1ERMA

X-ray crystal structure of tem-1 beta lactamase in complex with a designed boronic acid inhibitor (1r)-1-acetamido-2-(3-carboxyphenyl)ethane boronic acid
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
263
structure length
262
Chain Sequence
b'HPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRWEPELNEAIPNDERDTTMPAAMATTLRKLLTGELLTLASRQQLIDWMEAKVAGPLLRSALPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TEM-1 BETA-LACTAMASE
publication title Structure-based design guides the improved efficacy of deacylation transition state analogue inhibitors of TEM-1 beta-Lactamase(,).
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 90
structure length 262
sequence length 263
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2000-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 1ermA00
4C75A 5CXWA 5FI2A 3PBQA 5E2EA 1ALQA 2FFFB 3P98A 1KE4A 3HUMA 4KZ3A 1IYPA 2WAEA 3HREA 4GB7A 4JXGA 4QD4A 1NJ4A 1H8ZA 1FQGA 2XQZA 1FR1A 2HDQA 2ZJ9A 3DW0A 4DDYA 4LV2A 3IF6B 5EOEA 5HW3A 2A49A 5E43A 1XKZA 2Z2LB 4MEZA 5I94A 3N8LA 1FR6A 4P6BA 1FCNA 1JWZA 4N9KA 3FKWA 1L0EA 3M6BA 3OPHA 5A90A 1QMFA 3HVFA 5GLCA 3SH8A 1DY6A 4A5RA 1ES2A 3HBRA 3Q81A 2XDMA 3DWZA 2WKHA 2EX6A 3N8RA 4OKPA 4E3NA 5EVIA 2HPBA 5TR7A 5GLBA 1QMEA 2Y2OA 2HDRA 2WGWB 3A3JA 4HBTA 1KE0A 1I5QA 1NRFA 1PWDA 1K57A 2B5RA 3N4IA 3O87A 4FH4A 1K55A 5GLDA 4BLMA 1SCWA 4GDNA 2XR0A 2XD1A 3OCNA 1EI5A 5EE8A 3VP1A 4KQQA 3RXXA 4K0WA 3BM6A 5J8XA 2C6WB 4X68A 2JE5A 1KVLA 5A91A 2CC1A 4ZDXA 3PBSA 4IBXA 3BRMA 4OPZA 4EV4A 4UAAA 1FOFA 4S2KA 5FQIA 2Y4AA 1RCJA 4GNUA 3GV9A 4PPRA 3FWLA 1SKFA 4WBGA 4JBFA 4P0MA 3MXRA 4ZJ1A 1BLSA 2C5WB 3UN7A 3P09A 1KDSA 1IEMA 1YLPA 4O7DA 1GHIA 3ITBA 4EBPA 5FASA 1H5XA 5FAPA 4MBKA 4U0TA 3M2JA 3Q7VB 3UPOA 3S4XA 4P87A 2WGVA 3IHAA 5EOOA 4FH2A 3ZFZA 1M40A 3MZDA 2GDNA 2OLVA 3HLWA 5CRFA 2ZQ8A 1MPLA 2Y2QA 4Y7PA 4X69A 3M2KA 1PI5A 4X55A 5KMWA 1K56D 3IF5A 3QNBA 1XGJA 3UE3A 5G18A 3G2YA 2XFSA 2XFTA 3V3RA 2Q9MA 3O88A 5HAQA 5AQ9A 5FA7A 3FYZA 3Q82A 1L0DA 4E3KA 3GQZA 3ZG5A 4OOMA 3QHYA 4OPQA 1IYOA 4KZ7A 4KQRA 2ZLYA 1S6RA 3HL9A 3BFFA 1TEMA 3HLEA 3NCKA 3NDGA 4K0XA 4JXWA 5EVIC 4U0XA 3HUOA 3VMAA 4F94A 3UE1A 4GD8A 5IHVA 4RA7A 5L2FA 3A3IA 4BD1A 4GOGA 2Y2JA 3CMZA 3W4OA 2PU4A 3N8SA 4R23A 1CI8A 2J9PA 2BG1A 2WZZA 4KZAA 1GA9A 5JYPA 2EXBA 1K54A 1IKIA 4JF5A 3CG5A 1SDEA 2Z2MB 1W8YA 2ZQCA 3NBLA 5CHMA 5AQBA 4C6YA 1BZAA 1JTDA 4KZ9A 2X02A 1IYQA 1YMSA 4UA9A 5DF7A 2WAFA 3HLFA 1L0FA 2XEPA 3IT9A 4B4ZA 3TSGA 1SHVA 3G34A 2Q9NA 3M6HA 5CGWA 1FSWA 5CTNA 3ITAA 1O7EA 4OLGA 3OZHA 2WYXA 1NZOA 2JC7A 4GD6A 4IVIA 3SH7A 2ZM0A 2Y2LA 3MBZA 1K56A 3NDEA 1W79A 3G31A 4KQOA 4OQHA 4R0QA 2VGKA 4R3JA 4ZAMA 2Y2PA 3GSGA 2P9VB 1S0WA 4DRTA 4OQGA 3VP0A 4GN2A 2QPNA 1XX2A 1LL9A 1G68A 3WS0A 5BOHA 5FQ9A 2ZQ7A 4UA6A 1ES4A 4S2OA 3OPRA 4EWFA 1K4FA 1ESUA 2QZ6A 1WE4A 3SOIA 3DTMA 2RCXA 4RVAA 4PM5A 5CGXA 2H0TA 1I2SA 2E8IA 4IVKA 4LV0A 4S2NA 4X53A 5DTKA 4EBLA 3MXSA 3LEZA 3HLCA 3IWIA 3CZDA 1RGZA 4S2IA 4XUXA 1PI4A 1YLTA 2HDSA 2EX8A 5HX9A 4S2JA 5F83A 1YLZA 3BLMA 3FZCA 2V1ZA 4KENB 2ZC6B 4Y0UA 5DF8A 4Z9QA 3RXWA 3UPPA 4HESA 2WADA 5EPHA 5EECA 5JYOA 2WGWA 1E25A 3WS4A 2Y2GA 4N1HA 4WELA 4XUZA 1ERMA 3PBRA 1EWZA 2FFYA 5DTTA 2J8YA 1LI9A 1NZUA 1KGEA 2Y2IA 3C5AA 3HUNA 1DJCA 4OPYA 1MY8A 3UPNA 3WRZA 2H5SA 1PW1A 1Q2QA 1BTLA 1WYBA 1ZG6A 3IXBA 3OPPA 2JCHA 3BFDA 3NI9A 1FSYA 4WZ5A 2G2WA 3V5MA 3BFCA 5TGFA 1IYSA 1GCEA 4E6XA 5EVIB 4HEFA 1FCOA 4NK3A 3IQAA 3EQUA 3MZEA 2XLNA 4WM9A 5CEDA 2IWDA 3G4PA 4ID4A 1DJBA 5DF9A 1YM1A 4QJGA 2WKEA 4R4RA 5HAPA 3PAGA 1BSGA 2J9OA 3OPLA 3WS2A 3S22A 1N4OA 4OQIA 3IHBA 1PIOA 1SDNA 4N9LA 3G35A 2Y2NA 4OLDA 3BFEA 3VFFA 4C3QA 3GMWA 3MKEA 1MWTA 1KE3A 3IWOA 5D3OA 4ZJ2A 3WS5A 5CTMA 2HP6A 4PM6A 1BLPA 3UE0A 2XK1A 1W7FA 2OV5A 1BLHA 1PWGA 1O07A 5FQJA 2ZC3B 1WYCA 5FI6A 1K57C 4QU3A 4BL3A 1HD8A 1I2WA 1K55C 1J9MA 2EFUA 5FAOA 5FSRA 3V50A 5CEBA 1G6AA 2HP5A 1CI9A 4OP8A 1PW8A 3N7WA 1ONGA 2WUQA 4KZ8A 4QB8A 5EUAA 4E3IA 4CPKA 1C3BA 2X71A 5FAQA 3PTEA 2X01A 2H0YA 4OOLA 1RGYA 3Q1FA 5A92A 1XGIA 3ZG9B 4DE0A 5FDHA 4RYEA 3SS4A 5HAIA 4NETA 4BENA 2Y55A 4WMCD 4E3JA 3W4PA 5TFQA 1AXBA 2OLUA 1LL5A 1KGFA 2ZC5B 3A3EA 4OVDA 5EVLA 3VP4A 4R1GA 5M18A 5FQQA 3VP2A 5FQKA 3MKFA 1DJAA 3O3VA 2OSUA 4DKIA 1K4EA 1L2SA 4WEKA 3HLBA 3C4PA 1JVJA 2QMIA 2ZMAA 2PBYA 1CEFA 1MBLA 3ZNTA 4IEDA 2XF3A 5CERA 1NYMA 2ZM8A 5CGSA 2PU2A 1U60A 2P9VA 1JWPA 1MWRA 1NYYA 1CEGA 2ZQDA 2Y59A 5HARA 3ZHHA 4PM9A 4QY6A 5M19A 3LY3A 1MWUA 4MLLA 1MXOA 3W4QA 4MBHA 5FI7A 3RJUA 1LLBA 3HLDA 1E4DA 4MNRA 4JXSA 4EBNA 5F1FA 4JKTA 1XA7A 1E3UD 5HL1A 2Y2KA 3GR2A 4BL2A 3NIAA 3UDFA 1FCMA 2XD5A 4LV3A 3IF6A 2EX9A 1Q2PA 1Z6FA 1JWVA 1IKGA 2DCFA 3VFHA 3W8KA 1BULA 3GTCA 3MZFA 3Q7ZA 3VOZA 1K54C 3GRJA 1GA0A 3ZVWA 2V20A 4WMCA 3AGFA 4LV1A 4JF4A 2G2UA 1W8QA 3QNCA 4X56A 4E3OA 4RX2A 1YLWA 1ONHA 1L0GA 4LCLA 5GHXA 1ES5A 3C7VA 3GVBA 4S2LA 4DF6A 5F1GA 1BT5A 3ZVTA 4H8RA 4OQ0A 4Y0TA 1BUEA 5CHJA 1VM1A 5AQ7A 2Y91A 1ZG4A 2A3UA 3AGDA 4B88A 5CHUA 3V39A 3AGEA 1KVMA 1HVBA 2HDUA 4PM7A 4DE2A 1TVFA 1Y54A 1GHPA 3C4OA 4LCMA 1HZOA 1KGGA 4GZBA 2Y2MA 3G2ZA 3UDIA 1JTGA 1ZC2A 3BECA 4Q8IA 5DTSA 2HP9A 2DNSA 3WRTA 3ZCZA 1GHMA 4QY5A 1M6KA 3G32A 3A3FA 1PYYA 4RX3A 2ZD8A 4N1XA 3ZG0A 1E3UA 4K91A 1ES3A 4S2MA 2WZXA 4JPMA 2V2FF 2ZM2A 4DE3A 5DVAA 4OOYA 3Q7VA 3VSKA 3TG9A 1HTZA 1YQSA 3IWQA 1IELA 3FKVA 3IF6C 4DXBA 4FD8A 3N6IA 4S2NC 1RP5A 3MFDA 2H10A 1LHYA 4OPRA 4KG5A 5M1AA 4E3LA 2XH9A 1N9BA 1XXMA 2UWXA 2WKIA 1W5DA 3IH9A 5FQMA 3CJMA 1ESIA 4KZBA 3UY6A 3VP3A 3BLSA 3VSLA 3WWXA 1PWCA 3ZNYA 4DXCA 3E2KA 3OC2A 3PBNA 3BFGA 3NC8A 1XA1A 3O86A 4S2PA 1BLCA 3E2LA 3ZG8B 4WEJA 2WK0A 1EROA 4UHUA 4L0LA 3B3XA 2I72A 1K25A 4FCFA 4KZ5A 1YLYA 1LI0A 4M3KA 4YFMA 4R4SA 3NY4A 1VQQA 4FSFA 4OP5A 3SS5A 1YT4A 3Q07A 4ZTKA 4OONA 1ERQA 3ZDJA 1XP4A 4WZ5C 2J7VA 4KG6A 4ZBEA 3ZG7B 3LO7A 3OCLA 2EFXA 4BQMA 4WZ4A 3BEBA 5U47A 3TOIA 2ZQAA 2EXAA 3IH8A 4EUZA 3S1YA 5HFOA 4KZ4A 4D2OA 3LCEA 5GHZA 5CECA 1XPBA 3A3DA 4N92A 4X6TA 5AQAA 3I7JA 4DE1A 3UNWA 5E2HA 3SH9A 3BYDA 4KZ6A 2WGIA 1K38A 3LY4A 4EQIA 5E2GA 2R9XA 4HBUA 3C7UA 1K6SA 3IXDA 5FATA 1YLJA 4WYYA 4E6WA 4OH0A 3JYIA 4LENA 3UO9A 3FV7A 4BD0A 4BJPA 4R3BA 5A93A 5E2FA 1TDLA 2ZC7A 4JLFA 5GHYA 1MKIA 4ZJ3A 5KSCA 1TDGA 4PM8A 4XXRA 1CK3A 4DDSA 2VGJA 3PBTA 3V3SA 5KSHA 2BLSA 2IWBA 4CJNA 2P74A 3D4FA 3IXHA 3SS3A 1PZPA 1OMEA 4JF6A 4PMAA 3WS1A 2Y2HA 2RL3A 1NXYA 5EVID 4KG2A 5KZHA 4B4XA 1YMXA 1ZKJA 2XGNA 2JBFA 3PAEA 5F82A 2IWCA 1PZOA 1H8YA 5GL9A 4E3MA 1MWSA 1K6RA 3EQVA 2DRWA 2ZC4B 4Y0OA 3VOYA 4GDBA 2ZQ9A 3UDXA 3PBOA 4JXVA 4U3TA 2R9WA 4GKUA 2EX2A 4UA7A 3IXGA 4YINA 1KDWA 3ISGA 4QHCA 3HLGA 4MBFA 5GLAA 4IBRA 4P85A 1NY0A 3G30A 3ZGAB 3DWKA
chains in the Genus database with same CATH superfamily
4C75A 4HI4A 2JKFA 2HV1A 4R38A 1KE4A 4KZ3A 2WAEA 3HREA 1FR1A 5HW3A 1TS7A 1XKZA 2W3HA 4H6JB 4M4XA 1H0MA 1JWZA 4ESPA 3FKWA 1L0EA 4BBUA 1QMFA 2YKFA 5GLCA 3HBRA 3Q81A 2XDMA 3N8RA 2Y2OA 1KE0A 1K55A 2PBDP 1SCWA 4GDNA 2XD1A 3VP1A 3D3OA 1N9OA 1NWZA 5IT5A 4UAAA 4GS9B 1ZHHB 3NECA 4GNUA 4PPRA 3FWLA 1SKFA 3CHWP 5F6AA 4ZJ1A 3P09A 2PR5A 1KDSA 1IEMA 1GHIA 4P87A 3IHAA 5EOOA 3KSFA 4FH2A 3ZFZA 2GDNA 5EM1A 4CLCA 4Y7PA 4X69A 1PI5A 1K56D 3IF5A 3V3RA 1L0DA 3GQZA 4OPQA 1S6RA 3BFFA 4EUVA 5TBMA 3VMAA 3VOLA 3UE1A 4F94A 4RA7A 2V9AA 4GOGA 3CMZA 2HJ9C 2QYBA 5JYPA 4KQDA 1K54A 1IKIA 4JF5A 2ZQCA 3NBLA 5AQBA 4KZ9A 2X02A 4R3AA 2ZL1A 1YMSA 2WAFA 3HLFA 2XEPA 1ZTUA 4EQ1A 4B4ZA 3FC7A 2OAP1 4OLGA 3OZHA 3SH7A 4IVIA 2Y2LA 1NRJA 4KQOA 5HD3A 1H3QA 2Y2PA 4ME4A 4BBTA 2P9VB 2NUTC 1XX2A 4I3IA 2XRNA 1ES4A 2VX8A 3OPRA 3F1PB 4PM5A 1I2SA 4LV0A 1NLYA 4Q0JA 3OOVA 4P6ZM 3KYQA 1RGZA 3T12B 1SKOB 1PI4A 1YLTA 1P9WA 2EX8A 3BLMA 2V1ZA 4Y0UA 5DF8A 4Z9QA 2WADA 5JYOA 2WGWA 1E25A 3OLOA 1ERMA 2FFYA 5DTTA 3QP1A 1MZUA 4YWZA 4OPYA 2QHKA 2H5SA 1Q2QA 1BTLA 3OPPA 2VGLM 5DJTA 2NUPC 3V5MA 2XA7S 3KYZA 1FCOA 3TRCA 3IQAA 3EQUA 3TE8A 4ID4A 5DF9A 1XJ2A 2WKEA 3C2WA 4R4RA 5HAPA 4MCWA 4WF0A 3G35A 2Y2NA 4OLDA 3BFEA 3GMWA 1X0OA 4PM6A 3UE0A 3ICYA 4Q0HA 2OV5A 1BLHA 1O07A 3H7WA 4BL3A 1HD8A 5FSRA 5CEBA 4WL9A 3N7WA 4CLCB 4E3IA 2V1BA 5FEFA 5FAQA 4OOLA 3Q1FA 5A92A 3ZG9B 3SS4A 1OTBA 4NETA 3UMEA 3A3EA 4KUKA 3PXPA 1L2SA 1CEFA 2XF3A 1NYMA 5A8BA 3UB7A 1U60A 2W27A 4QY6A 1KOUA 4MLLA 1LLBA 1E4DA 4EXOA 5F1FA 4MDZA 4NEED 3T4TA 2PDRA 3UE6A 2Y2KA 3GR2A 4BL2A 4O0PA 2J80A 3IF6A 3IX8A 1Z6FA 5EM0A 2DMWA 3BY9A 2DCFA 3W8KA 3Q7ZA 1JNUA 4WLAA 2V20A 4HJ6A 4YNRA 4EETB 4LV1A 2QJ5A 2Z6CA 5HD5A 3QNCA 4IUKA 4X56A 1ONHA 1L0GA 2XSSA 5GHXA 4DF6A 5F1GA 5FDSA 4H8RA 1F5MA 5AQ7A 2Y91A 2A3UA 3MSHA 1KVMA 2HDUA 1TVFA 1GHPA 4GLQA 3BECA 5DTSA 3G32A 4RX3A 4K91A 2VKSA 4Y2FA 2JN7A 4DE3A 3Q7VA 1HTZA 2B95A 4DXBA 4FD8A 3N6IA 1RP5A 3MFDA 2H10A 2E8JA 4OPRA 5M1AA 2BTFP 1N9BA 5G4ZA 4LPZA 3CJMA 1ESIA 1F9IA 1F2KA 1HLUP 4JGOA 5EFWA 1Y28A 2M7VA 5HPIA 1XA1A 1BLCA 4IHQA 4WEJA 1EROA 4UHUA 2O9AA 4FCFA 4KZ5A 4M3KA 4R4SA 4OP5A 1TF1A 3E4PA 4OONA 1XP4A 4WZ5C 3ZG7B 3LO7A 3OCLA 3R4KA 1G5UA 4WZ4A 3BEBA 3TOIA 1S67L 3IH8A 4MMNA 2W1TB 3T4OA 2V0WA 1YSQA 3EOIA 4DE1A 3SH9A 3BYDA 3LY4A 2R9XA 3HCYA 3JYIA 3FV7A 5F68A 1TDLA 4JLFA 2PT7A 1CK3A 5KSHA 2VGJA 3PBTA 2BLSA 3UMDA 5HWTA 3SS3A 2V0UA 3FG8A 4KG2A 3NHQA 1YMXA 2XGNA 3HJIA 5F82A 5GL9A 1K6RA 3EQVA 2ZC4B 4ARZB 4JXVA 4U3TA 3LIFA 1XJ6A 4XT2A 5GLAA 3G30A 4BBVA 3PYPA 2M1CA 1IYPA 3T4LA 2VV8A 4QD4A 1NJ4A 1H8ZA 1FQGA 2PAVP 2HDQA 3DW0A 1W63M 3IF6B 5I94A 3N8LA 4PHTA 1WA9A 4N9KA 5A90A 3SH8A 2V8FA 4A5RA 3MQ0A 3K2NA 5HPFA 3C38A 1GSWA 2WKHA 2EX6A 2KX6A 5J4EA 2PRFA 3A3JA 1I5QA 1K57A 2PHYA 5DJUA 4GW9A 3W2ZA 3H82B 5EE8A 5HL6A 3RFBA 3RXXA 5J8XA 3BM6A 4X68A 1KVLA 5A91A 2CC1A 3PBSA 4EV4A 4Y17A 4WBGA 1LSWA 2ACGA 1BLSA 3UN7A 2UV0E 3ITBA 1H5XA 4Y5FA 3Q7VB 4NXFA 1ACFA 3PR6A 2ZQ8A 2Y2QA 4G3WA 3QNBA 1XGJA 2Q9MA 3FYZA 2PD7A 1S4RA 3L7HA 4Q0IA 3BW6A 5IS1A 4KQRA 1V9ZA 4DE2A 3NCKA 4K0XA 5IU1A 3NDGA 4GD8A 5IHVA 3JVVA 2Y2JA 3W4OA 3N8SA 4R23A 1CI8A 4I3AA 2J9PA 2WZZA 4KZAA 5CX7A 2EXBA 4QPRA 3CG5A 1SDEA 3FPVA 4AFIA 4UA9A 3T1RA 1OT9A 1LT0A 3G34A 3NULA 4HOIA 3M6HA 5CGWA 1FSWA 3DTKA 1O7EA 1NZOA 2JC7A 3NDEA 4R0QA 2VGKA 2O9CA 2J3TC 1S0WA 3E0YA 4BWIA 5EV0A 4LLOB 3VP0A 2QPNA 1LL9A 3KYEA 5FQ9A 1K4FA 1ESUA 1WE4A 5CGXA 2E8IA 4S2NA 5G4YA 3CZDA 4XUXA 1XJ4A 2HDSA 5HX9A 4NXEA 2B18A 4S2JA 2GZAA 4HJ4A 3UPPA 3T1XA 2W3DA 3WS4A 4N1HA 4XUZA 1LI9A 1KGEA 1V9YA 1MY8A 1PW1A 1SZVA 1ZG6A 2JCHA 1FSYA 2Y8HA 2HGVA 3QP8A 1IYSA 3IBRA 4E6XA 1L3LA 3MFXA 5AJGA 3H9WA 2P04A 5CEDA 1YM1A 4QJGA 3PAGA 2J9OA 3WS2A 3S22A 1N4OA 3LI8A 2R78A 3IHBA 4N9LA 1SDNA 4O01A 3MKEA 1KE3A 3IWOA 3WS5A 5CTMA 1BLPA 4L9FA 1W7FA 1Z09A 5FQJA 1WYCA 5HWWA 5FI6A 1I2WA 1J9MA 5LBRA 3V50A 3CAXA 1ONGA 5EUAA 4CPKA 4JGQA 2L1MA 1XGIA 5FDHA 4RYEA 4BENA 4WMCD 4E3JA 5TFQA 1LL5A 1S4SA 3VP4A 4R1GA 1VEUA 3MKFA 3O3VA 2OSUA 1K4EA 5DKKA 3TJZC 2QMIA 2ZMAA 1BYWA 4ETXA 4IEDA 5CERA 5CGSA 3MQQA 1MWRA 1NLZA 1MWUA 3W4QA 1IOUA 4PKYG 1VHMA 3RJUA 4EBNA 2PD8A 3R7WB 1XA7A 4I38A 1E3UD 1YPRA 2XD5A 4LV3A 1Q2PA 1TD5A 5J3WA 3VFHA 3EEHA 3MZFA 3VOZA 4HNBA 3ZVWA 1GA0A 3BWLA 3CUEC 2J3WA 4RX2A 2VZWA 4LCLA 2B02A 1ES5A 1BT5A 2H28A 3ZVTA 1OJ5A 5CHJA 1ZG4A 1FIKA 3AGDA 4B88A 5CHUA 5AVFA 2JHEA 3C4OA 2K2NA 4LCMA 4GZBA 2Y2MA 3G2ZA 1ZC2A 1T19A 3WRTA 4QY5A 1CF0A 3A3FA 5HZHA 1PYYA 2L4RA 2QWSA 4RQ9A 3QP2A 1ES3A 4HP9A 2XA7M 3A0SA 5DVAA 3CITA 3TG9A 2VV7A 3IWQA 3FKVA 3IF6C 3K3CA 2OAQ1 5FL3A 1XXMA 1W5DA 4IUHA 4DXCA 3PBNA 3O86A 3E2LA 1OTDA 4L0LA 3B3XA 4GHIA 4YFMA 3S7NA 3NY4A 3MS6A 3Q07A 2ZOIA 3B33A 5FEGA 3ZDJA 4BQMA 5L10A 2EXAA 4X1LA 5TBMB 5GHZA 4X6TA 5AQAA 5E2GA 3QP4A 1YLJA 4OH0A 4UQIS 5DFXA 3UO9A 4BD0A 4ZJ3A 2ZL1B 2MJ6A 3UB8A 5HDDA 2IWBA 2P74A 3D4FA 1PZPA 3MJQA 3WS1A 2D01A 3EEAA 3DAVA 3PAEA 4HJ3A 2WKPA 1G6OA 1MWSA 5HDSA 4FOFA 4Y0OA 2Q0OA 4GDBA 4NXGA 5KIZA 4GKUA 2EX2A 3IXGA 3ISGA 4QHCA 4JGRA 4EERA 3F1OA 1NY0A 4CLCE 5KSCA 1T18A 5CXWA 5FI2A 3PBQA 1ALQA 3P98A 2HZ5A 3HUMA 4GB7A 4JXGA 2ZJ9A 5L07A 4CQHA 3EGDC 3EWKA 3LIDA 4P6BA 1FCNA 4LRXC 4CLCD 3M6BA 1XFNA 3S7QA 1ES2A 2INWA 2J3TD 4ZRRA 5L09A 5EVIA 2HPBA 1PNEA 1W63Q 4PAUA 2WGWB 1NRFA 4EEPA 3N4IA 2B5RA 4FH4A 4BLMA 4NXBA 2A2LA 3OCNA 1EI5A 1LSVA 2W1RA 4F3LA 3LYXA 1LL8A 4OPZA 4S2KA 2Y4AA 3GV9A 5F5YA 3ZYTA 1VETA 5DFYA 4JBFA 4DMZA 4P0MA 2C5WB 4L9GA 1YLPA 4O7DA 4EBPA 4MBKA 4U0TA 3M2JA 1CQAA 3NOPC 4Z1WA 1STZA 3S4XA 3UPOA 3LIAA 1UGUA 1M40A 3MZDA 3HLWA 2OLVA 5CRFA 1MPLA 2O9BA 3M2KA 4X55A 5KMWA 5G18A 3G2YA 2XFSA 2XFTA 1S1ZA 3O88A 5HAQA 5FA7A 3Q82A 3ZG5A 2CMNA 3QHYA 4EW7A 5HSQA 1IYOA 4KZ7A 2VK3A 2ZLYA 3HL9A 1TEMA 3HUOA 5L2FA 1OTIA 3H7WB 4BD1A 3T4JA 2PU4A 3BQ8A 2BG1A 3QP5A 3E98A 3IX4A 1W8YA 4C6YA 1BZAA 4R6LA 1IYQA 5DF7A 1L0FA 3UB5P 3IT9A 3TSGA 5CTNA 3LIBA 5HWVA 1TS0A 4GD6A 2ZM0A 3MBZA 1K56A 2XROA 1W79A 3LUQA 4OQHA 4ZAMA 4FUWA 2PR6A 4DRTA 4OQGA 4GN2A 4K08A 2KDKA 3WS0A 1OJGA 2ZQ7A 4UA6A 4S2OA 4EWFA 3SOIA 4IVKA 4H6JA 3SZTA 4EBLA 3T1QB 4S2IA 3LR5A 1YLZA 1J3WA 2ZC6B 3RXWA 3B47A 4BMWA 4HESA 5EPHA 2K7SA 2Y2GA 4WELA 5DKLA 3ULFA 3PBRA 1NZUA 4HQAA 3C5AA 1MKMA 1DJCA 4DJ2A 3UPNA 1WYBA 3IXBA 3BFDA 4WZ5A 2G2WA 1GCEA 5EVIB 4HEFA 5K5BA 2G7UA 4LFUA 4UEYA 4FTXA 2V1AA 1OPXA 3MZEA 2M7UA 2IWDA 3G4PA 5MC7A 1DJBA 4F3LB 4GCZA 3OPLA 1XJ3A 4DJ3A 4OQIA 4HP4A 2ZOHA 2O99A 3QP6A 1PFLA 2PYRA 4C3QA 1VETB 1MWTA 4NG2A 3UB9A 2XK1A 1UWPX 1PWGA 4EESA 4QU3A 1K55C 1S1YA 2HP5A 4OP8A 3KSHA 1C3BA 2GX5A 2X71A 4B9OA 1D7EA 3PTEA 5HAIA 2Y55A 2ZC5B 1KGFA 3F1NA 3NJAA 5M18A 5FQQA 2FZ0A 4DKIA 3NOTC 3PHYA 3HLBA 3C4PA 1JVJA 4CLCC 4PKYA 1H8MA 2PBYA 1MBLA 3BQAA 2ZM8A 2P9VA 5HARA 1NYYA 1CEGA 1D06A 3G6OA 4PM9A 4WN5A 3LY3A 4MBHA 2A24A 3HLDA 4MNRA 4JKTA 4I3JA 3DTEA 1FCMA 1JWVA 2OWJA 1BULA 3GTCA 1K54C 4HHDA 2ZBBA 3AGFA 4JF4A 4XT2B 1W8QA 3T4SA 4S2LA 4OQ0A 3CLOA 1BUEA 4X1MA 3AGEA 2EA9A 2VV6A 1Y54A 1HZOA 1JTGA 3S7PA 3T1SA 2DNSA 3ZCZA 4MN5A 2ZD8A 3A0RA 4N1XA 5EVEA 3ZG0A 3LI9A 2WZXA 3OBFA 4OOYA 3VSKA 1YQSA 1GSVA 1UWNX 2LB9A 3SW1A 3LR0A 1F98A 2UWXA 1T1AA 3IX3A 4O8GA 4KZBA 3UY6A 3VP3A 5AVEA 3VSLA 3WWXA 1PWCA 3E2KA 3OC2A 3BFGA 4Y3IA 1YLYA 2BASA 3MF0A 1VQQA 4FSFA 4ZTKA 4ETZA 4D60A 2J7VA 2GJ3A 4KG6A 2O0YA 2EFXA 2ZQAA 3S1YA 3KX0X 4D2OA 1EW0A 5CECA 3A3DA 3P01A 3UNWA 3JPUA 4KZ6A 2OOLA 3MXQA 2WGIA 4E6WA 1K6SA 4R70A 4LENA 5A93A 4BJPA 5E2FA 1TDGA 3B42A 4MN6A 1TS8A 4PM8A 4XXRA 3V3SA 2V8CA 3F1NB 4CJNA 3IXHA 1OMEA 4PMAA 2EWVA 2Y2HA 4B4XA 1ZKJA 2IWCA 1PZOA 4E3MA 1S66L 3VOYA 3K3DA 3FPWA 2ZQ9A 3UDXA 2WKRA 2VJWA 3HLGA 4MBFA 2W3EA 4IBRA 2JKRM 4P85A 2A24B 5F69A 3HJKA 5E2EA 2FFFB 1YKDA 2D02A 3LGOA 4G3KA 2XQZA 3VE4A 2GNXA 4DDYA 4LV2A 5EOEA 4P6ZS 2A49A 3CPTA 5E43A 2Z2LB 4MEZA 3RTYA 3IS2A 3LEQA 1MC0A 1FR6A 2ZMVA 1Y4OA 3KO6A 3ZQ5A 3T4QA 3OPHA 3KSGA 3HVFA 4EU0A 1DY6A 1IFQA 3DWZA 4OKPA 4E3NA 5TR7A 3GECA 5GLBA 1QMEA 3E4QA 2KOIA 2HDRA 4KUOA 4HBTA 1PWDA 3O87A 5GLDA 3D9YA 2XR0A 4KQQA 2VGLS 4K0WA 4WUJA 2C6WB 2JE5A 2JKTM 2Z6DA 4ZDXA 4IBXA 3BRMA 3UB6A 1FOFA 5FQIA 1RCJA 2HF6A 3MXRA 3S7OA 4NKPA 5FASA 5FAPA 2AVXA 2WGVA 5I5LA 3UE3A 3V67A 5AQ9A 2Y79A 2L0WA 4E3KA 4OOMA 5J7EA 2W1TA 3HLEA 5EVIC 4JXWA 4U0XA 3C8CA 4B93A 3A3IA 3LICA 2I9VA 1GA9A 1OTEA 2KLIA 2Z2MB 5CHMA 1JTDA 3CUEA 2FH5A 4UQIM 2VEAA 3C30A 5HDCA 1SHVA 3LR4A 2Q9NA 2JKRI 1VEUB 3ITAA 1D1JA 4EEUA 2WYXA 1XFQA 2K31A 1P9RA 3G31A 4ARZA 4R3JA 1N9NA 3GSGA 3KSIA 4DN0A 3EGXC 1G68A 5BOHA 3VE3A 2QZ6A 3BJNA 3DTMA 2RCXA 4RVAA 2H0TA 4X53A 5DTKA 3MXSA 3LEZA 3HLCA 3IWIA 3O5YA 2JKTI 2VLGA 3A0VA 1TS6A 1OT6A 5F83A 3FZCA 1YAXA 4KENB 3LFVA 3D72A 4HH3A 5EECA 4MN7A 1EWZA 3H82A 2J8YA 3CPTB 5TJJA 2Y2IA 3HUNA 3IS2B 2W0NA 2P7JA 3WRZA 3NI9A 3BFCA 5TGFA 2W3FA 3NOUC 4NK3A 1T1BA 3MR0A 2XLNA 4WM9A 4HY8A 2EWWA 2QKPA 3LIEA 1BSGA 3U2AA 3LR3A 1N9LA 1PIOA 3VFFA 2LB5A 5D3OA 4ZJ2A 1DP9A 2HP6A 3DBAA 4GJ4A 3GDIA 4G3VA 2ZC3B 1A0KA 1K57C 5FAOA 2EFUA 1G6AA 1CI9A 3U4LP 1PW8A 3MMHA 1CJFA 2WUQA 4KZ8A 4QB8A 5L8MA 4GHIB 2X01A 2H0YA 1LSXA 1RGYA 2JKGA 4DE0A 3W4PA 1AXBA 2OLUA 4OVDA 5EVLA 1K0KA 3RH8B 1GSXA 1OTAA 3VP2A 5FQKA 1DJAA 1ODVA 2W3GA 4L9EA 4HH2A 4WEKA 3ZNTA 2PU2A 4LGWA 1JWPA 2ZQDA 2Y59A 3ZHHA 5M19A 1MXOA 3BY8A 5FI7A 1G28A 4JXSA 4QWOA 5HL1A 4IJGA 3NIAA 3UDFA 2EX9A 2IA2A 1IKGA 4YOFA 1VB6A 3GRJA 3JVUA 3L9KA 4WMCA 2G2UA 4E3OA 1YLWA 3F1OB 3C7VA 3GVBA 4I39A 1YSPA 4Y0TA 1VM1A 3T50A 4LRYC 4Y15A 2P08A 3V39A 1HVBA 4PM7A 1KGGA 3UDIA 4Q8IA 2HP9A 1DP6A 4GS9A 1GHMA 4E04A 1M6KA 3IBJA 3T4KA 1E3UA 4S2MA 4JPMA 2V2FF 2ZM2A 1PRQA 1IELA 4S2NC 1LHYA 4KG5A 2ZMFA 3VV4A 4E3LA 2XH9A 5FQMA 2WKIA 3IH9A 3BLSA 3ZNYA 4II7A 3NC8A 4LRZE 4S2PA 4I5SA 3ZG8B 2WK0A 1DRMA 4Y13A 1AWIA 2I72A 1K25A 1LI0A 3SS5A 1YT4A 1P97A 5C5KA 1ERQA 3MQOA 2PYPA 3CWFA 4ZBEA 3E4OA 5U47A 1FILA 4EUZA 2WKQA 5HFOA 4KZ4A 3LCEA 1XPBA 4N92A 4HIAA 3I7JA 2VA0A 3P7NA 5E2HA 1K38A 4EQIA 4HBUA 3C7UA 3IXDA 5FATA 3TW8A 4WYYA 4R3BA 1P0ZA 2OWHA 2ZC7A 5GHYA 4X25A 1MKIA 2HJEA 4DDSA 3R7WA 1DP8A 1T1CA 4JF6A 2YKHA 2RL3A 1NXYA 5EVID 3DTIA 5KZHA 2JBFA 3F1PA 2QJ7A 1H8YA 4JGPA 2DRWA 3PBOA 4YINA 2R9WA 4UA7A 1SKOA 1KDWA 3CI6A 3ZGAB 3DWKA
chains in the Genus database with same CATH topology
4C75A 5CXWA 5FI2A 3PBQA 5E2EA 1ALQA 2FFFB 3P98A 1KE4A 3HUMA 4KZ3A 1IYPA 2WAEA 3HREA 4GB7A 4JXGA 4QD4A 1NJ4A 1H8ZA 1FQGA 2XQZA 1FR1A 2HDQA 2ZJ9A 3DW0A 4DDYA 4LV2A 3IF6B 5EOEA 5HW3A 2A49A 5E43A 1XKZA 2Z2LB 4MEZA 5I94A 3N8LA 1FR6A 4P6BA 1FCNA 1JWZA 4N9KA 3FKWA 1L0EA 3M6BA 3OPHA 5A90A 1QMFA 3HVFA 5GLCA 3SH8A 1DY6A 4A5RA 1ES2A 3HBRA 3Q81A 2XDMA 3DWZA 2WKHA 2EX6A 3N8RA 4OKPA 4E3NA 5EVIA 2HPBA 5TR7A 5GLBA 1QMEA 2Y2OA 2HDRA 2WGWB 3A3JA 4HBTA 1KE0A 1I5QA 1NRFA 1PWDA 1K57A 2B5RA 3N4IA 3O87A 4FH4A 1K55A 5GLDA 4BLMA 1SCWA 4GDNA 2XR0A 2XD1A 3OCNA 1EI5A 5EE8A 3VP1A 4KQQA 3RXXA 4K0WA 3BM6A 5J8XA 2C6WB 4X68A 2JE5A 1KVLA 5A91A 2CC1A 4ZDXA 3PBSA 4IBXA 3BRMA 4OPZA 4EV4A 4UAAA 1FOFA 4S2KA 5FQIA 2Y4AA 1RCJA 4GNUA 3GV9A 4PPRA 3FWLA 1SKFA 4WBGA 4JBFA 4P0MA 3MXRA 4ZJ1A 1BLSA 2C5WB 3UN7A 3P09A 1KDSA 1IEMA 1YLPA 4O7DA 1GHIA 3ITBA 4EBPA 5FASA 1H5XA 5FAPA 4MBKA 4U0TA 3M2JA 3Q7VB 3UPOA 3S4XA 4P87A 2WGVA 3IHAA 5EOOA 4FH2A 3ZFZA 1M40A 3MZDA 2GDNA 2OLVA 3HLWA 5CRFA 2ZQ8A 1MPLA 2Y2QA 4Y7PA 4X69A 3M2KA 1PI5A 4X55A 5KMWA 1K56D 3IF5A 3QNBA 1XGJA 3UE3A 5G18A 3G2YA 2XFSA 2XFTA 3V3RA 2Q9MA 3O88A 5HAQA 5AQ9A 5FA7A 3FYZA 3Q82A 1L0DA 4E3KA 3GQZA 3ZG5A 4OOMA 3QHYA 4OPQA 1IYOA 4KZ7A 4KQRA 2ZLYA 1S6RA 3HL9A 3BFFA 1TEMA 3HLEA 3NCKA 3NDGA 4K0XA 4JXWA 5EVIC 4U0XA 3HUOA 3VMAA 4F94A 3UE1A 4GD8A 5IHVA 4RA7A 5L2FA 3A3IA 4BD1A 4GOGA 2Y2JA 3CMZA 3W4OA 2PU4A 3N8SA 4R23A 1CI8A 2J9PA 2BG1A 2WZZA 4KZAA 1GA9A 5JYPA 2EXBA 1K54A 1IKIA 4JF5A 3CG5A 1SDEA 2Z2MB 1W8YA 2ZQCA 3NBLA 5CHMA 5AQBA 4C6YA 1BZAA 1JTDA 4KZ9A 2X02A 1IYQA 1YMSA 4UA9A 5DF7A 2WAFA 3HLFA 1L0FA 2XEPA 3IT9A 4B4ZA 3TSGA 1SHVA 3G34A 2Q9NA 3M6HA 5CGWA 1FSWA 5CTNA 3ITAA 1O7EA 4OLGA 3OZHA 2WYXA 1NZOA 2JC7A 4GD6A 4IVIA 3SH7A 2ZM0A 2Y2LA 3MBZA 1K56A 3NDEA 1W79A 3G31A 4KQOA 4OQHA 4R0QA 2VGKA 4R3JA 4ZAMA 2Y2PA 3GSGA 2P9VB 1S0WA 4DRTA 4OQGA 3VP0A 4GN2A 2QPNA 1XX2A 1LL9A 1G68A 3WS0A 5BOHA 5FQ9A 2ZQ7A 4UA6A 1ES4A 4S2OA 3OPRA 4EWFA 1K4FA 1ESUA 2QZ6A 1WE4A 3SOIA 3DTMA 2RCXA 4RVAA 4PM5A 5CGXA 2H0TA 1I2SA 2E8IA 4IVKA 4LV0A 4S2NA 4X53A 5DTKA 4EBLA 3MXSA 3LEZA 3HLCA 3IWIA 3CZDA 1RGZA 4S2IA 4XUXA 1PI4A 1YLTA 2HDSA 2EX8A 5HX9A 4S2JA 5F83A 1YLZA 3BLMA 3FZCA 2V1ZA 4KENB 2ZC6B 4Y0UA 5DF8A 4Z9QA 3RXWA 3UPPA 4HESA 2WADA 5EPHA 5EECA 5JYOA 2WGWA 1E25A 3WS4A 2Y2GA 4N1HA 4WELA 4XUZA 1ERMA 3PBRA 1EWZA 2FFYA 5DTTA 2J8YA 1LI9A 1NZUA 1KGEA 2Y2IA 3C5AA 3HUNA 1DJCA 4OPYA 1MY8A 3UPNA 3WRZA 2H5SA 1PW1A 1Q2QA 1BTLA 1WYBA 1ZG6A 3IXBA 3OPPA 2JCHA 3BFDA 3NI9A 1FSYA 4WZ5A 2G2WA 3V5MA 3BFCA 5TGFA 1IYSA 1GCEA 4E6XA 5EVIB 4HEFA 1FCOA 4NK3A 3IQAA 3EQUA 3MZEA 2XLNA 4WM9A 5CEDA 2IWDA 3G4PA 4ID4A 1DJBA 5DF9A 1YM1A 4QJGA 2WKEA 4R4RA 5HAPA 3PAGA 1BSGA 2J9OA 3OPLA 3WS2A 3S22A 1N4OA 4OQIA 3IHBA 1PIOA 1SDNA 4N9LA 3G35A 2Y2NA 4OLDA 3BFEA 3VFFA 4C3QA 3GMWA 3MKEA 1MWTA 1KE3A 3IWOA 5D3OA 4ZJ2A 3WS5A 5CTMA 2HP6A 4PM6A 1BLPA 3UE0A 2XK1A 1W7FA 2OV5A 1BLHA 1PWGA 1O07A 5FQJA 2ZC3B 1WYCA 5FI6A 1K57C 4QU3A 4BL3A 1HD8A 1I2WA 1K55C 1J9MA 2EFUA 5FAOA 5FSRA 3V50A 5CEBA 1G6AA 2HP5A 1CI9A 4OP8A 1PW8A 3N7WA 1ONGA 2WUQA 4KZ8A 4QB8A 5EUAA 4E3IA 4CPKA 1C3BA 2X71A 5FAQA 3PTEA 2X01A 2H0YA 4OOLA 1RGYA 3Q1FA 5A92A 1XGIA 3ZG9B 4DE0A 5FDHA 4RYEA 3SS4A 5HAIA 4NETA 4BENA 2Y55A 4WMCD 4E3JA 3W4PA 5TFQA 1AXBA 2OLUA 1LL5A 1KGFA 2ZC5B 3A3EA 4OVDA 5EVLA 3VP4A 4R1GA 5M18A 5FQQA 3VP2A 5FQKA 3MKFA 1DJAA 3O3VA 2OSUA 4DKIA 1K4EA 1L2SA 4WEKA 3HLBA 3C4PA 1JVJA 2QMIA 2ZMAA 2PBYA 1CEFA 1MBLA 3ZNTA 4IEDA 2XF3A 5CERA 1NYMA 2ZM8A 5CGSA 2PU2A 1U60A 2P9VA 1JWPA 1MWRA 1NYYA 1CEGA 2ZQDA 2Y59A 5HARA 3ZHHA 4PM9A 4QY6A 5M19A 3LY3A 1MWUA 4MLLA 1MXOA 3W4QA 4MBHA 5FI7A 3RJUA 1LLBA 3HLDA 1E4DA 4MNRA 4JXSA 4EBNA 5F1FA 4JKTA 1XA7A 1E3UD 5HL1A 2Y2KA 3GR2A 4BL2A 3NIAA 3UDFA 1FCMA 2XD5A 4LV3A 3IF6A 2EX9A 1Q2PA 1Z6FA 1JWVA 1IKGA 2DCFA 3VFHA 3W8KA 1BULA 3GTCA 3MZFA 3Q7ZA 3VOZA 1K54C 3GRJA 1GA0A 3ZVWA 2V20A 4WMCA 3AGFA 4LV1A 4JF4A 2G2UA 1W8QA 3QNCA 4X56A 4E3OA 4RX2A 1YLWA 1ONHA 1L0GA 4LCLA 5GHXA 1ES5A 3C7VA 3GVBA 4S2LA 4DF6A 5F1GA 1BT5A 3ZVTA 4H8RA 4OQ0A 4Y0TA 1BUEA 5CHJA 1VM1A 5AQ7A 2Y91A 1ZG4A 2A3UA 3AGDA 4B88A 5CHUA 3V39A 3AGEA 1KVMA 1HVBA 2HDUA 4PM7A 4DE2A 1TVFA 1Y54A 1GHPA 3C4OA 4LCMA 1HZOA 1KGGA 4GZBA 2Y2MA 3G2ZA 3UDIA 1JTGA 1ZC2A 3BECA 4Q8IA 5DTSA 2HP9A 2DNSA 3WRTA 3ZCZA 1GHMA 4QY5A 1M6KA 3G32A 3A3FA 1PYYA 4RX3A 2ZD8A 4N1XA 3ZG0A 1E3UA 4K91A 1ES3A 4S2MA 2WZXA 4JPMA 2V2FF 2ZM2A 4DE3A 5DVAA 4OOYA 3Q7VA 3VSKA 3TG9A 1HTZA 1YQSA 3IWQA 1IELA 3FKVA 3IF6C 4DXBA 4FD8A 3N6IA 4S2NC 1RP5A 3MFDA 2H10A 1LHYA 4OPRA 4KG5A 5M1AA 4E3LA 2XH9A 1N9BA 1XXMA 2UWXA 2WKIA 1W5DA 3IH9A 5FQMA 3CJMA 1ESIA 4KZBA 3UY6A 3VP3A 3BLSA 3VSLA 3WWXA 1PWCA 3ZNYA 4DXCA 3E2KA 3OC2A 3PBNA 3BFGA 3NC8A 1XA1A 3O86A 4S2PA 1BLCA 3E2LA 3ZG8B 4WEJA 2WK0A 1EROA 4UHUA 4L0LA 3B3XA 2I72A 1K25A 4FCFA 4KZ5A 1YLYA 1LI0A 4M3KA 4YFMA 4R4SA 3NY4A 1VQQA 4FSFA 4OP5A 3SS5A 1YT4A 3Q07A 4ZTKA 4OONA 1ERQA 3ZDJA 1XP4A 4WZ5C 2J7VA 4KG6A 4ZBEA 3ZG7B 3LO7A 3OCLA 2EFXA 4BQMA 4WZ4A 3BEBA 5U47A 3TOIA 2ZQAA 2EXAA 3IH8A 4EUZA 3S1YA 5HFOA 4KZ4A 4D2OA 3LCEA 5GHZA 5CECA 1XPBA 3A3DA 4N92A 4X6TA 5AQAA 3I7JA 4DE1A 3UNWA 5E2HA 3SH9A 3BYDA 4KZ6A 2WGIA 1K38A 3LY4A 4EQIA 5E2GA 2R9XA 4HBUA 3C7UA 1K6SA 3IXDA 5FATA 1YLJA 4WYYA 4E6WA 4OH0A 3JYIA 4LENA 3UO9A 3FV7A 4BD0A 4BJPA 4R3BA 5A93A 5E2FA 1TDLA 2ZC7A 4JLFA 5GHYA 1MKIA 4ZJ3A 5KSCA 1TDGA 4PM8A 4XXRA 1CK3A 4DDSA 2VGJA 3PBTA 3V3SA 5KSHA 2BLSA 2IWBA 4CJNA 2P74A 3D4FA 3IXHA 3SS3A 1PZPA 1OMEA 4JF6A 4PMAA 3WS1A 2Y2HA 2RL3A 1NXYA 5EVID 4KG2A 5KZHA 4B4XA 1YMXA 1ZKJA 2XGNA 2JBFA 3PAEA 5F82A 2IWCA 1PZOA 1H8YA 5GL9A 4E3MA 1MWSA 1K6RA 3EQVA 2DRWA 2ZC4B 4Y0OA 3VOYA 4GDBA 2ZQ9A 3UDXA 3PBOA 4JXVA 4U3TA 2R9WA 4GKUA 2EX2A 4UA7A 3IXGA 4YINA 1KDWA 3ISGA 4QHCA 3HLGA 4MBFA 5GLAA 4IBRA 4P85A 1NY0A 3G30A 3ZGAB 3DWKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4C75 A;  5CXW A;  5FI2 A;  3PBQ A;  5E2E A;  1ALQ A;  2FFF B;  3P98 A;  1KE4 A;  3HUM A;  4KZ3 A;  1IYP A;  2WAE A;  3HRE A;  4GB7 A;  4JXG A;  4QD4 A;  1NJ4 A;  1H8Z A;  1FQG A;  2XQZ A;  1FR1 A;  2HDQ A;  2ZJ9 A;  3DW0 A;  4DDY A;  4LV2 A;  3IF6 B;  5EOE A;  5HW3 A;  2A49 A;  5E43 A;  1XKZ A;  2Z2L B;  4MEZ A;  5I94 A;  3N8L A;  1FR6 A;  4P6B A;  1FCN A;  1JWZ A;  4N9K A;  3FKW A;  1L0E A;  3M6B A;  3OPH A;  5A90 A;  1QMF A;  3HVF A;  5GLC A;  3SH8 A;  1DY6 A;  4A5R A;  1ES2 A;  3HBR A;  3Q81 A;  2XDM A;  3DWZ A;  2WKH A;  2EX6 A;  3N8R A;  4OKP A;  4E3N A;  5EVI A;  2HPB A;  5TR7 A;  5GLB A;  1QME A;  2Y2O A;  2HDR A;  2WGW B;  3A3J A;  4HBT A;  1KE0 A;  1I5Q A;  1NRF A;  1PWD A;  1K57 A;  2B5R A;  3N4I A;  3O87 A;  4FH4 A;  1K55 A;  5GLD A;  4BLM A;  1SCW A;  4GDN A;  2XR0 A;  2XD1 A;  3OCN A;  1EI5 A;  5EE8 A;  3VP1 A;  4KQQ A;  3RXX A;  4K0W A;  3BM6 A;  5J8X A;  2C6W B;  4X68 A;  2JE5 A;  1KVL A;  5A91 A;  2CC1 A;  4ZDX A;  3PBS A;  4IBX A;  3BRM A;  4OPZ A;  4EV4 A;  4UAA A;  1FOF A;  4S2K A;  5FQI A;  2Y4A A;  1RCJ A;  4GNU A;  3GV9 A;  4PPR A;  3FWL A;  1SKF A;  4WBG A;  4JBF A;  4P0M A;  3MXR A;  4ZJ1 A;  1BLS A;  2C5W B;  3UN7 A;  3P09 A;  1KDS A;  1IEM A;  1YLP A;  4O7D A;  1GHI A;  3ITB A;  4EBP A;  5FAS A;  1H5X A;  5FAP A;  4MBK A;  4U0T A;  3M2J A;  3Q7V B;  3UPO A;  3S4X A;  4P87 A;  2WGV A;  3IHA A;  5EOO A;  4FH2 A;  3ZFZ A;  1M40 A;  3MZD A;  2GDN A;  2OLV A;  3HLW A;  5CRF A;  2ZQ8 A;  1MPL A;  2Y2Q A;  4Y7P A;  4X69 A;  3M2K A;  1PI5 A;  4X55 A;  5KMW A;  1K56 D;  3IF5 A;  3QNB A;  1XGJ A;  3UE3 A;  5G18 A;  3G2Y A;  2XFS A;  2XFT A;  3V3R A;  2Q9M A;  3O88 A;  5HAQ A;  5AQ9 A;  5FA7 A;  3FYZ A;  3Q82 A;  1L0D A;  4E3K A;  3GQZ A;  3ZG5 A;  4OOM A;  3QHY A;  4OPQ A;  1IYO A;  4KZ7 A;  4KQR A;  2ZLY A;  1S6R A;  3HL9 A;  3BFF A;  1TEM A;  3HLE A;  3NCK A;  3NDG A;  4K0X A;  4JXW A;  5EVI C;  4U0X A;  3HUO A;  3VMA A;  4F94 A;  3UE1 A;  4GD8 A;  5IHV A;  4RA7 A;  5L2F A;  3A3I A;  4BD1 A;  4GOG A;  2Y2J A;  3CMZ A;  3W4O A;  2PU4 A;  3N8S A;  4R23 A;  1CI8 A;  2J9P A;  2BG1 A;  2WZZ A;  4KZA A;  1GA9 A;  5JYP A;  2EXB A;  1K54 A;  1IKI A;  4JF5 A;  3CG5 A;  1SDE A;  2Z2M B;  1W8Y A;  2ZQC A;  3NBL A;  5CHM A;  5AQB A;  4C6Y A;  1BZA A;  1JTD A;  4KZ9 A;  2X02 A;  1IYQ A;  1YMS A;  4UA9 A;  5DF7 A;  2WAF A;  3HLF A;  1L0F A;  2XEP A;  3IT9 A;  4B4Z A;  3TSG A;  1SHV A;  3G34 A;  2Q9N A;  3M6H A;  5CGW A;  1FSW A;  5CTN A;  3ITA A;  1O7E A;  4OLG A;  3OZH A;  2WYX A;  1NZO A;  2JC7 A;  4GD6 A;  4IVI A;  3SH7 A;  2ZM0 A;  2Y2L A;  3MBZ A;  1K56 A;  3NDE A;  1W79 A;  3G31 A;  4KQO A;  4OQH A;  4R0Q A;  2VGK A;  4R3J A;  4ZAM A;  2Y2P A;  3GSG A;  2P9V B;  1S0W A;  4DRT A;  4OQG A;  3VP0 A;  4GN2 A;  2QPN A;  1XX2 A;  1LL9 A;  1G68 A;  3WS0 A;  5BOH A;  5FQ9 A;  2ZQ7 A;  4UA6 A;  1ES4 A;  4S2O A;  3OPR A;  4EWF A;  1K4F A;  1ESU A;  2QZ6 A;  1WE4 A;  3SOI A;  3DTM A;  2RCX A;  4RVA A;  4PM5 A;  5CGX A;  2H0T A;  1I2S A;  2E8I A;  4IVK A;  4LV0 A;  4S2N A;  4X53 A;  5DTK A;  4EBL A;  3MXS A;  3LEZ A;  3HLC A;  3IWI A;  3CZD A;  1RGZ A;  4S2I A;  4XUX A;  1PI4 A;  1YLT A;  2HDS A;  2EX8 A;  5HX9 A;  4S2J A;  5F83 A;  1YLZ A;  3BLM A;  3FZC A;  2V1Z A;  4KEN B;  2ZC6 B;  4Y0U A;  5DF8 A;  4Z9Q A;  3RXW A;  3UPP A;  4HES A;  2WAD A;  5EPH A;  5EEC A;  5JYO A;  2WGW A;  1E25 A;  3WS4 A;  2Y2G A;  4N1H A;  4WEL A;  4XUZ A;  1ERM A;  3PBR A;  1EWZ A;  2FFY A;  5DTT A;  2J8Y A;  1LI9 A;  1NZU A;  1KGE A;  2Y2I A;  3C5A A;  3HUN A;  1DJC A;  4OPY A;  1MY8 A;  3UPN A;  3WRZ A;  2H5S A;  1PW1 A;  1Q2Q A;  1BTL A;  1WYB A;  1ZG6 A;  3IXB A;  3OPP A;  2JCH A;  3BFD A;  3NI9 A;  1FSY A;  4WZ5 A;  2G2W A;  3V5M A;  3BFC A;  5TGF A;  1IYS A;  1GCE A;  4E6X A;  5EVI B;  4HEF A;  1FCO A;  4NK3 A;  3IQA A;  3EQU A;  3MZE A;  2XLN A;  4WM9 A;  5CED A;  2IWD A;  3G4P A;  4ID4 A;  1DJB A;  5DF9 A;  1YM1 A;  4QJG A;  2WKE A;  4R4R A;  5HAP A;  3PAG A;  1BSG A;  2J9O A;  3OPL A;  3WS2 A;  3S22 A;  1N4O A;  4OQI A;  3IHB A;  1PIO A;  1SDN A;  4N9L A;  3G35 A;  2Y2N A;  4OLD A;  3BFE A;  3VFF A;  4C3Q A;  3GMW A;  3MKE A;  1MWT A;  1KE3 A;  3IWO A;  5D3O A;  4ZJ2 A;  3WS5 A;  5CTM A;  2HP6 A;  4PM6 A;  1BLP A;  3UE0 A;  2XK1 A;  1W7F A;  2OV5 A;  1BLH A;  1PWG A;  1O07 A;  5FQJ A;  2ZC3 B;  1WYC A;  5FI6 A;  1K57 C;  4QU3 A;  4BL3 A;  1HD8 A;  1I2W A;  1K55 C;  1J9M A;  2EFU A;  5FAO A;  5FSR A;  3V50 A;  5CEB A;  1G6A A;  2HP5 A;  1CI9 A;  4OP8 A;  1PW8 A;  3N7W A;  1ONG A;  2WUQ A;  4KZ8 A;  4QB8 A;  5EUA A;  4E3I A;  4CPK A;  1C3B A;  2X71 A;  5FAQ A;  3PTE A;  2X01 A;  2H0Y A;  4OOL A;  1RGY A;  3Q1F A;  5A92 A;  1XGI A;  3ZG9 B;  4DE0 A;  5FDH A;  4RYE A;  3SS4 A;  5HAI A;  4NET A;  4BEN A;  2Y55 A;  4WMC D;  4E3J A;  3W4P A;  5TFQ A;  1AXB A;  2OLU A;  1LL5 A;  1KGF A;  2ZC5 B;  3A3E A;  4OVD A;  5EVL A;  3VP4 A;  4R1G A;  5M18 A;  5FQQ A;  3VP2 A;  5FQK A;  3MKF A;  1DJA A;  3O3V A;  2OSU A;  4DKI A;  1K4E A;  1L2S A;  4WEK A;  3HLB A;  3C4P A;  1JVJ A;  2QMI A;  2ZMA A;  2PBY A;  1CEF A;  1MBL A;  3ZNT A;  4IED A;  2XF3 A;  5CER A;  1NYM A;  2ZM8 A;  5CGS A;  2PU2 A;  1U60 A;  2P9V A;  1JWP A;  1MWR A;  1NYY A;  1CEG A;  2ZQD A;  2Y59 A;  5HAR A;  3ZHH A;  4PM9 A;  4QY6 A;  5M19 A;  3LY3 A;  1MWU A;  4MLL A;  1MXO A;  3W4Q A;  4MBH A;  5FI7 A;  3RJU A;  1LLB A;  3HLD A;  1E4D A;  4MNR A;  4JXS A;  4EBN A;  5F1F A;  4JKT A;  1XA7 A;  1E3U D;  5HL1 A;  2Y2K A;  3GR2 A;  4BL2 A;  3NIA A;  3UDF A;  1FCM A;  2XD5 A;  4LV3 A;  3IF6 A;  2EX9 A;  1Q2P A;  1Z6F A;  1JWV A;  1IKG A;  2DCF A;  3VFH A;  3W8K A;  1BUL A;  3GTC A;  3MZF A;  3Q7Z A;  3VOZ A;  1K54 C;  3GRJ A;  1GA0 A;  3ZVW A;  2V20 A;  4WMC A;  3AGF A;  4LV1 A;  4JF4 A;  2G2U A;  1W8Q A;  3QNC A;  4X56 A;  4E3O A;  4RX2 A;  1YLW A;  1ONH A;  1L0G A;  4LCL A;  5GHX A;  1ES5 A;  3C7V A;  3GVB A;  4S2L A;  4DF6 A;  5F1G A;  1BT5 A;  3ZVT A;  4H8R A;  4OQ0 A;  4Y0T A;  1BUE A;  5CHJ A;  1VM1 A;  5AQ7 A;  2Y91 A;  1ZG4 A;  2A3U A;  3AGD A;  4B88 A;  5CHU A;  3V39 A;  3AGE A;  1KVM A;  1HVB A;  2HDU A;  4PM7 A;  4DE2 A;  1TVF A;  1Y54 A;  1GHP A;  3C4O A;  4LCM A;  1HZO A;  1KGG A;  4GZB A;  2Y2M A;  3G2Z A;  3UDI A;  1JTG A;  1ZC2 A;  3BEC A;  4Q8I A;  5DTS A;  2HP9 A;  2DNS A;  3WRT A;  3ZCZ A;  1GHM A;  4QY5 A;  1M6K A;  3G32 A;  3A3F A;  1PYY A;  4RX3 A;  2ZD8 A;  4N1X A;  3ZG0 A;  1E3U A;  4K91 A;  1ES3 A;  4S2M A;  2WZX A;  4JPM A;  2V2F F;  2ZM2 A;  4DE3 A;  5DVA A;  4OOY A;  3Q7V A;  3VSK A;  3TG9 A;  1HTZ A;  1YQS A;  3IWQ A;  1IEL A;  3FKV A;  3IF6 C;  4DXB A;  4FD8 A;  3N6I A;  4S2N C;  1RP5 A;  3MFD A;  2H10 A;  1LHY A;  4OPR A;  4KG5 A;  5M1A A;  4E3L A;  2XH9 A;  1N9B A;  1XXM A;  2UWX A;  2WKI A;  1W5D A;  3IH9 A;  5FQM A;  3CJM A;  1ESI A;  4KZB A;  3UY6 A;  3VP3 A;  3BLS A;  3VSL A;  3WWX A;  1PWC A;  3ZNY A;  4DXC A;  3E2K A;  3OC2 A;  3PBN A;  3BFG A;  3NC8 A;  1XA1 A;  3O86 A;  4S2P A;  1BLC A;  3E2L A;  3ZG8 B;  4WEJ A;  2WK0 A;  1ERO A;  4UHU A;  4L0L A;  3B3X A;  2I72 A;  1K25 A;  4FCF A;  4KZ5 A;  1YLY A;  1LI0 A;  4M3K A;  4YFM A;  4R4S A;  3NY4 A;  1VQQ A;  4FSF A;  4OP5 A;  3SS5 A;  1YT4 A;  3Q07 A;  4ZTK A;  4OON A;  1ERQ A;  3ZDJ A;  1XP4 A;  4WZ5 C;  2J7V A;  4KG6 A;  4ZBE A;  3ZG7 B;  3LO7 A;  3OCL A;  2EFX A;  4BQM A;  4WZ4 A;  3BEB A;  5U47 A;  3TOI A;  2ZQA A;  2EXA A;  3IH8 A;  4EUZ A;  3S1Y A;  5HFO A;  4KZ4 A;  4D2O A;  3LCE A;  5GHZ A;  5CEC A;  1XPB A;  3A3D A;  4N92 A;  4X6T A;  5AQA A;  3I7J A;  4DE1 A;  3UNW A;  5E2H A;  3SH9 A;  3BYD A;  4KZ6 A;  2WGI A;  1K38 A;  3LY4 A;  4EQI A;  5E2G A;  2R9X A;  4HBU A;  3C7U A;  1K6S A;  3IXD A;  5FAT A;  1YLJ A;  4WYY A;  4E6W A;  4OH0 A;  3JYI A;  4LEN A;  3UO9 A;  3FV7 A;  4BD0 A;  4BJP A;  4R3B A;  5A93 A;  5E2F A;  1TDL A;  2ZC7 A;  4JLF A;  5GHY A;  1MKI A;  4ZJ3 A;  5KSC A;  1TDG A;  4PM8 A;  4XXR A;  1CK3 A;  4DDS A;  2VGJ A;  3PBT A;  3V3S A;  5KSH A;  2BLS A;  2IWB A;  4CJN A;  2P74 A;  3D4F A;  3IXH A;  3SS3 A;  1PZP A;  1OME A;  4JF6 A;  4PMA A;  3WS1 A;  2Y2H A;  2RL3 A;  1NXY A;  5EVI D;  4KG2 A;  5KZH A;  4B4X A;  1YMX A;  1ZKJ A;  2XGN A;  2JBF A;  3PAE A;  5F82 A;  2IWC A;  1PZO A;  1H8Y A;  5GL9 A;  4E3M A;  1MWS A;  1K6R A;  3EQV A;  2DRW A;  2ZC4 B;  4Y0O A;  3VOY A;  4GDB A;  2ZQ9 A;  3UDX A;  3PBO A;  4JXV A;  4U3T A;  2R9W A;  4GKU A;  2EX2 A;  4UA7 A;  3IXG A;  4YIN A;  1KDW A;  3ISG A;  4QHC A;  3HLG A;  4MBF A;  5GLA A;  4IBR A;  4P85 A;  1NY0 A;  3G30 A;  3ZGA B;  3DWK A; 
#chains in the Genus database with same CATH topology
 4C75 A;  4HI4 A;  2JKF A;  2HV1 A;  4R38 A;  1KE4 A;  4KZ3 A;  2WAE A;  3HRE A;  1FR1 A;  5HW3 A;  1TS7 A;  1XKZ A;  2W3H A;  4H6J B;  4M4X A;  1H0M A;  1JWZ A;  4ESP A;  3FKW A;  1L0E A;  4BBU A;  1QMF A;  2YKF A;  5GLC A;  3HBR A;  3Q81 A;  2XDM A;  3N8R A;  2Y2O A;  1KE0 A;  1K55 A;  2PBD P;  1SCW A;  4GDN A;  2XD1 A;  3VP1 A;  3D3O A;  1N9O A;  1NWZ A;  5IT5 A;  4UAA A;  4GS9 B;  1ZHH B;  3NEC A;  4GNU A;  4PPR A;  3FWL A;  1SKF A;  3CHW P;  5F6A A;  4ZJ1 A;  3P09 A;  2PR5 A;  1KDS A;  1IEM A;  1GHI A;  4P87 A;  3IHA A;  5EOO A;  3KSF A;  4FH2 A;  3ZFZ A;  2GDN A;  5EM1 A;  4CLC A;  4Y7P A;  4X69 A;  1PI5 A;  1K56 D;  3IF5 A;  3V3R A;  1L0D A;  3GQZ A;  4OPQ A;  1S6R A;  3BFF A;  4EUV A;  5TBM A;  3VMA A;  3VOL A;  3UE1 A;  4F94 A;  4RA7 A;  2V9A A;  4GOG A;  3CMZ A;  2HJ9 C;  2QYB A;  5JYP A;  4KQD A;  1K54 A;  1IKI A;  4JF5 A;  2ZQC A;  3NBL A;  5AQB A;  4KZ9 A;  2X02 A;  4R3A A;  2ZL1 A;  1YMS A;  2WAF A;  3HLF A;  2XEP A;  1ZTU A;  4EQ1 A;  4B4Z A;  3FC7 A;  2OAP 1;  4OLG A;  3OZH A;  3SH7 A;  4IVI A;  2Y2L A;  1NRJ A;  4KQO A;  5HD3 A;  1H3Q A;  2Y2P A;  4ME4 A;  4BBT A;  2P9V B;  2NUT C;  1XX2 A;  4I3I A;  2XRN A;  1ES4 A;  2VX8 A;  3OPR A;  3F1P B;  4PM5 A;  1I2S A;  4LV0 A;  1NLY A;  4Q0J A;  3OOV A;  4P6Z M;  3KYQ A;  1RGZ A;  3T12 B;  1SKO B;  1PI4 A;  1YLT A;  1P9W A;  2EX8 A;  3BLM A;  2V1Z A;  4Y0U A;  5DF8 A;  4Z9Q A;  2WAD A;  5JYO A;  2WGW A;  1E25 A;  3OLO A;  1ERM A;  2FFY A;  5DTT A;  3QP1 A;  1MZU A;  4YWZ A;  4OPY A;  2QHK A;  2H5S A;  1Q2Q A;  1BTL A;  3OPP A;  2VGL M;  5DJT A;  2NUP C;  3V5M A;  2XA7 S;  3KYZ A;  1FCO A;  3TRC A;  3IQA A;  3EQU A;  3TE8 A;  4ID4 A;  5DF9 A;  1XJ2 A;  2WKE A;  3C2W A;  4R4R A;  5HAP A;  4MCW A;  4WF0 A;  3G35 A;  2Y2N A;  4OLD A;  3BFE A;  3GMW A;  1X0O A;  4PM6 A;  3UE0 A;  3ICY A;  4Q0H A;  2OV5 A;  1BLH A;  1O07 A;  3H7W A;  4BL3 A;  1HD8 A;  5FSR A;  5CEB A;  4WL9 A;  3N7W A;  4CLC B;  4E3I A;  2V1B A;  5FEF A;  5FAQ A;  4OOL A;  3Q1F A;  5A92 A;  3ZG9 B;  3SS4 A;  1OTB A;  4NET A;  3UME A;  3A3E A;  4KUK A;  3PXP A;  1L2S A;  1CEF A;  2XF3 A;  1NYM A;  5A8B A;  3UB7 A;  1U60 A;  2W27 A;  4QY6 A;  1KOU A;  4MLL A;  1LLB A;  1E4D A;  4EXO A;  5F1F A;  4MDZ A;  4NEE D;  3T4T A;  2PDR A;  3UE6 A;  2Y2K A;  3GR2 A;  4BL2 A;  4O0P A;  2J80 A;  3IF6 A;  3IX8 A;  1Z6F A;  5EM0 A;  2DMW A;  3BY9 A;  2DCF A;  3W8K A;  3Q7Z A;  1JNU A;  4WLA A;  2V20 A;  4HJ6 A;  4YNR A;  4EET B;  4LV1 A;  2QJ5 A;  2Z6C A;  5HD5 A;  3QNC A;  4IUK A;  4X56 A;  1ONH A;  1L0G A;  2XSS A;  5GHX A;  4DF6 A;  5F1G A;  5FDS A;  4H8R A;  1F5M A;  5AQ7 A;  2Y91 A;  2A3U A;  3MSH A;  1KVM A;  2HDU A;  1TVF A;  1GHP A;  4GLQ A;  3BEC A;  5DTS A;  3G32 A;  4RX3 A;  4K91 A;  2VKS A;  4Y2F A;  2JN7 A;  4DE3 A;  3Q7V A;  1HTZ A;  2B95 A;  4DXB A;  4FD8 A;  3N6I A;  1RP5 A;  3MFD A;  2H10 A;  2E8J A;  4OPR A;  5M1A A;  2BTF P;  1N9B A;  5G4Z A;  4LPZ A;  3CJM A;  1ESI A;  1F9I A;  1F2K A;  1HLU P;  4JGO A;  5EFW A;  1Y28 A;  2M7V A;  5HPI A;  1XA1 A;  1BLC A;  4IHQ A;  4WEJ A;  1ERO A;  4UHU A;  2O9A A;  4FCF A;  4KZ5 A;  4M3K A;  4R4S A;  4OP5 A;  1TF1 A;  3E4P A;  4OON A;  1XP4 A;  4WZ5 C;  3ZG7 B;  3LO7 A;  3OCL A;  3R4K A;  1G5U A;  4WZ4 A;  3BEB A;  3TOI A;  1S67 L;  3IH8 A;  4MMN A;  2W1T B;  3T4O A;  2V0W A;  1YSQ A;  3EOI A;  4DE1 A;  3SH9 A;  3BYD A;  3LY4 A;  2R9X A;  3HCY A;  3JYI A;  3FV7 A;  5F68 A;  1TDL A;  4JLF A;  2PT7 A;  1CK3 A;  5KSH A;  2VGJ A;  3PBT A;  2BLS A;  3UMD A;  5HWT A;  3SS3 A;  2V0U A;  3FG8 A;  4KG2 A;  3NHQ A;  1YMX A;  2XGN A;  3HJI A;  5F82 A;  5GL9 A;  1K6R A;  3EQV A;  2ZC4 B;  4ARZ B;  4JXV A;  4U3T A;  3LIF A;  1XJ6 A;  4XT2 A;  5GLA A;  3G30 A;  4BBV A;  3PYP A;  2M1C A;  1IYP A;  3T4L A;  2VV8 A;  4QD4 A;  1NJ4 A;  1H8Z A;  1FQG A;  2PAV P;  2HDQ A;  3DW0 A;  1W63 M;  3IF6 B;  5I94 A;  3N8L A;  4PHT A;  1WA9 A;  4N9K A;  5A90 A;  3SH8 A;  2V8F A;  4A5R A;  3MQ0 A;  3K2N A;  5HPF A;  3C38 A;  1GSW A;  2WKH A;  2EX6 A;  2KX6 A;  5J4E A;  2PRF A;  3A3J A;  1I5Q A;  1K57 A;  2PHY A;  5DJU A;  4GW9 A;  3W2Z A;  3H82 B;  5EE8 A;  5HL6 A;  3RFB A;  3RXX A;  5J8X A;  3BM6 A;  4X68 A;  1KVL A;  5A91 A;  2CC1 A;  3PBS A;  4EV4 A;  4Y17 A;  4WBG A;  1LSW A;  2ACG A;  1BLS A;  3UN7 A;  2UV0 E;  3ITB A;  1H5X A;  4Y5F A;  3Q7V B;  4NXF A;  1ACF A;  3PR6 A;  2ZQ8 A;  2Y2Q A;  4G3W A;  3QNB A;  1XGJ A;  2Q9M A;  3FYZ A;  2PD7 A;  1S4R A;  3L7H A;  4Q0I A;  3BW6 A;  5IS1 A;  4KQR A;  1V9Z A;  4DE2 A;  3NCK A;  4K0X A;  5IU1 A;  3NDG A;  4GD8 A;  5IHV A;  3JVV A;  2Y2J A;  3W4O A;  3N8S A;  4R23 A;  1CI8 A;  4I3A A;  2J9P A;  2WZZ A;  4KZA A;  5CX7 A;  2EXB A;  4QPR A;  3CG5 A;  1SDE A;  3FPV A;  4AFI A;  4UA9 A;  3T1R A;  1OT9 A;  1LT0 A;  3G34 A;  3NUL A;  4HOI A;  3M6H A;  5CGW A;  1FSW A;  3DTK A;  1O7E A;  1NZO A;  2JC7 A;  3NDE A;  4R0Q A;  2VGK A;  2O9C A;  2J3T C;  1S0W A;  3E0Y A;  4BWI A;  5EV0 A;  4LLO B;  3VP0 A;  2QPN A;  1LL9 A;  3KYE A;  5FQ9 A;  1K4F A;  1ESU A;  1WE4 A;  5CGX A;  2E8I A;  4S2N A;  5G4Y A;  3CZD A;  4XUX A;  1XJ4 A;  2HDS A;  5HX9 A;  4NXE A;  2B18 A;  4S2J A;  2GZA A;  4HJ4 A;  3UPP A;  3T1X A;  2W3D A;  3WS4 A;  4N1H A;  4XUZ A;  1LI9 A;  1KGE A;  1V9Y A;  1MY8 A;  1PW1 A;  1SZV A;  1ZG6 A;  2JCH A;  1FSY A;  2Y8H A;  2HGV A;  3QP8 A;  1IYS A;  3IBR A;  4E6X A;  1L3L A;  3MFX A;  5AJG A;  3H9W A;  2P04 A;  5CED A;  1YM1 A;  4QJG A;  3PAG A;  2J9O A;  3WS2 A;  3S22 A;  1N4O A;  3LI8 A;  2R78 A;  3IHB A;  4N9L A;  1SDN A;  4O01 A;  3MKE A;  1KE3 A;  3IWO A;  3WS5 A;  5CTM A;  1BLP A;  4L9F A;  1W7F A;  1Z09 A;  5FQJ A;  1WYC A;  5HWW A;  5FI6 A;  1I2W A;  1J9M A;  5LBR A;  3V50 A;  3CAX A;  1ONG A;  5EUA A;  4CPK A;  4JGQ A;  2L1M A;  1XGI A;  5FDH A;  4RYE A;  4BEN A;  4WMC D;  4E3J A;  5TFQ A;  1LL5 A;  1S4S A;  3VP4 A;  4R1G A;  1VEU A;  3MKF A;  3O3V A;  2OSU A;  1K4E A;  5DKK A;  3TJZ C;  2QMI A;  2ZMA A;  1BYW A;  4ETX A;  4IED A;  5CER A;  5CGS A;  3MQQ A;  1MWR A;  1NLZ A;  1MWU A;  3W4Q A;  1IOU A;  4PKY G;  1VHM A;  3RJU A;  4EBN A;  2PD8 A;  3R7W B;  1XA7 A;  4I38 A;  1E3U D;  1YPR A;  2XD5 A;  4LV3 A;  1Q2P A;  1TD5 A;  5J3W A;  3VFH A;  3EEH A;  3MZF A;  3VOZ A;  4HNB A;  3ZVW A;  1GA0 A;  3BWL A;  3CUE C;  2J3W A;  4RX2 A;  2VZW A;  4LCL A;  2B02 A;  1ES5 A;  1BT5 A;  2H28 A;  3ZVT A;  1OJ5 A;  5CHJ A;  1ZG4 A;  1FIK A;  3AGD A;  4B88 A;  5CHU A;  5AVF A;  2JHE A;  3C4O A;  2K2N A;  4LCM A;  4GZB A;  2Y2M A;  3G2Z A;  1ZC2 A;  1T19 A;  3WRT A;  4QY5 A;  1CF0 A;  3A3F A;  5HZH A;  1PYY A;  2L4R A;  2QWS A;  4RQ9 A;  3QP2 A;  1ES3 A;  4HP9 A;  2XA7 M;  3A0S A;  5DVA A;  3CIT A;  3TG9 A;  2VV7 A;  3IWQ A;  3FKV A;  3IF6 C;  3K3C A;  2OAQ 1;  5FL3 A;  1XXM A;  1W5D A;  4IUH A;  4DXC A;  3PBN A;  3O86 A;  3E2L A;  1OTD A;  4L0L A;  3B3X A;  4GHI A;  4YFM A;  3S7N A;  3NY4 A;  3MS6 A;  3Q07 A;  2ZOI A;  3B33 A;  5FEG A;  3ZDJ A;  4BQM A;  5L10 A;  2EXA A;  4X1L A;  5TBM B;  5GHZ A;  4X6T A;  5AQA A;  5E2G A;  3QP4 A;  1YLJ A;  4OH0 A;  4UQI S;  5DFX A;  3UO9 A;  4BD0 A;  4ZJ3 A;  2ZL1 B;  2MJ6 A;  3UB8 A;  5HDD A;  2IWB A;  2P74 A;  3D4F A;  1PZP A;  3MJQ A;  3WS1 A;  2D01 A;  3EEA A;  3DAV A;  3PAE A;  4HJ3 A;  2WKP A;  1G6O A;  1MWS A;  5HDS A;  4FOF A;  4Y0O A;  2Q0O A;  4GDB A;  4NXG A;  5KIZ A;  4GKU A;  2EX2 A;  3IXG A;  3ISG A;  4QHC A;  4JGR A;  4EER A;  3F1O A;  1NY0 A;  4CLC E;  5KSC A;  1T18 A;  5CXW A;  5FI2 A;  3PBQ A;  1ALQ A;  3P98 A;  2HZ5 A;  3HUM A;  4GB7 A;  4JXG A;  2ZJ9 A;  5L07 A;  4CQH A;  3EGD C;  3EWK A;  3LID A;  4P6B A;  1FCN A;  4LRX C;  4CLC D;  3M6B A;  1XFN A;  3S7Q A;  1ES2 A;  2INW A;  2J3T D;  4ZRR A;  5L09 A;  5EVI A;  2HPB A;  1PNE A;  1W63 Q;  4PAU A;  2WGW B;  1NRF A;  4EEP A;  3N4I A;  2B5R A;  4FH4 A;  4BLM A;  4NXB A;  2A2L A;  3OCN A;  1EI5 A;  1LSV A;  2W1R A;  4F3L A;  3LYX A;  1LL8 A;  4OPZ A;  4S2K A;  2Y4A A;  3GV9 A;  5F5Y A;  3ZYT A;  1VET A;  5DFY A;  4JBF A;  4DMZ A;  4P0M A;  2C5W B;  4L9G A;  1YLP A;  4O7D A;  4EBP A;  4MBK A;  4U0T A;  3M2J A;  1CQA A;  3NOP C;  4Z1W A;  1STZ A;  3S4X A;  3UPO A;  3LIA A;  1UGU A;  1M40 A;  3MZD A;  3HLW A;  2OLV A;  5CRF A;  1MPL A;  2O9B A;  3M2K A;  4X55 A;  5KMW A;  5G18 A;  3G2Y A;  2XFS A;  2XFT A;  1S1Z A;  3O88 A;  5HAQ A;  5FA7 A;  3Q82 A;  3ZG5 A;  2CMN A;  3QHY A;  4EW7 A;  5HSQ A;  1IYO A;  4KZ7 A;  2VK3 A;  2ZLY A;  3HL9 A;  1TEM A;  3HUO A;  5L2F A;  1OTI A;  3H7W B;  4BD1 A;  3T4J A;  2PU4 A;  3BQ8 A;  2BG1 A;  3QP5 A;  3E98 A;  3IX4 A;  1W8Y A;  4C6Y A;  1BZA A;  4R6L A;  1IYQ A;  5DF7 A;  1L0F A;  3UB5 P;  3IT9 A;  3TSG A;  5CTN A;  3LIB A;  5HWV A;  1TS0 A;  4GD6 A;  2ZM0 A;  3MBZ A;  1K56 A;  2XRO A;  1W79 A;  3LUQ A;  4OQH A;  4ZAM A;  4FUW A;  2PR6 A;  4DRT A;  4OQG A;  4GN2 A;  4K08 A;  2KDK A;  3WS0 A;  1OJG A;  2ZQ7 A;  4UA6 A;  4S2O A;  4EWF A;  3SOI A;  4IVK A;  4H6J A;  3SZT A;  4EBL A;  3T1Q B;  4S2I A;  3LR5 A;  1YLZ A;  1J3W A;  2ZC6 B;  3RXW A;  3B47 A;  4BMW A;  4HES A;  5EPH A;  2K7S A;  2Y2G A;  4WEL A;  5DKL A;  3ULF A;  3PBR A;  1NZU A;  4HQA A;  3C5A A;  1MKM A;  1DJC A;  4DJ2 A;  3UPN A;  1WYB A;  3IXB A;  3BFD A;  4WZ5 A;  2G2W A;  1GCE A;  5EVI B;  4HEF A;  5K5B A;  2G7U A;  4LFU A;  4UEY A;  4FTX A;  2V1A A;  1OPX A;  3MZE A;  2M7U A;  2IWD A;  3G4P A;  5MC7 A;  1DJB A;  4F3L B;  4GCZ A;  3OPL A;  1XJ3 A;  4DJ3 A;  4OQI A;  4HP4 A;  2ZOH A;  2O99 A;  3QP6 A;  1PFL A;  2PYR A;  4C3Q A;  1VET B;  1MWT A;  4NG2 A;  3UB9 A;  2XK1 A;  1UWP X;  1PWG A;  4EES A;  4QU3 A;  1K55 C;  1S1Y A;  2HP5 A;  4OP8 A;  3KSH A;  1C3B A;  2GX5 A;  2X71 A;  4B9O A;  1D7E A;  3PTE A;  5HAI A;  2Y55 A;  2ZC5 B;  1KGF A;  3F1N A;  3NJA A;  5M18 A;  5FQQ A;  2FZ0 A;  4DKI A;  3NOT C;  3PHY A;  3HLB A;  3C4P A;  1JVJ A;  4CLC C;  4PKY A;  1H8M A;  2PBY A;  1MBL A;  3BQA A;  2ZM8 A;  2P9V A;  5HAR A;  1NYY A;  1CEG A;  1D06 A;  3G6O A;  4PM9 A;  4WN5 A;  3LY3 A;  4MBH A;  2A24 A;  3HLD A;  4MNR A;  4JKT A;  4I3J A;  3DTE A;  1FCM A;  1JWV A;  2OWJ A;  1BUL A;  3GTC A;  1K54 C;  4HHD A;  2ZBB A;  3AGF A;  4JF4 A;  4XT2 B;  1W8Q A;  3T4S A;  4S2L A;  4OQ0 A;  3CLO A;  1BUE A;  4X1M A;  3AGE A;  2EA9 A;  2VV6 A;  1Y54 A;  1HZO A;  1JTG A;  3S7P A;  3T1S A;  2DNS A;  3ZCZ A;  4MN5 A;  2ZD8 A;  3A0R A;  4N1X A;  5EVE A;  3ZG0 A;  3LI9 A;  2WZX A;  3OBF A;  4OOY A;  3VSK A;  1YQS A;  1GSV A;  1UWN X;  2LB9 A;  3SW1 A;  3LR0 A;  1F98 A;  2UWX A;  1T1A A;  3IX3 A;  4O8G A;  4KZB A;  3UY6 A;  3VP3 A;  5AVE A;  3VSL A;  3WWX A;  1PWC A;  3E2K A;  3OC2 A;  3BFG A;  4Y3I A;  1YLY A;  2BAS A;  3MF0 A;  1VQQ A;  4FSF A;  4ZTK A;  4ETZ A;  4D60 A;  2J7V A;  2GJ3 A;  4KG6 A;  2O0Y A;  2EFX A;  2ZQA A;  3S1Y A;  3KX0 X;  4D2O A;  1EW0 A;  5CEC A;  3A3D A;  3P01 A;  3UNW A;  3JPU A;  4KZ6 A;  2OOL A;  3MXQ A;  2WGI A;  4E6W A;  1K6S A;  4R70 A;  4LEN A;  5A93 A;  4BJP A;  5E2F A;  1TDG A;  3B42 A;  4MN6 A;  1TS8 A;  4PM8 A;  4XXR A;  3V3S A;  2V8C A;  3F1N B;  4CJN A;  3IXH A;  1OME A;  4PMA A;  2EWV A;  2Y2H A;  4B4X A;  1ZKJ A;  2IWC A;  1PZO A;  4E3M A;  1S66 L;  3VOY A;  3K3D A;  3FPW A;  2ZQ9 A;  3UDX A;  2WKR A;  2VJW A;  3HLG A;  4MBF A;  2W3E A;  4IBR A;  2JKR M;  4P85 A;  2A24 B;  5F69 A;  3HJK A;  5E2E A;  2FFF B;  1YKD A;  2D02 A;  3LGO A;  4G3K A;  2XQZ A;  3VE4 A;  2GNX A;  4DDY A;  4LV2 A;  5EOE A;  4P6Z S;  2A49 A;  3CPT A;  5E43 A;  2Z2L B;  4MEZ A;  3RTY A;  3IS2 A;  3LEQ A;  1MC0 A;  1FR6 A;  2ZMV A;  1Y4O A;  3KO6 A;  3ZQ5 A;  3T4Q A;  3OPH A;  3KSG A;  3HVF A;  4EU0 A;  1DY6 A;  1IFQ A;  3DWZ A;  4OKP A;  4E3N A;  5TR7 A;  3GEC A;  5GLB A;  1QME A;  3E4Q A;  2KOI A;  2HDR A;  4KUO A;  4HBT A;  1PWD A;  3O87 A;  5GLD A;  3D9Y A;  2XR0 A;  4KQQ A;  2VGL S;  4K0W A;  4WUJ A;  2C6W B;  2JE5 A;  2JKT M;  2Z6D A;  4ZDX A;  4IBX A;  3BRM A;  3UB6 A;  1FOF A;  5FQI A;  1RCJ A;  2HF6 A;  3MXR A;  3S7O A;  4NKP A;  5FAS A;  5FAP A;  2AVX A;  2WGV A;  5I5L A;  3UE3 A;  3V67 A;  5AQ9 A;  2Y79 A;  2L0W A;  4E3K A;  4OOM A;  5J7E A;  2W1T A;  3HLE A;  5EVI C;  4JXW A;  4U0X A;  3C8C A;  4B93 A;  3A3I A;  3LIC A;  2I9V A;  1GA9 A;  1OTE A;  2KLI A;  2Z2M B;  5CHM A;  1JTD A;  3CUE A;  2FH5 A;  4UQI M;  2VEA A;  3C30 A;  5HDC A;  1SHV A;  3LR4 A;  2Q9N A;  2JKR I;  1VEU B;  3ITA A;  1D1J A;  4EEU A;  2WYX A;  1XFQ A;  2K31 A;  1P9R A;  3G31 A;  4ARZ A;  4R3J A;  1N9N A;  3GSG A;  3KSI A;  4DN0 A;  3EGX C;  1G68 A;  5BOH A;  3VE3 A;  2QZ6 A;  3BJN A;  3DTM A;  2RCX A;  4RVA A;  2H0T A;  4X53 A;  5DTK A;  3MXS A;  3LEZ A;  3HLC A;  3IWI A;  3O5Y A;  2JKT I;  2VLG A;  3A0V A;  1TS6 A;  1OT6 A;  5F83 A;  3FZC A;  1YAX A;  4KEN B;  3LFV A;  3D72 A;  4HH3 A;  5EEC A;  4MN7 A;  1EWZ A;  3H82 A;  2J8Y A;  3CPT B;  5TJJ A;  2Y2I A;  3HUN A;  3IS2 B;  2W0N A;  2P7J A;  3WRZ A;  3NI9 A;  3BFC A;  5TGF A;  2W3F A;  3NOU C;  4NK3 A;  1T1B A;  3MR0 A;  2XLN A;  4WM9 A;  4HY8 A;  2EWW A;  2QKP A;  3LIE A;  1BSG A;  3U2A A;  3LR3 A;  1N9L A;  1PIO A;  3VFF A;  2LB5 A;  5D3O A;  4ZJ2 A;  1DP9 A;  2HP6 A;  3DBA A;  4GJ4 A;  3GDI A;  4G3V A;  2ZC3 B;  1A0K A;  1K57 C;  5FAO A;  2EFU A;  1G6A A;  1CI9 A;  3U4L P;  1PW8 A;  3MMH A;  1CJF A;  2WUQ A;  4KZ8 A;  4QB8 A;  5L8M A;  4GHI B;  2X01 A;  2H0Y A;  1LSX A;  1RGY A;  2JKG A;  4DE0 A;  3W4P A;  1AXB A;  2OLU A;  4OVD A;  5EVL A;  1K0K A;  3RH8 B;  1GSX A;  1OTA A;  3VP2 A;  5FQK A;  1DJA A;  1ODV A;  2W3G A;  4L9E A;  4HH2 A;  4WEK A;  3ZNT A;  2PU2 A;  4LGW A;  1JWP A;  2ZQD A;  2Y59 A;  3ZHH A;  5M19 A;  1MXO A;  3BY8 A;  5FI7 A;  1G28 A;  4JXS A;  4QWO A;  5HL1 A;  4IJG A;  3NIA A;  3UDF A;  2EX9 A;  2IA2 A;  1IKG A;  4YOF A;  1VB6 A;  3GRJ A;  3JVU A;  3L9K A;  4WMC A;  2G2U A;  4E3O A;  1YLW A;  3F1O B;  3C7V A;  3GVB A;  4I39 A;  1YSP A;  4Y0T A;  1VM1 A;  3T50 A;  4LRY C;  4Y15 A;  2P08 A;  3V39 A;  1HVB A;  4PM7 A;  1KGG A;  3UDI A;  4Q8I A;  2HP9 A;  1DP6 A;  4GS9 A;  1GHM A;  4E04 A;  1M6K A;  3IBJ A;  3T4K A;  1E3U A;  4S2M A;  4JPM A;  2V2F F;  2ZM2 A;  1PRQ A;  1IEL A;  4S2N C;  1LHY A;  4KG5 A;  2ZMF A;  3VV4 A;  4E3L A;  2XH9 A;  5FQM A;  2WKI A;  3IH9 A;  3BLS A;  3ZNY A;  4II7 A;  3NC8 A;  4LRZ E;  4S2P A;  4I5S A;  3ZG8 B;  2WK0 A;  1DRM A;  4Y13 A;  1AWI A;  2I72 A;  1K25 A;  1LI0 A;  3SS5 A;  1YT4 A;  1P97 A;  5C5K A;  1ERQ A;  3MQO A;  2PYP A;  3CWF A;  4ZBE A;  3E4O A;  5U47 A;  1FIL A;  4EUZ A;  2WKQ A;  5HFO A;  4KZ4 A;  3LCE A;  1XPB A;  4N92 A;  4HIA A;  3I7J A;  2VA0 A;  3P7N A;  5E2H A;  1K38 A;  4EQI A;  4HBU A;  3C7U A;  3IXD A;  5FAT A;  3TW8 A;  4WYY A;  4R3B A;  1P0Z A;  2OWH A;  2ZC7 A;  5GHY A;  4X25 A;  1MKI A;  2HJE A;  4DDS A;  3R7W A;  1DP8 A;  1T1C A;  4JF6 A;  2YKH A;  2RL3 A;  1NXY A;  5EVI D;  3DTI A;  5KZH A;  2JBF A;  3F1P A;  2QJ7 A;  1H8Y A;  4JGP A;  2DRW A;  3PBO A;  4YIN A;  2R9W A;  4UA7 A;  1SKO A;  1KDW A;  3CI6 A;  3ZGA B;  3DWK A; 
#chains in the Genus database with same CATH homology
 4C75 A;  5CXW A;  5FI2 A;  3PBQ A;  5E2E A;  1ALQ A;  2FFF B;  3P98 A;  1KE4 A;  3HUM A;  4KZ3 A;  1IYP A;  2WAE A;  3HRE A;  4GB7 A;  4JXG A;  4QD4 A;  1NJ4 A;  1H8Z A;  1FQG A;  2XQZ A;  1FR1 A;  2HDQ A;  2ZJ9 A;  3DW0 A;  4DDY A;  4LV2 A;  3IF6 B;  5EOE A;  5HW3 A;  2A49 A;  5E43 A;  1XKZ A;  2Z2L B;  4MEZ A;  5I94 A;  3N8L A;  1FR6 A;  4P6B A;  1FCN A;  1JWZ A;  4N9K A;  3FKW A;  1L0E A;  3M6B A;  3OPH A;  5A90 A;  1QMF A;  3HVF A;  5GLC A;  3SH8 A;  1DY6 A;  4A5R A;  1ES2 A;  3HBR A;  3Q81 A;  2XDM A;  3DWZ A;  2WKH A;  2EX6 A;  3N8R A;  4OKP A;  4E3N A;  5EVI A;  2HPB A;  5TR7 A;  5GLB A;  1QME A;  2Y2O A;  2HDR A;  2WGW B;  3A3J A;  4HBT A;  1KE0 A;  1I5Q A;  1NRF A;  1PWD A;  1K57 A;  2B5R A;  3N4I A;  3O87 A;  4FH4 A;  1K55 A;  5GLD A;  4BLM A;  1SCW A;  4GDN A;  2XR0 A;  2XD1 A;  3OCN A;  1EI5 A;  5EE8 A;  3VP1 A;  4KQQ A;  3RXX A;  4K0W A;  3BM6 A;  5J8X A;  2C6W B;  4X68 A;  2JE5 A;  1KVL A;  5A91 A;  2CC1 A;  4ZDX A;  3PBS A;  4IBX A;  3BRM A;  4OPZ A;  4EV4 A;  4UAA A;  1FOF A;  4S2K A;  5FQI A;  2Y4A A;  1RCJ A;  4GNU A;  3GV9 A;  4PPR A;  3FWL A;  1SKF A;  4WBG A;  4JBF A;  4P0M A;  3MXR A;  4ZJ1 A;  1BLS A;  2C5W B;  3UN7 A;  3P09 A;  1KDS A;  1IEM A;  1YLP A;  4O7D A;  1GHI A;  3ITB A;  4EBP A;  5FAS A;  1H5X A;  5FAP A;  4MBK A;  4U0T A;  3M2J A;  3Q7V B;  3UPO A;  3S4X A;  4P87 A;  2WGV A;  3IHA A;  5EOO A;  4FH2 A;  3ZFZ A;  1M40 A;  3MZD A;  2GDN A;  2OLV A;  3HLW A;  5CRF A;  2ZQ8 A;  1MPL A;  2Y2Q A;  4Y7P A;  4X69 A;  3M2K A;  1PI5 A;  4X55 A;  5KMW A;  1K56 D;  3IF5 A;  3QNB A;  1XGJ A;  3UE3 A;  5G18 A;  3G2Y A;  2XFS A;  2XFT A;  3V3R A;  2Q9M A;  3O88 A;  5HAQ A;  5AQ9 A;  5FA7 A;  3FYZ A;  3Q82 A;  1L0D A;  4E3K A;  3GQZ A;  3ZG5 A;  4OOM A;  3QHY A;  4OPQ A;  1IYO A;  4KZ7 A;  4KQR A;  2ZLY A;  1S6R A;  3HL9 A;  3BFF A;  1TEM A;  3HLE A;  3NCK A;  3NDG A;  4K0X A;  4JXW A;  5EVI C;  4U0X A;  3HUO A;  3VMA A;  4F94 A;  3UE1 A;  4GD8 A;  5IHV A;  4RA7 A;  5L2F A;  3A3I A;  4BD1 A;  4GOG A;  2Y2J A;  3CMZ A;  3W4O A;  2PU4 A;  3N8S A;  4R23 A;  1CI8 A;  2J9P A;  2BG1 A;  2WZZ A;  4KZA A;  1GA9 A;  5JYP A;  2EXB A;  1K54 A;  1IKI A;  4JF5 A;  3CG5 A;  1SDE A;  2Z2M B;  1W8Y A;  2ZQC A;  3NBL A;  5CHM A;  5AQB A;  4C6Y A;  1BZA A;  1JTD A;  4KZ9 A;  2X02 A;  1IYQ A;  1YMS A;  4UA9 A;  5DF7 A;  2WAF A;  3HLF A;  1L0F A;  2XEP A;  3IT9 A;  4B4Z A;  3TSG A;  1SHV A;  3G34 A;  2Q9N A;  3M6H A;  5CGW A;  1FSW A;  5CTN A;  3ITA A;  1O7E A;  4OLG A;  3OZH A;  2WYX A;  1NZO A;  2JC7 A;  4GD6 A;  4IVI A;  3SH7 A;  2ZM0 A;  2Y2L A;  3MBZ A;  1K56 A;  3NDE A;  1W79 A;  3G31 A;  4KQO A;  4OQH A;  4R0Q A;  2VGK A;  4R3J A;  4ZAM A;  2Y2P A;  3GSG A;  2P9V B;  1S0W A;  4DRT A;  4OQG A;  3VP0 A;  4GN2 A;  2QPN A;  1XX2 A;  1LL9 A;  1G68 A;  3WS0 A;  5BOH A;  5FQ9 A;  2ZQ7 A;  4UA6 A;  1ES4 A;  4S2O A;  3OPR A;  4EWF A;  1K4F A;  1ESU A;  2QZ6 A;  1WE4 A;  3SOI A;  3DTM A;  2RCX A;  4RVA A;  4PM5 A;  5CGX A;  2H0T A;  1I2S A;  2E8I A;  4IVK A;  4LV0 A;  4S2N A;  4X53 A;  5DTK A;  4EBL A;  3MXS A;  3LEZ A;  3HLC A;  3IWI A;  3CZD A;  1RGZ A;  4S2I A;  4XUX A;  1PI4 A;  1YLT A;  2HDS A;  2EX8 A;  5HX9 A;  4S2J A;  5F83 A;  1YLZ A;  3BLM A;  3FZC A;  2V1Z A;  4KEN B;  2ZC6 B;  4Y0U A;  5DF8 A;  4Z9Q A;  3RXW A;  3UPP A;  4HES A;  2WAD A;  5EPH A;  5EEC A;  5JYO A;  2WGW A;  1E25 A;  3WS4 A;  2Y2G A;  4N1H A;  4WEL A;  4XUZ A;  1ERM A;  3PBR A;  1EWZ A;  2FFY A;  5DTT A;  2J8Y A;  1LI9 A;  1NZU A;  1KGE A;  2Y2I A;  3C5A A;  3HUN A;  1DJC A;  4OPY A;  1MY8 A;  3UPN A;  3WRZ A;  2H5S A;  1PW1 A;  1Q2Q A;  1BTL A;  1WYB A;  1ZG6 A;  3IXB A;  3OPP A;  2JCH A;  3BFD A;  3NI9 A;  1FSY A;  4WZ5 A;  2G2W A;  3V5M A;  3BFC A;  5TGF A;  1IYS A;  1GCE A;  4E6X A;  5EVI B;  4HEF A;  1FCO A;  4NK3 A;  3IQA A;  3EQU A;  3MZE A;  2XLN A;  4WM9 A;  5CED A;  2IWD A;  3G4P A;  4ID4 A;  1DJB A;  5DF9 A;  1YM1 A;  4QJG A;  2WKE A;  4R4R A;  5HAP A;  3PAG A;  1BSG A;  2J9O A;  3OPL A;  3WS2 A;  3S22 A;  1N4O A;  4OQI A;  3IHB A;  1PIO A;  1SDN A;  4N9L A;  3G35 A;  2Y2N A;  4OLD A;  3BFE A;  3VFF A;  4C3Q A;  3GMW A;  3MKE A;  1MWT A;  1KE3 A;  3IWO A;  5D3O A;  4ZJ2 A;  3WS5 A;  5CTM A;  2HP6 A;  4PM6 A;  1BLP A;  3UE0 A;  2XK1 A;  1W7F A;  2OV5 A;  1BLH A;  1PWG A;  1O07 A;  5FQJ A;  2ZC3 B;  1WYC A;  5FI6 A;  1K57 C;  4QU3 A;  4BL3 A;  1HD8 A;  1I2W A;  1K55 C;  1J9M A;  2EFU A;  5FAO A;  5FSR A;  3V50 A;  5CEB A;  1G6A A;  2HP5 A;  1CI9 A;  4OP8 A;  1PW8 A;  3N7W A;  1ONG A;  2WUQ A;  4KZ8 A;  4QB8 A;  5EUA A;  4E3I A;  4CPK A;  1C3B A;  2X71 A;  5FAQ A;  3PTE A;  2X01 A;  2H0Y A;  4OOL A;  1RGY A;  3Q1F A;  5A92 A;  1XGI A;  3ZG9 B;  4DE0 A;  5FDH A;  4RYE A;  3SS4 A;  5HAI A;  4NET A;  4BEN A;  2Y55 A;  4WMC D;  4E3J A;  3W4P A;  5TFQ A;  1AXB A;  2OLU A;  1LL5 A;  1KGF A;  2ZC5 B;  3A3E A;  4OVD A;  5EVL A;  3VP4 A;  4R1G A;  5M18 A;  5FQQ A;  3VP2 A;  5FQK A;  3MKF A;  1DJA A;  3O3V A;  2OSU A;  4DKI A;  1K4E A;  1L2S A;  4WEK A;  3HLB A;  3C4P A;  1JVJ A;  2QMI A;  2ZMA A;  2PBY A;  1CEF A;  1MBL A;  3ZNT A;  4IED A;  2XF3 A;  5CER A;  1NYM A;  2ZM8 A;  5CGS A;  2PU2 A;  1U60 A;  2P9V A;  1JWP A;  1MWR A;  1NYY A;  1CEG A;  2ZQD A;  2Y59 A;  5HAR A;  3ZHH A;  4PM9 A;  4QY6 A;  5M19 A;  3LY3 A;  1MWU A;  4MLL A;  1MXO A;  3W4Q A;  4MBH A;  5FI7 A;  3RJU A;  1LLB A;  3HLD A;  1E4D A;  4MNR A;  4JXS A;  4EBN A;  5F1F A;  4JKT A;  1XA7 A;  1E3U D;  5HL1 A;  2Y2K A;  3GR2 A;  4BL2 A;  3NIA A;  3UDF A;  1FCM A;  2XD5 A;  4LV3 A;  3IF6 A;  2EX9 A;  1Q2P A;  1Z6F A;  1JWV A;  1IKG A;  2DCF A;  3VFH A;  3W8K A;  1BUL A;  3GTC A;  3MZF A;  3Q7Z A;  3VOZ A;  1K54 C;  3GRJ A;  1GA0 A;  3ZVW A;  2V20 A;  4WMC A;  3AGF A;  4LV1 A;  4JF4 A;  2G2U A;  1W8Q A;  3QNC A;  4X56 A;  4E3O A;  4RX2 A;  1YLW A;  1ONH A;  1L0G A;  4LCL A;  5GHX A;  1ES5 A;  3C7V A;  3GVB A;  4S2L A;  4DF6 A;  5F1G A;  1BT5 A;  3ZVT A;  4H8R A;  4OQ0 A;  4Y0T A;  1BUE A;  5CHJ A;  1VM1 A;  5AQ7 A;  2Y91 A;  1ZG4 A;  2A3U A;  3AGD A;  4B88 A;  5CHU A;  3V39 A;  3AGE A;  1KVM A;  1HVB A;  2HDU A;  4PM7 A;  4DE2 A;  1TVF A;  1Y54 A;  1GHP A;  3C4O A;  4LCM A;  1HZO A;  1KGG A;  4GZB A;  2Y2M A;  3G2Z A;  3UDI A;  1JTG A;  1ZC2 A;  3BEC A;  4Q8I A;  5DTS A;  2HP9 A;  2DNS A;  3WRT A;  3ZCZ A;  1GHM A;  4QY5 A;  1M6K A;  3G32 A;  3A3F A;  1PYY A;  4RX3 A;  2ZD8 A;  4N1X A;  3ZG0 A;  1E3U A;  4K91 A;  1ES3 A;  4S2M A;  2WZX A;  4JPM A;  2V2F F;  2ZM2 A;  4DE3 A;  5DVA A;  4OOY A;  3Q7V A;  3VSK A;  3TG9 A;  1HTZ A;  1YQS A;  3IWQ A;  1IEL A;  3FKV A;  3IF6 C;  4DXB A;  4FD8 A;  3N6I A;  4S2N C;  1RP5 A;  3MFD A;  2H10 A;  1LHY A;  4OPR A;  4KG5 A;  5M1A A;  4E3L A;  2XH9 A;  1N9B A;  1XXM A;  2UWX A;  2WKI A;  1W5D A;  3IH9 A;  5FQM A;  3CJM A;  1ESI A;  4KZB A;  3UY6 A;  3VP3 A;  3BLS A;  3VSL A;  3WWX A;  1PWC A;  3ZNY A;  4DXC A;  3E2K A;  3OC2 A;  3PBN A;  3BFG A;  3NC8 A;  1XA1 A;  3O86 A;  4S2P A;  1BLC A;  3E2L A;  3ZG8 B;  4WEJ A;  2WK0 A;  1ERO A;  4UHU A;  4L0L A;  3B3X A;  2I72 A;  1K25 A;  4FCF A;  4KZ5 A;  1YLY A;  1LI0 A;  4M3K A;  4YFM A;  4R4S A;  3NY4 A;  1VQQ A;  4FSF A;  4OP5 A;  3SS5 A;  1YT4 A;  3Q07 A;  4ZTK A;  4OON A;  1ERQ A;  3ZDJ A;  1XP4 A;  4WZ5 C;  2J7V A;  4KG6 A;  4ZBE A;  3ZG7 B;  3LO7 A;  3OCL A;  2EFX A;  4BQM A;  4WZ4 A;  3BEB A;  5U47 A;  3TOI A;  2ZQA A;  2EXA A;  3IH8 A;  4EUZ A;  3S1Y A;  5HFO A;  4KZ4 A;  4D2O A;  3LCE A;  5GHZ A;  5CEC A;  1XPB A;  3A3D A;  4N92 A;  4X6T A;  5AQA A;  3I7J A;  4DE1 A;  3UNW A;  5E2H A;  3SH9 A;  3BYD A;  4KZ6 A;  2WGI A;  1K38 A;  3LY4 A;  4EQI A;  5E2G A;  2R9X A;  4HBU A;  3C7U A;  1K6S A;  3IXD A;  5FAT A;  1YLJ A;  4WYY A;  4E6W A;  4OH0 A;  3JYI A;  4LEN A;  3UO9 A;  3FV7 A;  4BD0 A;  4BJP A;  4R3B A;  5A93 A;  5E2F A;  1TDL A;  2ZC7 A;  4JLF A;  5GHY A;  1MKI A;  4ZJ3 A;  5KSC A;  1TDG A;  4PM8 A;  4XXR A;  1CK3 A;  4DDS A;  2VGJ A;  3PBT A;  3V3S A;  5KSH A;  2BLS A;  2IWB A;  4CJN A;  2P74 A;  3D4F A;  3IXH A;  3SS3 A;  1PZP A;  1OME A;  4JF6 A;  4PMA A;  3WS1 A;  2Y2H A;  2RL3 A;  1NXY A;  5EVI D;  4KG2 A;  5KZH A;  4B4X A;  1YMX A;  1ZKJ A;  2XGN A;  2JBF A;  3PAE A;  5F82 A;  2IWC A;  1PZO A;  1H8Y A;  5GL9 A;  4E3M A;  1MWS A;  1K6R A;  3EQV A;  2DRW A;  2ZC4 B;  4Y0O A;  3VOY A;  4GDB A;  2ZQ9 A;  3UDX A;  3PBO A;  4JXV A;  4U3T A;  2R9W A;  4GKU A;  2EX2 A;  4UA7 A;  3IXG A;  4YIN A;  1KDW A;  3ISG A;  4QHC A;  3HLG A;  4MBF A;  5GLA A;  4IBR A;  4P85 A;  1NY0 A;  3G30 A;  3ZGA B;  3DWK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...