1F9IA

Crystal structure of the photoactive yellow protein mutant y42f
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
125
structure length
125
Chain Sequence
MEHVAFGSEDIENTLAKMDDGQLDGLAFGAIQLDGDGNILQFNAAEGDITGRDPKQVIGKNFFKDVAPCTDSPEFYGKFKEGVASGNLNTMFEYTFDYQMTPTKVKVHMKKALSGDSYWVFVKRV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PHOTOACTIVE YELLOW PROTEIN
publication title Coupling of hydrogen bonding to chromophore conformation and function in photoactive yellow protein.
pubmed doi rcsb
source organism Halorhodospira halophila
molecule tags Signaling protein
total genus 35
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2000-07-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00989 PAS PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 1f9iA00
4HH3A 4EXOA 4I3IA 2JHEA 2W0NA 3LI9A 4F3LB 1TS8A 5TBMB 3NOPC 2W27A 3UMDA 4HH2A 2KX6A 1T1BA 1N9NA 4HJ3A 2QWSA 2OOLA 4DJ2A 1OTAA 3E4QA 3VOLA 4MN5A 3BWLA 3CWFA 1XJ6A 1D7EA 4R6LA 4R38A 4GS9B 4NXGA 1BYWA 2GJ3A 4KUKA 3B33A 3LICA 1JNUA 4EERA 5F6AA 1DP9A 4RQ9A 2P7JA 3H82A 2QJ5A 4XT2B 4MN6A 2L4RA 4NXBA 1T18A 2I9VA 1DP8A 3BY8A 1T1CA 1UWPX 2VV8A 3GECA 4HP9A 1OT9A 2V0WA 4L9EA 4EEUA 2M1CA 2Z6DA 2BASA 1DRMA 1OTEA 5A8BA 1XJ3A 2YKFA 1N9LA 3F1NA 4I3JA 2INWA 1S1YA 2QKPA 3UE6A 3IS2A 5IS1A 3PYPA 2QHKA 1XFQA 4BBVA 1TS6A 3MR0A 1TS7A 1OJ5A 2QJ7A 2OWHA 3HJIA 1T19A 4WF0A 3PHYA 4HOIA 4M4XA 1UGUA 2PD7A 2PYRA 3HJKA 1V9YA 3A0RA 1D06A 3LIDA 1OJGA 4WUJA 4HP4A 4JGQA 5HSQA 4EQ1A 3LUQA 4JGRA 3F1OA 3MQOA 1LSXA 3ICYA 5AVEA 1LSVA 2Z6CA 2R78A 2ZOHA 3LIAA 3UMEA 4NXEA 1TS0A 2EA9A 3CLOA 3F1PA 3G6OA 4L9GA 4LRZE 4BBTA 2PHYA 4BBUA 2A24A 1N9OA 5J4EA 5HZHA 5F5YA 3H9WA 4KQDA 4GHIB 3LYXA 4DJ3A 2HV1A 2PR6A 4YWZA 5HD3A 4JGPA 1OTBA 4H6JA 3H7WA 5IU1A 3UB9A 1XJ2A 3MFXA 3E4PA 2PR5A 1F98A 2J80A 4R3AA 5HDSA 3P7NA 3UB8A 1WA9A 2VV6A 4LRYC 5HDDA 2WKRA 3F1NB 3NOUC 1S66L 4HIAA 3IS2B 4EEPA 3D72A 1S4RA 2D02A 1UWNX 2JN7A 3VE3A 3T50A 2D01A 3FG8A 4GCZA 2L1MA 3C2WA 5HWWA 3OLOA 3LIFA 3LIBA 1NWZA 1OT6A 3LIEA 1G28A 3IBRA 1P97A 4HNBA 1V9ZA 2PYPA 3NHQA 1VB6A 3ULFA 5DKKA 4R70A 1DP6A 5F68A 1KOUA 2WKQA 5EFWA 4WLAA 5HWVA 4EETB 2PD8A 1X0OA 3MXQA 3F1PB 3NJAA 2H28A 2V1AA 5DJUA 3K3DA 4LLOB 2A24B 1S4SA 3GDIA 4HI4A 4E04A 1GSWA 2VLGA 4I5SA 1F9IA 1XFNA 4HHDA 4L9FA 4H6JB 2YKHA 5HD5A 2ZBBA 3E4OA 4KUOA 4B9OA 4GW9A 4HQAA 5J7EA 4JGOA 3MQQA 3A0VA 3UB7A 3H82B 5I5LA 2L0WA 4I38A 3RH8B 4NXFA 5J3WA 3CAXA 2K7SA 5DKLA 3NOTC 2V0UA 4F3LA 5TBMA 4HJ4A 3EWKA 5F69A 4I39A 5G4YA 1LL8A 1S1ZA 1LT0A 4LRXC 3RTYA 2CMNA 4I3AA 3UB6A 4GHIA 2ZOIA 3KX0X 5AVFA 5DJTA 1OTDA 2OWJA 4PKYG 5KIZA 3K3CA 2WKPA 1XJ4A 4K08A 4WN5A 4EESA 4GS9A 4HY8A 2B02A 5HWTA 1P0ZA 2V9AA 2KDKA 3A0SA 3EEHA 4WL9A 3ZQ5A 4XT2A 3VE4A 3BY9A 3F1OB 3SW1A 1GSVA 2PDRA 3MJQA 2V1BA 3C8CA 5G4ZA 5HDCA 4LPZA 1MZUA 1Y28A 1T1AA 3LI8A 1EW0A 2VEAA 1LSWA 1ODVA 2VV7A 3H7WB 1S67L 4HJ6A 4EW7A 3FC7A 1GSXA 4PKYA 1OTIA
chains in the Genus database with same CATH superfamily
4EXOA 4I3IA 4ZTKA 3LI9A 4DE0A 1PIOA 2JE5A 5TBMB 2Q9NA 3NOPC 4A5RA 4NKPA 3UPOA 1VEUB 3Q7ZA 3MSHA 1G6AA 3UY6A 4UAAA 1N9NA 2Y8HA 1YLTA 2QWSA 3ZCZA 2OOLA 4DJ2A 1YLYA 1EWZA 1H3QA 4WZ4A 3EQUA 4JBFA 1K4FA 4CQHA 4MCWA 3TOIA 3E4QA 2IWBA 4MN5A 3BWLA 1XJ6A 4DE3A 4R38A 4M3KA 3ZG8B 4ZRRA 1VETB 2GJ3A 3T4TA 3V3RA 3FWLA 5FAPA 1PWDA 4KZAA 3VOYA 5GLBA 5IHVA 1DP9A 5L8MA 5TFQA 3H82A 1CF0A 3NY4A 2OLUA 2KOIA 4PHTA 2I9VA 5AQ7A 2XLNA 3BY8A 3C4PA 1T1CA 4QY6A 4L9EA 3KSFA 1SKOA 4N1XA 2EXAA 3MZDA 2M1CA 4F94A 1FILA 4ESPA 1YLPA 1F5MA 3BFDA 1ES5A 1MKMA 5A8BA 1XJ3A 3VP3A 2J9PA 3VFHA 4KQRA 5EM1A 4I3JA 3ZDJA 3MMHA 2QKPA 3IX8A 5FQKA 2EXBA 2HGVA 2QHKA 2VGKA 4UA9A 1TEMA 2XF3A 5F1GA 2Y2GA 3SS5A 2OWHA 2ZQ7A 2KLIA 2XA7M 3WRTA 5FASA 4ZJ1A 1Y54A 1LLBA 3CJMA 3HJKA 3R7WA 4DE1A 3A0RA 1D06A 4BLMA 1OJGA 2Y79A 4JGQA 4OLGA 5HSQA 4EQ1A 4JGRA 3MQOA 5HL1A 1XXMA 3PAEA 1P9WA 1KE3A 3ICYA 1DY6A 4DXBA 3AGDA 4LV3A 3PBQA 3AGFA 3UMEA 4Y0OA 4S2KA 5CEBA 3P09A 4S2JA 5FL3A 4BBTA 2PHYA 4BBUA 1MPLA 2Y4AA 5J4EA 4U0XA 4GHIB 3LYXA 2M7VA 3DTMA 1OTBA 5EVID 4H6JA 3BYDA 1TD5A 3VP0A 2ZQ8A 2M7UA 2P08A 4OPYA 2V20A 3DTEA 3CG5A 5FQMA 4R3AA 5GLDA 5CRFA 1WA9A 3C5AA 1YPRA 2VV6A 2XD5A 3G2ZA 2JKGA 2OLVA 1VQQA 4YOFA 1HLUP 5FEGA 4GJ4A 3EEAA 1LI9A 4UEYA 1KGGA 3GR2A 3T50A 4X55A 1SDEA 4K0WA 2ACGA 4Y0UA 3LIEA 5F83A 4O01A 3T4KA 1ZTUA 3BLMA 4HNBA 3UE0A 2PYPA 1ONHA 1ES2A 4JLFA 2EWVA 3SH9A 1DP6A 1H8YA 2XSSA 3CHWP 2LB5A 1E3UD 4X69A 3OOVA 5IT5A 4RA7A 4IUHA 3N6IA 4S2OA 2ZJ9A 1Y4OA 3NJAA 2W1RA 1LHYA 4RX3A 2Y2JA 3PTEA 5CERA 2J3WA 4WYYA 3K3DA 4LLOB 2A24B 3UE3A 1KE0A 1NYMA 4HI4A 3MKFA 3P01A 4RYEA 2VLGA 4I5SA 4QY5A 3JVVA 4Q0JA 4MBFA 2JCHA 5HL6A 1E4DA 1FCOA 3S1YA 4KUOA 4JGOA 3NIAA 4LENA 3FYZA 1RGZA 3ZG9B 3H82B 3FKWA 2GZAA 2ZQDA 3D3OA 3IHBA 1CQAA 2BG1A 2EX2A 1KVLA 4NEED 5J3WA 3CAXA 5HARA 5DKLA 1SKOB 2V0UA 1QMFA 4E3LA 1ES3A 5TBMA 3D4FA 2Y91A 3CMZA 1VEUA 3BQ8A 3EWKA 5F69A 4I39A 4R4RA 1KVMA 3NECA 2WUQA 4LRXC 2EFXA 3TSGA 2EWWA 4WEJA 3DWZA 2C5WB 1YMXA 5DJTA 2PU4A 4P6ZS 2H0YA 3O3VA 2Q0OA 4EBNA 1L0EA 2VX8A 3QP8A 3TE8A 3BFEA 5M18A 2B02A 3T4JA 1VETA 5HWTA 3EOIA 3MS6A 4OPRA 3L9KA 1K54A 1SHVA 2KDKA 2B95A 3MZEA 2QPNA 3R7WB 4HBTA 3ZQ5A 5KMWA 3NI9A 2FFFB 1EI5A 1G6OA 1J9MA 5TJJA 5FQQA 5EOOA 3S7QA 4UQIM 1STZA 3MKEA 4B93A 2PDRA 5EVLA 2Y2QA 2Y2IA 3CZDA 1JWVA 3OZHA 1K56D 3HLEA 3CUEC 4CLCC 1JWPA 3NCKA 3E0YA 3LR3A 4E3JA 1NY0A 2Y2MA 4LPZA 3SS3A 2W3GA 2XFTA 4EV4A 2WADA 2G2WA 1LSWA 5FI2A 2VV7A 1BZAA 3KSIA 1S67L 2WK0A 4EW7A 3T12B 1BSGA 3P98A 3OCNA 1GHIA 3KSHA 1GSXA 1KDSA 2JC7A 4EBPA 4LGWA 1P9RA 3FKVA 1TS8A 3RXWA 2PT7A 3WS2A 2W27A 3LFVA 4WMCA 4OQHA 2KX6A 2HDQA 4IUKA 1IYOA 4CLCA 1HVBA 4OOYA 3HLDA 5FEFA 5GHZA 1O07A 4WZ5A 1DJCA 3CWFA 3V50A 1I5QA 3GRJA 5CGSA 2VZWA 2Y2PA 4XXRA 4GS9B 4NXGA 1K55A 4BL2A 3ZHHA 4KUKA 4ID4A 3UDXA 1PFLA 1JNUA 4EERA 5F6AA 3S22A 1DJBA 4E3IA 3UPPA 4NXBA 2CC1A 3IH9A 1D1JA 1T18A 1CEGA 4Y17A 1DP8A 2VV8A 4OOMA 3GECA 3QNBA 1OT9A 4WBGA 3ZVTA 2V0WA 4EEUA 2EX9A 4OPZA 1RCJA 2Z6DA 1OPXA 2BASA 1W7FA 3WRZA 5CX7A 3UPNA 4B4XA 2XRNA 1S1YA 1W63Q 3S4XA 4QJGA 4WEKA 3IXBA 3OBFA 5AJGA 5E2EA 1L0FA 1TS7A 5E43A 4DE2A 4LV0A 2XK1A 5FQIA 2DNSA 5GLAA 3G2YA 1K6RA 3PHYA 4Y2FA 4HOIA 2PD7A 2WKHA 3C7UA 3PXPA 3ZG5A 1ZG6A 4WUJA 2BTFP 3G35A 1ES4A 4PM9A 3BFFA 3HLBA 1LSVA 1IELA 2RCXA 3HLWA 2Q9MA 1FCNA 4L9GA 4QHCA 2A24A 5HZHA 2B18A 1ZC2A 1S0WA 3IF5A 1KDWA 4ARZB 2HV1A 2PR6A 4OOLA 4YWZA 4UHUA 3LO7A 3JYIA 3H7WA 1IKIA 1SKFA 3IWOA 4QB8A 1YMSA 3SS4A 5EVIC 3WS4A 2FZ0A 3E4PA 2BLSA 2G7UA 2VGLM 1ONGA 3MBZA 4S2LA 5EOEA 4GD6A 5G18A 1YSQA 1PWCA 5HDDA 4Q8IA 3F1NB 3NOUC 2H5SA 1S66L 3DTKA 4NG2A 1K57C 3IS2B 2P04A 5FATA 4EEPA 4G3WA 3OC2A 3R4KA 1UWNX 2JN7A 3O86A 1W8YA 3DWKA 4EUZA 2IA2A 3T1QB 2D01A 3FG8A 2LB9A 5HWWA 4OP5A 2K31A 3HLFA 2VGJA 2WYXA 3VSLA 4BENA 4DKIA 3BFCA 1HZOA 3LEQA 3IBRA 3NC8A 1V9ZA 1CK3A 2OAQ1 1VB6A 4R70A 3V3SA 4E3OA 2R9XA 5F68A 1KOUA 4E3NA 3SH8A 5EFWA 2XA7S 4L0LA 1FR6A 3C4OA 3A3IA 1CI8A 2NUTC 3A3DA 3UO9A 1Q2QA 3WWXA 4WLAA 3LR5A 4EETB 2PD8A 4FD8A 3F1PB 4O0PA 1PI5A 4EUVA 1TVFA 5GHYA 1JVJA 5DTKA 3I7JA 3TG9A 4CLCB 3V67A 2JKFA 2PBYA 1GSWA 4IVIA 1XFNA 4HHDA 5CHMA 1ERMA 1BUEA 5L10A 5HD5A 3E4OA 2IWDA 4B9OA 4OQIA 4D60A 4GW9A 4HQAA 5J7EA 3LY4A 1RGYA 4IJGA 3A0VA 2Z2LB 2O99A 2HP5A 5FI7A 4WELA 1SZVA 3DAVA 5KSHA 1ALQA 1FSWA 3RH8B 4KG5A 5DF8A 2K7SA 3TW8A 3GMWA 4UA7A 5L07A 1BLHA 3G34A 4LCMA 4K91A 1G68A 4R23A 3BEBA 2OAP1 2JKRI 4BD1A 3UB6A 4R0QA 3KSGA 3KX0X 4IHQA 2K2NA 4S2MA 1OTDA 2OWJA 4PKYG 1PNEA 1XA7A 2OSUA 5HPFA 2J8YA 4IBXA 1XX2A 4S2NC 4K08A 3HUOA 4GS9A 4HY8A 5DTTA 3WS0A 1P0ZA 4ETZA 2DMWA 2W3HA 3BECA 3A0SA 3EEHA 3VE4A 2XDMA 4QPRA 2XR0A 4KZ3A 3T4QA 3S7PA 3B3XA 4OPQA 5EUAA 2ZM2A 2V1BA 1H8ZA 3PAGA 3Q7VB 1BULA 2XEPA 1PW8A 5A91A 1ESIA 3A3FA 2HP6A 4BWIA 2PBDP 4ETXA 4Z1WA 1EW0A 1O7EA 1XKZA 5GHXA 3H7WB 4NETA 2X71A 4HEFA 2V2FF 3HLGA 3FC7A 2ZMAA 4JXGA 2J3TD 3M6BA 3ZFZA 4ZBEA 3KO6A 2XGNA 2JHEA 4K0XA 2ZL1B 4F3LB 4Q0IA 1NRFA 4KZ4A 5EV0A 3HREA 4OQ0A 1VHMA 1MWTA 1T1BA 4H8RA 3EQVA 4X68A 3PR6A 3T1RA 3IXHA 2AVXA 4QU3A 3BRMA 4MLLA 2IWCA 4JXWA 4GLQA 1MXOA 2WKIA 1BYWA 4OP8A 2O9AA 3B33A 5J8XA 1Z09A 3LICA 5CEDA 4UA6A 3UNWA 2W1TB 1KGFA 1GA0A 4RQ9A 5EVIB 2XROA 4ARZA 4FTXA 2QJ5A 4XT2B 2C6WB 3L7HA 3Q82A 1H0MA 3TJZC 3C30A 4R3BA 1GCEA 5CECA 3GSGA 5CHJA 4XUXA 3IXDA 2JKTI 4KG2A 4LV2A 4UQIS 1IEMA 2J9OA 1DRMA 1OTEA 1W5DA 2HDRA 2W3EA 3F1NA 2INWA 3IS2A 2A2LA 3UE6A 2Y2OA 4C3QA 3KYZA 4O7DA 5HPIA 1YKDA 3SH7A 5M19A 3PYPA 3DBAA 1XFQA 3JPUA 4N9LA 3MR0A 4KQQA 2QJ7A 1N4OA 3C7VA 1ZHHB 3HJIA 1ACFA 3QP2A 1RP5A 4GKUA 2Y55A 2GNXA 3QP5A 2HJ9C 2OV5A 2VJWA 4M4XA 4XUZA 2PYRA 4YFMA 1TDGA 4LFUA 3LIDA 3E98A 5FSRA 4HP4A 5EECA 5C5KA 3LUQA 2FFYA 1IYSA 3F1OA 3IF6C 3JVUA 1LSXA 5AVEA 5LBRA 2ZLYA 2JKRM 1H8MA 3G30A 4NXEA 4KZ9A 2HJEA 3WS1A 4R4SA 2EA9A 3F1PA 3UDFA 1FCMA 1IKGA 3ZG0A 5F1FA 4LRZE 1L3LA 4YNRA 5GL9A 1W63M 1N9OA 5AQAA 3B42A 1YQSA 3H9WA 4D2OA 4KQDA 3RXXA 3CUEA 1BLSA 2E8IA 4Y13A 3ZGAB 2ZC7A 4LV1A 3OPHA 2QZ6A 5IU1A 1ESUA 4G3VA 2ZQAA 1XJ2A 4DMZA 4DDYA 4PMAA 2ZC5B 1WYBA 1K0KA 5TGFA 2PR5A 1F98A 3MXRA 4ZJ3A 5HDSA 3T4OA 2WGVA 3IWQA 3P7NA 3UB8A 2WGIA 4P85A 4ME4A 2WKRA 1IFQA 4HIAA 3QP6A 2FH5A 3WS5A 1S4RA 4S2IA 3LY3A 3VE3A 4DXCA 3IH8A 2W3FA 4GDNA 4E3MA 4X6TA 5FQJA 3GVBA 5U47A 1IOUA 2L1MA 4BQMA 2R9WA 3OLOA 2WZZA 3T4LA 2EFUA 4JF6A 3LIBA 4MN7A 1K4EA 1G28A 4JKTA 1F2KA 4EBLA 1S6RA 3BW6A 2ZC4B 4KZ5A 4GD8A 3NHQA 3UN7A 4FOFA 2E8JA 4HESA 3ULFA 1I2SA 1KE4A 2PAVP 5EVEA 1G5UA 2DCFA 3K2NA 5CGXA 1NZOA 2O9CA 4C75A 3M2JA 5L09A 1JWZA 5CGWA 4R3JA 2ZD8A 4CLCD 3ZNYA 3UDIA 5HWVA 1LL5A 1OMEA 4U3TA 5CXWA 1NYYA 2H28A 2V1AA 3S7OA 1ZG4A 1S4SA 3T4SA 1JTDA 4E3KA 1XA1A 3PBRA 1PZOA 4Y5FA 5CTMA 2Y2HA 4L9FA 4ZDXA 1EROA 3Q07A 3Q7VA 3SOIA 5E2GA 2YKHA 5D3OA 1SCWA 3HBRA 1PYYA 4N92A 4QD4A 3M6HA 3HCYA 3TRCA 4PM5A 3QP4A 3MQQA 3V39A 3G4PA 3LGOA 5HX9A 2GDNA 5AQ9A 2P9VA 1YLWA 2JKTM 5FDSA 5FDHA 2L0WA 5DF7A 3PBTA 4I38A 3DTIA 3U4LP 2VGLS 1U60A 2A49A 4CLCE 2WGWB 1L0GA 3EGDC 1WE4A 2G2UA 2ZL1A 4F3LA 3QHYA 1YLZA 1NLZA 3CPTB 4FUWA 1FOFA 3SZTA 4MBKA 3LEZA 4P87A 4PM8A 1LT0A 5FI6A 3RTYA 2CMNA 1PI4A 3KYEA 4ZJ2A 2ZC6B 5JYOA 2GX5A 3CI6A 5E2HA 2ZMFA 2ZOIA 5AVFA 4II7A 3FV7A 3ITBA 5KIZA 3K3CA 2WKPA 3PBNA 3CITA 4MBHA 1ERQA 1PW1A 4WN5A 1MWSA 4EESA 5L2FA 4OLDA 1L0DA 3A3JA 3MXSA 2V9AA 5HAIA 2PU2A 1GHMA 3BQAA 3GQZA 2W1TA 1TDLA 2HPBA 5EVIA 3ZNTA 4WL9A 4XT2A 2ZMVA 4KZ7A 5MC7A 3BY9A 3F1OB 4GDBA 3IBJA 5A90A 1GSVA 2QYBA 4MMNA 4KZ8A 5FA7A 4C6YA 5DFXA 4X1MA 2VA0A 2J7VA 2X02A 3V5MA 3O88A 1FIKA 2Y2LA 4CPKA 1K57A 1BTLA 1Z6FA 3HVFA 3EGXC 4GOGA 4OKPA 5HAQA 3BLSA 4DN0A 1Y28A 3Q81A 5FQ9A 1T1AA 3LI8A 3NDGA 2VEAA 1HD8A 3W2ZA 4AFIA 1OTIA 1A0KA 3E2LA 4HH3A 2J3TC 2W0NA 4BJPA 1C3BA 3IF6B 1AWIA 4N9KA 3ZG7B 1GA9A 4FSFA 4WM9A 3UMDA 4HH2A 5EE8A 1E3UA 2X01A 3O5YA 4HJ3A 3T1SA 1CJFA 4JF5A 4Z9QA 4FH4A 2A3UA 1OTAA 2NUPC 1ZKJA 3D9YA 2MJ6A 3VOLA 1K6SA 1J3WA 4RVAA 2H0TA 3BFGA 1D7EA 4R6LA 2EX8A 4OQGA 5TR7A 3ZYTA 5CHUA 3MFDA 3MQ0A 3OPPA 5F82A 1SDNA 1NXYA 3QP1A 3IT9A 2JBFA 4DDSA 3IXGA 2HDUA 2P7JA 2Y59A 4MN6A 2L4RA 4Y0TA 5DTSA 3UE1A 2WAEA 3VSKA 2ZC3B 5DFYA 1UWPX 5I94A 4HP9A 4RX2A 3E2KA 5BOHA 5DF9A 4YINA 1XGJA 1W79A 2HP9A 1IYPA 1PWGA 1FQGA 1TF1A 1E25A 2YKFA 1N9LA 4O8GA 3HUMA 4E6XA 3N4IA 5IS1A 3PBOA 2I72A 5DVAA 4BBVA 1TS6A 3G31A 1LI0A 4X1LA 1OJ5A 4KG6A 1BT5A 1T19A 4WF0A 1VM1A 2XH9A 1NLYA 5EM0A 2XFSA 2P9VB 3U2AA 4S2NA 1UGUA 4P6BA 1V9YA 3MZFA 3RJUA 4MNRA 3W4OA 2ZM0A 2ZQCA 1IYQA 2RL3A 4B4ZA 1QMEA 2WKEA 2Z6CA 2R78A 1I2WA 2ZOHA 3LIAA 2Y2NA 4EU0A 1TS0A 4B88A 3W4PA 3CLOA 4OH0A 1XGIA 3G6OA 4MDZA 1MWUA 4NK3A 3VP2A 2HZ5A 3FPWA 5CTNA 3W4QA 4Y15A 2V8FA 5F5YA 4PAUA 1NJ4A 1W8QA 3LCEA 4PPRA 4DJ3A 3OPRA 2ZM8A 4GNUA 1K56A 5HD3A 4JGPA 1K54C 4IEDA 3B47A 4LCLA 3UB9A 1PZPA 1AXBA 3MFXA 1BLPA 1JTGA 3HUNA 1MY8A 3FPVA 2VK3A 2J80A 3UB5P 2H10A 3BJNA 4GB7A 3MF0A 4LRYC 3IX3A 3G32A 4IBRA 3VP4A 5JYPA 2HF6A 3D72A 5M1AA 2D02A 1MKIA 2WGWA 4GCZA 3C2WA 3VFFA 3ISGA 3ZVWA 3LIFA 2O0YA 3CPTA 4PM7A 1NWZA 1OT6A 4P6ZM 1L2SA 4DRTA 4KZ6A 2UWXA 1P97A 4EQIA 5DKKA 3NDEA 4JF4A 3N8RA 4U0TA 1YAXA 3T1XA 1KGEA 4PM6A 2WKQA 4KQOA 4JXVA 4G3KA 4GZBA 2XD1A 4JXSA 5GLCA 3GV9A 1X0OA 3MXQA 2B5RA 4Y3IA 1MC0A 4Y7PA 5DJUA 1M40A 1MWRA 1BLCA 4WZ5C 4X25A 4FH2A 5K5BA 3GDIA 3RFBA 4E04A 3OPLA 1XP4A 2WZXA 3A3EA 4DF6A 1K55C 1F9IA 5FAOA 4GN2A 1YM1A 5HAPA 1N9BA 4H6JB 2ZBBA 4BMWA 1NZUA 4BL3A 2WAFA 1WYCA 4OVDA 3BM6A 3UB7A 5I5LA 1HTZA 2XQZA 3FZCA 1MBLA 1H5XA 5KSCA 4ZAMA 2QMIA 2V8CA 4S2PA 4FCFA 3Q1FA 3VV4A 3W8KA 4KZBA 1Q2PA 4NXFA 3HL9A 2VKSA 1CEFA 3NOTC 1K38A 3IF6A 1M6KA 1YLJA 2PRFA 4HJ4A 4R1GA 5E2FA 5A92A 3IWIA 4HBUA 3S7NA 2EX6A 4Q0HA 5G4YA 1LL8A 3LR4A 1S1ZA 3LR0A 4QWOA 4I3AA 5EPHA 1GHPA 4GHIA 4MEZA 3O87A 2P74A 4E6WA 3N7WA 1XJ4A 3PBSA 3OCLA 5KZHA 2HDSA 4BD0A 3VP1A 5AQBA 2DRWA 3AGEA 1DJAA 3QNCA 1FSYA 5HFOA 1LL9A 3IX4A 1FR1A 4WMCD 3IQAA 1YSPA 3M2KA 3VMAA 3SW1A 2ZQ9A 4X53A 4IVKA 3N8LA 2V1ZA 3C38A 4N1HA 3MJQA 1XPBA 1CI9A 3ITAA 5HW3A 3KYQA 1K25A 3C8CA 5A93A 3NBLA 5G4ZA 2UV0E 5HDCA 1PRQA 5FAQA 2Y2KA 4KENB 1YT4A 3GTCA 4JPMA 4P0MA 4OONA 1MZUA 3VOZA 3IHAA 4CJNA 1ODVA 4X56A 3HLCA 1NRJA 3DW0A 2W3DA 3N8SA 4HJ6A 2O9BA 4EWFA 2Z2MB 3NULA 4PKYA
chains in the Genus database with same CATH topology
3KO6A 4HH3A 4EXOA 4I3IA 2JHEA 2J3TC 2W0NA 4BJPA 3LI9A 1P9RA 4F3LB 4Q0IA 1TS8A 5TBMB 2PT7A 3NOPC 4NKPA 2W27A 3LFVA 4FSFA 1VHMA 3UMDA 4HH2A 2KX6A 4IUKA 1T1BA 1N9NA 2Y8HA 3O5YA 4HJ3A 2QWSA 2OOLA 4DJ2A 1H3QA 4CLCA 3EQUA 3EQVA 3PR6A 1OTAA 4CQHA 2NUPC 4MCWA 3E4QA 2MJ6A 3VOLA 4MN5A 3BWLA 3CWFA 1XJ6A 1D7EA 4R6LA 4R38A 4GLQA 2VZWA 3ZYTA 4GS9B 4ZRRA 4NXGA 1BYWA 3MQ0A 2GJ3A 4KUKA 3T4TA 2O9AA 3B33A 3LICA 1JNUA 4EERA 5F6AA 1DP9A 5L8MA 2W1TB 4RQ9A 2XROA 2P7JA 4ARZA 3H82A 2QJ5A 4XT2B 4MN6A 2L4RA 4NXBA 2KOIA 4PHTA 1T18A 2I9VA 1DP8A 3TJZC 3C30A 5DFYA 3BY8A 1T1CA 1UWPX 2VV8A 4OOMA 3GECA 4HP9A 1OT9A 2V0WA 2JKTI 4L9EA 5DF9A 3KSFA 4EEUA 2M1CA 4UQIS 2Z6DA 1OPXA 1F5MA 2BASA 1DRMA 1OTEA 1MKMA 5A8BA 1XJ3A 5CX7A 1TF1A 2W3EA 2YKFA 1N9LA 3F1NA 4I3JA 4O8GA 3MMHA 2XRNA 1S1YA 2INWA 2QKPA 2A2LA 3IS2A 3UE6A 3KYZA 5HPIA 1W63Q 1YKDA 5IS1A 3PBOA 3PYPA 2HGVA 3DBAA 4WEKA 2QHKA 1XFQA 4BBVA 1TS6A 3OBFA 5AJGA 3MR0A 1TS7A 1OJ5A 2QJ7A 1ZHHB 2OWHA 3HJIA 1T19A 4WF0A 2KLIA 3PHYA 4Y2FA 2GNXA 1NLYA 2HJ9C 2XA7M 3U2AA 2VJWA 4HOIA 4M4XA 1UGUA 2PD7A 2PYRA 3HJKA 1V9YA 3R7WA 3A0RA 1D06A 3LIDA 1OJGA 3PXPA 4WUJA 3E98A 4HP4A 2Y79A 4JGQA 5HSQA 5C5KA 3LUQA 4JGRA 4EQ1A 3F1OA 3MQOA 3JVUA 1LSXA 1P9WA 3ICYA 5AVEA 5LBRA 2JKRM 1LSVA 2Z6CA 2R78A 3PBQA 2ZOHA 3LIAA 3UMEA 1H8MA 4EU0A 4NXEA 1TS0A 2HJEA 2EA9A 3CLOA 3F1PA 3G6OA 4MDZA 5FL3A 4L9GA 4LRZE 4BBTA 2PHYA 4YNRA 4BBUA 3FPWA 2A24A 1W63M 1N9OA 5J4EA 5HZHA 2B18A 3B42A 5F5YA 3H9WA 4PAUA 4KQDA 4GHIB 3CUEA 3LYXA 4ARZB 4DJ3A 2HV1A 2PR6A 4OOLA 4YWZA 2M7VA 5HD3A 4JGPA 1OTBA 4H6JA 3B47A 3H7WA 1TD5A 5IU1A 3UB9A 4G3VA 1XJ2A 4DMZA 2M7UA 3MFXA 2P08A 2FZ0A 3E4PA 3FPVA 2PR5A 2G7UA 1F98A 2VGLM 2J80A 4R3AA 5HDSA 3T4OA 3BJNA 3P7NA 3UB8A 1WA9A 2VV6A 1YSQA 4ME4A 3MF0A 4LRYC 4YOFA 5HDDA 3F1NB 1IFQA 2WKRA 3NOUC 1S66L 4HIAA 3IS2B 2P04A 4EEPA 4G3WA 2FH5A 2HF6A 3OC2A 3D72A 3R4KA 4GJ4A 1S4RA 2D02A 1UWNX 3EEAA 2JN7A 3VE3A 2W3FA 4UEYA 2IA2A 3T50A 2D01A 3FG8A 4GCZA 2L1MA 3C2WA 1IOUA 2LB9A 5HWWA 3OLOA 3LIFA 2K31A 3T4LA 2O0YA 3LIBA 4MN7A 1NWZA 1OT6A 3LIEA 4P6ZM 1G28A 3BW6A 3IBRA 4O01A 3T4KA 1P97A 1ZTUA 4HNBA 1V9ZA 2PYPA 3NHQA 4FOFA 2OAQ1 1VB6A 3ULFA 2EWVA 5DKKA 3K2NA 4R70A 1DP6A 5F68A 2O9CA 1YAXA 2XSSA 1KOUA 2LB5A 2WKQA 5EFWA 2XA7S 4L0LA 4KQOA 4G3KA 2NUTC 3OOVA 5IT5A 4IUHA 4WLAA 4CLCD 3LR5A 5HWVA 4EETB 2PD8A 1X0OA 3MXQA 3F1PB 4O0PA 3NJAA 2W1RA 4Y3IA 2H28A 1MC0A 2V1AA 4EUVA 2J3WA 5DJUA 3K3DA 4LLOB 3S7OA 2A24B 1S4SA 3UE3A 3T4SA 5K5BA 3GDIA 3PBRA 4HI4A 3RFBA 4CLCB 4E04A 3V67A 3P01A 1GSWA 2VLGA 4I5SA 4Y5FA 3JVVA 1F9IA 1XFNA 4HHDA 4Q0JA 4L9FA 4H6JB 5HL6A 2YKHA 5HD5A 2ZBBA 3E4OA 4KUOA 4B9OA 4BMWA 3HCYA 4GW9A 4HQAA 5J7EA 3TRCA 4JGOA 3MQQA 4IJGA 3A0VA 2O99A 3UB7A 3H82B 5I5LA 4WELA 2JKTM 2GZAA 3D3OA 2L0WA 5KSHA 3PBTA 4I38A 3VV4A 2VGLS 3RH8B 4NEED 4NXFA 3CAXA 5J3WA 4CLCE 2VKSA 2K7SA 5DKLA 3TW8A 3NOTC 2V0UA 3EGDC 4F3LA 5TBMA 4HJ4A 1NLZA 3BQ8A 3EWKA 3S7NA 5F69A 4Q0HA 4I39A 5G4YA 1LL8A 3LR4A 1S1ZA 2OAP1 2JKRI 1LT0A 4LRXC 3RTYA 2CMNA 3LR0A 4I3AA 2EWWA 2GX5A 4WEJA 3UB6A 3CI6A 4GHIA 2ZMFA 2ZOIA 3KSGA 3KX0X 4IHQA 2K2NA 5AVFA 5DJTA 1OTDA 2OWJA 4PKYG 4II7A 4P6ZS 5HPFA 3K3CA 5KIZA 2VX8A 2WKPA 3PBNA 3CITA 1XJ4A 4K08A 4WN5A 3TE8A 4EESA 3PBSA 4GS9A 3OCLA 2B02A 4HY8A 3T4JA 5HWTA 3EOIA 1P0ZA 2V9AA 2KDKA 4ETZA 2DMWA 3BQAA 2W3HA 3R7WB 2W1TA 3A0SA 3EEHA 4WL9A 3ZQ5A 4XT2A 2ZMVA 5MC7A 1G6OA 3VE4A 3BY9A 3F1OB 4QPRA 1YSPA 5TJJA 3SW1A 3S7QA 4UQIM 1STZA 3IBJA 1GSVA 2QYBA 4B93A 2PDRA 3C38A 3T4QA 3S7PA 3MJQA 4MMNA 5DFXA 2VA0A 2V1BA 3KYQA 3C8CA 4CLCC 3CUEC 5G4ZA 3EGXC 3E0YA 5HDCA 3LR3A 4BWIA 4LPZA 1MZUA 4ETXA 4Z1WA 4DN0A 1Y28A 2W3GA 1T1AA 3LI8A 1EW0A 2VEAA 1LSWA 1ODVA 2VV7A 3H7WB 3W2ZA 3KSIA 1NRJA 1S67L 4AFIA 2W3DA 4HJ6A 2O9BA 4EW7A 3FC7A 2J3TD 3OCNA 3KSHA 1GSXA 4PKYA 1OTIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HH3 A;  4EXO A;  4I3I A;  2JHE A;  2W0N A;  3LI9 A;  4F3L B;  1TS8 A;  5TBM B;  3NOP C;  2W27 A;  3UMD A;  4HH2 A;  2KX6 A;  1T1B A;  1N9N A;  4HJ3 A;  2QWS A;  2OOL A;  4DJ2 A;  1OTA A;  3E4Q A;  3VOL A;  4MN5 A;  3BWL A;  3CWF A;  1XJ6 A;  1D7E A;  4R6L A;  4R38 A;  4GS9 B;  4NXG A;  1BYW A;  2GJ3 A;  4KUK A;  3B33 A;  3LIC A;  1JNU A;  4EER A;  5F6A A;  1DP9 A;  4RQ9 A;  2P7J A;  3H82 A;  2QJ5 A;  4XT2 B;  4MN6 A;  2L4R A;  4NXB A;  1T18 A;  2I9V A;  1DP8 A;  3BY8 A;  1T1C A;  1UWP X;  2VV8 A;  3GEC A;  4HP9 A;  1OT9 A;  2V0W A;  4L9E A;  4EEU A;  2M1C A;  2Z6D A;  2BAS A;  1DRM A;  1OTE A;  5A8B A;  1XJ3 A;  2YKF A;  1N9L A;  3F1N A;  4I3J A;  2INW A;  1S1Y A;  2QKP A;  3UE6 A;  3IS2 A;  5IS1 A;  3PYP A;  2QHK A;  1XFQ A;  4BBV A;  1TS6 A;  3MR0 A;  1TS7 A;  1OJ5 A;  2QJ7 A;  2OWH A;  3HJI A;  1T19 A;  4WF0 A;  3PHY A;  4HOI A;  4M4X A;  1UGU A;  2PD7 A;  2PYR A;  3HJK A;  1V9Y A;  3A0R A;  1D06 A;  3LID A;  1OJG A;  4WUJ A;  4HP4 A;  4JGQ A;  5HSQ A;  4EQ1 A;  3LUQ A;  4JGR A;  3F1O A;  3MQO A;  1LSX A;  3ICY A;  5AVE A;  1LSV A;  2Z6C A;  2R78 A;  2ZOH A;  3LIA A;  3UME A;  4NXE A;  1TS0 A;  2EA9 A;  3CLO A;  3F1P A;  3G6O A;  4L9G A;  4LRZ E;  4BBT A;  2PHY A;  4BBU A;  2A24 A;  1N9O A;  5J4E A;  5HZH A;  5F5Y A;  3H9W A;  4KQD A;  4GHI B;  3LYX A;  4DJ3 A;  2HV1 A;  2PR6 A;  4YWZ A;  5HD3 A;  4JGP A;  1OTB A;  4H6J A;  3H7W A;  5IU1 A;  3UB9 A;  1XJ2 A;  3MFX A;  3E4P A;  2PR5 A;  1F98 A;  2J80 A;  4R3A A;  5HDS A;  3P7N A;  3UB8 A;  1WA9 A;  2VV6 A;  4LRY C;  5HDD A;  2WKR A;  3F1N B;  3NOU C;  1S66 L;  4HIA A;  3IS2 B;  4EEP A;  3D72 A;  1S4R A;  2D02 A;  1UWN X;  2JN7 A;  3VE3 A;  3T50 A;  2D01 A;  3FG8 A;  4GCZ A;  2L1M A;  3C2W A;  5HWW A;  3OLO A;  3LIF A;  3LIB A;  1NWZ A;  1OT6 A;  3LIE A;  1G28 A;  3IBR A;  1P97 A;  4HNB A;  1V9Z A;  2PYP A;  3NHQ A;  1VB6 A;  3ULF A;  5DKK A;  4R70 A;  1DP6 A;  5F68 A;  1KOU A;  2WKQ A;  5EFW A;  4WLA A;  5HWV A;  4EET B;  2PD8 A;  1X0O A;  3MXQ A;  3F1P B;  3NJA A;  2H28 A;  2V1A A;  5DJU A;  3K3D A;  4LLO B;  2A24 B;  1S4S A;  3GDI A;  4HI4 A;  4E04 A;  1GSW A;  2VLG A;  4I5S A;  1F9I A;  1XFN A;  4HHD A;  4L9F A;  4H6J B;  2YKH A;  5HD5 A;  2ZBB A;  3E4O A;  4KUO A;  4B9O A;  4GW9 A;  4HQA A;  5J7E A;  4JGO A;  3MQQ A;  3A0V A;  3UB7 A;  3H82 B;  5I5L A;  2L0W A;  4I38 A;  3RH8 B;  4NXF A;  5J3W A;  3CAX A;  2K7S A;  5DKL A;  3NOT C;  2V0U A;  4F3L A;  5TBM A;  4HJ4 A;  3EWK A;  5F69 A;  4I39 A;  5G4Y A;  1LL8 A;  1S1Z A;  1LT0 A;  4LRX C;  3RTY A;  2CMN A;  4I3A A;  3UB6 A;  4GHI A;  2ZOI A;  3KX0 X;  5AVF A;  5DJT A;  1OTD A;  2OWJ A;  4PKY G;  5KIZ A;  3K3C A;  2WKP A;  1XJ4 A;  4K08 A;  4WN5 A;  4EES A;  4GS9 A;  4HY8 A;  2B02 A;  5HWT A;  1P0Z A;  2V9A A;  2KDK A;  3A0S A;  3EEH A;  4WL9 A;  3ZQ5 A;  4XT2 A;  3VE4 A;  3BY9 A;  3F1O B;  3SW1 A;  1GSV A;  2PDR A;  3MJQ A;  2V1B A;  3C8C A;  5G4Z A;  5HDC A;  4LPZ A;  1MZU A;  1Y28 A;  1T1A A;  3LI8 A;  1EW0 A;  2VEA A;  1LSW A;  1ODV A;  2VV7 A;  3H7W B;  1S67 L;  4HJ6 A;  4EW7 A;  3FC7 A;  1GSX A;  4PKY A;  1OTI A; 
#chains in the Genus database with same CATH topology
 4EXO A;  4I3I A;  4ZTK A;  3LI9 A;  4DE0 A;  1PIO A;  2JE5 A;  5TBM B;  2Q9N A;  3NOP C;  4A5R A;  4NKP A;  3UPO A;  1VEU B;  3Q7Z A;  3MSH A;  1G6A A;  3UY6 A;  4UAA A;  1N9N A;  2Y8H A;  1YLT A;  2QWS A;  3ZCZ A;  2OOL A;  4DJ2 A;  1YLY A;  1EWZ A;  1H3Q A;  4WZ4 A;  3EQU A;  4JBF A;  1K4F A;  4CQH A;  4MCW A;  3TOI A;  3E4Q A;  2IWB A;  4MN5 A;  3BWL A;  1XJ6 A;  4DE3 A;  4R38 A;  4M3K A;  3ZG8 B;  4ZRR A;  1VET B;  2GJ3 A;  3T4T A;  3V3R A;  3FWL A;  5FAP A;  1PWD A;  4KZA A;  3VOY A;  5GLB A;  5IHV A;  1DP9 A;  5L8M A;  5TFQ A;  3H82 A;  1CF0 A;  3NY4 A;  2OLU A;  2KOI A;  4PHT A;  2I9V A;  5AQ7 A;  2XLN A;  3BY8 A;  3C4P A;  1T1C A;  4QY6 A;  4L9E A;  3KSF A;  1SKO A;  4N1X A;  2EXA A;  3MZD A;  2M1C A;  4F94 A;  1FIL A;  4ESP A;  1YLP A;  1F5M A;  3BFD A;  1ES5 A;  1MKM A;  5A8B A;  1XJ3 A;  3VP3 A;  2J9P A;  3VFH A;  4KQR A;  5EM1 A;  4I3J A;  3ZDJ A;  3MMH A;  2QKP A;  3IX8 A;  5FQK A;  2EXB A;  2HGV A;  2QHK A;  2VGK A;  4UA9 A;  1TEM A;  2XF3 A;  5F1G A;  2Y2G A;  3SS5 A;  2OWH A;  2ZQ7 A;  2KLI A;  2XA7 M;  3WRT A;  5FAS A;  4ZJ1 A;  1Y54 A;  1LLB A;  3CJM A;  3HJK A;  3R7W A;  4DE1 A;  3A0R A;  1D06 A;  4BLM A;  1OJG A;  2Y79 A;  4JGQ A;  4OLG A;  5HSQ A;  4EQ1 A;  4JGR A;  3MQO A;  5HL1 A;  1XXM A;  3PAE A;  1P9W A;  1KE3 A;  3ICY A;  1DY6 A;  4DXB A;  3AGD A;  4LV3 A;  3PBQ A;  3AGF A;  3UME A;  4Y0O A;  4S2K A;  5CEB A;  3P09 A;  4S2J A;  5FL3 A;  4BBT A;  2PHY A;  4BBU A;  1MPL A;  2Y4A A;  5J4E A;  4U0X A;  4GHI B;  3LYX A;  2M7V A;  3DTM A;  1OTB A;  5EVI D;  4H6J A;  3BYD A;  1TD5 A;  3VP0 A;  2ZQ8 A;  2M7U A;  2P08 A;  4OPY A;  2V20 A;  3DTE A;  3CG5 A;  5FQM A;  4R3A A;  5GLD A;  5CRF A;  1WA9 A;  3C5A A;  1YPR A;  2VV6 A;  2XD5 A;  3G2Z A;  2JKG A;  2OLV A;  1VQQ A;  4YOF A;  1HLU P;  5FEG A;  4GJ4 A;  3EEA A;  1LI9 A;  4UEY A;  1KGG A;  3GR2 A;  3T50 A;  4X55 A;  1SDE A;  4K0W A;  2ACG A;  4Y0U A;  3LIE A;  5F83 A;  4O01 A;  3T4K A;  1ZTU A;  3BLM A;  4HNB A;  3UE0 A;  2PYP A;  1ONH A;  1ES2 A;  4JLF A;  2EWV A;  3SH9 A;  1DP6 A;  1H8Y A;  2XSS A;  3CHW P;  2LB5 A;  1E3U D;  4X69 A;  3OOV A;  5IT5 A;  4RA7 A;  4IUH A;  3N6I A;  4S2O A;  2ZJ9 A;  1Y4O A;  3NJA A;  2W1R A;  1LHY A;  4RX3 A;  2Y2J A;  3PTE A;  5CER A;  2J3W A;  4WYY A;  3K3D A;  4LLO B;  2A24 B;  3UE3 A;  1KE0 A;  1NYM A;  4HI4 A;  3MKF A;  3P01 A;  4RYE A;  2VLG A;  4I5S A;  4QY5 A;  3JVV A;  4Q0J A;  4MBF A;  2JCH A;  5HL6 A;  1E4D A;  1FCO A;  3S1Y A;  4KUO A;  4JGO A;  3NIA A;  4LEN A;  3FYZ A;  1RGZ A;  3ZG9 B;  3H82 B;  3FKW A;  2GZA A;  2ZQD A;  3D3O A;  3IHB A;  1CQA A;  2BG1 A;  2EX2 A;  1KVL A;  4NEE D;  5J3W A;  3CAX A;  5HAR A;  5DKL A;  1SKO B;  2V0U A;  1QMF A;  4E3L A;  1ES3 A;  5TBM A;  3D4F A;  2Y91 A;  3CMZ A;  1VEU A;  3BQ8 A;  3EWK A;  5F69 A;  4I39 A;  4R4R A;  1KVM A;  3NEC A;  2WUQ A;  4LRX C;  2EFX A;  3TSG A;  2EWW A;  4WEJ A;  3DWZ A;  2C5W B;  1YMX A;  5DJT A;  2PU4 A;  4P6Z S;  2H0Y A;  3O3V A;  2Q0O A;  4EBN A;  1L0E A;  2VX8 A;  3QP8 A;  3TE8 A;  3BFE A;  5M18 A;  2B02 A;  3T4J A;  1VET A;  5HWT A;  3EOI A;  3MS6 A;  4OPR A;  3L9K A;  1K54 A;  1SHV A;  2KDK A;  2B95 A;  3MZE A;  2QPN A;  3R7W B;  4HBT A;  3ZQ5 A;  5KMW A;  3NI9 A;  2FFF B;  1EI5 A;  1G6O A;  1J9M A;  5TJJ A;  5FQQ A;  5EOO A;  3S7Q A;  4UQI M;  1STZ A;  3MKE A;  4B93 A;  2PDR A;  5EVL A;  2Y2Q A;  2Y2I A;  3CZD A;  1JWV A;  3OZH A;  1K56 D;  3HLE A;  3CUE C;  4CLC C;  1JWP A;  3NCK A;  3E0Y A;  3LR3 A;  4E3J A;  1NY0 A;  2Y2M A;  4LPZ A;  3SS3 A;  2W3G A;  2XFT A;  4EV4 A;  2WAD A;  2G2W A;  1LSW A;  5FI2 A;  2VV7 A;  1BZA A;  3KSI A;  1S67 L;  2WK0 A;  4EW7 A;  3T12 B;  1BSG A;  3P98 A;  3OCN A;  1GHI A;  3KSH A;  1GSX A;  1KDS A;  2JC7 A;  4EBP A;  4LGW A;  1P9R A;  3FKV A;  1TS8 A;  3RXW A;  2PT7 A;  3WS2 A;  2W27 A;  3LFV A;  4WMC A;  4OQH A;  2KX6 A;  2HDQ A;  4IUK A;  1IYO A;  4CLC A;  1HVB A;  4OOY A;  3HLD A;  5FEF A;  5GHZ A;  1O07 A;  4WZ5 A;  1DJC A;  3CWF A;  3V50 A;  1I5Q A;  3GRJ A;  5CGS A;  2VZW A;  2Y2P A;  4XXR A;  4GS9 B;  4NXG A;  1K55 A;  4BL2 A;  3ZHH A;  4KUK A;  4ID4 A;  3UDX A;  1PFL A;  1JNU A;  4EER A;  5F6A A;  3S22 A;  1DJB A;  4E3I A;  3UPP A;  4NXB A;  2CC1 A;  3IH9 A;  1D1J A;  1T18 A;  1CEG A;  4Y17 A;  1DP8 A;  2VV8 A;  4OOM A;  3GEC A;  3QNB A;  1OT9 A;  4WBG A;  3ZVT A;  2V0W A;  4EEU A;  2EX9 A;  4OPZ A;  1RCJ A;  2Z6D A;  1OPX A;  2BAS A;  1W7F A;  3WRZ A;  5CX7 A;  3UPN A;  4B4X A;  2XRN A;  1S1Y A;  1W63 Q;  3S4X A;  4QJG A;  4WEK A;  3IXB A;  3OBF A;  5AJG A;  5E2E A;  1L0F A;  1TS7 A;  5E43 A;  4DE2 A;  4LV0 A;  2XK1 A;  5FQI A;  2DNS A;  5GLA A;  3G2Y A;  1K6R A;  3PHY A;  4Y2F A;  4HOI A;  2PD7 A;  2WKH A;  3C7U A;  3PXP A;  3ZG5 A;  1ZG6 A;  4WUJ A;  2BTF P;  3G35 A;  1ES4 A;  4PM9 A;  3BFF A;  3HLB A;  1LSV A;  1IEL A;  2RCX A;  3HLW A;  2Q9M A;  1FCN A;  4L9G A;  4QHC A;  2A24 A;  5HZH A;  2B18 A;  1ZC2 A;  1S0W A;  3IF5 A;  1KDW A;  4ARZ B;  2HV1 A;  2PR6 A;  4OOL A;  4YWZ A;  4UHU A;  3LO7 A;  3JYI A;  3H7W A;  1IKI A;  1SKF A;  3IWO A;  4QB8 A;  1YMS A;  3SS4 A;  5EVI C;  3WS4 A;  2FZ0 A;  3E4P A;  2BLS A;  2G7U A;  2VGL M;  1ONG A;  3MBZ A;  4S2L A;  5EOE A;  4GD6 A;  5G18 A;  1YSQ A;  1PWC A;  5HDD A;  4Q8I A;  3F1N B;  3NOU C;  2H5S A;  1S66 L;  3DTK A;  4NG2 A;  1K57 C;  3IS2 B;  2P04 A;  5FAT A;  4EEP A;  4G3W A;  3OC2 A;  3R4K A;  1UWN X;  2JN7 A;  3O86 A;  1W8Y A;  3DWK A;  4EUZ A;  2IA2 A;  3T1Q B;  2D01 A;  3FG8 A;  2LB9 A;  5HWW A;  4OP5 A;  2K31 A;  3HLF A;  2VGJ A;  2WYX A;  3VSL A;  4BEN A;  4DKI A;  3BFC A;  1HZO A;  3LEQ A;  3IBR A;  3NC8 A;  1V9Z A;  1CK3 A;  2OAQ 1;  1VB6 A;  4R70 A;  3V3S A;  4E3O A;  2R9X A;  5F68 A;  1KOU A;  4E3N A;  3SH8 A;  5EFW A;  2XA7 S;  4L0L A;  1FR6 A;  3C4O A;  3A3I A;  1CI8 A;  2NUT C;  3A3D A;  3UO9 A;  1Q2Q A;  3WWX A;  4WLA A;  3LR5 A;  4EET B;  2PD8 A;  4FD8 A;  3F1P B;  4O0P A;  1PI5 A;  4EUV A;  1TVF A;  5GHY A;  1JVJ A;  5DTK A;  3I7J A;  3TG9 A;  4CLC B;  3V67 A;  2JKF A;  2PBY A;  1GSW A;  4IVI A;  1XFN A;  4HHD A;  5CHM A;  1ERM A;  1BUE A;  5L10 A;  5HD5 A;  3E4O A;  2IWD A;  4B9O A;  4OQI A;  4D60 A;  4GW9 A;  4HQA A;  5J7E A;  3LY4 A;  1RGY A;  4IJG A;  3A0V A;  2Z2L B;  2O99 A;  2HP5 A;  5FI7 A;  4WEL A;  1SZV A;  3DAV A;  5KSH A;  1ALQ A;  1FSW A;  3RH8 B;  4KG5 A;  5DF8 A;  2K7S A;  3TW8 A;  3GMW A;  4UA7 A;  5L07 A;  1BLH A;  3G34 A;  4LCM A;  4K91 A;  1G68 A;  4R23 A;  3BEB A;  2OAP 1;  2JKR I;  4BD1 A;  3UB6 A;  4R0Q A;  3KSG A;  3KX0 X;  4IHQ A;  2K2N A;  4S2M A;  1OTD A;  2OWJ A;  4PKY G;  1PNE A;  1XA7 A;  2OSU A;  5HPF A;  2J8Y A;  4IBX A;  1XX2 A;  4S2N C;  4K08 A;  3HUO A;  4GS9 A;  4HY8 A;  5DTT A;  3WS0 A;  1P0Z A;  4ETZ A;  2DMW A;  2W3H A;  3BEC A;  3A0S A;  3EEH A;  3VE4 A;  2XDM A;  4QPR A;  2XR0 A;  4KZ3 A;  3T4Q A;  3S7P A;  3B3X A;  4OPQ A;  5EUA A;  2ZM2 A;  2V1B A;  1H8Z A;  3PAG A;  3Q7V B;  1BUL A;  2XEP A;  1PW8 A;  5A91 A;  1ESI A;  3A3F A;  2HP6 A;  4BWI A;  2PBD P;  4ETX A;  4Z1W A;  1EW0 A;  1O7E A;  1XKZ A;  5GHX A;  3H7W B;  4NET A;  2X71 A;  4HEF A;  2V2F F;  3HLG A;  3FC7 A;  2ZMA A;  4JXG A;  2J3T D;  3M6B A;  3ZFZ A;  4ZBE A;  3KO6 A;  2XGN A;  2JHE A;  4K0X A;  2ZL1 B;  4F3L B;  4Q0I A;  1NRF A;  4KZ4 A;  5EV0 A;  3HRE A;  4OQ0 A;  1VHM A;  1MWT A;  1T1B A;  4H8R A;  3EQV A;  4X68 A;  3PR6 A;  3T1R A;  3IXH A;  2AVX A;  4QU3 A;  3BRM A;  4MLL A;  2IWC A;  4JXW A;  4GLQ A;  1MXO A;  2WKI A;  1BYW A;  4OP8 A;  2O9A A;  3B33 A;  5J8X A;  1Z09 A;  3LIC A;  5CED A;  4UA6 A;  3UNW A;  2W1T B;  1KGF A;  1GA0 A;  4RQ9 A;  5EVI B;  2XRO A;  4ARZ A;  4FTX A;  2QJ5 A;  4XT2 B;  2C6W B;  3L7H A;  3Q82 A;  1H0M A;  3TJZ C;  3C30 A;  4R3B A;  1GCE A;  5CEC A;  3GSG A;  5CHJ A;  4XUX A;  3IXD A;  2JKT I;  4KG2 A;  4LV2 A;  4UQI S;  1IEM A;  2J9O A;  1DRM A;  1OTE A;  1W5D A;  2HDR A;  2W3E A;  3F1N A;  2INW A;  3IS2 A;  2A2L A;  3UE6 A;  2Y2O A;  4C3Q A;  3KYZ A;  4O7D A;  5HPI A;  1YKD A;  3SH7 A;  5M19 A;  3PYP A;  3DBA A;  1XFQ A;  3JPU A;  4N9L A;  3MR0 A;  4KQQ A;  2QJ7 A;  1N4O A;  3C7V A;  1ZHH B;  3HJI A;  1ACF A;  3QP2 A;  1RP5 A;  4GKU A;  2Y55 A;  2GNX A;  3QP5 A;  2HJ9 C;  2OV5 A;  2VJW A;  4M4X A;  4XUZ A;  2PYR A;  4YFM A;  1TDG A;  4LFU A;  3LID A;  3E98 A;  5FSR A;  4HP4 A;  5EEC A;  5C5K A;  3LUQ A;  2FFY A;  1IYS A;  3F1O A;  3IF6 C;  3JVU A;  1LSX A;  5AVE A;  5LBR A;  2ZLY A;  2JKR M;  1H8M A;  3G30 A;  4NXE A;  4KZ9 A;  2HJE A;  3WS1 A;  4R4S A;  2EA9 A;  3F1P A;  3UDF A;  1FCM A;  1IKG A;  3ZG0 A;  5F1F A;  4LRZ E;  1L3L A;  4YNR A;  5GL9 A;  1W63 M;  1N9O A;  5AQA A;  3B42 A;  1YQS A;  3H9W A;  4D2O A;  4KQD A;  3RXX A;  3CUE A;  1BLS A;  2E8I A;  4Y13 A;  3ZGA B;  2ZC7 A;  4LV1 A;  3OPH A;  2QZ6 A;  5IU1 A;  1ESU A;  4G3V A;  2ZQA A;  1XJ2 A;  4DMZ A;  4DDY A;  4PMA A;  2ZC5 B;  1WYB A;  1K0K A;  5TGF A;  2PR5 A;  1F98 A;  3MXR A;  4ZJ3 A;  5HDS A;  3T4O A;  2WGV A;  3IWQ A;  3P7N A;  3UB8 A;  2WGI A;  4P85 A;  4ME4 A;  2WKR A;  1IFQ A;  4HIA A;  3QP6 A;  2FH5 A;  3WS5 A;  1S4R A;  4S2I A;  3LY3 A;  3VE3 A;  4DXC A;  3IH8 A;  2W3F A;  4GDN A;  4E3M A;  4X6T A;  5FQJ A;  3GVB A;  5U47 A;  1IOU A;  2L1M A;  4BQM A;  2R9W A;  3OLO A;  2WZZ A;  3T4L A;  2EFU A;  4JF6 A;  3LIB A;  4MN7 A;  1K4E A;  1G28 A;  4JKT A;  1F2K A;  4EBL A;  1S6R A;  3BW6 A;  2ZC4 B;  4KZ5 A;  4GD8 A;  3NHQ A;  3UN7 A;  4FOF A;  2E8J A;  4HES A;  3ULF A;  1I2S A;  1KE4 A;  2PAV P;  5EVE A;  1G5U A;  2DCF A;  3K2N A;  5CGX A;  1NZO A;  2O9C A;  4C75 A;  3M2J A;  5L09 A;  1JWZ A;  5CGW A;  4R3J A;  2ZD8 A;  4CLC D;  3ZNY A;  3UDI A;  5HWV A;  1LL5 A;  1OME A;  4U3T A;  5CXW A;  1NYY A;  2H28 A;  2V1A A;  3S7O A;  1ZG4 A;  1S4S A;  3T4S A;  1JTD A;  4E3K A;  1XA1 A;  3PBR A;  1PZO A;  4Y5F A;  5CTM A;  2Y2H A;  4L9F A;  4ZDX A;  1ERO A;  3Q07 A;  3Q7V A;  3SOI A;  5E2G A;  2YKH A;  5D3O A;  1SCW A;  3HBR A;  1PYY A;  4N92 A;  4QD4 A;  3M6H A;  3HCY A;  3TRC A;  4PM5 A;  3QP4 A;  3MQQ A;  3V39 A;  3G4P A;  3LGO A;  5HX9 A;  2GDN A;  5AQ9 A;  2P9V A;  1YLW A;  2JKT M;  5FDS A;  5FDH A;  2L0W A;  5DF7 A;  3PBT A;  4I38 A;  3DTI A;  3U4L P;  2VGL S;  1U60 A;  2A49 A;  4CLC E;  2WGW B;  1L0G A;  3EGD C;  1WE4 A;  2G2U A;  2ZL1 A;  4F3L A;  3QHY A;  1YLZ A;  1NLZ A;  3CPT B;  4FUW A;  1FOF A;  3SZT A;  4MBK A;  3LEZ A;  4P87 A;  4PM8 A;  1LT0 A;  5FI6 A;  3RTY A;  2CMN A;  1PI4 A;  3KYE A;  4ZJ2 A;  2ZC6 B;  5JYO A;  2GX5 A;  3CI6 A;  5E2H A;  2ZMF A;  2ZOI A;  5AVF A;  4II7 A;  3FV7 A;  3ITB A;  5KIZ A;  3K3C A;  2WKP A;  3PBN A;  3CIT A;  4MBH A;  1ERQ A;  1PW1 A;  4WN5 A;  1MWS A;  4EES A;  5L2F A;  4OLD A;  1L0D A;  3A3J A;  3MXS A;  2V9A A;  5HAI A;  2PU2 A;  1GHM A;  3BQA A;  3GQZ A;  2W1T A;  1TDL A;  2HPB A;  5EVI A;  3ZNT A;  4WL9 A;  4XT2 A;  2ZMV A;  4KZ7 A;  5MC7 A;  3BY9 A;  3F1O B;  4GDB A;  3IBJ A;  5A90 A;  1GSV A;  2QYB A;  4MMN A;  4KZ8 A;  5FA7 A;  4C6Y A;  5DFX A;  4X1M A;  2VA0 A;  2J7V A;  2X02 A;  3V5M A;  3O88 A;  1FIK A;  2Y2L A;  4CPK A;  1K57 A;  1BTL A;  1Z6F A;  3HVF A;  3EGX C;  4GOG A;  4OKP A;  5HAQ A;  3BLS A;  4DN0 A;  1Y28 A;  3Q81 A;  5FQ9 A;  1T1A A;  3LI8 A;  3NDG A;  2VEA A;  1HD8 A;  3W2Z A;  4AFI A;  1OTI A;  1A0K A;  3E2L A;  4HH3 A;  2J3T C;  2W0N A;  4BJP A;  1C3B A;  3IF6 B;  1AWI A;  4N9K A;  3ZG7 B;  1GA9 A;  4FSF A;  4WM9 A;  3UMD A;  4HH2 A;  5EE8 A;  1E3U A;  2X01 A;  3O5Y A;  4HJ3 A;  3T1S A;  1CJF A;  4JF5 A;  4Z9Q A;  4FH4 A;  2A3U A;  1OTA A;  2NUP C;  1ZKJ A;  3D9Y A;  2MJ6 A;  3VOL A;  1K6S A;  1J3W A;  4RVA A;  2H0T A;  3BFG A;  1D7E A;  4R6L A;  2EX8 A;  4OQG A;  5TR7 A;  3ZYT A;  5CHU A;  3MFD A;  3MQ0 A;  3OPP A;  5F82 A;  1SDN A;  1NXY A;  3QP1 A;  3IT9 A;  2JBF A;  4DDS A;  3IXG A;  2HDU A;  2P7J A;  2Y59 A;  4MN6 A;  2L4R A;  4Y0T A;  5DTS A;  3UE1 A;  2WAE A;  3VSK A;  2ZC3 B;  5DFY A;  1UWP X;  5I94 A;  4HP9 A;  4RX2 A;  3E2K A;  5BOH A;  5DF9 A;  4YIN A;  1XGJ A;  1W79 A;  2HP9 A;  1IYP A;  1PWG A;  1FQG A;  1TF1 A;  1E25 A;  2YKF A;  1N9L A;  4O8G A;  3HUM A;  4E6X A;  3N4I A;  5IS1 A;  3PBO A;  2I72 A;  5DVA A;  4BBV A;  1TS6 A;  3G31 A;  1LI0 A;  4X1L A;  1OJ5 A;  4KG6 A;  1BT5 A;  1T19 A;  4WF0 A;  1VM1 A;  2XH9 A;  1NLY A;  5EM0 A;  2XFS A;  2P9V B;  3U2A A;  4S2N A;  1UGU A;  4P6B A;  1V9Y A;  3MZF A;  3RJU A;  4MNR A;  3W4O A;  2ZM0 A;  2ZQC A;  1IYQ A;  2RL3 A;  4B4Z A;  1QME A;  2WKE A;  2Z6C A;  2R78 A;  1I2W A;  2ZOH A;  3LIA A;  2Y2N A;  4EU0 A;  1TS0 A;  4B88 A;  3W4P A;  3CLO A;  4OH0 A;  1XGI A;  3G6O A;  4MDZ A;  1MWU A;  4NK3 A;  3VP2 A;  2HZ5 A;  3FPW A;  5CTN A;  3W4Q A;  4Y15 A;  2V8F A;  5F5Y A;  4PAU A;  1NJ4 A;  1W8Q A;  3LCE A;  4PPR A;  4DJ3 A;  3OPR A;  2ZM8 A;  4GNU A;  1K56 A;  5HD3 A;  4JGP A;  1K54 C;  4IED A;  3B47 A;  4LCL A;  3UB9 A;  1PZP A;  1AXB A;  3MFX A;  1BLP A;  1JTG A;  3HUN A;  1MY8 A;  3FPV A;  2VK3 A;  2J80 A;  3UB5 P;  2H10 A;  3BJN A;  4GB7 A;  3MF0 A;  4LRY C;  3IX3 A;  3G32 A;  4IBR A;  3VP4 A;  5JYP A;  2HF6 A;  3D72 A;  5M1A A;  2D02 A;  1MKI A;  2WGW A;  4GCZ A;  3C2W A;  3VFF A;  3ISG A;  3ZVW A;  3LIF A;  2O0Y A;  3CPT A;  4PM7 A;  1NWZ A;  1OT6 A;  4P6Z M;  1L2S A;  4DRT A;  4KZ6 A;  2UWX A;  1P97 A;  4EQI A;  5DKK A;  3NDE A;  4JF4 A;  3N8R A;  4U0T A;  1YAX A;  3T1X A;  1KGE A;  4PM6 A;  2WKQ A;  4KQO A;  4JXV A;  4G3K A;  4GZB A;  2XD1 A;  4JXS A;  5GLC A;  3GV9 A;  1X0O A;  3MXQ A;  2B5R A;  4Y3I A;  1MC0 A;  4Y7P A;  5DJU A;  1M40 A;  1MWR A;  1BLC A;  4WZ5 C;  4X25 A;  4FH2 A;  5K5B A;  3GDI A;  3RFB A;  4E04 A;  3OPL A;  1XP4 A;  2WZX A;  3A3E A;  4DF6 A;  1K55 C;  1F9I A;  5FAO A;  4GN2 A;  1YM1 A;  5HAP A;  1N9B A;  4H6J B;  2ZBB A;  4BMW A;  1NZU A;  4BL3 A;  2WAF A;  1WYC A;  4OVD A;  3BM6 A;  3UB7 A;  5I5L A;  1HTZ A;  2XQZ A;  3FZC A;  1MBL A;  1H5X A;  5KSC A;  4ZAM A;  2QMI A;  2V8C A;  4S2P A;  4FCF A;  3Q1F A;  3VV4 A;  3W8K A;  4KZB A;  1Q2P A;  4NXF A;  3HL9 A;  2VKS A;  1CEF A;  3NOT C;  1K38 A;  3IF6 A;  1M6K A;  1YLJ A;  2PRF A;  4HJ4 A;  4R1G A;  5E2F A;  5A92 A;  3IWI A;  4HBU A;  3S7N A;  2EX6 A;  4Q0H A;  5G4Y A;  1LL8 A;  3LR4 A;  1S1Z A;  3LR0 A;  4QWO A;  4I3A A;  5EPH A;  1GHP A;  4GHI A;  4MEZ A;  3O87 A;  2P74 A;  4E6W A;  3N7W A;  1XJ4 A;  3PBS A;  3OCL A;  5KZH A;  2HDS A;  4BD0 A;  3VP1 A;  5AQB A;  2DRW A;  3AGE A;  1DJA A;  3QNC A;  1FSY A;  5HFO A;  1LL9 A;  3IX4 A;  1FR1 A;  4WMC D;  3IQA A;  1YSP A;  3M2K A;  3VMA A;  3SW1 A;  2ZQ9 A;  4X53 A;  4IVK A;  3N8L A;  2V1Z A;  3C38 A;  4N1H A;  3MJQ A;  1XPB A;  1CI9 A;  3ITA A;  5HW3 A;  3KYQ A;  1K25 A;  3C8C A;  5A93 A;  3NBL A;  5G4Z A;  2UV0 E;  5HDC A;  1PRQ A;  5FAQ A;  2Y2K A;  4KEN B;  1YT4 A;  3GTC A;  4JPM A;  4P0M A;  4OON A;  1MZU A;  3VOZ A;  3IHA A;  4CJN A;  1ODV A;  4X56 A;  3HLC A;  1NRJ A;  3DW0 A;  2W3D A;  3N8S A;  4HJ6 A;  2O9B A;  4EWF A;  2Z2M B;  3NUL A;  4PKY A; 
#chains in the Genus database with same CATH homology
 3KO6 A;  4HH3 A;  4EXO A;  4I3I A;  2JHE A;  2J3T C;  2W0N A;  4BJP A;  3LI9 A;  1P9R A;  4F3L B;  4Q0I A;  1TS8 A;  5TBM B;  2PT7 A;  3NOP C;  4NKP A;  2W27 A;  3LFV A;  4FSF A;  1VHM A;  3UMD A;  4HH2 A;  2KX6 A;  4IUK A;  1T1B A;  1N9N A;  2Y8H A;  3O5Y A;  4HJ3 A;  2QWS A;  2OOL A;  4DJ2 A;  1H3Q A;  4CLC A;  3EQU A;  3EQV A;  3PR6 A;  1OTA A;  4CQH A;  2NUP C;  4MCW A;  3E4Q A;  2MJ6 A;  3VOL A;  4MN5 A;  3BWL A;  3CWF A;  1XJ6 A;  1D7E A;  4R6L A;  4R38 A;  4GLQ A;  2VZW A;  3ZYT A;  4GS9 B;  4ZRR A;  4NXG A;  1BYW A;  3MQ0 A;  2GJ3 A;  4KUK A;  3T4T A;  2O9A A;  3B33 A;  3LIC A;  1JNU A;  4EER A;  5F6A A;  1DP9 A;  5L8M A;  2W1T B;  4RQ9 A;  2XRO A;  2P7J A;  4ARZ A;  3H82 A;  2QJ5 A;  4XT2 B;  4MN6 A;  2L4R A;  4NXB A;  2KOI A;  4PHT A;  1T18 A;  2I9V A;  1DP8 A;  3TJZ C;  3C30 A;  5DFY A;  3BY8 A;  1T1C A;  1UWP X;  2VV8 A;  4OOM A;  3GEC A;  4HP9 A;  1OT9 A;  2V0W A;  2JKT I;  4L9E A;  5DF9 A;  3KSF A;  4EEU A;  2M1C A;  4UQI S;  2Z6D A;  1OPX A;  1F5M A;  2BAS A;  1DRM A;  1OTE A;  1MKM A;  5A8B A;  1XJ3 A;  5CX7 A;  1TF1 A;  2W3E A;  2YKF A;  1N9L A;  3F1N A;  4I3J A;  4O8G A;  3MMH A;  2XRN A;  1S1Y A;  2INW A;  2QKP A;  2A2L A;  3IS2 A;  3UE6 A;  3KYZ A;  5HPI A;  1W63 Q;  1YKD A;  5IS1 A;  3PBO A;  3PYP A;  2HGV A;  3DBA A;  4WEK A;  2QHK A;  1XFQ A;  4BBV A;  1TS6 A;  3OBF A;  5AJG A;  3MR0 A;  1TS7 A;  1OJ5 A;  2QJ7 A;  1ZHH B;  2OWH A;  3HJI A;  1T19 A;  4WF0 A;  2KLI A;  3PHY A;  4Y2F A;  2GNX A;  1NLY A;  2HJ9 C;  2XA7 M;  3U2A A;  2VJW A;  4HOI A;  4M4X A;  1UGU A;  2PD7 A;  2PYR A;  3HJK A;  1V9Y A;  3R7W A;  3A0R A;  1D06 A;  3LID A;  1OJG A;  3PXP A;  4WUJ A;  3E98 A;  4HP4 A;  2Y79 A;  4JGQ A;  5HSQ A;  5C5K A;  3LUQ A;  4JGR A;  4EQ1 A;  3F1O A;  3MQO A;  3JVU A;  1LSX A;  1P9W A;  3ICY A;  5AVE A;  5LBR A;  2JKR M;  1LSV A;  2Z6C A;  2R78 A;  3PBQ A;  2ZOH A;  3LIA A;  3UME A;  1H8M A;  4EU0 A;  4NXE A;  1TS0 A;  2HJE A;  2EA9 A;  3CLO A;  3F1P A;  3G6O A;  4MDZ A;  5FL3 A;  4L9G A;  4LRZ E;  4BBT A;  2PHY A;  4YNR A;  4BBU A;  3FPW A;  2A24 A;  1W63 M;  1N9O A;  5J4E A;  5HZH A;  2B18 A;  3B42 A;  5F5Y A;  3H9W A;  4PAU A;  4KQD A;  4GHI B;  3CUE A;  3LYX A;  4ARZ B;  4DJ3 A;  2HV1 A;  2PR6 A;  4OOL A;  4YWZ A;  2M7V A;  5HD3 A;  4JGP A;  1OTB A;  4H6J A;  3B47 A;  3H7W A;  1TD5 A;  5IU1 A;  3UB9 A;  4G3V A;  1XJ2 A;  4DMZ A;  2M7U A;  3MFX A;  2P08 A;  2FZ0 A;  3E4P A;  3FPV A;  2PR5 A;  2G7U A;  1F98 A;  2VGL M;  2J80 A;  4R3A A;  5HDS A;  3T4O A;  3BJN A;  3P7N A;  3UB8 A;  1WA9 A;  2VV6 A;  1YSQ A;  4ME4 A;  3MF0 A;  4LRY C;  4YOF A;  5HDD A;  3F1N B;  1IFQ A;  2WKR A;  3NOU C;  1S66 L;  4HIA A;  3IS2 B;  2P04 A;  4EEP A;  4G3W A;  2FH5 A;  2HF6 A;  3OC2 A;  3D72 A;  3R4K A;  4GJ4 A;  1S4R A;  2D02 A;  1UWN X;  3EEA A;  2JN7 A;  3VE3 A;  2W3F A;  4UEY A;  2IA2 A;  3T50 A;  2D01 A;  3FG8 A;  4GCZ A;  2L1M A;  3C2W A;  1IOU A;  2LB9 A;  5HWW A;  3OLO A;  3LIF A;  2K31 A;  3T4L A;  2O0Y A;  3LIB A;  4MN7 A;  1NWZ A;  1OT6 A;  3LIE A;  4P6Z M;  1G28 A;  3BW6 A;  3IBR A;  4O01 A;  3T4K A;  1P97 A;  1ZTU A;  4HNB A;  1V9Z A;  2PYP A;  3NHQ A;  4FOF A;  2OAQ 1;  1VB6 A;  3ULF A;  2EWV A;  5DKK A;  3K2N A;  4R70 A;  1DP6 A;  5F68 A;  2O9C A;  1YAX A;  2XSS A;  1KOU A;  2LB5 A;  2WKQ A;  5EFW A;  2XA7 S;  4L0L A;  4KQO A;  4G3K A;  2NUT C;  3OOV A;  5IT5 A;  4IUH A;  4WLA A;  4CLC D;  3LR5 A;  5HWV A;  4EET B;  2PD8 A;  1X0O A;  3MXQ A;  3F1P B;  4O0P A;  3NJA A;  2W1R A;  4Y3I A;  2H28 A;  1MC0 A;  2V1A A;  4EUV A;  2J3W A;  5DJU A;  3K3D A;  4LLO B;  3S7O A;  2A24 B;  1S4S A;  3UE3 A;  3T4S A;  5K5B A;  3GDI A;  3PBR A;  4HI4 A;  3RFB A;  4CLC B;  4E04 A;  3V67 A;  3P01 A;  1GSW A;  2VLG A;  4I5S A;  4Y5F A;  3JVV A;  1F9I A;  1XFN A;  4HHD A;  4Q0J A;  4L9F A;  4H6J B;  5HL6 A;  2YKH A;  5HD5 A;  2ZBB A;  3E4O A;  4KUO A;  4B9O A;  4BMW A;  3HCY A;  4GW9 A;  4HQA A;  5J7E A;  3TRC A;  4JGO A;  3MQQ A;  4IJG A;  3A0V A;  2O99 A;  3UB7 A;  3H82 B;  5I5L A;  4WEL A;  2JKT M;  2GZA A;  3D3O A;  2L0W A;  5KSH A;  3PBT A;  4I38 A;  3VV4 A;  2VGL S;  3RH8 B;  4NEE D;  4NXF A;  3CAX A;  5J3W A;  4CLC E;  2VKS A;  2K7S A;  5DKL A;  3TW8 A;  3NOT C;  2V0U A;  3EGD C;  4F3L A;  5TBM A;  4HJ4 A;  1NLZ A;  3BQ8 A;  3EWK A;  3S7N A;  5F69 A;  4Q0H A;  4I39 A;  5G4Y A;  1LL8 A;  3LR4 A;  1S1Z A;  2OAP 1;  2JKR I;  1LT0 A;  4LRX C;  3RTY A;  2CMN A;  3LR0 A;  4I3A A;  2EWW A;  2GX5 A;  4WEJ A;  3UB6 A;  3CI6 A;  4GHI A;  2ZMF A;  2ZOI A;  3KSG A;  3KX0 X;  4IHQ A;  2K2N A;  5AVF A;  5DJT A;  1OTD A;  2OWJ A;  4PKY G;  4II7 A;  4P6Z S;  5HPF A;  3K3C A;  5KIZ A;  2VX8 A;  2WKP A;  3PBN A;  3CIT A;  1XJ4 A;  4K08 A;  4WN5 A;  3TE8 A;  4EES A;  3PBS A;  4GS9 A;  3OCL A;  2B02 A;  4HY8 A;  3T4J A;  5HWT A;  3EOI A;  1P0Z A;  2V9A A;  2KDK A;  4ETZ A;  2DMW A;  3BQA A;  2W3H A;  3R7W B;  2W1T A;  3A0S A;  3EEH A;  4WL9 A;  3ZQ5 A;  4XT2 A;  2ZMV A;  5MC7 A;  1G6O A;  3VE4 A;  3BY9 A;  3F1O B;  4QPR A;  1YSP A;  5TJJ A;  3SW1 A;  3S7Q A;  4UQI M;  1STZ A;  3IBJ A;  1GSV A;  2QYB A;  4B93 A;  2PDR A;  3C38 A;  3T4Q A;  3S7P A;  3MJQ A;  4MMN A;  5DFX A;  2VA0 A;  2V1B A;  3KYQ A;  3C8C A;  4CLC C;  3CUE C;  5G4Z A;  3EGX C;  3E0Y A;  5HDC A;  3LR3 A;  4BWI A;  4LPZ A;  1MZU A;  4ETX A;  4Z1W A;  4DN0 A;  1Y28 A;  2W3G A;  1T1A A;  3LI8 A;  1EW0 A;  2VEA A;  1LSW A;  1ODV A;  2VV7 A;  3H7W B;  3W2Z A;  3KSI A;  1NRJ A;  1S67 L;  4AFI A;  2W3D A;  4HJ6 A;  2O9B A;  4EW7 A;  3FC7 A;  2J3T D;  3OCN A;  3KSH A;  1GSX A;  4PKY A;  1OTI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...