J A;  2EFX A;  3WS0 A;  5KIZ A;  1PZO A;  4B88 A;  3UO9 A;  2M1C A;  2Y2P A;  2WGW B;  4WMC A;  1JWZ A;  1KVL A;  1KE3 A;  4EEU A;  3FPW A;  4I38 A;  4DDS A;  3HLC A;  4ETX A;  4UA9 A;  1N9N A;  2PDR A;  5EM1 A;  1MZU A;  5KMW A;  2UV0 E;  4JF6 A;  5CHJ A;  4GHI B;  2XK1 A;  2ZC7 A;  3JVU A;  5EVI B;  4F3L B;  1OPX A;  1SZV A;  3BJN A;  2J8Y A;  2Y2I A;  1LHY A;  2Y8H A;  2XDM A;  1XKZ A;  5KSC A;  4X53 A;  4N9K A;  1VQQ A;  1XFQ A;  3UB8 A;  1L0E A;  1F2K A;  2Y79 A;  4PM6 A;  3Q82 A;  5F1G A;  5EVI C;  4MEZ A;  5MC7 A;  2V1A A;  2XSS A;  4BBT A;  5CEB A;  5AQB A;  1DJB A;  5HX9 A;  3ZG8 B;  4MMN A;  3VFH A;  4OQ0 A;  2J3T C;  3S1Y A;  1G5U A;  5HDD A;  2A3U A;  4S2P A;  1D7E A;  4RX2 A;  3T1Q B;  4KZ9 A;  2O0Y A;  5CXW A;  4AFI A;  5DKL A;  1ESI A;  1H8Z A;  2W1T B;  3KYQ A;  5EEC A; 
#chains in the Genus database with same CATH homology
 1CJF A;  3LEQ A;  2VK3 A;  4X1M A;  1HLU P;  4QWO A;  5EVE A;  1YPR A;  3D9Y A;  2JKG A;  3MS6 A;  2ZL1 B;  3DAV A;  1Z09 A;  3T12 B;  1ACF A;  3UB5 P;  1K0K A;  1D1J A;  4X25 A;  4FUW A;  1J3W A;  4X1L A;  3CPT B;  4D60 A;  1VET B;  3T1X A;  3CHW P;  2PBD P;  1SKO B;  3NUL A;  2E8J A;  5FDS A;  1CQA A;  5EM1 A;  1PNE A;  2ZL1 A;  3L7H A;  2ACG A;  5EM0 A;  3NEC A;  4ESP A;  2BTF P;  1SZV A;  2V8F A;  3T1R A;  1VET A;  1FIK A;  1A0K A;  1PRQ A;  2JKF A;  1SKO A;  1PFL A;  5EV0 A;  2HZ5 A;  5FEF A;  1F2K A;  3KYE A;  1FIL A;  1VEU B;  1AWI A;  3L9K A;  4FTX A;  2PAV P;  3MSH A;  1Y4O A;  2V8C A;  3T1S A;  5FEG A;  3CPT A;  3LGO A;  1G5U A;  2B95 A;  3T1Q B;  1CF0 A;  1VEU A;  3U4L P;  2PRF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...