1ERMA

X-ray crystal structure of tem-1 beta lactamase in complex with a designed boronic acid inhibitor (1r)-1-acetamido-2-(3-carboxyphenyl)ethane boronic acid
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
263
structure length
262
Chain Sequence
HPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRWEPELNEAIPNDERDTTMPAAMATTLRKLLTGELLTLASRQQLIDWMEAKVAGPLLRSALPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords TEM-1 BETA-LACTAMASE
publication title Structure-based design guides the improved efficacy of deacylation transition state analogue inhibitors of TEM-1 beta-Lactamase(,).
pubmed doi rcsb
source organism Escherichia coli
total genus 90
structure length 262
sequence length 263
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2000-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 1ermA00
2WK0A 5GHZA 3NY4A 3WRZA 1CEFA 1GHPA 3G30A 1NY0A 2Y2NA 1PIOA 4XUZA 3O86A 1FCNA 1BLHA 2DRWA 3V5MA 2WGWA 1LI9A 1YLJA 4UAAA 3S22A 3S4XA 3VFHA 4JF6A 4ZDXA 5E2GA 4KZ9A 3ZG7B 3QNCA 4OPRA 1FR6A 4E3MA 3IWQA 1ZG4A 4Y7PA 4BL3A 4QD4A 5DF8A 1TDGA 5KZHA 1PZPA 3MZFA 5CERA 3BFEA 3NI9A 3HLEA 5DVAA 3BLSA 2EFUA 3ITAA 5EOEA 3EQVA 4EWFA 4H8RA 2HDRA 5CGXA 4RA7A 5JYOA 4KG6A 4WMCD 4Y0UA 4DE1A 1YM1A 5EE8A 1H8ZA 3B3XA 1XA7A 1KE4A 3Q81A 3UDFA 4E6XA 2EXAA 3G4PA 2OSUA 4JXGA 5FQMA 4PM8A 1LHYA 1K38A 1VM1A 4XXRA 3GQZA 2ZC6B 4KZ3A 4OQIA 5FAPA 1IKIA 3D4FA 4KQOA 3P09A 4JXSA 1DY6A 3ZG0A 1OMEA 3ZFZA 1G6AA 2H0TA 4S2IA 2ZLYA 4GB7A 1BLPA 3WS5A 4DKIA 3TSGA 3GSGA 3VP1A 4R1GA 5F1GA 2OLUA 5AQAA 1E4DA 4A5RA 4MBFA 1GCEA 4PM9A 1BLSA 5FI6A 5EPHA 1IYSA 4OKPA 4RVAA 4BLMA 4U0XA 1JTDA 2Y2LA 3ZG5A 4MNRA 4P0MA 1HZOA 3GVBA 5A90A 4QY5A 4R0QA 2ZQ9A 5DF7A 4N92A 4WEJA 5FQ9A 4E3KA 4S2PA 4IVIA 1HD8A 3IWIA 4P85A 2IWDA 3HLFA 1MY8A 3PBTA 1JWZA 3HUNA 3GV9A 1MWSA 3C5AA 3UN7A 5EVID 1XA1A 3OPRA 5M1AA 1BZAA 2V2FF 4ZJ3A 2J9PA 4R3JA 4S2JA 4D2OA 1O07A 3G34A 1YLYA 4KQRA 1BTLA 3HBRA 1PYYA 4N9KA 4P87A 5CHJA 3UPPA 1W79A 5HFOA 2P74A 4WZ5A 1FSYA 2XH9A 4BQMA 5DTTA 5TGFA 2QPNA 5F83A 1IELA 2Q9NA 2Y2PA 4OPQA 2Y2GA 3UDIA 2XD1A 4K91A 5M18A 3IXBA 3CG5A 2X01A 4ID4A 2IWCA 3QNBA 5TFQA 4OQGA 4WEKA 3GRJA 4JBFA 3MZDA 3IH9A 1C3BA 4LV2A 3P98A 4R3BA 3UY6A 1TEMA 2C5WB 2ZM0A 5GLDA 2WZXA 4RX3A 1ZKJA 2Y2KA 5HAIA 1K4FA 1ONHA 4DE3A 1PW8A 1K57C 1ES2A 1GA9A 4BD1A 4ZJ1A 1ES3A 5FAQA 4BD0A 2ZD8A 4KQQA 2HP6A 3HVFA 3BFFA 4E6WA 4EUZA 3OCLA 4OOLA 5EVLA 4C75A 3VOYA 4QB8A 1DJBA 1KVLA 3MBZA 1ERMA 5HARA 1CI8A 4P6BA 5U47A 1JVJA 4WM9A 2BLSA 3OPHA 3UDXA 5FQJA 2VGKA 2WGWB 1QMFA 3A3IA 2ZC4B 2WADA 3NBLA 4OPZA 4BENA 5DTSA 4X56A 4R23A 3JYIA 3FWLA 1I2WA 1U60A 1MBLA 1FOFA 4MBKA 4K0WA 3HLGA 5BOHA 1K54C 4N1HA 3Q7VB 4KG5A 1IYOA 4C3QA 1IYPA 1CEGA 2J8YA 4GKUA 4FCFA 2HP9A 2WKHA 3DTMA 2XDMA 5CEDA 4CJNA 5CRFA 4LV1A 1KGGA 3C4OA 2XFTA 2XF3A 4KG2A 5DTKA 5FQIA 1K55A 4S2MA 3IT9A 3LO7A 5CGWA 3FKVA 5M19A 4PM6A 4JXWA 1NRFA 1WE4A 3C4PA 3SOIA 4GDNA 3Q7VA 5F82A 4WMCA 3PAEA 2XD5A 3HUOA 3PTEA 4BL2A 3CMZA 3N8LA 1FCMA 3M2KA 4K0XA 4M3KA 3ZVWA 4OLDA 4IEDA 3WWXA 1VQQA 1E3UD 5IHVA 1BT5A 3ITBA 1NXYA 3UE0A 3ZG8B 5CGSA 2XGNA 3ZGAB 1L0GA 2PU2A 3IF5A 3OPPA 4GD6A 4KZ7A 1YLZA 1RCJA 4OOMA 3LEZA 3Q82A 2RL3A 4GNUA 5D3OA 4S2OA 4IVKA 3Q07A 3VP3A 2QMIA 1HVBA 2B5RA 5CHUA 3MZEA 2EX6A 3E2KA 5A91A 1ALQA 1ESIA 4KZ8A 2RCXA 1JTGA 1NYYA 5AQ9A 3HREA 3GTCA 1NYMA 1LL5A 3FV7A 4OLGA 3ZHHA 1YQSA 4EQIA 3G32A 4KZ4A 5EOOA 3N6IA 3VP4A 4ZBEA 2ZQ8A 4DXCA 4UA6A 3PBNA 3TOIA 4S2KA 3VFFA 1BULA 4OOYA 1EI5A 3BFCA 1BSGA 4OPYA 1PI4A 2I72A 1K56A 3ZVTA 1RGYA 1H5XA 2Y2QA 3WRTA 1W5DA 2H5SA 2ZJ9A 2H10A 2Y4AA 5GHXA 4HBTA 4HBUA 1YMSA 4NETA 3M2JA 4JLFA 1ESUA 2EX8A 2Q9MA 4X68A 3BYDA 1GA0A 2A49A 3V3RA 3A3FA 2WKEA 1K56D 3G35A 4UHUA 4E3NA 3C7VA 2HDUA 1PW1A 5EVIA 4LENA 1KGFA 3UE1A 2JCHA 1TVFA 5CXWA 3N8SA 3DWKA 2Z2LB 1YLTA 4U0TA 1N4OA 1CI9A 3AGEA 1HTZA 4DE0A 3AGFA 1XXMA 1L0DA 2Y2JA 3EQUA 3IHAA 4OVDA 1Z6FA 4LCLA 1M40A 4L0LA 4MEZA 4IBRA 4WBGA 1MKIA 1SCWA 3W8KA 3TG9A 1ES4A 2EX2A 3QHYA 2WUQA 5E2FA 1XKZA 3AGDA 3O88A 3FYZA 4BJPA 5CTNA 2EX9A 2G2WA 3C7UA 5EUAA 2ZC7A 3IH8A 3MXSA 1FSWA 3Q1FA 4HEFA 4N1XA 4OH0A 5J8XA 4S2NA 4UA7A 1NZOA 1S6RA 3PBSA 1NJ4A 1Q2PA 2ZQDA 2HPBA 2HDSA 1MXOA 3WS2A 5A93A 1AXBA 3MXRA 4EV4A 4JF4A 5FI2A 3SH8A 3NDEA 3FKWA 4PPRA 4S2LA 2XQZA 1W8QA 2R9WA 4QY6A 4C6YA 5FA7A 3PBRA 1YT4A 3ZNTA 4E3LA 3A3EA 3HLWA 2XFSA 4ZAMA 3VP2A 2BG1A 3HLCA 4O7DA 2JE5A 3E2LA 1LI0A 1KVMA 3IXDA 1SDEA 5KSCA 1I5QA 5HAPA 3OCNA 1Q2QA 5FI7A 4ZJ2A 3MKFA 5TR7A 4CPKA 2EXBA 2C6WB 2PBYA 2ZMAA 4XUXA 3DWZA 4Y0OA 1PWDA 3M6BA 2ZC5B 4E3OA 1IKGA 3W4PA 2J9OA 3IF6B 1S0WA 5FATA 5GHYA 3IXHA 3VSLA 3MKEA 1MWRA 5FQQA 5CECA 2FFYA 3CJMA 5EECA 2WKIA 4GD8A 2Y2MA 5FSRA 4DDSA 1Y54A 1J9MA 3N4IA 4OP8A 4RX2A 2V1ZA 1QMEA 4Z9QA 2ZM8A 1XX2A 1N9BA 3O87A 1MPLA 5HAQA 2X71A 4DE2A 1E3UA 1MWUA 3BLMA 3IF6A 4MBHA 4KZBA 4OONA 1EROA 2ZC3B 1JWVA 1XPBA 3HLDA 3HLBA 2JC7A 2UWXA 1YLPA 4KENB 5FASA 4QU3A 1L2SA 2WGVA 1K6SA 5G18A 2P9VB 4GDBA 4EBLA 3GR2A 1YMXA 2Y55A 4DXBA 3RXXA 1EWZA 3UE3A 1SKFA 3M6HA 5AQ7A 1K25A 1O7EA 1KE0A 3IQAA 4X53A 3CZDA 4JKTA 3WS4A 2OLVA 2WZZA 3V3SA 3N8RA 5AQBA 2XEPA 2IWBA 3UPNA 3PBQA 2J7VA 5E43A 2P9VA 4YINA 4X69A 5GL9A 4QJGA 4HESA 4LV0A 4JXVA 1L0FA 2H0YA 2WAEA 2WYXA 5EVIB 3WS1A 1SHVA 1I2SA 3MFDA 1LL9A 3LCEA 4R4SA 4X55A 2GDNA 2Y91A 3BM6A 2ZQCA 4GZBA 1ERQA 1DJAA 5FDHA 2Y2OA 3G31A 3G2ZA 3ZNYA 4KZAA 4RYEA 5A92A 1KDWA 4OQ0A 2OV5A 3FZCA 4F94A 1KGEA 5HW3A 3N7WA 4KZ5A 5EVIC 1TDLA 3PBOA 5CTMA 4IBXA 4LCMA 2E8IA 2Y59A 3SH9A 3SS3A 1L0EA 3I7JA 3SS5A 3UPOA 3OPLA 4DDYA 5L2FA 1NZUA 2DCFA 3OZHA 4LV3A 4PMAA 4ZTKA 5GLAA 4WZ4A 4PM5A 4FD8A 1FCOA 4GN2A 4JF5A 3SS4A 3OC2A 4B4ZA 2HP5A 3IXGA 3A3JA 1H8YA 5CEBA 4WZ5C 1RGZA 1CK3A 2XLNA 2G2UA 4EBNA 4Y0TA 1ONGA 1K6RA 3O3VA 4MLLA 4U3TA 1SDNA 1W7FA 4S2NC 4Q8IA 2VGJA 3BRMA 1PWCA 1G68A 5HX9A 4DRTA 1ZC2A 4N9LA 3UNWA 2A3UA 1IEMA 2JBFA 5CHMA 4OP5A 3VSKA 2CC1A 3V39A 1E25A 2ZQ7A 5FQKA 2EFXA 1FQGA 1LLBA 1PZOA 3W4QA 4WELA 1ZG6A 5KMWA 3LY3A 4YFMA 5JYPA 1XGJA 1GHMA 3NC8A 3V50A 4B4XA 5HL1A 4B88A 1DJCA 1M6KA 3NIAA 3G2YA 3W4OA 5E2HA 1YLWA 3ZG9B 1BUEA 5KSHA 1KDSA 3BECA 5DF9A 3UO9A 5GLBA 2V20A 2ZM2A 4UA9A 3WS0A 4FSFA 3IHBA 3SH7A 1WYCA 1WYBA 2ZQAA 2R9XA 3NCKA 3Q7ZA 1JWPA 4E3JA 2FFFB 2X02A 3NDGA 1MWTA 1IYQA 3PAGA 5I94A 3S1YA 2Y2HA 5F1FA 4OQHA 4DF6A 2Z2MB 2XR0A 5FAOA 4KZ6A 4E3IA 4GOGA 3BFGA 4QHCA 1XGIA 4FH2A 1K57A 4FH4A 1XP4A 5E2EA 1W8YA 3VMAA 3A3DA 2WAFA 3GMWA 3HL9A 3VP0A 4X6TA 3ZCZA 4WYYA 1KE3A 1K4EA 2PU4A 2QZ6A 2HDQA 3LY4A 1K55C 1FR1A 2Y2IA 4PM7A 3HUMA 4R4RA 3VOZA 4EBPA 5GLCA 1BLCA 2WGIA 4NK3A 3RJUA 3BFDA 1GHIA 3IF6C 3DW0A 2DNSA 1RP5A 3BEBA 3ISGA 1ES5A 3ZDJA 3RXWA 2XK1A 3IWOA 1PWGA 4JPMA 1K54A 1PI5A
chains in the Genus database with same CATH superfamily
4G3WA 5GHZA 3NY4A 2HV1A 2L4RA 5DJTA 4DJ3A 3S22A 3T1QB 4CLCC 4KZ9A 4JGPA 3QNCA 4OPRA 1FR6A 4E3MA 3IWQA 3F1NB 4QD4A 5DF8A 1PZPA 3MZFA 3BFEA 3LIBA 2EFUA 4EWFA 1UGUA 2HDRA 3LR5A 4DE1A 1YM1A 3B3XA 3CWFA 1XA7A 3Q81A 4O8GA 3OBFA 2CMNA 4JXGA 4PM8A 1VM1A 4KZ3A 3ZYTA 3D4FA 4II7A 1OMEA 3ZFZA 5LBRA 1G6AA 4S2IA 2ZLYA 4GB7A 1BLPA 3NOTC 3QP6A 3GSGA 2OOLA 3T4JA 1E4DA 2VJWA 3BW6A 5EPHA 1G28A 2VA0A 3JVVA 1JTDA 2Y2LA 3UMEA 4MNRA 4R0QA 2ZQ9A 3EEHA 5FQ9A 1HD8A 3R4KA 2JKTM 4P85A 2MJ6A 3GV9A 3DTEA 3UN7A 5HDDA 5M1AA 1BZAA 1JNUA 4R3JA 4D2OA 1O07A 1H8MA 5F83A 2Q9NA 2Y2GA 1LT0A 3IXBA 2IWCA 5TFQA 4OQGA 1T1CA 2QYBA 4JBFA 3MZDA 2R78A 3IH9A 3NECA 1C3BA 3P98A 1TEMA 2P04A 4PHTA 1ODVA 4UQIM 3T50A 3CPTB 1PW8A 1ES2A 4ZJ1A 1ES3A 2KLIA 5FAQA 4BD0A 2ZD8A 4KQQA 3BFFA 4QB8A 2VV6A 3MBZA 5HARA 2Y79A 4ETXA 4WM9A 3D3OA 1NLZA 2ZC4B 2B02A 3JYIA 3FWLA 1I2WA 2VGLM 5G4ZA 1ACFA 4MBKA 4GKUA 2VZWA 4FCFA 2HP9A 5CEDA 3VV4A 2J80A 4KG2A 3L9KA 3FKVA 1NRFA 4G3VA 5F82A 3UB6A 5EFWA 4BL2A 3CMZA 4EERA 4K0XA 1NXYA 3IF5A 3OPPA 1RCJA 3Q82A 4GNUA 4HNBA 3MZEA 5A91A 4KZ8A 3DTIA 1S1ZA 3NOPC 1LL5A 4GW9A 4EQIA 3MFXA 3C30A 3VFFA 1BULA 3BFCA 1A0KA 1BSGA 4OPYA 1PI4A 1RGYA 3NHQA 1H5XA 1CQAA 4KUOA 5F69A 4MN7A 3EGDC 3H82A 1GA0A 2INWA 3V3RA 2WKEA 3G35A 4E3NA 2AVXA 3C7VA 2HDUA 2W3FA 3N8SA 4WL9A 1DP6A 1CI9A 4WUJA 3AGFA 1XXMA 4L0LA 4WF0A 1SCWA 1XKZA 3AGDA 3O88A 4L9EA 2JHEA 4OH0A 1S6RA 1F98A 2JKRM 3P7NA 5A93A 1AXBA 3LGOA 1TS0A 3NDEA 3FKWA 4S2LA 4XT2B 1L3LA 4EUVA 3A3EA 4ZAMA 3VP2A 3HLCA 1KVMA 1SDEA 5IT5A 2A2LA 5TR7A 4CPKA 2EXBA 3S7NA 1XJ2A 4ARZB 3CHWP 4Q0HA 4JGRA 4XUXA 4Y0OA 1PWDA 3E98A 2ZC5B 3W4PA 3IF6B 4EETB 3MS6A 5FQQA 5EECA 2Y2MA 5FSRA 1VETB 2V1ZA 1QMEA 5HAQA 3CAXA 1E3UA 3BLMA 4MBHA 4KZBA 1EROA 1JWVA 3HLDA 3HLBA 4QU3A 2WGVA 1K6SA 4DXBA 3RXXA 1EWZA 4H6JA 1O7EA 3F1OB 3KO6A 3CZDA 3N8RA 2IWBA 4LRYC 5E43A 4YINA 1S4SA 4X69A 3UE6A 2W1TB 4LV0A 4JXVA 1L0FA 2H0YA 2WAEA 2WYXA 5EVIB 3LR0A 2XSSA 3MFDA 3F1NA 5HWTA 3NULA 2PR6A 2ZQCA 3VOLA 3IS2B 4RYEA 5A92A 5EM1A 3LIAA 3T4QA 3SZTA 5EVIC 1TDLA 2G7UA 2PYRA 4LCMA 4YNRA 4IJGA 3SH9A 3UPOA 3OZHA 4WZ4A 2OAP1 4FD8A 4X25A 4BMWA 4B4ZA 2HP5A 3A3JA 1H8YA 1CK3A 2G2UA 3B47A 4U3TA 4Y2FA 3TW8A 1CJFA 2VGJA 4Q8IA 2BTFP 4EEUA 5CHMA 3HJIA 4LFUA 3V39A 1FQGA 1LLBA 1PZOA 2K7SA 4WELA 2HF6A 4YFMA 4B4XA 3NC8A 2J3TD 3PHYA 3TE8A 5KSHA 2D02A 3D9YA 4UQIS 3SH7A 1WYCA 2ZQAA 2R9XA 1JWPA 3U2AA 2O9BA 3VE3A 1S66L 3PAGA 4DF6A 1ZHHB 2XR0A 1N9NA 4E3IA 4QHCA 3KYZA 3T1SA 3C38A 2VGLS 1PNEA 3CPTA 5GLCA 1BLCA 2WGIA 1MC0A 1GHIA 3DW0A 1RP5A 1YSPA 3RXWA 4EESA 3JPUA 5IS1A 5L10A 3C8CA 1CEFA 3G30A 1T18A 2O0YA 1LI9A 4JF6A 2W3DA 4Y7PA 4IUHA 4QWOA 3ULFA 5CERA 2FZ0A 3BLSA 2V1BA 3EQVA 2PRFA 5CGXA 5JYOA 5EE8A 1OJ5A 1KE4A 3UDFA 4E6XA 3LIDA 5FQMA 5F68A 1K38A 2L1MA 3GQZA 2ZC6B 4OQIA 3UB8A 2QJ7A 2H0TA 3WS5A 3TSGA 1DP8A 4R1GA 5F1GA 2OLUA 4A5RA 2JKFA 4MBFA 1GCEA 5FEFA 1LSVA 2JKRI 5FI6A 4OKPA 4BLMA 4U0XA 2NUTC 5DF7A 3OOVA 4S2PA 1LSWA 2IWDA 3HLFA 3PBTA 1JWZA 2PYPA 4DJ2A 4ESPA 4HJ6A 3IBRA 3C5AA 2QKPA 2V2FF 4ZJ3A 2J9PA 3G34A 4N9KA 5FDSA 1PYYA 3UPPA 1W79A 4BQMA 2XH9A 1IELA 3UDIA 4K91A 2VX8A 4L9FA 4Q0JA 2JKGA 4HP4A 2Y2KA 4DE3A 1GA9A 4I3IA 3T4LA 2O99A 3G6OA 3HVFA 3OCLA 3VOYA 3K3CA 1DJBA 1KVLA 1ERMA 3BWLA 2BLSA 4D60A 3CI6A 5FQJA 2WGWB 4XT2A 5DTSA 4HIAA 4X56A 2EA9A 4R23A 4K0WA 5BOHA 3Q7VB 4KG5A 3UB7A 1X0OA 5HPIA 2ZBBA 4CJNA 4LV1A 4ARZA 4Y15A 5DTKA 3VE4A 3SOIA 2PT7A 5HD3A 4WMCA 3P01A 3QP5A 3HUOA 3PTEA 1FCMA 1VETA 2VLGA 4OLDA 1VQQA 1E3UD 5IHVA 3ITBA 2J3WA 5FEGA 1YLZA 3KX0X 4S2OA 4IVKA 3Q07A 2QMIA 2B5RA 5CHUA 1SKOB 1JTGA 2QJ5A 3HREA 4OLGA 3ZHHA 3LR4A 3VP4A 4ZBEA 2ZQ8A 4CLCD 4DXCA 2ACGA 3PBNA 1T19A 2PD7A 3PR6A 1IFQA 1H3QA 3EGXC 3WRTA 2Y4AA 4HBUA 1YMSA 4NETA 4JLFA 2EX8A 2W1TA 1K56D 5EVIA 3JVUA 1KGFA 3UE1A 2VK3A 4NEED 4U0TA 3AGEA 1AWIA 5TBMB 1HTZA 3IHAA 1J3WA 2Y2JA 1VB6A 5EVEA 1M40A 2A24B 4IBRA 4WBGA 3TG9A 2GNXA 4I39A 1ES4A 2LB5A 2WUQA 5E2FA 2ZC7A 3Q1FA 5HZHA 4N1XA 4UA7A 3PBSA 5MC7A 1MXOA 3KYQA 4JF4A 3SH8A 4PPRA 1W8QA 4QPRA 5FA7A 1YT4A 1UWPX 3ZNTA 4HH2A 3HLWA 2XFSA 2BG1A 3E2LA 1LI0A 3IXDA 4JGOA 1F9IA 5HAPA 3OCNA 1Q2QA 5J4EA 1OTIA 3MKFA 1FILA 5TJJA 3RH8B 2Q0OA 3M6BA 2FH5A 2J9OA 5GHYA 3VSLA 2PBDP 3MKEA 1MWRA 5CECA 4GD8A 2W0NA 1J9MA 3N4IA 3U4LP 2ZM8A 1S4RA 3BQAA 3E0YA 1N9BA 3O87A 1MPLA 1OT6A 1XJ3A 1XPBA 2OAQ1 3W2ZA 2UWXA 5FASA 2P9VB 3S7PA 4GDBA 4EBLA 1YMXA 3UE3A 3M6HA 2Z6CA 1K25A 1K0KA 2OLVA 4BWIA 3V3SA 5AQBA 3UPNA 2B95A 3SW1A 2J7VA 2I9VA 4NXBA 3WS1A 1LL9A 4X55A 4PKYG 1SZVA 2GDNA 1DJAA 3BQ8A 2P08A 3ZNYA 1KDWA 2ZMVA 2OV5A 4F94A 5AVEA 2K31A 5HWVA 4GLQA 2E8IA 4X1MA 3I7JA 1NZUA 3CUEC 5GLAA 4ZTKA 4PM5A 4GN2A 1F5MA 3LI9A 3OC2A 3IXGA 1T1BA 2ZL1B 2XLNA 1ONGA 4MLLA 3PYPA 4S2NC 3KYEA 1G68A 2KX6A 5HX9A 1ZC2A 2A3UA 2VV7A 3VSKA 4OP5A 2CC1A 3GECA 5FQKA 4Y3IA 3W4QA 5KMWA 3LY3A 1DJCA 3NIAA 3W4OA 4LPZA 5E2HA 1YLWA 1MKMA 5DF9A 3UO9A 1OTAA 3WS0A 3NCKA 3DAVA 4FOFA 4DMZA 1IYQA 2Y2HA 2Z2MB 2BASA 4GOGA 3BFGA 1S1YA 5E2EA 2WAFA 3GMWA 1YKDA 1KE3A 4G3KA 4PM7A 4EBPA 1FR1A 4R4RA 5HSQA 3HUMA 1XJ4A 1Z09A 5IU1A 3IF6C 2DNSA 4FUWA 4PAUA 1ES5A 3ZDJA 2XK1A 4Q0IA 2ZOIA 1PI5A 2WK0A 3EEAA 3WRZA 3MF0A 1NY0A 2Y2NA 1PIOA 4HJ4A 1FCNA 4EW7A 1BLHA 2WGWA 4UAAA 2M1CA 4ZDXA 5E2GA 3CLOA 4BL3A 4NXEA 5KZHA 3LICA 3ICYA 3HLEA 5DVAA 3IBJA 3ITAA 5EOEA 3E4QA 4RA7A 4WMCD 4Y0UA 1H8ZA 4EEPA 4DN0A 3G4PA 5L09A 5FAPA 5G4YA 1CF0A 4KQOA 2M7VA 1DY6A 3ZG0A 2HJ9C 4NXFA 3VP1A 2W3HA 5AQAA 3HJKA 3R7WB 3E4OA 4PM9A 1N9LA 1IYSA 4RVAA 4ZRRA 2EWWA 3ZG5A 4P0MA 4QY5A 4BBUA 4N92A 1TF1A 3NOUC 4E3KA 4EQ1A 1V9YA 3IWIA 4R70A 1MY8A 2KDKA 3MQ0A 4HHDA 5EVID 1XA1A 3OPRA 1WA9A 1YLYA 4KQRA 1BTLA 5CHJA 5HFOA 1VEUB 2P74A 3QP4A 4GS9B 2QPNA 3KSHA 4OPQA 2XD1A 5TBMA 3CG5A 4ID4A 4I38A 3QNBA 2A24A 4R6LA 4LV2A 4R3BA 2H28A 3UY6A 5GLDA 4RX3A 3LEQA 1XFNA 2ZOHA 1ONHA 4BD1A 4HOIA 4E6WA 2NUPC 4OOLA 4C75A 3O5YA 1CI8A 4P6BA 5U47A 5HDCA 1GSVA 1QMFA 4OPZA 4BENA 5J7EA 1FIKA 1MBLA 1U60A 4Y5FA 5EM0A 3HLGA 1K54C 4N1HA 1IYPA 1CEGA 2D01A 3KSGA 1H0MA 1KGGA 3C4OA 2E8JA 3QP2A 1K55A 3IT9A 3LO7A 5M19A 1NRJA 4PM6A 3UMDA 4JXWA 5L8MA 2XD5A 4EXOA 2VEAA 3EWKA 1IOUA 4IEDA 3BY8A 3UE0A 3ZG8B 5CGSA 2XGNA 3ZGAB 3HCYA 4OOMA 3LEZA 2RL3A 2ZMFA 1ALQA 1ESIA 5AQ9A 3GTCA 3N6IA 4CQHA 1GSWA 3MSHA 4UA6A 4OOYA 2H5SA 2ZJ9A 4LRXC 3LYXA 3M2JA 1ESUA 4X68A 3BYDA 2A49A 3A3FA 4BBVA 3FPVA 2JCHA 5CXWA 2Z2LB 2VV8A 1N4OA 4MMNA 4DE0A 3EQUA 4OVDA 1Z6FA 3CUEA 4MEZA 2M7UA 1MKIA 3B42A 2QHKA 2EX2A 3CITA 3QHYA 3C7UA 2G2WA 3IH8A 3MXSA 5AVFA 1FSWA 4GJ4A 5J8XA 5FL3A 4S2NA 1NZOA 2XA7M 2ZQDA 2HPBA 2HDSA 2HJEA 3MXRA 2ZL1A 2XQZA 4Z1WA 3LIFA 3DTKA 3PBRA 2JE5A 2W1RA 1W63Q 3DWZA 3A0RA 1S0WA 2HZ5A 5EV0A 3IXHA 4R38A 4P6ZM 4ME4A 1P9WA 4IHQA 2FFYA 1Y54A 1GSXA 3K3DA 4FTXA 2X71A 5F6AA 3IX4A 3IF6A 4CLCB 4KUKA 4OONA 1YLPA 4I5SA 3MR0A 1L2SA 5G18A 4HJ3A 3GR2A 3A0SA 3F1PB 3KSIA 1KE0A 3WS4A 2WZZA 1G5UA 1EW0A 3LUQA 3PBQA 5GL9A 2L0WA 1I2SA 5DFXA 1XFQA 3F1OA 4R4SA 2Y91A 1ERQA 5FDHA 2Y2OA 3G31A 3G2ZA 3T4SA 4KZAA 5I5LA 1TS7A 3FG8A 4IBXA 2Y59A 1L0EA 2JN7A 3SS5A 4M4XA 2HGVA 3IS2A 1FCOA 4JF5A 3SS4A 4EBNA 1RGZA 4Y0TA 1K6RA 2V8CA 3O3VA 1W7FA 2PR5A 3R7WA 1VHMA 3UNWA 2JBFA 1E25A 2ZQ7A 2Y8HA 1ZG6A 2PAVP 5JYPA 3V50A 4HQAA 5HL1A 3EOIA 2UV0E 2XROA 1M6KA 3LR3A 4GCZA 1KDSA 2V20A 4UA9A 4LLOB 4FSFA 1G6OA 3Q7ZA 1OJGA 2FFFB 2X02A 5J3WA 5F1FA 4OQHA 4PKYA 1VEUA 3RTYA 4GS9A 4MCWA 1XGIA 4FH2A 4FH4A 1P97A 1XP4A 3VMAA 5C5KA 5K5BA 3HL9A 2XRNA 3ZCZA 1K4EA 2PU4A 2GZAA 2QZ6A 5AJGA 3LY4A 1K55C 2Y2IA 3RJUA 3BEBA 3IWOA 4E04A 4JPMA 1K54A 1DRMA 1GHPA 4XUZA 3O86A 1KOUA 2DRWA 3V5MA 1YLJA 3S4XA 3VFHA 3OLOA 2GJ3A 3ZG7B 1STZA 1V9ZA 1ZG4A 1ZTUA 1TDGA 3UB5P 2W3GA 4JGQA 4ETZA 3IX3A 4F3LB 3NI9A 3T4KA 2VKSA 4H8RA 1NWZA 2QWSA 2OWHA 4KG6A 4GHIB 4K08A 3NJAA 2GX5A 2EXAA 2OSUA 3E4PA 1S67L 4NXGA 1LHYA 4XXRA 1IKIA 3P09A 4JXSA 4L9GA 3T1RA 2K2NA 4DKIA 3L7HA 1OT9A 3MJQA 4B93A 4BBTA 1OTBA 4B9OA 1BLSA 3GDIA 3LFVA 1N9OA 1HZOA 3GVBA 5A90A 4HH3A 4WEJA 3T1XA 4HY8A 4IVIA 3HUNA 4HP9A 3T4OA 1MWSA 1YPRA 4S2JA 1D06A 3HBRA 4P87A 5DKLA 2XA7S 4WZ5A 1FSYA 3RFBA 5DTTA 5TGFA 2Y2PA 5M18A 2X01A 2V9AA 3FPWA 2P7JA 4WEKA 3GRJA 2ZM0A 2C5WB 2WZXA 1ZKJA 5HAIA 1K4FA 2PDRA 1K57C 3TJZC 5KIZA 3H7WB 2OWJA 2B18A 2HP6A 5DKKA 4EUZA 3V67A 5EVLA 4R3AA 1JVJA 3UB9A 3OPHA 3FC7A 3UDXA 1PRQA 2VGKA 3NBLA 3A3IA 2WADA 4P6ZS 1FOFA 2IA2A 1YAXA 1IYOA 4C3QA 4IUKA 2J8YA 2WKHA 3DTMA 2XDMA 5CRFA 2XF3A 2XFTA 5FQIA 4S2MA 5CGWA 1WE4A 3C4PA 4GDNA 3Q7VA 3PAEA 2YKHA 3N8LA 3M2KA 3ZQ5A 4M3KA 5L07A 3ZVWA 3WWXA 1BT5A 2LB9A 5F5YA 1L0GA 2PU2A 3A0VA 4GD6A 2YKFA 4KZ7A 5D3OA 4CLCA 3QP8A 3VP3A 5HDSA 1HVBA 3LI8A 2EX6A 3E2KA 2RCXA 1NYYA 1NYMA 3FV7A 4CLCE 2V0WA 1YQSA 3G32A 4KZ4A 4I3JA 5EOOA 4RQ9A 3F1PA 4S2KA 3TOIA 1EI5A 3QP1A 1PFLA 2I72A 3ZVTA 1K56A 3TRCA 1SKOA 2EWVA 2Y2QA 1YSQA 3KSFA 1W5DA 4KQDA 2H10A 2JKTI 2DMWA 1Y28A 5GHXA 4HBTA 3K2NA 4YOFA 2Q9MA 5DFYA 2O9CA 5HD5A 4UHUA 1PW1A 2J3TC 4LENA 2WKRA 1TVFA 3DWKA 1YLTA 4NKPA 4WLAA 1BYWA 3C2WA 4LCLA 4I3AA 3W8KA 1OTDA 5A8BA 3FYZA 1TS8A 4BJPA 5CTNA 2EX9A 5EUAA 4HEFA 5HPFA 1NJ4A 1Q2PA 4Y13A 3WS2A 3MXQA 4O0PA 4EV4A 5FI2A 4Y17A 1MZUA 4QY6A 2R9WA 4C6YA 4E3LA 2O9AA 4WN5A 4O01A 4O7DA 1LL8A 5KSCA 1I5QA 2W3EA 5FI7A 2WKQA 4ZJ2A 3T12B 2PD8A 2C6WB 2PBYA 2ZMAA 4E3OA 1IKGA 4AFIA 5FATA 3B33A 3CJMA 2WKIA 3DBAA 4DDSA 1HLUP 4OP8A 4RX2A 4Z9QA 4MDZA 4X1LA 1XX2A 1TS6A 4NG2A 4DE2A 1MWUA 2ZC3B 2W27A 2JC7A 1D1JA 1OTEA 4KENB 1LSXA 1F2KA 2Y55A 3S7QA 1SKFA 1XJ6A 5AQ7A 4LRZE 3IQAA 4X53A 3MMHA 4JKTA 4EU0A 2XEPA 2V0UA 3S7OA 1DP9A 1OPXA 2P9VA 3H82B 4QJGA 4HESA 1W63M 1UWNX 1SHVA 5DJUA 3LCEA 3BM6A 1P0ZA 4GZBA 3D72A 4F3LA 4OQ0A 4HI4A 3FZCA 1KGEA 5HW3A 3N7WA 4KZ5A 3PBOA 5CTMA 3SS3A 4GHIA 3OPLA 3BJNA 3LIEA 4DDYA 5L2FA 4LV3A 2DCFA 4PMAA 3IX8A 4MN5A 1TD5A 3PXPA 3MQOA 5CEBA 4WZ5C 1SDNA 5HWWA 3BRMA 1PWCA 2PHYA 4DRTA 4N9LA 1IEMA 2Z6DA 2EFXA 1XGJA 1GHMA 1T1AA 4B88A 3G2YA 4MN6A 4LGWA 3ZG9B 1BUEA 3BECA 5GLBA 2ZM2A 1NLYA 5HL6A 3IHBA 3H9WA 4UEYA 1WYBA 3MQQA 4E3JA 2V1AA 1D7EA 3NDGA 1MWTA 5I94A 3T4TA 3S1YA 1P9RA 2V8FA 5FAOA 4KZ6A 1K57A 1Y4OA 3BY9A 1W8YA 3A3DA 5CX7A 3VP0A 4X6TA 4WYYA 2HDQA 2KOIA 3VOZA 4H6JB 4NK3A 4YWZA 3BFDA 2WKPA 3ISGA 3H7WA 1PWGA 1L0DA
chains in the Genus database with same CATH topology
2WK0A 5GHZA 3NY4A 3WRZA 1CEFA 1GHPA 3G30A 1NY0A 2Y2NA 1PIOA 4XUZA 3O86A 1FCNA 1BLHA 2DRWA 3V5MA 2WGWA 1LI9A 1YLJA 4UAAA 3S22A 3S4XA 3VFHA 4JF6A 4ZDXA 5E2GA 4KZ9A 3ZG7B 3QNCA 4OPRA 1FR6A 4E3MA 3IWQA 1ZG4A 4Y7PA 4BL3A 4QD4A 5DF8A 1TDGA 5KZHA 1PZPA 3MZFA 5CERA 3BFEA 3NI9A 3HLEA 5DVAA 3BLSA 2EFUA 3ITAA 5EOEA 3EQVA 4EWFA 4H8RA 2HDRA 5CGXA 4RA7A 5JYOA 4KG6A 4WMCD 4Y0UA 4DE1A 1YM1A 5EE8A 1H8ZA 3B3XA 1XA7A 1KE4A 3Q81A 3UDFA 4E6XA 2EXAA 3G4PA 2OSUA 4JXGA 5FQMA 4PM8A 1LHYA 1K38A 1VM1A 4XXRA 3GQZA 2ZC6B 4KZ3A 4OQIA 5FAPA 1IKIA 3D4FA 4KQOA 3P09A 4JXSA 1DY6A 3ZG0A 1OMEA 3ZFZA 1G6AA 2H0TA 4S2IA 2ZLYA 4GB7A 1BLPA 3WS5A 4DKIA 3TSGA 3GSGA 3VP1A 4R1GA 5F1GA 2OLUA 5AQAA 1E4DA 4A5RA 4MBFA 1GCEA 4PM9A 1BLSA 5FI6A 5EPHA 1IYSA 4OKPA 4RVAA 4BLMA 4U0XA 1JTDA 2Y2LA 3ZG5A 4MNRA 4P0MA 1HZOA 3GVBA 5A90A 4QY5A 4R0QA 2ZQ9A 5DF7A 4N92A 4WEJA 5FQ9A 4E3KA 4S2PA 4IVIA 1HD8A 3IWIA 4P85A 2IWDA 3HLFA 1MY8A 3PBTA 1JWZA 3HUNA 3GV9A 1MWSA 3C5AA 3UN7A 5EVID 1XA1A 3OPRA 5M1AA 1BZAA 2V2FF 4ZJ3A 2J9PA 4R3JA 4S2JA 4D2OA 1O07A 3G34A 1YLYA 4KQRA 1BTLA 3HBRA 1PYYA 4N9KA 4P87A 5CHJA 3UPPA 1W79A 5HFOA 2P74A 4WZ5A 1FSYA 2XH9A 4BQMA 5DTTA 5TGFA 2QPNA 5F83A 1IELA 2Q9NA 2Y2PA 4OPQA 2Y2GA 3UDIA 2XD1A 4K91A 5M18A 3IXBA 3CG5A 2X01A 4ID4A 2IWCA 3QNBA 5TFQA 4OQGA 4WEKA 3GRJA 4JBFA 3MZDA 3IH9A 1C3BA 4LV2A 3P98A 4R3BA 3UY6A 1TEMA 2C5WB 2ZM0A 5GLDA 2WZXA 4RX3A 1ZKJA 2Y2KA 5HAIA 1K4FA 1ONHA 4DE3A 1PW8A 1K57C 1ES2A 1GA9A 4BD1A 4ZJ1A 1ES3A 5FAQA 4BD0A 2ZD8A 4KQQA 2HP6A 3HVFA 3BFFA 4E6WA 4EUZA 3OCLA 4OOLA 5EVLA 4C75A 3VOYA 4QB8A 1DJBA 1KVLA 3MBZA 1ERMA 5HARA 1CI8A 4P6BA 5U47A 1JVJA 4WM9A 2BLSA 3OPHA 3UDXA 5FQJA 2VGKA 2WGWB 1QMFA 3A3IA 2ZC4B 2WADA 3NBLA 4OPZA 4BENA 5DTSA 4X56A 4R23A 3JYIA 3FWLA 1I2WA 1U60A 1MBLA 1FOFA 4MBKA 4K0WA 3HLGA 5BOHA 1K54C 4N1HA 3Q7VB 4KG5A 1IYOA 4C3QA 1IYPA 1CEGA 2J8YA 4GKUA 4FCFA 2HP9A 2WKHA 3DTMA 2XDMA 5CEDA 4CJNA 5CRFA 4LV1A 1KGGA 3C4OA 2XFTA 2XF3A 4KG2A 5DTKA 5FQIA 1K55A 4S2MA 3IT9A 3LO7A 5CGWA 3FKVA 5M19A 4PM6A 4JXWA 1NRFA 1WE4A 3C4PA 3SOIA 4GDNA 3Q7VA 5F82A 4WMCA 3PAEA 2XD5A 3HUOA 3PTEA 4BL2A 3CMZA 3N8LA 1FCMA 3M2KA 4K0XA 4M3KA 3ZVWA 4OLDA 4IEDA 3WWXA 1VQQA 1E3UD 5IHVA 1BT5A 3ITBA 1NXYA 3UE0A 3ZG8B 5CGSA 2XGNA 3ZGAB 1L0GA 2PU2A 3IF5A 3OPPA 4GD6A 4KZ7A 1YLZA 1RCJA 4OOMA 3LEZA 3Q82A 2RL3A 4GNUA 5D3OA 4S2OA 4IVKA 3Q07A 3VP3A 2QMIA 1HVBA 2B5RA 5CHUA 3MZEA 2EX6A 3E2KA 5A91A 1ALQA 1ESIA 4KZ8A 2RCXA 1JTGA 1NYYA 5AQ9A 3HREA 3GTCA 1NYMA 1LL5A 3FV7A 4OLGA 3ZHHA 1YQSA 4EQIA 3G32A 4KZ4A 5EOOA 3N6IA 3VP4A 4ZBEA 2ZQ8A 4DXCA 4UA6A 3PBNA 3TOIA 4S2KA 3VFFA 1BULA 4OOYA 1EI5A 3BFCA 1BSGA 4OPYA 1PI4A 2I72A 1K56A 3ZVTA 1RGYA 1H5XA 2Y2QA 3WRTA 1W5DA 2H5SA 2ZJ9A 2H10A 2Y4AA 5GHXA 4HBTA 4HBUA 1YMSA 4NETA 3M2JA 4JLFA 1ESUA 2EX8A 2Q9MA 4X68A 3BYDA 1GA0A 2A49A 3V3RA 3A3FA 2WKEA 1K56D 3G35A 4UHUA 4E3NA 3C7VA 2HDUA 1PW1A 5EVIA 4LENA 1KGFA 3UE1A 2JCHA 1TVFA 5CXWA 3N8SA 3DWKA 2Z2LB 1YLTA 4U0TA 1N4OA 1CI9A 3AGEA 1HTZA 4DE0A 3AGFA 1XXMA 1L0DA 2Y2JA 3EQUA 3IHAA 4OVDA 1Z6FA 4LCLA 1M40A 4L0LA 4MEZA 4IBRA 4WBGA 1MKIA 1SCWA 3W8KA 3TG9A 1ES4A 2EX2A 3QHYA 2WUQA 5E2FA 1XKZA 3AGDA 3O88A 3FYZA 4BJPA 5CTNA 2EX9A 2G2WA 3C7UA 5EUAA 2ZC7A 3IH8A 3MXSA 1FSWA 3Q1FA 4HEFA 4N1XA 4OH0A 5J8XA 4S2NA 4UA7A 1NZOA 1S6RA 3PBSA 1NJ4A 1Q2PA 2ZQDA 2HPBA 2HDSA 1MXOA 3WS2A 5A93A 1AXBA 3MXRA 4EV4A 4JF4A 5FI2A 3SH8A 3NDEA 3FKWA 4PPRA 4S2LA 2XQZA 1W8QA 2R9WA 4QY6A 4C6YA 5FA7A 3PBRA 1YT4A 3ZNTA 4E3LA 3A3EA 3HLWA 2XFSA 4ZAMA 3VP2A 2BG1A 3HLCA 4O7DA 2JE5A 3E2LA 1LI0A 1KVMA 3IXDA 1SDEA 5KSCA 1I5QA 5HAPA 3OCNA 1Q2QA 5FI7A 4ZJ2A 3MKFA 5TR7A 4CPKA 2EXBA 2C6WB 2PBYA 2ZMAA 4XUXA 3DWZA 4Y0OA 1PWDA 3M6BA 2ZC5B 4E3OA 1IKGA 3W4PA 2J9OA 3IF6B 1S0WA 5FATA 5GHYA 3IXHA 3VSLA 3MKEA 1MWRA 5FQQA 5CECA 2FFYA 3CJMA 5EECA 2WKIA 4GD8A 2Y2MA 5FSRA 4DDSA 1Y54A 1J9MA 3N4IA 4OP8A 4RX2A 2V1ZA 1QMEA 4Z9QA 2ZM8A 1XX2A 1N9BA 3O87A 1MPLA 5HAQA 2X71A 4DE2A 1E3UA 1MWUA 3BLMA 3IF6A 4MBHA 4KZBA 4OONA 1EROA 2ZC3B 1JWVA 1XPBA 3HLDA 3HLBA 2JC7A 2UWXA 1YLPA 4KENB 5FASA 4QU3A 1L2SA 2WGVA 1K6SA 5G18A 2P9VB 4GDBA 4EBLA 3GR2A 1YMXA 2Y55A 4DXBA 3RXXA 1EWZA 3UE3A 1SKFA 3M6HA 5AQ7A 1K25A 1O7EA 1KE0A 3IQAA 4X53A 3CZDA 4JKTA 3WS4A 2OLVA 2WZZA 3V3SA 3N8RA 5AQBA 2XEPA 2IWBA 3UPNA 3PBQA 2J7VA 5E43A 2P9VA 4YINA 4X69A 5GL9A 4QJGA 4HESA 4LV0A 4JXVA 1L0FA 2H0YA 2WAEA 2WYXA 5EVIB 3WS1A 1SHVA 1I2SA 3MFDA 1LL9A 3LCEA 4R4SA 4X55A 2GDNA 2Y91A 3BM6A 2ZQCA 4GZBA 1ERQA 1DJAA 5FDHA 2Y2OA 3G31A 3G2ZA 3ZNYA 4KZAA 4RYEA 5A92A 1KDWA 4OQ0A 2OV5A 3FZCA 4F94A 1KGEA 5HW3A 3N7WA 4KZ5A 5EVIC 1TDLA 3PBOA 5CTMA 4IBXA 4LCMA 2E8IA 2Y59A 3SH9A 3SS3A 1L0EA 3I7JA 3SS5A 3UPOA 3OPLA 4DDYA 5L2FA 1NZUA 2DCFA 3OZHA 4LV3A 4PMAA 4ZTKA 5GLAA 4WZ4A 4PM5A 4FD8A 1FCOA 4GN2A 4JF5A 3SS4A 3OC2A 4B4ZA 2HP5A 3IXGA 3A3JA 1H8YA 5CEBA 4WZ5C 1RGZA 1CK3A 2XLNA 2G2UA 4EBNA 4Y0TA 1ONGA 1K6RA 3O3VA 4MLLA 4U3TA 1SDNA 1W7FA 4S2NC 4Q8IA 2VGJA 3BRMA 1PWCA 1G68A 5HX9A 4DRTA 1ZC2A 4N9LA 3UNWA 2A3UA 1IEMA 2JBFA 5CHMA 4OP5A 3VSKA 2CC1A 3V39A 1E25A 2ZQ7A 5FQKA 2EFXA 1FQGA 1LLBA 1PZOA 3W4QA 4WELA 1ZG6A 5KMWA 3LY3A 4YFMA 5JYPA 1XGJA 1GHMA 3NC8A 3V50A 4B4XA 5HL1A 4B88A 1DJCA 1M6KA 3NIAA 3G2YA 3W4OA 5E2HA 1YLWA 3ZG9B 1BUEA 5KSHA 1KDSA 3BECA 5DF9A 3UO9A 5GLBA 2V20A 2ZM2A 4UA9A 3WS0A 4FSFA 3IHBA 3SH7A 1WYCA 1WYBA 2ZQAA 2R9XA 3NCKA 3Q7ZA 1JWPA 4E3JA 2FFFB 2X02A 3NDGA 1MWTA 1IYQA 3PAGA 5I94A 3S1YA 2Y2HA 5F1FA 4OQHA 4DF6A 2Z2MB 2XR0A 5FAOA 4KZ6A 4E3IA 4GOGA 3BFGA 4QHCA 1XGIA 4FH2A 1K57A 4FH4A 1XP4A 5E2EA 1W8YA 3VMAA 3A3DA 2WAFA 3GMWA 3HL9A 3VP0A 4X6TA 3ZCZA 4WYYA 1KE3A 1K4EA 2PU4A 2QZ6A 2HDQA 3LY4A 1K55C 1FR1A 2Y2IA 4PM7A 3HUMA 4R4RA 3VOZA 4EBPA 5GLCA 1BLCA 2WGIA 4NK3A 3RJUA 3BFDA 1GHIA 3IF6C 3DW0A 2DNSA 1RP5A 3BEBA 3ISGA 1ES5A 3ZDJA 3RXWA 2XK1A 3IWOA 1PWGA 4JPMA 1K54A 1PI5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WK0 A;  5GHZ A;  3NY4 A;  3WRZ A;  1CEF A;  1GHP A;  3G30 A;  1NY0 A;  2Y2N A;  1PIO A;  4XUZ A;  3O86 A;  1FCN A;  1BLH A;  2DRW A;  3V5M A;  2WGW A;  1LI9 A;  1YLJ A;  4UAA A;  3S22 A;  3S4X A;  3VFH A;  4JF6 A;  4ZDX A;  5E2G A;  4KZ9 A;  3ZG7 B;  3QNC A;  4OPR A;  1FR6 A;  4E3M A;  3IWQ A;  1ZG4 A;  4Y7P A;  4BL3 A;  4QD4 A;  5DF8 A;  1TDG A;  5KZH A;  1PZP A;  3MZF A;  5CER A;  3BFE A;  3NI9 A;  3HLE A;  5DVA A;  3BLS A;  2EFU A;  3ITA A;  5EOE A;  3EQV A;  4EWF A;  4H8R A;  2HDR A;  5CGX A;  4RA7 A;  5JYO A;  4KG6 A;  4WMC D;  4Y0U A;  4DE1 A;  1YM1 A;  5EE8 A;  1H8Z A;  3B3X A;  1XA7 A;  1KE4 A;  3Q81 A;  3UDF A;  4E6X A;  2EXA A;  3G4P A;  2OSU A;  4JXG A;  5FQM A;  4PM8 A;  1LHY A;  1K38 A;  1VM1 A;  4XXR A;  3GQZ A;  2ZC6 B;  4KZ3 A;  4OQI A;  5FAP A;  1IKI A;  3D4F A;  4KQO A;  3P09 A;  4JXS A;  1DY6 A;  3ZG0 A;  1OME A;  3ZFZ A;  1G6A A;  2H0T A;  4S2I A;  2ZLY A;  4GB7 A;  1BLP A;  3WS5 A;  4DKI A;  3TSG A;  3GSG A;  3VP1 A;  4R1G A;  5F1G A;  2OLU A;  5AQA A;  1E4D A;  4A5R A;  4MBF A;  1GCE A;  4PM9 A;  1BLS A;  5FI6 A;  5EPH A;  1IYS A;  4OKP A;  4RVA A;  4BLM A;  4U0X A;  1JTD A;  2Y2L A;  3ZG5 A;  4MNR A;  4P0M A;  1HZO A;  3GVB A;  5A90 A;  4QY5 A;  4R0Q A;  2ZQ9 A;  5DF7 A;  4N92 A;  4WEJ A;  5FQ9 A;  4E3K A;  4S2P A;  4IVI A;  1HD8 A;  3IWI A;  4P85 A;  2IWD A;  3HLF A;  1MY8 A;  3PBT A;  1JWZ A;  3HUN A;  3GV9 A;  1MWS A;  3C5A A;  3UN7 A;  5EVI D;  1XA1 A;  3OPR A;  5M1A A;  1BZA A;  2V2F F;  4ZJ3 A;  2J9P A;  4R3J A;  4S2J A;  4D2O A;  1O07 A;  3G34 A;  1YLY A;  4KQR A;  1BTL A;  3HBR A;  1PYY A;  4N9K A;  4P87 A;  5CHJ A;  3UPP A;  1W79 A;  5HFO A;  2P74 A;  4WZ5 A;  1FSY A;  2XH9 A;  4BQM A;  5DTT A;  5TGF A;  2QPN A;  5F83 A;  1IEL A;  2Q9N A;  2Y2P A;  4OPQ A;  2Y2G A;  3UDI A;  2XD1 A;  4K91 A;  5M18 A;  3IXB A;  3CG5 A;  2X01 A;  4ID4 A;  2IWC A;  3QNB A;  5TFQ A;  4OQG A;  4WEK A;  3GRJ A;  4JBF A;  3MZD A;  3IH9 A;  1C3B A;  4LV2 A;  3P98 A;  4R3B A;  3UY6 A;  1TEM A;  2C5W B;  2ZM0 A;  5GLD A;  2WZX A;  4RX3 A;  1ZKJ A;  2Y2K A;  5HAI A;  1K4F A;  1ONH A;  4DE3 A;  1PW8 A;  1K57 C;  1ES2 A;  1GA9 A;  4BD1 A;  4ZJ1 A;  1ES3 A;  5FAQ A;  4BD0 A;  2ZD8 A;  4KQQ A;  2HP6 A;  3HVF A;  3BFF A;  4E6W A;  4EUZ A;  3OCL A;  4OOL A;  5EVL A;  4C75 A;  3VOY A;  4QB8 A;  1DJB A;  1KVL A;  3MBZ A;  1ERM A;  5HAR A;  1CI8 A;  4P6B A;  5U47 A;  1JVJ A;  4WM9 A;  2BLS A;  3OPH A;  3UDX A;  5FQJ A;  2VGK A;  2WGW B;  1QMF A;  3A3I A;  2ZC4 B;  2WAD A;  3NBL A;  4OPZ A;  4BEN A;  5DTS A;  4X56 A;  4R23 A;  3JYI A;  3FWL A;  1I2W A;  1U60 A;  1MBL A;  1FOF A;  4MBK A;  4K0W A;  3HLG A;  5BOH A;  1K54 C;  4N1H A;  3Q7V B;  4KG5 A;  1IYO A;  4C3Q A;  1IYP A;  1CEG A;  2J8Y A;  4GKU A;  4FCF A;  2HP9 A;  2WKH A;  3DTM A;  2XDM A;  5CED A;  4CJN A;  5CRF A;  4LV1 A;  1KGG A;  3C4O A;  2XFT A;  2XF3 A;  4KG2 A;  5DTK A;  5FQI A;  1K55 A;  4S2M A;  3IT9 A;  3LO7 A;  5CGW A;  3FKV A;  5M19 A;  4PM6 A;  4JXW A;  1NRF A;  1WE4 A;  3C4P A;  3SOI A;  4GDN A;  3Q7V A;  5F82 A;  4WMC A;  3PAE A;  2XD5 A;  3HUO A;  3PTE A;  4BL2 A;  3CMZ A;  3N8L A;  1FCM A;  3M2K A;  4K0X A;  4M3K A;  3ZVW A;  4OLD A;  4IED A;  3WWX A;  1VQQ A;  1E3U D;  5IHV A;  1BT5 A;  3ITB A;  1NXY A;  3UE0 A;  3ZG8 B;  5CGS A;  2XGN A;  3ZGA B;  1L0G A;  2PU2 A;  3IF5 A;  3OPP A;  4GD6 A;  4KZ7 A;  1YLZ A;  1RCJ A;  4OOM A;  3LEZ A;  3Q82 A;  2RL3 A;  4GNU A;  5D3O A;  4S2O A;  4IVK A;  3Q07 A;  3VP3 A;  2QMI A;  1HVB A;  2B5R A;  5CHU A;  3MZE A;  2EX6 A;  3E2K A;  5A91 A;  1ALQ A;  1ESI A;  4KZ8 A;  2RCX A;  1JTG A;  1NYY A;  5AQ9 A;  3HRE A;  3GTC A;  1NYM A;  1LL5 A;  3FV7 A;  4OLG A;  3ZHH A;  1YQS A;  4EQI A;  3G32 A;  4KZ4 A;  5EOO A;  3N6I A;  3VP4 A;  4ZBE A;  2ZQ8 A;  4DXC A;  4UA6 A;  3PBN A;  3TOI A;  4S2K A;  3VFF A;  1BUL A;  4OOY A;  1EI5 A;  3BFC A;  1BSG A;  4OPY A;  1PI4 A;  2I72 A;  1K56 A;  3ZVT A;  1RGY A;  1H5X A;  2Y2Q A;  3WRT A;  1W5D A;  2H5S A;  2ZJ9 A;  2H10 A;  2Y4A A;  5GHX A;  4HBT A;  4HBU A;  1YMS A;  4NET A;  3M2J A;  4JLF A;  1ESU A;  2EX8 A;  2Q9M A;  4X68 A;  3BYD A;  1GA0 A;  2A49 A;  3V3R A;  3A3F A;  2WKE A;  1K56 D;  3G35 A;  4UHU A;  4E3N A;  3C7V A;  2HDU A;  1PW1 A;  5EVI A;  4LEN A;  1KGF A;  3UE1 A;  2JCH A;  1TVF A;  5CXW A;  3N8S A;  3DWK A;  2Z2L B;  1YLT A;  4U0T A;  1N4O A;  1CI9 A;  3AGE A;  1HTZ A;  4DE0 A;  3AGF A;  1XXM A;  1L0D A;  2Y2J A;  3EQU A;  3IHA A;  4OVD A;  1Z6F A;  4LCL A;  1M40 A;  4L0L A;  4MEZ A;  4IBR A;  4WBG A;  1MKI A;  1SCW A;  3W8K A;  3TG9 A;  1ES4 A;  2EX2 A;  3QHY A;  2WUQ A;  5E2F A;  1XKZ A;  3AGD A;  3O88 A;  3FYZ A;  4BJP A;  5CTN A;  2EX9 A;  2G2W A;  3C7U A;  5EUA A;  2ZC7 A;  3IH8 A;  3MXS A;  1FSW A;  3Q1F A;  4HEF A;  4N1X A;  4OH0 A;  5J8X A;  4S2N A;  4UA7 A;  1NZO A;  1S6R A;  3PBS A;  1NJ4 A;  1Q2P A;  2ZQD A;  2HPB A;  2HDS A;  1MXO A;  3WS2 A;  5A93 A;  1AXB A;  3MXR A;  4EV4 A;  4JF4 A;  5FI2 A;  3SH8 A;  3NDE A;  3FKW A;  4PPR A;  4S2L A;  2XQZ A;  1W8Q A;  2R9W A;  4QY6 A;  4C6Y A;  5FA7 A;  3PBR A;  1YT4 A;  3ZNT A;  4E3L A;  3A3E A;  3HLW A;  2XFS A;  4ZAM A;  3VP2 A;  2BG1 A;  3HLC A;  4O7D A;  2JE5 A;  3E2L A;  1LI0 A;  1KVM A;  3IXD A;  1SDE A;  5KSC A;  1I5Q A;  5HAP A;  3OCN A;  1Q2Q A;  5FI7 A;  4ZJ2 A;  3MKF A;  5TR7 A;  4CPK A;  2EXB A;  2C6W B;  2PBY A;  2ZMA A;  4XUX A;  3DWZ A;  4Y0O A;  1PWD A;  3M6B A;  2ZC5 B;  4E3O A;  1IKG A;  3W4P A;  2J9O A;  3IF6 B;  1S0W A;  5FAT A;  5GHY A;  3IXH A;  3VSL A;  3MKE A;  1MWR A;  5FQQ A;  5CEC A;  2FFY A;  3CJM A;  5EEC A;  2WKI A;  4GD8 A;  2Y2M A;  5FSR A;  4DDS A;  1Y54 A;  1J9M A;  3N4I A;  4OP8 A;  4RX2 A;  2V1Z A;  1QME A;  4Z9Q A;  2ZM8 A;  1XX2 A;  1N9B A;  3O87 A;  1MPL A;  5HAQ A;  2X71 A;  4DE2 A;  1E3U A;  1MWU A;  3BLM A;  3IF6 A;  4MBH A;  4KZB A;  4OON A;  1ERO A;  2ZC3 B;  1JWV A;  1XPB A;  3HLD A;  3HLB A;  2JC7 A;  2UWX A;  1YLP A;  4KEN B;  5FAS A;  4QU3 A;  1L2S A;  2WGV A;  1K6S A;  5G18 A;  2P9V B;  4GDB A;  4EBL A;  3GR2 A;  1YMX A;  2Y55 A;  4DXB A;  3RXX A;  1EWZ A;  3UE3 A;  1SKF A;  3M6H A;  5AQ7 A;  1K25 A;  1O7E A;  1KE0 A;  3IQA A;  4X53 A;  3CZD A;  4JKT A;  3WS4 A;  2OLV A;  2WZZ A;  3V3S A;  3N8R A;  5AQB A;  2XEP A;  2IWB A;  3UPN A;  3PBQ A;  2J7V A;  5E43 A;  2P9V A;  4YIN A;  4X69 A;  5GL9 A;  4QJG A;  4HES A;  4LV0 A;  4JXV A;  1L0F A;  2H0Y A;  2WAE A;  2WYX A;  5EVI B;  3WS1 A;  1SHV A;  1I2S A;  3MFD A;  1LL9 A;  3LCE A;  4R4S A;  4X55 A;  2GDN A;  2Y91 A;  3BM6 A;  2ZQC A;  4GZB A;  1ERQ A;  1DJA A;  5FDH A;  2Y2O A;  3G31 A;  3G2Z A;  3ZNY A;  4KZA A;  4RYE A;  5A92 A;  1KDW A;  4OQ0 A;  2OV5 A;  3FZC A;  4F94 A;  1KGE A;  5HW3 A;  3N7W A;  4KZ5 A;  5EVI C;  1TDL A;  3PBO A;  5CTM A;  4IBX A;  4LCM A;  2E8I A;  2Y59 A;  3SH9 A;  3SS3 A;  1L0E A;  3I7J A;  3SS5 A;  3UPO A;  3OPL A;  4DDY A;  5L2F A;  1NZU A;  2DCF A;  3OZH A;  4LV3 A;  4PMA A;  4ZTK A;  5GLA A;  4WZ4 A;  4PM5 A;  4FD8 A;  1FCO A;  4GN2 A;  4JF5 A;  3SS4 A;  3OC2 A;  4B4Z A;  2HP5 A;  3IXG A;  3A3J A;  1H8Y A;  5CEB A;  4WZ5 C;  1RGZ A;  1CK3 A;  2XLN A;  2G2U A;  4EBN A;  4Y0T A;  1ONG A;  1K6R A;  3O3V A;  4MLL A;  4U3T A;  1SDN A;  1W7F A;  4S2N C;  4Q8I A;  2VGJ A;  3BRM A;  1PWC A;  1G68 A;  5HX9 A;  4DRT A;  1ZC2 A;  4N9L A;  3UNW A;  2A3U A;  1IEM A;  2JBF A;  5CHM A;  4OP5 A;  3VSK A;  2CC1 A;  3V39 A;  1E25 A;  2ZQ7 A;  5FQK A;  2EFX A;  1FQG A;  1LLB A;  1PZO A;  3W4Q A;  4WEL A;  1ZG6 A;  5KMW A;  3LY3 A;  4YFM A;  5JYP A;  1XGJ A;  1GHM A;  3NC8 A;  3V50 A;  4B4X A;  5HL1 A;  4B88 A;  1DJC A;  1M6K A;  3NIA A;  3G2Y A;  3W4O A;  5E2H A;  1YLW A;  3ZG9 B;  1BUE A;  5KSH A;  1KDS A;  3BEC A;  5DF9 A;  3UO9 A;  5GLB A;  2V20 A;  2ZM2 A;  4UA9 A;  3WS0 A;  4FSF A;  3IHB A;  3SH7 A;  1WYC A;  1WYB A;  2ZQA A;  2R9X A;  3NCK A;  3Q7Z A;  1JWP A;  4E3J A;  2FFF B;  2X02 A;  3NDG A;  1MWT A;  1IYQ A;  3PAG A;  5I94 A;  3S1Y A;  2Y2H A;  5F1F A;  4OQH A;  4DF6 A;  2Z2M B;  2XR0 A;  5FAO A;  4KZ6 A;  4E3I A;  4GOG A;  3BFG A;  4QHC A;  1XGI A;  4FH2 A;  1K57 A;  4FH4 A;  1XP4 A;  5E2E A;  1W8Y A;  3VMA A;  3A3D A;  2WAF A;  3GMW A;  3HL9 A;  3VP0 A;  4X6T A;  3ZCZ A;  4WYY A;  1KE3 A;  1K4E A;  2PU4 A;  2QZ6 A;  2HDQ A;  3LY4 A;  1K55 C;  1FR1 A;  2Y2I A;  4PM7 A;  3HUM A;  4R4R A;  3VOZ A;  4EBP A;  5GLC A;  1BLC A;  2WGI A;  4NK3 A;  3RJU A;  3BFD A;  1GHI A;  3IF6 C;  3DW0 A;  2DNS A;  1RP5 A;  3BEB A;  3ISG A;  1ES5 A;  3ZDJ A;  3RXW A;  2XK1 A;  3IWO A;  1PWG A;  4JPM A;  1K54 A;  1PI5 A; 
#chains in the Genus database with same CATH topology
 4G3W A;  5GHZ A;  3NY4 A;  2HV1 A;  2L4R A;  5DJT A;  4DJ3 A;  3S22 A;  3T1Q B;  4CLC C;  4KZ9 A;  4JGP A;  3QNC A;  4OPR A;  1FR6 A;  4E3M A;  3IWQ A;  3F1N B;  4QD4 A;  5DF8 A;  1PZP A;  3MZF A;  3BFE A;  3LIB A;  2EFU A;  4EWF A;  1UGU A;  2HDR A;  3LR5 A;  4DE1 A;  1YM1 A;  3B3X A;  3CWF A;  1XA7 A;  3Q81 A;  4O8G A;  3OBF A;  2CMN A;  4JXG A;  4PM8 A;  1VM1 A;  4KZ3 A;  3ZYT A;  3D4F A;  4II7 A;  1OME A;  3ZFZ A;  5LBR A;  1G6A A;  4S2I A;  2ZLY A;  4GB7 A;  1BLP A;  3NOT C;  3QP6 A;  3GSG A;  2OOL A;  3T4J A;  1E4D A;  2VJW A;  3BW6 A;  5EPH A;  1G28 A;  2VA0 A;  3JVV A;  1JTD A;  2Y2L A;  3UME A;  4MNR A;  4R0Q A;  2ZQ9 A;  3EEH A;  5FQ9 A;  1HD8 A;  3R4K A;  2JKT M;  4P85 A;  2MJ6 A;  3GV9 A;  3DTE A;  3UN7 A;  5HDD A;  5M1A A;  1BZA A;  1JNU A;  4R3J A;  4D2O A;  1O07 A;  1H8M A;  5F83 A;  2Q9N A;  2Y2G A;  1LT0 A;  3IXB A;  2IWC A;  5TFQ A;  4OQG A;  1T1C A;  2QYB A;  4JBF A;  3MZD A;  2R78 A;  3IH9 A;  3NEC A;  1C3B A;  3P98 A;  1TEM A;  2P04 A;  4PHT A;  1ODV A;  4UQI M;  3T50 A;  3CPT B;  1PW8 A;  1ES2 A;  4ZJ1 A;  1ES3 A;  2KLI A;  5FAQ A;  4BD0 A;  2ZD8 A;  4KQQ A;  3BFF A;  4QB8 A;  2VV6 A;  3MBZ A;  5HAR A;  2Y79 A;  4ETX A;  4WM9 A;  3D3O A;  1NLZ A;  2ZC4 B;  2B02 A;  3JYI A;  3FWL A;  1I2W A;  2VGL M;  5G4Z A;  1ACF A;  4MBK A;  4GKU A;  2VZW A;  4FCF A;  2HP9 A;  5CED A;  3VV4 A;  2J80 A;  4KG2 A;  3L9K A;  3FKV A;  1NRF A;  4G3V A;  5F82 A;  3UB6 A;  5EFW A;  4BL2 A;  3CMZ A;  4EER A;  4K0X A;  1NXY A;  3IF5 A;  3OPP A;  1RCJ A;  3Q82 A;  4GNU A;  4HNB A;  3MZE A;  5A91 A;  4KZ8 A;  3DTI A;  1S1Z A;  3NOP C;  1LL5 A;  4GW9 A;  4EQI A;  3MFX A;  3C30 A;  3VFF A;  1BUL A;  3BFC A;  1A0K A;  1BSG A;  4OPY A;  1PI4 A;  1RGY A;  3NHQ A;  1H5X A;  1CQA A;  4KUO A;  5F69 A;  4MN7 A;  3EGD C;  3H82 A;  1GA0 A;  2INW A;  3V3R A;  2WKE A;  3G35 A;  4E3N A;  2AVX A;  3C7V A;  2HDU A;  2W3F A;  3N8S A;  4WL9 A;  1DP6 A;  1CI9 A;  4WUJ A;  3AGF A;  1XXM A;  4L0L A;  4WF0 A;  1SCW A;  1XKZ A;  3AGD A;  3O88 A;  4L9E A;  2JHE A;  4OH0 A;  1S6R A;  1F98 A;  2JKR M;  3P7N A;  5A93 A;  1AXB A;  3LGO A;  1TS0 A;  3NDE A;  3FKW A;  4S2L A;  4XT2 B;  1L3L A;  4EUV A;  3A3E A;  4ZAM A;  3VP2 A;  3HLC A;  1KVM A;  1SDE A;  5IT5 A;  2A2L A;  5TR7 A;  4CPK A;  2EXB A;  3S7N A;  1XJ2 A;  4ARZ B;  3CHW P;  4Q0H A;  4JGR A;  4XUX A;  4Y0O A;  1PWD A;  3E98 A;  2ZC5 B;  3W4P A;  3IF6 B;  4EET B;  3MS6 A;  5FQQ A;  5EEC A;  2Y2M A;  5FSR A;  1VET B;  2V1Z A;  1QME A;  5HAQ A;  3CAX A;  1E3U A;  3BLM A;  4MBH A;  4KZB A;  1ERO A;  1JWV A;  3HLD A;  3HLB A;  4QU3 A;  2WGV A;  1K6S A;  4DXB A;  3RXX A;  1EWZ A;  4H6J A;  1O7E A;  3F1O B;  3KO6 A;  3CZD A;  3N8R A;  2IWB A;  4LRY C;  5E43 A;  4YIN A;  1S4S A;  4X69 A;  3UE6 A;  2W1T B;  4LV0 A;  4JXV A;  1L0F A;  2H0Y A;  2WAE A;  2WYX A;  5EVI B;  3LR0 A;  2XSS A;  3MFD A;  3F1N A;  5HWT A;  3NUL A;  2PR6 A;  2ZQC A;  3VOL A;  3IS2 B;  4RYE A;  5A92 A;  5EM1 A;  3LIA A;  3T4Q A;  3SZT A;  5EVI C;  1TDL A;  2G7U A;  2PYR A;  4LCM A;  4YNR A;  4IJG A;  3SH9 A;  3UPO A;  3OZH A;  4WZ4 A;  2OAP 1;  4FD8 A;  4X25 A;  4BMW A;  4B4Z A;  2HP5 A;  3A3J A;  1H8Y A;  1CK3 A;  2G2U A;  3B47 A;  4U3T A;  4Y2F A;  3TW8 A;  1CJF A;  2VGJ A;  4Q8I A;  2BTF P;  4EEU A;  5CHM A;  3HJI A;  4LFU A;  3V39 A;  1FQG A;  1LLB A;  1PZO A;  2K7S A;  4WEL A;  2HF6 A;  4YFM A;  4B4X A;  3NC8 A;  2J3T D;  3PHY A;  3TE8 A;  5KSH A;  2D02 A;  3D9Y A;  4UQI S;  3SH7 A;  1WYC A;  2ZQA A;  2R9X A;  1JWP A;  3U2A A;  2O9B A;  3VE3 A;  1S66 L;  3PAG A;  4DF6 A;  1ZHH B;  2XR0 A;  1N9N A;  4E3I A;  4QHC A;  3KYZ A;  3T1S A;  3C38 A;  2VGL S;  1PNE A;  3CPT A;  5GLC A;  1BLC A;  2WGI A;  1MC0 A;  1GHI A;  3DW0 A;  1RP5 A;  1YSP A;  3RXW A;  4EES A;  3JPU A;  5IS1 A;  5L10 A;  3C8C A;  1CEF A;  3G30 A;  1T18 A;  2O0Y A;  1LI9 A;  4JF6 A;  2W3D A;  4Y7P A;  4IUH A;  4QWO A;  3ULF A;  5CER A;  2FZ0 A;  3BLS A;  2V1B A;  3EQV A;  2PRF A;  5CGX A;  5JYO A;  5EE8 A;  1OJ5 A;  1KE4 A;  3UDF A;  4E6X A;  3LID A;  5FQM A;  5F68 A;  1K38 A;  2L1M A;  3GQZ A;  2ZC6 B;  4OQI A;  3UB8 A;  2QJ7 A;  2H0T A;  3WS5 A;  3TSG A;  1DP8 A;  4R1G A;  5F1G A;  2OLU A;  4A5R A;  2JKF A;  4MBF A;  1GCE A;  5FEF A;  1LSV A;  2JKR I;  5FI6 A;  4OKP A;  4BLM A;  4U0X A;  2NUT C;  5DF7 A;  3OOV A;  4S2P A;  1LSW A;  2IWD A;  3HLF A;  3PBT A;  1JWZ A;  2PYP A;  4DJ2 A;  4ESP A;  4HJ6 A;  3IBR A;  3C5A A;  2QKP A;  2V2F F;  4ZJ3 A;  2J9P A;  3G34 A;  4N9K A;  5FDS A;  1PYY A;  3UPP A;  1W79 A;  4BQM A;  2XH9 A;  1IEL A;  3UDI A;  4K91 A;  2VX8 A;  4L9F A;  4Q0J A;  2JKG A;  4HP4 A;  2Y2K A;  4DE3 A;  1GA9 A;  4I3I A;  3T4L A;  2O99 A;  3G6O A;  3HVF A;  3OCL A;  3VOY A;  3K3C A;  1DJB A;  1KVL A;  1ERM A;  3BWL A;  2BLS A;  4D60 A;  3CI6 A;  5FQJ A;  2WGW B;  4XT2 A;  5DTS A;  4HIA A;  4X56 A;  2EA9 A;  4R23 A;  4K0W A;  5BOH A;  3Q7V B;  4KG5 A;  3UB7 A;  1X0O A;  5HPI A;  2ZBB A;  4CJN A;  4LV1 A;  4ARZ A;  4Y15 A;  5DTK A;  3VE4 A;  3SOI A;  2PT7 A;  5HD3 A;  4WMC A;  3P01 A;  3QP5 A;  3HUO A;  3PTE A;  1FCM A;  1VET A;  2VLG A;  4OLD A;  1VQQ A;  1E3U D;  5IHV A;  3ITB A;  2J3W A;  5FEG A;  1YLZ A;  3KX0 X;  4S2O A;  4IVK A;  3Q07 A;  2QMI A;  2B5R A;  5CHU A;  1SKO B;  1JTG A;  2QJ5 A;  3HRE A;  4OLG A;  3ZHH A;  3LR4 A;  3VP4 A;  4ZBE A;  2ZQ8 A;  4CLC D;  4DXC A;  2ACG A;  3PBN A;  1T19 A;  2PD7 A;  3PR6 A;  1IFQ A;  1H3Q A;  3EGX C;  3WRT A;  2Y4A A;  4HBU A;  1YMS A;  4NET A;  4JLF A;  2EX8 A;  2W1T A;  1K56 D;  5EVI A;  3JVU A;  1KGF A;  3UE1 A;  2VK3 A;  4NEE D;  4U0T A;  3AGE A;  1AWI A;  5TBM B;  1HTZ A;  3IHA A;  1J3W A;  2Y2J A;  1VB6 A;  5EVE A;  1M40 A;  2A24 B;  4IBR A;  4WBG A;  3TG9 A;  2GNX A;  4I39 A;  1ES4 A;  2LB5 A;  2WUQ A;  5E2F A;  2ZC7 A;  3Q1F A;  5HZH A;  4N1X A;  4UA7 A;  3PBS A;  5MC7 A;  1MXO A;  3KYQ A;  4JF4 A;  3SH8 A;  4PPR A;  1W8Q A;  4QPR A;  5FA7 A;  1YT4 A;  1UWP X;  3ZNT A;  4HH2 A;  3HLW A;  2XFS A;  2BG1 A;  3E2L A;  1LI0 A;  3IXD A;  4JGO A;  1F9I A;  5HAP A;  3OCN A;  1Q2Q A;  5J4E A;  1OTI A;  3MKF A;  1FIL A;  5TJJ A;  3RH8 B;  2Q0O A;  3M6B A;  2FH5 A;  2J9O A;  5GHY A;  3VSL A;  2PBD P;  3MKE A;  1MWR A;  5CEC A;  4GD8 A;  2W0N A;  1J9M A;  3N4I A;  3U4L P;  2ZM8 A;  1S4R A;  3BQA A;  3E0Y A;  1N9B A;  3O87 A;  1MPL A;  1OT6 A;  1XJ3 A;  1XPB A;  2OAQ 1;  3W2Z A;  2UWX A;  5FAS A;  2P9V B;  3S7P A;  4GDB A;  4EBL A;  1YMX A;  3UE3 A;  3M6H A;  2Z6C A;  1K25 A;  1K0K A;  2OLV A;  4BWI A;  3V3S A;  5AQB A;  3UPN A;  2B95 A;  3SW1 A;  2J7V A;  2I9V A;  4NXB A;  3WS1 A;  1LL9 A;  4X55 A;  4PKY G;  1SZV A;  2GDN A;  1DJA A;  3BQ8 A;  2P08 A;  3ZNY A;  1KDW A;  2ZMV A;  2OV5 A;  4F94 A;  5AVE A;  2K31 A;  5HWV A;  4GLQ A;  2E8I A;  4X1M A;  3I7J A;  1NZU A;  3CUE C;  5GLA A;  4ZTK A;  4PM5 A;  4GN2 A;  1F5M A;  3LI9 A;  3OC2 A;  3IXG A;  1T1B A;  2ZL1 B;  2XLN A;  1ONG A;  4MLL A;  3PYP A;  4S2N C;  3KYE A;  1G68 A;  2KX6 A;  5HX9 A;  1ZC2 A;  2A3U A;  2VV7 A;  3VSK A;  4OP5 A;  2CC1 A;  3GEC A;  5FQK A;  4Y3I A;  3W4Q A;  5KMW A;  3LY3 A;  1DJC A;  3NIA A;  3W4O A;  4LPZ A;  5E2H A;  1YLW A;  1MKM A;  5DF9 A;  3UO9 A;  1OTA A;  3WS0 A;  3NCK A;  3DAV A;  4FOF A;  4DMZ A;  1IYQ A;  2Y2H A;  2Z2M B;  2BAS A;  4GOG A;  3BFG A;  1S1Y A;  5E2E A;  2WAF A;  3GMW A;  1YKD A;  1KE3 A;  4G3K A;  4PM7 A;  4EBP A;  1FR1 A;  4R4R A;  5HSQ A;  3HUM A;  1XJ4 A;  1Z09 A;  5IU1 A;  3IF6 C;  2DNS A;  4FUW A;  4PAU A;  1ES5 A;  3ZDJ A;  2XK1 A;  4Q0I A;  2ZOI A;  1PI5 A;  2WK0 A;  3EEA A;  3WRZ A;  3MF0 A;  1NY0 A;  2Y2N A;  1PIO A;  4HJ4 A;  1FCN A;  4EW7 A;  1BLH A;  2WGW A;  4UAA A;  2M1C A;  4ZDX A;  5E2G A;  3CLO A;  4BL3 A;  4NXE A;  5KZH A;  3LIC A;  3ICY A;  3HLE A;  5DVA A;  3IBJ A;  3ITA A;  5EOE A;  3E4Q A;  4RA7 A;  4WMC D;  4Y0U A;  1H8Z A;  4EEP A;  4DN0 A;  3G4P A;  5L09 A;  5FAP A;  5G4Y A;  1CF0 A;  4KQO A;  2M7V A;  1DY6 A;  3ZG0 A;  2HJ9 C;  4NXF A;  3VP1 A;  2W3H A;  5AQA A;  3HJK A;  3R7W B;  3E4O A;  4PM9 A;  1N9L A;  1IYS A;  4RVA A;  4ZRR A;  2EWW A;  3ZG5 A;  4P0M A;  4QY5 A;  4BBU A;  4N92 A;  1TF1 A;  3NOU C;  4E3K A;  4EQ1 A;  1V9Y A;  3IWI A;  4R70 A;  1MY8 A;  2KDK A;  3MQ0 A;  4HHD A;  5EVI D;  1XA1 A;  3OPR A;  1WA9 A;  1YLY A;  4KQR A;  1BTL A;  5CHJ A;  5HFO A;  1VEU B;  2P74 A;  3QP4 A;  4GS9 B;  2QPN A;  3KSH A;  4OPQ A;  2XD1 A;  5TBM A;  3CG5 A;  4ID4 A;  4I38 A;  3QNB A;  2A24 A;  4R6L A;  4LV2 A;  4R3B A;  2H28 A;  3UY6 A;  5GLD A;  4RX3 A;  3LEQ A;  1XFN A;  2ZOH A;  1ONH A;  4BD1 A;  4HOI A;  4E6W A;  2NUP C;  4OOL A;  4C75 A;  3O5Y A;  1CI8 A;  4P6B A;  5U47 A;  5HDC A;  1GSV A;  1QMF A;  4OPZ A;  4BEN A;  5J7E A;  1FIK A;  1MBL A;  1U60 A;  4Y5F A;  5EM0 A;  3HLG A;  1K54 C;  4N1H A;  1IYP A;  1CEG A;  2D01 A;  3KSG A;  1H0M A;  1KGG A;  3C4O A;  2E8J A;  3QP2 A;  1K55 A;  3IT9 A;  3LO7 A;  5M19 A;  1NRJ A;  4PM6 A;  3UMD A;  4JXW A;  5L8M A;  2XD5 A;  4EXO A;  2VEA A;  3EWK A;  1IOU A;  4IED A;  3BY8 A;  3UE0 A;  3ZG8 B;  5CGS A;  2XGN A;  3ZGA B;  3HCY A;  4OOM A;  3LEZ A;  2RL3 A;  2ZMF A;  1ALQ A;  1ESI A;  5AQ9 A;  3GTC A;  3N6I A;  4CQH A;  1GSW A;  3MSH A;  4UA6 A;  4OOY A;  2H5S A;  2ZJ9 A;  4LRX C;  3LYX A;  3M2J A;  1ESU A;  4X68 A;  3BYD A;  2A49 A;  3A3F A;  4BBV A;  3FPV A;  2JCH A;  5CXW A;  2Z2L B;  2VV8 A;  1N4O A;  4MMN A;  4DE0 A;  3EQU A;  4OVD A;  1Z6F A;  3CUE A;  4MEZ A;  2M7U A;  1MKI A;  3B42 A;  2QHK A;  2EX2 A;  3CIT A;  3QHY A;  3C7U A;  2G2W A;  3IH8 A;  3MXS A;  5AVF A;  1FSW A;  4GJ4 A;  5J8X A;  5FL3 A;  4S2N A;  1NZO A;  2XA7 M;  2ZQD A;  2HPB A;  2HDS A;  2HJE A;  3MXR A;  2ZL1 A;  2XQZ A;  4Z1W A;  3LIF A;  3DTK A;  3PBR A;  2JE5 A;  2W1R A;  1W63 Q;  3DWZ A;  3A0R A;  1S0W A;  2HZ5 A;  5EV0 A;  3IXH A;  4R38 A;  4P6Z M;  4ME4 A;  1P9W A;  4IHQ A;  2FFY A;  1Y54 A;  1GSX A;  3K3D A;  4FTX A;  2X71 A;  5F6A A;  3IX4 A;  3IF6 A;  4CLC B;  4KUK A;  4OON A;  1YLP A;  4I5S A;  3MR0 A;  1L2S A;  5G18 A;  4HJ3 A;  3GR2 A;  3A0S A;  3F1P B;  3KSI A;  1KE0 A;  3WS4 A;  2WZZ A;  1G5U A;  1EW0 A;  3LUQ A;  3PBQ A;  5GL9 A;  2L0W A;  1I2S A;  5DFX A;  1XFQ A;  3F1O A;  4R4S A;  2Y91 A;  1ERQ A;  5FDH A;  2Y2O A;  3G31 A;  3G2Z A;  3T4S A;  4KZA A;  5I5L A;  1TS7 A;  3FG8 A;  4IBX A;  2Y59 A;  1L0E A;  2JN7 A;  3SS5 A;  4M4X A;  2HGV A;  3IS2 A;  1FCO A;  4JF5 A;  3SS4 A;  4EBN A;  1RGZ A;  4Y0T A;  1K6R A;  2V8C A;  3O3V A;  1W7F A;  2PR5 A;  3R7W A;  1VHM A;  3UNW A;  2JBF A;  1E25 A;  2ZQ7 A;  2Y8H A;  1ZG6 A;  2PAV P;  5JYP A;  3V50 A;  4HQA A;  5HL1 A;  3EOI A;  2UV0 E;  2XRO A;  1M6K A;  3LR3 A;  4GCZ A;  1KDS A;  2V20 A;  4UA9 A;  4LLO B;  4FSF A;  1G6O A;  3Q7Z A;  1OJG A;  2FFF B;  2X02 A;  5J3W A;  5F1F A;  4OQH A;  4PKY A;  1VEU A;  3RTY A;  4GS9 A;  4MCW A;  1XGI A;  4FH2 A;  4FH4 A;  1P97 A;  1XP4 A;  3VMA A;  5C5K A;  5K5B A;  3HL9 A;  2XRN A;  3ZCZ A;  1K4E A;  2PU4 A;  2GZA A;  2QZ6 A;  5AJG A;  3LY4 A;  1K55 C;  2Y2I A;  3RJU A;  3BEB A;  3IWO A;  4E04 A;  4JPM A;  1K54 A;  1DRM A;  1GHP A;  4XUZ A;  3O86 A;  1KOU A;  2DRW A;  3V5M A;  1YLJ A;  3S4X A;  3VFH A;  3OLO A;  2GJ3 A;  3ZG7 B;  1STZ A;  1V9Z A;  1ZG4 A;  1ZTU A;  1TDG A;  3UB5 P;  2W3G A;  4JGQ A;  4ETZ A;  3IX3 A;  4F3L B;  3NI9 A;  3T4K A;  2VKS A;  4H8R A;  1NWZ A;  2QWS A;  2OWH A;  4KG6 A;  4GHI B;  4K08 A;  3NJA A;  2GX5 A;  2EXA A;  2OSU A;  3E4P A;  1S67 L;  4NXG A;  1LHY A;  4XXR A;  1IKI A;  3P09 A;  4JXS A;  4L9G A;  3T1R A;  2K2N A;  4DKI A;  3L7H A;  1OT9 A;  3MJQ A;  4B93 A;  4BBT A;  1OTB A;  4B9O A;  1BLS A;  3GDI A;  3LFV A;  1N9O A;  1HZO A;  3GVB A;  5A90 A;  4HH3 A;  4WEJ A;  3T1X A;  4HY8 A;  4IVI A;  3HUN A;  4HP9 A;  3T4O A;  1MWS A;  1YPR A;  4S2J A;  1D06 A;  3HBR A;  4P87 A;  5DKL A;  2XA7 S;  4WZ5 A;  1FSY A;  3RFB A;  5DTT A;  5TGF A;  2Y2P A;  5M18 A;  2X01 A;  2V9A A;  3FPW A;  2P7J A;  4WEK A;  3GRJ A;  2ZM0 A;  2C5W B;  2WZX A;  1ZKJ A;  5HAI A;  1K4F A;  2PDR A;  1K57 C;  3TJZ C;  5KIZ A;  3H7W B;  2OWJ A;  2B18 A;  2HP6 A;  5DKK A;  4EUZ A;  3V67 A;  5EVL A;  4R3A A;  1JVJ A;  3UB9 A;  3OPH A;  3FC7 A;  3UDX A;  1PRQ A;  2VGK A;  3NBL A;  3A3I A;  2WAD A;  4P6Z S;  1FOF A;  2IA2 A;  1YAX A;  1IYO A;  4C3Q A;  4IUK A;  2J8Y A;  2WKH A;  3DTM A;  2XDM A;  5CRF A;  2XF3 A;  2XFT A;  5FQI A;  4S2M A;  5CGW A;  1WE4 A;  3C4P A;  4GDN A;  3Q7V A;  3PAE A;  2YKH A;  3N8L A;  3M2K A;  3ZQ5 A;  4M3K A;  5L07 A;  3ZVW A;  3WWX A;  1BT5 A;  2LB9 A;  5F5Y A;  1L0G A;  2PU2 A;  3A0V A;  4GD6 A;  2YKF A;  4KZ7 A;  5D3O A;  4CLC A;  3QP8 A;  3VP3 A;  5HDS A;  1HVB A;  3LI8 A;  2EX6 A;  3E2K A;  2RCX A;  1NYY A;  1NYM A;  3FV7 A;  4CLC E;  2V0W A;  1YQS A;  3G32 A;  4KZ4 A;  4I3J A;  5EOO A;  4RQ9 A;  3F1P A;  4S2K A;  3TOI A;  1EI5 A;  3QP1 A;  1PFL A;  2I72 A;  3ZVT A;  1K56 A;  3TRC A;  1SKO A;  2EWV A;  2Y2Q A;  1YSQ A;  3KSF A;  1W5D A;  4KQD A;  2H10 A;  2JKT I;  2DMW A;  1Y28 A;  5GHX A;  4HBT A;  3K2N A;  4YOF A;  2Q9M A;  5DFY A;  2O9C A;  5HD5 A;  4UHU A;  1PW1 A;  2J3T C;  4LEN A;  2WKR A;  1TVF A;  3DWK A;  1YLT A;  4NKP A;  4WLA A;  1BYW A;  3C2W A;  4LCL A;  4I3A A;  3W8K A;  1OTD A;  5A8B A;  3FYZ A;  1TS8 A;  4BJP A;  5CTN A;  2EX9 A;  5EUA A;  4HEF A;  5HPF A;  1NJ4 A;  1Q2P A;  4Y13 A;  3WS2 A;  3MXQ A;  4O0P A;  4EV4 A;  5FI2 A;  4Y17 A;  1MZU A;  4QY6 A;  2R9W A;  4C6Y A;  4E3L A;  2O9A A;  4WN5 A;  4O01 A;  4O7D A;  1LL8 A;  5KSC A;  1I5Q A;  2W3E A;  5FI7 A;  2WKQ A;  4ZJ2 A;  3T12 B;  2PD8 A;  2C6W B;  2PBY A;  2ZMA A;  4E3O A;  1IKG A;  4AFI A;  5FAT A;  3B33 A;  3CJM A;  2WKI A;  3DBA A;  4DDS A;  1HLU P;  4OP8 A;  4RX2 A;  4Z9Q A;  4MDZ A;  4X1L A;  1XX2 A;  1TS6 A;  4NG2 A;  4DE2 A;  1MWU A;  2ZC3 B;  2W27 A;  2JC7 A;  1D1J A;  1OTE A;  4KEN B;  1LSX A;  1F2K A;  2Y55 A;  3S7Q A;  1SKF A;  1XJ6 A;  5AQ7 A;  4LRZ E;  3IQA A;  4X53 A;  3MMH A;  4JKT A;  4EU0 A;  2XEP A;  2V0U A;  3S7O A;  1DP9 A;  1OPX A;  2P9V A;  3H82 B;  4QJG A;  4HES A;  1W63 M;  1UWN X;  1SHV A;  5DJU A;  3LCE A;  3BM6 A;  1P0Z A;  4GZB A;  3D72 A;  4F3L A;  4OQ0 A;  4HI4 A;  3FZC A;  1KGE A;  5HW3 A;  3N7W A;  4KZ5 A;  3PBO A;  5CTM A;  3SS3 A;  4GHI A;  3OPL A;  3BJN A;  3LIE A;  4DDY A;  5L2F A;  4LV3 A;  2DCF A;  4PMA A;  3IX8 A;  4MN5 A;  1TD5 A;  3PXP A;  3MQO A;  5CEB A;  4WZ5 C;  1SDN A;  5HWW A;  3BRM A;  1PWC A;  2PHY A;  4DRT A;  4N9L A;  1IEM A;  2Z6D A;  2EFX A;  1XGJ A;  1GHM A;  1T1A A;  4B88 A;  3G2Y A;  4MN6 A;  4LGW A;  3ZG9 B;  1BUE A;  3BEC A;  5GLB A;  2ZM2 A;  1NLY A;  5HL6 A;  3IHB A;  3H9W A;  4UEY A;  1WYB A;  3MQQ A;  4E3J A;  2V1A A;  1D7E A;  3NDG A;  1MWT A;  5I94 A;  3T4T A;  3S1Y A;  1P9R A;  2V8F A;  5FAO A;  4KZ6 A;  1K57 A;  1Y4O A;  3BY9 A;  1W8Y A;  3A3D A;  5CX7 A;  3VP0 A;  4X6T A;  4WYY A;  2HDQ A;  2KOI A;  3VOZ A;  4H6J B;  4NK3 A;  4YWZ A;  3BFD A;  2WKP A;  3ISG A;  3H7W A;  1PWG A;  1L0D A; 
#chains in the Genus database with same CATH homology
 2WK0 A;  5GHZ A;  3NY4 A;  3WRZ A;  1CEF A;  1GHP A;  3G30 A;  1NY0 A;  2Y2N A;  1PIO A;  4XUZ A;  3O86 A;  1FCN A;  1BLH A;  2DRW A;  3V5M A;  2WGW A;  1LI9 A;  1YLJ A;  4UAA A;  3S22 A;  3S4X A;  3VFH A;  4JF6 A;  4ZDX A;  5E2G A;  4KZ9 A;  3ZG7 B;  3QNC A;  4OPR A;  1FR6 A;  4E3M A;  3IWQ A;  1ZG4 A;  4Y7P A;  4BL3 A;  4QD4 A;  5DF8 A;  1TDG A;  5KZH A;  1PZP A;  3MZF A;  5CER A;  3BFE A;  3NI9 A;  3HLE A;  5DVA A;  3BLS A;  2EFU A;  3ITA A;  5EOE A;  3EQV A;  4EWF A;  4H8R A;  2HDR A;  5CGX A;  4RA7 A;  5JYO A;  4KG6 A;  4WMC D;  4Y0U A;  4DE1 A;  1YM1 A;  5EE8 A;  1H8Z A;  3B3X A;  1XA7 A;  1KE4 A;  3Q81 A;  3UDF A;  4E6X A;  2EXA A;  3G4P A;  2OSU A;  4JXG A;  5FQM A;  4PM8 A;  1LHY A;  1K38 A;  1VM1 A;  4XXR A;  3GQZ A;  2ZC6 B;  4KZ3 A;  4OQI A;  5FAP A;  1IKI A;  3D4F A;  4KQO A;  3P09 A;  4JXS A;  1DY6 A;  3ZG0 A;  1OME A;  3ZFZ A;  1G6A A;  2H0T A;  4S2I A;  2ZLY A;  4GB7 A;  1BLP A;  3WS5 A;  4DKI A;  3TSG A;  3GSG A;  3VP1 A;  4R1G A;  5F1G A;  2OLU A;  5AQA A;  1E4D A;  4A5R A;  4MBF A;  1GCE A;  4PM9 A;  1BLS A;  5FI6 A;  5EPH A;  1IYS A;  4OKP A;  4RVA A;  4BLM A;  4U0X A;  1JTD A;  2Y2L A;  3ZG5 A;  4MNR A;  4P0M A;  1HZO A;  3GVB A;  5A90 A;  4QY5 A;  4R0Q A;  2ZQ9 A;  5DF7 A;  4N92 A;  4WEJ A;  5FQ9 A;  4E3K A;  4S2P A;  4IVI A;  1HD8 A;  3IWI A;  4P85 A;  2IWD A;  3HLF A;  1MY8 A;  3PBT A;  1JWZ A;  3HUN A;  3GV9 A;  1MWS A;  3C5A A;  3UN7 A;  5EVI D;  1XA1 A;  3OPR A;  5M1A A;  1BZA A;  2V2F F;  4ZJ3 A;  2J9P A;  4R3J A;  4S2J A;  4D2O A;  1O07 A;  3G34 A;  1YLY A;  4KQR A;  1BTL A;  3HBR A;  1PYY A;  4N9K A;  4P87 A;  5CHJ A;  3UPP A;  1W79 A;  5HFO A;  2P74 A;  4WZ5 A;  1FSY A;  2XH9 A;  4BQM A;  5DTT A;  5TGF A;  2QPN A;  5F83 A;  1IEL A;  2Q9N A;  2Y2P A;  4OPQ A;  2Y2G A;  3UDI A;  2XD1 A;  4K91 A;  5M18 A;  3IXB A;  3CG5 A;  2X01 A;  4ID4 A;  2IWC A;  3QNB A;  5TFQ A;  4OQG A;  4WEK A;  3GRJ A;  4JBF A;  3MZD A;  3IH9 A;  1C3B A;  4LV2 A;  3P98 A;  4R3B A;  3UY6 A;  1TEM A;  2C5W B;  2ZM0 A;  5GLD A;  2WZX A;  4RX3 A;  1ZKJ A;  2Y2K A;  5HAI A;  1K4F A;  1ONH A;  4DE3 A;  1PW8 A;  1K57 C;  1ES2 A;  1GA9 A;  4BD1 A;  4ZJ1 A;  1ES3 A;  5FAQ A;  4BD0 A;  2ZD8 A;  4KQQ A;  2HP6 A;  3HVF A;  3BFF A;  4E6W A;  4EUZ A;  3OCL A;  4OOL A;  5EVL A;  4C75 A;  3VOY A;  4QB8 A;  1DJB A;  1KVL A;  3MBZ A;  1ERM A;  5HAR A;  1CI8 A;  4P6B A;  5U47 A;  1JVJ A;  4WM9 A;  2BLS A;  3OPH A;  3UDX A;  5FQJ A;  2VGK A;  2WGW B;  1QMF A;  3A3I A;  2ZC4 B;  2WAD A;  3NBL A;  4OPZ A;  4BEN A;  5DTS A;  4X56 A;  4R23 A;  3JYI A;  3FWL A;  1I2W A;  1U60 A;  1MBL A;  1FOF A;  4MBK A;  4K0W A;  3HLG A;  5BOH A;  1K54 C;  4N1H A;  3Q7V B;  4KG5 A;  1IYO A;  4C3Q A;  1IYP A;  1CEG A;  2J8Y A;  4GKU A;  4FCF A;  2HP9 A;  2WKH A;  3DTM A;  2XDM A;  5CED A;  4CJN A;  5CRF A;  4LV1 A;  1KGG A;  3C4O A;  2XFT A;  2XF3 A;  4KG2 A;  5DTK A;  5FQI A;  1K55 A;  4S2M A;  3IT9 A;  3LO7 A;  5CGW A;  3FKV A;  5M19 A;  4PM6 A;  4JXW A;  1NRF A;  1WE4 A;  3C4P A;  3SOI A;  4GDN A;  3Q7V A;  5F82 A;  4WMC A;  3PAE A;  2XD5 A;  3HUO A;  3PTE A;  4BL2 A;  3CMZ A;  3N8L A;  1FCM A;  3M2K A;  4K0X A;  4M3K A;  3ZVW A;  4OLD A;  4IED A;  3WWX A;  1VQQ A;  1E3U D;  5IHV A;  1BT5 A;  3ITB A;  1NXY A;  3UE0 A;  3ZG8 B;  5CGS A;  2XGN A;  3ZGA B;  1L0G A;  2PU2 A;  3IF5 A;  3OPP A;  4GD6 A;  4KZ7 A;  1YLZ A;  1RCJ A;  4OOM A;  3LEZ A;  3Q82 A;  2RL3 A;  4GNU A;  5D3O A;  4S2O A;  4IVK A;  3Q07 A;  3VP3 A;  2QMI A;  1HVB A;  2B5R A;  5CHU A;  3MZE A;  2EX6 A;  3E2K A;  5A91 A;  1ALQ A;  1ESI A;  4KZ8 A;  2RCX A;  1JTG A;  1NYY A;  5AQ9 A;  3HRE A;  3GTC A;  1NYM A;  1LL5 A;  3FV7 A;  4OLG A;  3ZHH A;  1YQS A;  4EQI A;  3G32 A;  4KZ4 A;  5EOO A;  3N6I A;  3VP4 A;  4ZBE A;  2ZQ8 A;  4DXC A;  4UA6 A;  3PBN A;  3TOI A;  4S2K A;  3VFF A;  1BUL A;  4OOY A;  1EI5 A;  3BFC A;  1BSG A;  4OPY A;  1PI4 A;  2I72 A;  1K56 A;  3ZVT A;  1RGY A;  1H5X A;  2Y2Q A;  3WRT A;  1W5D A;  2H5S A;  2ZJ9 A;  2H10 A;  2Y4A A;  5GHX A;  4HBT A;  4HBU A;  1YMS A;  4NET A;  3M2J A;  4JLF A;  1ESU A;  2EX8 A;  2Q9M A;  4X68 A;  3BYD A;  1GA0 A;  2A49 A;  3V3R A;  3A3F A;  2WKE A;  1K56 D;  3G35 A;  4UHU A;  4E3N A;  3C7V A;  2HDU A;  1PW1 A;  5EVI A;  4LEN A;  1KGF A;  3UE1 A;  2JCH A;  1TVF A;  5CXW A;  3N8S A;  3DWK A;  2Z2L B;  1YLT A;  4U0T A;  1N4O A;  1CI9 A;  3AGE A;  1HTZ A;  4DE0 A;  3AGF A;  1XXM A;  1L0D A;  2Y2J A;  3EQU A;  3IHA A;  4OVD A;  1Z6F A;  4LCL A;  1M40 A;  4L0L A;  4MEZ A;  4IBR A;  4WBG A;  1MKI A;  1SCW A;  3W8K A;  3TG9 A;  1ES4 A;  2EX2 A;  3QHY A;  2WUQ A;  5E2F A;  1XKZ A;  3AGD A;  3O88 A;  3FYZ A;  4BJP A;  5CTN A;  2EX9 A;  2G2W A;  3C7U A;  5EUA A;  2ZC7 A;  3IH8 A;  3MXS A;  1FSW A;  3Q1F A;  4HEF A;  4N1X A;  4OH0 A;  5J8X A;  4S2N A;  4UA7 A;  1NZO A;  1S6R A;  3PBS A;  1NJ4 A;  1Q2P A;  2ZQD A;  2HPB A;  2HDS A;  1MXO A;  3WS2 A;  5A93 A;  1AXB A;  3MXR A;  4EV4 A;  4JF4 A;  5FI2 A;  3SH8 A;  3NDE A;  3FKW A;  4PPR A;  4S2L A;  2XQZ A;  1W8Q A;  2R9W A;  4QY6 A;  4C6Y A;  5FA7 A;  3PBR A;  1YT4 A;  3ZNT A;  4E3L A;  3A3E A;  3HLW A;  2XFS A;  4ZAM A;  3VP2 A;  2BG1 A;  3HLC A;  4O7D A;  2JE5 A;  3E2L A;  1LI0 A;  1KVM A;  3IXD A;  1SDE A;  5KSC A;  1I5Q A;  5HAP A;  3OCN A;  1Q2Q A;  5FI7 A;  4ZJ2 A;  3MKF A;  5TR7 A;  4CPK A;  2EXB A;  2C6W B;  2PBY A;  2ZMA A;  4XUX A;  3DWZ A;  4Y0O A;  1PWD A;  3M6B A;  2ZC5 B;  4E3O A;  1IKG A;  3W4P A;  2J9O A;  3IF6 B;  1S0W A;  5FAT A;  5GHY A;  3IXH A;  3VSL A;  3MKE A;  1MWR A;  5FQQ A;  5CEC A;  2FFY A;  3CJM A;  5EEC A;  2WKI A;  4GD8 A;  2Y2M A;  5FSR A;  4DDS A;  1Y54 A;  1J9M A;  3N4I A;  4OP8 A;  4RX2 A;  2V1Z A;  1QME A;  4Z9Q A;  2ZM8 A;  1XX2 A;  1N9B A;  3O87 A;  1MPL A;  5HAQ A;  2X71 A;  4DE2 A;  1E3U A;  1MWU A;  3BLM A;  3IF6 A;  4MBH A;  4KZB A;  4OON A;  1ERO A;  2ZC3 B;  1JWV A;  1XPB A;  3HLD A;  3HLB A;  2JC7 A;  2UWX A;  1YLP A;  4KEN B;  5FAS A;  4QU3 A;  1L2S A;  2WGV A;  1K6S A;  5G18 A;  2P9V B;  4GDB A;  4EBL A;  3GR2 A;  1YMX A;  2Y55 A;  4DXB A;  3RXX A;  1EWZ A;  3UE3 A;  1SKF A;  3M6H A;  5AQ7 A;  1K25 A;  1O7E A;  1KE0 A;  3IQA A;  4X53 A;  3CZD A;  4JKT A;  3WS4 A;  2OLV A;  2WZZ A;  3V3S A;  3N8R A;  5AQB A;  2XEP A;  2IWB A;  3UPN A;  3PBQ A;  2J7V A;  5E43 A;  2P9V A;  4YIN A;  4X69 A;  5GL9 A;  4QJG A;  4HES A;  4LV0 A;  4JXV A;  1L0F A;  2H0Y A;  2WAE A;  2WYX A;  5EVI B;  3WS1 A;  1SHV A;  1I2S A;  3MFD A;  1LL9 A;  3LCE A;  4R4S A;  4X55 A;  2GDN A;  2Y91 A;  3BM6 A;  2ZQC A;  4GZB A;  1ERQ A;  1DJA A;  5FDH A;  2Y2O A;  3G31 A;  3G2Z A;  3ZNY A;  4KZA A;  4RYE A;  5A92 A;  1KDW A;  4OQ0 A;  2OV5 A;  3FZC A;  4F94 A;  1KGE A;  5HW3 A;  3N7W A;  4KZ5 A;  5EVI C;  1TDL A;  3PBO A;  5CTM A;  4IBX A;  4LCM A;  2E8I A;  2Y59 A;  3SH9 A;  3SS3 A;  1L0E A;  3I7J A;  3SS5 A;  3UPO A;  3OPL A;  4DDY A;  5L2F A;  1NZU A;  2DCF A;  3OZH A;  4LV3 A;  4PMA A;  4ZTK A;  5GLA A;  4WZ4 A;  4PM5 A;  4FD8 A;  1FCO A;  4GN2 A;  4JF5 A;  3SS4 A;  3OC2 A;  4B4Z A;  2HP5 A;  3IXG A;  3A3J A;  1H8Y A;  5CEB A;  4WZ5 C;  1RGZ A;  1CK3 A;  2XLN A;  2G2U A;  4EBN A;  4Y0T A;  1ONG A;  1K6R A;  3O3V A;  4MLL A;  4U3T A;  1SDN A;  1W7F A;  4S2N C;  4Q8I A;  2VGJ A;  3BRM A;  1PWC A;  1G68 A;  5HX9 A;  4DRT A;  1ZC2 A;  4N9L A;  3UNW A;  2A3U A;  1IEM A;  2JBF A;  5CHM A;  4OP5 A;  3VSK A;  2CC1 A;  3V39 A;  1E25 A;  2ZQ7 A;  5FQK A;  2EFX A;  1FQG A;  1LLB A;  1PZO A;  3W4Q A;  4WEL A;  1ZG6 A;  5KMW A;  3LY3 A;  4YFM A;  5JYP A;  1XGJ A;  1GHM A;  3NC8 A;  3V50 A;  4B4X A;  5HL1 A;  4B88 A;  1DJC A;  1M6K A;  3NIA A;  3G2Y A;  3W4O A;  5E2H A;  1YLW A;  3ZG9 B;  1BUE A;  5KSH A;  1KDS A;  3BEC A;  5DF9 A;  3UO9 A;  5GLB A;  2V20 A;  2ZM2 A;  4UA9 A;  3WS0 A;  4FSF A;  3IHB A;  3SH7 A;  1WYC A;  1WYB A;  2ZQA A;  2R9X A;  3NCK A;  3Q7Z A;  1JWP A;  4E3J A;  2FFF B;  2X02 A;  3NDG A;  1MWT A;  1IYQ A;  3PAG A;  5I94 A;  3S1Y A;  2Y2H A;  5F1F A;  4OQH A;  4DF6 A;  2Z2M B;  2XR0 A;  5FAO A;  4KZ6 A;  4E3I A;  4GOG A;  3BFG A;  4QHC A;  1XGI A;  4FH2 A;  1K57 A;  4FH4 A;  1XP4 A;  5E2E A;  1W8Y A;  3VMA A;  3A3D A;  2WAF A;  3GMW A;  3HL9 A;  3VP0 A;  4X6T A;  3ZCZ A;  4WYY A;  1KE3 A;  1K4E A;  2PU4 A;  2QZ6 A;  2HDQ A;  3LY4 A;  1K55 C;  1FR1 A;  2Y2I A;  4PM7 A;  3HUM A;  4R4R A;  3VOZ A;  4EBP A;  5GLC A;  1BLC A;  2WGI A;  4NK3 A;  3RJU A;  3BFD A;  1GHI A;  3IF6 C;  3DW0 A;  2DNS A;  1RP5 A;  3BEB A;  3ISG A;  1ES5 A;  3ZDJ A;  3RXW A;  2XK1 A;  3IWO A;  1PWG A;  4JPM A;  1K54 A;  1PI5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...