1F9IA

Crystal structure of the photoactive yellow protein mutant y42f
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
125
structure length
125
Chain Sequence
MEHVAFGSEDIENTLAKMDDGQLDGLAFGAIQLDGDGNILQFNAAEGDITGRDPKQVIGKNFFKDVAPCTDSPEFYGKFKEGVASGNLNTMFEYTFDYQMTPTKVKVHMKKALSGDSYWVFVKRV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Coupling of hydrogen bonding to chromophore conformation and function in photoactive yellow protein.
pubmed doi rcsb
source organism Halorhodospira halophila
molecule tags Signaling protein
molecule keywords PHOTOACTIVE YELLOW PROTEIN
total genus 35
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2000-07-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00989 PAS PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 1f9iA00
4EESA 1N9LA 4JGOA 5HWWA 1LT0A 1EW0A 3KX0X 4LRXC 4M4XA 5F68A 5HWTA 2YKFA 4MN5A 3UB7A 2HV1A 1NWZA 3K3DA 2BASA 4R6LA 1JNUA 1XJ2A 2OWHA 3MQOA 2L0WA 1BYWA 2WKPA 2EA9A 5TBMB 4I3IA 3LUQA 1F98A 3LIDA 1DRMA 1S66L 3A0SA 1T1AA 5DJUA 3LYXA 4MN6A 3UMEA 3NOUC 5G4ZA 5IS1A 1X0OA 4LLOB 2P7JA 2V1BA 3MQQA 1VB6A 5HSQA 3MXQA 3P7NA 2PD8A 4GW9A 5TBMA 4R3AA 1S4SA 1Y28A 3NHQA 2W27A 2PYPA 3BWLA 3CAXA 5HD5A 3E4OA 3LIEA 2OOLA 3C8CA 3VE4A 2B02A 2KX6A 5DKLA 3H9WA 5DJTA 3SW1A 2PHYA 2V9AA 4NXEA 1D06A 4L9EA 2V0WA 5F6AA 2ZOIA 3PHYA 3RH8B 1TS8A 3E4PA 3ZQ5A 1V9ZA 5AVFA 1G28A 1LL8A 4H6JB 2VV7A 4HY8A 4I5SA 4LRZE 4LRYC 2Z6CA 4HP4A 4I38A 3UE6A 4EERA 4JGRA 4F3LA 2K7SA 2CMNA 3H82A 4WF0A 1OT9A 4L9FA 5HDCA 1OJGA 3MJQA 1TS7A 4NXGA 5AVEA 3UB8A 1OTBA 1T1CA 1LSVA 3F1NB 3RTYA 4EXOA 3EWKA 3BY9A 3FC7A 2JN7A 2KDKA 4R38A 1D7EA 4BBVA 5HZHA 1OT6A 5HD3A 2A24A 3F1OA 1LSXA 4WUJA 4F3LB 3LICA 3FG8A 1P97A 3IS2B 4NXFA 3A0VA 3IBRA 1XFNA 3NJAA 1S1YA 4HJ3A 4K08A 4R70A 1OTIA 1P0ZA 3G6OA 4WL9A 1OTEA 4PKYA 4HJ6A 4JGPA 1GSWA 4HIAA 4KUKA 4GS9B 3B33A 2QHKA 4GHIA 5HWVA 2WKQA 4YWZA 2W0NA 2VEAA 4B9OA 2I9VA 3HJKA 2WKRA 2PR6A 4BBTA 4XT2B 4EQ1A 4XT2A 1S67L 2J80A 5A8BA 3H7WB 3C2WA 1UWPX 2VLGA 2PYRA 3CWFA 4HH3A 1XFQA 5G4YA 4GHIB 4BBUA 1ODVA 4HH2A 3F1PA 3LIAA 2PR5A 5HDDA 4HP9A 1T18A 3BY8A 4WLAA 4DJ3A 1KOUA 2QJ5A 1UGUA 1XJ6A 3EEHA 4WN5A 4NXBA 3IS2A 4HHDA 2H28A 1S1ZA 1GSXA 1OJ5A 3NOTC 2VV8A 1OTDA 5IU1A 5J4EA 1T19A 2R78A 2INWA 3E4QA 3F1PB 4KUOA 3ULFA 5F69A 3UB9A 4RQ9A 1S4RA 1DP9A 3F1NA 5KIZA 2QKPA 3H7WA 1T1BA 2YKHA 2D01A 3LIFA 4KQDA 4DJ2A 2M1CA 4EW7A 1WA9A 2L1MA 3OLOA 4HNBA 2PDRA 3ICYA 2QJ7A 1DP8A 1MZUA 3PYPA 4GS9A 5EFWA 1XJ4A 2V1AA 1OTAA 2JHEA 3A0RA 4HQAA 3VOLA 4E04A 4PKYG 3LIBA 5F5YA 3MFXA 3MR0A 2D02A 1F9IA 1GSVA 4GCZA 4L9GA 4HJ4A 4HOIA 2L4RA 2Z6DA 2VV6A 3D72A 2V0UA 3F1OB 2A24B 3GECA 3VE3A 4EEUA 3CLOA 1N9NA 2PD7A 3NOPC 4I3JA 1TS6A 2ZBBA 4I3AA 3UB6A 5DKKA 1TS0A 3GDIA 3UMDA 3LI8A 4JGQA 4I39A 1DP6A 4LPZA 5J3WA 4EETB 3H82B 1N9OA 2ZOHA 5HDSA 3LI9A 5J7EA 2GJ3A 2QWSA 3T50A 4H6JA 2OWJA 5I5LA 1LSWA 1UWNX 1XJ3A 3HJIA 3K3CA 4EEPA 1V9YA 4HI4A
chains in the Genus database with same CATH superfamily
4JBFA 4OOLA 1EW0A 3JYIA 3VP3A 3EOIA 3K3DA 4B88A 3SS4A 5HL6A 1GA0A 5EUAA 4C3QA 3QP2A 5TBMB 5F83A 2ZMAA 5E2HA 4Y17A 3UMEA 3VV4A 1YMXA 1CEGA 1C3BA 4GW9A 3C7UA 2W27A 4YOFA 3PBQA 4UQIS 4LFUA 4KZ6A 1D06A 3DW0A 4S2PA 1G28A 4HY8A 4WBGA 1H0MA 4GOGA 2Z6CA 3WRZA 2Y2GA 1OT9A 4E3OA 1BLHA 1BZAA 3BY9A 2A3UA 4DE1A 4DXCA 4DE2A 4K08A 1EWZA 3MFDA 1K25A 3R7WB 4Q0JA 1S67L 5AQ7A 3S1YA 3DTIA 4HEFA 4EV4A 1K4FA 4X55A 3GMWA 1IFQA 1GSXA 2XD1A 2H0YA 4E6WA 3O87A 3D3OA 3UPOA 3PR6A 3BW6A 2ACGA 1GSVA 2L4RA 3LO7A 3LFVA 5CHJA 1BLPA 3FWLA 4G3VA 2AVXA 1ZTUA 3UPPA 4KZ7A 3CPTA 4HBUA 1RGZA 3ZFZA 3BECA 5CGSA 4MLLA 1W7FA 2QMIA 1MWRA 4O7DA 3MQ0A 1F98A 1FR1A 3KO6A 4JF4A 5DJUA 1H3QA 1X0OA 1ONHA 1AXBA 5TBMA 1S4SA 3LR0A 3C38A 2XA7M 1TD5A 4BD0A 4LV2A 5CHUA 4NXEA 4L9EA 4PM6A 3QP1A 4ZRRA 1ZG4A 3E4PA 2ZQCA 3MZDA 1NYYA 3DTMA 3MJQA 3PBNA 4R1GA 1OT6A 1GA9A 1S0WA 5FAOA 1IKGA 3FG8A 3IS2B 1XFNA 4KG2A 4R70A 2J3WA 5C5KA 2BLSA 5HARA 4WL9A 1GSWA 3B33A 1NY0A 2VEAA 2WKRA 3IQAA 4BBTA 4ZJ2A 4KENB 4U0TA 5HDDA 4RX2A 4BJPA 1K6RA 3E98A 3GQZA 1VQQA 5IU1A 2R78A 5GLBA 5LBRA 3F1NA 3G32A 5G18A 5E2EA 4FD8A 3Q82A 4KZ8A 4MNRA 3R7WA 1XJ4A 3A0RA 4CPKA 1JWVA 3MFXA 3NI9A 2HP9A 1TS6A 1ESUA 5E2FA 2RL3A 4D2OA 4GD8A 4WMCA 3UMDA 5FQKA 4EETB 1N9OA 2Y2QA 3QNCA 4NKPA 1BT5A 3BM6A 1NWZA 4P0MA 3CMZA 3EGDC 2QPNA 3LUQA 3HLBA 1SCWA 2EX9A 3V5MA 3Q81A 3KSIA 3HBRA 3IF5A 2Y2IA 3CAXA 4O0PA 3C4PA 5EM0A 3SW1A 4S2NC 4MCWA 4FCFA 4EUZA 3L9KA 4HP4A 3W4PA 4EBLA 5AVEA 2FFYA 2NUTC 5IT5A 3ZG5A 2A24A 2X02A 1P97A 2P04A 5DKKA 1OTIA 4MDZA 1ONGA 1ERQA 2XA7S 2J80A 1N4OA 3EGXC 4BBUA 2IWCA 4RVAA 2EFXA 3QHYA 1ZKJA 4OLGA 4NG2A 1RP5A 2VV8A 5FI2A 1A0KA 3PXPA 4WZ4A 4GN2A 2ZLYA 4P87A 3HLFA 3IXDA 2KLIA 2XR0A 3IHBA 3LR5A 3BEBA 1KVLA 3AGEA 1MWSA 1N9BA 3ZCZA 2HPBA 3VE3A 3LR3A 3CLOA 4I3JA 1NXYA 5CXWA 4IBRA 5EE8A 3SH7A 3P01A 3H82B 1NJ4A 2EX6A 5FASA 3FV7A 4FH4A 2YKFA 3V39A 1IOUA 4Z1WA 2R9WA 1E25A 2ZM0A 2VX8A 3MXQA 3OPRA 5L2FA 4QHCA 1VHMA 4O01A 1YM1A 1PW1A 3WS0A 3H82A 5HAIA 2V20A 4Y0OA 1L0GA 4MBHA 2ZL1B 4NETA 4ETZA 3FKVA 2PT7A 1S1YA 4JGPA 2CC1A 1XGIA 4GHIA 4YWZA 4C75A 4PM9A 5DF8A 1TDLA 2Y55A 3VOYA 1Z09A 3LIAA 1K57C 3QP6A 4F94A 1VEUB 1UGUA 4IVIA 3UY6A 3BLMA 4PPRA 3NOTC 5L09A 1PWCA 1HD8A 3B3XA 3IT9A 3LIFA 4E3JA 5DTTA 1M40A 4BWIA 4FTXA 4WM9A 3WS4A 1MY8A 2Y2PA 3MR0A 4OOYA 4BQMA 3A3DA 1H8ZA 4F3LA 2E8JA 5MC7A 5EM1A 2JCHA 3FZCA 5K5BA 1CI8A 5DTSA 1GHMA 4EU0A 2PAVP 1EROA 4U3TA 5GHYA 3UB7A 4LRXC 1IYOA 1KGGA 3ZG0A 4OH0A 2BASA 2H0TA 2VA0A 3KSHA 4I3IA 4S2LA 5FI6A 4PMAA 1S66L 3A0SA 4KZAA 5EVIB 1BTLA 1PFLA 4MBFA 4OQHA 3UB5P 3P7NA 2PD8A 4R3AA 1Y28A 4DXBA 4G3KA 1YLJA 1NLZA 4IVKA 4Q0IA 5DKLA 1PZOA 1K54C 3RH8B 4KQRA 4YFMA 5FQMA 4H6JB 4Y3IA 2OAP1 4MMNA 3UE6A 1YLZA 4JGRA 5DVAA 4L9FA 5FDSA 3I7JA 2XFTA 2XFSA 5HPIA 1XA1A 1XKZA 3ZG8B 4QB8A 5FEGA 5FQ9A 4E3LA 2XK1A 1W8YA 4M3KA 4D60A 1S6RA 4MN7A 4L0LA 2PYRA 1XFQA 3FYZA 4FUWA 2O9BA 4LV0A 1FCOA 3VP2A 1S4RA 1DP9A 3AGFA 2BTFP 3MZFA 3C4OA 3OLOA 3PYPA 1MZUA 1MWTA 1OTAA 2EWWA 3N7WA 4E3KA 2JKRM 3UNWA 5HFOA 2DMWA 2W3GA 5BOHA 5HAPA 2EX2A 5HX9A 3CG5A 4JLFA 3O5YA 4ZJ3A 4Y13A 1JVJA 1ALQA 2WKPA 1W63M 1SKFA 4Y15A 3NOUC 5IS1A 4IBXA 2ZC6B 1K38A 3FPWA 2OOLA 4QWOA 5KZHA 3OPHA 1LL8A 4KQQA 4CLCD 5EVLA 3HLGA 2Y91A 5HDCA 1XGJA 3QP8A 4QD4A 2ZQ8A 3HREA 3F1OA 1I2SA 3NBLA 3GVBA 2O9CA 4PKYA 1K6SA 4HIAA 2I9VA 5DTKA 3MF0A 5CEDA 2M7VA 4XXRA 3MBZA 3IF6C 2QJ5A 1XJ6A 4N9KA 3CUEA 5A90A 3GTCA 4E3NA 4KQDA 1XA7A 4JPMA 3FKWA 2VKSA 4PAUA 4Y5FA 1PWDA 2BG1A 4PKYG 2JC7A 4IUKA 4HJ4A 1ZG6A 2V0UA 2ZQDA 1ES3A 4EEUA 2M7UA 3NOPC 3HCYA 3LI8A 4LV1A 1NZOA 2EXAA 3G4PA 3T50A 3LY3A 2DCFA 3PBOA 2PU2A 3B42A 3HJIA 4HP9A 4EEPA 4O8GA 4OQGA 4M4XA 2Y2NA 4C6YA 2GDNA 4WEKA 2UWXA 4CLCE 3DTKA 3T1RA 5EV0A 2O99A 5CEBA 2ZC4B 5G4ZA 1LI9A 4Y0UA 3O3VA 2Y2JA 3VFFA 1NLYA 2XSSA 1RGYA 2PYPA 3E4OA 3LIEA 1K55C 3A3JA 4R23A 2H5SA 5DJTA 2R9XA 4ZAMA 5KSHA 1V9ZA 1WYCA 3S7NA 1BUEA 3VP4A 1JWPA 1ZHHB 4JXWA 3V50A 1LI0A 1LSXA 2Q9NA 4NXFA 4NEED 3A0VA 3IBRA 3NJAA 3KYZA 3CITA 4GB7A 4FH2A 3E0YA 4HJ6A 2LB9A 4GS9B 5HWVA 4B9OA 3DAVA 3K2NA 3PAEA 2PR6A 4XT2B 2JKTI 1W79A 3MS6A 3S7OA 3MSHA 2XLNA 5E2GA 5CERA 3IS2A 2NUPC 4DMZA 5U47A 5F69A 2VGLM 3BYDA 5M19A 2M1CA 2ZM2A 1YPRA 5GHXA 2PDRA 5FEFA 3M2KA 5GLAA 5M1AA 1E3UA 2Y2MA 1SKOA 2D02A 3ITBA 1KGEA 4HOIA 4K0WA 4UQIM 1NRJA 2VV6A 2Z2MB 2ZL1A 5HW3A 1CI9A 4OOMA 4HBTA 4LPZA 4AFIA 1ESIA 3VOZA 3CZDA 4CQHA 2Y8HA 5F68A 4MN5A 3NC8A 5GLDA 4CJNA 4R6LA 2L0WA 1KDSA 3D4FA 2B5RA 3MMHA 3S7PA 4OPRA 4ZTKA 4N1XA 4BLMA 4E3MA 3MQQA 3T4OA 2ZC7A 3JVUA 3NDEA 4KG6A 4B4XA 3SZTA 3H9WA 3GV9A 1CJFA 5F6AA 3BQAA 5HPFA 2HDRA 5JYOA 2CMNA 2FFFB 2WGWB 1OTBA 3EWKA 3FC7A 4DN0A 3HL9A 4WUJA 2J7VA 1SDEA 1PYYA 2C5WB 1FILA 1Y4OA 4KUKA 1ZC2A 2W0NA 4GDBA 1YLWA 3Q7VB 2E8IA 2UV0E 3T4LA 1MXOA 1RCJA 5G4YA 1UWPX 3T1SA 3MXSA 1YAXA 1O07A 2HZ5A 1T18A 1TEMA 1YKDA 4WN5A 3T12B 5FQIA 4LCLA 3ZDJA 1I2WA 3E4QA 3HUMA 2QKPA 2D01A 4ESPA 2MJ6A 2G7UA 2EXBA 4GS9A 5HSQA 2JHEA 3LIBA 5F5YA 4Z9QA 1G68A 4Q0HA 3D72A 5CTNA 4KZ9A 3MZEA 2ZBBA 5F1FA 2KOIA 1F2KA 2JKTM 4A5RA 1NZUA 4E6XA 5DF7A 3LEQA 1NRFA 4CLCC 3T4TA 5EVID 5CECA 3S7QA 3SOIA 5KSCA 3TG9A 4LGWA 4OVDA 2O9AA 3E2LA 1WE4A 1HZOA 4ZJ1A 1TF1A 3IXGA 3S4XA 3C8CA 1MKMA 3VE4A 3SS5A 1MPLA 4X1MA 3SH9A 4WF0A 2Q0OA 3IXHA 1LSVA 3EEAA 5FSRA 4BBVA 4PM7A 4R38A 5DFXA 5HD3A 3OZHA 3ZG7B 1IYPA 3EQVA 4HJ3A 4EWFA 1MWUA 2QHKA 2RCXA 1KE3A 2PBYA 1L3LA 4OQ0A 2QZ6A 3T4SA 2ZQ7A 3TRCA 3SH8A 2JE5A 3BRMA 2ZQ9A 3NDGA 4UHUA 5AQ9A 3T4QA 2PBDP 1JTDA 1S1ZA 3KYQA 4KUOA 3QP4A 4PHTA 2YKHA 2WGWA 3MKEA 4DJ2A 2L1MA 3V3RA 2WKHA 3O88A 3MKFA 2QJ7A 4PM8A 3C30A 1H8MA 1E3UD 4GCZA 4OKPA 2Z6DA 2WZXA 4EBNA 1K56A 4R4SA 4ID4A 1G6OA 1WYBA 3HUNA 1LSWA 3ZGAB 4EUVA 1FCMA 2P9VB 2IWDA 3BFDA 1VETB 3CI6A 1ES2A 1STZA 4JKTA 5FQJA 5L10A 4WMCD 3M2JA 3UE0A 2C6WB 3L7HA 4LLOB 4Y7PA 4DE0A 5GL9A 5FA7A 3IH8A 3ZNTA 5FI7A 4R3BA 1DY6A 3C7VA 2W3EA 5FAQA 2DRWA 4BD1A 4X56A 2V0WA 5CHMA 1HVBA 1O7EA 3IWIA 1IEMA 3OOVA 2A2LA 3HVFA 3SS3A 1CQAA 2A49A 2KDKA 2B95A 4GD6A 2OAQ1 4IHQA 1P0ZA 3G6OA 1KVMA 4WZ5A 1GHPA 1BULA 3WWXA 3WS2A 4GJ4A 1ERMA 3IWOA 1YQSA 3F1PA 3UE1A 1SHVA 3UDFA 4OLDA 3VMAA 3IF6B 2Z2LB 1BLSA 2O0YA 4NXBA 1K55A 4ZBEA 2B18A 2PU4A 3WS1A 1TVFA 2JKFA 1SZVA 3Q1FA 1T1BA 2WADA 3W4QA 3ISGA 3VP0A 1EI5A 2WK0A 2OLVA 3G30A 1W63Q 2W1RA 4MBKA 3RFBA 1F9IA 3GRJA 4I39A 5HDSA 2V8FA 5J7EA 4H6JA 3R4KA 3RJUA 2QYBA 3UDIA 2ZC5B 1G6AA 1L0DA 1Z6FA 3IH9A 1JNUA 3MQOA 3LIDA 2Y2KA 5L8MA 1XPBA 3ZHHA 2VZWA 3NHQA 5HD5A 1Q2PA 3LY4A 4WEJA 1FSWA 1K4EA 1L0EA 2VGJA 2V9AA 1FR6A 3PHYA 4JXVA 2OV5A 3UN7A 2G2WA 1PRQA 4LRZE 3HLDA 3G35A 4I38A 3IHAA 2WYXA 4OPZA 1J9MA 1LL9A 2ZQAA 5HL1A 5E43A 3T1QB 4LV3A 2EWVA 1CK3A 3KSFA 4R3JA 1KDWA 1ES4A 2FZ0A 1NYMA 4WYYA 4GKUA 4N9LA 2ZJ9A 1PW8A 1QMFA 4HHDA 3AGDA 4ARZA 2G2UA 3DWZA 3G34A 4X53A 5EVIC 1K0KA 3P98A 2Y2LA 4HQAA 4GNUA 3OCNA 2XD5A 2Y2HA 3JPUA 2V1ZA 4RX3A 4S2KA 1FIKA 1I5QA 2HDQA 1K56D 4PM5A 5TGFA 2XROA 5CTMA 5HAQA 5J3WA 3EQUA 4GLQA 1PNEA 1CF0A 4K91A 4EESA 1H5XA 1Y54A 1DJAA 3IWQA 5HWTA 3T4KA 2Y59A 1MBLA 1U60A 3VSLA 5FQQA 2P9VA 1GHIA 5F82A 2W1TA 3V67A 3GR2A 2V1BA 1VB6A 4E3IA 2DNSA 1HLUP 4B4ZA 2WKIA 1GCEA 1IELA 1PZPA 1OJGA 4DE3A 4P6ZM 4NXGA 5KMWA 1T1CA 5F1GA 1D7EA 3TJZC 4DRTA 3NECA 3LICA 3G2YA 4JXGA 4GZBA 1VEUA 1YSQA 1MC0A 3RXXA 3FPVA 5A93A 4HH2A 2WGIA 1AWIA 1F5MA 1P9WA 4S2IA 2XF3A 2H28A 3Q7ZA 4KG5A 1BSGA 3IF6A 4BMWA 3F1PB 3TSGA 1YLPA 1Q2QA 3N8RA 5DF9A 3PTEA 4UA9A 1WA9A 3ICYA 1DP8A 2V1AA 2J3TC 4X6TA 3ZYTA 4H8RA 3Q07A 3ZG9B 1N9NA 3U4LP 4UAAA 1IYQA 3NULA 2GX5A 1BLCA 1K54A 1DP6A 4OPYA 3VSKA 1W5DA 5EOOA 5M18A 2Y2OA 3LI9A 4QY5A 2OWJA 3VOLA 3UB8A 2WGVA 2EX8A 2J8YA 2JKGA 2HDUA 3IBJA 3UPNA 2WAFA 2OWHA 1KE0A 4OP5A 5GLCA 4R4RA 4K0XA 2WKEA 3IX4A 4NK3A 3KYEA 3LGOA 4N1HA 4OQIA 2PRFA 3G31A 3BWLA 4UA6A 2KX6A 5I94A 3CJMA 3DBAA 4QJGA 1LHYA 2ZOIA 4JXSA 4ZDXA 1ES5A 3CUEC 1HTZA 3TE8A 1JWZA 3NY4A 3BFGA 4B93A 3PBSA 2VGKA 4FSFA 2HP6A 2JN7A 4LCMA 5HZHA 4CLCB 4ARZB 2HDSA 3IX3A 1PIOA 2J9OA 2ZM8A 3PBTA 4X69A 4P85A 5J8XA 2Y4AA 2VK3A 1PI5A 3HJKA 4Y2FA 1YLYA 3PBRA 4XT2A 3Q7VA 5A8BA 5CGWA 3RXWA 2JBFA 4HH3A 5EVEA 4WLAA 3LR4A 3BY8A 3BQ8A 2X01A 3UO9A 2X71A 2IA2A 1T19A 2LB5A 4P6ZS 2V8CA 1D1JA 2ZC3B 3WS5A 5EFWA 4R0QA 3N6IA 4E04A 4MEZA 3N8SA 5DFYA 4IUHA 4X25A 3F1OB 3S22A 3IX8A 3UB6A 2J9PA 2WUQA 2ZD8A 1XXMA 1DJBA 4S2NA 4ETXA 1DJCA 5I5LA 1XJ3A 3U2AA 3K3CA 1V9YA 4S2MA 3KX0X 1XJ2A 1BYWA 2EA9A 2I72A 1VM1A 3LYXA 1IYSA 3A3FA 1KE4A 2EFUA 3PAGA 3N4IA 4JF6A 4ME4A 1VETA 1SKOB 4I5SA 2Q9MA 3ZVTA 3NCKA 1YSPA 1E4DA 1P9RA 1TS7A 3HLCA 1MKIA 4XUZA 1L0FA 3RTYA 3T1XA 5AQAA 4EXOA 2XDMA 4U0XA 3W4OA 5IHVA 4RA7A 2XQZA 1YMSA 2GZAA 1OTEA 2H10A 5CX7A 4OPQA 2XGNA 4EQ1A 3CHWP 3H7WB 1H8YA 2XRNA 1CEFA 1FQGA 1J3WA 3OPLA 4DJ3A 1L2SA 4IJGA 5J4EA 4UEYA 3ULFA 3UB9A 3M6BA 4G3WA 1YT4A 5A91A 5A92A 1TDGA 2HF6A 2W3HA 5TFQA 3HUOA 2Y79A 2XEPA 5CRFA 3O86A 2K31A 4N92A 4JF5A 2OLUA 2WAEA 3GECA 2K2NA 2PD7A 1FSYA 5EECA 2V2FF 4JGQA 3W2ZA 2J3TD 1LLBA 4YNRA 1LT0A 4IEDA 2WZZA 4EQIA 1T1AA 1PWGA 3CPTB 2OSUA 3LEZA 4KZBA 1SDNA 2W1TB 4WELA 3V3SA 2W3DA 5EPHA 2B02A 3OC2A 2PHYA 1M6KA 1OPXA 5L07A 3ZQ5A 5AVFA 5JYPA 5D3OA 3T4JA 4EERA 2K7SA 3DWKA 4KQOA 3BLSA 3F1NB 4FOFA 1K57A 4BL3A 1QMEA 3BFCA 3WRTA 1IKIA 4F3LB 4DDYA 4QY6A 5TR7A 3D9YA 2W3FA 2HJEA 4X68A 3W8KA 3A3IA 5FAPA 2HGVA 2VLGA 1ODVA 2PR5A 2VGLS 1LL5A 1OJ5A 5AQBA 2INWA 3VFHA 4RQ9A 4UA7A 4WZ5C 3GSGA 3QNBA 5KIZA 3OCLA 4EW7A 4HNBA 4S2OA 3M6HA 3N8LA 3ZNYA 2FH5A 4QU3A 2ZMVA 3B47A 1KGFA 4KZ4A 3BJNA 3BFEA 5CGXA 5EVIA 4LENA 5TJJA 3IXBA 2QWSA 4P6BA 4BENA 1UWNX 3HLWA 2ZOHA 5HWWA 1N9LA 4JGOA 4QPRA 3UDXA 2HV1A 5FL3A 3JVVA 3VP1A 2GNXA 1JTGA 1G5UA 1FOFA 1DRMA 1OMEA 4II7A 4MN6A 2P7JA 4X1LA 5FATA 2P74A 4DF6A 4HESA 3OPPA 4GDNA 1XX2A 4S2JA 1TS8A 2HJ9C 4BL2A 2VV7A 5FDHA 4LRYC 3OBFA 5GHZA 3A3EA 3G2ZA 4KZ5A 3BFFA 3TW8A 4OP8A 1W8QA 2JKRI 3DTEA 3QP5A 3KSGA 2P08A 3LCEA 3NIAA 1YLTA 4DDSA 1ACFA 2WKQA 3UE3A 1PI4A 4RYEA 1FCNA 3C5AA 3C2WA 3TOIA 3CWFA 4GHIB 4XUXA 3HLEA 4KZ3A 1KOUA 3EEHA 1OTDA 4CLCA 4OONA 3MXRA 3H7WA 4EBPA 2ZMFA 3ITAA 1XP4A 4Q8IA 4Y0TA 3ZVWA 4L9GA 2IWBA 2XH9A 3E2KA 2A24B 4DKIA 4I3AA 4YINA 1TS0A 3GDIA 5AJGA 3P09A 2GJ3A 2VJWA 5EOEA 2HP5A 4HI4A
chains in the Genus database with same CATH topology
4OOLA 4CLCC 3T4TA 1EW0A 4LRXC 3UB7A 3EOIA 3K3DA 3S7QA 3IBJA 2BASA 5HL6A 2VA0A 2OWHA 3KSHA 5TBMB 4I3IA 1S66L 2O9AA 3A0SA 3UMEA 3VV4A 3P7NA 2PD8A 1TF1A 4GW9A 4R3AA 1Y28A 2W27A 3BWLA 4G3KA 4YOFA 1NLZA 1MKMA 3C8CA 4Q0IA 2KX6A 5DKLA 3VE4A 3DBAA 3PBQA 4UQIS 1D06A 3RH8B 2ZOIA 1G28A 4H6JB 4HY8A 4Y3IA 2OAP1 2Z6CA 4MMNA 3UE6A 3CUEC 4JGRA 4WF0A 3TE8A 1OT9A 4L9FA 4B93A 3PBSA 1LSVA 4FSFA 3BY9A 3EEAA 2JN7A 4BBVA 4R38A 5DFXA 5HZHA 5HD3A 4CLCB 5HPIA 4ARZB 3EQVA 4HJ3A 4K08A 3PBTA 3R7WB 2QHKA 3HJKA 4Y2FA 4MN7A 3PBRA 4Q0JA 3T4SA 4XT2A 1S67L 5A8BA 3TRCA 4L0LA 2PYRA 4HH3A 1XFQA 4WLAA 3LR4A 3BY8A 3BQ8A 3T4QA 2O9BA 1IFQA 1S1ZA 1GSXA 3KYQA 2IA2A 1T19A 2LB5A 4KUOA 4P6ZS 4PHTA 1S4RA 1DP9A 2YKHA 4DJ2A 3D3OA 2L1MA 3OLOA 3PYPA 2QJ7A 1MZUA 5EFWA 3C30A 1OTAA 1H8MA 3PR6A 4E04A 2EWWA 3BW6A 5DFYA 1GSVA 4IUHA 4GCZA 2JKRM 2L4RA 2Z6DA 3LFVA 3F1OB 3UB6A 4G3VA 1ZTUA 4ETXA 1G6OA 2DMWA 5I5LA 2W3GA 1LSWA 1XJ3A 3U2AA 3K3CA 1V9YA 4EUVA 3KX0X 3O5YA 1XJ2A 3CI6A 1STZA 1BYWA 2WKPA 2EA9A 3MQ0A 1W63M 1F98A 3KO6A 5DJUA 3LYXA 3NOUC 1H3QA 1X0OA 4LLOB 5IS1A 5TBMA 1S4SA 3FPWA 3LR0A 3C38A 2XA7M 1TD5A 2W3EA 4ME4A 2OOLA 4NXEA 4L9EA 2V0WA 3E4PA 4ZRRA 4I5SA 1LL8A 4CLCD 3OOVA 2A2LA 1YSPA 5HDCA 1P9RA 3MJQA 1TS7A 3PBNA 3UB8A 3RTYA 4EXOA 2KDKA 1OT6A 3F1OA 3FG8A 3IS2B 1XFNA 2OAQ1 4IHQA 4R70A 2J3WA 5C5KA 1P0ZA 2GZAA 3G6OA 1OTEA 2O9CA 4PKYA 4WL9A 1GSWA 4HIAA 3B33A 5CX7A 2VEAA 2I9VA 2WKRA 4BBTA 3MF0A 4EQ1A 3H7WB 4GJ4A 2XRNA 2M7VA 3F1PA 5HDDA 4BJPA 4DJ3A 2QJ5A 1XJ6A 2O0YA 3E98A 4NXBA 2B18A 4IJGA 5IU1A 3CUEA 5J4EA 4UEYA 2R78A 3ULFA 3UB9A 4G3WA 5LBRA 3F1NA 1T1BA 4KQDA 2VKSA 4PAUA 4Y5FA 2HF6A 3R7WA 2W3HA 1W63Q 1XJ4A 3A0RA 4PKYG 2W1RA 3MFXA 2Y79A 3RFBA 1F9IA 4IUKA 4HJ4A 2K31A 2V0UA 4EEUA 3GECA 2M7UA 2K2NA 2PD7A 3NOPC 1TS6A 3UMDA 3HCYA 3LI8A 4JGQA 4I39A 4EETB 1N9OA 5HDSA 5J7EA 3T50A 4H6JA 3W2ZA 2J3TD 3PBOA 4HP9A 3B42A 3HJIA 3R4KA 4EEPA 4O8GA 2QYBA 4YNRA 1LT0A 4M4XA 4NKPA 1NWZA 3EGDC 1JNUA 3MQOA 4WEKA 3LUQA 4CLCE 3LIDA 1T1AA 5L8MA 2O99A 5G4ZA 2W1TB 4WELA 3KSIA 2VZWA 1NLYA 2XSSA 3NHQA 2PYPA 3CAXA 4O0PA 5HD5A 2W3DA 3E4OA 3LIEA 4WEJA 2B02A 3OC2A 5DJTA 3SW1A 2PHYA 2V9AA 1OPXA 4MCWA 5KSHA 3PHYA 3ZQ5A 1V9ZA 5AVFA 3S7NA 4LRZE 4HP4A 4I38A 3T4JA 1ZHHB 4EERA 2K7SA 4KQOA 5AVEA 2NUTC 3F1NB 4FOFA 5IT5A 2A24A 1LSXA 4F3LB 1P97A 4NXFA 2P04A 4NEED 3A0VA 3IBRA 3NJAA 2EWVA 5DKKA 3KYZA 1OTIA 3CITA 4MDZA 3E0YA 3KSFA 4HJ6A 2LB9A 4GS9B 2W3FA 5HWVA 4B9OA 2HJEA 3K2NA 2XA7S 2PR6A 4XT2B 2JKTI 2FZ0A 2J80A 2HGVA 3EGXC 2VLGA 4BBUA 1ODVA 3S7OA 2PR5A 2VGLS 4DMZA 3IS2A 2NUPC 4HHDA 1OJ5A 2VV8A 4ARZA 2INWA 3PXPA 5F69A 2VGLM 4RQ9A 5KIZA 2M1CA 3OCLA 4EW7A 4HNBA 2PDRA 2KLIA 4HQAA 3OCNA 3LR5A 2D02A 4HOIA 3VE3A 4UQIM 1NRJA 2FH5A 2VV6A 3LR3A 3CLOA 2ZMVA 4I3JA 3B47A 2XROA 4OOMA 3BJNA 4LPZA 3P01A 5J3WA 3H82B 3EQUA 4AFIA 5TJJA 4GLQA 2QWSA 4CQHA 2Y8HA 1UWNX 2ZOHA 4EESA 1N9LA 4JGOA 5HWWA 4QPRA 5F68A 5HWTA 3T4KA 2YKFA 4MN5A 2HV1A 4R6LA 2L0WA 5FL3A 1IOUA 3JVVA 4Z1WA 2GNXA 3S7PA 3MMHA 1DRMA 2W1TA 4II7A 4MN6A 3V67A 2P7JA 2V1BA 3MQQA 1VB6A 2VX8A 3MXQA 3T4OA 3JVUA 3H9WA 5F6AA 1VHMA 3BQAA 1TS8A 4O01A 2HJ9C 5HPFA 2VV7A 4LRYC 3OBFA 2CMNA 3H82A 1OJGA 4P6ZM 4NXGA 1OTBA 1T1CA 3TW8A 3EWKA 3FC7A 4DN0A 1D7EA 3TJZC 2JKRI 4WUJA 3LICA 3KSGA 4ETZA 2PT7A 2P08A 1S1YA 1YSQA 4JGPA 4KUKA 1MC0A 4GHIA 2WKQA 4YWZA 2W0NA 3FPVA 3UE3A 3T4LA 3C2WA 1UWPX 3CWFA 5G4YA 1YAXA 4GHIB 4HH2A 3LIAA 1T18A 1KOUA 1UGUA 1F5MA 1P9WA 1YKDA 3EEHA 4WN5A 2H28A 3NOTC 1OTDA 4CLCA 4BMWA 3E4QA 3F1PB 5DF9A 2QKPA 3H7WA 3LIFA 2D01A 1WA9A 4BWIA 2MJ6A 2ZMFA 3ICYA 1DP8A 2G7UA 4GS9A 2V1AA 5HSQA 2J3TC 2JHEA 3LIBA 5F5YA 3MR0A 3ZYTA 4L9GA 4Q0HA 4F3LA 5MC7A 3D72A 2A24B 1N9NA 4I3AA 2ZBBA 2KOIA 1TS0A 3GDIA 2JKTM 5AJGA 2GX5A 1DP6A 3LI9A 2GJ3A 5K5BA 2VJWA 2OWJA 3VOLA 4EU0A 4HI4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EES A;  1N9L A;  4JGO A;  5HWW A;  1LT0 A;  1EW0 A;  3KX0 X;  4LRX C;  4M4X A;  5F68 A;  5HWT A;  2YKF A;  4MN5 A;  3UB7 A;  2HV1 A;  1NWZ A;  3K3D A;  2BAS A;  4R6L A;  1JNU A;  1XJ2 A;  2OWH A;  3MQO A;  2L0W A;  1BYW A;  2WKP A;  2EA9 A;  5TBM B;  4I3I A;  3LUQ A;  1F98 A;  3LID A;  1DRM A;  1S66 L;  3A0S A;  1T1A A;  5DJU A;  3LYX A;  4MN6 A;  3UME A;  3NOU C;  5G4Z A;  5IS1 A;  1X0O A;  4LLO B;  2P7J A;  2V1B A;  3MQQ A;  1VB6 A;  5HSQ A;  3MXQ A;  3P7N A;  2PD8 A;  4GW9 A;  5TBM A;  4R3A A;  1S4S A;  1Y28 A;  3NHQ A;  2W27 A;  2PYP A;  3BWL A;  3CAX A;  5HD5 A;  3E4O A;  3LIE A;  2OOL A;  3C8C A;  3VE4 A;  2B02 A;  2KX6 A;  5DKL A;  3H9W A;  5DJT A;  3SW1 A;  2PHY A;  2V9A A;  4NXE A;  1D06 A;  4L9E A;  2V0W A;  5F6A A;  2ZOI A;  3PHY A;  3RH8 B;  1TS8 A;  3E4P A;  3ZQ5 A;  1V9Z A;  5AVF A;  1G28 A;  1LL8 A;  4H6J B;  2VV7 A;  4HY8 A;  4I5S A;  4LRZ E;  4LRY C;  2Z6C A;  4HP4 A;  4I38 A;  3UE6 A;  4EER A;  4JGR A;  4F3L A;  2K7S A;  2CMN A;  3H82 A;  4WF0 A;  1OT9 A;  4L9F A;  5HDC A;  1OJG A;  3MJQ A;  1TS7 A;  4NXG A;  5AVE A;  3UB8 A;  1OTB A;  1T1C A;  1LSV A;  3F1N B;  3RTY A;  4EXO A;  3EWK A;  3BY9 A;  3FC7 A;  2JN7 A;  2KDK A;  4R38 A;  1D7E A;  4BBV A;  5HZH A;  1OT6 A;  5HD3 A;  2A24 A;  3F1O A;  1LSX A;  4WUJ A;  4F3L B;  3LIC A;  3FG8 A;  1P97 A;  3IS2 B;  4NXF A;  3A0V A;  3IBR A;  1XFN A;  3NJA A;  1S1Y A;  4HJ3 A;  4K08 A;  4R70 A;  1OTI A;  1P0Z A;  3G6O A;  4WL9 A;  1OTE A;  4PKY A;  4HJ6 A;  4JGP A;  1GSW A;  4HIA A;  4KUK A;  4GS9 B;  3B33 A;  2QHK A;  4GHI A;  5HWV A;  2WKQ A;  4YWZ A;  2W0N A;  2VEA A;  4B9O A;  2I9V A;  3HJK A;  2WKR A;  2PR6 A;  4BBT A;  4XT2 B;  4EQ1 A;  4XT2 A;  1S67 L;  2J80 A;  5A8B A;  3H7W B;  3C2W A;  1UWP X;  2VLG A;  2PYR A;  3CWF A;  4HH3 A;  1XFQ A;  5G4Y A;  4GHI B;  4BBU A;  1ODV A;  4HH2 A;  3F1P A;  3LIA A;  2PR5 A;  5HDD A;  4HP9 A;  1T18 A;  3BY8 A;  4WLA A;  4DJ3 A;  1KOU A;  2QJ5 A;  1UGU A;  1XJ6 A;  3EEH A;  4WN5 A;  4NXB A;  3IS2 A;  4HHD A;  2H28 A;  1S1Z A;  1GSX A;  1OJ5 A;  3NOT C;  2VV8 A;  1OTD A;  5IU1 A;  5J4E A;  1T19 A;  2R78 A;  2INW A;  3E4Q A;  3F1P B;  4KUO A;  3ULF A;  5F69 A;  3UB9 A;  4RQ9 A;  1S4R A;  1DP9 A;  3F1N A;  5KIZ A;  2QKP A;  3H7W A;  1T1B A;  2YKH A;  2D01 A;  3LIF A;  4KQD A;  4DJ2 A;  2M1C A;  4EW7 A;  1WA9 A;  2L1M A;  3OLO A;  4HNB A;  2PDR A;  3ICY A;  2QJ7 A;  1DP8 A;  1MZU A;  3PYP A;  4GS9 A;  5EFW A;  1XJ4 A;  2V1A A;  1OTA A;  2JHE A;  3A0R A;  4HQA A;  3VOL A;  4E04 A;  4PKY G;  3LIB A;  5F5Y A;  3MFX A;  3MR0 A;  2D02 A;  1F9I A;  1GSV A;  4GCZ A;  4L9G A;  4HJ4 A;  4HOI A;  2L4R A;  2Z6D A;  2VV6 A;  3D72 A;  2V0U A;  3F1O B;  2A24 B;  3GEC A;  3VE3 A;  4EEU A;  3CLO A;  1N9N A;  2PD7 A;  3NOP C;  4I3J A;  1TS6 A;  2ZBB A;  4I3A A;  3UB6 A;  5DKK A;  1TS0 A;  3GDI A;  3UMD A;  3LI8 A;  4JGQ A;  4I39 A;  1DP6 A;  4LPZ A;  5J3W A;  4EET B;  3H82 B;  1N9O A;  2ZOH A;  5HDS A;  3LI9 A;  5J7E A;  2GJ3 A;  2QWS A;  3T50 A;  4H6J A;  2OWJ A;  5I5L A;  1LSW A;  1UWN X;  1XJ3 A;  3HJI A;  3K3C A;  4EEP A;  1V9Y A;  4HI4 A; 
#chains in the Genus database with same CATH topology
 4JBF A;  4OOL A;  1EW0 A;  3JYI A;  3VP3 A;  3EOI A;  3K3D A;  4B88 A;  3SS4 A;  5HL6 A;  1GA0 A;  5EUA A;  4C3Q A;  3QP2 A;  5TBM B;  5F83 A;  2ZMA A;  5E2H A;  4Y17 A;  3UME A;  3VV4 A;  1YMX A;  1CEG A;  1C3B A;  4GW9 A;  3C7U A;  2W27 A;  4YOF A;  3PBQ A;  4UQI S;  4LFU A;  4KZ6 A;  1D06 A;  3DW0 A;  4S2P A;  1G28 A;  4HY8 A;  4WBG A;  1H0M A;  4GOG A;  2Z6C A;  3WRZ A;  2Y2G A;  1OT9 A;  4E3O A;  1BLH A;  1BZA A;  3BY9 A;  2A3U A;  4DE1 A;  4DXC A;  4DE2 A;  4K08 A;  1EWZ A;  3MFD A;  1K25 A;  3R7W B;  4Q0J A;  1S67 L;  5AQ7 A;  3S1Y A;  3DTI A;  4HEF A;  4EV4 A;  1K4F A;  4X55 A;  3GMW A;  1IFQ A;  1GSX A;  2XD1 A;  2H0Y A;  4E6W A;  3O87 A;  3D3O A;  3UPO A;  3PR6 A;  3BW6 A;  2ACG A;  1GSV A;  2L4R A;  3LO7 A;  3LFV A;  5CHJ A;  1BLP A;  3FWL A;  4G3V A;  2AVX A;  1ZTU A;  3UPP A;  4KZ7 A;  3CPT A;  4HBU A;  1RGZ A;  3ZFZ A;  3BEC A;  5CGS A;  4MLL A;  1W7F A;  2QMI A;  1MWR A;  4O7D A;  3MQ0 A;  1F98 A;  1FR1 A;  3KO6 A;  4JF4 A;  5DJU A;  1H3Q A;  1X0O A;  1ONH A;  1AXB A;  5TBM A;  1S4S A;  3LR0 A;  3C38 A;  2XA7 M;  1TD5 A;  4BD0 A;  4LV2 A;  5CHU A;  4NXE A;  4L9E A;  4PM6 A;  3QP1 A;  4ZRR A;  1ZG4 A;  3E4P A;  2ZQC A;  3MZD A;  1NYY A;  3DTM A;  3MJQ A;  3PBN A;  4R1G A;  1OT6 A;  1GA9 A;  1S0W A;  5FAO A;  1IKG A;  3FG8 A;  3IS2 B;  1XFN A;  4KG2 A;  4R70 A;  2J3W A;  5C5K A;  2BLS A;  5HAR A;  4WL9 A;  1GSW A;  3B33 A;  1NY0 A;  2VEA A;  2WKR A;  3IQA A;  4BBT A;  4ZJ2 A;  4KEN B;  4U0T A;  5HDD A;  4RX2 A;  4BJP A;  1K6R A;  3E98 A;  3GQZ A;  1VQQ A;  5IU1 A;  2R78 A;  5GLB A;  5LBR A;  3F1N A;  3G32 A;  5G18 A;  5E2E A;  4FD8 A;  3Q82 A;  4KZ8 A;  4MNR A;  3R7W A;  1XJ4 A;  3A0R A;  4CPK A;  1JWV A;  3MFX A;  3NI9 A;  2HP9 A;  1TS6 A;  1ESU A;  5E2F A;  2RL3 A;  4D2O A;  4GD8 A;  4WMC A;  3UMD A;  5FQK A;  4EET B;  1N9O A;  2Y2Q A;  3QNC A;  4NKP A;  1BT5 A;  3BM6 A;  1NWZ A;  4P0M A;  3CMZ A;  3EGD C;  2QPN A;  3LUQ A;  3HLB A;  1SCW A;  2EX9 A;  3V5M A;  3Q81 A;  3KSI A;  3HBR A;  3IF5 A;  2Y2I A;  3CAX A;  4O0P A;  3C4P A;  5EM0 A;  3SW1 A;  4S2N C;  4MCW A;  4FCF A;  4EUZ A;  3L9K A;  4HP4 A;  3W4P A;  4EBL A;  5AVE A;  2FFY A;  2NUT C;  5IT5 A;  3ZG5 A;  2A24 A;  2X02 A;  1P97 A;  2P04 A;  5DKK A;  1OTI A;  4MDZ A;  1ONG A;  1ERQ A;  2XA7 S;  2J80 A;  1N4O A;  3EGX C;  4BBU A;  2IWC A;  4RVA A;  2EFX A;  3QHY A;  1ZKJ A;  4OLG A;  4NG2 A;  1RP5 A;  2VV8 A;  5FI2 A;  1A0K A;  3PXP A;  4WZ4 A;  4GN2 A;  2ZLY A;  4P87 A;  3HLF A;  3IXD A;  2KLI A;  2XR0 A;  3IHB A;  3LR5 A;  3BEB A;  1KVL A;  3AGE A;  1MWS A;  1N9B A;  3ZCZ A;  2HPB A;  3VE3 A;  3LR3 A;  3CLO A;  4I3J A;  1NXY A;  5CXW A;  4IBR A;  5EE8 A;  3SH7 A;  3P01 A;  3H82 B;  1NJ4 A;  2EX6 A;  5FAS A;  3FV7 A;  4FH4 A;  2YKF A;  3V39 A;  1IOU A;  4Z1W A;  2R9W A;  1E25 A;  2ZM0 A;  2VX8 A;  3MXQ A;  3OPR A;  5L2F A;  4QHC A;  1VHM A;  4O01 A;  1YM1 A;  1PW1 A;  3WS0 A;  3H82 A;  5HAI A;  2V20 A;  4Y0O A;  1L0G A;  4MBH A;  2ZL1 B;  4NET A;  4ETZ A;  3FKV A;  2PT7 A;  1S1Y A;  4JGP A;  2CC1 A;  1XGI A;  4GHI A;  4YWZ A;  4C75 A;  4PM9 A;  5DF8 A;  1TDL A;  2Y55 A;  3VOY A;  1Z09 A;  3LIA A;  1K57 C;  3QP6 A;  4F94 A;  1VEU B;  1UGU A;  4IVI A;  3UY6 A;  3BLM A;  4PPR A;  3NOT C;  5L09 A;  1PWC A;  1HD8 A;  3B3X A;  3IT9 A;  3LIF A;  4E3J A;  5DTT A;  1M40 A;  4BWI A;  4FTX A;  4WM9 A;  3WS4 A;  1MY8 A;  2Y2P A;  3MR0 A;  4OOY A;  4BQM A;  3A3D A;  1H8Z A;  4F3L A;  2E8J A;  5MC7 A;  5EM1 A;  2JCH A;  3FZC A;  5K5B A;  1CI8 A;  5DTS A;  1GHM A;  4EU0 A;  2PAV P;  1ERO A;  4U3T A;  5GHY A;  3UB7 A;  4LRX C;  1IYO A;  1KGG A;  3ZG0 A;  4OH0 A;  2BAS A;  2H0T A;  2VA0 A;  3KSH A;  4I3I A;  4S2L A;  5FI6 A;  4PMA A;  1S66 L;  3A0S A;  4KZA A;  5EVI B;  1BTL A;  1PFL A;  4MBF A;  4OQH A;  3UB5 P;  3P7N A;  2PD8 A;  4R3A A;  1Y28 A;  4DXB A;  4G3K A;  1YLJ A;  1NLZ A;  4IVK A;  4Q0I A;  5DKL A;  1PZO A;  1K54 C;  3RH8 B;  4KQR A;  4YFM A;  5FQM A;  4H6J B;  4Y3I A;  2OAP 1;  4MMN A;  3UE6 A;  1YLZ A;  4JGR A;  5DVA A;  4L9F A;  5FDS A;  3I7J A;  2XFT A;  2XFS A;  5HPI A;  1XA1 A;  1XKZ A;  3ZG8 B;  4QB8 A;  5FEG A;  5FQ9 A;  4E3L A;  2XK1 A;  1W8Y A;  4M3K A;  4D60 A;  1S6R A;  4MN7 A;  4L0L A;  2PYR A;  1XFQ A;  3FYZ A;  4FUW A;  2O9B A;  4LV0 A;  1FCO A;  3VP2 A;  1S4R A;  1DP9 A;  3AGF A;  2BTF P;  3MZF A;  3C4O A;  3OLO A;  3PYP A;  1MZU A;  1MWT A;  1OTA A;  2EWW A;  3N7W A;  4E3K A;  2JKR M;  3UNW A;  5HFO A;  2DMW A;  2W3G A;  5BOH A;  5HAP A;  2EX2 A;  5HX9 A;  3CG5 A;  4JLF A;  3O5Y A;  4ZJ3 A;  4Y13 A;  1JVJ A;  1ALQ A;  2WKP A;  1W63 M;  1SKF A;  4Y15 A;  3NOU C;  5IS1 A;  4IBX A;  2ZC6 B;  1K38 A;  3FPW A;  2OOL A;  4QWO A;  5KZH A;  3OPH A;  1LL8 A;  4KQQ A;  4CLC D;  5EVL A;  3HLG A;  2Y91 A;  5HDC A;  1XGJ A;  3QP8 A;  4QD4 A;  2ZQ8 A;  3HRE A;  3F1O A;  1I2S A;  3NBL A;  3GVB A;  2O9C A;  4PKY A;  1K6S A;  4HIA A;  2I9V A;  5DTK A;  3MF0 A;  5CED A;  2M7V A;  4XXR A;  3MBZ A;  3IF6 C;  2QJ5 A;  1XJ6 A;  4N9K A;  3CUE A;  5A90 A;  3GTC A;  4E3N A;  4KQD A;  1XA7 A;  4JPM A;  3FKW A;  2VKS A;  4PAU A;  4Y5F A;  1PWD A;  2BG1 A;  4PKY G;  2JC7 A;  4IUK A;  4HJ4 A;  1ZG6 A;  2V0U A;  2ZQD A;  1ES3 A;  4EEU A;  2M7U A;  3NOP C;  3HCY A;  3LI8 A;  4LV1 A;  1NZO A;  2EXA A;  3G4P A;  3T50 A;  3LY3 A;  2DCF A;  3PBO A;  2PU2 A;  3B42 A;  3HJI A;  4HP9 A;  4EEP A;  4O8G A;  4OQG A;  4M4X A;  2Y2N A;  4C6Y A;  2GDN A;  4WEK A;  2UWX A;  4CLC E;  3DTK A;  3T1R A;  5EV0 A;  2O99 A;  5CEB A;  2ZC4 B;  5G4Z A;  1LI9 A;  4Y0U A;  3O3V A;  2Y2J A;  3VFF A;  1NLY A;  2XSS A;  1RGY A;  2PYP A;  3E4O A;  3LIE A;  1K55 C;  3A3J A;  4R23 A;  2H5S A;  5DJT A;  2R9X A;  4ZAM A;  5KSH A;  1V9Z A;  1WYC A;  3S7N A;  1BUE A;  3VP4 A;  1JWP A;  1ZHH B;  4JXW A;  3V50 A;  1LI0 A;  1LSX A;  2Q9N A;  4NXF A;  4NEE D;  3A0V A;  3IBR A;  3NJA A;  3KYZ A;  3CIT A;  4GB7 A;  4FH2 A;  3E0Y A;  4HJ6 A;  2LB9 A;  4GS9 B;  5HWV A;  4B9O A;  3DAV A;  3K2N A;  3PAE A;  2PR6 A;  4XT2 B;  2JKT I;  1W79 A;  3MS6 A;  3S7O A;  3MSH A;  2XLN A;  5E2G A;  5CER A;  3IS2 A;  2NUP C;  4DMZ A;  5U47 A;  5F69 A;  2VGL M;  3BYD A;  5M19 A;  2M1C A;  2ZM2 A;  1YPR A;  5GHX A;  2PDR A;  5FEF A;  3M2K A;  5GLA A;  5M1A A;  1E3U A;  2Y2M A;  1SKO A;  2D02 A;  3ITB A;  1KGE A;  4HOI A;  4K0W A;  4UQI M;  1NRJ A;  2VV6 A;  2Z2M B;  2ZL1 A;  5HW3 A;  1CI9 A;  4OOM A;  4HBT A;  4LPZ A;  4AFI A;  1ESI A;  3VOZ A;  3CZD A;  4CQH A;  2Y8H A;  5F68 A;  4MN5 A;  3NC8 A;  5GLD A;  4CJN A;  4R6L A;  2L0W A;  1KDS A;  3D4F A;  2B5R A;  3MMH A;  3S7P A;  4OPR A;  4ZTK A;  4N1X A;  4BLM A;  4E3M A;  3MQQ A;  3T4O A;  2ZC7 A;  3JVU A;  3NDE A;  4KG6 A;  4B4X A;  3SZT A;  3H9W A;  3GV9 A;  1CJF A;  5F6A A;  3BQA A;  5HPF A;  2HDR A;  5JYO A;  2CMN A;  2FFF B;  2WGW B;  1OTB A;  3EWK A;  3FC7 A;  4DN0 A;  3HL9 A;  4WUJ A;  2J7V A;  1SDE A;  1PYY A;  2C5W B;  1FIL A;  1Y4O A;  4KUK A;  1ZC2 A;  2W0N A;  4GDB A;  1YLW A;  3Q7V B;  2E8I A;  2UV0 E;  3T4L A;  1MXO A;  1RCJ A;  5G4Y A;  1UWP X;  3T1S A;  3MXS A;  1YAX A;  1O07 A;  2HZ5 A;  1T18 A;  1TEM A;  1YKD A;  4WN5 A;  3T12 B;  5FQI A;  4LCL A;  3ZDJ A;  1I2W A;  3E4Q A;  3HUM A;  2QKP A;  2D01 A;  4ESP A;  2MJ6 A;  2G7U A;  2EXB A;  4GS9 A;  5HSQ A;  2JHE A;  3LIB A;  5F5Y A;  4Z9Q A;  1G68 A;  4Q0H A;  3D72 A;  5CTN A;  4KZ9 A;  3MZE A;  2ZBB A;  5F1F A;  2KOI A;  1F2K A;  2JKT M;  4A5R A;  1NZU A;  4E6X A;  5DF7 A;  3LEQ A;  1NRF A;  4CLC C;  3T4T A;  5EVI D;  5CEC A;  3S7Q A;  3SOI A;  5KSC A;  3TG9 A;  4LGW A;  4OVD A;  2O9A A;  3E2L A;  1WE4 A;  1HZO A;  4ZJ1 A;  1TF1 A;  3IXG A;  3S4X A;  3C8C A;  1MKM A;  3VE4 A;  3SS5 A;  1MPL A;  4X1M A;  3SH9 A;  4WF0 A;  2Q0O A;  3IXH A;  1LSV A;  3EEA A;  5FSR A;  4BBV A;  4PM7 A;  4R38 A;  5DFX A;  5HD3 A;  3OZH A;  3ZG7 B;  1IYP A;  3EQV A;  4HJ3 A;  4EWF A;  1MWU A;  2QHK A;  2RCX A;  1KE3 A;  2PBY A;  1L3L A;  4OQ0 A;  2QZ6 A;  3T4S A;  2ZQ7 A;  3TRC A;  3SH8 A;  2JE5 A;  3BRM A;  2ZQ9 A;  3NDG A;  4UHU A;  5AQ9 A;  3T4Q A;  2PBD P;  1JTD A;  1S1Z A;  3KYQ A;  4KUO A;  3QP4 A;  4PHT A;  2YKH A;  2WGW A;  3MKE A;  4DJ2 A;  2L1M A;  3V3R A;  2WKH A;  3O88 A;  3MKF A;  2QJ7 A;  4PM8 A;  3C30 A;  1H8M A;  1E3U D;  4GCZ A;  4OKP A;  2Z6D A;  2WZX A;  4EBN A;  1K56 A;  4R4S A;  4ID4 A;  1G6O A;  1WYB A;  3HUN A;  1LSW A;  3ZGA B;  4EUV A;  1FCM A;  2P9V B;  2IWD A;  3BFD A;  1VET B;  3CI6 A;  1ES2 A;  1STZ A;  4JKT A;  5FQJ A;  5L10 A;  4WMC D;  3M2J A;  3UE0 A;  2C6W B;  3L7H A;  4LLO B;  4Y7P A;  4DE0 A;  5GL9 A;  5FA7 A;  3IH8 A;  3ZNT A;  5FI7 A;  4R3B A;  1DY6 A;  3C7V A;  2W3E A;  5FAQ A;  2DRW A;  4BD1 A;  4X56 A;  2V0W A;  5CHM A;  1HVB A;  1O7E A;  3IWI A;  1IEM A;  3OOV A;  2A2L A;  3HVF A;  3SS3 A;  1CQA A;  2A49 A;  2KDK A;  2B95 A;  4GD6 A;  2OAQ 1;  4IHQ A;  1P0Z A;  3G6O A;  1KVM A;  4WZ5 A;  1GHP A;  1BUL A;  3WWX A;  3WS2 A;  4GJ4 A;  1ERM A;  3IWO A;  1YQS A;  3F1P A;  3UE1 A;  1SHV A;  3UDF A;  4OLD A;  3VMA A;  3IF6 B;  2Z2L B;  1BLS A;  2O0Y A;  4NXB A;  1K55 A;  4ZBE A;  2B18 A;  2PU4 A;  3WS1 A;  1TVF A;  2JKF A;  1SZV A;  3Q1F A;  1T1B A;  2WAD A;  3W4Q A;  3ISG A;  3VP0 A;  1EI5 A;  2WK0 A;  2OLV A;  3G30 A;  1W63 Q;  2W1R A;  4MBK A;  3RFB A;  1F9I A;  3GRJ A;  4I39 A;  5HDS A;  2V8F A;  5J7E A;  4H6J A;  3R4K A;  3RJU A;  2QYB A;  3UDI A;  2ZC5 B;  1G6A A;  1L0D A;  1Z6F A;  3IH9 A;  1JNU A;  3MQO A;  3LID A;  2Y2K A;  5L8M A;  1XPB A;  3ZHH A;  2VZW A;  3NHQ A;  5HD5 A;  1Q2P A;  3LY4 A;  4WEJ A;  1FSW A;  1K4E A;  1L0E A;  2VGJ A;  2V9A A;  1FR6 A;  3PHY A;  4JXV A;  2OV5 A;  3UN7 A;  2G2W A;  1PRQ A;  4LRZ E;  3HLD A;  3G35 A;  4I38 A;  3IHA A;  2WYX A;  4OPZ A;  1J9M A;  1LL9 A;  2ZQA A;  5HL1 A;  5E43 A;  3T1Q B;  4LV3 A;  2EWV A;  1CK3 A;  3KSF A;  4R3J A;  1KDW A;  1ES4 A;  2FZ0 A;  1NYM A;  4WYY A;  4GKU A;  4N9L A;  2ZJ9 A;  1PW8 A;  1QMF A;  4HHD A;  3AGD A;  4ARZ A;  2G2U A;  3DWZ A;  3G34 A;  4X53 A;  5EVI C;  1K0K A;  3P98 A;  2Y2L A;  4HQA A;  4GNU A;  3OCN A;  2XD5 A;  2Y2H A;  3JPU A;  2V1Z A;  4RX3 A;  4S2K A;  1FIK A;  1I5Q A;  2HDQ A;  1K56 D;  4PM5 A;  5TGF A;  2XRO A;  5CTM A;  5HAQ A;  5J3W A;  3EQU A;  4GLQ A;  1PNE A;  1CF0 A;  4K91 A;  4EES A;  1H5X A;  1Y54 A;  1DJA A;  3IWQ A;  5HWT A;  3T4K A;  2Y59 A;  1MBL A;  1U60 A;  3VSL A;  5FQQ A;  2P9V A;  1GHI A;  5F82 A;  2W1T A;  3V67 A;  3GR2 A;  2V1B A;  1VB6 A;  4E3I A;  2DNS A;  1HLU P;  4B4Z A;  2WKI A;  1GCE A;  1IEL A;  1PZP A;  1OJG A;  4DE3 A;  4P6Z M;  4NXG A;  5KMW A;  1T1C A;  5F1G A;  1D7E A;  3TJZ C;  4DRT A;  3NEC A;  3LIC A;  3G2Y A;  4JXG A;  4GZB A;  1VEU A;  1YSQ A;  1MC0 A;  3RXX A;  3FPV A;  5A93 A;  4HH2 A;  2WGI A;  1AWI A;  1F5M A;  1P9W A;  4S2I A;  2XF3 A;  2H28 A;  3Q7Z A;  4KG5 A;  1BSG A;  3IF6 A;  4BMW A;  3F1P B;  3TSG A;  1YLP A;  1Q2Q A;  3N8R A;  5DF9 A;  3PTE A;  4UA9 A;  1WA9 A;  3ICY A;  1DP8 A;  2V1A A;  2J3T C;  4X6T A;  3ZYT A;  4H8R A;  3Q07 A;  3ZG9 B;  1N9N A;  3U4L P;  4UAA A;  1IYQ A;  3NUL A;  2GX5 A;  1BLC A;  1K54 A;  1DP6 A;  4OPY A;  3VSK A;  1W5D A;  5EOO A;  5M18 A;  2Y2O A;  3LI9 A;  4QY5 A;  2OWJ A;  3VOL A;  3UB8 A;  2WGV A;  2EX8 A;  2J8Y A;  2JKG A;  2HDU A;  3IBJ A;  3UPN A;  2WAF A;  2OWH A;  1KE0 A;  4OP5 A;  5GLC A;  4R4R A;  4K0X A;  2WKE A;  3IX4 A;  4NK3 A;  3KYE A;  3LGO A;  4N1H A;  4OQI A;  2PRF A;  3G31 A;  3BWL A;  4UA6 A;  2KX6 A;  5I94 A;  3CJM A;  3DBA A;  4QJG A;  1LHY A;  2ZOI A;  4JXS A;  4ZDX A;  1ES5 A;  3CUE C;  1HTZ A;  3TE8 A;  1JWZ A;  3NY4 A;  3BFG A;  4B93 A;  3PBS A;  2VGK A;  4FSF A;  2HP6 A;  2JN7 A;  4LCM A;  5HZH A;  4CLC B;  4ARZ B;  2HDS A;  3IX3 A;  1PIO A;  2J9O A;  2ZM8 A;  3PBT A;  4X69 A;  4P85 A;  5J8X A;  2Y4A A;  2VK3 A;  1PI5 A;  3HJK A;  4Y2F A;  1YLY A;  3PBR A;  4XT2 A;  3Q7V A;  5A8B A;  5CGW A;  3RXW A;  2JBF A;  4HH3 A;  5EVE A;  4WLA A;  3LR4 A;  3BY8 A;  3BQ8 A;  2X01 A;  3UO9 A;  2X71 A;  2IA2 A;  1T19 A;  2LB5 A;  4P6Z S;  2V8C A;  1D1J A;  2ZC3 B;  3WS5 A;  5EFW A;  4R0Q A;  3N6I A;  4E04 A;  4MEZ A;  3N8S A;  5DFY A;  4IUH A;  4X25 A;  3F1O B;  3S22 A;  3IX8 A;  3UB6 A;  2J9P A;  2WUQ A;  2ZD8 A;  1XXM A;  1DJB A;  4S2N A;  4ETX A;  1DJC A;  5I5L A;  1XJ3 A;  3U2A A;  3K3C A;  1V9Y A;  4S2M A;  3KX0 X;  1XJ2 A;  1BYW A;  2EA9 A;  2I72 A;  1VM1 A;  3LYX A;  1IYS A;  3A3F A;  1KE4 A;  2EFU A;  3PAG A;  3N4I A;  4JF6 A;  4ME4 A;  1VET A;  1SKO B;  4I5S A;  2Q9M A;  3ZVT A;  3NCK A;  1YSP A;  1E4D A;  1P9R A;  1TS7 A;  3HLC A;  1MKI A;  4XUZ A;  1L0F A;  3RTY A;  3T1X A;  5AQA A;  4EXO A;  2XDM A;  4U0X A;  3W4O A;  5IHV A;  4RA7 A;  2XQZ A;  1YMS A;  2GZA A;  1OTE A;  2H10 A;  5CX7 A;  4OPQ A;  2XGN A;  4EQ1 A;  3CHW P;  3H7W B;  1H8Y A;  2XRN A;  1CEF A;  1FQG A;  1J3W A;  3OPL A;  4DJ3 A;  1L2S A;  4IJG A;  5J4E A;  4UEY A;  3ULF A;  3UB9 A;  3M6B A;  4G3W A;  1YT4 A;  5A91 A;  5A92 A;  1TDG A;  2HF6 A;  2W3H A;  5TFQ A;  3HUO A;  2Y79 A;  2XEP A;  5CRF A;  3O86 A;  2K31 A;  4N92 A;  4JF5 A;  2OLU A;  2WAE A;  3GEC A;  2K2N A;  2PD7 A;  1FSY A;  5EEC A;  2V2F F;  4JGQ A;  3W2Z A;  2J3T D;  1LLB A;  4YNR A;  1LT0 A;  4IED A;  2WZZ A;  4EQI A;  1T1A A;  1PWG A;  3CPT B;  2OSU A;  3LEZ A;  4KZB A;  1SDN A;  2W1T B;  4WEL A;  3V3S A;  2W3D A;  5EPH A;  2B02 A;  3OC2 A;  2PHY A;  1M6K A;  1OPX A;  5L07 A;  3ZQ5 A;  5AVF A;  5JYP A;  5D3O A;  3T4J A;  4EER A;  2K7S A;  3DWK A;  4KQO A;  3BLS A;  3F1N B;  4FOF A;  1K57 A;  4BL3 A;  1QME A;  3BFC A;  3WRT A;  1IKI A;  4F3L B;  4DDY A;  4QY6 A;  5TR7 A;  3D9Y A;  2W3F A;  2HJE A;  4X68 A;  3W8K A;  3A3I A;  5FAP A;  2HGV A;  2VLG A;  1ODV A;  2PR5 A;  2VGL S;  1LL5 A;  1OJ5 A;  5AQB A;  2INW A;  3VFH A;  4RQ9 A;  4UA7 A;  4WZ5 C;  3GSG A;  3QNB A;  5KIZ A;  3OCL A;  4EW7 A;  4HNB A;  4S2O A;  3M6H A;  3N8L A;  3ZNY A;  2FH5 A;  4QU3 A;  2ZMV A;  3B47 A;  1KGF A;  4KZ4 A;  3BJN A;  3BFE A;  5CGX A;  5EVI A;  4LEN A;  5TJJ A;  3IXB A;  2QWS A;  4P6B A;  4BEN A;  1UWN X;  3HLW A;  2ZOH A;  5HWW A;  1N9L A;  4JGO A;  4QPR A;  3UDX A;  2HV1 A;  5FL3 A;  3JVV A;  3VP1 A;  2GNX A;  1JTG A;  1G5U A;  1FOF A;  1DRM A;  1OME A;  4II7 A;  4MN6 A;  2P7J A;  4X1L A;  5FAT A;  2P74 A;  4DF6 A;  4HES A;  3OPP A;  4GDN A;  1XX2 A;  4S2J A;  1TS8 A;  2HJ9 C;  4BL2 A;  2VV7 A;  5FDH A;  4LRY C;  3OBF A;  5GHZ A;  3A3E A;  3G2Z A;  4KZ5 A;  3BFF A;  3TW8 A;  4OP8 A;  1W8Q A;  2JKR I;  3DTE A;  3QP5 A;  3KSG A;  2P08 A;  3LCE A;  3NIA A;  1YLT A;  4DDS A;  1ACF A;  2WKQ A;  3UE3 A;  1PI4 A;  4RYE A;  1FCN A;  3C5A A;  3C2W A;  3TOI A;  3CWF A;  4GHI B;  4XUX A;  3HLE A;  4KZ3 A;  1KOU A;  3EEH A;  1OTD A;  4CLC A;  4OON A;  3MXR A;  3H7W A;  4EBP A;  2ZMF A;  3ITA A;  1XP4 A;  4Q8I A;  4Y0T A;  3ZVW A;  4L9G A;  2IWB A;  2XH9 A;  3E2K A;  2A24 B;  4DKI A;  4I3A A;  4YIN A;  1TS0 A;  3GDI A;  5AJG A;  3P09 A;  2GJ3 A;  2VJW A;  5EOE A;  2HP5 A;  4HI4 A; 
#chains in the Genus database with same CATH homology
 4OOL A;  4CLC C;  3T4T A;  1EW0 A;  4LRX C;  3UB7 A;  3EOI A;  3K3D A;  3S7Q A;  3IBJ A;  2BAS A;  5HL6 A;  2VA0 A;  2OWH A;  3KSH A;  5TBM B;  4I3I A;  1S66 L;  2O9A A;  3A0S A;  3UME A;  3VV4 A;  3P7N A;  2PD8 A;  1TF1 A;  4GW9 A;  4R3A A;  1Y28 A;  2W27 A;  3BWL A;  4G3K A;  4YOF A;  1NLZ A;  1MKM A;  3C8C A;  4Q0I A;  2KX6 A;  5DKL A;  3VE4 A;  3DBA A;  3PBQ A;  4UQI S;  1D06 A;  3RH8 B;  2ZOI A;  1G28 A;  4H6J B;  4HY8 A;  4Y3I A;  2OAP 1;  2Z6C A;  4MMN A;  3UE6 A;  3CUE C;  4JGR A;  4WF0 A;  3TE8 A;  1OT9 A;  4L9F A;  4B93 A;  3PBS A;  1LSV A;  4FSF A;  3BY9 A;  3EEA A;  2JN7 A;  4BBV A;  4R38 A;  5DFX A;  5HZH A;  5HD3 A;  4CLC B;  5HPI A;  4ARZ B;  3EQV A;  4HJ3 A;  4K08 A;  3PBT A;  3R7W B;  2QHK A;  3HJK A;  4Y2F A;  4MN7 A;  3PBR A;  4Q0J A;  3T4S A;  4XT2 A;  1S67 L;  5A8B A;  3TRC A;  4L0L A;  2PYR A;  4HH3 A;  1XFQ A;  4WLA A;  3LR4 A;  3BY8 A;  3BQ8 A;  3T4Q A;  2O9B A;  1IFQ A;  1S1Z A;  1GSX A;  3KYQ A;  2IA2 A;  1T19 A;  2LB5 A;  4KUO A;  4P6Z S;  4PHT A;  1S4R A;  1DP9 A;  2YKH A;  4DJ2 A;  3D3O A;  2L1M A;  3OLO A;  3PYP A;  2QJ7 A;  1MZU A;  5EFW A;  3C30 A;  1OTA A;  1H8M A;  3PR6 A;  4E04 A;  2EWW A;  3BW6 A;  5DFY A;  1GSV A;  4IUH A;  4GCZ A;  2JKR M;  2L4R A;  2Z6D A;  3LFV A;  3F1O B;  3UB6 A;  4G3V A;  1ZTU A;  4ETX A;  1G6O A;  2DMW A;  5I5L A;  2W3G A;  1LSW A;  1XJ3 A;  3U2A A;  3K3C A;  1V9Y A;  4EUV A;  3KX0 X;  3O5Y A;  1XJ2 A;  3CI6 A;  1STZ A;  1BYW A;  2WKP A;  2EA9 A;  3MQ0 A;  1W63 M;  1F98 A;  3KO6 A;  5DJU A;  3LYX A;  3NOU C;  1H3Q A;  1X0O A;  4LLO B;  5IS1 A;  5TBM A;  1S4S A;  3FPW A;  3LR0 A;  3C38 A;  2XA7 M;  1TD5 A;  2W3E A;  4ME4 A;  2OOL A;  4NXE A;  4L9E A;  2V0W A;  3E4P A;  4ZRR A;  4I5S A;  1LL8 A;  4CLC D;  3OOV A;  2A2L A;  1YSP A;  5HDC A;  1P9R A;  3MJQ A;  1TS7 A;  3PBN A;  3UB8 A;  3RTY A;  4EXO A;  2KDK A;  1OT6 A;  3F1O A;  3FG8 A;  3IS2 B;  1XFN A;  2OAQ 1;  4IHQ A;  4R70 A;  2J3W A;  5C5K A;  1P0Z A;  2GZA A;  3G6O A;  1OTE A;  2O9C A;  4PKY A;  4WL9 A;  1GSW A;  4HIA A;  3B33 A;  5CX7 A;  2VEA A;  2I9V A;  2WKR A;  4BBT A;  3MF0 A;  4EQ1 A;  3H7W B;  4GJ4 A;  2XRN A;  2M7V A;  3F1P A;  5HDD A;  4BJP A;  4DJ3 A;  2QJ5 A;  1XJ6 A;  2O0Y A;  3E98 A;  4NXB A;  2B18 A;  4IJG A;  5IU1 A;  3CUE A;  5J4E A;  4UEY A;  2R78 A;  3ULF A;  3UB9 A;  4G3W A;  5LBR A;  3F1N A;  1T1B A;  4KQD A;  2VKS A;  4PAU A;  4Y5F A;  2HF6 A;  3R7W A;  2W3H A;  1W63 Q;  1XJ4 A;  3A0R A;  4PKY G;  2W1R A;  3MFX A;  2Y79 A;  3RFB A;  1F9I A;  4IUK A;  4HJ4 A;  2K31 A;  2V0U A;  4EEU A;  3GEC A;  2M7U A;  2K2N A;  2PD7 A;  3NOP C;  1TS6 A;  3UMD A;  3HCY A;  3LI8 A;  4JGQ A;  4I39 A;  4EET B;  1N9O A;  5HDS A;  5J7E A;  3T50 A;  4H6J A;  3W2Z A;  2J3T D;  3PBO A;  4HP9 A;  3B42 A;  3HJI A;  3R4K A;  4EEP A;  4O8G A;  2QYB A;  4YNR A;  1LT0 A;  4M4X A;  4NKP A;  1NWZ A;  3EGD C;  1JNU A;  3MQO A;  4WEK A;  3LUQ A;  4CLC E;  3LID A;  1T1A A;  5L8M A;  2O99 A;  5G4Z A;  2W1T B;  4WEL A;  3KSI A;  2VZW A;  1NLY A;  2XSS A;  3NHQ A;  2PYP A;  3CAX A;  4O0P A;  5HD5 A;  2W3D A;  3E4O A;  3LIE A;  4WEJ A;  2B02 A;  3OC2 A;  5DJT A;  3SW1 A;  2PHY A;  2V9A A;  1OPX A;  4MCW A;  5KSH A;  3PHY A;  3ZQ5 A;  1V9Z A;  5AVF A;  3S7N A;  4LRZ E;  4HP4 A;  4I38 A;  3T4J A;  1ZHH B;  4EER A;  2K7S A;  4KQO A;  5AVE A;  2NUT C;  3F1N B;  4FOF A;  5IT5 A;  2A24 A;  1LSX A;  4F3L B;  1P97 A;  4NXF A;  2P04 A;  4NEE D;  3A0V A;  3IBR A;  3NJA A;  2EWV A;  5DKK A;  3KYZ A;  1OTI A;  3CIT A;  4MDZ A;  3E0Y A;  3KSF A;  4HJ6 A;  2LB9 A;  4GS9 B;  2W3F A;  5HWV A;  4B9O A;  2HJE A;  3K2N A;  2XA7 S;  2PR6 A;  4XT2 B;  2JKT I;  2FZ0 A;  2J80 A;  2HGV A;  3EGX C;  2VLG A;  4BBU A;  1ODV A;  3S7O A;  2PR5 A;  2VGL S;  4DMZ A;  3IS2 A;  2NUP C;  4HHD A;  1OJ5 A;  2VV8 A;  4ARZ A;  2INW A;  3PXP A;  5F69 A;  2VGL M;  4RQ9 A;  5KIZ A;  2M1C A;  3OCL A;  4EW7 A;  4HNB A;  2PDR A;  2KLI A;  4HQA A;  3OCN A;  3LR5 A;  2D02 A;  4HOI A;  3VE3 A;  4UQI M;  1NRJ A;  2FH5 A;  2VV6 A;  3LR3 A;  3CLO A;  2ZMV A;  4I3J A;  3B47 A;  2XRO A;  4OOM A;  3BJN A;  4LPZ A;  3P01 A;  5J3W A;  3H82 B;  3EQU A;  4AFI A;  5TJJ A;  4GLQ A;  2QWS A;  4CQH A;  2Y8H A;  1UWN X;  2ZOH A;  4EES A;  1N9L A;  4JGO A;  5HWW A;  4QPR A;  5F68 A;  5HWT A;  3T4K A;  2YKF A;  4MN5 A;  2HV1 A;  4R6L A;  2L0W A;  5FL3 A;  1IOU A;  3JVV A;  4Z1W A;  2GNX A;  3S7P A;  3MMH A;  1DRM A;  2W1T A;  4II7 A;  4MN6 A;  3V67 A;  2P7J A;  2V1B A;  3MQQ A;  1VB6 A;  2VX8 A;  3MXQ A;  3T4O A;  3JVU A;  3H9W A;  5F6A A;  1VHM A;  3BQA A;  1TS8 A;  4O01 A;  2HJ9 C;  5HPF A;  2VV7 A;  4LRY C;  3OBF A;  2CMN A;  3H82 A;  1OJG A;  4P6Z M;  4NXG A;  1OTB A;  1T1C A;  3TW8 A;  3EWK A;  3FC7 A;  4DN0 A;  1D7E A;  3TJZ C;  2JKR I;  4WUJ A;  3LIC A;  3KSG A;  4ETZ A;  2PT7 A;  2P08 A;  1S1Y A;  1YSQ A;  4JGP A;  4KUK A;  1MC0 A;  4GHI A;  2WKQ A;  4YWZ A;  2W0N A;  3FPV A;  3UE3 A;  3T4L A;  3C2W A;  1UWP X;  3CWF A;  5G4Y A;  1YAX A;  4GHI B;  4HH2 A;  3LIA A;  1T18 A;  1KOU A;  1UGU A;  1F5M A;  1P9W A;  1YKD A;  3EEH A;  4WN5 A;  2H28 A;  3NOT C;  1OTD A;  4CLC A;  4BMW A;  3E4Q A;  3F1P B;  5DF9 A;  2QKP A;  3H7W A;  3LIF A;  2D01 A;  1WA9 A;  4BWI A;  2MJ6 A;  2ZMF A;  3ICY A;  1DP8 A;  2G7U A;  4GS9 A;  2V1A A;  5HSQ A;  2J3T C;  2JHE A;  3LIB A;  5F5Y A;  3MR0 A;  3ZYT A;  4L9G A;  4Q0H A;  4F3L A;  5MC7 A;  3D72 A;  2A24 B;  1N9N A;  4I3A A;  2ZBB A;  2KOI A;  1TS0 A;  3GDI A;  2JKT M;  5AJG A;  2GX5 A;  1DP6 A;  3LI9 A;  2GJ3 A;  5K5B A;  2VJW A;  2OWJ A;  3VOL A;  4EU0 A;  4HI4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...