1G5UA

Latex profilin hevb8
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
130
structure length
130
Chain Sequence
SWQTYVDDHLMCDIDGHRLTAAAIIGHDGSVWAQSSSFPQFKSDEVAAVMKDFDEPGSLAPTGLHLGGTKYMVIQGEPGAVIRGKKGSGGITVKRTGQALIIGIYDEPLTPGQCNMIVERLGDYLLDQGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PROFILIN
publication title A Comparative Structural Analysis of Allergen Profilins HEVB8 and BETV2
rcsb
source organism Hevea brasiliensis
molecule tags Allergen
total genus 28
structure length 130
sequence length 130
chains with identical sequence B
ec nomenclature
pdb deposition date 2000-11-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00235 Profilin Profilin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.30 Alpha Beta 2-Layer Sandwich Beta-Lactamase Dynein light chain 2a, cytoplasmic 1g5uA00
3L7HA 3NULA 3NECA 1CF0A 1VETB 4X1MA 3T1XA 3MS6A 2ZL1A 1SKOA 2JKFA 5EM1A 1K0KA 2HZ5A 1VEUB 1A0KA 1PFLA 3MSHA 1HLUP 1FIKA 4FUWA 5EV0A 1CQAA 2PRFA 3LGOA 1PRQA 4FTXA 3T1SA 5EVEA 3U4LP 5FEGA 3D9YA 3T1RA 4QWOA 2ZL1B 4X25A 1SKOB 2V8CA 4ESPA 2VK3A 2JKGA 4X1LA 3KYEA 1Z09A 1SZVA 3CHWP 1F2KA 5EM0A 5FDSA 3CPTA 2ACGA 3L9KA 1D1JA 1AWIA 4D60A 1Y4OA 3CPTB 1YPRA 2PAVP 1CJFA 2B95A 3LEQA 3T1QB 1VEUA 2BTFP 2V8FA 1FILA 2E8JA 1J3WA 1G5UA 2PBDP 3T12B 3UB5P 5FEFA 1PNEA 1ACFA 1VETA 3DAVA
chains in the Genus database with same CATH superfamily
1K55A 2PU4A 3L7HA 4QY6A 2XEPA 1JTGA 3IF6A 2ZOIA 1VETB 4PM8A 1JTDA 1IELA 2JKRM 4DN0A 3P98A 2XH9A 4Q0IA 1RCJA 5HAPA 1LT0A 1NZOA 5TFQA 5DF8A 2Y2MA 3LR4A 2ZBBA 3FZCA 1XJ2A 1FIKA 3NDGA 2HDRA 2M7UA 1H8MA 1TDGA 2PR5A 4LCMA 4GW9A 4L9GA 1T18A 1ONHA 3V5MA 4WYYA 4EBPA 2WAFA 2P7JA 4CLCC 1PWDA 3D9YA 2XSSA 3CMZA 4KQOA 2QHKA 1CEGA 5DF7A 2FFFB 4WZ5C 4MDZA 3R7WA 5HSQA 3WWXA 4N1HA 4KZAA 3WS0A 4EETB 2X02A 3S22A 4F3LB 3T4LA 3ZNYA 1F2KA 1MWUA 1OPXA 1L0DA 3LO7A 2EX2A 2HF6A 3LR5A 1GA0A 4E3KA 2J3TC 1DP9A 4JF6A 3IHBA 3Q82A 3S1YA 1LLBA 3EGXC 1X0OA 2B95A 2W3EA 4H6JB 3ZG9B 2Y4AA 4Y2FA 3NC8A 3UDXA 1XFNA 5HD3A 4H8RA 2V1AA 3PXPA 4DE2A 4KZBA 3T12B 4BD1A 3RJUA 1G6AA 3T4JA 1PZPA 1N9BA 4E3IA 2XA7S 3BY9A 2Y2HA 4IJGA 3KYZA 4HP4A 1YQSA 2ZL1A 4LV3A 5EM1A 2WKIA 3P7NA 2BG1A 4EWFA 2K31A 3ZDJA 3MKFA 1K6SA 1BLCA 3F1OA 2HPBA 3T4TA 2Y2PA 2VV6A 4HY8A 4LV0A 5KSHA 2PR6A 2DMWA 4GOGA 2AVXA 3A0RA 3EWKA 2WKHA 1BTLA 4QU3A 2A3UA 4DDSA 3N8SA 1CEFA 4RVAA 2VGJA 2HJ9C 3C4OA 4WBGA 1IYPA 2Z2LB 3FWLA 5FQKA 2QJ7A 4KQDA 2ZM8A 2ACGA 1GHMA 1AWIA 3QP2A 5CTMA 4FOFA 2OLVA 3T1QB 3GV9A 4WF0A 1SDNA 2IA2A 3OPLA 3NOTC 2EXAA 2YKFA 3ISGA 2GNXA 5KIZA 4ME4A 3HLDA 3IBRA 2XDMA 1NZUA 1VETA 5EOOA 2XD1A 2ZMFA 2ZC5B 4BJPA 4HHDA 3GQZA 3JYIA 1PWGA 4K0WA 4Y15A 5HL6A 1YMSA 1NLZA 3DWKA 3NBLA 2XK1A 4KQRA 4B4ZA 5J7EA 4KUOA 1S4SA 1XA1A 4DRTA 4E3OA 5EV0A 2EFXA 2A24A 2W3DA 1W63Q 1L0EA 5L09A 1OJ5A 4BBTA 3U4LP 4DJ3A 3RXWA 1K54A 2PU2A 3N8LA 1UWNX 4OQ0A 3A3FA 4PM9A 3TSGA 3UE1A 2YKHA 4F3LA 3F1NB 2V2FF 2X71A 1MWTA 3BJNA 5EVIA 1H5XA 3CHWP 3NY4A 1S6RA 2GZAA 3VP3A 3PAEA 5CECA 4N1XA 2WUQA 3JVUA 4KZ4A 5IS1A 1OTIA 4X56A 3UB7A 1IKIA 4H6JA 2WKRA 3MF0A 4EUZA 3QP8A 5CHUA 2O99A 1VEUA 4GKUA 5A93A 5AQBA 3GVBA 5GLDA 2Q9NA 3UPOA 4JGPA 1VB6A 5I5LA 3ICYA 2Y2QA 5CGWA 3ZVTA 3JVVA 3PBSA 3MXRA 3ZG8B 4LRYC 4IHQA 5IHVA 3K3CA 4GDNA 4R6LA 2XRNA 3TJZC 5DTSA 1PFLA 5FAOA 4OQGA 1HLUP 2EX9A 1M40A 1IKGA 2ZJ9A 1FSWA 4MNRA 3HCYA 4B93A 3IF5A 2ZOHA 4ID4A 4UEYA 3ZNTA 1ES2A 1OTDA 4GHIB 5J4EA 3ZQ5A 4S2IA 4DE1A 4NXEA 4EEPA 5AQ7A 3UB9A 2C6WB 5FDHA 3IT9A 1F98A 1TS6A 3BQ8A 1PW1A 3HLGA 1Y28A 4XT2A 2IWCA 1FSYA 4BD0A 3G6OA 4PM7A 3D4FA 3UMEA 4EBNA 3IF6C 1JWZA 4L9FA 3H7WA 1N4OA 3E98A 5GLAA 2ZD8A 3QHYA 3OCNA 3PBOA 1DP8A 2JBFA 3AGDA 5HAIA 1GA9A 3NDEA 4KQQA 3R7WB 2XFTA 4OH0A 5L07A 2EWWA 4Q8IA 2QYBA 2OWHA 4O0PA 1ODVA 3SS4A 5FQMA 2O9BA 3BYDA 1I5QA 2IWDA 2JKTI 2JN7A 3NJAA 3ZG0A 1I2WA 4OPRA 3QP5A 4LCLA 3T1XA 4WL9A 4NG2A 1WYBA 1SKOA 2JKFA 3O5YA 3CZDA 4ZJ1A 1ZTUA 3GECA 1ES3A 4N92A 1D06A 5AVEA 3VE3A 3LUQA 4X53A 4RA7A 3WS2A 3P01A 3T4OA 2Q0OA 2D01A 3EEHA 2VV7A 1BUEA 3WRTA 4WLAA 2ZC7A 5GLCA 1K25A 3W4OA 4CQHA 3T1RA 2ZC6B 4R3BA 2ZL1B 4R4SA 3MXSA 2WGVA 4JPMA 3UPNA 3O87A 4I5SA 2VV8A 1KE4A 4HJ6A 5G4YA 4HIAA 4LV2A 1SDEA 2PD8A 3C4PA 3LICA 5J3WA 3IXHA 3VV4A 5GL9A 1YMXA 4WMCA 2OLUA 3WS5A 4CPKA 4JLFA 4ZJ2A 3ZYTA 5DJTA 3LR3A 3BLSA 5EVID 1NJ4A 1FCNA 3GTCA 2Y2GA 4R38A 1GSXA 3PBNA 3EOIA 3UE3A 2UV0E 4RYEA 2OOLA 3B33A 2VGLM 5GHXA 4NETA 4NEED 1BYWA 2K2NA 4MBHA 4S2PA 3SH9A 2PHYA 3SH7A 2WYXA 3NULA 1KVLA 4WN5A 4JBFA 1LSXA 3BW6A 4S2JA 3B42A 2Y79A 5I94A 1LI0A 4CJNA 2HDSA 1PIOA 3SS5A 4DDYA 4PM5A 4LRXC 3S7QA 4UA6A 1E25A 1PZOA 1MY8A 1S1ZA 1PI5A 3V67A 1FCMA 4GCZA 4GD6A 4MLLA 4GHIA 1IYSA 4UHUA 4ARZA 1KGEA 2FH5A 4UQIM 4I3AA 2ZQ8A 1PWCA 4OPQA 2WKEA 2W3GA 2O9CA 1DY6A 2VKSA 2ZMVA 2NUTC 3KYEA 1F5MA 3LCEA 3MQ0A 5F69A 3AGEA 4BENA 5CTNA 5TR7A 2A24B 3LIBA 2IWBA 3UN7A 1NY0A 3Q7ZA 4Q0JA 1BLPA 2XR0A 3U2AA 2LB9A 2M1CA 3KSGA 3KX0X 1KE3A 4OOYA 5E2GA 2WKQA 1VQQA 3KYQA 3HBRA 5DTKA 2LB5A 3UMDA 1NWZA 3VOYA 1EWZA 1MXOA 3GRJA 1W8QA 5EVIB 5E2EA 2V0WA 1K38A 2KX6A 1K57A 3FPWA 4XUXA 3G35A 5A91A 4PPRA 3RFBA 5E2FA 3DAVA 4E04A 4O7DA 3DBAA 4ZRRA 4EQIA 4EU0A 4Y3IA 4HH2A 3G31A 4O8GA 2W1RA 4MBKA 1RGYA 1CF0A 5FI2A 1S67L 3V3RA 3E2LA 3MS6A 4OQIA 4X6TA 3CG5A 1XA7A 3TOIA 5LBRA 3UO9A 5E43A 1P9WA 1VEUB 2HZ5A 3CITA 2J80A 5F68A 3LIDA 4EEUA 3IXGA 1CQAA 4F94A 3DTMA 3PBRA 4YNRA 2JE5A 4DMZA 3VSKA 4GNUA 5U47A 4MBFA 3A0VA 4YOFA 4PKYA 4QWOA 3MQOA 5A92A 5EVLA 3K3DA 3O3VA 5HWWA 3D72A 4C6YA 4X55A 4S2NA 3T4QA 2QMIA 3FKVA 3TG9A 2VJWA 3UDIA 1Z09A 1ONGA 2Y2LA 3SOIA 1YLTA 4ZTKA 4Y7PA 4GD8A 3BFDA 4KENB 3QP1A 4B4XA 4EQ1A 2ZM0A 3UB8A 3ITBA 1T19A 4EV4A 3FV7A 3S7OA 5F1FA 2PAVP 2VGKA 3NCKA 3O86A 3CJMA 4WMCD 3Q81A 2EFUA 3PBTA 4P87A 3ZCZA 2V8FA 3BM6A 1IEMA 3D3OA 1OTBA 4XT2B 1PNEA 1YLJA 1S1YA 1XP4A 1CI8A 2V0UA 2EXBA 3HLBA 3OLOA 3N8RA 3H7WB 1ALQA 3ZG7B 4M3KA 3QNBA 4LPZA 2I9VA 4N9KA 4BLMA 5HD5A 3FC7A 2ZQCA 1K0KA 5EECA 3C5AA 4B88A 3G2YA 3UY6A 5FI7A 4R3JA 1ZHHB 3OC2A 4Y0UA 4E3NA 2RL3A 4KG2A 4D2OA 3HUNA 4FTXA 1XGJA 4BBUA 3VFHA 3UNWA 4HEFA 4WZ4A 1Z6FA 3PHYA 3HL9A 4P6ZM 3QNCA 2PDRA 4GS9A 4CLCA 1SKOB 4JGRA 1XPBA 3DW0A 4NXFA 3BWLA 5FQJA 5M19A 4WZ5A 3QP4A 5TGFA 1N9NA 1OTEA 2B02A 5FDSA 4FH2A 4GN2A 1P0ZA 3FYZA 4GJ4A 4K91A 2DRWA 1MC0A 2K7SA 2XD5A 4KUKA 5AQ9A 1L0FA 5IU1A 1CJFA 1PW8A 3SS3A 4EBLA 4EESA 4DJ2A 1SKFA 1H8ZA 4FH4A 2Y2JA 4KG6A 3M6BA 2EX8A 3MZEA 3OBFA 3RH8B 4N9LA 3IH8A 3WS4A 1WE4A 1QMFA 1LL8A 3M2KA 1SHVA 1QMEA 4II7A 3VMAA 4X1MA 3NIAA 3RTYA 5HWVA 4RQ9A 1WYCA 5FSRA 2P9VA 4EXOA 4YWZA 3HJKA 1A0KA 1S66L 4I3IA 2VZWA 3EQVA 2XF3A 3LI9A 5CRFA 5D3OA 1TS7A 1XX2A 2G2WA 2HDQA 4GB7A 2R9WA 4JXWA 4MN6A 3TRCA 2JKRI 2L1MA 4LLOB 1N9LA 3IX8A 1YLZA 5CHMA 4EW7A 3OOVA 3A3JA 4IVKA 1VHMA 4NKPA 2J9PA 3KSFA 1K4FA 5DFYA 2UWXA 3PYPA 4ZDXA 4RX2A 1FQGA 4Y0TA 4BWIA 1O7EA 2HDUA 4WELA 3W4QA 2Y91A 3NHQA 3BFEA 4ARZB 1NXYA 4OONA 1NYMA 4BQMA 3VFFA 1TS8A 5HZHA 4P6BA 2XGNA 2ZLYA 4PMAA 5EFWA 4Y0OA 4FCFA 5FQ9A 3DTIA 3JPUA 4IUKA 4JGOA 2VGLS 3LI8A 2QZ6A 1YKDA 2WZZA 2QJ5A 1K55C 4I39A 1L2SA 5FEFA 1GHIA 4EERA 3C30A 5M18A 3N6IA 5IT5A 2P04A 3MBZA 1IOUA 2C5WB 4HJ3A 1KE0A 4U0TA 4OVDA 4E3LA 4I38A 3G4PA 4OQHA 3P09A 3E0YA 3B47A 3H9WA 4QD4A 5CX7A 3M6HA 2HJEA 3K2NA 3LGOA 5MC7A 2Y55A 1MBLA 4KZ6A 4P85A 3EQUA 2HP5A 4UQIS 3A0SA 1K4EA 1WA9A 3UE6A 4PAUA 3C2WA 1EI5A 4DKIA 5GHYA 2ZC4B 4MN5A 4MN7A 4JXSA 1EW0A 2B18A 4X1LA 3SW1A 3LY4A 3FKWA 3R4KA 2FZ0A 3BFFA 4CLCD 5EPHA 2INWA 4B9OA 2WKPA 5FI6A 1D1JA 5CHJA 3GSGA 3RXXA 3IBJA 1G68A 2I72A 2Z2MB 4JGQA 4UA7A 1M6KA 2W1TA 2QKPA 2WGWA 3BRMA 5FAQA 3LYXA 2PBDP 1YSPA 4QY5A 3BECA 3QP6A 3A3DA 3G32A 2VX8A 3A3EA 4FSFA 4BBVA 4X69A 3EGDC 1NYYA 3LEZA 3DTKA 4ETXA 4E6XA 3VSLA 4DXBA 2G7UA 1HTZA 5DF9A 1KGGA 4K08A 1Q2PA 2EA9A 1N9OA 4JKTA 1XJ6A 3DWZA 2A2LA 2PRFA 1PRQA 1TVFA 3MXQA 3IX4A 5FEGA 1J9MA 2WK0A 3HLEA 1UWPX 3F1PB 1T1AA 1LL5A 4S2OA 1BSGA 5HPIA 4RX3A 2H0YA 1DRMA 2JHEA 5G4ZA 4ESPA 3G2ZA 4JXVA 2V20A 2MJ6A 2J9OA 1MKMA 3MJQA 1S4RA 3KO6A 4XUZA 4CLCE 3AGFA 3CLOA 4KZ8A 1OT9A 1PI4A 1JVJA 1GHPA 5GLBA 5HWTA 1LI9A 3W8KA 4D60A 1HVBA 3PBQA 3BEBA 3OPRA 4R70A 3VOLA 2P74A 4GS9B 2XROA 4CLCB 4E3JA 1GSWA 3N7WA 1T1CA 1O07A 2OV5A 2PD7A 3IX3A 1G5UA 1H8YA 3BY8A 2H5SA 1FOFA 4A5RA 3A3IA 1W5DA 3BLMA 2PT7A 3HLCA 3HJIA 3MR0A 3MFXA 4OKPA 3PR6A 3IQAA 4WEJA 4ZAMA 3T4KA 3BFGA 5GHZA 3ZGAB 3NOUC 5F83A 3MMHA 4OPYA 4KZ9A 4HH3A 2HGVA 2XLNA 2Y2IA 3GR2A 1K54C 3HUOA 1F9IA 1GCEA 5FAPA 4KZ3A 4LFUA 4R1GA 4YFMA 3G34A 3T50A 1XKZA 4WEKA 5BOHA 4R0QA 1MZUA 2HP6A 4P6ZS 3ZHHA 5E2HA 1XGIA 2P9VB 1E3UA 1ES5A 5EVIC 4QHCA 2H28A 2A49A 3IH9A 3IS2A 5CEBA 2J7VA 2Z6DA 5G18A 2JKGA 1YM1A 4DE3A 4LENA 1HD8A 3OPPA 1JWVA 4HBTA 5CGSA 1OT6A 4L9EA 3CUEA 2J8YA 1TS0A 4WUJA 5FQIA 3B3XA 3L9KA 2CC1A 3Q07A 2QWSA 2V1BA 5L10A 1P9RA 2JKTM 2B5RA 4KZ7A 5CERA 5FASA 4LRZE 5AQAA 4DF6A 2GX5A 1CK3A 5M1AA 1FILA 5KZHA 4MMNA 3LY3A 2XFSA 5F6AA 4BL3A 4C75A 4ZJ3A 2GJ3A 5TJJA 3V50A 5AJGA 4QB8A 4IUHA 1XJ4A 1K6RA 2R9XA 1AXBA 5FQQA 4IEDA 5JYOA 3Q1FA 1SCWA 3HUMA 1VM1A 3ZVWA 4U3TA 2M7VA 1ESUA 5EE8A 2R78A 5HAQA 1ERMA 3Q7VA 3F1PA 1YLYA 2VA0A 4UAAA 3T1SA 3E2KA 4HESA 3GMWA 2G2UA 1ZG4A 1I2SA 5DFXA 2PBYA 2D02A 2BASA 4GDBA 4E3MA 1HZOA 2WAEA 1YAXA 1V9YA 2L4RA 4HJ4A 2OAQ1 3N4IA 1SZVA 5CEDA 2OWJA 3VP0A 1G28A 1TF1A 3C7VA 5HDDA 3NOPC 1LL9A 1NRFA 5KSCA 4PKYG 3CPTB 3WS1A 5TBMB 5F1GA 4K0XA 1IYQA 3UE0A 3I7JA 4Z9QA 1BLHA 2EX6A 3VP2A 1CI9A 3H82B 2VEAA 1NRJA 3UB5P 1YSQA 1TD5A 3IWOA 4IVIA 3UDFA 1T1BA 2ZMAA 2Y8HA 2XA7M 5HW3A 1KDSA 1DP6A 1BT5A 4NK3A 5FA7A 4JF5A 2NUPC 4JXGA 4OOMA 1OJGA 5HL1A 1XXMA 4I3JA 2L0WA 5DTTA 2ZC3B 2XQZA 2W1TB 2WGWB 1Q2QA 3HLFA 4HBUA 2HV1A 1RGZA 3MSHA 1BULA 5HPFA 1PYYA 1H3QA 4BL2A 1ES4A 1S0WA 5F5YA 2OSUA 2PYRA 3HREA 1U60A 1STZA 3W4PA 2E8IA 1D7EA 3V3SA 4X25A 4GLQA 1JWPA 3E4PA 2VK3A 4R23A 2J3WA 3VP1A 3IWIA 3OCLA 3C38A 3TE8A 1W7FA 4KZ5A 1DJAA 1E3UD 2ZQ9A 1K56A 3KSIA 1L0GA 1ZG6A 2DNSA 3NI9A 4OPZA 3ZG5A 1ZKJA 1GSVA 3ULFA 3OZHA 3CI6A 3LIAA 5K5BA 1Y4OA 5DKLA 1OTAA 5HARA 5DKKA 3IXDA 5KMWA 4WM9A 3C7UA 2Y59A 5EOEA 1Y54A 1TEMA 4UA9A 4O01A 4S2MA 1FR6A 2GDNA 2O0YA 3S7NA 1MWSA 1RP5A 2BTFP 4GZBA 4HI4A 4PHTA 4G3KA 2W27A 2E8JA 1E4DA 5HDCA 4OLDA 4M4XA 2WZXA 4FD8A 1ACFA 1IFQA 1W63M 2H0TA 4OOLA 2WADA 4NXGA 3BFCA 3NECA 1P97A 2QPNA 4R4RA 5A90A 1BZAA 2KLIA 5EUAA 2V1ZA 4JF4A 4X68A 3IF6B 2RCXA 1OMEA 1FR1A 5L8MA 5FL3A 1IYOA 4R3AA 1W79A 1MKIA 2P08A 3VE4A 4OLGA 4FUWA 4G3WA 4QJGA 3TW8A 4OP8A 3MZFA 5EVEA 2KOIA 3CAXA 4IBRA 3MQQA 4PM6A 2OAP1 2ZQDA 3BQAA 4Y13A 3HLWA 2Y2KA 3VOZA 1ERQA 1MWRA 1KOUA 3LFVA 2HP9A 3DTEA 4YINA 1DJBA 4S2KA 3LIEA 2PYPA 4OP5A 5EM0A 2VLGA 2Y2NA 3CPTA 2W3FA 3FPVA 2EWVA 3C8CA 2V9AA 5TBMA 3S7PA 1ZC2A 4U0XA 1YPRA 4HP9A 3V39A 1FCOA 1ESIA 1KVMA 1YT4A 3EEAA 3H82A 2DCFA 3PTEA 4HQAA 3IS2B 1K57C 1TDLA 3T4SA 4MEZA 3LR0A 4IBXA 5CGXA 4LGWA 2ZQ7A 2ZQAA 3M2JA 2W3HA 4BMWA 5HFOA 1LSWA 3CWFA 1JNUA 1UGUA 1MPLA 3KSHA 2Q9MA 3E4QA 4Q0HA 1W8YA 4LV1A 4XXRA 2ZM2A 1KGFA 3O88A 3HVFA 2H10A 3F1NA 4MCWA 3WRZA 5C5KA 3IHAA 2J3TD 4G3VA 3SZTA 3MFDA 3IWQA 2KDKA 5CXWA 1C3BA 2JCHA 1XFQA 2W0NA 3CUEC 1G6OA 5L2FA 3OPHA 5F82A 3G30A 4C3QA 3F1OB 4DE0A 3S4XA 3ZFZA 4S2NC 3UB6A 3UPPA 3E4OA 2X01A 4KG5A 1L3LA 1DJCA 4ETZA 4S2LA 5DJUA 3PAGA 4DXCA 2V8CA 5FATA 3VP4A 4ZBEA 4HNBA 1V9ZA 4EUVA 1LSVA 5J8XA 2Z6CA 1KDWA 1YLPA 5HX9A 5JYPA 3GDIA 4Y17A 4HOIA 5DVAA 3W2ZA 4L0LA 4Z1WA 4QPRA 5HDSA 3Q7VB 4Y5FA 3SH8A 3IXBA 2BLSA 2JC7A 2Y2OA 3ITAA 2O9AA 1BLSA 4AFIA 3LIFA 4E6WA 1EROA 1NLYA 2CMNA 2FFYA 1XJ3A 3LEQA 2WGIA 5A8BA 1K56D 1H0MA 1LHYA 3MKEA 1YLWA 4P0MA 1J3WA 3MZDA 4NXBA 5AVFA 3FG8A
chains in the Genus database with same CATH topology
3L7HA 3NULA 3NECA 1CF0A 1VETB 4X1MA 3T1XA 3MS6A 2ZL1A 1SKOA 2JKFA 5EM1A 1K0KA 2HZ5A 1VEUB 1A0KA 1PFLA 3MSHA 1HLUP 1FIKA 4FUWA 5EV0A 1CQAA 2PRFA 3LGOA 1PRQA 4FTXA 3T1SA 5EVEA 3U4LP 5FEGA 3D9YA 3T1RA 4QWOA 2ZL1B 4X25A 1SKOB 2V8CA 4ESPA 2VK3A 2JKGA 4X1LA 3KYEA 1Z09A 1SZVA 3CHWP 1F2KA 5EM0A 5FDSA 3CPTA 2ACGA 3L9KA 1D1JA 1AWIA 4D60A 1Y4OA 3CPTB 1YPRA 2PAVP 1CJFA 2B95A 3LEQA 3T1QB 1VEUA 2BTFP 2V8FA 1FILA 2E8JA 1J3WA 1G5UA 2PBDP 3T12B 3UB5P 5FEFA 1PNEA 1ACFA 1VETA 3DAVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3L7H A;  3NUL A;  3NEC A;  1CF0 A;  1VET B;  4X1M A;  3T1X A;  3MS6 A;  2ZL1 A;  1SKO A;  2JKF A;  5EM1 A;  1K0K A;  2HZ5 A;  1VEU B;  1A0K A;  1PFL A;  3MSH A;  1HLU P;  1FIK A;  4FUW A;  5EV0 A;  1CQA A;  2PRF A;  3LGO A;  1PRQ A;  4FTX A;  3T1S A;  5EVE A;  3U4L P;  5FEG A;  3D9Y A;  3T1R A;  4QWO A;  2ZL1 B;  4X25 A;  1SKO B;  2V8C A;  4ESP A;  2VK3 A;  2JKG A;  4X1L A;  3KYE A;  1Z09 A;  1SZV A;  3CHW P;  1F2K A;  5EM0 A;  5FDS A;  3CPT A;  2ACG A;  3L9K A;  1D1J A;  1AWI A;  4D60 A;  1Y4O A;  3CPT B;  1YPR A;  2PAV P;  1CJF A;  2B95 A;  3LEQ A;  3T1Q B;  1VEU A;  2BTF P;  2V8F A;  1FIL A;  2E8J A;  1J3W A;  1G5U A;  2PBD P;  3T12 B;  3UB5 P;  5FEF A;  1PNE A;  1ACF A;  1VET A;  3DAV A; 
#chains in the Genus database with same CATH topology
 1K55 A;  2PU4 A;  3L7H A;  4QY6 A;  2XEP A;  1JTG A;  3IF6 A;  2ZOI A;  1VET B;  4PM8 A;  1JTD A;  1IEL A;  2JKR M;  4DN0 A;  3P98 A;  2XH9 A;  4Q0I A;  1RCJ A;  5HAP A;  1LT0 A;  1NZO A;  5TFQ A;  5DF8 A;  2Y2M A;  3LR4 A;  2ZBB A;  3FZC A;  1XJ2 A;  1FIK A;  3NDG A;  2HDR A;  2M7U A;  1H8M A;  1TDG A;  2PR5 A;  4LCM A;  4GW9 A;  4L9G A;  1T18 A;  1ONH A;  3V5M A;  4WYY A;  4EBP A;  2WAF A;  2P7J A;  4CLC C;  1PWD A;  3D9Y A;  2XSS A;  3CMZ A;  4KQO A;  2QHK A;  1CEG A;  5DF7 A;  2FFF B;  4WZ5 C;  4MDZ A;  3R7W A;  5HSQ A;  3WWX A;  4N1H A;  4KZA A;  3WS0 A;  4EET B;  2X02 A;  3S22 A;  4F3L B;  3T4L A;  3ZNY A;  1F2K A;  1MWU A;  1OPX A;  1L0D A;  3LO7 A;  2EX2 A;  2HF6 A;  3LR5 A;  1GA0 A;  4E3K A;  2J3T C;  1DP9 A;  4JF6 A;  3IHB A;  3Q82 A;  3S1Y A;  1LLB A;  3EGX C;  1X0O A;  2B95 A;  2W3E A;  4H6J B;  3ZG9 B;  2Y4A A;  4Y2F A;  3NC8 A;  3UDX A;  1XFN A;  5HD3 A;  4H8R A;  2V1A A;  3PXP A;  4DE2 A;  4KZB A;  3T12 B;  4BD1 A;  3RJU A;  1G6A A;  3T4J A;  1PZP A;  1N9B A;  4E3I A;  2XA7 S;  3BY9 A;  2Y2H A;  4IJG A;  3KYZ A;  4HP4 A;  1YQS A;  2ZL1 A;  4LV3 A;  5EM1 A;  2WKI A;  3P7N A;  2BG1 A;  4EWF A;  2K31 A;  3ZDJ A;  3MKF A;  1K6S A;  1BLC A;  3F1O A;  2HPB A;  3T4T A;  2Y2P A;  2VV6 A;  4HY8 A;  4LV0 A;  5KSH A;  2PR6 A;  2DMW A;  4GOG A;  2AVX A;  3A0R A;  3EWK A;  2WKH A;  1BTL A;  4QU3 A;  2A3U A;  4DDS A;  3N8S A;  1CEF A;  4RVA A;  2VGJ A;  2HJ9 C;  3C4O A;  4WBG A;  1IYP A;  2Z2L B;  3FWL A;  5FQK A;  2QJ7 A;  4KQD A;  2ZM8 A;  2ACG A;  1GHM A;  1AWI A;  3QP2 A;  5CTM A;  4FOF A;  2OLV A;  3T1Q B;  3GV9 A;  4WF0 A;  1SDN A;  2IA2 A;  3OPL A;  3NOT C;  2EXA A;  2YKF A;  3ISG A;  2GNX A;  5KIZ A;  4ME4 A;  3HLD A;  3IBR A;  2XDM A;  1NZU A;  1VET A;  5EOO A;  2XD1 A;  2ZMF A;  2ZC5 B;  4BJP A;  4HHD A;  3GQZ A;  3JYI A;  1PWG A;  4K0W A;  4Y15 A;  5HL6 A;  1YMS A;  1NLZ A;  3DWK A;  3NBL A;  2XK1 A;  4KQR A;  4B4Z A;  5J7E A;  4KUO A;  1S4S A;  1XA1 A;  4DRT A;  4E3O A;  5EV0 A;  2EFX A;  2A24 A;  2W3D A;  1W63 Q;  1L0E A;  5L09 A;  1OJ5 A;  4BBT A;  3U4L P;  4DJ3 A;  3RXW A;  1K54 A;  2PU2 A;  3N8L A;  1UWN X;  4OQ0 A;  3A3F A;  4PM9 A;  3TSG A;  3UE1 A;  2YKH A;  4F3L A;  3F1N B;  2V2F F;  2X71 A;  1MWT A;  3BJN A;  5EVI A;  1H5X A;  3CHW P;  3NY4 A;  1S6R A;  2GZA A;  3VP3 A;  3PAE A;  5CEC A;  4N1X A;  2WUQ A;  3JVU A;  4KZ4 A;  5IS1 A;  1OTI A;  4X56 A;  3UB7 A;  1IKI A;  4H6J A;  2WKR A;  3MF0 A;  4EUZ A;  3QP8 A;  5CHU A;  2O99 A;  1VEU A;  4GKU A;  5A93 A;  5AQB A;  3GVB A;  5GLD A;  2Q9N A;  3UPO A;  4JGP A;  1VB6 A;  5I5L A;  3ICY A;  2Y2Q A;  5CGW A;  3ZVT A;  3JVV A;  3PBS A;  3MXR A;  3ZG8 B;  4LRY C;  4IHQ A;  5IHV A;  3K3C A;  4GDN A;  4R6L A;  2XRN A;  3TJZ C;  5DTS A;  1PFL A;  5FAO A;  4OQG A;  1HLU P;  2EX9 A;  1M40 A;  1IKG A;  2ZJ9 A;  1FSW A;  4MNR A;  3HCY A;  4B93 A;  3IF5 A;  2ZOH A;  4ID4 A;  4UEY A;  3ZNT A;  1ES2 A;  1OTD A;  4GHI B;  5J4E A;  3ZQ5 A;  4S2I A;  4DE1 A;  4NXE A;  4EEP A;  5AQ7 A;  3UB9 A;  2C6W B;  5FDH A;  3IT9 A;  1F98 A;  1TS6 A;  3BQ8 A;  1PW1 A;  3HLG A;  1Y28 A;  4XT2 A;  2IWC A;  1FSY A;  4BD0 A;  3G6O A;  4PM7 A;  3D4F A;  3UME A;  4EBN A;  3IF6 C;  1JWZ A;  4L9F A;  3H7W A;  1N4O A;  3E98 A;  5GLA A;  2ZD8 A;  3QHY A;  3OCN A;  3PBO A;  1DP8 A;  2JBF A;  3AGD A;  5HAI A;  1GA9 A;  3NDE A;  4KQQ A;  3R7W B;  2XFT A;  4OH0 A;  5L07 A;  2EWW A;  4Q8I A;  2QYB A;  2OWH A;  4O0P A;  1ODV A;  3SS4 A;  5FQM A;  2O9B A;  3BYD A;  1I5Q A;  2IWD A;  2JKT I;  2JN7 A;  3NJA A;  3ZG0 A;  1I2W A;  4OPR A;  3QP5 A;  4LCL A;  3T1X A;  4WL9 A;  4NG2 A;  1WYB A;  1SKO A;  2JKF A;  3O5Y A;  3CZD A;  4ZJ1 A;  1ZTU A;  3GEC A;  1ES3 A;  4N92 A;  1D06 A;  5AVE A;  3VE3 A;  3LUQ A;  4X53 A;  4RA7 A;  3WS2 A;  3P01 A;  3T4O A;  2Q0O A;  2D01 A;  3EEH A;  2VV7 A;  1BUE A;  3WRT A;  4WLA A;  2ZC7 A;  5GLC A;  1K25 A;  3W4O A;  4CQH A;  3T1R A;  2ZC6 B;  4R3B A;  2ZL1 B;  4R4S A;  3MXS A;  2WGV A;  4JPM A;  3UPN A;  3O87 A;  4I5S A;  2VV8 A;  1KE4 A;  4HJ6 A;  5G4Y A;  4HIA A;  4LV2 A;  1SDE A;  2PD8 A;  3C4P A;  3LIC A;  5J3W A;  3IXH A;  3VV4 A;  5GL9 A;  1YMX A;  4WMC A;  2OLU A;  3WS5 A;  4CPK A;  4JLF A;  4ZJ2 A;  3ZYT A;  5DJT A;  3LR3 A;  3BLS A;  5EVI D;  1NJ4 A;  1FCN A;  3GTC A;  2Y2G A;  4R38 A;  1GSX A;  3PBN A;  3EOI A;  3UE3 A;  2UV0 E;  4RYE A;  2OOL A;  3B33 A;  2VGL M;  5GHX A;  4NET A;  4NEE D;  1BYW A;  2K2N A;  4MBH A;  4S2P A;  3SH9 A;  2PHY A;  3SH7 A;  2WYX A;  3NUL A;  1KVL A;  4WN5 A;  4JBF A;  1LSX A;  3BW6 A;  4S2J A;  3B42 A;  2Y79 A;  5I94 A;  1LI0 A;  4CJN A;  2HDS A;  1PIO A;  3SS5 A;  4DDY A;  4PM5 A;  4LRX C;  3S7Q A;  4UA6 A;  1E25 A;  1PZO A;  1MY8 A;  1S1Z A;  1PI5 A;  3V67 A;  1FCM A;  4GCZ A;  4GD6 A;  4MLL A;  4GHI A;  1IYS A;  4UHU A;  4ARZ A;  1KGE A;  2FH5 A;  4UQI M;  4I3A A;  2ZQ8 A;  1PWC A;  4OPQ A;  2WKE A;  2W3G A;  2O9C A;  1DY6 A;  2VKS A;  2ZMV A;  2NUT C;  3KYE A;  1F5M A;  3LCE A;  3MQ0 A;  5F69 A;  3AGE A;  4BEN A;  5CTN A;  5TR7 A;  2A24 B;  3LIB A;  2IWB A;  3UN7 A;  1NY0 A;  3Q7Z A;  4Q0J A;  1BLP A;  2XR0 A;  3U2A A;  2LB9 A;  2M1C A;  3KSG A;  3KX0 X;  1KE3 A;  4OOY A;  5E2G A;  2WKQ A;  1VQQ A;  3KYQ A;  3HBR A;  5DTK A;  2LB5 A;  3UMD A;  1NWZ A;  3VOY A;  1EWZ A;  1MXO A;  3GRJ A;  1W8Q A;  5EVI B;  5E2E A;  2V0W A;  1K38 A;  2KX6 A;  1K57 A;  3FPW A;  4XUX A;  3G35 A;  5A91 A;  4PPR A;  3RFB A;  5E2F A;  3DAV A;  4E04 A;  4O7D A;  3DBA A;  4ZRR A;  4EQI A;  4EU0 A;  4Y3I A;  4HH2 A;  3G31 A;  4O8G A;  2W1R A;  4MBK A;  1RGY A;  1CF0 A;  5FI2 A;  1S67 L;  3V3R A;  3E2L A;  3MS6 A;  4OQI A;  4X6T A;  3CG5 A;  1XA7 A;  3TOI A;  5LBR A;  3UO9 A;  5E43 A;  1P9W A;  1VEU B;  2HZ5 A;  3CIT A;  2J80 A;  5F68 A;  3LID A;  4EEU A;  3IXG A;  1CQA A;  4F94 A;  3DTM A;  3PBR A;  4YNR A;  2JE5 A;  4DMZ A;  3VSK A;  4GNU A;  5U47 A;  4MBF A;  3A0V A;  4YOF A;  4PKY A;  4QWO A;  3MQO A;  5A92 A;  5EVL A;  3K3D A;  3O3V A;  5HWW A;  3D72 A;  4C6Y A;  4X55 A;  4S2N A;  3T4Q A;  2QMI A;  3FKV A;  3TG9 A;  2VJW A;  3UDI A;  1Z09 A;  1ONG A;  2Y2L A;  3SOI A;  1YLT A;  4ZTK A;  4Y7P A;  4GD8 A;  3BFD A;  4KEN B;  3QP1 A;  4B4X A;  4EQ1 A;  2ZM0 A;  3UB8 A;  3ITB A;  1T19 A;  4EV4 A;  3FV7 A;  3S7O A;  5F1F A;  2PAV P;  2VGK A;  3NCK A;  3O86 A;  3CJM A;  4WMC D;  3Q81 A;  2EFU A;  3PBT A;  4P87 A;  3ZCZ A;  2V8F A;  3BM6 A;  1IEM A;  3D3O A;  1OTB A;  4XT2 B;  1PNE A;  1YLJ A;  1S1Y A;  1XP4 A;  1CI8 A;  2V0U A;  2EXB A;  3HLB A;  3OLO A;  3N8R A;  3H7W B;  1ALQ A;  3ZG7 B;  4M3K A;  3QNB A;  4LPZ A;  2I9V A;  4N9K A;  4BLM A;  5HD5 A;  3FC7 A;  2ZQC A;  1K0K A;  5EEC A;  3C5A A;  4B88 A;  3G2Y A;  3UY6 A;  5FI7 A;  4R3J A;  1ZHH B;  3OC2 A;  4Y0U A;  4E3N A;  2RL3 A;  4KG2 A;  4D2O A;  3HUN A;  4FTX A;  1XGJ A;  4BBU A;  3VFH A;  3UNW A;  4HEF A;  4WZ4 A;  1Z6F A;  3PHY A;  3HL9 A;  4P6Z M;  3QNC A;  2PDR A;  4GS9 A;  4CLC A;  1SKO B;  4JGR A;  1XPB A;  3DW0 A;  4NXF A;  3BWL A;  5FQJ A;  5M19 A;  4WZ5 A;  3QP4 A;  5TGF A;  1N9N A;  1OTE A;  2B02 A;  5FDS A;  4FH2 A;  4GN2 A;  1P0Z A;  3FYZ A;  4GJ4 A;  4K91 A;  2DRW A;  1MC0 A;  2K7S A;  2XD5 A;  4KUK A;  5AQ9 A;  1L0F A;  5IU1 A;  1CJF A;  1PW8 A;  3SS3 A;  4EBL A;  4EES A;  4DJ2 A;  1SKF A;  1H8Z A;  4FH4 A;  2Y2J A;  4KG6 A;  3M6B A;  2EX8 A;  3MZE A;  3OBF A;  3RH8 B;  4N9L A;  3IH8 A;  3WS4 A;  1WE4 A;  1QMF A;  1LL8 A;  3M2K A;  1SHV A;  1QME A;  4II7 A;  3VMA A;  4X1M A;  3NIA A;  3RTY A;  5HWV A;  4RQ9 A;  1WYC A;  5FSR A;  2P9V A;  4EXO A;  4YWZ A;  3HJK A;  1A0K A;  1S66 L;  4I3I A;  2VZW A;  3EQV A;  2XF3 A;  3LI9 A;  5CRF A;  5D3O A;  1TS7 A;  1XX2 A;  2G2W A;  2HDQ A;  4GB7 A;  2R9W A;  4JXW A;  4MN6 A;  3TRC A;  2JKR I;  2L1M A;  4LLO B;  1N9L A;  3IX8 A;  1YLZ A;  5CHM A;  4EW7 A;  3OOV A;  3A3J A;  4IVK A;  1VHM A;  4NKP A;  2J9P A;  3KSF A;  1K4F A;  5DFY A;  2UWX A;  3PYP A;  4ZDX A;  4RX2 A;  1FQG A;  4Y0T A;  4BWI A;  1O7E A;  2HDU A;  4WEL A;  3W4Q A;  2Y91 A;  3NHQ A;  3BFE A;  4ARZ B;  1NXY A;  4OON A;  1NYM A;  4BQM A;  3VFF A;  1TS8 A;  5HZH A;  4P6B A;  2XGN A;  2ZLY A;  4PMA A;  5EFW A;  4Y0O A;  4FCF A;  5FQ9 A;  3DTI A;  3JPU A;  4IUK A;  4JGO A;  2VGL S;  3LI8 A;  2QZ6 A;  1YKD A;  2WZZ A;  2QJ5 A;  1K55 C;  4I39 A;  1L2S A;  5FEF A;  1GHI A;  4EER A;  3C30 A;  5M18 A;  3N6I A;  5IT5 A;  2P04 A;  3MBZ A;  1IOU A;  2C5W B;  4HJ3 A;  1KE0 A;  4U0T A;  4OVD A;  4E3L A;  4I38 A;  3G4P A;  4OQH A;  3P09 A;  3E0Y A;  3B47 A;  3H9W A;  4QD4 A;  5CX7 A;  3M6H A;  2HJE A;  3K2N A;  3LGO A;  5MC7 A;  2Y55 A;  1MBL A;  4KZ6 A;  4P85 A;  3EQU A;  2HP5 A;  4UQI S;  3A0S A;  1K4E A;  1WA9 A;  3UE6 A;  4PAU A;  3C2W A;  1EI5 A;  4DKI A;  5GHY A;  2ZC4 B;  4MN5 A;  4MN7 A;  4JXS A;  1EW0 A;  2B18 A;  4X1L A;  3SW1 A;  3LY4 A;  3FKW A;  3R4K A;  2FZ0 A;  3BFF A;  4CLC D;  5EPH A;  2INW A;  4B9O A;  2WKP A;  5FI6 A;  1D1J A;  5CHJ A;  3GSG A;  3RXX A;  3IBJ A;  1G68 A;  2I72 A;  2Z2M B;  4JGQ A;  4UA7 A;  1M6K A;  2W1T A;  2QKP A;  2WGW A;  3BRM A;  5FAQ A;  3LYX A;  2PBD P;  1YSP A;  4QY5 A;  3BEC A;  3QP6 A;  3A3D A;  3G32 A;  2VX8 A;  3A3E A;  4FSF A;  4BBV A;  4X69 A;  3EGD C;  1NYY A;  3LEZ A;  3DTK A;  4ETX A;  4E6X A;  3VSL A;  4DXB A;  2G7U A;  1HTZ A;  5DF9 A;  1KGG A;  4K08 A;  1Q2P A;  2EA9 A;  1N9O A;  4JKT A;  1XJ6 A;  3DWZ A;  2A2L A;  2PRF A;  1PRQ A;  1TVF A;  3MXQ A;  3IX4 A;  5FEG A;  1J9M A;  2WK0 A;  3HLE A;  1UWP X;  3F1P B;  1T1A A;  1LL5 A;  4S2O A;  1BSG A;  5HPI A;  4RX3 A;  2H0Y A;  1DRM A;  2JHE A;  5G4Z A;  4ESP A;  3G2Z A;  4JXV A;  2V20 A;  2MJ6 A;  2J9O A;  1MKM A;  3MJQ A;  1S4R A;  3KO6 A;  4XUZ A;  4CLC E;  3AGF A;  3CLO A;  4KZ8 A;  1OT9 A;  1PI4 A;  1JVJ A;  1GHP A;  5GLB A;  5HWT A;  1LI9 A;  3W8K A;  4D60 A;  1HVB A;  3PBQ A;  3BEB A;  3OPR A;  4R70 A;  3VOL A;  2P74 A;  4GS9 B;  2XRO A;  4CLC B;  4E3J A;  1GSW A;  3N7W A;  1T1C A;  1O07 A;  2OV5 A;  2PD7 A;  3IX3 A;  1G5U A;  1H8Y A;  3BY8 A;  2H5S A;  1FOF A;  4A5R A;  3A3I A;  1W5D A;  3BLM A;  2PT7 A;  3HLC A;  3HJI A;  3MR0 A;  3MFX A;  4OKP A;  3PR6 A;  3IQA A;  4WEJ A;  4ZAM A;  3T4K A;  3BFG A;  5GHZ A;  3ZGA B;  3NOU C;  5F83 A;  3MMH A;  4OPY A;  4KZ9 A;  4HH3 A;  2HGV A;  2XLN A;  2Y2I A;  3GR2 A;  1K54 C;  3HUO A;  1F9I A;  1GCE A;  5FAP A;  4KZ3 A;  4LFU A;  4R1G A;  4YFM A;  3G34 A;  3T50 A;  1XKZ A;  4WEK A;  5BOH A;  4R0Q A;  1MZU A;  2HP6 A;  4P6Z S;  3ZHH A;  5E2H A;  1XGI A;  2P9V B;  1E3U A;  1ES5 A;  5EVI C;  4QHC A;  2H28 A;  2A49 A;  3IH9 A;  3IS2 A;  5CEB A;  2J7V A;  2Z6D A;  5G18 A;  2JKG A;  1YM1 A;  4DE3 A;  4LEN A;  1HD8 A;  3OPP A;  1JWV A;  4HBT A;  5CGS A;  1OT6 A;  4L9E A;  3CUE A;  2J8Y A;  1TS0 A;  4WUJ A;  5FQI A;  3B3X A;  3L9K A;  2CC1 A;  3Q07 A;  2QWS A;  2V1B A;  5L10 A;  1P9R A;  2JKT M;  2B5R A;  4KZ7 A;  5CER A;  5FAS A;  4LRZ E;  5AQA A;  4DF6 A;  2GX5 A;  1CK3 A;  5M1A A;  1FIL A;  5KZH A;  4MMN A;  3LY3 A;  2XFS A;  5F6A A;  4BL3 A;  4C75 A;  4ZJ3 A;  2GJ3 A;  5TJJ A;  3V50 A;  5AJG A;  4QB8 A;  4IUH A;  1XJ4 A;  1K6R A;  2R9X A;  1AXB A;  5FQQ A;  4IED A;  5JYO A;  3Q1F A;  1SCW A;  3HUM A;  1VM1 A;  3ZVW A;  4U3T A;  2M7V A;  1ESU A;  5EE8 A;  2R78 A;  5HAQ A;  1ERM A;  3Q7V A;  3F1P A;  1YLY A;  2VA0 A;  4UAA A;  3T1S A;  3E2K A;  4HES A;  3GMW A;  2G2U A;  1ZG4 A;  1I2S A;  5DFX A;  2PBY A;  2D02 A;  2BAS A;  4GDB A;  4E3M A;  1HZO A;  2WAE A;  1YAX A;  1V9Y A;  2L4R A;  4HJ4 A;  2OAQ 1;  3N4I A;  1SZV A;  5CED A;  2OWJ A;  3VP0 A;  1G28 A;  1TF1 A;  3C7V A;  5HDD A;  3NOP C;  1LL9 A;  1NRF A;  5KSC A;  4PKY G;  3CPT B;  3WS1 A;  5TBM B;  5F1G A;  4K0X A;  1IYQ A;  3UE0 A;  3I7J A;  4Z9Q A;  1BLH A;  2EX6 A;  3VP2 A;  1CI9 A;  3H82 B;  2VEA A;  1NRJ A;  3UB5 P;  1YSQ A;  1TD5 A;  3IWO A;  4IVI A;  3UDF A;  1T1B A;  2ZMA A;  2Y8H A;  2XA7 M;  5HW3 A;  1KDS A;  1DP6 A;  1BT5 A;  4NK3 A;  5FA7 A;  4JF5 A;  2NUP C;  4JXG A;  4OOM A;  1OJG A;  5HL1 A;  1XXM A;  4I3J A;  2L0W A;  5DTT A;  2ZC3 B;  2XQZ A;  2W1T B;  2WGW B;  1Q2Q A;  3HLF A;  4HBU A;  2HV1 A;  1RGZ A;  3MSH A;  1BUL A;  5HPF A;  1PYY A;  1H3Q A;  4BL2 A;  1ES4 A;  1S0W A;  5F5Y A;  2OSU A;  2PYR A;  3HRE A;  1U60 A;  1STZ A;  3W4P A;  2E8I A;  1D7E A;  3V3S A;  4X25 A;  4GLQ A;  1JWP A;  3E4P A;  2VK3 A;  4R23 A;  2J3W A;  3VP1 A;  3IWI A;  3OCL A;  3C38 A;  3TE8 A;  1W7F A;  4KZ5 A;  1DJA A;  1E3U D;  2ZQ9 A;  1K56 A;  3KSI A;  1L0G A;  1ZG6 A;  2DNS A;  3NI9 A;  4OPZ A;  3ZG5 A;  1ZKJ A;  1GSV A;  3ULF A;  3OZH A;  3CI6 A;  3LIA A;  5K5B A;  1Y4O A;  5DKL A;  1OTA A;  5HAR A;  5DKK A;  3IXD A;  5KMW A;  4WM9 A;  3C7U A;  2Y59 A;  5EOE A;  1Y54 A;  1TEM A;  4UA9 A;  4O01 A;  4S2M A;  1FR6 A;  2GDN A;  2O0Y A;  3S7N A;  1MWS A;  1RP5 A;  2BTF P;  4GZB A;  4HI4 A;  4PHT A;  4G3K A;  2W27 A;  2E8J A;  1E4D A;  5HDC A;  4OLD A;  4M4X A;  2WZX A;  4FD8 A;  1ACF A;  1IFQ A;  1W63 M;  2H0T A;  4OOL A;  2WAD A;  4NXG A;  3BFC A;  3NEC A;  1P97 A;  2QPN A;  4R4R A;  5A90 A;  1BZA A;  2KLI A;  5EUA A;  2V1Z A;  4JF4 A;  4X68 A;  3IF6 B;  2RCX A;  1OME A;  1FR1 A;  5L8M A;  5FL3 A;  1IYO A;  4R3A A;  1W79 A;  1MKI A;  2P08 A;  3VE4 A;  4OLG A;  4FUW A;  4G3W A;  4QJG A;  3TW8 A;  4OP8 A;  3MZF A;  5EVE A;  2KOI A;  3CAX A;  4IBR A;  3MQQ A;  4PM6 A;  2OAP 1;  2ZQD A;  3BQA A;  4Y13 A;  3HLW A;  2Y2K A;  3VOZ A;  1ERQ A;  1MWR A;  1KOU A;  3LFV A;  2HP9 A;  3DTE A;  4YIN A;  1DJB A;  4S2K A;  3LIE A;  2PYP A;  4OP5 A;  5EM0 A;  2VLG A;  2Y2N A;  3CPT A;  2W3F A;  3FPV A;  2EWV A;  3C8C A;  2V9A A;  5TBM A;  3S7P A;  1ZC2 A;  4U0X A;  1YPR A;  4HP9 A;  3V39 A;  1FCO A;  1ESI A;  1KVM A;  1YT4 A;  3EEA A;  3H82 A;  2DCF A;  3PTE A;  4HQA A;  3IS2 B;  1K57 C;  1TDL A;  3T4S A;  4MEZ A;  3LR0 A;  4IBX A;  5CGX A;  4LGW A;  2ZQ7 A;  2ZQA A;  3M2J A;  2W3H A;  4BMW A;  5HFO A;  1LSW A;  3CWF A;  1JNU A;  1UGU A;  1MPL A;  3KSH A;  2Q9M A;  3E4Q A;  4Q0H A;  1W8Y A;  4LV1 A;  4XXR A;  2ZM2 A;  1KGF A;  3O88 A;  3HVF A;  2H10 A;  3F1N A;  4MCW A;  3WRZ A;  5C5K A;  3IHA A;  2J3T D;  4G3V A;  3SZT A;  3MFD A;  3IWQ A;  2KDK A;  5CXW A;  1C3B A;  2JCH A;  1XFQ A;  2W0N A;  3CUE C;  1G6O A;  5L2F A;  3OPH A;  5F82 A;  3G30 A;  4C3Q A;  3F1O B;  4DE0 A;  3S4X A;  3ZFZ A;  4S2N C;  3UB6 A;  3UPP A;  3E4O A;  2X01 A;  4KG5 A;  1L3L A;  1DJC A;  4ETZ A;  4S2L A;  5DJU A;  3PAG A;  4DXC A;  2V8C A;  5FAT A;  3VP4 A;  4ZBE A;  4HNB A;  1V9Z A;  4EUV A;  1LSV A;  5J8X A;  2Z6C A;  1KDW A;  1YLP A;  5HX9 A;  5JYP A;  3GDI A;  4Y17 A;  4HOI A;  5DVA A;  3W2Z A;  4L0L A;  4Z1W A;  4QPR A;  5HDS A;  3Q7V B;  4Y5F A;  3SH8 A;  3IXB A;  2BLS A;  2JC7 A;  2Y2O A;  3ITA A;  2O9A A;  1BLS A;  4AFI A;  3LIF A;  4E6W A;  1ERO A;  1NLY A;  2CMN A;  2FFY A;  1XJ3 A;  3LEQ A;  2WGI A;  5A8B A;  1K56 D;  1H0M A;  1LHY A;  3MKE A;  1YLW A;  4P0M A;  1J3W A;  3MZD A;  4NXB A;  5AVF A;  3FG8 A; 
#chains in the Genus database with same CATH homology
 3L7H A;  3NUL A;  3NEC A;  1CF0 A;  1VET B;  4X1M A;  3T1X A;  3MS6 A;  2ZL1 A;  1SKO A;  2JKF A;  5EM1 A;  1K0K A;  2HZ5 A;  1VEU B;  1A0K A;  1PFL A;  3MSH A;  1HLU P;  1FIK A;  4FUW A;  5EV0 A;  1CQA A;  2PRF A;  3LGO A;  1PRQ A;  4FTX A;  3T1S A;  5EVE A;  3U4L P;  5FEG A;  3D9Y A;  3T1R A;  4QWO A;  2ZL1 B;  4X25 A;  1SKO B;  2V8C A;  4ESP A;  2VK3 A;  2JKG A;  4X1L A;  3KYE A;  1Z09 A;  1SZV A;  3CHW P;  1F2K A;  5EM0 A;  5FDS A;  3CPT A;  2ACG A;  3L9K A;  1D1J A;  1AWI A;  4D60 A;  1Y4O A;  3CPT B;  1YPR A;  2PAV P;  1CJF A;  2B95 A;  3LEQ A;  3T1Q B;  1VEU A;  2BTF P;  2V8F A;  1FIL A;  2E8J A;  1J3W A;  1G5U A;  2PBD P;  3T12 B;  3UB5 P;  5FEF A;  1PNE A;  1ACF A;  1VET A;  3DAV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...