1F9IA

Crystal structure of the photoactive yellow protein mutant y42f
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
125
structure length
125
Chain Sequence
b'MEHVAFGSEDIENTLAKMDDGQLDGLAFGAIQLDGDGNILQFNAAEGDITGRDPKQVIGKNFFKDVAPCTDSPEFYGKFKEGVASGNLNTMFEYTFDYQMTPTKVKVHMKKALSGDSYWVFVKRV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PHOTOACTIVE YELLOW PROTEIN
publication title Coupling of hydrogen bonding to chromophore conformation and function in photoactive yellow protein.
pubmed doi rcsb
source organism Halorhodospira halophila
molecule tags Signaling protein
total genus 35
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2000-07-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00989 PAS PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 1f9iA00
4PKYA 2W0NA 5AVFA 3ULFA 3VE4A 1OTBA 3FC7A 4EEUA 2QKPA 5HDDA 2PD7A 4BBUA 3NOUC 1T1CA 4H6JA 5F5YA 5G4ZA 1T18A 1S67L 5TBMB 1T1BA 2K7SA 2VLGA 5IS1A 4BBVA 1NWZA 1S4SA 2PD8A 4HJ4A 4R70A 1ODVA 3IS2B 1GSVA 2V0UA 4KUOA 2BASA 2M1CA 5HWVA 1V9YA 2V1BA 2JN7A 4HHDA 1Y28A 4GW9A 4L9GA 1DP8A 2PR5A 5HSQA 1UWPX 3LIBA 2PDRA 4MN6A 3F1PA 2QJ5A 2WKRA 2L1MA 4JGPA 4R6LA 2QHKA 2PR6A 3UB7A 5J4EA 4NXFA 4E04A 4WN5A 5DJTA 2D01A 2KDKA 4M4XA 2PYRA 3ICYA 2V1AA 1TS6A 2QWSA 3RTYA 1OJ5A 2GJ3A 4EW7A 3NHQA 3F1OA 5DKKA 3BY9A 3LUQA 2YKHA 4H6JB 1UWNX 2L0WA 1G28A 4BBTA 2P7JA 4HIAA 3RH8B 4WL9A 1JNUA 3FG8A 4GS9A 1S4RA 4GHIA 1T19A 3IBRA 4L9EA 3PYPA 4NXEA 4JGRA 3BY8A 3VOLA 5HD3A 4LLOB 3A0RA 4I3AA 4HH3A 3C2WA 3EWKA 3K3CA 3MFXA 1OT9A 3F1PB 1D7EA 3EEHA 3NOTC 5HWTA 3E4PA 1S66L 2Z6DA 4JGOA 3H82A 3KX0X 4RQ9A 3C8CA 3F1NA 1KOUA 3H9WA 4K08A 5F69A 2Z6CA 4WF0A 2PYPA 1DP9A 1N9NA 1D06A 5EFWA 3B33A 4HI4A 2ZOHA 1XJ3A 3T50A 3CWFA 1XFQA 1TS0A 3F1OB 3LI8A 4HOIA 3H7WA 4EERA 4HNBA 4EESA 3BWLA 5HWWA 3MJQA 4F3LA 1LT0A 3MXQA 3SW1A 4XT2A 2WKQA 1V9ZA 3A0VA 1XJ4A 4NXGA 5J7EA 1F9IA 4GS9B 3E4QA 2YKFA 4GHIB 3NOPC 4KQDA 1MZUA 3LIFA 1OTDA 5DKLA 5G4YA 1BYWA 1VB6A 3LYXA 5DJUA 1N9LA 3MR0A 2V9AA 2JHEA 4DJ2A 5IU1A 1F98A 3MQQA 4LPZA 4HJ6A 4EXOA 1OTAA 5HDCA 1T1AA 3E4OA 2CMNA 4GCZA 4HJ3A 4EETB 2EA9A 5F6AA 4YWZA 1WA9A 1XJ2A 4KUKA 4WLAA 3H82B 2HV1A 3F1NB 3GECA 4R3AA 1GSWA 1S1ZA 3CLOA 1TS8A 4HY8A 4B9OA 1P97A 3P7NA 1XJ6A 2I9VA 3LIAA 5I5LA 2A24A 4WUJA 3HJIA 4NXBA 1UGUA 3H7WB 2PHYA 3LIEA 3UMEA 4F3LB 3LICA 4XT2B 2ZBBA 3G6OA 4HQAA 2D02A 1EW0A 5HZHA 4JGQA 1OTEA 1LSVA 3UMDA 3UB9A 4HH2A 2INWA 4LRXC 4I3IA 1S1YA 5HD5A 2KX6A 5HDSA 1XFNA 1P0ZA 4I38A 4MN5A 3LI9A 3MQOA 4R38A 1X0OA 3UB8A 2W27A 5KIZA 4I5SA 3ZQ5A 1LSWA 3GDIA 1LSXA 5TBMA 1DP6A 1OTIA 2VEAA 2QJ7A 1DRMA 2OOLA 2OWHA 3IS2A 3CAXA 3PHYA 5F68A 4HP9A 2H28A 5A8BA 3VE3A 2ZOIA 2L4RA 4LRZE 1OT6A 2VV7A 5AVEA 2A24B 1LL8A 3K3DA 1GSXA 5J3WA 2VV8A 3NJAA 2J80A 4EQ1A 1TS7A 4L9FA 4I3JA 1OJGA 3A0SA 4DJ3A 2WKPA 3LIDA 3D72A 2B02A 3OLOA 2V0WA 4EEPA 1N9OA 3UB6A 2R78A 4HP4A 3UE6A 4I39A 3HJKA 4PKYG 2OWJA 4LRYC 2VV6A
chains in the Genus database with same CATH superfamily
1MY8A 4EWFA 4MBHA 2ZD8A 4QJGA 1E25A 4PKYA 5AVFA 3WWXA 1XGIA 1OTBA 2QKPA 3IXHA 3RJUA 1FCMA 4YINA 5D3OA 3RXXA 1ERQA 1K57A 3HBRA 3N8RA 4BBUA 4QPRA 3NOUC 1W8QA 3MBZA 4U0TA 2WAEA 4K0WA 1ONHA 1S67L 5TBMB 1T1BA 2O9CA 3MQ0A 4RVAA 1VETB 5IS1A 4BBVA 3W8KA 2C6WB 3Q7ZA 3IS2B 3PBOA 3NY4A 4CPKA 4OPZA 4RX3A 5HWVA 1V9YA 3SH7A 4HESA 3KYEA 3JVVA 3C5AA 4GW9A 4HBUA 3P98A 4L9GA 4JF4A 1MWTA 3TJZC 1H0MA 3Q82A 1ERMA 2J8YA 3IF6A 2UWXA 4LGWA 5AQ7A 3G4PA 3BYDA 1IOUA 4YNRA 2GX5A 2GDNA 5CHMA 2HPBA 3LIBA 3FKVA 3ZG9B 2PDRA 4FOFA 4ETXA 2ZMAA 1ALQA 2WKRA 1BZAA 1Q2PA 4R4SA 1FCNA 3ITBA 4DE3A 3BFEA 2L1MA 2WKEA 3ZG0A 3VP0A 4NXFA 1NY0A 4ZBEA 4S2OA 4Z1WA 3IXGA 4M4XA 1TEMA 4ZRRA 2JKTI 5TGFA 1NRJA 3PBRA 4KG6A 4EW7A 1L0EA 2DMWA 5AQAA 3BY9A 5FAPA 4R3JA 5F1FA 5U47A 3BEBA 3UN7A 1CK3A 4HIAA 3FZCA 1CI8A 1FSYA 3RH8B 2E8IA 4Q0JA 4KZ5A 1YM1A 4C6YA 5KSCA 3ZFZA 5CERA 1RP5A 5FEFA 4JGRA 5CEDA 3VOLA 5HD3A 1KVMA 3MSHA 4WZ5C 4E3OA 1W63Q 3WRZA 3OPPA 4LLOB 3IF6B 1IYQA 5CX7A 5JYPA 1BSGA 4Z9QA 3MS6A 3OBFA 4FSFA 4RX2A 2OAQ1 4MEZA 3VOYA 2X02A 4KQQA 3MFXA 3GRJA 1JTGA 3SZTA 4Y17A 4U3TA 3EEHA 3NOTC 4A5RA 3VMAA 3E4PA 1S66L 2Z6DA 2W3HA 1VEUA 4RQ9A 3C8CA 3F1NA 3T4JA 1KOUA 3W4OA 3S7OA 4KZ9A 2JE5A 4S2MA 2ZL1A 1DP9A 1N9NA 3M2KA 4YFMA 3FKWA 3EGXC 5DF9A 1M6KA 4HI4A 4JXGA 3VSLA 3ZHHA 1XJ3A 5DFYA 3T50A 1PI5A 2Y2LA 1ZHHB 1XFQA 5FAQA 1NXYA 2X71A 1AWIA 4HOIA 4EERA 1KE4A 4EESA 3TG9A 5HWWA 2K31A 1TF1A 3TOIA 3PXPA 1KGEA 3MMHA 1QMEA 1QMFA 2YKFA 4KQDA 4QHCA 3ZCZA 4NETA 1XGJA 1I2WA 3AGEA 5L09A 1H8YA 4PHTA 3LYXA 1N9LA 1YAXA 3ZG5A 2JHEA 4DJ2A 5DVAA 3IF5A 3MQQA 3MZDA 4OLDA 3IF6C 5HL6A 4WBGA 5CTNA 3BFFA 3MF0A 3PBTA 2KOIA 3NBLA 1ZTUA 4HBTA 5FI7A 3DWKA 4EETB 2QZ6A 1XKZA 1XJ2A 5FQMA 1VEUB 2HV1A 3F1NB 1ES3A 1HLUP 1GSWA 1G5UA 3GV9A 1NLZA 2ZL1B 1TS8A 4IEDA 4HY8A 3QHYA 5FQJA 1SDEA 4JF5A 5L10A 4O0PA 1P97A 3HCYA 1DJCA 4UQIS 5L2FA 2I9VA 3LIAA 4JBFA 5I5LA 3T1QB 2GNXA 5A92A 2I72A 1OPXA 3LIEA 3UMEA 4FD8A 3UDIA 5FA7A 1CEGA 1PWCA 3LICA 4LCLA 4DE1A 2D02A 4BL3A 1YT4A 3T1XA 4ZDXA 4KG2A 4JGQA 1LSVA 4MLLA 4Y13A 4HH2A 5FAOA 3HUMA 1N9BA 5GLAA 4EBLA 4LV3A 3BECA 5FI2A 2HP5A 3GTCA 2WZXA 3WRTA 4IUHA 3VOZA 3G2ZA 1RGYA 2KX6A 5HDSA 3BQAA 3IX3A 3A3IA 4MN5A 1CI9A 3VFFA 1X0OA 5CGXA 5GLBA 1K54A 1LSWA 1YMSA 3M6BA 5M1AA 4DMZA 3UPOA 1DP6A 1OMEA 4CLCE 1ES4A 2OOLA 3T1SA 2OWHA 1NZOA 1YPRA 3NDEA 2ZC7A 3R4KA 3CITA 3CZDA 1RGZA 2WKIA 3NIAA 4RYEA 1VHMA 1WYCA 1IKIA 1F5MA 1BT5A 1FILA 4GD6A 4P87A 4LRZE 1OT6A 4U0XA 4FCFA 2Y2KA 5J3WA 4BLMA 1K4FA 4S2PA 4EQ1A 1CF0A 3OCLA 4LCMA 2HGVA 3G31A 1XX2A 1LLBA 4I3JA 4DJ3A 2EX2A 3OLOA 4UA6A 1XXMA 3G32A 2P04A 4EEPA 1N9OA 4PM8A 2R78A 3P09A 4E3LA 4HP4A 3QNCA 5GHXA 5HFOA 2W3DA 4JKTA 4PKYG 4LRYC 1Y54A 2HF6A 4Y5FA 3U2AA 2QPNA 5GLCA 4RA7A 1H8ZA 4EEUA 3E2KA 3R7WA 2XH9A 4OH0A 3WS5A 1E4DA 3UNWA 4R0QA 5HL1A 4KZ6A 4E3NA 1MWUA 2ACGA 4N92A 1W79A 1T18A 1NRFA 2K7SA 2VLGA 3DWZA 1YLJA 1NWZA 4N9KA 4BQMA 3B47A 4R70A 4JPMA 2FZ0A 2V0UA 4DKIA 2H5SA 4JXWA 2V1BA 3C30A 4GZBA 4Y2FA 4HHDA 4KQOA 4Q8IA 1XA1A 1LHYA 2G2WA 1FSWA 4IBRA 1DP8A 3DTEA 2XF3A 2Y2NA 5F1GA 4ZJ2A 2Y2HA 1STZA 3ISGA 2PR5A 4WELA 5HPIA 1GHIA 3OPRA 3U4LP 4MDZA 1F2KA 5IHVA 4MN6A 1XA7A 3IHAA 2V8FA 4P6BA 3D4FA 2WGIA 2H0YA 3KYZA 4GLQA 1W63M 1SDNA 3L9KA 4WN5A 2D01A 2KDKA 1PIOA 1YSPA 2XD1A 1TVFA 2PYRA 2A3UA 3T4KA 3ICYA 3QP2A 2V1AA 3CHWP 3HL9A 2Y2GA 4Q0IA 3R7WB 3RTYA 3FYZA 3MZFA 1PYYA 5K5BA 3F1OA 5DKKA 2KLIA 2YKHA 1YMXA 3T4LA 2O9AA 1UWNX 2L0WA 4GN2A 2IWBA 1G28A 3TE8A 3TW8A 2P7JA 1W5DA 3W4PA 2ZQCA 1IYOA 2JKRM 3O87A 2HJ9C 4GS9A 1BULA 2B5RA 2VZWA 3IBRA 4L9EA 5E2HA 4BMWA 3PYPA 1YKDA 2OAP1 5CXWA 3OZHA 1IYPA 3IH9A 1PZOA 3JVUA 2PU4A 4C3QA 4NEED 3Q7VB 3I7JA 3UDFA 1JVJA 4HH3A 3C2WA 1RCJA 3K3CA 2WGVA 3WS2A 5GLDA 3OPLA 3UY6A 4CLCC 3V50A 2WYXA 2PBDP 1J9MA 3JPUA 2J3WA 4X68A 5AQBA 3V67A 3C7VA 4ESPA 3LFVA 3SH8A 5GHZA 2Q9NA 3MZEA 3ZGAB 4WF0A 2PYPA 4FH4A 5EFWA 2W3GA 2O0YA 4OP8A 1KGFA 3PAGA 2EWVA 2ZOHA 5AQ9A 3DTKA 3M6HA 3DTMA 3CWFA 4QB8A 2XFTA 3F1OB 2W1RA 3G35A 4K91A 3TSGA 1HD8A 2FH5A 3MFDA 4OQIA 3SW1A 2WKQA 3Q07A 4KENB 2PRFA 4GS9B 3MKFA 4S2IA 3NOPC 4CLCD 1MZUA 2ZM0A 1OTDA 4PMAA 1YLYA 1GHPA 5G4YA 3LEZA 1IEMA 4D60A 5DJUA 1LL9A 3MR0A 2V9AA 5CTMA 3T4OA 3HVFA 3LY4A 3N8LA 4DE2A 5HAIA 3E4OA 1PW8A 4OLGA 3T4TA 3V5MA 3C38A 4NK3A 4YWZA 2WUQA 4IBXA 3QP1A 4X69A 2O9BA 1JWPA 3GECA 4R3AA 1S1ZA 5J8XA 4KZ7A 4D2OA 2UV0E 4O8GA 2ZQ7A 2ZM2A 1ESUA 3N6IA 1Z09A 4QY5A 2G2UA 1L3LA 2A24A 1FR6A 2H0TA 4WUJA 2ZQ9A 1XPBA 3O88A 3GMWA 3E0YA 5HAQA 5FASA 3ZNTA 2V1ZA 1EW0A 5EM1A 4JXVA 2ZLYA 3OOVA 3LR4A 3VP4A 3A3JA 2ZQDA 4EUVA 5E2FA 4E3JA 2FFYA 3ZVWA 3TRCA 3BJNA 4LRXC 2XA7M 1D1JA 1S1YA 4WEKA 5KSHA 5HD5A 5IT5A 4WMCD 1TD5A 4X56A 1YLTA 4UAAA 4OQHA 4L0LA 3S7QA 2EXAA 4GB7A 3BLSA 3BQ8A 2B18A 3UB8A 2W27A 1PRQA 3DTIA 3ZNYA 1LSXA 1MBLA 3IHBA 1SCWA 3QP5A 2VX8A 3LCEA 2VEAA 2A2LA 2W3EA 5F68A 2JKGA 4OOYA 2DCFA 2WAFA 4EBNA 5E2GA 1SKOA 2H28A 3VP3A 5FATA 2Y79A 3HREA 4S2KA 1L0FA 1PW1A 3FPWA 3G2YA 2A24B 4E3IA 1N4OA 1NZUA 2J80A 1MKMA 4OQGA 5DF7A 1OJGA 2P9VA 3LIDA 5HX9A 3D72A 3E98A 2ZMFA 2FFFB 2ZC4B 4P85A 2HJEA 2OLVA 2R9WA 2IA2A 1BTLA 1XP4A 3EEAA 3UB5P 2VV6A 4WZ4A 3S7PA 1MPLA 4QD4A 3IH8A 3Q1FA 4DN0A 2W0NA 1K55A 2PAVP 3ULFA 4GD8A 3VE4A 2PBYA 3Q81A 1CEFA 3FC7A 2PD7A 3B3XA 5JYOA 5FI6A 2ZQ8A 3KO6A 3N7WA 2K2NA 3QP4A 1GA0A 2Z2MB 5F5YA 3CI6A 3UDXA 5FQQA 1M40A 4MBFA 2WADA 3IBJA 4AFIA 1GSVA 2EX9A 1PWGA 5EUAA 4X53A 5E43A 4ZAMA 5KMWA 4P6ZS 1SKOB 2Q0OA 2JN7A 5KZHA 3IT9A 1CJFA 4OKPA 2Y2OA 3VFHA 2WZZA 3BW6A 1WYBA 4R1GA 4OOLA 1UWPX 4BL2A 2J9PA 1G6AA 4XUXA 2H10A 3F1PA 2QJ5A 3PBSA 2P9VB 4BD0A 4B4XA 2EX6A 4EUZA 3CMZA 4E6XA 4K0XA 4R6LA 4E3MA 2QHKA 4HEFA 3UB7A 4KZBA 5J4EA 5MC7A 2EFUA 5CGWA 1H3QA 4II7A 4QWOA 3A3DA 3UE0A 2XFSA 2RL3A 4P0MA 1L0GA 1J3WA 2DRWA 1OJ5A 4CLCA 2VGLM 5A90A 1ES5A 3HLCA 3NHQA 5DTSA 5FSRA 4S2LA 1K56A 4N1XA 5CEBA 1FR1A 3SH9A 1W7FA 3MXRA 3DW0A 4R23A 4BBTA 3S22A 2OV5A 2WKHA 5EECA 3B42A 1JNUA 3FG8A 1U60A 2C5WB 4Y7PA 1HTZA 4EBPA 1S4RA 1Y4OA 1O7EA 2Q9MA 3UPNA 4FTXA 4ETZA 1YQSA 3HLFA 3VV4A 3UE3A 3BY8A 4G3KA 3UO9A 4G3WA 4MCWA 4G3VA 2A49A 5EE8A 4OOMA 3A0RA 3CPTA 2ZMVA 3OC2A 3CUEA 4I3AA 1IELA 3NDGA 3HLDA 2WGWA 3EWKA 2XROA 3F1PB 2O99A 2XGNA 3W2ZA 1D7EA 5HWTA 3KSFA 3ZG7B 3HLBA 2HDQA 3KX0X 5HAPA 4K08A 5F69A 1MC0A 3LR3A 4X1LA 2Z6CA 4Y0TA 1GCEA 1D06A 5A91A 2M7VA 3C7UA 4Q0HA 4ARZA 1ZG6A 2P74A 3P01A 3Q7VA 4CJNA 3VP2A 5FEGA 1FIKA 1PNEA 4E6WA 3IQAA 4GDBA 1K55C 4CLCB 3DBAA 4BWIA 4ZJ3A 1TS0A 1HZOA 3HLWA 3BFGA 3LI8A 3H7WA 1LL5A 3JYIA 1JWZA 2JBFA 3BWLA 3MJQA 1LT0A 3MXQA 4F94A 5EV0A 4WMCA 3A0VA 1XJ4A 4NXGA 1BUEA 4UA9A 4UEYA 1F9IA 3N4IA 4KG5A 3WS0A 5HW3A 4EQIA 3SS3A 5EVEA 3CG5A 5FL3A 2XDMA 3D9YA 4GOGA 1FCOA 1PZPA 3PAEA 3LR0A 2OLUA 3CPTB 1F98A 4GKUA 2JKTM 5BOHA 4IUKA 4KQRA 5HDCA 4MN7A 1T1AA 4B88A 2WGWB 4GJ4A 2CMNA 3VSKA 4GCZA 2R9XA 3GQZA 4O01A 2EX8A 1EI5A 2HDSA 4C75A 1IKGA 1KVLA 4ZTKA 3EQVA 1G6OA 4H8RA 1BLPA 1KE3A 3CLOA 3GSGA 4DDYA 2Y55A 4B9OA 3A3EA 4ARZB 4XUZA 1XJ6A 2JC7A 1DJAA 4B4ZA 3N8SA 2XEPA 3KSGA 4EV4A 1VM1A 3SS4A 4FH2A 2NUPC 3HJIA 4E3KA 3H7WB 3T4SA 2PHYA 4LV2A 4Y0OA 2Z2LB 2ZBBA 3G6OA 1PI4A 5HZHA 4DF6A 3ZG8B 1AXBA 4X6TA 5EOOA 1C3BA 3UMDA 3UB9A 1ACFA 2INWA 2GZAA 4S2JA 4PPRA 4PM7A 1YLWA 1DJBA 5CGSA 5A93A 4WEJA 1YSQA 4Y3IA 3V3RA 2PU2A 5DF8A 1XFNA 4I38A 4R38A 4PM9A 3CUEC 5KIZA 3BFCA 4IVKA 2W1TA 2W3FA 4I5SA 3ZQ5A 4Y0UA 3QP6A 1ES2A 2RCXA 1OTIA 1DRMA 4BJPA 1BLSA 3D3OA 4R4RA 4KZ4A 1K56D 3PHYA 1BLCA 2HDUA 2XSSA 5E2EA 3WS4A 2V8CA 3RXWA 4HP9A 4LV1A 3ITAA 2P08A 3VE3A 2L4RA 3PBNA 2VGJA 1K0KA 2ZC3B 3K3DA 3LO7A 4PAUA 1GSXA 1WE4A 2VV8A 3GR2A 3NJAA 4KZAA 3O5YA 1YLPA 3IWOA 4XXRA 4L9FA 3UPPA 4BENA 5F83A 3PBQA 3A0SA 2WKPA 2M7UA 2B02A 3FPVA 2JKRI 1TDLA 2V0WA 2VKSA 3VP1A 3UB6A 3IWQA 4UQIM 5FQKA 2X01A 1K6RA 1EROA 4DDSA 3W4QA 1IFQA 2LB5A 3LY3A 3V3SA 2LB9A 3BRMA 1MWRA 1CQAA 1K6SA 5HDDA 3HLEA 3IX4A 1FOFA 2W1TB 4JLFA 1T1CA 4H6JA 5G4ZA 2VA0A 1O07A 3RFBA 4YOFA 1S4SA 3M2JA 2PD8A 4HJ4A 1ODVA 1SKFA 3LEQA 2IWDA 4P6ZM 4KUOA 2ZC5B 2BASA 2M1CA 3SOIA 4X25A 3O3VA 4LV0A 1Y28A 5TR7A 2NUTC 4X55A 5FDHA 5M19A 4OPYA 4OONA 1MKIA 3ZVTA 5HSQA 3MXSA 1KGGA 4O7DA 1Z6FA 3EOIA 1BLHA 2QYBA 3S7NA 2XRNA 2BTFP 1K57C 2Y2QA 3MKEA 4DXBA 3ZYTA 4JGPA 2PR6A 1G68A 2XR0A 4E04A 5DFXA 4M3KA 1W8YA 3NC8A 3EGDC 5DJTA 1E3UA 3OCNA 2Y59A 5DTKA 1A0KA 4DRTA 3UE1A 2IWCA 2V20A 1TS6A 2QWSA 4CQHA 4JF6A 4IHQA 4S2NA 2GJ3A 5FDSA 4NKPA 2OSUA 2Y8HA 4PM6A 3L7HA 3SS5A 3LUQA 4H6JB 5I94A 3PTEA 2HDRA 4LENA 5C5KA 3E2LA 3KSIA 4X1MA 4FUWA 5EVIA 4WL9A 1L2SA 5TJJA 1EWZA 4GHIA 3T4QA 1T19A 4PM5A 4WM9A 1K4EA 4BD1A 4NXEA 4ZJ1A 2Y2IA 1L0DA 1LI9A 3IWIA 3EQUA 2VGKA 5F82A 3KYQA 5EVLA 4UA7A 4NG2A 5M18A 1K25A 5L07A 2DNSA 1OT9A 1JWVA 5CHJA 1IYSA 1FQGA 4WYYA 3IXDA 4QY6A 4JGOA 3LGOA 3H82A 2XK1A 2B95A 1S0WA 1ONGA 3T12B 5CRFA 2Y2MA 3H9WA 1MXOA 3QP8A 5LBRA 4DXCA 5FQIA 2J7VA 3GVBA 3BLMA 1PWDA 3AGFA 2Y91A 3HLGA 2EFXA 1YLZA 3O86A 3V39A 1VQQA 2XLNA 3B33A 3DAVA 1P9RA 2HP6A 1KDWA 2XQZA 2XA7S 2VK3A 2HP9A 3KSHA 3FV7A 4Y15A 3PR6A 4HNBA 5CHUA 3K2NA 3S1YA 4LFUA 4F3LA 4XT2A 1HVBA 4EU0A 4GDNA 1V9ZA 5J7EA 5EVIB 4KZ3A 2ZQAA 1Q2QA 3E4QA 4QU3A 1I5QA 4GHIB 4GNUA 3LIFA 5G18A 2VJWA 3NI9A 4MBKA 4R3BA 4MMNA 5DKLA 2AVXA 1BYWA 1VB6A 5EOEA 2XD5A 1GA9A 4MNRA 5IU1A 4LPZA 4HJ6A 2V2FF 4EXOA 1OTAA 3C4OA 1ESIA 1PFLA 4HJ3A 2E8JA 4ME4A 3QNBA 1NJ4A 2EA9A 1KDSA 1TDGA 5F6AA 1WA9A 5EM0A 4KUKA 1JTDA 4WLAA 1MWSA 1DY6A 3H82B 2Y4AA 4DE0A 1LI0A 4JXSA 1SZVA 1K38A 1S6RA 3P7NA 3T1RA 5AJGA 1I2SA 3A3FA 2J3TC 3OPHA 3BM6A 2HZ5A 4ID4A 1H5XA 3LR5A 4NXBA 1UGUA 4S2NC 5EPHA 4F3LB 4XT2B 3IX8A 4HQAA 3BFDA 2JKFA 5FQ9A 4IVIA 1OTEA 3C4PA 4OVDA 5EVIC 1KE0A 2BG1A 4KZ8A 4N9LA 1NYMA 4OQ0A 2WK0A 4I3IA 3CJMA 3NULA 2ZC6B 2MJ6A 3NCKA 1P0ZA 3LI9A 3MQOA 1P9WA 3S4XA 1E3UD 3GDIA 3NECA 3ZDJA 2BLSA 1ZC2A 2Y2JA 2J3TD 5TBMA 1H8MA 4N1HA 2ZJ9A 1VETA 5HARA 5L8MA 3G34A 4UHUA 2QJ7A 4OPRA 3IS2A 3CAXA 4OP5A 3AGDA 2ZM8A 4IJGA 3HUOA 3FWLA 4WZ5A 4OPQA 5A8BA 3WS1A 3IXBA 1NYYA 2ZOIA 5EVID 5TFQA 1GHMA 5HPFA 2VV7A 5GHYA 5AVEA 1LL8A 2QMIA 1ZKJA 2CC1A 2J9OA 5CECA 1TS7A 2G7UA 2VGLS 3G30A 1ZG4A 1SHVA 3HUNA 1K54C 2EXBA 5GL9A 5DTTA 2PT7A 3UE6A 4I39A 1NLYA 4B93A 2EWWA 2JCHA 3HJKA 2OWJA 2Y2PA
chains in the Genus database with same CATH topology
1IFQA 2HF6A 4Y5FA 3S7PA 3U2AA 2LB5A 4PKYA 4DN0A 2W0NA 5AVFA 3ULFA 3VE4A 2LB9A 1OTBA 3FC7A 4EEUA 2QKPA 3R7WA 5HDDA 2PD7A 4BBUA 4QPRA 2W1TB 3KO6A 3NOUC 2K2NA 1T1CA 4H6JA 5F5YA 5G4ZA 1T18A 1S67L 3CI6A 1T1BA 2O9CA 3MQ0A 5TBMB 2K7SA 2VA0A 2VLGA 5IS1A 4BBVA 3RFBA 1NWZA 4YOFA 1S4SA 3IBJA 2PD8A 3B47A 4HJ4A 4R70A 4AFIA 1ODVA 3IS2B 3PBOA 2FZ0A 1GSVA 2V0UA 4P6ZM 4KUOA 2BASA 2M1CA 5HWVA 4P6ZS 1V9YA 2V1BA 2JN7A 3C30A 4Y2FA 4HHDA 4KQOA 1Y28A 3JVVA 4GW9A 4L9GA 2NUTC 3TJZC 3BW6A 1DP8A 1IOUA 1STZA 4OOLA 2GX5A 4YNRA 2PR5A 4WELA 5HPIA 5HSQA 1UWPX 3LIBA 4MDZA 2PDRA 4FOFA 4ETXA 3EOIA 4MN6A 2QYBA 2QJ5A 3F1PA 2WKRA 3PBSA 3S7NA 2XRNA 3ZYTA 2L1MA 4JGPA 4R6LA 2QHKA 2PR6A 3KYZA 4GLQA 1W63M 3UB7A 5J4EA 4NXFA 5MC7A 4E04A 1H3QA 4II7A 5DFXA 4WN5A 3EGDC 5DJTA 2D01A 2KDKA 4Z1WA 3OCNA 1YSPA 4M4XA 2PYRA 3T4KA 3ICYA 2V1AA 1TS6A 4ZRRA 2QWSA 4CQHA 2JKTI 4Q0IA 3R7WB 3RTYA 1OJ5A 4IHQA 2VGLM 4CLCA 2GJ3A 1NRJA 3PBRA 4EW7A 4NKPA 3NHQA 2DMWA 2Y8HA 5K5BA 3F1OA 5DKKA 2KLIA 3BY9A 3LUQA 2YKHA 4H6JB 3T4LA 2O9AA 1UWNX 2L0WA 3TE8A 1G28A 4BBTA 5C5KA 3KSIA 3TW8A 2P7JA 4HIAA 3RH8B 3B42A 4WL9A 1JNUA 3FG8A 2JKRM 5TJJA 2HJ9C 4GS9A 1S4RA 4GHIA 4ETZA 4Q0JA 3T4QA 2VZWA 1T19A 3IBRA 4L9EA 4BMWA 3PYPA 4NXEA 3VV4A 1YKDA 2OAP1 4JGRA 3UE3A 3BY8A 4G3KA 3VOLA 5HD3A 4G3WA 4MCWA 4G3VA 1W63Q 3EQUA 4LLOB 4OOMA 3JVUA 5CX7A 3A0RA 3KYQA 2ZMVA 3OC2A 3CUEA 4I3AA 4NEED 3OBFA 4FSFA 2OAQ1 4HH3A 3C2WA 3EWKA 3K3CA 2XROA 3MFXA 1OT9A 3F1PB 2O99A 3W2ZA 1D7EA 3EEHA 3NOTC 5HWTA 4CLCC 3E4PA 1S66L 3KSFA 2J3WA 2Z6DA 4JGOA 3H82A 3KX0X 2W3HA 4RQ9A 3V67A 3C8CA 3F1NA 3T4JA 1KOUA 3LFVA 3H9WA 4K08A 5F69A 3S7OA 1MC0A 3LR3A 5LBRA 2Z6CA 4WF0A 2PYPA 1DP9A 1N9NA 1D06A 2M7VA 4Q0HA 5EFWA 2W3GA 4ARZA 2O0YA 3EGXC 5DF9A 3B33A 3P01A 4HI4A 2EWVA 2ZOHA 1XJ3A 5DFYA 3T50A 3CWFA 4CLCB 1ZHHB 1P9RA 3DBAA 4BWIA 2XA7S 1XFQA 1TS0A 3F1OB 2W1RA 3KSHA 3LI8A 4HOIA 3H7WA 4EERA 3PR6A 4HNBA 4EESA 3K2NA 3BWLA 5HWWA 2K31A 3MJQA 4F3LA 1LT0A 3MXQA 2FH5A 3SW1A 4XT2A 4EU0A 1TF1A 2WKQA 1V9ZA 3A0VA 1XJ4A 3PXPA 4NXGA 5J7EA 3MMHA 4UEYA 1F9IA 4GS9B 3E4QA 2YKFA 4GHIB 3NOPC 4CLCD 4KQDA 1MZUA 3LIFA 1OTDA 2VJWA 4MMNA 5DKLA 5G4YA 1BYWA 1VB6A 4PHTA 3LYXA 5DJUA 5FL3A 1N9LA 3MR0A 1YAXA 2V9AA 2JHEA 4DJ2A 5IU1A 3LR0A 3T4OA 1F98A 3MQQA 2JKTM 4LPZA 4HJ6A 4IUKA 4EXOA 1OTAA 5HDCA 4MN7A 1T1AA 5HL6A 3E4OA 3MF0A 3PBTA 4GJ4A 2CMNA 2KOIA 4GCZA 1ZTUA 4O01A 4HJ3A 4ME4A 4EETB 3T4TA 2EA9A 3C38A 5F6AA 4YWZA 1WA9A 1XJ2A 4KUKA 4WLAA 3H82B 3EQVA 1G6OA 2HV1A 3F1NB 2O9BA 3GECA 4R3AA 1GSWA 1S1ZA 1NLZA 3CLOA 1TS8A 4HY8A 4O8GA 4B9OA 4O0PA 4ARZB 1P97A 3P7NA 3HCYA 1XJ6A 4UQIS 2I9VA 3LIAA 3KSGA 5AJGA 2J3TC 5I5LA 2A24A 4WUJA 3LR5A 3HJIA 2NUPC 4NXBA 2GNXA 1UGUA 3H7WB 3T4SA 1OPXA 2PHYA 3E0YA 3LIEA 3UMEA 4F3LB 3LICA 4XT2B 2ZBBA 3G6OA 4HQAA 2D02A 1EW0A 5HZHA 3OOVA 3LR4A 4JGQA 1OTEA 1LSVA 3UMDA 3UB9A 4HH2A 4EUVA 2INWA 2GZAA 3TRCA 3BJNA 4LRXC 2XA7M 4I3IA 1S1YA 4WEKA 5KSHA 5HD5A 4IUHA 2MJ6A 2KX6A 1YSQA 4WEJA 5IT5A 4Y3IA 5HDSA 1TD5A 1XFNA 1P0ZA 3BQAA 4I38A 4L0LA 3S7QA 4MN5A 3LI9A 3MQOA 3BQ8A 2B18A 4R38A 1P9WA 1X0OA 3UB8A 2W27A 3CUEC 5KIZA 2W1TA 2W3FA 4I5SA 3ZQ5A 1LSWA 3GDIA 1LSXA 2J3TD 5TBMA 1H8MA 4DMZA 2VX8A 1DP6A 1OTIA 2VEAA 5L8MA 4CLCE 2QJ7A 1DRMA 2A2LA 4BJPA 2OOLA 3D3OA 2W3EA 2OWHA 3IS2A 3CAXA 3R4KA 3PHYA 3CITA 5F68A 2XSSA 4IJGA 1VHMA 1F5MA 4HP9A 2H28A 2P08A 5A8BA 3VE3A 2Y79A 2ZOIA 2L4RA 3PBNA 3FPWA 4LRZE 1OT6A 5HPFA 2VV7A 5AVEA 2A24B 1LL8A 3K3DA 4PAUA 1GSXA 5J3WA 2VV8A 3NJAA 2J80A 3O5YA 1MKMA 4EQ1A 1TS7A 3OCLA 2HGVA 4L9FA 4I3JA 2G7UA 3PBQA 2VGLS 1OJGA 3A0SA 4DJ3A 2WKPA 3LIDA 2M7UA 3D72A 2B02A 3OLOA 3E98A 3FPVA 2JKRI 2ZMFA 2P04A 2V0WA 2VKSA 4EEPA 1N9OA 3UB6A 2R78A 4UQIM 2PT7A 4HP4A 3UE6A 4I39A 2HJEA 2IA2A 1NLYA 2W3DA 4B93A 2EWWA 3EEAA 3HJKA 4PKYG 2OWJA 4LRYC 2VV6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PKY A;  2W0N A;  5AVF A;  3ULF A;  3VE4 A;  1OTB A;  3FC7 A;  4EEU A;  2QKP A;  5HDD A;  2PD7 A;  4BBU A;  3NOU C;  1T1C A;  4H6J A;  5F5Y A;  5G4Z A;  1T18 A;  1S67 L;  5TBM B;  1T1B A;  2K7S A;  2VLG A;  5IS1 A;  4BBV A;  1NWZ A;  1S4S A;  2PD8 A;  4HJ4 A;  4R70 A;  1ODV A;  3IS2 B;  1GSV A;  2V0U A;  4KUO A;  2BAS A;  2M1C A;  5HWV A;  1V9Y A;  2V1B A;  2JN7 A;  4HHD A;  1Y28 A;  4GW9 A;  4L9G A;  1DP8 A;  2PR5 A;  5HSQ A;  1UWP X;  3LIB A;  2PDR A;  4MN6 A;  3F1P A;  2QJ5 A;  2WKR A;  2L1M A;  4JGP A;  4R6L A;  2QHK A;  2PR6 A;  3UB7 A;  5J4E A;  4NXF A;  4E04 A;  4WN5 A;  5DJT A;  2D01 A;  2KDK A;  4M4X A;  2PYR A;  3ICY A;  2V1A A;  1TS6 A;  2QWS A;  3RTY A;  1OJ5 A;  2GJ3 A;  4EW7 A;  3NHQ A;  3F1O A;  5DKK A;  3BY9 A;  3LUQ A;  2YKH A;  4H6J B;  1UWN X;  2L0W A;  1G28 A;  4BBT A;  2P7J A;  4HIA A;  3RH8 B;  4WL9 A;  1JNU A;  3FG8 A;  4GS9 A;  1S4R A;  4GHI A;  1T19 A;  3IBR A;  4L9E A;  3PYP A;  4NXE A;  4JGR A;  3BY8 A;  3VOL A;  5HD3 A;  4LLO B;  3A0R A;  4I3A A;  4HH3 A;  3C2W A;  3EWK A;  3K3C A;  3MFX A;  1OT9 A;  3F1P B;  1D7E A;  3EEH A;  3NOT C;  5HWT A;  3E4P A;  1S66 L;  2Z6D A;  4JGO A;  3H82 A;  3KX0 X;  4RQ9 A;  3C8C A;  3F1N A;  1KOU A;  3H9W A;  4K08 A;  5F69 A;  2Z6C A;  4WF0 A;  2PYP A;  1DP9 A;  1N9N A;  1D06 A;  5EFW A;  3B33 A;  4HI4 A;  2ZOH A;  1XJ3 A;  3T50 A;  3CWF A;  1XFQ A;  1TS0 A;  3F1O B;  3LI8 A;  4HOI A;  3H7W A;  4EER A;  4HNB A;  4EES A;  3BWL A;  5HWW A;  3MJQ A;  4F3L A;  1LT0 A;  3MXQ A;  3SW1 A;  4XT2 A;  2WKQ A;  1V9Z A;  3A0V A;  1XJ4 A;  4NXG A;  5J7E A;  1F9I A;  4GS9 B;  3E4Q A;  2YKF A;  4GHI B;  3NOP C;  4KQD A;  1MZU A;  3LIF A;  1OTD A;  5DKL A;  5G4Y A;  1BYW A;  1VB6 A;  3LYX A;  5DJU A;  1N9L A;  3MR0 A;  2V9A A;  2JHE A;  4DJ2 A;  5IU1 A;  1F98 A;  3MQQ A;  4LPZ A;  4HJ6 A;  4EXO A;  1OTA A;  5HDC A;  1T1A A;  3E4O A;  2CMN A;  4GCZ A;  4HJ3 A;  4EET B;  2EA9 A;  5F6A A;  4YWZ A;  1WA9 A;  1XJ2 A;  4KUK A;  4WLA A;  3H82 B;  2HV1 A;  3F1N B;  3GEC A;  4R3A A;  1GSW A;  1S1Z A;  3CLO A;  1TS8 A;  4HY8 A;  4B9O A;  1P97 A;  3P7N A;  1XJ6 A;  2I9V A;  3LIA A;  5I5L A;  2A24 A;  4WUJ A;  3HJI A;  4NXB A;  1UGU A;  3H7W B;  2PHY A;  3LIE A;  3UME A;  4F3L B;  3LIC A;  4XT2 B;  2ZBB A;  3G6O A;  4HQA A;  2D02 A;  1EW0 A;  5HZH A;  4JGQ A;  1OTE A;  1LSV A;  3UMD A;  3UB9 A;  4HH2 A;  2INW A;  4LRX C;  4I3I A;  1S1Y A;  5HD5 A;  2KX6 A;  5HDS A;  1XFN A;  1P0Z A;  4I38 A;  4MN5 A;  3LI9 A;  3MQO A;  4R38 A;  1X0O A;  3UB8 A;  2W27 A;  5KIZ A;  4I5S A;  3ZQ5 A;  1LSW A;  3GDI A;  1LSX A;  5TBM A;  1DP6 A;  1OTI A;  2VEA A;  2QJ7 A;  1DRM A;  2OOL A;  2OWH A;  3IS2 A;  3CAX A;  3PHY A;  5F68 A;  4HP9 A;  2H28 A;  5A8B A;  3VE3 A;  2ZOI A;  2L4R A;  4LRZ E;  1OT6 A;  2VV7 A;  5AVE A;  2A24 B;  1LL8 A;  3K3D A;  1GSX A;  5J3W A;  2VV8 A;  3NJA A;  2J80 A;  4EQ1 A;  1TS7 A;  4L9F A;  4I3J A;  1OJG A;  3A0S A;  4DJ3 A;  2WKP A;  3LID A;  3D72 A;  2B02 A;  3OLO A;  2V0W A;  4EEP A;  1N9O A;  3UB6 A;  2R78 A;  4HP4 A;  3UE6 A;  4I39 A;  3HJK A;  4PKY G;  2OWJ A;  4LRY C;  2VV6 A; 
#chains in the Genus database with same CATH topology
 1MY8 A;  4EWF A;  4MBH A;  2ZD8 A;  4QJG A;  1E25 A;  4PKY A;  5AVF A;  3WWX A;  1XGI A;  1OTB A;  2QKP A;  3IXH A;  3RJU A;  1FCM A;  4YIN A;  5D3O A;  3RXX A;  1ERQ A;  1K57 A;  3HBR A;  3N8R A;  4BBU A;  4QPR A;  3NOU C;  1W8Q A;  3MBZ A;  4U0T A;  2WAE A;  4K0W A;  1ONH A;  1S67 L;  5TBM B;  1T1B A;  2O9C A;  3MQ0 A;  4RVA A;  1VET B;  5IS1 A;  4BBV A;  3W8K A;  2C6W B;  3Q7Z A;  3IS2 B;  3PBO A;  3NY4 A;  4CPK A;  4OPZ A;  4RX3 A;  5HWV A;  1V9Y A;  3SH7 A;  4HES A;  3KYE A;  3JVV A;  3C5A A;  4GW9 A;  4HBU A;  3P98 A;  4L9G A;  4JF4 A;  1MWT A;  3TJZ C;  1H0M A;  3Q82 A;  1ERM A;  2J8Y A;  3IF6 A;  2UWX A;  4LGW A;  5AQ7 A;  3G4P A;  3BYD A;  1IOU A;  4YNR A;  2GX5 A;  2GDN A;  5CHM A;  2HPB A;  3LIB A;  3FKV A;  3ZG9 B;  2PDR A;  4FOF A;  4ETX A;  2ZMA A;  1ALQ A;  2WKR A;  1BZA A;  1Q2P A;  4R4S A;  1FCN A;  3ITB A;  4DE3 A;  3BFE A;  2L1M A;  2WKE A;  3ZG0 A;  3VP0 A;  4NXF A;  1NY0 A;  4ZBE A;  4S2O A;  4Z1W A;  3IXG A;  4M4X A;  1TEM A;  4ZRR A;  2JKT I;  5TGF A;  1NRJ A;  3PBR A;  4KG6 A;  4EW7 A;  1L0E A;  2DMW A;  5AQA A;  3BY9 A;  5FAP A;  4R3J A;  5F1F A;  5U47 A;  3BEB A;  3UN7 A;  1CK3 A;  4HIA A;  3FZC A;  1CI8 A;  1FSY A;  3RH8 B;  2E8I A;  4Q0J A;  4KZ5 A;  1YM1 A;  4C6Y A;  5KSC A;  3ZFZ A;  5CER A;  1RP5 A;  5FEF A;  4JGR A;  5CED A;  3VOL A;  5HD3 A;  1KVM A;  3MSH A;  4WZ5 C;  4E3O A;  1W63 Q;  3WRZ A;  3OPP A;  4LLO B;  3IF6 B;  1IYQ A;  5CX7 A;  5JYP A;  1BSG A;  4Z9Q A;  3MS6 A;  3OBF A;  4FSF A;  4RX2 A;  2OAQ 1;  4MEZ A;  3VOY A;  2X02 A;  4KQQ A;  3MFX A;  3GRJ A;  1JTG A;  3SZT A;  4Y17 A;  4U3T A;  3EEH A;  3NOT C;  4A5R A;  3VMA A;  3E4P A;  1S66 L;  2Z6D A;  2W3H A;  1VEU A;  4RQ9 A;  3C8C A;  3F1N A;  3T4J A;  1KOU A;  3W4O A;  3S7O A;  4KZ9 A;  2JE5 A;  4S2M A;  2ZL1 A;  1DP9 A;  1N9N A;  3M2K A;  4YFM A;  3FKW A;  3EGX C;  5DF9 A;  1M6K A;  4HI4 A;  4JXG A;  3VSL A;  3ZHH A;  1XJ3 A;  5DFY A;  3T50 A;  1PI5 A;  2Y2L A;  1ZHH B;  1XFQ A;  5FAQ A;  1NXY A;  2X71 A;  1AWI A;  4HOI A;  4EER A;  1KE4 A;  4EES A;  3TG9 A;  5HWW A;  2K31 A;  1TF1 A;  3TOI A;  3PXP A;  1KGE A;  3MMH A;  1QME A;  1QMF A;  2YKF A;  4KQD A;  4QHC A;  3ZCZ A;  4NET A;  1XGJ A;  1I2W A;  3AGE A;  5L09 A;  1H8Y A;  4PHT A;  3LYX A;  1N9L A;  1YAX A;  3ZG5 A;  2JHE A;  4DJ2 A;  5DVA A;  3IF5 A;  3MQQ A;  3MZD A;  4OLD A;  3IF6 C;  5HL6 A;  4WBG A;  5CTN A;  3BFF A;  3MF0 A;  3PBT A;  2KOI A;  3NBL A;  1ZTU A;  4HBT A;  5FI7 A;  3DWK A;  4EET B;  2QZ6 A;  1XKZ A;  1XJ2 A;  5FQM A;  1VEU B;  2HV1 A;  3F1N B;  1ES3 A;  1HLU P;  1GSW A;  1G5U A;  3GV9 A;  1NLZ A;  2ZL1 B;  1TS8 A;  4IED A;  4HY8 A;  3QHY A;  5FQJ A;  1SDE A;  4JF5 A;  5L10 A;  4O0P A;  1P97 A;  3HCY A;  1DJC A;  4UQI S;  5L2F A;  2I9V A;  3LIA A;  4JBF A;  5I5L A;  3T1Q B;  2GNX A;  5A92 A;  2I72 A;  1OPX A;  3LIE A;  3UME A;  4FD8 A;  3UDI A;  5FA7 A;  1CEG A;  1PWC A;  3LIC A;  4LCL A;  4DE1 A;  2D02 A;  4BL3 A;  1YT4 A;  3T1X A;  4ZDX A;  4KG2 A;  4JGQ A;  1LSV A;  4MLL A;  4Y13 A;  4HH2 A;  5FAO A;  3HUM A;  1N9B A;  5GLA A;  4EBL A;  4LV3 A;  3BEC A;  5FI2 A;  2HP5 A;  3GTC A;  2WZX A;  3WRT A;  4IUH A;  3VOZ A;  3G2Z A;  1RGY A;  2KX6 A;  5HDS A;  3BQA A;  3IX3 A;  3A3I A;  4MN5 A;  1CI9 A;  3VFF A;  1X0O A;  5CGX A;  5GLB A;  1K54 A;  1LSW A;  1YMS A;  3M6B A;  5M1A A;  4DMZ A;  3UPO A;  1DP6 A;  1OME A;  4CLC E;  1ES4 A;  2OOL A;  3T1S A;  2OWH A;  1NZO A;  1YPR A;  3NDE A;  2ZC7 A;  3R4K A;  3CIT A;  3CZD A;  1RGZ A;  2WKI A;  3NIA A;  4RYE A;  1VHM A;  1WYC A;  1IKI A;  1F5M A;  1BT5 A;  1FIL A;  4GD6 A;  4P87 A;  4LRZ E;  1OT6 A;  4U0X A;  4FCF A;  2Y2K A;  5J3W A;  4BLM A;  1K4F A;  4S2P A;  4EQ1 A;  1CF0 A;  3OCL A;  4LCM A;  2HGV A;  3G31 A;  1XX2 A;  1LLB A;  4I3J A;  4DJ3 A;  2EX2 A;  3OLO A;  4UA6 A;  1XXM A;  3G32 A;  2P04 A;  4EEP A;  1N9O A;  4PM8 A;  2R78 A;  3P09 A;  4E3L A;  4HP4 A;  3QNC A;  5GHX A;  5HFO A;  2W3D A;  4JKT A;  4PKY G;  4LRY C;  1Y54 A;  2HF6 A;  4Y5F A;  3U2A A;  2QPN A;  5GLC A;  4RA7 A;  1H8Z A;  4EEU A;  3E2K A;  3R7W A;  2XH9 A;  4OH0 A;  3WS5 A;  1E4D A;  3UNW A;  4R0Q A;  5HL1 A;  4KZ6 A;  4E3N A;  1MWU A;  2ACG A;  4N92 A;  1W79 A;  1T18 A;  1NRF A;  2K7S A;  2VLG A;  3DWZ A;  1YLJ A;  1NWZ A;  4N9K A;  4BQM A;  3B47 A;  4R70 A;  4JPM A;  2FZ0 A;  2V0U A;  4DKI A;  2H5S A;  4JXW A;  2V1B A;  3C30 A;  4GZB A;  4Y2F A;  4HHD A;  4KQO A;  4Q8I A;  1XA1 A;  1LHY A;  2G2W A;  1FSW A;  4IBR A;  1DP8 A;  3DTE A;  2XF3 A;  2Y2N A;  5F1G A;  4ZJ2 A;  2Y2H A;  1STZ A;  3ISG A;  2PR5 A;  4WEL A;  5HPI A;  1GHI A;  3OPR A;  3U4L P;  4MDZ A;  1F2K A;  5IHV A;  4MN6 A;  1XA7 A;  3IHA A;  2V8F A;  4P6B A;  3D4F A;  2WGI A;  2H0Y A;  3KYZ A;  4GLQ A;  1W63 M;  1SDN A;  3L9K A;  4WN5 A;  2D01 A;  2KDK A;  1PIO A;  1YSP A;  2XD1 A;  1TVF A;  2PYR A;  2A3U A;  3T4K A;  3ICY A;  3QP2 A;  2V1A A;  3CHW P;  3HL9 A;  2Y2G A;  4Q0I A;  3R7W B;  3RTY A;  3FYZ A;  3MZF A;  1PYY A;  5K5B A;  3F1O A;  5DKK A;  2KLI A;  2YKH A;  1YMX A;  3T4L A;  2O9A A;  1UWN X;  2L0W A;  4GN2 A;  2IWB A;  1G28 A;  3TE8 A;  3TW8 A;  2P7J A;  1W5D A;  3W4P A;  2ZQC A;  1IYO A;  2JKR M;  3O87 A;  2HJ9 C;  4GS9 A;  1BUL A;  2B5R A;  2VZW A;  3IBR A;  4L9E A;  5E2H A;  4BMW A;  3PYP A;  1YKD A;  2OAP 1;  5CXW A;  3OZH A;  1IYP A;  3IH9 A;  1PZO A;  3JVU A;  2PU4 A;  4C3Q A;  4NEE D;  3Q7V B;  3I7J A;  3UDF A;  1JVJ A;  4HH3 A;  3C2W A;  1RCJ A;  3K3C A;  2WGV A;  3WS2 A;  5GLD A;  3OPL A;  3UY6 A;  4CLC C;  3V50 A;  2WYX A;  2PBD P;  1J9M A;  3JPU A;  2J3W A;  4X68 A;  5AQB A;  3V67 A;  3C7V A;  4ESP A;  3LFV A;  3SH8 A;  5GHZ A;  2Q9N A;  3MZE A;  3ZGA B;  4WF0 A;  2PYP A;  4FH4 A;  5EFW A;  2W3G A;  2O0Y A;  4OP8 A;  1KGF A;  3PAG A;  2EWV A;  2ZOH A;  5AQ9 A;  3DTK A;  3M6H A;  3DTM A;  3CWF A;  4QB8 A;  2XFT A;  3F1O B;  2W1R A;  3G35 A;  4K91 A;  3TSG A;  1HD8 A;  2FH5 A;  3MFD A;  4OQI A;  3SW1 A;  2WKQ A;  3Q07 A;  4KEN B;  2PRF A;  4GS9 B;  3MKF A;  4S2I A;  3NOP C;  4CLC D;  1MZU A;  2ZM0 A;  1OTD A;  4PMA A;  1YLY A;  1GHP A;  5G4Y A;  3LEZ A;  1IEM A;  4D60 A;  5DJU A;  1LL9 A;  3MR0 A;  2V9A A;  5CTM A;  3T4O A;  3HVF A;  3LY4 A;  3N8L A;  4DE2 A;  5HAI A;  3E4O A;  1PW8 A;  4OLG A;  3T4T A;  3V5M A;  3C38 A;  4NK3 A;  4YWZ A;  2WUQ A;  4IBX A;  3QP1 A;  4X69 A;  2O9B A;  1JWP A;  3GEC A;  4R3A A;  1S1Z A;  5J8X A;  4KZ7 A;  4D2O A;  2UV0 E;  4O8G A;  2ZQ7 A;  2ZM2 A;  1ESU A;  3N6I A;  1Z09 A;  4QY5 A;  2G2U A;  1L3L A;  2A24 A;  1FR6 A;  2H0T A;  4WUJ A;  2ZQ9 A;  1XPB A;  3O88 A;  3GMW A;  3E0Y A;  5HAQ A;  5FAS A;  3ZNT A;  2V1Z A;  1EW0 A;  5EM1 A;  4JXV A;  2ZLY A;  3OOV A;  3LR4 A;  3VP4 A;  3A3J A;  2ZQD A;  4EUV A;  5E2F A;  4E3J A;  2FFY A;  3ZVW A;  3TRC A;  3BJN A;  4LRX C;  2XA7 M;  1D1J A;  1S1Y A;  4WEK A;  5KSH A;  5HD5 A;  5IT5 A;  4WMC D;  1TD5 A;  4X56 A;  1YLT A;  4UAA A;  4OQH A;  4L0L A;  3S7Q A;  2EXA A;  4GB7 A;  3BLS A;  3BQ8 A;  2B18 A;  3UB8 A;  2W27 A;  1PRQ A;  3DTI A;  3ZNY A;  1LSX A;  1MBL A;  3IHB A;  1SCW A;  3QP5 A;  2VX8 A;  3LCE A;  2VEA A;  2A2L A;  2W3E A;  5F68 A;  2JKG A;  4OOY A;  2DCF A;  2WAF A;  4EBN A;  5E2G A;  1SKO A;  2H28 A;  3VP3 A;  5FAT A;  2Y79 A;  3HRE A;  4S2K A;  1L0F A;  1PW1 A;  3FPW A;  3G2Y A;  2A24 B;  4E3I A;  1N4O A;  1NZU A;  2J80 A;  1MKM A;  4OQG A;  5DF7 A;  1OJG A;  2P9V A;  3LID A;  5HX9 A;  3D72 A;  3E98 A;  2ZMF A;  2FFF B;  2ZC4 B;  4P85 A;  2HJE A;  2OLV A;  2R9W A;  2IA2 A;  1BTL A;  1XP4 A;  3EEA A;  3UB5 P;  2VV6 A;  4WZ4 A;  3S7P A;  1MPL A;  4QD4 A;  3IH8 A;  3Q1F A;  4DN0 A;  2W0N A;  1K55 A;  2PAV P;  3ULF A;  4GD8 A;  3VE4 A;  2PBY A;  3Q81 A;  1CEF A;  3FC7 A;  2PD7 A;  3B3X A;  5JYO A;  5FI6 A;  2ZQ8 A;  3KO6 A;  3N7W A;  2K2N A;  3QP4 A;  1GA0 A;  2Z2M B;  5F5Y A;  3CI6 A;  3UDX A;  5FQQ A;  1M40 A;  4MBF A;  2WAD A;  3IBJ A;  4AFI A;  1GSV A;  2EX9 A;  1PWG A;  5EUA A;  4X53 A;  5E43 A;  4ZAM A;  5KMW A;  4P6Z S;  1SKO B;  2Q0O A;  2JN7 A;  5KZH A;  3IT9 A;  1CJF A;  4OKP A;  2Y2O A;  3VFH A;  2WZZ A;  3BW6 A;  1WYB A;  4R1G A;  4OOL A;  1UWP X;  4BL2 A;  2J9P A;  1G6A A;  4XUX A;  2H10 A;  3F1P A;  2QJ5 A;  3PBS A;  2P9V B;  4BD0 A;  4B4X A;  2EX6 A;  4EUZ A;  3CMZ A;  4E6X A;  4K0X A;  4R6L A;  4E3M A;  2QHK A;  4HEF A;  3UB7 A;  4KZB A;  5J4E A;  5MC7 A;  2EFU A;  5CGW A;  1H3Q A;  4II7 A;  4QWO A;  3A3D A;  3UE0 A;  2XFS A;  2RL3 A;  4P0M A;  1L0G A;  1J3W A;  2DRW A;  1OJ5 A;  4CLC A;  2VGL M;  5A90 A;  1ES5 A;  3HLC A;  3NHQ A;  5DTS A;  5FSR A;  4S2L A;  1K56 A;  4N1X A;  5CEB A;  1FR1 A;  3SH9 A;  1W7F A;  3MXR A;  3DW0 A;  4R23 A;  4BBT A;  3S22 A;  2OV5 A;  2WKH A;  5EEC A;  3B42 A;  1JNU A;  3FG8 A;  1U60 A;  2C5W B;  4Y7P A;  1HTZ A;  4EBP A;  1S4R A;  1Y4O A;  1O7E A;  2Q9M A;  3UPN A;  4FTX A;  4ETZ A;  1YQS A;  3HLF A;  3VV4 A;  3UE3 A;  3BY8 A;  4G3K A;  3UO9 A;  4G3W A;  4MCW A;  4G3V A;  2A49 A;  5EE8 A;  4OOM A;  3A0R A;  3CPT A;  2ZMV A;  3OC2 A;  3CUE A;  4I3A A;  1IEL A;  3NDG A;  3HLD A;  2WGW A;  3EWK A;  2XRO A;  3F1P B;  2O99 A;  2XGN A;  3W2Z A;  1D7E A;  5HWT A;  3KSF A;  3ZG7 B;  3HLB A;  2HDQ A;  3KX0 X;  5HAP A;  4K08 A;  5F69 A;  1MC0 A;  3LR3 A;  4X1L A;  2Z6C A;  4Y0T A;  1GCE A;  1D06 A;  5A91 A;  2M7V A;  3C7U A;  4Q0H A;  4ARZ A;  1ZG6 A;  2P74 A;  3P01 A;  3Q7V A;  4CJN A;  3VP2 A;  5FEG A;  1FIK A;  1PNE A;  4E6W A;  3IQA A;  4GDB A;  1K55 C;  4CLC B;  3DBA A;  4BWI A;  4ZJ3 A;  1TS0 A;  1HZO A;  3HLW A;  3BFG A;  3LI8 A;  3H7W A;  1LL5 A;  3JYI A;  1JWZ A;  2JBF A;  3BWL A;  3MJQ A;  1LT0 A;  3MXQ A;  4F94 A;  5EV0 A;  4WMC A;  3A0V A;  1XJ4 A;  4NXG A;  1BUE A;  4UA9 A;  4UEY A;  1F9I A;  3N4I A;  4KG5 A;  3WS0 A;  5HW3 A;  4EQI A;  3SS3 A;  5EVE A;  3CG5 A;  5FL3 A;  2XDM A;  3D9Y A;  4GOG A;  1FCO A;  1PZP A;  3PAE A;  3LR0 A;  2OLU A;  3CPT B;  1F98 A;  4GKU A;  2JKT M;  5BOH A;  4IUK A;  4KQR A;  5HDC A;  4MN7 A;  1T1A A;  4B88 A;  2WGW B;  4GJ4 A;  2CMN A;  3VSK A;  4GCZ A;  2R9X A;  3GQZ A;  4O01 A;  2EX8 A;  1EI5 A;  2HDS A;  4C75 A;  1IKG A;  1KVL A;  4ZTK A;  3EQV A;  1G6O A;  4H8R A;  1BLP A;  1KE3 A;  3CLO A;  3GSG A;  4DDY A;  2Y55 A;  4B9O A;  3A3E A;  4ARZ B;  4XUZ A;  1XJ6 A;  2JC7 A;  1DJA A;  4B4Z A;  3N8S A;  2XEP A;  3KSG A;  4EV4 A;  1VM1 A;  3SS4 A;  4FH2 A;  2NUP C;  3HJI A;  4E3K A;  3H7W B;  3T4S A;  2PHY A;  4LV2 A;  4Y0O A;  2Z2L B;  2ZBB A;  3G6O A;  1PI4 A;  5HZH A;  4DF6 A;  3ZG8 B;  1AXB A;  4X6T A;  5EOO A;  1C3B A;  3UMD A;  3UB9 A;  1ACF A;  2INW A;  2GZA A;  4S2J A;  4PPR A;  4PM7 A;  1YLW A;  1DJB A;  5CGS A;  5A93 A;  4WEJ A;  1YSQ A;  4Y3I A;  3V3R A;  2PU2 A;  5DF8 A;  1XFN A;  4I38 A;  4R38 A;  4PM9 A;  3CUE C;  5KIZ A;  3BFC A;  4IVK A;  2W1T A;  2W3F A;  4I5S A;  3ZQ5 A;  4Y0U A;  3QP6 A;  1ES2 A;  2RCX A;  1OTI A;  1DRM A;  4BJP A;  1BLS A;  3D3O A;  4R4R A;  4KZ4 A;  1K56 D;  3PHY A;  1BLC A;  2HDU A;  2XSS A;  5E2E A;  3WS4 A;  2V8C A;  3RXW A;  4HP9 A;  4LV1 A;  3ITA A;  2P08 A;  3VE3 A;  2L4R A;  3PBN A;  2VGJ A;  1K0K A;  2ZC3 B;  3K3D A;  3LO7 A;  4PAU A;  1GSX A;  1WE4 A;  2VV8 A;  3GR2 A;  3NJA A;  4KZA A;  3O5Y A;  1YLP A;  3IWO A;  4XXR A;  4L9F A;  3UPP A;  4BEN A;  5F83 A;  3PBQ A;  3A0S A;  2WKP A;  2M7U A;  2B02 A;  3FPV A;  2JKR I;  1TDL A;  2V0W A;  2VKS A;  3VP1 A;  3UB6 A;  3IWQ A;  4UQI M;  5FQK A;  2X01 A;  1K6R A;  1ERO A;  4DDS A;  3W4Q A;  1IFQ A;  2LB5 A;  3LY3 A;  3V3S A;  2LB9 A;  3BRM A;  1MWR A;  1CQA A;  1K6S A;  5HDD A;  3HLE A;  3IX4 A;  1FOF A;  2W1T B;  4JLF A;  1T1C A;  4H6J A;  5G4Z A;  2VA0 A;  1O07 A;  3RFB A;  4YOF A;  1S4S A;  3M2J A;  2PD8 A;  4HJ4 A;  1ODV A;  1SKF A;  3LEQ A;  2IWD A;  4P6Z M;  4KUO A;  2ZC5 B;  2BAS A;  2M1C A;  3SOI A;  4X25 A;  3O3V A;  4LV0 A;  1Y28 A;  5TR7 A;  2NUT C;  4X55 A;  5FDH A;  5M19 A;  4OPY A;  4OON A;  1MKI A;  3ZVT A;  5HSQ A;  3MXS A;  1KGG A;  4O7D A;  1Z6F A;  3EOI A;  1BLH A;  2QYB A;  3S7N A;  2XRN A;  2BTF P;  1K57 C;  2Y2Q A;  3MKE A;  4DXB A;  3ZYT A;  4JGP A;  2PR6 A;  1G68 A;  2XR0 A;  4E04 A;  5DFX A;  4M3K A;  1W8Y A;  3NC8 A;  3EGD C;  5DJT A;  1E3U A;  3OCN A;  2Y59 A;  5DTK A;  1A0K A;  4DRT A;  3UE1 A;  2IWC A;  2V20 A;  1TS6 A;  2QWS A;  4CQH A;  4JF6 A;  4IHQ A;  4S2N A;  2GJ3 A;  5FDS A;  4NKP A;  2OSU A;  2Y8H A;  4PM6 A;  3L7H A;  3SS5 A;  3LUQ A;  4H6J B;  5I94 A;  3PTE A;  2HDR A;  4LEN A;  5C5K A;  3E2L A;  3KSI A;  4X1M A;  4FUW A;  5EVI A;  4WL9 A;  1L2S A;  5TJJ A;  1EWZ A;  4GHI A;  3T4Q A;  1T19 A;  4PM5 A;  4WM9 A;  1K4E A;  4BD1 A;  4NXE A;  4ZJ1 A;  2Y2I A;  1L0D A;  1LI9 A;  3IWI A;  3EQU A;  2VGK A;  5F82 A;  3KYQ A;  5EVL A;  4UA7 A;  4NG2 A;  5M18 A;  1K25 A;  5L07 A;  2DNS A;  1OT9 A;  1JWV A;  5CHJ A;  1IYS A;  1FQG A;  4WYY A;  3IXD A;  4QY6 A;  4JGO A;  3LGO A;  3H82 A;  2XK1 A;  2B95 A;  1S0W A;  1ONG A;  3T12 B;  5CRF A;  2Y2M A;  3H9W A;  1MXO A;  3QP8 A;  5LBR A;  4DXC A;  5FQI A;  2J7V A;  3GVB A;  3BLM A;  1PWD A;  3AGF A;  2Y91 A;  3HLG A;  2EFX A;  1YLZ A;  3O86 A;  3V39 A;  1VQQ A;  2XLN A;  3B33 A;  3DAV A;  1P9R A;  2HP6 A;  1KDW A;  2XQZ A;  2XA7 S;  2VK3 A;  2HP9 A;  3KSH A;  3FV7 A;  4Y15 A;  3PR6 A;  4HNB A;  5CHU A;  3K2N A;  3S1Y A;  4LFU A;  4F3L A;  4XT2 A;  1HVB A;  4EU0 A;  4GDN A;  1V9Z A;  5J7E A;  5EVI B;  4KZ3 A;  2ZQA A;  1Q2Q A;  3E4Q A;  4QU3 A;  1I5Q A;  4GHI B;  4GNU A;  3LIF A;  5G18 A;  2VJW A;  3NI9 A;  4MBK A;  4R3B A;  4MMN A;  5DKL A;  2AVX A;  1BYW A;  1VB6 A;  5EOE A;  2XD5 A;  1GA9 A;  4MNR A;  5IU1 A;  4LPZ A;  4HJ6 A;  2V2F F;  4EXO A;  1OTA A;  3C4O A;  1ESI A;  1PFL A;  4HJ3 A;  2E8J A;  4ME4 A;  3QNB A;  1NJ4 A;  2EA9 A;  1KDS A;  1TDG A;  5F6A A;  1WA9 A;  5EM0 A;  4KUK A;  1JTD A;  4WLA A;  1MWS A;  1DY6 A;  3H82 B;  2Y4A A;  4DE0 A;  1LI0 A;  4JXS A;  1SZV A;  1K38 A;  1S6R A;  3P7N A;  3T1R A;  5AJG A;  1I2S A;  3A3F A;  2J3T C;  3OPH A;  3BM6 A;  2HZ5 A;  4ID4 A;  1H5X A;  3LR5 A;  4NXB A;  1UGU A;  4S2N C;  5EPH A;  4F3L B;  4XT2 B;  3IX8 A;  4HQA A;  3BFD A;  2JKF A;  5FQ9 A;  4IVI A;  1OTE A;  3C4P A;  4OVD A;  5EVI C;  1KE0 A;  2BG1 A;  4KZ8 A;  4N9L A;  1NYM A;  4OQ0 A;  2WK0 A;  4I3I A;  3CJM A;  3NUL A;  2ZC6 B;  2MJ6 A;  3NCK A;  1P0Z A;  3LI9 A;  3MQO A;  1P9W A;  3S4X A;  1E3U D;  3GDI A;  3NEC A;  3ZDJ A;  2BLS A;  1ZC2 A;  2Y2J A;  2J3T D;  5TBM A;  1H8M A;  4N1H A;  2ZJ9 A;  1VET A;  5HAR A;  5L8M A;  3G34 A;  4UHU A;  2QJ7 A;  4OPR A;  3IS2 A;  3CAX A;  4OP5 A;  3AGD A;  2ZM8 A;  4IJG A;  3HUO A;  3FWL A;  4WZ5 A;  4OPQ A;  5A8B A;  3WS1 A;  3IXB A;  1NYY A;  2ZOI A;  5EVI D;  5TFQ A;  1GHM A;  5HPF A;  2VV7 A;  5GHY A;  5AVE A;  1LL8 A;  2QMI A;  1ZKJ A;  2CC1 A;  2J9O A;  5CEC A;  1TS7 A;  2G7U A;  2VGL S;  3G30 A;  1ZG4 A;  1SHV A;  3HUN A;  1K54 C;  2EXB A;  5GL9 A;  5DTT A;  2PT7 A;  3UE6 A;  4I39 A;  1NLY A;  4B93 A;  2EWW A;  2JCH A;  3HJK A;  2OWJ A;  2Y2P A; 
#chains in the Genus database with same CATH homology
 1IFQ A;  2HF6 A;  4Y5F A;  3S7P A;  3U2A A;  2LB5 A;  4PKY A;  4DN0 A;  2W0N A;  5AVF A;  3ULF A;  3VE4 A;  2LB9 A;  1OTB A;  3FC7 A;  4EEU A;  2QKP A;  3R7W A;  5HDD A;  2PD7 A;  4BBU A;  4QPR A;  2W1T B;  3KO6 A;  3NOU C;  2K2N A;  1T1C A;  4H6J A;  5F5Y A;  5G4Z A;  1T18 A;  1S67 L;  3CI6 A;  1T1B A;  2O9C A;  3MQ0 A;  5TBM B;  2K7S A;  2VA0 A;  2VLG A;  5IS1 A;  4BBV A;  3RFB A;  1NWZ A;  4YOF A;  1S4S A;  3IBJ A;  2PD8 A;  3B47 A;  4HJ4 A;  4R70 A;  4AFI A;  1ODV A;  3IS2 B;  3PBO A;  2FZ0 A;  1GSV A;  2V0U A;  4P6Z M;  4KUO A;  2BAS A;  2M1C A;  5HWV A;  4P6Z S;  1V9Y A;  2V1B A;  2JN7 A;  3C30 A;  4Y2F A;  4HHD A;  4KQO A;  1Y28 A;  3JVV A;  4GW9 A;  4L9G A;  2NUT C;  3TJZ C;  3BW6 A;  1DP8 A;  1IOU A;  1STZ A;  4OOL A;  2GX5 A;  4YNR A;  2PR5 A;  4WEL A;  5HPI A;  5HSQ A;  1UWP X;  3LIB A;  4MDZ A;  2PDR A;  4FOF A;  4ETX A;  3EOI A;  4MN6 A;  2QYB A;  2QJ5 A;  3F1P A;  2WKR A;  3PBS A;  3S7N A;  2XRN A;  3ZYT A;  2L1M A;  4JGP A;  4R6L A;  2QHK A;  2PR6 A;  3KYZ A;  4GLQ A;  1W63 M;  3UB7 A;  5J4E A;  4NXF A;  5MC7 A;  4E04 A;  1H3Q A;  4II7 A;  5DFX A;  4WN5 A;  3EGD C;  5DJT A;  2D01 A;  2KDK A;  4Z1W A;  3OCN A;  1YSP A;  4M4X A;  2PYR A;  3T4K A;  3ICY A;  2V1A A;  1TS6 A;  4ZRR A;  2QWS A;  4CQH A;  2JKT I;  4Q0I A;  3R7W B;  3RTY A;  1OJ5 A;  4IHQ A;  2VGL M;  4CLC A;  2GJ3 A;  1NRJ A;  3PBR A;  4EW7 A;  4NKP A;  3NHQ A;  2DMW A;  2Y8H A;  5K5B A;  3F1O A;  5DKK A;  2KLI A;  3BY9 A;  3LUQ A;  2YKH A;  4H6J B;  3T4L A;  2O9A A;  1UWN X;  2L0W A;  3TE8 A;  1G28 A;  4BBT A;  5C5K A;  3KSI A;  3TW8 A;  2P7J A;  4HIA A;  3RH8 B;  3B42 A;  4WL9 A;  1JNU A;  3FG8 A;  2JKR M;  5TJJ A;  2HJ9 C;  4GS9 A;  1S4R A;  4GHI A;  4ETZ A;  4Q0J A;  3T4Q A;  2VZW A;  1T19 A;  3IBR A;  4L9E A;  4BMW A;  3PYP A;  4NXE A;  3VV4 A;  1YKD A;  2OAP 1;  4JGR A;  3UE3 A;  3BY8 A;  4G3K A;  3VOL A;  5HD3 A;  4G3W A;  4MCW A;  4G3V A;  1W63 Q;  3EQU A;  4LLO B;  4OOM A;  3JVU A;  5CX7 A;  3A0R A;  3KYQ A;  2ZMV A;  3OC2 A;  3CUE A;  4I3A A;  4NEE D;  3OBF A;  4FSF A;  2OAQ 1;  4HH3 A;  3C2W A;  3EWK A;  3K3C A;  2XRO A;  3MFX A;  1OT9 A;  3F1P B;  2O99 A;  3W2Z A;  1D7E A;  3EEH A;  3NOT C;  5HWT A;  4CLC C;  3E4P A;  1S66 L;  3KSF A;  2J3W A;  2Z6D A;  4JGO A;  3H82 A;  3KX0 X;  2W3H A;  4RQ9 A;  3V67 A;  3C8C A;  3F1N A;  3T4J A;  1KOU A;  3LFV A;  3H9W A;  4K08 A;  5F69 A;  3S7O A;  1MC0 A;  3LR3 A;  5LBR A;  2Z6C A;  4WF0 A;  2PYP A;  1DP9 A;  1N9N A;  1D06 A;  2M7V A;  4Q0H A;  5EFW A;  2W3G A;  4ARZ A;  2O0Y A;  3EGX C;  5DF9 A;  3B33 A;  3P01 A;  4HI4 A;  2EWV A;  2ZOH A;  1XJ3 A;  5DFY A;  3T50 A;  3CWF A;  4CLC B;  1ZHH B;  1P9R A;  3DBA A;  4BWI A;  2XA7 S;  1XFQ A;  1TS0 A;  3F1O B;  2W1R A;  3KSH A;  3LI8 A;  4HOI A;  3H7W A;  4EER A;  3PR6 A;  4HNB A;  4EES A;  3K2N A;  3BWL A;  5HWW A;  2K31 A;  3MJQ A;  4F3L A;  1LT0 A;  3MXQ A;  2FH5 A;  3SW1 A;  4XT2 A;  4EU0 A;  1TF1 A;  2WKQ A;  1V9Z A;  3A0V A;  1XJ4 A;  3PXP A;  4NXG A;  5J7E A;  3MMH A;  4UEY A;  1F9I A;  4GS9 B;  3E4Q A;  2YKF A;  4GHI B;  3NOP C;  4CLC D;  4KQD A;  1MZU A;  3LIF A;  1OTD A;  2VJW A;  4MMN A;  5DKL A;  5G4Y A;  1BYW A;  1VB6 A;  4PHT A;  3LYX A;  5DJU A;  5FL3 A;  1N9L A;  3MR0 A;  1YAX A;  2V9A A;  2JHE A;  4DJ2 A;  5IU1 A;  3LR0 A;  3T4O A;  1F98 A;  3MQQ A;  2JKT M;  4LPZ A;  4HJ6 A;  4IUK A;  4EXO A;  1OTA A;  5HDC A;  4MN7 A;  1T1A A;  5HL6 A;  3E4O A;  3MF0 A;  3PBT A;  4GJ4 A;  2CMN A;  2KOI A;  4GCZ A;  1ZTU A;  4O01 A;  4HJ3 A;  4ME4 A;  4EET B;  3T4T A;  2EA9 A;  3C38 A;  5F6A A;  4YWZ A;  1WA9 A;  1XJ2 A;  4KUK A;  4WLA A;  3H82 B;  3EQV A;  1G6O A;  2HV1 A;  3F1N B;  2O9B A;  3GEC A;  4R3A A;  1GSW A;  1S1Z A;  1NLZ A;  3CLO A;  1TS8 A;  4HY8 A;  4O8G A;  4B9O A;  4O0P A;  4ARZ B;  1P97 A;  3P7N A;  3HCY A;  1XJ6 A;  4UQI S;  2I9V A;  3LIA A;  3KSG A;  5AJG A;  2J3T C;  5I5L A;  2A24 A;  4WUJ A;  3LR5 A;  3HJI A;  2NUP C;  4NXB A;  2GNX A;  1UGU A;  3H7W B;  3T4S A;  1OPX A;  2PHY A;  3E0Y A;  3LIE A;  3UME A;  4F3L B;  3LIC A;  4XT2 B;  2ZBB A;  3G6O A;  4HQA A;  2D02 A;  1EW0 A;  5HZH A;  3OOV A;  3LR4 A;  4JGQ A;  1OTE A;  1LSV A;  3UMD A;  3UB9 A;  4HH2 A;  4EUV A;  2INW A;  2GZA A;  3TRC A;  3BJN A;  4LRX C;  2XA7 M;  4I3I A;  1S1Y A;  4WEK A;  5KSH A;  5HD5 A;  4IUH A;  2MJ6 A;  2KX6 A;  1YSQ A;  4WEJ A;  5IT5 A;  4Y3I A;  5HDS A;  1TD5 A;  1XFN A;  1P0Z A;  3BQA A;  4I38 A;  4L0L A;  3S7Q A;  4MN5 A;  3LI9 A;  3MQO A;  3BQ8 A;  2B18 A;  4R38 A;  1P9W A;  1X0O A;  3UB8 A;  2W27 A;  3CUE C;  5KIZ A;  2W1T A;  2W3F A;  4I5S A;  3ZQ5 A;  1LSW A;  3GDI A;  1LSX A;  2J3T D;  5TBM A;  1H8M A;  4DMZ A;  2VX8 A;  1DP6 A;  1OTI A;  2VEA A;  5L8M A;  4CLC E;  2QJ7 A;  1DRM A;  2A2L A;  4BJP A;  2OOL A;  3D3O A;  2W3E A;  2OWH A;  3IS2 A;  3CAX A;  3R4K A;  3PHY A;  3CIT A;  5F68 A;  2XSS A;  4IJG A;  1VHM A;  1F5M A;  4HP9 A;  2H28 A;  2P08 A;  5A8B A;  3VE3 A;  2Y79 A;  2ZOI A;  2L4R A;  3PBN A;  3FPW A;  4LRZ E;  1OT6 A;  5HPF A;  2VV7 A;  5AVE A;  2A24 B;  1LL8 A;  3K3D A;  4PAU A;  1GSX A;  5J3W A;  2VV8 A;  3NJA A;  2J80 A;  3O5Y A;  1MKM A;  4EQ1 A;  1TS7 A;  3OCL A;  2HGV A;  4L9F A;  4I3J A;  2G7U A;  3PBQ A;  2VGL S;  1OJG A;  3A0S A;  4DJ3 A;  2WKP A;  3LID A;  2M7U A;  3D72 A;  2B02 A;  3OLO A;  3E98 A;  3FPV A;  2JKR I;  2ZMF A;  2P04 A;  2V0W A;  2VKS A;  4EEP A;  1N9O A;  3UB6 A;  2R78 A;  4UQI M;  2PT7 A;  4HP4 A;  3UE6 A;  4I39 A;  2HJE A;  2IA2 A;  1NLY A;  2W3D A;  4B93 A;  2EWW A;  3EEA A;  3HJK A;  4PKY G;  2OWJ A;  4LRY C;  2VV6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...