1F9IA

Crystal structure of the photoactive yellow protein mutant y42f
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
125
structure length
125
Chain Sequence
MEHVAFGSEDIENTLAKMDDGQLDGLAFGAIQLDGDGNILQFNAAEGDITGRDPKQVIGKNFFKDVAPCTDSPEFYGKFKEGVASGNLNTMFEYTFDYQMTPTKVKVHMKKALSGDSYWVFVKRV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords PHOTOACTIVE YELLOW PROTEIN
publication title Coupling of hydrogen bonding to chromophore conformation and function in photoactive yellow protein.
pubmed doi rcsb
source organism Halorhodospira halophila
total genus 35
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2000-07-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00989 PAS PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 1f9iA00
1S1ZA 3T50A 1LL8A 4I3IA 4R6LA 1WA9A 4EEUA 3G6OA 4MN5A 5HDSA 2EA9A 3GECA 4HNBA 3UE6A 2ZOHA 3IS2A 1ODVA 4JGOA 1OTAA 2V9AA 5DKKA 2A24B 5DKLA 1V9ZA 2GJ3A 3EWKA 4EW7A 5EFWA 3E4OA 1S1YA 3CAXA 2KX6A 2PYPA 2YKHA 4LRYC 5DJTA 4KUKA 1JNUA 3D72A 3A0RA 4I39A 5HDCA 3LYXA 3A0SA 4JGPA 2I9VA 4EETB 4H6JB 3F1NA 3H82B 3UB7A 4XT2B 4BBUA 2VV6A 1OT6A 4LLOB 4L9EA 3UB6A 3E4QA 1G28A 3FC7A 4NXGA 1OTBA 1UWNX 2PD7A 3HJKA 3KX0X 3SW1A 2V0WA 3NOUC 2A24A 4KUOA 2D02A 5DJUA 5J3WA 2WKQA 3NOTC 5F6AA 3K3DA 4RQ9A 3P7NA 4HJ4A 1KOUA 4HHDA 4HY8A 3ICYA 4HJ3A 2W27A 5HSQA 4HIAA 4H6JA 3UB8A 1F98A 3H82A 4JGQA 4WF0A 1T18A 3CLOA 4HP4A 4F3LB 4XT2A 4EESA 3LIDA 4NXBA 5G4YA 1XJ6A 4R70A 3PHYA 4JGRA 1DP8A 2V1BA 1TS6A 3LIAA 1S67L 3MJQA 5AVEA 3E4PA 3VOLA 2QHKA 1LT0A 2PR6A 4HP9A 1TS0A 1S4RA 3MQOA 2QKPA 1XJ3A 2PHYA 2OWHA 3ULFA 1T1CA 2OWJA 2ZBBA 3IBRA 2K7SA 2VEAA 3H9WA 3VE4A 1NWZA 4F3LA 2L4RA 4PKYA 2P7JA 3BY8A 3C2WA 3RTYA 3LICA 1TS7A 2KDKA 3VE3A 1GSWA 4GHIB 4R38A 2BASA 2CMNA 1TS8A 4I3AA 1T1BA 2VLGA 4L9FA 2INWA 3UMDA 4NXFA 1OJGA 3H7WB 4HOIA 4L9GA 4LRXC 2JHEA 1P97A 4BBVA 5TBMB 1XJ2A 1GSVA 3MR0A 1XFNA 2R78A 2PR5A 4BBTA 1T19A 1T1AA 2HV1A 2D01A 1X0OA 3ZQ5A 4GCZA 3CWFA 3LIBA 4I3JA 2Z6CA 1XJ4A 3NHQA 2L1MA 1GSXA 4M4XA 2J80A 2H28A 5G4ZA 4K08A 5HZHA 5F5YA 3HJIA 4GHIA 4EQ1A 4EEPA 4YWZA 5HD3A 4HH3A 1EW0A 3F1OB 5KIZA 1P0ZA 4WL9A 5HWTA 4HQAA 4WN5A 3H7WA 2QJ5A 5J7EA 1S66L 4HI4A 1LSVA 5TBMA 5F68A 3C8CA 3LI8A 2PYRA 1OTEA 1UWPX 2YKFA 3NOPC 3EEHA 2PDRA 3FG8A 1OJ5A 5IU1A 4GS9B 4EERA 5J4EA 1N9NA 4B9OA 3A0VA 1D06A 2W0NA 2ZOIA 2PD8A 1F9IA 4E04A 4KQDA 2QWSA 5A8BA 1Y28A 3OLOA 2L0WA 3F1OA 1UGUA 3MXQA 5HWWA 4R3AA 2WKRA 1S4SA 1OTDA 4LPZA 1BYWA 4HJ6A 5HDDA 3BWLA 2OOLA 4WUJA 3LUQA 1D7EA 5HD5A 3UMEA 2M1CA 3LI9A 2VV8A 4EXOA 1OTIA 4NXEA 4WLAA 3MQQA 4GS9A 5I5LA 4DJ2A 1DP9A 3F1PB 3UB9A 3MFXA 4PKYG 5IS1A 3GDIA 5AVFA 1LSWA 4HH2A 4GW9A 3LIEA 1N9LA 4LRZE 1N9OA 4I5SA 2WKPA 3IS2B 3PYPA 3K3CA 1XFQA 3NJAA 2V1AA 2V0UA 1OT9A 1VB6A 3RH8B 1DRMA 5HWVA 5F69A 2JN7A 2Z6DA 3LIFA 2B02A 1MZUA 1DP6A 4DJ3A 4I38A 3BY9A 3B33A 1LSXA 2QJ7A 4MN6A 3F1NB 3F1PA 2VV7A 1V9YA
chains in the Genus database with same CATH superfamily
3B3XA 3UE3A 1LL8A 2P04A 2OLVA 4MNRA 4R6LA 1XKZA 4EEUA 3TG9A 2EA9A 3OPPA 3UE6A 4OQHA 2ZOHA 1NLYA 1KGFA 3JYIA 3B47A 3UN7A 1OTAA 5HPFA 2EWVA 1KE3A 1MKMA 3OPLA 1XX2A 5DKLA 3VP2A 1ONGA 3G31A 4X6TA 3BFDA 2J9PA 3BYDA 4CLCA 1MY8A 5MC7A 3BM6A 4CLCD 1L2SA 4LENA 4Y13A 3PAEA 4I39A 5CTMA 1FR1A 5FAQA 4RX2A 4JGPA 2I9VA 4EETB 5KSHA 2Y2IA 4XT2B 2VV6A 4UEYA 2X01A 3NULA 2J3TC 4BWIA 2P08A 3A3IA 4OPZA 2ZL1A 5AQ7A 2PRFA 3NDGA 4DRTA 3NBLA 3PR6A 4ZAMA 4E3KA 3SS5A 3SW1A 4X56A 1M40A 4K91A 3T1SA 2A24A 1GA0A 1Q2QA 2ACGA 2WKIA 4KZBA 3VSKA 5FQQA 2JKGA 3K3DA 3GRJA 2G2UA 4X1MA 1BLCA 1H5XA 3U2AA 4HJ4A 1KOUA 1BT5A 3CJMA 4HY8A 2BG1A 2W27A 5HSQA 4PM8A 1IFQA 4H6JA 3H82A 4WF0A 2RCXA 3PXPA 4PM7A 5FL3A 4PM6A 1W5DA 4K0XA 2XRNA 2NUPC 2OAQ1 4NXBA 4HESA 2ZQAA 4Q0HA 1YAXA 5A93A 3MJQA 5AVEA 3E4PA 3ZVTA 5FAPA 2PR6A 5D3OA 3FZCA 2Y2JA 1TS0A 1S4RA 5DTSA 1SDEA 5KMWA 3MFDA 5AQAA 2PHYA 4WEKA 5L8MA 1C3BA 5TGFA 4UQIS 5E2EA 3GVBA 4IEDA 1PWCA 4Z9QA 3IBRA 2K7SA 1BUEA 3IF5A 1JWZA 1H8YA 3VE4A 4KZ9A 4F3LA 2ZM0A 2HDQA 4PKYA 1LI9A 3IXHA 4YFMA 4ARZB 3BY8A 3N8RA 4QB8A 5M18A 1BTLA 2WKEA 5FI6A 3RTYA 4MEZA 3T4KA 2C6WB 3LICA 2VZWA 5FEFA 1FCNA 5FAOA 4JPMA 1TS8A 4LCLA 4RA7A 4HBUA 3FV7A 3MXSA 2ZQ9A 4FUWA 4NXFA 1OJGA 1JWVA 2C5WB 2GNXA 5EUAA 1IKIA 4L9GA 4LRXC 3ZNYA 5L09A 4O0PA 2M7VA 2HDUA 1P97A 2J7VA 3SZTA 5E2HA 1XJ2A 5HAQA 4X25A 3KSFA 3MR0A 1XFNA 4ZTKA 4DE0A 3WS0A 4IBXA 1XXMA 3M6BA 3BW6A 1I2WA 4ETXA 1X0OA 2Y79A 3TRCA 3SOIA 3T4SA 3ZQ5A 1XPBA 3LIBA 5HARA 2ZC5B 1ZTUA 2XR0A 4YNRA 4X1LA 3LR3A 1XJ4A 3C5AA 1BLPA 2Y2GA 3LY3A 5EV0A 3UNWA 4M4XA 4U3TA 1ES2A 2HP6A 5G4ZA 4PAUA 1PI4A 3LR0A 4EEPA 4YWZA 3C38A 3LR5A 3BLSA 3F1OB 2OAP1 4P6ZS 4QWOA 3M2KA 4HQAA 4UQIM 3RJUA 3IXDA 5AQ9A 5F68A 3SS4A 2JKTI 4C75A 4OPQA 4WZ5A 4GN2A 2J8YA 2YKFA 3OCNA 2DCFA 2ZM8A 4PPRA 1E3UA 3G32A 4KZAA 3GTCA 3VMAA 3FG8A 1ESIA 1E3UD 4JBFA 5IU1A 2EX9A 1IELA 1HTZA 2VGJA 3ZVWA 3A0VA 1D06A 3IH8A 1A0KA 5CGWA 3KSHA 2XH9A 2NUTC 1NYYA 2Y4AA 3QP1A 4DMZA 3U4LP 1XA1A 4Y0TA 4UA9A 2R9XA 2WZXA 2QWSA 4IHQA 3HLEA 3OLOA 1F2KA 3PTEA 3O5YA 2Q9MA 1UGUA 4R3AA 1HZOA 3T4JA 5HAIA 3NDEA 2KLIA 1OTDA 3OBFA 5CRFA 3BJNA 4X68A 2PBDP 4KZ6A 1SKFA 1ZG6A 4RVAA 3ZFZA 1J9MA 1D7EA 2WADA 1NZOA 3UMEA 3DWZA 3WS4A 1NRFA 1STZA 2EFUA 5FI7A 3CMZA 2K2NA 2ZC7A 3EGXC 2EX2A 3IF6A 4GS9A 4DJ2A 1DP9A 1SDNA 1YKDA 3F1PB 4N92A 1RGYA 3UE1A 2VX8A 4KZ5A 5IS1A 4JXVA 3GDIA 4P6ZM 4GLQA 2XFTA 1LSWA 1NLZA 3Q82A 3LIEA 4JF5A 2HZ5A 4XUXA 1K38A 1D1JA 4OPYA 2XROA 5EVIC 3IS2B 3G4PA 3K3CA 3LGOA 2V8FA 4OH0A 1VEUB 4HBTA 4R4RA 1IOUA 3S4XA 2JCHA 4IJGA 1VB6A 1PIOA 2A2LA 5HWVA 4Y0UA 2O99A 2JN7A 4X53A 1QMFA 3LIFA 2B02A 4N9LA 5DFYA 1DP6A 4DJ3A 2ZQDA 3IHBA 3CPTB 3QNCA 1LSXA 2WK0A 4MN6A 3F1NB 4KG2A 4E3OA 1S1ZA 3T50A 4GD6A 4I3IA 3FKVA 4MDZA 4MN5A 2FZ0A 4Q8IA 3FWLA 1IKGA 2ZM2A 1ZHHB 5FQKA 4KZ7A 1SKOB 1CI9A 2W3GA 1P9RA 4JGOA 3M6HA 2V9AA 2EX8A 1HD8A 4E3LA 4DF6A 1FILA 1KGGA 5DKKA 1PYYA 1K55A 5CGSA 1S0WA 1IYOA 3EWKA 3E4OA 4Y15A 1S1YA 2XGNA 2PYPA 2BTFP 4OONA 3O3VA 3KSIA 4JXWA 3VP4A 5HDCA 2WGWB 5HPIA 1K56A 4OOMA 5DF7A 3MZDA 1K56D 3EOIA 5M1AA 2JKRI 2J3WA 4BBUA 3NI9A 4L9EA 4NG2A 4LV2A 4G3WA 3E4QA 3FC7A 3HVFA 4KG5A 5IHVA 2V0WA 4N1XA 3NOUC 3G2YA 3R7WA 3FPVA 2JKRM 1K4EA 3HLBA 1M6KA 4HHDA 5DF8A 3ICYA 2W1TB 1H3QA 4FD8A 1WYBA 3ZYTA 4XXRA 5LBRA 3CLOA 1FCMA 3HBRA 3ZG0A 1EWZA 2W1RA 2LB9A 3MSHA 4YOFA 3EQVA 1FOFA 3LIDA 5EVEA 4BLMA 2HF6A 1VETA 4HEFA 1H8ZA 2VGLM 3GV9A 1XJ6A 4GDNA 1DP8A 3BRMA 1FSYA 3L9KA 1H8MA 1WE4A 2ZQCA 1S6RA 5L2FA 4LV0A 3VSLA 3HLDA 4QY6A 3MF0A 1Y4OA 5F1GA 5E2FA 2HJEA 5EVIB 2PU2A 2Q9NA 3BEBA 2QKPA 1RGZA 5EECA 3S7OA 4EV4A 2X71A 1PWDA 2OWHA 4Y0OA 3CZDA 1PW1A 4C6YA 1T1CA 2ZBBA 4GNUA 4MLLA 3H9WA 3QP2A 1NWZA 4P87A 3C4PA 5CEDA 2B95A 4DDYA 4E3JA 3W8KA 1PZPA 1YLYA 4ZRRA 2PU4A 2J3TD 3C2WA 4JF6A 2KDKA 4UA6A 3VE3A 4GB7A 5E43A 1GSWA 4GHIB 1PNEA 3ITBA 3KYQA 2BASA 2CMNA 3O87A 3BQ8A 3FPWA 3MZEA 5CGXA 3E2LA 3W4OA 2VLGA 5A92A 3OCLA 1FIKA 4L9FA 3JVUA 2INWA 3EGDC 5EVLA 3IWQA 4HOIA 4KZ4A 2XDMA 4C3QA 3ZGAB 3VP3A 4GDBA 3DW0A 1L0GA 2ZLYA 4M3KA 4JF4A 4R4SA 2PR5A 1T19A 1T1AA 3MKFA 4DXBA 2HV1A 3OZHA 2GZAA 3LR4A 3P09A 4GCZA 3NC8A 4I3JA 1PI5A 4II7A 1CF0A 3N6IA 3CI6A 3NHQA 1K6SA 1CK3A 4MMNA 5GLBA 4MBKA 1XGJA 5G18A 3BFEA 5HZHA 1K57C 3HJIA 2P9VA 5FDHA 3UDXA 3PAGA 1YSPA 4Y5FA 5KIZA 4WL9A 4E3MA 3FYZA 4WM9A 3KYEA 3H7WA 3MZFA 4E6WA 2QJ5A 3A3DA 4IUHA 5J7EA 2AVXA 4EBLA 3TE8A 2HJ9C 5TBMA 3SS3A 4S2KA 3LI8A 3HLFA 5DF9A 2A3UA 1OTEA 2WAFA 4NK3A 2XD1A 1Z6FA 2XSSA 1N9NA 3VP0A 4EU0A 4EBPA 3UO9A 1SZVA 2ZOIA 2W3FA 3QP6A 2PD8A 4N1HA 1K54C 5FQIA 5CERA 3UDFA 1Z09A 4LV1A 1W8QA 3WS1A 2QYBA 2Y59A 3D4FA 5EOEA 2A49A 1BLHA 4KQDA 2GX5A 4IBRA 2QMIA 5HWWA 5FASA 2WKRA 4BJPA 5FQ9A 2QZ6A 4UAAA 4LPZA 1BYWA 1F5MA 1L3LA 3CPTA 5HDDA 1LI0A 1KVLA 1CEGA 4X69A 4ZJ2A 5HD5A 3NIAA 2VK3A 4QJGA 2J9OA 3JPUA 3Q07A 2WGIA 2OLUA 4LCMA 2DRWA 3S7QA 1SKOA 4FSFA 5F82A 5AVFA 2XEPA 3P01A 3HCYA 1EI5A 1L0DA 4P0MA 4DDSA 4U0XA 1TDLA 2O9CA 4I5SA 1KE0A 5HL1A 1XFQA 3NJAA 3DTIA 1DJCA 3A3EA 1YM1A 3N7WA 3TOIA 1P9WA 2Y2KA 2V1AA 4S2JA 3LFVA 2V0UA 3IX4A 1JTDA 4FCFA 1DRMA 5F69A 2GDNA 1MZUA 4B4XA 5GL9A 3BY9A 4PMAA 3TW8A 1H0MA 1MBLA 1O7EA 3IXBA 1ONHA 2XK1A 3KYZA 1WA9A 1YQSA 5EPHA 4BD0A 3GECA 2VA0A 4HNBA 3IBJA 1ODVA 1OPXA 2UWXA 1ALQA 2WAEA 2M7UA 3NECA 2JKTM 1PW8A 4EUVA 4E3IA 2A24B 1V9ZA 5GLAA 3SH7A 4FH2A 1YLWA 1YLPA 3RXWA 3PBNA 1XGIA 1SHVA 3JVVA 1MPLA 1LL9A 4S2NC 1JNUA 3D72A 3UPNA 2JBFA 3A0SA 4H6JB 3H82B 4O8GA 5DVAA 3UB7A 1LHYA 5C5KA 1BLSA 4LLOB 3CUEC 3MKEA 3UB6A 4BD1A 1G28A 1OTBA 1UWNX 2I72A 3HJKA 4EUZA 3KX0X 3HUNA 4ETZA 3ZDJA 4KUOA 3NCKA 2D02A 2BLSA 2WKQA 3HUMA 4OP5A 4RQ9A 3V39A 2DNSA 3MXRA 5JYOA 2HP5A 2QPNA 5KSCA 5HX9A 4E6XA 3AGEA 3O88A 4HIAA 4WELA 3T1QB 1F98A 4JGQA 3AGDA 2JC7A 4NEED 4HP4A 4F3LB 4XT2A 2Y55A 1W8YA 2Y2HA 1FCOA 1K4FA 2XD5A 3V5MA 4S2IA 3BQAA 3BFGA 4PM5A 1K0KA 4BQMA 3PHYA 1SCWA 4Q0IA 2V1BA 2EWWA 1S67L 3IWIA 2V8CA 2LB5A 2Y2PA 4WEJA 1E25A 1KVMA 3A3JA 2H0TA 3VOLA 4ESPA 5FI2A 3I7JA 2IWBA 2ZC4B 1MKIA 4HP9A 3MQOA 2KOIA 1ES3A 1XJ3A 2VGLS 1XP4A 1MWUA 2E8JA 3Q1FA 3ULFA 1YSQA 2V20A 2HDRA 2X02A 2VEAA 1ERQA 1KDWA 1N9BA 2L4RA 1IYPA 5HFOA 2XA7S 4O7DA 5CXWA 2MJ6A 3G35A 4JXSA 4D2OA 1W7FA 3DWKA 2EFXA 4DE3A 4KQOA 3UE0A 2WZZA 3QP5A 5CHUA 5HAPA 4I3AA 4B88A 2EXBA 1TDGA 5TFQA 1NJ4A 5CHJA 1T1BA 1YT4A 1N4OA 1FSWA 3UMDA 3W4QA 3CHWP 2IWCA 1W79A 2HDSA 3C4OA 4NETA 4UA7A 1GSVA 3ZNTA 2R78A 4LFUA 3Q7VB 2D01A 3T4QA 3EQUA 4D60A 3CWFA 4NKPA 4OQIA 4ARZA 4MN7A 2FH5A 1ZKJA 3BFFA 2H10A 1NYMA 1GSXA 3BLMA 2CC1A 4JXGA 2H28A 5GHZA 3T12B 2B5RA 5F5YA 3QP8A 4LGWA 1TVFA 1BZAA 2E8IA 1ZC2A 2P74A 5FATA 2ZJ9A 5HWTA 4K0WA 3S7NA 3LO7A 3BFCA 3T1RA 5HL6A 4DE1A 2VKSA 1S66L 4R1GA 4HI4A 5FSRA 5L10A 3PBRA 1Q2PA 4OLGA 5I94A 4IVKA 3HUOA 2XA7M 3NOPC 1YPRA 3EEHA 2PDRA 1VM1A 2JE5A 2W3HA 3Q7ZA 3IF6B 1OJ5A 4ME4A 4YINA 4GS9B 3IHAA 4S2LA 4EERA 5J4EA 4N9KA 4B9OA 3S22A 3GSGA 1DY6A 2W0NA 4GZBA 3N8SA 1NY0A 4R3JA 1F9IA 2ZMFA 3HLWA 1RCJA 3BECA 2L0WA 3F1OA 2WYXA 4U0TA 4QHCA 3MXQA 1ACFA 3QP4A 2UV0E 4OKPA 3NY4A 1KDSA 4EQIA 4HJ6A 4UHUA 3G30A 2HP9A 5M19A 1J3WA 2OOLA 5CTNA 4Y7PA 4R0QA 4CLCC 3Q81A 1WYCA 4RYEA 3D3OA 4OQGA 4X55A 4EXOA 1MC0A 3FKWA 4ZJ1A 5DTTA 2FFYA 3EEAA 5GHYA 3SH9A 2W3DA 2ZQ7A 3MFXA 4PKYG 4CLCE 4PHTA 5TJJA 3A3FA 4GW9A 3W4PA 5E2GA 1K57A 1N9LA 2Y2QA 1OMEA 3PYPA 3V50A 3TSGA 2K31A 2Y91A 3CITA 5FEGA 4R23A 2G7UA 3CG5A 4JLFA 1OT9A 2VGKA 3RH8B 4CQHA 1HLUP 4WMCA 3K2NA 3QHYA 2V2FF 4WMCD 2ZMAA 3OC2A 4PM9A 1CQAA 3MS6A 5JYPA 3UDIA 1RP5A 2XFSA 3F1PA 2VV7A 3IX8A 1PRQA 1V9YA 2ZC3B 5DTKA 3T1XA 4Q0JA 1K54A 4OQ0A 1IYSA 3DAVA 3G6OA 3PBOA 5HDSA 1IEMA 5FA7A 3IS2A 3IWOA 2WGVA 1VEUA 3VP1A 5J8XA 1W63M 1ES5A 3LEQA 3M2JA 1LL5A 2GJ3A 3MMHA 3R7WB 2JKFA 5EFWA 4EW7A 4GOGA 4MBHA 3CAXA 4RX3A 2V1ZA 2KX6A 1U60A 2YKHA 4LRYC 1ZG4A 5DJTA 1KE4A 3WRZA 4KUKA 3IXGA 4OVDA 3E2KA 1MXOA 4DE2A 3A0RA 3LYXA 4P85A 1DJBA 4OOYA 3F1NA 1DJAA 4DXCA 3WRTA 4BENA 2O9BA 4KENB 1OT6A 2IWDA 3TJZC 3E0YA 5EOOA 1VETB 3ZG9B 3N8LA 4MBFA 2VJWA 4NXGA 2PD7A 3UB5P 2Y2NA 3VOYA 1CJFA 4QD4A 5EM1A 5DJUA 5J3WA 1YLJA 1YMSA 2XF3A 3NOTC 5F6AA 3P7NA 3VFFA 3VOZA 4HJ3A 4ZDXA 4IUKA 2WGWA 1YLZA 1HVBA 3UB8A 3PBSA 3KSGA 3DTMA 4CLCB 1T18A 3C30A 5K5BA 2Y2OA 1GHPA 5A90A 5CHMA 5GLDA 2ZD8A 4QPRA 4DN0A 4EESA 3ZG5A 1JVJA 5G4YA 1PWGA 4R70A 2Q0OA 4JGRA 1TF1A 2XLNA 3ZG7B 1TS6A 3LIAA 3IH9A 1JTGA 4ID4A 1PFLA 4GJ4A 3T4OA 2OV5A 2H5SA 4MCWA 2ZL1B 2QHKA 1LT0A 3C7UA 1TD5A 2EXAA 4WBGA 4Y17A 3GMWA 1YMXA 3Q7VA 4AFIA 2H0YA 3VV4A 3L7HA 5AQBA 1PZOA 2W1TA 4S2PA 4S2NA 5DFXA 4WZ5C 1L0FA 3VFHA 3V3SA 3S1YA 2OWJA 4OOLA 4BL2A 3PBQA 4CJNA 3SH8A 3OPRA 4OP8A 1LLBA 2P7JA 1NXYA 3UPOA 1G6AA 3CUEA 3E98A 4R3BA 3PBTA 3IT9A 1AWIA 1TS7A 3O86A 4B93A 1G6OA 1GCEA 4WYYA 4KQQA 4LV3A 4IVIA 4R38A 4EWFA 1YLTA 4Z1WA 2P9VB 5FQJA 3ZCZA 2FFFB 1MWSA 4KZ8A 4G3KA 5EVIA 3QNBA 3KO6A 1K25A 4G3VA 3H7WB 5EVID 3B42A 4ZJ3A 1GA9A 3DBAA 4FTXA 2JHEA 1ES4A 3WS5A 4BBVA 3S7PA 5TBMB 5A91A 3LCEA 1G68A 2O9AA 4BBTA 1VQQA 3ZHHA 5GLCA 4KQRA 2WUQA 1TEMA 3IF6C 4JKTA 1L0EA 2Z6CA 3GR2A 3P98A 2L1MA 1W63Q 4BL3A 4OPRA 5CX7A 2J80A 3MBZA 4K08A 4Y3IA 4GHIA 1VHMA 4EQ1A 5IT5A 5HD3A 4HH3A 3V67A 1EW0A 3R4KA 5EM0A 2DMWA 1P0ZA 1AXBA 2ZC6B 4WN5A 4Y2FA 1G5UA 1LSVA 4CPKA 5FDSA 1BSGA 1EROA 4FOFA 4XUZA 3OPHA 5L07A 2HGVA 3C8CA 3UY6A 1E4DA 5F1FA 2PYRA 2WKHA 2Y2MA 1UWPX 3G34A 2IA2A 4QY5A 3HL9A 3RFBA 4FH4A 1CI8A 1BULA 1XA7A 4A5RA 4OLDA 3V3RA 1JWPA 4P6BA 1CEFA 5HW3A 5KZHA 3T4TA 3HREA 2HPBA 1IYQA 2Z2MB 4E04A 3WS2A 3MQ0A 4S2MA 5A8BA 1Y28A 4BMWA 5CEBA 3DTEA 1KGEA 1GHMA 2OSUA 1S4SA 1K6RA 3GQZA 5TR7A 3D9YA 3ZG8B 3ITAA 3LEZA 3G2ZA 3HLCA 1NZUA 3BWLA 1K55C 4GKUA 3RXXA 5U47A 1ESUA 2R9WA 4WUJA 2PBYA 3IX3A 4GD8A 4EBNA 3LUQA 2XQZA 2M1CA 3LI9A 2VV8A 4KG6A 3C7VA 1OTIA 3WWXA 4NXEA 4WLAA 1NRJA 4B4ZA 2W3EA 3MQQA 4F94A 2EX6A 1FQGA 5I5LA 1GHIA 1I5QA 2Z2LB 1Y54A 3LY4A 1I2SA 3W2ZA 3UB9A 4HH2A 2ZQ8A 5GHXA 1QMEA 2G2WA 1ERMA 4H8RA 4QU3A 3DTKA 3UPPA 4LRZE 1N9OA 4WZ4A 2WKPA 4E3NA 1O07A 3N4IA 3ISGA 3HLGA 4O01A 2O0YA 4DKIA 4S2OA 2Y8HA 2Y2LA 2RL3A 4L0LA 2PAVP 5BOHA 5EE8A 5CECA 2Z6DA 5FQMA 4ZBEA 1FR6A 3OOVA 4I38A 3T4LA 3B33A 2B18A 2PT7A 1MWTA 5AJGA 3IQAA 5F83A 2QJ7A 1MWRA 3AGFA 2ZMVA 4KZ3A
chains in the Genus database with same CATH topology
1S1ZA 3T50A 3UE3A 1LL8A 4I3IA 2P04A 4Q0JA 4R6LA 1WA9A 4MDZA 4EEUA 3G6OA 3PBOA 4MN5A 5HDSA 2FZ0A 2EA9A 3GECA 2VA0A 4HNBA 3UE6A 1ZHHB 2ZOHA 3IBJA 3IS2A 1ODVA 1NLYA 1OPXA 2W3GA 3B47A 1P9RA 4JGOA 1OTAA 2M7UA 5HPFA 1W63M 2EWVA 2V9AA 2JKTM 1MKMA 4EUVA 5DKKA 2A24B 5DKLA 1V9ZA 2GJ3A 3EWKA 3MMHA 3R7WB 4EW7A 5EFWA 3E4OA 1S1YA 3CAXA 3PBNA 4CLCA 5MC7A 3JVVA 2KX6A 2PYPA 2YKHA 4LRYC 5DJTA 4CLCD 3KSIA 4KUKA 1JNUA 3D72A 3A0RA 4I39A 5HDCA 3LYXA 3A0SA 4JGPA 2I9VA 4EETB 5HPIA 5KSHA 4H6JB 4OOMA 3F1NA 3H82B 4O8GA 3EOIA 3UB7A 4XT2B 2JKRI 2J3WA 4BBUA 2O9BA 2VV6A 5C5KA 1OT6A 4UEYA 4LLOB 4L9EA 3TJZC 3CUEC 2J3TC 4BWIA 3E0YA 2P08A 4G3WA 3UB6A 3E4QA 1G28A 3FC7A 2VJWA 1OTBA 1UWNX 2PD7A 4NXGA 3HJKA 3KX0X 3PR6A 3SW1A 2V0WA 4ETZA 3NOUC 2A24A 4KUOA 2D02A 5DJUA 3R7WA 5J3WA 2WKQA 3FPVA 3NOTC 3K3DA 2JKRM 4RQ9A 5F6AA 3P7NA 3U2AA 4HJ4A 1KOUA 4HHDA 4HY8A 3ICYA 4HJ3A 2W27A 2W1TB 1H3QA 5HSQA 4IUKA 3ZYTA 1IFQA 4HIAA 4WELA 4H6JA 5LBRA 3UB8A 1F98A 3PBSA 3H82A 4JGQA 4WF0A 3KSGA 4NEED 4CLCB 1T18A 3CLOA 4HP4A 3C30A 4F3LB 5K5BA 4XT2A 3PXPA 2W1RA 2LB9A 4YOFA 3EQVA 4QPRA 4DN0A 4EESA 3LIDA 5FL3A 2HF6A 2XRNA 2NUPC 2OAQ1 4NXBA 5G4YA 2VGLM 4Q0HA 3BQAA 1XJ6A 4R70A 1YAXA 3PHYA 4JGRA 1DP8A 1TF1A 4Q0IA 2V1BA 1TS6A 2EWWA 3LIAA 1S67L 2LB5A 3MJQA 5AVEA 4WEJA 4GJ4A 3E4PA 3T4OA 1H8MA 4MCWA 3VOLA 2QHKA 3MF0A 1LT0A 2PR6A 1TD5A 4HP9A 2HJEA 1TS0A 1S4RA 3MQOA 2KOIA 4AFIA 3VV4A 2QKPA 3S7OA 1XJ3A 2VGLS 2PHYA 4WEKA 2W1TA 5L8MA 2OWHA 5DFXA 4UQIS 3ULFA 1T1CA 1YSQA 2OWJA 2ZBBA 3IBRA 4OOLA 2K7SA 2VEAA 3H9WA 3VE4A 1NWZA 4F3LA 3PBQA 2L4RA 4PKYA 2P7JA 4ARZB 3BY8A 2XA7S 2MJ6A 3CUEA 3E98A 3PBTA 4ZRRA 2J3TD 3C2WA 3RTYA 3T4KA 3LICA 1TS7A 4B93A 2KDKA 2VZWA 1G6OA 4KQOA 3VE3A 1GSWA 4GHIB 4R38A 3KYQA 2BASA 2CMNA 1TS8A 3BQ8A 3FPWA 4I3AA 4Z1WA 1T1BA 2VLGA 3OCLA 4L9FA 4G3KA 3JVUA 2INWA 3EGDC 3KO6A 4NXFA 3UMDA 4G3VA 1OJGA 3H7WB 2GNXA 4HOIA 3B42A 4L9GA 3DBAA 4LRXC 2JHEA 4O0PA 2M7VA 1P97A 4BBVA 3S7PA 5TBMB 1XJ2A 1GSVA 3KSFA 3MR0A 1XFNA 2R78A 2O9AA 2PR5A 4BBTA 1T19A 1T1AA 2HV1A 3BW6A 2D01A 4ETXA 2GZAA 3T4QA 3LR4A 1X0OA 2Y79A 3TRCA 3T4SA 3ZQ5A 3EQUA 4GCZA 3CWFA 3LIBA 4I3JA 4NKPA 4II7A 1ZTUA 4ARZA 4MN7A 4YNRA 2FH5A 2Z6CA 3LR3A 3CI6A 1XJ4A 3NHQA 2L1MA 4MMNA 1W63Q 1GSXA 4M4XA 5CX7A 2J80A 2H28A 5G4ZA 4K08A 5HZHA 4PAUA 4Y3IA 5F5YA 3HJIA 4GHIA 1VHMA 4EQ1A 5IT5A 3LR0A 4EEPA 4YWZA 5HD3A 4HH3A 3C38A 3LR5A 3V67A 1EW0A 1YSPA 3R4KA 4Y5FA 3F1OB 2OAP1 4P6ZS 5KIZA 2DMWA 1P0ZA 4WL9A 5HWTA 4HQAA 3S7NA 4UQIM 4WN5A 3H7WA 5HL6A 2QJ5A 4IUHA 4Y2FA 5J7EA 2VKSA 3TE8A 1S66L 4HI4A 1LSVA 2HJ9C 4FOFA 5TBMA 3PBRA 2HGVA 5F68A 2JKTI 3C8CA 3LI8A 2PYRA 5DF9A 1OTEA 1UWPX 2XA7M 2YKFA 3NOPC 3OCNA 3EEHA 2IA2A 2PDRA 2W3HA 3RFBA 3FG8A 2XSSA 1OJ5A 4ME4A 5IU1A 4GS9B 4EERA 5J4EA 1N9NA 4B9OA 4EU0A 3A0VA 1D06A 2W0NA 2ZOIA 2W3FA 2PD8A 3KSHA 2QYBA 2NUTC 4DMZA 3T4TA 1F9IA 2ZMFA 4E04A 4KQDA 2GX5A 2QWSA 3MQ0A 4IHQA 5A8BA 1Y28A 3OLOA 4BMWA 2L0WA 3F1OA 3O5YA 1UGUA 3MXQA 5HWWA 4R3AA 3T4JA 2WKRA 1S4SA 1OTDA 2KLIA 4BJPA 3OBFA 4LPZA 1BYWA 1F5MA 3BJNA 4HJ6A 5HDDA 3BWLA 2OOLA 4WUJA 3LUQA 4CLCC 1D7EA 5HD5A 3UMEA 3D3OA 2M1CA 1STZA 3LI9A 2VV8A 4EXOA 1MC0A 3EEAA 2K2NA 1OTIA 4NXEA 4WLAA 1NRJA 2W3EA 3EGXC 3MQQA 4GS9A 5I5LA 2W3DA 4DJ2A 1DP9A 1YKDA 3F1PB 3W2ZA 3UB9A 3S7QA 2VX8A 3MFXA 4FSFA 4PKYG 4PHTA 5TJJA 4CLCE 5IS1A 3GDIA 5AVFA 4P6ZM 4GLQA 1LSWA 1NLZA 3HCYA 3P01A 4GW9A 3LIEA 4HH2A 1N9LA 2O9CA 4LRZE 2XROA 1N9OA 4I5SA 2WKPA 3IS2B 3PYPA 3K3CA 2K31A 1XFQA 3NJAA 4O01A 2O0YA 3CITA 1IOUA 2Y8HA 1P9WA 4L0LA 2G7UA 2V1AA 3LFVA 2V0UA 4IJGA 1OT9A 1VB6A 3RH8B 1DRMA 2A2LA 5HWVA 5F69A 2O99A 2JN7A 2Z6DA 4CQHA 3LIFA 2B02A 1MZUA 3K2NA 5DFYA 1DP6A 4DJ3A 3OOVA 4I38A 3T4LA 3BY9A 3B33A 2B18A 2PT7A 3TW8A 3OC2A 1LSXA 5AJGA 2QJ7A 4MN6A 3F1NB 3KYZA 3F1PA 2VV7A 1V9YA 2ZMVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1S1Z A;  3T50 A;  1LL8 A;  4I3I A;  4R6L A;  1WA9 A;  4EEU A;  3G6O A;  4MN5 A;  5HDS A;  2EA9 A;  3GEC A;  4HNB A;  3UE6 A;  2ZOH A;  3IS2 A;  1ODV A;  4JGO A;  1OTA A;  2V9A A;  5DKK A;  2A24 B;  5DKL A;  1V9Z A;  2GJ3 A;  3EWK A;  4EW7 A;  5EFW A;  3E4O A;  1S1Y A;  3CAX A;  2KX6 A;  2PYP A;  2YKH A;  4LRY C;  5DJT A;  4KUK A;  1JNU A;  3D72 A;  3A0R A;  4I39 A;  5HDC A;  3LYX A;  3A0S A;  4JGP A;  2I9V A;  4EET B;  4H6J B;  3F1N A;  3H82 B;  3UB7 A;  4XT2 B;  4BBU A;  2VV6 A;  1OT6 A;  4LLO B;  4L9E A;  3UB6 A;  3E4Q A;  1G28 A;  3FC7 A;  4NXG A;  1OTB A;  1UWN X;  2PD7 A;  3HJK A;  3KX0 X;  3SW1 A;  2V0W A;  3NOU C;  2A24 A;  4KUO A;  2D02 A;  5DJU A;  5J3W A;  2WKQ A;  3NOT C;  5F6A A;  3K3D A;  4RQ9 A;  3P7N A;  4HJ4 A;  1KOU A;  4HHD A;  4HY8 A;  3ICY A;  4HJ3 A;  2W27 A;  5HSQ A;  4HIA A;  4H6J A;  3UB8 A;  1F98 A;  3H82 A;  4JGQ A;  4WF0 A;  1T18 A;  3CLO A;  4HP4 A;  4F3L B;  4XT2 A;  4EES A;  3LID A;  4NXB A;  5G4Y A;  1XJ6 A;  4R70 A;  3PHY A;  4JGR A;  1DP8 A;  2V1B A;  1TS6 A;  3LIA A;  1S67 L;  3MJQ A;  5AVE A;  3E4P A;  3VOL A;  2QHK A;  1LT0 A;  2PR6 A;  4HP9 A;  1TS0 A;  1S4R A;  3MQO A;  2QKP A;  1XJ3 A;  2PHY A;  2OWH A;  3ULF A;  1T1C A;  2OWJ A;  2ZBB A;  3IBR A;  2K7S A;  2VEA A;  3H9W A;  3VE4 A;  1NWZ A;  4F3L A;  2L4R A;  4PKY A;  2P7J A;  3BY8 A;  3C2W A;  3RTY A;  3LIC A;  1TS7 A;  2KDK A;  3VE3 A;  1GSW A;  4GHI B;  4R38 A;  2BAS A;  2CMN A;  1TS8 A;  4I3A A;  1T1B A;  2VLG A;  4L9F A;  2INW A;  3UMD A;  4NXF A;  1OJG A;  3H7W B;  4HOI A;  4L9G A;  4LRX C;  2JHE A;  1P97 A;  4BBV A;  5TBM B;  1XJ2 A;  1GSV A;  3MR0 A;  1XFN A;  2R78 A;  2PR5 A;  4BBT A;  1T19 A;  1T1A A;  2HV1 A;  2D01 A;  1X0O A;  3ZQ5 A;  4GCZ A;  3CWF A;  3LIB A;  4I3J A;  2Z6C A;  1XJ4 A;  3NHQ A;  2L1M A;  1GSX A;  4M4X A;  2J80 A;  2H28 A;  5G4Z A;  4K08 A;  5HZH A;  5F5Y A;  3HJI A;  4GHI A;  4EQ1 A;  4EEP A;  4YWZ A;  5HD3 A;  4HH3 A;  1EW0 A;  3F1O B;  5KIZ A;  1P0Z A;  4WL9 A;  5HWT A;  4HQA A;  4WN5 A;  3H7W A;  2QJ5 A;  5J7E A;  1S66 L;  4HI4 A;  1LSV A;  5TBM A;  5F68 A;  3C8C A;  3LI8 A;  2PYR A;  1OTE A;  1UWP X;  2YKF A;  3NOP C;  3EEH A;  2PDR A;  3FG8 A;  1OJ5 A;  5IU1 A;  4GS9 B;  4EER A;  5J4E A;  1N9N A;  4B9O A;  3A0V A;  1D06 A;  2W0N A;  2ZOI A;  2PD8 A;  1F9I A;  4E04 A;  4KQD A;  2QWS A;  5A8B A;  1Y28 A;  3OLO A;  2L0W A;  3F1O A;  1UGU A;  3MXQ A;  5HWW A;  4R3A A;  2WKR A;  1S4S A;  1OTD A;  4LPZ A;  1BYW A;  4HJ6 A;  5HDD A;  3BWL A;  2OOL A;  4WUJ A;  3LUQ A;  1D7E A;  5HD5 A;  3UME A;  2M1C A;  3LI9 A;  2VV8 A;  4EXO A;  1OTI A;  4NXE A;  4WLA A;  3MQQ A;  4GS9 A;  5I5L A;  4DJ2 A;  1DP9 A;  3F1P B;  3UB9 A;  3MFX A;  4PKY G;  5IS1 A;  3GDI A;  5AVF A;  1LSW A;  4HH2 A;  4GW9 A;  3LIE A;  1N9L A;  4LRZ E;  1N9O A;  4I5S A;  2WKP A;  3IS2 B;  3PYP A;  3K3C A;  1XFQ A;  3NJA A;  2V1A A;  2V0U A;  1OT9 A;  1VB6 A;  3RH8 B;  1DRM A;  5HWV A;  5F69 A;  2JN7 A;  2Z6D A;  3LIF A;  2B02 A;  1MZU A;  1DP6 A;  4DJ3 A;  4I38 A;  3BY9 A;  3B33 A;  1LSX A;  2QJ7 A;  4MN6 A;  3F1N B;  3F1P A;  2VV7 A;  1V9Y A; 
#chains in the Genus database with same CATH topology
 3B3X A;  3UE3 A;  1LL8 A;  2P04 A;  2OLV A;  4MNR A;  4R6L A;  1XKZ A;  4EEU A;  3TG9 A;  2EA9 A;  3OPP A;  3UE6 A;  4OQH A;  2ZOH A;  1NLY A;  1KGF A;  3JYI A;  3B47 A;  3UN7 A;  1OTA A;  5HPF A;  2EWV A;  1KE3 A;  1MKM A;  3OPL A;  1XX2 A;  5DKL A;  3VP2 A;  1ONG A;  3G31 A;  4X6T A;  3BFD A;  2J9P A;  3BYD A;  4CLC A;  1MY8 A;  5MC7 A;  3BM6 A;  4CLC D;  1L2S A;  4LEN A;  4Y13 A;  3PAE A;  4I39 A;  5CTM A;  1FR1 A;  5FAQ A;  4RX2 A;  4JGP A;  2I9V A;  4EET B;  5KSH A;  2Y2I A;  4XT2 B;  2VV6 A;  4UEY A;  2X01 A;  3NUL A;  2J3T C;  4BWI A;  2P08 A;  3A3I A;  4OPZ A;  2ZL1 A;  5AQ7 A;  2PRF A;  3NDG A;  4DRT A;  3NBL A;  3PR6 A;  4ZAM A;  4E3K A;  3SS5 A;  3SW1 A;  4X56 A;  1M40 A;  4K91 A;  3T1S A;  2A24 A;  1GA0 A;  1Q2Q A;  2ACG A;  2WKI A;  4KZB A;  3VSK A;  5FQQ A;  2JKG A;  3K3D A;  3GRJ A;  2G2U A;  4X1M A;  1BLC A;  1H5X A;  3U2A A;  4HJ4 A;  1KOU A;  1BT5 A;  3CJM A;  4HY8 A;  2BG1 A;  2W27 A;  5HSQ A;  4PM8 A;  1IFQ A;  4H6J A;  3H82 A;  4WF0 A;  2RCX A;  3PXP A;  4PM7 A;  5FL3 A;  4PM6 A;  1W5D A;  4K0X A;  2XRN A;  2NUP C;  2OAQ 1;  4NXB A;  4HES A;  2ZQA A;  4Q0H A;  1YAX A;  5A93 A;  3MJQ A;  5AVE A;  3E4P A;  3ZVT A;  5FAP A;  2PR6 A;  5D3O A;  3FZC A;  2Y2J A;  1TS0 A;  1S4R A;  5DTS A;  1SDE A;  5KMW A;  3MFD A;  5AQA A;  2PHY A;  4WEK A;  5L8M A;  1C3B A;  5TGF A;  4UQI S;  5E2E A;  3GVB A;  4IED A;  1PWC A;  4Z9Q A;  3IBR A;  2K7S A;  1BUE A;  3IF5 A;  1JWZ A;  1H8Y A;  3VE4 A;  4KZ9 A;  4F3L A;  2ZM0 A;  2HDQ A;  4PKY A;  1LI9 A;  3IXH A;  4YFM A;  4ARZ B;  3BY8 A;  3N8R A;  4QB8 A;  5M18 A;  1BTL A;  2WKE A;  5FI6 A;  3RTY A;  4MEZ A;  3T4K A;  2C6W B;  3LIC A;  2VZW A;  5FEF A;  1FCN A;  5FAO A;  4JPM A;  1TS8 A;  4LCL A;  4RA7 A;  4HBU A;  3FV7 A;  3MXS A;  2ZQ9 A;  4FUW A;  4NXF A;  1OJG A;  1JWV A;  2C5W B;  2GNX A;  5EUA A;  1IKI A;  4L9G A;  4LRX C;  3ZNY A;  5L09 A;  4O0P A;  2M7V A;  2HDU A;  1P97 A;  2J7V A;  3SZT A;  5E2H A;  1XJ2 A;  5HAQ A;  4X25 A;  3KSF A;  3MR0 A;  1XFN A;  4ZTK A;  4DE0 A;  3WS0 A;  4IBX A;  1XXM A;  3M6B A;  3BW6 A;  1I2W A;  4ETX A;  1X0O A;  2Y79 A;  3TRC A;  3SOI A;  3T4S A;  3ZQ5 A;  1XPB A;  3LIB A;  5HAR A;  2ZC5 B;  1ZTU A;  2XR0 A;  4YNR A;  4X1L A;  3LR3 A;  1XJ4 A;  3C5A A;  1BLP A;  2Y2G A;  3LY3 A;  5EV0 A;  3UNW A;  4M4X A;  4U3T A;  1ES2 A;  2HP6 A;  5G4Z A;  4PAU A;  1PI4 A;  3LR0 A;  4EEP A;  4YWZ A;  3C38 A;  3LR5 A;  3BLS A;  3F1O B;  2OAP 1;  4P6Z S;  4QWO A;  3M2K A;  4HQA A;  4UQI M;  3RJU A;  3IXD A;  5AQ9 A;  5F68 A;  3SS4 A;  2JKT I;  4C75 A;  4OPQ A;  4WZ5 A;  4GN2 A;  2J8Y A;  2YKF A;  3OCN A;  2DCF A;  2ZM8 A;  4PPR A;  1E3U A;  3G32 A;  4KZA A;  3GTC A;  3VMA A;  3FG8 A;  1ESI A;  1E3U D;  4JBF A;  5IU1 A;  2EX9 A;  1IEL A;  1HTZ A;  2VGJ A;  3ZVW A;  3A0V A;  1D06 A;  3IH8 A;  1A0K A;  5CGW A;  3KSH A;  2XH9 A;  2NUT C;  1NYY A;  2Y4A A;  3QP1 A;  4DMZ A;  3U4L P;  1XA1 A;  4Y0T A;  4UA9 A;  2R9X A;  2WZX A;  2QWS A;  4IHQ A;  3HLE A;  3OLO A;  1F2K A;  3PTE A;  3O5Y A;  2Q9M A;  1UGU A;  4R3A A;  1HZO A;  3T4J A;  5HAI A;  3NDE A;  2KLI A;  1OTD A;  3OBF A;  5CRF A;  3BJN A;  4X68 A;  2PBD P;  4KZ6 A;  1SKF A;  1ZG6 A;  4RVA A;  3ZFZ A;  1J9M A;  1D7E A;  2WAD A;  1NZO A;  3UME A;  3DWZ A;  3WS4 A;  1NRF A;  1STZ A;  2EFU A;  5FI7 A;  3CMZ A;  2K2N A;  2ZC7 A;  3EGX C;  2EX2 A;  3IF6 A;  4GS9 A;  4DJ2 A;  1DP9 A;  1SDN A;  1YKD A;  3F1P B;  4N92 A;  1RGY A;  3UE1 A;  2VX8 A;  4KZ5 A;  5IS1 A;  4JXV A;  3GDI A;  4P6Z M;  4GLQ A;  2XFT A;  1LSW A;  1NLZ A;  3Q82 A;  3LIE A;  4JF5 A;  2HZ5 A;  4XUX A;  1K38 A;  1D1J A;  4OPY A;  2XRO A;  5EVI C;  3IS2 B;  3G4P A;  3K3C A;  3LGO A;  2V8F A;  4OH0 A;  1VEU B;  4HBT A;  4R4R A;  1IOU A;  3S4X A;  2JCH A;  4IJG A;  1VB6 A;  1PIO A;  2A2L A;  5HWV A;  4Y0U A;  2O99 A;  2JN7 A;  4X53 A;  1QMF A;  3LIF A;  2B02 A;  4N9L A;  5DFY A;  1DP6 A;  4DJ3 A;  2ZQD A;  3IHB A;  3CPT B;  3QNC A;  1LSX A;  2WK0 A;  4MN6 A;  3F1N B;  4KG2 A;  4E3O A;  1S1Z A;  3T50 A;  4GD6 A;  4I3I A;  3FKV A;  4MDZ A;  4MN5 A;  2FZ0 A;  4Q8I A;  3FWL A;  1IKG A;  2ZM2 A;  1ZHH B;  5FQK A;  4KZ7 A;  1SKO B;  1CI9 A;  2W3G A;  1P9R A;  4JGO A;  3M6H A;  2V9A A;  2EX8 A;  1HD8 A;  4E3L A;  4DF6 A;  1FIL A;  1KGG A;  5DKK A;  1PYY A;  1K55 A;  5CGS A;  1S0W A;  1IYO A;  3EWK A;  3E4O A;  4Y15 A;  1S1Y A;  2XGN A;  2PYP A;  2BTF P;  4OON A;  3O3V A;  3KSI A;  4JXW A;  3VP4 A;  5HDC A;  2WGW B;  5HPI A;  1K56 A;  4OOM A;  5DF7 A;  3MZD A;  1K56 D;  3EOI A;  5M1A A;  2JKR I;  2J3W A;  4BBU A;  3NI9 A;  4L9E A;  4NG2 A;  4LV2 A;  4G3W A;  3E4Q A;  3FC7 A;  3HVF A;  4KG5 A;  5IHV A;  2V0W A;  4N1X A;  3NOU C;  3G2Y A;  3R7W A;  3FPV A;  2JKR M;  1K4E A;  3HLB A;  1M6K A;  4HHD A;  5DF8 A;  3ICY A;  2W1T B;  1H3Q A;  4FD8 A;  1WYB A;  3ZYT A;  4XXR A;  5LBR A;  3CLO A;  1FCM A;  3HBR A;  3ZG0 A;  1EWZ A;  2W1R A;  2LB9 A;  3MSH A;  4YOF A;  3EQV A;  1FOF A;  3LID A;  5EVE A;  4BLM A;  2HF6 A;  1VET A;  4HEF A;  1H8Z A;  2VGL M;  3GV9 A;  1XJ6 A;  4GDN A;  1DP8 A;  3BRM A;  1FSY A;  3L9K A;  1H8M A;  1WE4 A;  2ZQC A;  1S6R A;  5L2F A;  4LV0 A;  3VSL A;  3HLD A;  4QY6 A;  3MF0 A;  1Y4O A;  5F1G A;  5E2F A;  2HJE A;  5EVI B;  2PU2 A;  2Q9N A;  3BEB A;  2QKP A;  1RGZ A;  5EEC A;  3S7O A;  4EV4 A;  2X71 A;  1PWD A;  2OWH A;  4Y0O A;  3CZD A;  1PW1 A;  4C6Y A;  1T1C A;  2ZBB A;  4GNU A;  4MLL A;  3H9W A;  3QP2 A;  1NWZ A;  4P87 A;  3C4P A;  5CED A;  2B95 A;  4DDY A;  4E3J A;  3W8K A;  1PZP A;  1YLY A;  4ZRR A;  2PU4 A;  2J3T D;  3C2W A;  4JF6 A;  2KDK A;  4UA6 A;  3VE3 A;  4GB7 A;  5E43 A;  1GSW A;  4GHI B;  1PNE A;  3ITB A;  3KYQ A;  2BAS A;  2CMN A;  3O87 A;  3BQ8 A;  3FPW A;  3MZE A;  5CGX A;  3E2L A;  3W4O A;  2VLG A;  5A92 A;  3OCL A;  1FIK A;  4L9F A;  3JVU A;  2INW A;  3EGD C;  5EVL A;  3IWQ A;  4HOI A;  4KZ4 A;  2XDM A;  4C3Q A;  3ZGA B;  3VP3 A;  4GDB A;  3DW0 A;  1L0G A;  2ZLY A;  4M3K A;  4JF4 A;  4R4S A;  2PR5 A;  1T19 A;  1T1A A;  3MKF A;  4DXB A;  2HV1 A;  3OZH A;  2GZA A;  3LR4 A;  3P09 A;  4GCZ A;  3NC8 A;  4I3J A;  1PI5 A;  4II7 A;  1CF0 A;  3N6I A;  3CI6 A;  3NHQ A;  1K6S A;  1CK3 A;  4MMN A;  5GLB A;  4MBK A;  1XGJ A;  5G18 A;  3BFE A;  5HZH A;  1K57 C;  3HJI A;  2P9V A;  5FDH A;  3UDX A;  3PAG A;  1YSP A;  4Y5F A;  5KIZ A;  4WL9 A;  4E3M A;  3FYZ A;  4WM9 A;  3KYE A;  3H7W A;  3MZF A;  4E6W A;  2QJ5 A;  3A3D A;  4IUH A;  5J7E A;  2AVX A;  4EBL A;  3TE8 A;  2HJ9 C;  5TBM A;  3SS3 A;  4S2K A;  3LI8 A;  3HLF A;  5DF9 A;  2A3U A;  1OTE A;  2WAF A;  4NK3 A;  2XD1 A;  1Z6F A;  2XSS A;  1N9N A;  3VP0 A;  4EU0 A;  4EBP A;  3UO9 A;  1SZV A;  2ZOI A;  2W3F A;  3QP6 A;  2PD8 A;  4N1H A;  1K54 C;  5FQI A;  5CER A;  3UDF A;  1Z09 A;  4LV1 A;  1W8Q A;  3WS1 A;  2QYB A;  2Y59 A;  3D4F A;  5EOE A;  2A49 A;  1BLH A;  4KQD A;  2GX5 A;  4IBR A;  2QMI A;  5HWW A;  5FAS A;  2WKR A;  4BJP A;  5FQ9 A;  2QZ6 A;  4UAA A;  4LPZ A;  1BYW A;  1F5M A;  1L3L A;  3CPT A;  5HDD A;  1LI0 A;  1KVL A;  1CEG A;  4X69 A;  4ZJ2 A;  5HD5 A;  3NIA A;  2VK3 A;  4QJG A;  2J9O A;  3JPU A;  3Q07 A;  2WGI A;  2OLU A;  4LCM A;  2DRW A;  3S7Q A;  1SKO A;  4FSF A;  5F82 A;  5AVF A;  2XEP A;  3P01 A;  3HCY A;  1EI5 A;  1L0D A;  4P0M A;  4DDS A;  4U0X A;  1TDL A;  2O9C A;  4I5S A;  1KE0 A;  5HL1 A;  1XFQ A;  3NJA A;  3DTI A;  1DJC A;  3A3E A;  1YM1 A;  3N7W A;  3TOI A;  1P9W A;  2Y2K A;  2V1A A;  4S2J A;  3LFV A;  2V0U A;  3IX4 A;  1JTD A;  4FCF A;  1DRM A;  5F69 A;  2GDN A;  1MZU A;  4B4X A;  5GL9 A;  3BY9 A;  4PMA A;  3TW8 A;  1H0M A;  1MBL A;  1O7E A;  3IXB A;  1ONH A;  2XK1 A;  3KYZ A;  1WA9 A;  1YQS A;  5EPH A;  4BD0 A;  3GEC A;  2VA0 A;  4HNB A;  3IBJ A;  1ODV A;  1OPX A;  2UWX A;  1ALQ A;  2WAE A;  2M7U A;  3NEC A;  2JKT M;  1PW8 A;  4EUV A;  4E3I A;  2A24 B;  1V9Z A;  5GLA A;  3SH7 A;  4FH2 A;  1YLW A;  1YLP A;  3RXW A;  3PBN A;  1XGI A;  1SHV A;  3JVV A;  1MPL A;  1LL9 A;  4S2N C;  1JNU A;  3D72 A;  3UPN A;  2JBF A;  3A0S A;  4H6J B;  3H82 B;  4O8G A;  5DVA A;  3UB7 A;  1LHY A;  5C5K A;  1BLS A;  4LLO B;  3CUE C;  3MKE A;  3UB6 A;  4BD1 A;  1G28 A;  1OTB A;  1UWN X;  2I72 A;  3HJK A;  4EUZ A;  3KX0 X;  3HUN A;  4ETZ A;  3ZDJ A;  4KUO A;  3NCK A;  2D02 A;  2BLS A;  2WKQ A;  3HUM A;  4OP5 A;  4RQ9 A;  3V39 A;  2DNS A;  3MXR A;  5JYO A;  2HP5 A;  2QPN A;  5KSC A;  5HX9 A;  4E6X A;  3AGE A;  3O88 A;  4HIA A;  4WEL A;  3T1Q B;  1F98 A;  4JGQ A;  3AGD A;  2JC7 A;  4NEE D;  4HP4 A;  4F3L B;  4XT2 A;  2Y55 A;  1W8Y A;  2Y2H A;  1FCO A;  1K4F A;  2XD5 A;  3V5M A;  4S2I A;  3BQA A;  3BFG A;  4PM5 A;  1K0K A;  4BQM A;  3PHY A;  1SCW A;  4Q0I A;  2V1B A;  2EWW A;  1S67 L;  3IWI A;  2V8C A;  2LB5 A;  2Y2P A;  4WEJ A;  1E25 A;  1KVM A;  3A3J A;  2H0T A;  3VOL A;  4ESP A;  5FI2 A;  3I7J A;  2IWB A;  2ZC4 B;  1MKI A;  4HP9 A;  3MQO A;  2KOI A;  1ES3 A;  1XJ3 A;  2VGL S;  1XP4 A;  1MWU A;  2E8J A;  3Q1F A;  3ULF A;  1YSQ A;  2V20 A;  2HDR A;  2X02 A;  2VEA A;  1ERQ A;  1KDW A;  1N9B A;  2L4R A;  1IYP A;  5HFO A;  2XA7 S;  4O7D A;  5CXW A;  2MJ6 A;  3G35 A;  4JXS A;  4D2O A;  1W7F A;  3DWK A;  2EFX A;  4DE3 A;  4KQO A;  3UE0 A;  2WZZ A;  3QP5 A;  5CHU A;  5HAP A;  4I3A A;  4B88 A;  2EXB A;  1TDG A;  5TFQ A;  1NJ4 A;  5CHJ A;  1T1B A;  1YT4 A;  1N4O A;  1FSW A;  3UMD A;  3W4Q A;  3CHW P;  2IWC A;  1W79 A;  2HDS A;  3C4O A;  4NET A;  4UA7 A;  1GSV A;  3ZNT A;  2R78 A;  4LFU A;  3Q7V B;  2D01 A;  3T4Q A;  3EQU A;  4D60 A;  3CWF A;  4NKP A;  4OQI A;  4ARZ A;  4MN7 A;  2FH5 A;  1ZKJ A;  3BFF A;  2H10 A;  1NYM A;  1GSX A;  3BLM A;  2CC1 A;  4JXG A;  2H28 A;  5GHZ A;  3T12 B;  2B5R A;  5F5Y A;  3QP8 A;  4LGW A;  1TVF A;  1BZA A;  2E8I A;  1ZC2 A;  2P74 A;  5FAT A;  2ZJ9 A;  5HWT A;  4K0W A;  3S7N A;  3LO7 A;  3BFC A;  3T1R A;  5HL6 A;  4DE1 A;  2VKS A;  1S66 L;  4R1G A;  4HI4 A;  5FSR A;  5L10 A;  3PBR A;  1Q2P A;  4OLG A;  5I94 A;  4IVK A;  3HUO A;  2XA7 M;  3NOP C;  1YPR A;  3EEH A;  2PDR A;  1VM1 A;  2JE5 A;  2W3H A;  3Q7Z A;  3IF6 B;  1OJ5 A;  4ME4 A;  4YIN A;  4GS9 B;  3IHA A;  4S2L A;  4EER A;  5J4E A;  4N9K A;  4B9O A;  3S22 A;  3GSG A;  1DY6 A;  2W0N A;  4GZB A;  3N8S A;  1NY0 A;  4R3J A;  1F9I A;  2ZMF A;  3HLW A;  1RCJ A;  3BEC A;  2L0W A;  3F1O A;  2WYX A;  4U0T A;  4QHC A;  3MXQ A;  1ACF A;  3QP4 A;  2UV0 E;  4OKP A;  3NY4 A;  1KDS A;  4EQI A;  4HJ6 A;  4UHU A;  3G30 A;  2HP9 A;  5M19 A;  1J3W A;  2OOL A;  5CTN A;  4Y7P A;  4R0Q A;  4CLC C;  3Q81 A;  1WYC A;  4RYE A;  3D3O A;  4OQG A;  4X55 A;  4EXO A;  1MC0 A;  3FKW A;  4ZJ1 A;  5DTT A;  2FFY A;  3EEA A;  5GHY A;  3SH9 A;  2W3D A;  2ZQ7 A;  3MFX A;  4PKY G;  4CLC E;  4PHT A;  5TJJ A;  3A3F A;  4GW9 A;  3W4P A;  5E2G A;  1K57 A;  1N9L A;  2Y2Q A;  1OME A;  3PYP A;  3V50 A;  3TSG A;  2K31 A;  2Y91 A;  3CIT A;  5FEG A;  4R23 A;  2G7U A;  3CG5 A;  4JLF A;  1OT9 A;  2VGK A;  3RH8 B;  4CQH A;  1HLU P;  4WMC A;  3K2N A;  3QHY A;  2V2F F;  4WMC D;  2ZMA A;  3OC2 A;  4PM9 A;  1CQA A;  3MS6 A;  5JYP A;  3UDI A;  1RP5 A;  2XFS A;  3F1P A;  2VV7 A;  3IX8 A;  1PRQ A;  1V9Y A;  2ZC3 B;  5DTK A;  3T1X A;  4Q0J A;  1K54 A;  4OQ0 A;  1IYS A;  3DAV A;  3G6O A;  3PBO A;  5HDS A;  1IEM A;  5FA7 A;  3IS2 A;  3IWO A;  2WGV A;  1VEU A;  3VP1 A;  5J8X A;  1W63 M;  1ES5 A;  3LEQ A;  3M2J A;  1LL5 A;  2GJ3 A;  3MMH A;  3R7W B;  2JKF A;  5EFW A;  4EW7 A;  4GOG A;  4MBH A;  3CAX A;  4RX3 A;  2V1Z A;  2KX6 A;  1U60 A;  2YKH A;  4LRY C;  1ZG4 A;  5DJT A;  1KE4 A;  3WRZ A;  4KUK A;  3IXG A;  4OVD A;  3E2K A;  1MXO A;  4DE2 A;  3A0R A;  3LYX A;  4P85 A;  1DJB A;  4OOY A;  3F1N A;  1DJA A;  4DXC A;  3WRT A;  4BEN A;  2O9B A;  4KEN B;  1OT6 A;  2IWD A;  3TJZ C;  3E0Y A;  5EOO A;  1VET B;  3ZG9 B;  3N8L A;  4MBF A;  2VJW A;  4NXG A;  2PD7 A;  3UB5 P;  2Y2N A;  3VOY A;  1CJF A;  4QD4 A;  5EM1 A;  5DJU A;  5J3W A;  1YLJ A;  1YMS A;  2XF3 A;  3NOT C;  5F6A A;  3P7N A;  3VFF A;  3VOZ A;  4HJ3 A;  4ZDX A;  4IUK A;  2WGW A;  1YLZ A;  1HVB A;  3UB8 A;  3PBS A;  3KSG A;  3DTM A;  4CLC B;  1T18 A;  3C30 A;  5K5B A;  2Y2O A;  1GHP A;  5A90 A;  5CHM A;  5GLD A;  2ZD8 A;  4QPR A;  4DN0 A;  4EES A;  3ZG5 A;  1JVJ A;  5G4Y A;  1PWG A;  4R70 A;  2Q0O A;  4JGR A;  1TF1 A;  2XLN A;  3ZG7 B;  1TS6 A;  3LIA A;  3IH9 A;  1JTG A;  4ID4 A;  1PFL A;  4GJ4 A;  3T4O A;  2OV5 A;  2H5S A;  4MCW A;  2ZL1 B;  2QHK A;  1LT0 A;  3C7U A;  1TD5 A;  2EXA A;  4WBG A;  4Y17 A;  3GMW A;  1YMX A;  3Q7V A;  4AFI A;  2H0Y A;  3VV4 A;  3L7H A;  5AQB A;  1PZO A;  2W1T A;  4S2P A;  4S2N A;  5DFX A;  4WZ5 C;  1L0F A;  3VFH A;  3V3S A;  3S1Y A;  2OWJ A;  4OOL A;  4BL2 A;  3PBQ A;  4CJN A;  3SH8 A;  3OPR A;  4OP8 A;  1LLB A;  2P7J A;  1NXY A;  3UPO A;  1G6A A;  3CUE A;  3E98 A;  4R3B A;  3PBT A;  3IT9 A;  1AWI A;  1TS7 A;  3O86 A;  4B93 A;  1G6O A;  1GCE A;  4WYY A;  4KQQ A;  4LV3 A;  4IVI A;  4R38 A;  4EWF A;  1YLT A;  4Z1W A;  2P9V B;  5FQJ A;  3ZCZ A;  2FFF B;  1MWS A;  4KZ8 A;  4G3K A;  5EVI A;  3QNB A;  3KO6 A;  1K25 A;  4G3V A;  3H7W B;  5EVI D;  3B42 A;  4ZJ3 A;  1GA9 A;  3DBA A;  4FTX A;  2JHE A;  1ES4 A;  3WS5 A;  4BBV A;  3S7P A;  5TBM B;  5A91 A;  3LCE A;  1G68 A;  2O9A A;  4BBT A;  1VQQ A;  3ZHH A;  5GLC A;  4KQR A;  2WUQ A;  1TEM A;  3IF6 C;  4JKT A;  1L0E A;  2Z6C A;  3GR2 A;  3P98 A;  2L1M A;  1W63 Q;  4BL3 A;  4OPR A;  5CX7 A;  2J80 A;  3MBZ A;  4K08 A;  4Y3I A;  4GHI A;  1VHM A;  4EQ1 A;  5IT5 A;  5HD3 A;  4HH3 A;  3V67 A;  1EW0 A;  3R4K A;  5EM0 A;  2DMW A;  1P0Z A;  1AXB A;  2ZC6 B;  4WN5 A;  4Y2F A;  1G5U A;  1LSV A;  4CPK A;  5FDS A;  1BSG A;  1ERO A;  4FOF A;  4XUZ A;  3OPH A;  5L07 A;  2HGV A;  3C8C A;  3UY6 A;  1E4D A;  5F1F A;  2PYR A;  2WKH A;  2Y2M A;  1UWP X;  3G34 A;  2IA2 A;  4QY5 A;  3HL9 A;  3RFB A;  4FH4 A;  1CI8 A;  1BUL A;  1XA7 A;  4A5R A;  4OLD A;  3V3R A;  1JWP A;  4P6B A;  1CEF A;  5HW3 A;  5KZH A;  3T4T A;  3HRE A;  2HPB A;  1IYQ A;  2Z2M B;  4E04 A;  3WS2 A;  3MQ0 A;  4S2M A;  5A8B A;  1Y28 A;  4BMW A;  5CEB A;  3DTE A;  1KGE A;  1GHM A;  2OSU A;  1S4S A;  1K6R A;  3GQZ A;  5TR7 A;  3D9Y A;  3ZG8 B;  3ITA A;  3LEZ A;  3G2Z A;  3HLC A;  1NZU A;  3BWL A;  1K55 C;  4GKU A;  3RXX A;  5U47 A;  1ESU A;  2R9W A;  4WUJ A;  2PBY A;  3IX3 A;  4GD8 A;  4EBN A;  3LUQ A;  2XQZ A;  2M1C A;  3LI9 A;  2VV8 A;  4KG6 A;  3C7V A;  1OTI A;  3WWX A;  4NXE A;  4WLA A;  1NRJ A;  4B4Z A;  2W3E A;  3MQQ A;  4F94 A;  2EX6 A;  1FQG A;  5I5L A;  1GHI A;  1I5Q A;  2Z2L B;  1Y54 A;  3LY4 A;  1I2S A;  3W2Z A;  3UB9 A;  4HH2 A;  2ZQ8 A;  5GHX A;  1QME A;  2G2W A;  1ERM A;  4H8R A;  4QU3 A;  3DTK A;  3UPP A;  4LRZ E;  1N9O A;  4WZ4 A;  2WKP A;  4E3N A;  1O07 A;  3N4I A;  3ISG A;  3HLG A;  4O01 A;  2O0Y A;  4DKI A;  4S2O A;  2Y8H A;  2Y2L A;  2RL3 A;  4L0L A;  2PAV P;  5BOH A;  5EE8 A;  5CEC A;  2Z6D A;  5FQM A;  4ZBE A;  1FR6 A;  3OOV A;  4I38 A;  3T4L A;  3B33 A;  2B18 A;  2PT7 A;  1MWT A;  5AJG A;  3IQA A;  5F83 A;  2QJ7 A;  1MWR A;  3AGF A;  2ZMV A;  4KZ3 A; 
#chains in the Genus database with same CATH homology
 1S1Z A;  3T50 A;  3UE3 A;  1LL8 A;  4I3I A;  2P04 A;  4Q0J A;  4R6L A;  1WA9 A;  4MDZ A;  4EEU A;  3G6O A;  3PBO A;  4MN5 A;  5HDS A;  2FZ0 A;  2EA9 A;  3GEC A;  2VA0 A;  4HNB A;  3UE6 A;  1ZHH B;  2ZOH A;  3IBJ A;  3IS2 A;  1ODV A;  1NLY A;  1OPX A;  2W3G A;  3B47 A;  1P9R A;  4JGO A;  1OTA A;  2M7U A;  5HPF A;  1W63 M;  2EWV A;  2V9A A;  2JKT M;  1MKM A;  4EUV A;  5DKK A;  2A24 B;  5DKL A;  1V9Z A;  2GJ3 A;  3EWK A;  3MMH A;  3R7W B;  4EW7 A;  5EFW A;  3E4O A;  1S1Y A;  3CAX A;  3PBN A;  4CLC A;  5MC7 A;  3JVV A;  2KX6 A;  2PYP A;  2YKH A;  4LRY C;  5DJT A;  4CLC D;  3KSI A;  4KUK A;  1JNU A;  3D72 A;  3A0R A;  4I39 A;  5HDC A;  3LYX A;  3A0S A;  4JGP A;  2I9V A;  4EET B;  5HPI A;  5KSH A;  4H6J B;  4OOM A;  3F1N A;  3H82 B;  4O8G A;  3EOI A;  3UB7 A;  4XT2 B;  2JKR I;  2J3W A;  4BBU A;  2O9B A;  2VV6 A;  5C5K A;  1OT6 A;  4UEY A;  4LLO B;  4L9E A;  3TJZ C;  3CUE C;  2J3T C;  4BWI A;  3E0Y A;  2P08 A;  4G3W A;  3UB6 A;  3E4Q A;  1G28 A;  3FC7 A;  2VJW A;  1OTB A;  1UWN X;  2PD7 A;  4NXG A;  3HJK A;  3KX0 X;  3PR6 A;  3SW1 A;  2V0W A;  4ETZ A;  3NOU C;  2A24 A;  4KUO A;  2D02 A;  5DJU A;  3R7W A;  5J3W A;  2WKQ A;  3FPV A;  3NOT C;  3K3D A;  2JKR M;  4RQ9 A;  5F6A A;  3P7N A;  3U2A A;  4HJ4 A;  1KOU A;  4HHD A;  4HY8 A;  3ICY A;  4HJ3 A;  2W27 A;  2W1T B;  1H3Q A;  5HSQ A;  4IUK A;  3ZYT A;  1IFQ A;  4HIA A;  4WEL A;  4H6J A;  5LBR A;  3UB8 A;  1F98 A;  3PBS A;  3H82 A;  4JGQ A;  4WF0 A;  3KSG A;  4NEE D;  4CLC B;  1T18 A;  3CLO A;  4HP4 A;  3C30 A;  4F3L B;  5K5B A;  4XT2 A;  3PXP A;  2W1R A;  2LB9 A;  4YOF A;  3EQV A;  4QPR A;  4DN0 A;  4EES A;  3LID A;  5FL3 A;  2HF6 A;  2XRN A;  2NUP C;  2OAQ 1;  4NXB A;  5G4Y A;  2VGL M;  4Q0H A;  3BQA A;  1XJ6 A;  4R70 A;  1YAX A;  3PHY A;  4JGR A;  1DP8 A;  1TF1 A;  4Q0I A;  2V1B A;  1TS6 A;  2EWW A;  3LIA A;  1S67 L;  2LB5 A;  3MJQ A;  5AVE A;  4WEJ A;  4GJ4 A;  3E4P A;  3T4O A;  1H8M A;  4MCW A;  3VOL A;  2QHK A;  3MF0 A;  1LT0 A;  2PR6 A;  1TD5 A;  4HP9 A;  2HJE A;  1TS0 A;  1S4R A;  3MQO A;  2KOI A;  4AFI A;  3VV4 A;  2QKP A;  3S7O A;  1XJ3 A;  2VGL S;  2PHY A;  4WEK A;  2W1T A;  5L8M A;  2OWH A;  5DFX A;  4UQI S;  3ULF A;  1T1C A;  1YSQ A;  2OWJ A;  2ZBB A;  3IBR A;  4OOL A;  2K7S A;  2VEA A;  3H9W A;  3VE4 A;  1NWZ A;  4F3L A;  3PBQ A;  2L4R A;  4PKY A;  2P7J A;  4ARZ B;  3BY8 A;  2XA7 S;  2MJ6 A;  3CUE A;  3E98 A;  3PBT A;  4ZRR A;  2J3T D;  3C2W A;  3RTY A;  3T4K A;  3LIC A;  1TS7 A;  4B93 A;  2KDK A;  2VZW A;  1G6O A;  4KQO A;  3VE3 A;  1GSW A;  4GHI B;  4R38 A;  3KYQ A;  2BAS A;  2CMN A;  1TS8 A;  3BQ8 A;  3FPW A;  4I3A A;  4Z1W A;  1T1B A;  2VLG A;  3OCL A;  4L9F A;  4G3K A;  3JVU A;  2INW A;  3EGD C;  3KO6 A;  4NXF A;  3UMD A;  4G3V A;  1OJG A;  3H7W B;  2GNX A;  4HOI A;  3B42 A;  4L9G A;  3DBA A;  4LRX C;  2JHE A;  4O0P A;  2M7V A;  1P97 A;  4BBV A;  3S7P A;  5TBM B;  1XJ2 A;  1GSV A;  3KSF A;  3MR0 A;  1XFN A;  2R78 A;  2O9A A;  2PR5 A;  4BBT A;  1T19 A;  1T1A A;  2HV1 A;  3BW6 A;  2D01 A;  4ETX A;  2GZA A;  3T4Q A;  3LR4 A;  1X0O A;  2Y79 A;  3TRC A;  3T4S A;  3ZQ5 A;  3EQU A;  4GCZ A;  3CWF A;  3LIB A;  4I3J A;  4NKP A;  4II7 A;  1ZTU A;  4ARZ A;  4MN7 A;  4YNR A;  2FH5 A;  2Z6C A;  3LR3 A;  3CI6 A;  1XJ4 A;  3NHQ A;  2L1M A;  4MMN A;  1W63 Q;  1GSX A;  4M4X A;  5CX7 A;  2J80 A;  2H28 A;  5G4Z A;  4K08 A;  5HZH A;  4PAU A;  4Y3I A;  5F5Y A;  3HJI A;  4GHI A;  1VHM A;  4EQ1 A;  5IT5 A;  3LR0 A;  4EEP A;  4YWZ A;  5HD3 A;  4HH3 A;  3C38 A;  3LR5 A;  3V67 A;  1EW0 A;  1YSP A;  3R4K A;  4Y5F A;  3F1O B;  2OAP 1;  4P6Z S;  5KIZ A;  2DMW A;  1P0Z A;  4WL9 A;  5HWT A;  4HQA A;  3S7N A;  4UQI M;  4WN5 A;  3H7W A;  5HL6 A;  2QJ5 A;  4IUH A;  4Y2F A;  5J7E A;  2VKS A;  3TE8 A;  1S66 L;  4HI4 A;  1LSV A;  2HJ9 C;  4FOF A;  5TBM A;  3PBR A;  2HGV A;  5F68 A;  2JKT I;  3C8C A;  3LI8 A;  2PYR A;  5DF9 A;  1OTE A;  1UWP X;  2XA7 M;  2YKF A;  3NOP C;  3OCN A;  3EEH A;  2IA2 A;  2PDR A;  2W3H A;  3RFB A;  3FG8 A;  2XSS A;  1OJ5 A;  4ME4 A;  5IU1 A;  4GS9 B;  4EER A;  5J4E A;  1N9N A;  4B9O A;  4EU0 A;  3A0V A;  1D06 A;  2W0N A;  2ZOI A;  2W3F A;  2PD8 A;  3KSH A;  2QYB A;  2NUT C;  4DMZ A;  3T4T A;  1F9I A;  2ZMF A;  4E04 A;  4KQD A;  2GX5 A;  2QWS A;  3MQ0 A;  4IHQ A;  5A8B A;  1Y28 A;  3OLO A;  4BMW A;  2L0W A;  3F1O A;  3O5Y A;  1UGU A;  3MXQ A;  5HWW A;  4R3A A;  3T4J A;  2WKR A;  1S4S A;  1OTD A;  2KLI A;  4BJP A;  3OBF A;  4LPZ A;  1BYW A;  1F5M A;  3BJN A;  4HJ6 A;  5HDD A;  3BWL A;  2OOL A;  4WUJ A;  3LUQ A;  4CLC C;  1D7E A;  5HD5 A;  3UME A;  3D3O A;  2M1C A;  1STZ A;  3LI9 A;  2VV8 A;  4EXO A;  1MC0 A;  3EEA A;  2K2N A;  1OTI A;  4NXE A;  4WLA A;  1NRJ A;  2W3E A;  3EGX C;  3MQQ A;  4GS9 A;  5I5L A;  2W3D A;  4DJ2 A;  1DP9 A;  1YKD A;  3F1P B;  3W2Z A;  3UB9 A;  3S7Q A;  2VX8 A;  3MFX A;  4FSF A;  4PKY G;  4PHT A;  5TJJ A;  4CLC E;  5IS1 A;  3GDI A;  5AVF A;  4P6Z M;  4GLQ A;  1LSW A;  1NLZ A;  3HCY A;  3P01 A;  4GW9 A;  3LIE A;  4HH2 A;  1N9L A;  2O9C A;  4LRZ E;  2XRO A;  1N9O A;  4I5S A;  2WKP A;  3IS2 B;  3PYP A;  3K3C A;  2K31 A;  1XFQ A;  3NJA A;  4O01 A;  2O0Y A;  3CIT A;  1IOU A;  2Y8H A;  1P9W A;  4L0L A;  2G7U A;  2V1A A;  3LFV A;  2V0U A;  4IJG A;  1OT9 A;  1VB6 A;  3RH8 B;  1DRM A;  2A2L A;  5HWV A;  5F69 A;  2O99 A;  2JN7 A;  2Z6D A;  4CQH A;  3LIF A;  2B02 A;  1MZU A;  3K2N A;  5DFY A;  1DP6 A;  4DJ3 A;  3OOV A;  4I38 A;  3T4L A;  3BY9 A;  3B33 A;  2B18 A;  2PT7 A;  3TW8 A;  3OC2 A;  1LSX A;  5AJG A;  2QJ7 A;  4MN6 A;  3F1N B;  3KYZ A;  3F1P A;  2VV7 A;  1V9Y A;  2ZMV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...