1F9IA

Crystal structure of the photoactive yellow protein mutant y42f
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
125
structure length
125
Chain Sequence
MEHVAFGSEDIENTLAKMDDGQLDGLAFGAIQLDGDGNILQFNAAEGDITGRDPKQVIGKNFFKDVAPCTDSPEFYGKFKEGVASGNLNTMFEYTFDYQMTPTKVKVHMKKALSGDSYWVFVKRV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PHOTOACTIVE YELLOW PROTEIN
publication title Coupling of hydrogen bonding to chromophore conformation and function in photoactive yellow protein.
pubmed doi rcsb
source organism Halorhodospira halophila
molecule tags Signaling protein
total genus 35
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2000-07-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00989 PAS PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 1f9iA00
3H82B 3VE3A 1V9YA 3FC7A 1N9OA 5HWWA 3SW1A 4RQ9A 1UGUA 1OTDA 2INWA 5DJTA 5AVEA 5HDSA 3UB8A 1S4RA 2P7JA 3P7NA 4WL9A 4HJ4A 1UWPX 2JHEA 2QHKA 1S1ZA 2Z6DA 4HH3A 3C8CA 4R6LA 3F1OB 2ZOHA 1T18A 3MQQA 3UE6A 2KX6A 1OJGA 2PYRA 4MN6A 2J80A 3H7WB 3F1PB 1OTIA 3T50A 3OLOA 5DKKA 4DJ3A 3D72A 4GHIB 4WLAA 2M1CA 4HIAA 2VV7A 1XJ4A 3LIAA 1F98A 4EW7A 1DRMA 3BY9A 3GDIA 2L4RA 3LIFA 5J7EA 1DP6A 4HP4A 2QJ5A 4L9FA 1GSXA 1LSVA 5HWVA 5F69A 3A0RA 3LICA 4M4XA 4F3LA 3F1NB 3E4QA 5DKLA 3H9WA 4GCZA 3LI8A 1TS8A 2PHYA 1TS0A 3UB6A 3PYPA 3CLOA 4EEUA 4PKYA 4E04A 2L0WA 2HV1A 3IS2A 4L9EA 4LLOB 4KUOA 1OJ5A 3UB9A 3BY8A 4I3IA 1XJ6A 2QKPA 1OTAA 3G6OA 5F5YA 4R38A 5DJUA 4HHDA 4HH2A 2R78A 4HY8A 4KUKA 3MQOA 1G28A 4EEPA 1LSWA 2Z6CA 1ODVA 3NOUC 4HJ6A 1T1BA 3F1NA 1N9LA 3BWLA 4WF0A 1D7EA 3RTYA 4HOIA 4WUJA 2JN7A 5EFWA 4I39A 4LRZE 4H6JB 3IBRA 2W27A 3MR0A 2L1MA 2W0NA 5HZHA 2VV6A 3LIDA 3UB7A 4I5SA 5TBMA 4XT2A 1DP9A 5I5LA 2WKQA 4HNBA 2D01A 1S1YA 3NOTC 2CMNA 2PDRA 2VEAA 2VLGA 3H82A 5HD5A 2V1BA 5HDDA 4EESA 3UMEA 2D02A 4HJ3A 4BBUA 3C2WA 1S4SA 2YKFA 3MJQA 4LRYC 5KIZA 3K3DA 1T1CA 1S66L 4JGRA 1X0OA 2PD8A 3NOPC 4BBTA 3MFXA 5HSQA 4GW9A 3PHYA 1JNUA 2I9VA 1XJ3A 2KDKA 3F1OA 4H6JA 3UMDA 2PD7A 2VV8A 1GSWA 4JGOA 3A0SA 2WKPA 3RH8B 2B02A 1MZUA 3H7WA 3F1PA 2QJ7A 4YWZA 4GS9B 2A24B 4JGQA 2V0WA 4KQDA 5IS1A 4GHIA 2ZBBA 5AVFA 5HDCA 3HJIA 3K3CA 1BYWA 4EQ1A 2YKHA 4L9GA 4I3AA 4NXEA 4R70A 1D06A 3VOLA 2V0UA 3LUQA 4PKYG 4DJ2A 3ULFA 4EERA 5G4ZA 3CAXA 1KOUA 2EA9A 5HWTA 1T1AA 2OOLA 4HP9A 3E4OA 1XFNA 3LI9A 2OWHA 1LT0A 1WA9A 3KX0X 1VB6A 5IU1A 4HI4A 3ICYA 4MN5A 5J3WA 3E4PA 3NHQA 2GJ3A 4BBVA 4F3LB 1OT9A 1V9ZA 3LIEA 1OT6A 3B33A 3MXQA 1OTEA 1DP8A 4GS9A 1XFQA 2A24A 1F9IA 4NXGA 4K08A 1TS7A 2OWJA 1T19A 5F6AA 3GECA 1OTBA 4NXBA 3NJAA 1TS6A 2K7SA 3IS2B 4WN5A 3HJKA 4I3JA 4NXFA 3EEHA 4LRXC 3EWKA 1N9NA 2PR5A 3LYXA 4JGPA 3A0VA 1NWZA 5HD3A 1P0ZA 5J4EA 2PYPA 3FG8A 2V1AA 2V9AA 4I38A 1Y28A 5A8BA 4B9OA 4EETB 2QWSA 1P97A 3LIBA 4LPZA 2PR6A 1LSXA 4R3AA 5F68A 5G4YA 2H28A 2ZOIA 4EXOA 5TBMB 1GSVA 4XT2B 3VE4A 3CWFA 1EW0A 1LL8A 2BASA 3ZQ5A 1S67L 1UWNX 4HQAA 1XJ2A 2WKRA
chains in the Genus database with same CATH superfamily
1CEFA 1W8QA 2VGLS 3UE1A 1YLTA 4FH2A 1QMFA 3Q7VB 3O86A 4MNRA 3RXWA 4E6WA 5FQMA 4RQ9A 2W1TA 2GZAA 3T12B 5GL9A 1RGYA 2H0YA 1BLHA 4CPKA 2Y2OA 3P7NA 2V8FA 4WL9A 3TW8A 3BLSA 1UWPX 3PR6A 5FEGA 5FQ9A 3LCEA 4BQMA 1G6OA 2QHKA 1S1ZA 4MLLA 1ES5A 4HH3A 1ONGA 3CUEC 3V39A 2Y2GA 2XK1A 4R6LA 1LL5A 1NRJA 3NC8A 3SS4A 1YSPA 2KX6A 2W3EA 4R3BA 3A3FA 1NLZA 3C4PA 1SDNA 2ZLYA 1BT5A 1OJGA 5F1FA 1HLUP 4MBHA 2JKRM 4E3IA 2XRNA 1BTLA 1K55C 1OTIA 3OLOA 5EOOA 2OV5A 5CGSA 3W8KA 4WLAA 2VV7A 5GLAA 3VOZA 3IX4A 5J7EA 3G31A 3UO9A 2OAP1 3A0RA 5DF8A 5CEDA 1K54A 1NZOA 4AFIA 3LEQA 5CERA 3F1NB 4WEKA 3HL9A 5DTTA 3E4QA 4BWIA 4DE2A 4GD8A 4KQRA 3UE0A 3U4LP 3BW6A 2PHYA 5TJJA 3UB6A 3FPVA 5CGXA 1H8YA 3Q81A 3SH7A 3N6IA 5A90A 5HW3A 3T4SA 2M7UA 3IS2A 4LLOB 4QU3A 2HPBA 3UPNA 1JWVA 1NRFA 1XJ6A 2XLNA 3LR5A 3CMZA 4UA9A 3G6OA 3T4KA 5F5YA 1SDEA 5DJUA 2HDRA 3D4FA 3IF6C 1RGZA 4C6YA 3MKFA 2WADA 4KUKA 3FZCA 4JXWA 2H10A 1CJFA 4EEPA 1MPLA 2WZZA 4KZBA 1HTZA 4C75A 1ODVA 4WELA 3LR3A 3NBLA 3F1NA 3A3IA 2ZQ7A 4WZ4A 3B42A 4FUWA 1BLSA 1L3LA 1TD5A 2XA7M 2JN7A 3O3VA 2PRFA 5L8MA 2JE5A 2P9VA 2HP5A 4RX2A 4LCMA 4WMCA 3OPRA 2W27A 3CUEA 3IXHA 3TOIA 3JPUA 2W0NA 3QP8A 2FH5A 3UDFA 5HZHA 1CEGA 1DP9A 5FA7A 4OPZA 1KDSA 5I5LA 5M1AA 1XGIA 4R23A 2WKQA 2P04A 3HLFA 3NOTC 3HUMA 2CMNA 1K55A 5L2FA 3P01A 5HDDA 1WYBA 3BRMA 4WYYA 5FQKA 3W4PA 4Y2FA 3ZVWA 2Y2KA 3VP0A 4BBUA 3SH9A 1PZOA 4FD8A 3L9KA 5KIZA 1OPXA 5GHXA 3WWXA 4PMAA 1LL9A 5HL1A 1VETA 4OQGA 4BBTA 3OC2A 2JKRI 3BFDA 1JNUA 5CECA 3PTEA 2FZ0A 4L0LA 1JTDA 5CTMA 1NY0A 2Y79A 1GSWA 3A0SA 1ZG6A 1MZUA 2W3GA 3F1PA 3TG9A 4GS9B 4DDSA 3IXDA 3EQUA 3ITAA 2XD1A 3K3CA 3PBSA 1FOFA 3LY4A 4RVAA 4L9GA 1EROA 3BYDA 4I3AA 1IEMA 4DE0A 5AJGA 4X69A 5AQ9A 3IF6A 5KSCA 2JBFA 2J3TC 4PKYG 4U0XA 1E3UA 5EVID 4B4ZA 4DJ2A 3ULFA 1PNEA 4H8RA 4HP9A 2OWHA 4P87A 1LT0A 4D60A 1VB6A 4KZ6A 3S1YA 3OZHA 4OP8A 1IKGA 1XXMA 3HCYA 3BECA 3T1QB 1E4DA 2X02A 1IYOA 4ZBEA 4KG5A 4K0WA 4IVKA 1BZAA 1OTEA 3S7PA 2NUTC 4GS9A 1K6RA 4E3JA 1DJCA 3ZG5A 2J9PA 1P9WA 5IHVA 2ZL1A 2VA0A 4A5RA 5L10A 1WE4A 3NJAA 1TS6A 3BJNA 4QY5A 1IYPA 3HJKA 2Y55A 4I3JA 4NXFA 1N9NA 3T1RA 3SS5A 3V5MA 3LYXA 4JGPA 3A0VA 2ZC5B 3MKEA 4P0MA 1FILA 1GCEA 3E2LA 3KYEA 5HD3A 4PAUA 1JVJA 3R7WB 1YQSA 2J8YA 1IELA 3OCLA 3DTEA 3S7OA 1QMEA 4IUHA 3C7UA 2XEPA 3CPTB 3L7HA 3VSKA 1GHPA 2V1AA 2V9AA 1MWUA 5EVLA 4D2OA 5CHUA 1KVMA 5A8BA 4B9OA 2VX8A 2XR0A 1IOUA 3DTMA 1SKFA 5GLCA 2QWSA 2H5SA 5DF7A 3BFCA 3DWKA 2PBYA 4LPZA 3E98A 3PAGA 2PR6A 3IF5A 4OVDA 2XH9A 4LGWA 2VGKA 3DWZA 4OP5A 5HL6A 3A3JA 3NCKA 4EXOA 3V67A 1XA1A 5TBMB 4Y5FA 1GSVA 3VE4A 3CWFA 4O8GA 3O88A 2BASA 4OQHA 1U60A 2WKIA 3KSHA 2WYXA 2WKRA 5A93A 3VE3A 3CPTA 1FCMA 4OKPA 4WEJA 1NYYA 2LB9A 1OTDA 2ZJ9A 2INWA 1E25A 5DJTA 5HDSA 3UB8A 5L07A 4Y0OA 5KMWA 4EWFA 2OAQ1 3ZG0A 2JHEA 1L0EA 4ZJ2A 4RA7A 3C8CA 5AQAA 3QP6A 2PU2A 4DXCA 3IHBA 3F1OB 3EOIA 3B3XA 2ZOHA 1T18A 2XD5A 3MQ0A 3C5AA 3NIAA 4GJ4A 2E8JA 4MN6A 4P85A 4Z9QA 3H7WB 3IX3A 1DY6A 2AVXA 3FV7A 5E2FA 4GHIB 4BD1A 4HIAA 5FL3A 2Y2QA 4IBRA 4GB7A 2ACGA 1DP6A 3DTKA 5TGFA 2ZQ9A 1LSVA 5F69A 3LICA 4JF4A 1N4OA 4WZ5C 5HFOA 4UQIM 4F3LA 2C5WB 2PU4A 4S2LA 4JF6A 5DFXA 4HBTA 1KDWA 1HD8A 4IBXA 1STZA 1TS8A 3M2JA 3MF0A 3OBFA 1KGGA 1TS0A 4MCWA 3QP2A 1FSWA 4X55A 4CLCC 3EQVA 4PKYA 3T4QA 4DMZA 5JYOA 4S2KA 4E04A 3G35A 3GMWA 4E3MA 1PW1A 4XXRA 4I3IA 2QKPA 4WMCD 5KZHA 2PT7A 4Y0TA 2BTFP 2VGLM 2ZQDA 4FTXA 2Z2MB 2OSUA 5FQQA 1YT4A 1OMEA 2EWWA 2DCFA 4HY8A 3N4IA 2A3UA 1G28A 2Z6CA 3NOUC 4HJ6A 2ZM2A 3C4OA 5HX9A 3CI6A 1W8YA 5DVAA 1GA9A 2H0TA 3A3DA 1I2WA 5EFWA 4R1GA 2HDSA 4NK3A 4RX3A 1MBLA 5CHJA 4LRZE 4H6JB 5HARA 2EXBA 3MR0A 4CLCB 3VMAA 3KYQA 5M18A 2VV6A 5CGWA 2Y2JA 5AQ7A 4MDZA 4C3QA 4JLFA 1S1YA 2VLGA 2VEAA 1L0FA 3MXSA 5F83A 1S6RA 4R4SA 5GLBA 1W7FA 4EESA 2I72A 3NDGA 3G2YA 4QHCA 3Q7VA 3HVFA 5EOEA 5JYPA 4HJ3A 5CHMA 5F1GA 1ES4A 3C2WA 4UAAA 4CQHA 1S4SA 4R3JA 4LRYC 4PHTA 5FQIA 4YOFA 1X0OA 2JKTM 4WZ5A 1RCJA 2GDNA 3HUNA 1YMXA 1XJ3A 4BD0A 1L0GA 1I5QA 4H6JA 3FPWA 2PD7A 2VV8A 3RXXA 1FR1A 2HDQA 2WKPA 4CLCA 1ZKJA 2GNXA 1IFQA 2B02A 3LEZA 2Y59A 3IWQA 3IQAA 1ZHHB 3W2ZA 5BOHA 4YWZA 5E2HA 4KG2A 1ESUA 1MY8A 2WGWB 4Y0UA 3BFEA 4ZAMA 3S7NA 5HDCA 4KZ7A 3ZG9B 2YKHA 1K0KA 3VP2A 1KGEA 3AGEA 2W3HA 1G6AA 4DXBA 1KE0A 2NUPC 4DN0A 2R9XA 3OPPA 1T1AA 3IT9A 4EUZA 1WA9A 4B88A 3U2AA 4P6ZM 4HI4A 1ES2A 4MN5A 1W79A 3DW0A 4BBVA 1SHVA 3C38A 2EX6A 2ZC3B 4LV0A 2IA2A 4QB8A 4ID4A 2BLSA 1CQAA 3TE8A 4NXGA 4K08A 1K38A 1FCNA 3M6BA 2XA7S 2Q9MA 4WBGA 3GECA 3FYZA 1OTBA 4X25A 4ESPA 5CRFA 4Y7PA 4MBKA 3LGOA 5AQBA 2Y2HA 3IXBA 3EEHA 4LRXC 5EM0A 3EWKA 3CITA 1ALQA 3IWOA 4Y3IA 4G3VA 4IJGA 2O9BA 1P0ZA 5FDHA 5J4EA 1BULA 1YLJA 4HEFA 2ZMAA 2K2NA 2WKEA 2W3FA 1W5DA 3AGFA 2ZC4B 5MC7A 2J3TD 4QJGA 1CI8A 5EE8A 4I38A 3CG5A 3OOVA 3LR4A 1S0WA 2RCXA 2ZQCA 4EETB 4F94A 4LV1A 4ZTKA 1M40A 4UEYA 3RJUA 2ZQ8A 2ZMFA 1LSXA 5IT5A 4OQ0A 1ZG4A 1FCOA 2R9WA 1YSQA 2H28A 1VHMA 3DTIA 3GR2A 5G4YA 4PM8A 2P08A 2Y2NA 1J3WA 2W1RA 2IWCA 4XT2B 2VGJA 4ZDXA 1EW0A 4QY6A 2Y2IA 5G18A 5CTNA 1K56D 1S67L 1UWNX 4HQAA 4BMWA 3H82B 3VOYA 1V9YA 2C6WB 2XF3A 2B5RA 4KZ4A 1N9OA 1SKOB 4CJNA 4GNUA 4U3TA 4DE3A 3PXPA 3PBNA 4EQIA 2V1ZA 5AVEA 5U47A 1ESIA 3MZDA 1K25A 1JTGA 4O7DA 2MJ6A 3DAVA 1A0KA 3UE6A 4X6TA 3MFDA 2EX9A 2WAFA 4M3KA 2J80A 1TDGA 4BJPA 4LCLA 3ZG8B 1LHYA 1H0MA 5FQJA 3EEAA 2WUQA 5DKKA 3DBAA 1PI5A 1ERQA 1EWZA 3D9YA 1XJ4A 4II7A 3P09A 1DRMA 4P6BA 3BY9A 2L4RA 3LIFA 5EM1A 4HP4A 4L9FA 3T1XA 3VV4A 1CI9A 4M4XA 3QHYA 4E3OA 3ZHHA 1MKIA 2EWVA 4LENA 3Q07A 2JCHA 1XPBA 1YLPA 3H9WA 4E3KA 3LI8A 5GHZA 2GX5A 2JC7A 5DTSA 3PYPA 1GHIA 1ONHA 4IHQA 3CLOA 3ZGAB 3V50A 3SZTA 2WGVA 4EEUA 2Y4AA 2L0WA 2HV1A 2UV0E 4EBPA 1K4FA 3VP3A 3NULA 2Y91A 1L2SA 4Z1WA 1YLYA 3BY8A 2X71A 4DE1A 2IWDA 3N8RA 4S2IA 1I2SA 2EFXA 3KSIA 4HH2A 1Z09A 3TRCA 3R7WA 3SH8A 5EVIB 4N9LA 3BM6A 3FKVA 1NZUA 1YM1A 3MBZA 1WYCA 1G5UA 3NI9A 3ISGA 1MXOA 1N9LA 4RYEA 4WF0A 1GA0A 1D7EA 5FAPA 1EI5A 3BEBA 3RTYA 1PI4A 4HOIA 4ZJ3A 3T4JA 1YLWA 4S2PA 4ZRRA 3UPOA 4N92A 4CLCE 3MZFA 4N1XA 4ME4A 4I39A 3UPPA 3BQAA 4Q8IA 3IBRA 4ETXA 3EGDC 5GHYA 1KE3A 1XGJA 4YINA 3UB7A 4I5SA 5TBMA 3S4XA 4QPRA 3NECA 1SCWA 2CC1A 4EUVA 4B4XA 4OONA 2IWBA 4GDBA 2K31A 5HD5A 1MC0A 2V1BA 4OPQA 2J3WA 3UMEA 3NY4A 4JF5A 1DJAA 2VKSA 2DNSA 4MEZA 2EFUA 2YKFA 3N7WA 4EU0A 1YAXA 2HF6A 3T1SA 3K3DA 4JGRA 2Y2LA 2ZC6B 3O87A 3UNWA 2PD8A 4S2MA 1LI9A 1MWRA 4PPRA 5HSQA 3ZYTA 1HZOA 2I9VA 2KDKA 4GZBA 2W1TB 3F1OA 1RP5A 4X53A 4UHUA 2ZC7A 4G3WA 3UMDA 3JVVA 3QP1A 3G34A 5FI7A 4KZ8A 3RH8B 1NLYA 4PM9A 3H7WA 2QJ7A 2EXAA 4HBUA 3M6HA 1FR6A 3I7JA 1PWGA 2OLVA 3ZNTA 4JGQA 2V0WA 4KQDA 4S2JA 1G68A 5IS1A 4GHIA 3G4PA 1JWPA 5GLDA 5I94A 3HJIA 5DFYA 4FSFA 5K5BA 3CZDA 5C5KA 4NXEA 4MMNA 4KZAA 3N8SA 2EX2A 5EUAA 3IHAA 4FOFA 3KSFA 3VOLA 3LUQA 1F5MA 1TVFA 5HAPA 5G4ZA 5EVEA 2EA9A 5HWTA 2QZ6A 5FEFA 2PAVP 4E6XA 5LBRA 3ZNYA 1YPRA 1D1JA 4B93A 1J9MA 2OOLA 4EBLA 1XFNA 3LI9A 1KGFA 2Z2LB 1FIKA 4DRTA 1YLZA 3QNCA 5IU1A 2O9AA 3GVBA 3ICYA 1K6SA 2QYBA 4FH4A 3E4PA 1C3BA 3LO7A 3NHQA 3WRTA 2DRWA 5KSHA 4IEDA 1OT9A 3MSHA 5EV0A 4EBNA 2X01A 3D3OA 3LIEA 3R4KA 3MXQA 1K4EA 2HJ9C 2Y2PA 1DP8A 3TJZC 2OLUA 1F9IA 4BL3A 1Q2PA 3FWLA 3M2KA 3PAEA 4GLQA 3WS4A 3HLEA 4N9KA 4X1LA 3W4OA 3G2ZA 2OWJA 3BLMA 1SZVA 1VQQA 2XDMA 2K7SA 2G2UA 4K0XA 3IS2B 4WN5A 4BLMA 2O9CA 1TEMA 5DTKA 4OLGA 1H8ZA 1PZPA 3VP1A 1XKZA 5TFQA 2XFTA 1E3UD 1CF0A 2HJEA 5J8XA 2HP6A 1PW8A 4DKIA 3LFVA 2WZXA 4NKPA 2LB5A 2JKFA 3Q1FA 1PWCA 1Y28A 4NEED 2G2WA 3GQZA 3JYIA 1TF1A 1P97A 1PWDA 1XP4A 3LIBA 4O01A 3RFBA 3HLWA 2FFYA 3WS2A 2P9VB 1VEUB 4R3AA 4DF6A 2M7VA 1H5XA 2WKHA 3BFGA 1DJBA 2ZOIA 3UDIA 4E3NA 4N1HA 3S22A 4KENB 1YMSA 5FASA 3ZDJA 3PBQA 3HBRA 4GKUA 2JKGA 1AXBA 4Q0HA 1L0DA 3T4OA 1FQGA 3FC7A 2B95A 3Q82A 3W4QA 5HWWA 3GV9A 5A91A 3HUOA 5FI6A 3SW1A 5FAOA 3UY6A 3IXGA 1UGUA 1O7EA 5L09A 2RL3A 3B47A 1S4RA 2P7JA 4Q0JA 4OH0A 5HAQA 4HJ4A 2XROA 2V8CA 1VETB 2Z6DA 4XUZA 2WGWA 1H8MA 3BFFA 3GSGA 4P6ZS 4X56A 1VEUA 3HREA 2G7UA 3VFFA 3MQQA 1XX2A 4OOYA 3CHWP 2PYRA 4FCFA 4PM6A 1ZTUA 4LV2A 3F1PB 1HVBA 1IKIA 3T50A 5HPIA 1PIOA 4DJ3A 4QD4A 3D72A 4KQOA 3WRZA 2M1CA 5TR7A 3LIAA 1F98A 4EW7A 1Y54A 3GDIA 2QJ5A 3IF6B 1GSXA 5HWVA 3MXRA 3K2NA 4KZ9A 3EGXC 2E8IA 1K57C 5DKLA 4ARZB 1NXYA 4Y13A 3NDEA 2QPNA 4GCZA 4GN2A 4NG2A 1PYYA 3S7QA 2JKTI 1VM1A 2VJWA 4L9EA 1N9BA 4KUOA 1OJ5A 3UB9A 1ERMA 2A49A 3LR0A 1OTAA 4R38A 3KSGA 3G30A 2ZL1B 4HHDA 3GTCA 2R78A 3MQOA 2W3DA 1ACFA 3MZEA 1LSWA 3PBRA 4OPYA 4OOLA 2ZD8A 4X68A 4GOGA 1Y4OA 4JXVA 1MWSA 4ETZA 1BLCA 1T1BA 4LFUA 3IBJA 3TSGA 3QP4A 4ARZA 2HGVA 1AWIA 3BWLA 3IWIA 2O0YA 4O0PA 3AGDA 5CXWA 4WUJA 4S2NC 2J9OA 2O99A 3IH8A 2HP9A 2PBDP 3HLBA 4IVIA 1FSYA 1F2KA 2L1MA 3LIDA 4XT2A 4JPMA 5FDSA 3Q7ZA 3UE3A 5HAIA 4KZ5A 3QP5A 5EVIC 5A92A 4HNBA 2D01A 4DDYA 2HZ5A 1YKDA 2PDRA 4WM9A 1IYQA 2XGNA 2XFSA 3H82A 2Y2MA 2ZM8A 1SKOA 2DMWA 4OOMA 1KE4A 4U0TA 3UN7A 2D02A 2XQZA 3QNBA 4YFMA 2FFFB 3V3SA 1O07A 3MJQA 4E3LA 1ZC2A 3OPLA 2V20A 2WAEA 3OCNA 1ES3A 1T1CA 3JVUA 3VP4A 1S66L 1PRQA 1LI0A 5FSRA 3C30A 3NOPC 4NETA 5E2EA 3MFXA 4GW9A 1K57A 3PHYA 3ZFZA 4XUXA 3GRJA 5FAQA 4S2OA 3PBTA 1GHMA 2A2LA 3BQ8A 3VFHA 4JGOA 2VZWA 4BENA 2J7VA 1NJ4A 3A3EA 4BL2A 2B18A 2QMIA 4PM5A 2A24B 4GD6A 1BLPA 4ZJ1A 2ZBBA 5AVFA 4JBFA 1BYWA 4EQ1A 3C7VA 3ITBA 3E2KA 2KLIA 1NYMA 1Z6FA 4R70A 1D06A 3VSLA 2WGIA 5F82A 1PFLA 1W63M 3LY3A 2V0UA 4QWOA 4EERA 3CAXA 5FI2A 1KOUA 1M6KA 5FATA 3SS3A 3E4OA 5DF9A 3UB5P 4IUKA 4JXSA 3UDXA 3KX0X 3T4TA 4UA7A 1P9RA 2Q9NA 5J3WA 4R4RA 2Y8HA 2GJ3A 3IH9A 5EECA 5D3OA 2KOIA 4F3LB 1IYSA 4S2NA 4HESA 3ZG7B 1V9ZA 4OPRA 1OT6A 3B33A 1MKMA 3FKWA 3ZCZA 2ZM0A 4X1MA 3OPHA 4YNRA 3MS6A 1XFQA 2A24A 1H3QA 2ZMVA 4KQQA 2VK3A 1TS7A 4CLCD 4K91A 2WK0A 5CEBA 1T19A 5F6AA 3T4LA 5CX7A 4GDNA 4NXBA 3CJMA 1Q2QA 5EVIA 2UWXA 4Y15A 5M19A 1K56A 3O5YA 3ZVTA 4R0QA 4Y17A 2Q0OA 3SOIA 1XA7A 2HDUA 3WS5A 4KG6A 2PR5A 4KZ3A 4OLDA 1NWZA 4LV3A 1BUEA 2BG1A 1TDLA 1K54C 3V3RA 2PYPA 5E43A 4JKTA 4OQIA 3FG8A 3KO6A 4MN7A 1JWZA 3MMHA 3G32A 3E0YA 2EX8A 3PBOA 4UQIS 1W63Q 4PM7A 4EV4A 2XSSA 5EPHA 1MWTA 2P74A 1LLBA 4UA6A 4G3KA 3P98A 3WS0A 1CK3A 5E2GA 1BSGA 3HLDA 1KVLA 5F68A 3IX8A 3HLCA 3N8LA 4JXGA 1LL8A 3HLGA 4Q0IA 3KYZA 3ZQ5A 3WS1A 4MBFA 2V2FF 1XJ2A 2ZQAA 5HPFA
chains in the Genus database with same CATH topology
3T4OA 3H82B 3VE3A 1V9YA 2VGLS 3FC7A 1N9OA 5HWWA 3SW1A 4RQ9A 4WEJA 2W1TA 2GZAA 3PXPA 1UGUA 2LB9A 1OTDA 3PBNA 2INWA 5DJTA 5AVEA 3B47A 5HDSA 3UB8A 1S4RA 2P7JA 4Q0JA 3P7NA 4WL9A 3TW8A 4HJ4A 2OAQ1 1UWPX 2XROA 3PR6A 1G6OA 2JHEA 2QHKA 1S1ZA 2Z6DA 4HH3A 3C8CA 3CUEC 1H8MA 4R6LA 4P6ZS 2MJ6A 3F1OB 3EOIA 1NRJA 2G7UA 1YSPA 2ZOHA 1T18A 3MQQA 3UE6A 2KX6A 2W3EA 3MQ0A 1NLZA 4GJ4A 1OJGA 2PYRA 4MN6A 1ZTUA 2J80A 3H7WB 2JKRM 3F1PB 2XRNA 4BJPA 1OTIA 3T50A 3OLOA 3EEAA 5DKKA 3DBAA 5HPIA 4DJ3A 3D72A 4GHIB 4KQOA 4WLAA 2M1CA 4HIAA 5FL3A 2VV7A 1XJ4A 3LIAA 4II7A 1F98A 4EW7A 1DRMA 3BY9A 3GDIA 2L4RA 3LIFA 5J7EA 1DP6A 4HP4A 2QJ5A 4L9FA 1GSXA 3VV4A 1LSVA 5HWVA 5F69A 2OAP1 3A0RA 3K2NA 3LICA 4M4XA 4UQIM 4AFIA 4F3LA 2EWVA 3EGXC 3F1NB 4WEKA 4BWIA 3E4QA 5DKLA 4ARZB 5DFXA 3H9WA 4GCZA 1STZA 3LI8A 1TS8A 3MF0A 3OBFA 3BW6A 2GX5A 2PHYA 1TS0A 4MCWA 5TJJA 3UB6A 3FPVA 3PYPA 4IHQA 3CLOA 4CLCC 4EEUA 3EQVA 4PKYA 3T4QA 4DMZA 3T4SA 3S7QA 2M7UA 4E04A 2L0WA 2HV1A 2JKTI 3IS2A 2VJWA 4L9EA 4LLOB 4KUOA 1OJ5A 4Z1WA 3UB9A 3BY8A 4I3IA 3LR0A 1XJ6A 2QKPA 3LR5A 1OTAA 3G6OA 5F5YA 2PT7A 3T4KA 4R38A 3KSGA 5DJUA 2VGLM 4HHDA 4HH2A 3KSIA 3TRCA 3R7WA 2EWWA 2R78A 4HY8A 4KUKA 3MQOA 2W3DA 1G28A 4EEPA 1LSWA 3PBRA 4OOLA 2Z6CA 1ODVA 4WELA 3LR3A 4ETZA 3NOUC 4HJ6A 1T1BA 3F1NA 3IBJA 4ARZA 1N9LA 2HGVA 3BWLA 3B42A 4WF0A 2O0YA 1D7EA 4O0PA 3CI6A 3RTYA 1TD5A 4HOIA 3T4JA 4WUJA 2XA7M 2JN7A 4ZRRA 5L8MA 5EFWA 4CLCE 2O99A 4ME4A 4I39A 3BQAA 4LRZE 4H6JB 3IBRA 4ETXA 3EGDC 2W27A 3CUEA 3MR0A 2L1MA 4CLCB 2W0NA 3KYQA 2FH5A 2VV6A 3LIDA 5HZHA 3UB7A 4I5SA 5TBMA 4XT2A 1DP9A 4QPRA 3UE3A 5I5LA 2WKQA 4HNBA 4MDZA 2P04A 2D01A 1S1YA 3NOTC 1YKDA 4EUVA 2CMNA 2PDRA 2VEAA 2VLGA 3H82A 2K31A 5HD5A 1MC0A 3P01A 2V1BA 5HDDA 2J3WA 4EESA 3UMEA 4Y2FA 2DMWA 4OOMA 2D02A 4HJ3A 4BBUA 2VKSA 3C2WA 4CQHA 1S4SA 2YKFA 3MJQA 4LRYC 4PHTA 4EU0A 3OCNA 1YAXA 2HF6A 5KIZA 3K3DA 1T1CA 1OPXA 3JVUA 4YOFA 1S66L 4JGRA 1X0OA 2JKTM 2PD8A 3C30A 3NOPC 4BBTA 3OC2A 3MFXA 5HSQA 4GW9A 2JKRI 3ZYTA 3PHYA 1JNUA 2I9VA 1XJ3A 2KDKA 2FZ0A 2W1TB 3F1OA 3PBTA 2A2LA 4L0LA 3BQ8A 4G3WA 4H6JA 3UMDA 3JVVA 3FPWA 2Y79A 2PD7A 2VV8A 1GSWA 4JGOA 2VZWA 3A0SA 2WKPA 4CLCA 2GNXA 3RH8B 2B18A 1NLYA 1IFQA 2B02A 1MZUA 2W3GA 3H7WA 3F1PA 1ZHHB 3W2ZA 2QJ7A 4YWZA 4GS9B 2A24B 3EQUA 4JGQA 2V0WA 4KQDA 5IS1A 4GHIA 3S7NA 2ZBBA 5AVFA 5HDCA 3HJIA 3K3CA 3PBSA 5DFYA 1BYWA 4FSFA 4EQ1A 5K5BA 2YKHA 4L9GA 4I3AA 5C5KA 2KLIA 4NXEA 4MMNA 5AJGA 4R70A 2W3HA 1D06A 4FOFA 3KSFA 2J3TC 1W63M 2NUPC 3VOLA 2V0UA 1F5MA 3LUQA 4PKYG 4DJ2A 4DN0A 3ULFA 4EERA 5G4ZA 3CAXA 1KOUA 2EA9A 5HWTA 1T1AA 5LBRA 4B93A 2OOLA 4HP9A 3E4OA 5DF9A 1XFNA 4IUKA 3LI9A 2OWHA 1LT0A 1WA9A 3KX0X 3T4TA 1VB6A 4P6ZM 5IU1A 3U2AA 2O9AA 4HI4A 1P9RA 3ICYA 4MN5A 2QYBA 5J3WA 3E4PA 2Y8HA 3NHQA 2GJ3A 4BBVA 2KOIA 3HCYA 4F3LB 5KSHA 1OT9A 1V9ZA 3D3OA 3C38A 3LIEA 3R4KA 1OT6A 3B33A 1MKMA 3MXQA 2IA2A 2HJ9C 1OTEA 3S7PA 1DP8A 2NUTC 4YNRA 3TJZC 4GS9A 1XFQA 2A24A 1H3QA 3TE8A 2ZMVA 1F9IA 4NXGA 4GLQA 4K08A 1TS7A 1P9WA 4CLCD 2VA0A 2OWJA 2XA7S 1T19A 5F6AA 3T4LA 3GECA 5CX7A 1OTBA 4NXBA 3NJAA 1TS6A 2K7SA 3BJNA 3IS2B 3O5YA 4WN5A 3HJKA 4I3JA 4NXFA 2O9CA 3EEHA 4LRXC 3EWKA 1N9NA 2PR5A 3CITA 3LYXA 4JGPA 3A0VA 4Y3IA 1NWZA 5HD3A 4G3VA 4PAUA 4IJGA 3R7WB 2O9BA 1P0ZA 3OCLA 5J4EA 3S7OA 2HJEA 2PYPA 4IUHA 2K2NA 2W3FA 3LFVA 4NKPA 3FG8A 3KO6A 2J3TD 2LB5A 5MC7A 4MN7A 2V1AA 2V9AA 4I38A 1Y28A 3OOVA 3MMHA 3LR4A 3E0YA 3PBOA 5A8BA 4B9OA 4NEED 2VX8A 4UQIS 1IOUA 1W63Q 4EETB 2QWSA 1TF1A 2XSSA 1P97A 3LIBA 4O01A 4G3KA 4UEYA 3RFBA 4LPZA 2ZMFA 3E98A 2PR6A 1LSXA 5IT5A 4R3AA 2M7VA 5F68A 1YSQA 2H28A 1VHMA 5G4YA 2ZOIA 5HL6A 2P08A 4EXOA 3V67A 5TBMB 2W1RA 4Y5FA 1GSVA 4XT2B 3VE4A 3CWFA 4O8GA 1EW0A 1LL8A 2BASA 4Q0IA 3KYZA 3PBQA 3ZQ5A 1S67L 3KSHA 1UWNX 4HQAA 1XJ2A 5HPFA 2WKRA 4BMWA 4Q0HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3H82 B;  3VE3 A;  1V9Y A;  3FC7 A;  1N9O A;  5HWW A;  3SW1 A;  4RQ9 A;  1UGU A;  1OTD A;  2INW A;  5DJT A;  5AVE A;  5HDS A;  3UB8 A;  1S4R A;  2P7J A;  3P7N A;  4WL9 A;  4HJ4 A;  1UWP X;  2JHE A;  2QHK A;  1S1Z A;  2Z6D A;  4HH3 A;  3C8C A;  4R6L A;  3F1O B;  2ZOH A;  1T18 A;  3MQQ A;  3UE6 A;  2KX6 A;  1OJG A;  2PYR A;  4MN6 A;  2J80 A;  3H7W B;  3F1P B;  1OTI A;  3T50 A;  3OLO A;  5DKK A;  4DJ3 A;  3D72 A;  4GHI B;  4WLA A;  2M1C A;  4HIA A;  2VV7 A;  1XJ4 A;  3LIA A;  1F98 A;  4EW7 A;  1DRM A;  3BY9 A;  3GDI A;  2L4R A;  3LIF A;  5J7E A;  1DP6 A;  4HP4 A;  2QJ5 A;  4L9F A;  1GSX A;  1LSV A;  5HWV A;  5F69 A;  3A0R A;  3LIC A;  4M4X A;  4F3L A;  3F1N B;  3E4Q A;  5DKL A;  3H9W A;  4GCZ A;  3LI8 A;  1TS8 A;  2PHY A;  1TS0 A;  3UB6 A;  3PYP A;  3CLO A;  4EEU A;  4PKY A;  4E04 A;  2L0W A;  2HV1 A;  3IS2 A;  4L9E A;  4LLO B;  4KUO A;  1OJ5 A;  3UB9 A;  3BY8 A;  4I3I A;  1XJ6 A;  2QKP A;  1OTA A;  3G6O A;  5F5Y A;  4R38 A;  5DJU A;  4HHD A;  4HH2 A;  2R78 A;  4HY8 A;  4KUK A;  3MQO A;  1G28 A;  4EEP A;  1LSW A;  2Z6C A;  1ODV A;  3NOU C;  4HJ6 A;  1T1B A;  3F1N A;  1N9L A;  3BWL A;  4WF0 A;  1D7E A;  3RTY A;  4HOI A;  4WUJ A;  2JN7 A;  5EFW A;  4I39 A;  4LRZ E;  4H6J B;  3IBR A;  2W27 A;  3MR0 A;  2L1M A;  2W0N A;  5HZH A;  2VV6 A;  3LID A;  3UB7 A;  4I5S A;  5TBM A;  4XT2 A;  1DP9 A;  5I5L A;  2WKQ A;  4HNB A;  2D01 A;  1S1Y A;  3NOT C;  2CMN A;  2PDR A;  2VEA A;  2VLG A;  3H82 A;  5HD5 A;  2V1B A;  5HDD A;  4EES A;  3UME A;  2D02 A;  4HJ3 A;  4BBU A;  3C2W A;  1S4S A;  2YKF A;  3MJQ A;  4LRY C;  5KIZ A;  3K3D A;  1T1C A;  1S66 L;  4JGR A;  1X0O A;  2PD8 A;  3NOP C;  4BBT A;  3MFX A;  5HSQ A;  4GW9 A;  3PHY A;  1JNU A;  2I9V A;  1XJ3 A;  2KDK A;  3F1O A;  4H6J A;  3UMD A;  2PD7 A;  2VV8 A;  1GSW A;  4JGO A;  3A0S A;  2WKP A;  3RH8 B;  2B02 A;  1MZU A;  3H7W A;  3F1P A;  2QJ7 A;  4YWZ A;  4GS9 B;  2A24 B;  4JGQ A;  2V0W A;  4KQD A;  5IS1 A;  4GHI A;  2ZBB A;  5AVF A;  5HDC A;  3HJI A;  3K3C A;  1BYW A;  4EQ1 A;  2YKH A;  4L9G A;  4I3A A;  4NXE A;  4R70 A;  1D06 A;  3VOL A;  2V0U A;  3LUQ A;  4PKY G;  4DJ2 A;  3ULF A;  4EER A;  5G4Z A;  3CAX A;  1KOU A;  2EA9 A;  5HWT A;  1T1A A;  2OOL A;  4HP9 A;  3E4O A;  1XFN A;  3LI9 A;  2OWH A;  1LT0 A;  1WA9 A;  3KX0 X;  1VB6 A;  5IU1 A;  4HI4 A;  3ICY A;  4MN5 A;  5J3W A;  3E4P A;  3NHQ A;  2GJ3 A;  4BBV A;  4F3L B;  1OT9 A;  1V9Z A;  3LIE A;  1OT6 A;  3B33 A;  3MXQ A;  1OTE A;  1DP8 A;  4GS9 A;  1XFQ A;  2A24 A;  1F9I A;  4NXG A;  4K08 A;  1TS7 A;  2OWJ A;  1T19 A;  5F6A A;  3GEC A;  1OTB A;  4NXB A;  3NJA A;  1TS6 A;  2K7S A;  3IS2 B;  4WN5 A;  3HJK A;  4I3J A;  4NXF A;  3EEH A;  4LRX C;  3EWK A;  1N9N A;  2PR5 A;  3LYX A;  4JGP A;  3A0V A;  1NWZ A;  5HD3 A;  1P0Z A;  5J4E A;  2PYP A;  3FG8 A;  2V1A A;  2V9A A;  4I38 A;  1Y28 A;  5A8B A;  4B9O A;  4EET B;  2QWS A;  1P97 A;  3LIB A;  4LPZ A;  2PR6 A;  1LSX A;  4R3A A;  5F68 A;  5G4Y A;  2H28 A;  2ZOI A;  4EXO A;  5TBM B;  1GSV A;  4XT2 B;  3VE4 A;  3CWF A;  1EW0 A;  1LL8 A;  2BAS A;  3ZQ5 A;  1S67 L;  1UWN X;  4HQA A;  1XJ2 A;  2WKR A; 
#chains in the Genus database with same CATH topology
 1CEF A;  1W8Q A;  2VGL S;  3UE1 A;  1YLT A;  4FH2 A;  1QMF A;  3Q7V B;  3O86 A;  4MNR A;  3RXW A;  4E6W A;  5FQM A;  4RQ9 A;  2W1T A;  2GZA A;  3T12 B;  5GL9 A;  1RGY A;  2H0Y A;  1BLH A;  4CPK A;  2Y2O A;  3P7N A;  2V8F A;  4WL9 A;  3TW8 A;  3BLS A;  1UWP X;  3PR6 A;  5FEG A;  5FQ9 A;  3LCE A;  4BQM A;  1G6O A;  2QHK A;  1S1Z A;  4MLL A;  1ES5 A;  4HH3 A;  1ONG A;  3CUE C;  3V39 A;  2Y2G A;  2XK1 A;  4R6L A;  1LL5 A;  1NRJ A;  3NC8 A;  3SS4 A;  1YSP A;  2KX6 A;  2W3E A;  4R3B A;  3A3F A;  1NLZ A;  3C4P A;  1SDN A;  2ZLY A;  1BT5 A;  1OJG A;  5F1F A;  1HLU P;  4MBH A;  2JKR M;  4E3I A;  2XRN A;  1BTL A;  1K55 C;  1OTI A;  3OLO A;  5EOO A;  2OV5 A;  5CGS A;  3W8K A;  4WLA A;  2VV7 A;  5GLA A;  3VOZ A;  3IX4 A;  5J7E A;  3G31 A;  3UO9 A;  2OAP 1;  3A0R A;  5DF8 A;  5CED A;  1K54 A;  1NZO A;  4AFI A;  3LEQ A;  5CER A;  3F1N B;  4WEK A;  3HL9 A;  5DTT A;  3E4Q A;  4BWI A;  4DE2 A;  4GD8 A;  4KQR A;  3UE0 A;  3U4L P;  3BW6 A;  2PHY A;  5TJJ A;  3UB6 A;  3FPV A;  5CGX A;  1H8Y A;  3Q81 A;  3SH7 A;  3N6I A;  5A90 A;  5HW3 A;  3T4S A;  2M7U A;  3IS2 A;  4LLO B;  4QU3 A;  2HPB A;  3UPN A;  1JWV A;  1NRF A;  1XJ6 A;  2XLN A;  3LR5 A;  3CMZ A;  4UA9 A;  3G6O A;  3T4K A;  5F5Y A;  1SDE A;  5DJU A;  2HDR A;  3D4F A;  3IF6 C;  1RGZ A;  4C6Y A;  3MKF A;  2WAD A;  4KUK A;  3FZC A;  4JXW A;  2H10 A;  1CJF A;  4EEP A;  1MPL A;  2WZZ A;  4KZB A;  1HTZ A;  4C75 A;  1ODV A;  4WEL A;  3LR3 A;  3NBL A;  3F1N A;  3A3I A;  2ZQ7 A;  4WZ4 A;  3B42 A;  4FUW A;  1BLS A;  1L3L A;  1TD5 A;  2XA7 M;  2JN7 A;  3O3V A;  2PRF A;  5L8M A;  2JE5 A;  2P9V A;  2HP5 A;  4RX2 A;  4LCM A;  4WMC A;  3OPR A;  2W27 A;  3CUE A;  3IXH A;  3TOI A;  3JPU A;  2W0N A;  3QP8 A;  2FH5 A;  3UDF A;  5HZH A;  1CEG A;  1DP9 A;  5FA7 A;  4OPZ A;  1KDS A;  5I5L A;  5M1A A;  1XGI A;  4R23 A;  2WKQ A;  2P04 A;  3HLF A;  3NOT C;  3HUM A;  2CMN A;  1K55 A;  5L2F A;  3P01 A;  5HDD A;  1WYB A;  3BRM A;  4WYY A;  5FQK A;  3W4P A;  4Y2F A;  3ZVW A;  2Y2K A;  3VP0 A;  4BBU A;  3SH9 A;  1PZO A;  4FD8 A;  3L9K A;  5KIZ A;  1OPX A;  5GHX A;  3WWX A;  4PMA A;  1LL9 A;  5HL1 A;  1VET A;  4OQG A;  4BBT A;  3OC2 A;  2JKR I;  3BFD A;  1JNU A;  5CEC A;  3PTE A;  2FZ0 A;  4L0L A;  1JTD A;  5CTM A;  1NY0 A;  2Y79 A;  1GSW A;  3A0S A;  1ZG6 A;  1MZU A;  2W3G A;  3F1P A;  3TG9 A;  4GS9 B;  4DDS A;  3IXD A;  3EQU A;  3ITA A;  2XD1 A;  3K3C A;  3PBS A;  1FOF A;  3LY4 A;  4RVA A;  4L9G A;  1ERO A;  3BYD A;  4I3A A;  1IEM A;  4DE0 A;  5AJG A;  4X69 A;  5AQ9 A;  3IF6 A;  5KSC A;  2JBF A;  2J3T C;  4PKY G;  4U0X A;  1E3U A;  5EVI D;  4B4Z A;  4DJ2 A;  3ULF A;  1PNE A;  4H8R A;  4HP9 A;  2OWH A;  4P87 A;  1LT0 A;  4D60 A;  1VB6 A;  4KZ6 A;  3S1Y A;  3OZH A;  4OP8 A;  1IKG A;  1XXM A;  3HCY A;  3BEC A;  3T1Q B;  1E4D A;  2X02 A;  1IYO A;  4ZBE A;  4KG5 A;  4K0W A;  4IVK A;  1BZA A;  1OTE A;  3S7P A;  2NUT C;  4GS9 A;  1K6R A;  4E3J A;  1DJC A;  3ZG5 A;  2J9P A;  1P9W A;  5IHV A;  2ZL1 A;  2VA0 A;  4A5R A;  5L10 A;  1WE4 A;  3NJA A;  1TS6 A;  3BJN A;  4QY5 A;  1IYP A;  3HJK A;  2Y55 A;  4I3J A;  4NXF A;  1N9N A;  3T1R A;  3SS5 A;  3V5M A;  3LYX A;  4JGP A;  3A0V A;  2ZC5 B;  3MKE A;  4P0M A;  1FIL A;  1GCE A;  3E2L A;  3KYE A;  5HD3 A;  4PAU A;  1JVJ A;  3R7W B;  1YQS A;  2J8Y A;  1IEL A;  3OCL A;  3DTE A;  3S7O A;  1QME A;  4IUH A;  3C7U A;  2XEP A;  3CPT B;  3L7H A;  3VSK A;  1GHP A;  2V1A A;  2V9A A;  1MWU A;  5EVL A;  4D2O A;  5CHU A;  1KVM A;  5A8B A;  4B9O A;  2VX8 A;  2XR0 A;  1IOU A;  3DTM A;  1SKF A;  5GLC A;  2QWS A;  2H5S A;  5DF7 A;  3BFC A;  3DWK A;  2PBY A;  4LPZ A;  3E98 A;  3PAG A;  2PR6 A;  3IF5 A;  4OVD A;  2XH9 A;  4LGW A;  2VGK A;  3DWZ A;  4OP5 A;  5HL6 A;  3A3J A;  3NCK A;  4EXO A;  3V67 A;  1XA1 A;  5TBM B;  4Y5F A;  1GSV A;  3VE4 A;  3CWF A;  4O8G A;  3O88 A;  2BAS A;  4OQH A;  1U60 A;  2WKI A;  3KSH A;  2WYX A;  2WKR A;  5A93 A;  3VE3 A;  3CPT A;  1FCM A;  4OKP A;  4WEJ A;  1NYY A;  2LB9 A;  1OTD A;  2ZJ9 A;  2INW A;  1E25 A;  5DJT A;  5HDS A;  3UB8 A;  5L07 A;  4Y0O A;  5KMW A;  4EWF A;  2OAQ 1;  3ZG0 A;  2JHE A;  1L0E A;  4ZJ2 A;  4RA7 A;  3C8C A;  5AQA A;  3QP6 A;  2PU2 A;  4DXC A;  3IHB A;  3F1O B;  3EOI A;  3B3X A;  2ZOH A;  1T18 A;  2XD5 A;  3MQ0 A;  3C5A A;  3NIA A;  4GJ4 A;  2E8J A;  4MN6 A;  4P85 A;  4Z9Q A;  3H7W B;  3IX3 A;  1DY6 A;  2AVX A;  3FV7 A;  5E2F A;  4GHI B;  4BD1 A;  4HIA A;  5FL3 A;  2Y2Q A;  4IBR A;  4GB7 A;  2ACG A;  1DP6 A;  3DTK A;  5TGF A;  2ZQ9 A;  1LSV A;  5F69 A;  3LIC A;  4JF4 A;  1N4O A;  4WZ5 C;  5HFO A;  4UQI M;  4F3L A;  2C5W B;  2PU4 A;  4S2L A;  4JF6 A;  5DFX A;  4HBT A;  1KDW A;  1HD8 A;  4IBX A;  1STZ A;  1TS8 A;  3M2J A;  3MF0 A;  3OBF A;  1KGG A;  1TS0 A;  4MCW A;  3QP2 A;  1FSW A;  4X55 A;  4CLC C;  3EQV A;  4PKY A;  3T4Q A;  4DMZ A;  5JYO A;  4S2K A;  4E04 A;  3G35 A;  3GMW A;  4E3M A;  1PW1 A;  4XXR A;  4I3I A;  2QKP A;  4WMC D;  5KZH A;  2PT7 A;  4Y0T A;  2BTF P;  2VGL M;  2ZQD A;  4FTX A;  2Z2M B;  2OSU A;  5FQQ A;  1YT4 A;  1OME A;  2EWW A;  2DCF A;  4HY8 A;  3N4I A;  2A3U A;  1G28 A;  2Z6C A;  3NOU C;  4HJ6 A;  2ZM2 A;  3C4O A;  5HX9 A;  3CI6 A;  1W8Y A;  5DVA A;  1GA9 A;  2H0T A;  3A3D A;  1I2W A;  5EFW A;  4R1G A;  2HDS A;  4NK3 A;  4RX3 A;  1MBL A;  5CHJ A;  4LRZ E;  4H6J B;  5HAR A;  2EXB A;  3MR0 A;  4CLC B;  3VMA A;  3KYQ A;  5M18 A;  2VV6 A;  5CGW A;  2Y2J A;  5AQ7 A;  4MDZ A;  4C3Q A;  4JLF A;  1S1Y A;  2VLG A;  2VEA A;  1L0F A;  3MXS A;  5F83 A;  1S6R A;  4R4S A;  5GLB A;  1W7F A;  4EES A;  2I72 A;  3NDG A;  3G2Y A;  4QHC A;  3Q7V A;  3HVF A;  5EOE A;  5JYP A;  4HJ3 A;  5CHM A;  5F1G A;  1ES4 A;  3C2W A;  4UAA A;  4CQH A;  1S4S A;  4R3J A;  4LRY C;  4PHT A;  5FQI A;  4YOF A;  1X0O A;  2JKT M;  4WZ5 A;  1RCJ A;  2GDN A;  3HUN A;  1YMX A;  1XJ3 A;  4BD0 A;  1L0G A;  1I5Q A;  4H6J A;  3FPW A;  2PD7 A;  2VV8 A;  3RXX A;  1FR1 A;  2HDQ A;  2WKP A;  4CLC A;  1ZKJ A;  2GNX A;  1IFQ A;  2B02 A;  3LEZ A;  2Y59 A;  3IWQ A;  3IQA A;  1ZHH B;  3W2Z A;  5BOH A;  4YWZ A;  5E2H A;  4KG2 A;  1ESU A;  1MY8 A;  2WGW B;  4Y0U A;  3BFE A;  4ZAM A;  3S7N A;  5HDC A;  4KZ7 A;  3ZG9 B;  2YKH A;  1K0K A;  3VP2 A;  1KGE A;  3AGE A;  2W3H A;  1G6A A;  4DXB A;  1KE0 A;  2NUP C;  4DN0 A;  2R9X A;  3OPP A;  1T1A A;  3IT9 A;  4EUZ A;  1WA9 A;  4B88 A;  3U2A A;  4P6Z M;  4HI4 A;  1ES2 A;  4MN5 A;  1W79 A;  3DW0 A;  4BBV A;  1SHV A;  3C38 A;  2EX6 A;  2ZC3 B;  4LV0 A;  2IA2 A;  4QB8 A;  4ID4 A;  2BLS A;  1CQA A;  3TE8 A;  4NXG A;  4K08 A;  1K38 A;  1FCN A;  3M6B A;  2XA7 S;  2Q9M A;  4WBG A;  3GEC A;  3FYZ A;  1OTB A;  4X25 A;  4ESP A;  5CRF A;  4Y7P A;  4MBK A;  3LGO A;  5AQB A;  2Y2H A;  3IXB A;  3EEH A;  4LRX C;  5EM0 A;  3EWK A;  3CIT A;  1ALQ A;  3IWO A;  4Y3I A;  4G3V A;  4IJG A;  2O9B A;  1P0Z A;  5FDH A;  5J4E A;  1BUL A;  1YLJ A;  4HEF A;  2ZMA A;  2K2N A;  2WKE A;  2W3F A;  1W5D A;  3AGF A;  2ZC4 B;  5MC7 A;  2J3T D;  4QJG A;  1CI8 A;  5EE8 A;  4I38 A;  3CG5 A;  3OOV A;  3LR4 A;  1S0W A;  2RCX A;  2ZQC A;  4EET B;  4F94 A;  4LV1 A;  4ZTK A;  1M40 A;  4UEY A;  3RJU A;  2ZQ8 A;  2ZMF A;  1LSX A;  5IT5 A;  4OQ0 A;  1ZG4 A;  1FCO A;  2R9W A;  1YSQ A;  2H28 A;  1VHM A;  3DTI A;  3GR2 A;  5G4Y A;  4PM8 A;  2P08 A;  2Y2N A;  1J3W A;  2W1R A;  2IWC A;  4XT2 B;  2VGJ A;  4ZDX A;  1EW0 A;  4QY6 A;  2Y2I A;  5G18 A;  5CTN A;  1K56 D;  1S67 L;  1UWN X;  4HQA A;  4BMW A;  3H82 B;  3VOY A;  1V9Y A;  2C6W B;  2XF3 A;  2B5R A;  4KZ4 A;  1N9O A;  1SKO B;  4CJN A;  4GNU A;  4U3T A;  4DE3 A;  3PXP A;  3PBN A;  4EQI A;  2V1Z A;  5AVE A;  5U47 A;  1ESI A;  3MZD A;  1K25 A;  1JTG A;  4O7D A;  2MJ6 A;  3DAV A;  1A0K A;  3UE6 A;  4X6T A;  3MFD A;  2EX9 A;  2WAF A;  4M3K A;  2J80 A;  1TDG A;  4BJP A;  4LCL A;  3ZG8 B;  1LHY A;  1H0M A;  5FQJ A;  3EEA A;  2WUQ A;  5DKK A;  3DBA A;  1PI5 A;  1ERQ A;  1EWZ A;  3D9Y A;  1XJ4 A;  4II7 A;  3P09 A;  1DRM A;  4P6B A;  3BY9 A;  2L4R A;  3LIF A;  5EM1 A;  4HP4 A;  4L9F A;  3T1X A;  3VV4 A;  1CI9 A;  4M4X A;  3QHY A;  4E3O A;  3ZHH A;  1MKI A;  2EWV A;  4LEN A;  3Q07 A;  2JCH A;  1XPB A;  1YLP A;  3H9W A;  4E3K A;  3LI8 A;  5GHZ A;  2GX5 A;  2JC7 A;  5DTS A;  3PYP A;  1GHI A;  1ONH A;  4IHQ A;  3CLO A;  3ZGA B;  3V50 A;  3SZT A;  2WGV A;  4EEU A;  2Y4A A;  2L0W A;  2HV1 A;  2UV0 E;  4EBP A;  1K4F A;  3VP3 A;  3NUL A;  2Y91 A;  1L2S A;  4Z1W A;  1YLY A;  3BY8 A;  2X71 A;  4DE1 A;  2IWD A;  3N8R A;  4S2I A;  1I2S A;  2EFX A;  3KSI A;  4HH2 A;  1Z09 A;  3TRC A;  3R7W A;  3SH8 A;  5EVI B;  4N9L A;  3BM6 A;  3FKV A;  1NZU A;  1YM1 A;  3MBZ A;  1WYC A;  1G5U A;  3NI9 A;  3ISG A;  1MXO A;  1N9L A;  4RYE A;  4WF0 A;  1GA0 A;  1D7E A;  5FAP A;  1EI5 A;  3BEB A;  3RTY A;  1PI4 A;  4HOI A;  4ZJ3 A;  3T4J A;  1YLW A;  4S2P A;  4ZRR A;  3UPO A;  4N92 A;  4CLC E;  3MZF A;  4N1X A;  4ME4 A;  4I39 A;  3UPP A;  3BQA A;  4Q8I A;  3IBR A;  4ETX A;  3EGD C;  5GHY A;  1KE3 A;  1XGJ A;  4YIN A;  3UB7 A;  4I5S A;  5TBM A;  3S4X A;  4QPR A;  3NEC A;  1SCW A;  2CC1 A;  4EUV A;  4B4X A;  4OON A;  2IWB A;  4GDB A;  2K31 A;  5HD5 A;  1MC0 A;  2V1B A;  4OPQ A;  2J3W A;  3UME A;  3NY4 A;  4JF5 A;  1DJA A;  2VKS A;  2DNS A;  4MEZ A;  2EFU A;  2YKF A;  3N7W A;  4EU0 A;  1YAX A;  2HF6 A;  3T1S A;  3K3D A;  4JGR A;  2Y2L A;  2ZC6 B;  3O87 A;  3UNW A;  2PD8 A;  4S2M A;  1LI9 A;  1MWR A;  4PPR A;  5HSQ A;  3ZYT A;  1HZO A;  2I9V A;  2KDK A;  4GZB A;  2W1T B;  3F1O A;  1RP5 A;  4X53 A;  4UHU A;  2ZC7 A;  4G3W A;  3UMD A;  3JVV A;  3QP1 A;  3G34 A;  5FI7 A;  4KZ8 A;  3RH8 B;  1NLY A;  4PM9 A;  3H7W A;  2QJ7 A;  2EXA A;  4HBU A;  3M6H A;  1FR6 A;  3I7J A;  1PWG A;  2OLV A;  3ZNT A;  4JGQ A;  2V0W A;  4KQD A;  4S2J A;  1G68 A;  5IS1 A;  4GHI A;  3G4P A;  1JWP A;  5GLD A;  5I94 A;  3HJI A;  5DFY A;  4FSF A;  5K5B A;  3CZD A;  5C5K A;  4NXE A;  4MMN A;  4KZA A;  3N8S A;  2EX2 A;  5EUA A;  3IHA A;  4FOF A;  3KSF A;  3VOL A;  3LUQ A;  1F5M A;  1TVF A;  5HAP A;  5G4Z A;  5EVE A;  2EA9 A;  5HWT A;  2QZ6 A;  5FEF A;  2PAV P;  4E6X A;  5LBR A;  3ZNY A;  1YPR A;  1D1J A;  4B93 A;  1J9M A;  2OOL A;  4EBL A;  1XFN A;  3LI9 A;  1KGF A;  2Z2L B;  1FIK A;  4DRT A;  1YLZ A;  3QNC A;  5IU1 A;  2O9A A;  3GVB A;  3ICY A;  1K6S A;  2QYB A;  4FH4 A;  3E4P A;  1C3B A;  3LO7 A;  3NHQ A;  3WRT A;  2DRW A;  5KSH A;  4IED A;  1OT9 A;  3MSH A;  5EV0 A;  4EBN A;  2X01 A;  3D3O A;  3LIE A;  3R4K A;  3MXQ A;  1K4E A;  2HJ9 C;  2Y2P A;  1DP8 A;  3TJZ C;  2OLU A;  1F9I A;  4BL3 A;  1Q2P A;  3FWL A;  3M2K A;  3PAE A;  4GLQ A;  3WS4 A;  3HLE A;  4N9K A;  4X1L A;  3W4O A;  3G2Z A;  2OWJ A;  3BLM A;  1SZV A;  1VQQ A;  2XDM A;  2K7S A;  2G2U A;  4K0X A;  3IS2 B;  4WN5 A;  4BLM A;  2O9C A;  1TEM A;  5DTK A;  4OLG A;  1H8Z A;  1PZP A;  3VP1 A;  1XKZ A;  5TFQ A;  2XFT A;  1E3U D;  1CF0 A;  2HJE A;  5J8X A;  2HP6 A;  1PW8 A;  4DKI A;  3LFV A;  2WZX A;  4NKP A;  2LB5 A;  2JKF A;  3Q1F A;  1PWC A;  1Y28 A;  4NEE D;  2G2W A;  3GQZ A;  3JYI A;  1TF1 A;  1P97 A;  1PWD A;  1XP4 A;  3LIB A;  4O01 A;  3RFB A;  3HLW A;  2FFY A;  3WS2 A;  2P9V B;  1VEU B;  4R3A A;  4DF6 A;  2M7V A;  1H5X A;  2WKH A;  3BFG A;  1DJB A;  2ZOI A;  3UDI A;  4E3N A;  4N1H A;  3S22 A;  4KEN B;  1YMS A;  5FAS A;  3ZDJ A;  3PBQ A;  3HBR A;  4GKU A;  2JKG A;  1AXB A;  4Q0H A;  1L0D A;  3T4O A;  1FQG A;  3FC7 A;  2B95 A;  3Q82 A;  3W4Q A;  5HWW A;  3GV9 A;  5A91 A;  3HUO A;  5FI6 A;  3SW1 A;  5FAO A;  3UY6 A;  3IXG A;  1UGU A;  1O7E A;  5L09 A;  2RL3 A;  3B47 A;  1S4R A;  2P7J A;  4Q0J A;  4OH0 A;  5HAQ A;  4HJ4 A;  2XRO A;  2V8C A;  1VET B;  2Z6D A;  4XUZ A;  2WGW A;  1H8M A;  3BFF A;  3GSG A;  4P6Z S;  4X56 A;  1VEU A;  3HRE A;  2G7U A;  3VFF A;  3MQQ A;  1XX2 A;  4OOY A;  3CHW P;  2PYR A;  4FCF A;  4PM6 A;  1ZTU A;  4LV2 A;  3F1P B;  1HVB A;  1IKI A;  3T50 A;  5HPI A;  1PIO A;  4DJ3 A;  4QD4 A;  3D72 A;  4KQO A;  3WRZ A;  2M1C A;  5TR7 A;  3LIA A;  1F98 A;  4EW7 A;  1Y54 A;  3GDI A;  2QJ5 A;  3IF6 B;  1GSX A;  5HWV A;  3MXR A;  3K2N A;  4KZ9 A;  3EGX C;  2E8I A;  1K57 C;  5DKL A;  4ARZ B;  1NXY A;  4Y13 A;  3NDE A;  2QPN A;  4GCZ A;  4GN2 A;  4NG2 A;  1PYY A;  3S7Q A;  2JKT I;  1VM1 A;  2VJW A;  4L9E A;  1N9B A;  4KUO A;  1OJ5 A;  3UB9 A;  1ERM A;  2A49 A;  3LR0 A;  1OTA A;  4R38 A;  3KSG A;  3G30 A;  2ZL1 B;  4HHD A;  3GTC A;  2R78 A;  3MQO A;  2W3D A;  1ACF A;  3MZE A;  1LSW A;  3PBR A;  4OPY A;  4OOL A;  2ZD8 A;  4X68 A;  4GOG A;  1Y4O A;  4JXV A;  1MWS A;  4ETZ A;  1BLC A;  1T1B A;  4LFU A;  3IBJ A;  3TSG A;  3QP4 A;  4ARZ A;  2HGV A;  1AWI A;  3BWL A;  3IWI A;  2O0Y A;  4O0P A;  3AGD A;  5CXW A;  4WUJ A;  4S2N C;  2J9O A;  2O99 A;  3IH8 A;  2HP9 A;  2PBD P;  3HLB A;  4IVI A;  1FSY A;  1F2K A;  2L1M A;  3LID A;  4XT2 A;  4JPM A;  5FDS A;  3Q7Z A;  3UE3 A;  5HAI A;  4KZ5 A;  3QP5 A;  5EVI C;  5A92 A;  4HNB A;  2D01 A;  4DDY A;  2HZ5 A;  1YKD A;  2PDR A;  4WM9 A;  1IYQ A;  2XGN A;  2XFS A;  3H82 A;  2Y2M A;  2ZM8 A;  1SKO A;  2DMW A;  4OOM A;  1KE4 A;  4U0T A;  3UN7 A;  2D02 A;  2XQZ A;  3QNB A;  4YFM A;  2FFF B;  3V3S A;  1O07 A;  3MJQ A;  4E3L A;  1ZC2 A;  3OPL A;  2V20 A;  2WAE A;  3OCN A;  1ES3 A;  1T1C A;  3JVU A;  3VP4 A;  1S66 L;  1PRQ A;  1LI0 A;  5FSR A;  3C30 A;  3NOP C;  4NET A;  5E2E A;  3MFX A;  4GW9 A;  1K57 A;  3PHY A;  3ZFZ A;  4XUX A;  3GRJ A;  5FAQ A;  4S2O A;  3PBT A;  1GHM A;  2A2L A;  3BQ8 A;  3VFH A;  4JGO A;  2VZW A;  4BEN A;  2J7V A;  1NJ4 A;  3A3E A;  4BL2 A;  2B18 A;  2QMI A;  4PM5 A;  2A24 B;  4GD6 A;  1BLP A;  4ZJ1 A;  2ZBB A;  5AVF A;  4JBF A;  1BYW A;  4EQ1 A;  3C7V A;  3ITB A;  3E2K A;  2KLI A;  1NYM A;  1Z6F A;  4R70 A;  1D06 A;  3VSL A;  2WGI A;  5F82 A;  1PFL A;  1W63 M;  3LY3 A;  2V0U A;  4QWO A;  4EER A;  3CAX A;  5FI2 A;  1KOU A;  1M6K A;  5FAT A;  3SS3 A;  3E4O A;  5DF9 A;  3UB5 P;  4IUK A;  4JXS A;  3UDX A;  3KX0 X;  3T4T A;  4UA7 A;  1P9R A;  2Q9N A;  5J3W A;  4R4R A;  2Y8H A;  2GJ3 A;  3IH9 A;  5EEC A;  5D3O A;  2KOI A;  4F3L B;  1IYS A;  4S2N A;  4HES A;  3ZG7 B;  1V9Z A;  4OPR A;  1OT6 A;  3B33 A;  1MKM A;  3FKW A;  3ZCZ A;  2ZM0 A;  4X1M A;  3OPH A;  4YNR A;  3MS6 A;  1XFQ A;  2A24 A;  1H3Q A;  2ZMV A;  4KQQ A;  2VK3 A;  1TS7 A;  4CLC D;  4K91 A;  2WK0 A;  5CEB A;  1T19 A;  5F6A A;  3T4L A;  5CX7 A;  4GDN A;  4NXB A;  3CJM A;  1Q2Q A;  5EVI A;  2UWX A;  4Y15 A;  5M19 A;  1K56 A;  3O5Y A;  3ZVT A;  4R0Q A;  4Y17 A;  2Q0O A;  3SOI A;  1XA7 A;  2HDU A;  3WS5 A;  4KG6 A;  2PR5 A;  4KZ3 A;  4OLD A;  1NWZ A;  4LV3 A;  1BUE A;  2BG1 A;  1TDL A;  1K54 C;  3V3R A;  2PYP A;  5E43 A;  4JKT A;  4OQI A;  3FG8 A;  3KO6 A;  4MN7 A;  1JWZ A;  3MMH A;  3G32 A;  3E0Y A;  2EX8 A;  3PBO A;  4UQI S;  1W63 Q;  4PM7 A;  4EV4 A;  2XSS A;  5EPH A;  1MWT A;  2P74 A;  1LLB A;  4UA6 A;  4G3K A;  3P98 A;  3WS0 A;  1CK3 A;  5E2G A;  1BSG A;  3HLD A;  1KVL A;  5F68 A;  3IX8 A;  3HLC A;  3N8L A;  4JXG A;  1LL8 A;  3HLG A;  4Q0I A;  3KYZ A;  3ZQ5 A;  3WS1 A;  4MBF A;  2V2F F;  1XJ2 A;  2ZQA A;  5HPF A; 
#chains in the Genus database with same CATH homology
 3T4O A;  3H82 B;  3VE3 A;  1V9Y A;  2VGL S;  3FC7 A;  1N9O A;  5HWW A;  3SW1 A;  4RQ9 A;  4WEJ A;  2W1T A;  2GZA A;  3PXP A;  1UGU A;  2LB9 A;  1OTD A;  3PBN A;  2INW A;  5DJT A;  5AVE A;  3B47 A;  5HDS A;  3UB8 A;  1S4R A;  2P7J A;  4Q0J A;  3P7N A;  4WL9 A;  3TW8 A;  4HJ4 A;  2OAQ 1;  1UWP X;  2XRO A;  3PR6 A;  1G6O A;  2JHE A;  2QHK A;  1S1Z A;  2Z6D A;  4HH3 A;  3C8C A;  3CUE C;  1H8M A;  4R6L A;  4P6Z S;  2MJ6 A;  3F1O B;  3EOI A;  1NRJ A;  2G7U A;  1YSP A;  2ZOH A;  1T18 A;  3MQQ A;  3UE6 A;  2KX6 A;  2W3E A;  3MQ0 A;  1NLZ A;  4GJ4 A;  1OJG A;  2PYR A;  4MN6 A;  1ZTU A;  2J80 A;  3H7W B;  2JKR M;  3F1P B;  2XRN A;  4BJP A;  1OTI A;  3T50 A;  3OLO A;  3EEA A;  5DKK A;  3DBA A;  5HPI A;  4DJ3 A;  3D72 A;  4GHI B;  4KQO A;  4WLA A;  2M1C A;  4HIA A;  5FL3 A;  2VV7 A;  1XJ4 A;  3LIA A;  4II7 A;  1F98 A;  4EW7 A;  1DRM A;  3BY9 A;  3GDI A;  2L4R A;  3LIF A;  5J7E A;  1DP6 A;  4HP4 A;  2QJ5 A;  4L9F A;  1GSX A;  3VV4 A;  1LSV A;  5HWV A;  5F69 A;  2OAP 1;  3A0R A;  3K2N A;  3LIC A;  4M4X A;  4UQI M;  4AFI A;  4F3L A;  2EWV A;  3EGX C;  3F1N B;  4WEK A;  4BWI A;  3E4Q A;  5DKL A;  4ARZ B;  5DFX A;  3H9W A;  4GCZ A;  1STZ A;  3LI8 A;  1TS8 A;  3MF0 A;  3OBF A;  3BW6 A;  2GX5 A;  2PHY A;  1TS0 A;  4MCW A;  5TJJ A;  3UB6 A;  3FPV A;  3PYP A;  4IHQ A;  3CLO A;  4CLC C;  4EEU A;  3EQV A;  4PKY A;  3T4Q A;  4DMZ A;  3T4S A;  3S7Q A;  2M7U A;  4E04 A;  2L0W A;  2HV1 A;  2JKT I;  3IS2 A;  2VJW A;  4L9E A;  4LLO B;  4KUO A;  1OJ5 A;  4Z1W A;  3UB9 A;  3BY8 A;  4I3I A;  3LR0 A;  1XJ6 A;  2QKP A;  3LR5 A;  1OTA A;  3G6O A;  5F5Y A;  2PT7 A;  3T4K A;  4R38 A;  3KSG A;  5DJU A;  2VGL M;  4HHD A;  4HH2 A;  3KSI A;  3TRC A;  3R7W A;  2EWW A;  2R78 A;  4HY8 A;  4KUK A;  3MQO A;  2W3D A;  1G28 A;  4EEP A;  1LSW A;  3PBR A;  4OOL A;  2Z6C A;  1ODV A;  4WEL A;  3LR3 A;  4ETZ A;  3NOU C;  4HJ6 A;  1T1B A;  3F1N A;  3IBJ A;  4ARZ A;  1N9L A;  2HGV A;  3BWL A;  3B42 A;  4WF0 A;  2O0Y A;  1D7E A;  4O0P A;  3CI6 A;  3RTY A;  1TD5 A;  4HOI A;  3T4J A;  4WUJ A;  2XA7 M;  2JN7 A;  4ZRR A;  5L8M A;  5EFW A;  4CLC E;  2O99 A;  4ME4 A;  4I39 A;  3BQA A;  4LRZ E;  4H6J B;  3IBR A;  4ETX A;  3EGD C;  2W27 A;  3CUE A;  3MR0 A;  2L1M A;  4CLC B;  2W0N A;  3KYQ A;  2FH5 A;  2VV6 A;  3LID A;  5HZH A;  3UB7 A;  4I5S A;  5TBM A;  4XT2 A;  1DP9 A;  4QPR A;  3UE3 A;  5I5L A;  2WKQ A;  4HNB A;  4MDZ A;  2P04 A;  2D01 A;  1S1Y A;  3NOT C;  1YKD A;  4EUV A;  2CMN A;  2PDR A;  2VEA A;  2VLG A;  3H82 A;  2K31 A;  5HD5 A;  1MC0 A;  3P01 A;  2V1B A;  5HDD A;  2J3W A;  4EES A;  3UME A;  4Y2F A;  2DMW A;  4OOM A;  2D02 A;  4HJ3 A;  4BBU A;  2VKS A;  3C2W A;  4CQH A;  1S4S A;  2YKF A;  3MJQ A;  4LRY C;  4PHT A;  4EU0 A;  3OCN A;  1YAX A;  2HF6 A;  5KIZ A;  3K3D A;  1T1C A;  1OPX A;  3JVU A;  4YOF A;  1S66 L;  4JGR A;  1X0O A;  2JKT M;  2PD8 A;  3C30 A;  3NOP C;  4BBT A;  3OC2 A;  3MFX A;  5HSQ A;  4GW9 A;  2JKR I;  3ZYT A;  3PHY A;  1JNU A;  2I9V A;  1XJ3 A;  2KDK A;  2FZ0 A;  2W1T B;  3F1O A;  3PBT A;  2A2L A;  4L0L A;  3BQ8 A;  4G3W A;  4H6J A;  3UMD A;  3JVV A;  3FPW A;  2Y79 A;  2PD7 A;  2VV8 A;  1GSW A;  4JGO A;  2VZW A;  3A0S A;  2WKP A;  4CLC A;  2GNX A;  3RH8 B;  2B18 A;  1NLY A;  1IFQ A;  2B02 A;  1MZU A;  2W3G A;  3H7W A;  3F1P A;  1ZHH B;  3W2Z A;  2QJ7 A;  4YWZ A;  4GS9 B;  2A24 B;  3EQU A;  4JGQ A;  2V0W A;  4KQD A;  5IS1 A;  4GHI A;  3S7N A;  2ZBB A;  5AVF A;  5HDC A;  3HJI A;  3K3C A;  3PBS A;  5DFY A;  1BYW A;  4FSF A;  4EQ1 A;  5K5B A;  2YKH A;  4L9G A;  4I3A A;  5C5K A;  2KLI A;  4NXE A;  4MMN A;  5AJG A;  4R70 A;  2W3H A;  1D06 A;  4FOF A;  3KSF A;  2J3T C;  1W63 M;  2NUP C;  3VOL A;  2V0U A;  1F5M A;  3LUQ A;  4PKY G;  4DJ2 A;  4DN0 A;  3ULF A;  4EER A;  5G4Z A;  3CAX A;  1KOU A;  2EA9 A;  5HWT A;  1T1A A;  5LBR A;  4B93 A;  2OOL A;  4HP9 A;  3E4O A;  5DF9 A;  1XFN A;  4IUK A;  3LI9 A;  2OWH A;  1LT0 A;  1WA9 A;  3KX0 X;  3T4T A;  1VB6 A;  4P6Z M;  5IU1 A;  3U2A A;  2O9A A;  4HI4 A;  1P9R A;  3ICY A;  4MN5 A;  2QYB A;  5J3W A;  3E4P A;  2Y8H A;  3NHQ A;  2GJ3 A;  4BBV A;  2KOI A;  3HCY A;  4F3L B;  5KSH A;  1OT9 A;  1V9Z A;  3D3O A;  3C38 A;  3LIE A;  3R4K A;  1OT6 A;  3B33 A;  1MKM A;  3MXQ A;  2IA2 A;  2HJ9 C;  1OTE A;  3S7P A;  1DP8 A;  2NUT C;  4YNR A;  3TJZ C;  4GS9 A;  1XFQ A;  2A24 A;  1H3Q A;  3TE8 A;  2ZMV A;  1F9I A;  4NXG A;  4GLQ A;  4K08 A;  1TS7 A;  1P9W A;  4CLC D;  2VA0 A;  2OWJ A;  2XA7 S;  1T19 A;  5F6A A;  3T4L A;  3GEC A;  5CX7 A;  1OTB A;  4NXB A;  3NJA A;  1TS6 A;  2K7S A;  3BJN A;  3IS2 B;  3O5Y A;  4WN5 A;  3HJK A;  4I3J A;  4NXF A;  2O9C A;  3EEH A;  4LRX C;  3EWK A;  1N9N A;  2PR5 A;  3CIT A;  3LYX A;  4JGP A;  3A0V A;  4Y3I A;  1NWZ A;  5HD3 A;  4G3V A;  4PAU A;  4IJG A;  3R7W B;  2O9B A;  1P0Z A;  3OCL A;  5J4E A;  3S7O A;  2HJE A;  2PYP A;  4IUH A;  2K2N A;  2W3F A;  3LFV A;  4NKP A;  3FG8 A;  3KO6 A;  2J3T D;  2LB5 A;  5MC7 A;  4MN7 A;  2V1A A;  2V9A A;  4I38 A;  1Y28 A;  3OOV A;  3MMH A;  3LR4 A;  3E0Y A;  3PBO A;  5A8B A;  4B9O A;  4NEE D;  2VX8 A;  4UQI S;  1IOU A;  1W63 Q;  4EET B;  2QWS A;  1TF1 A;  2XSS A;  1P97 A;  3LIB A;  4O01 A;  4G3K A;  4UEY A;  3RFB A;  4LPZ A;  2ZMF A;  3E98 A;  2PR6 A;  1LSX A;  5IT5 A;  4R3A A;  2M7V A;  5F68 A;  1YSQ A;  2H28 A;  1VHM A;  5G4Y A;  2ZOI A;  5HL6 A;  2P08 A;  4EXO A;  3V67 A;  5TBM B;  2W1R A;  4Y5F A;  1GSV A;  4XT2 B;  3VE4 A;  3CWF A;  4O8G A;  1EW0 A;  1LL8 A;  2BAS A;  4Q0I A;  3KYZ A;  3PBQ A;  3ZQ5 A;  1S67 L;  3KSH A;  1UWN X;  4HQA A;  1XJ2 A;  5HPF A;  2WKR A;  4BMW A;  4Q0H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...