1ERMA

X-ray crystal structure of tem-1 beta lactamase in complex with a designed boronic acid inhibitor (1r)-1-acetamido-2-(3-carboxyphenyl)ethane boronic acid
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
263
structure length
262
Chain Sequence
HPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRWEPELNEAIPNDERDTTMPAAMATTLRKLLTGELLTLASRQQLIDWMEAKVAGPLLRSALPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TEM-1 BETA-LACTAMASE
publication title Structure-based design guides the improved efficacy of deacylation transition state analogue inhibitors of TEM-1 beta-Lactamase(,).
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 90
structure length 262
sequence length 263
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2000-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 1ermA00
1OMEA 5TR7A 4PMAA 2OLUA 3IQAA 1XGJA 2E8IA 5AQ7A 2C6WB 1E3UD 3EQUA 1HVBA 4X68A 1TVFA 4OP8A 5CHJA 1YM1A 5AQ9A 4E3LA 4Y0TA 1HZOA 2EX8A 1PW1A 5GL9A 5EECA 1K55C 4IBRA 3IWIA 1FOFA 3HLDA 3IXHA 3PBSA 1W7FA 4C3QA 3SS5A 2H0YA 3SH7A 3Q07A 4MBHA 4JF6A 4KQRA 1EROA 1XXMA 4XXRA 2Y2LA 2IWDA 5EPHA 2HDSA 1L0DA 2EX6A 5EOEA 3G34A 1ES4A 5IHVA 4GKUA 1L0FA 4S2NC 1SKFA 4UHUA 1K57A 4WELA 3I7JA 4N9LA 3DTMA 4S2PA 4KQQA 4DE3A 3V5MA 1IEMA 1QMEA 3RXXA 3VSLA 4RX2A 3Q81A 5GLDA 5L2FA 1CK3A 2ZM8A 1FCMA 1FQGA 2R9WA 3A3EA 5FI6A 2ZQ7A 5DTTA 4KQOA 4LV1A 5CECA 1H8YA 3Q82A 3BLSA 4YINA 3W4PA 3GSGA 3WS5A 1LI0A 4OQGA 4KZ9A 1ONGA 3PTEA 4E3KA 5CGWA 3RJUA 2Y2PA 4JXVA 4DE2A 4WEJA 3HUMA 4DRTA 1MWTA 2V1ZA 2XLNA 2HP9A 5D3OA 5GLCA 1XKZA 4E6XA 3ZNYA 5KZHA 2XFTA 5HL1A 1PZPA 4X69A 4S2JA 1PZOA 4R4SA 4ZJ3A 1CI9A 5DTKA 3GQZA 2H0TA 3UPPA 4P87A 2DCFA 1TDGA 3HUOA 3IT9A 1MWRA 4X6TA 4Y0OA 3IHAA 3SH8A 1TEMA 1WYBA 3ZCZA 1GA9A 5FSRA 4IBXA 2EFXA 3Q7VB 2R9XA 4IEDA 4LCMA 4JLFA 1PIOA 1NRFA 3C4OA 4BL2A 4OOYA 1W8QA 2WADA 1QMFA 1FSYA 5FQIA 1KGGA 5F1FA 1DJBA 3M2KA 4WZ4A 3G2ZA 1YLYA 3VP2A 1LL9A 1CEFA 5M19A 4WMCA 2HP5A 3IWQA 2C5WB 3GMWA 4FH4A 5A92A 3PAEA 2IWBA 3OPRA 3AGFA 1Z6FA 2XH9A 2Y4AA 4GZBA 4EBNA 1H5XA 2P74A 4JKTA 5FAPA 1PWGA 1SCWA 4WMCD 3UE0A 3OPLA 2XD1A 3G32A 3ZG7B 3S22A 1K56A 3V39A 3WS2A 4S2OA 3HLGA 1JTDA 4E3MA 5KSHA 2ZD8A 2WZXA 3V50A 1N9BA 3E2LA 4GNUA 4OVDA 4JF5A 4R3JA 3G35A 3BFGA 3OPHA 2EX2A 1HD8A 5G18A 4GDNA 1XP4A 4MNRA 4YFMA 4PM5A 1K56D 5FI2A 3ZFZA 1MWSA 1AXBA 1SDNA 4NK3A 4R0QA 4OH0A 2XDMA 2CC1A 2WYXA 3O3VA 3UPNA 5M18A 1BSGA 2OV5A 4ZDXA 4UA6A 3G2YA 3A3FA 1ESUA 1MPLA 3GR2A 3B3XA 3N8LA 4QB8A 2Y2NA 5E2EA 1O07A 4BL3A 4EQIA 1Y54A 1IKGA 3W8KA 5FQKA 1YQSA 1LL5A 3OPPA 4DKIA 5CERA 4BD0A 1H8ZA 4Y0UA 4R1GA 1SHVA 2RL3A 5GHYA 2B5RA 1NYYA 3WS1A 5GHZA 2H5SA 3BFEA 1YLJA 4DXBA 3O86A 3Q7ZA 4WYYA 1M40A 3D4FA 1RGYA 3EQVA 4OQHA 4BQMA 1IYSA 4KG2A 4QY5A 4PPRA 4Z9QA 1MKIA 2Y2KA 5DVAA 4OLDA 3LO7A 3UDXA 2P9VB 4H8RA 3C4PA 4P6BA 4FD8A 2HDUA 3IXGA 2ZM0A 3CJMA 3Q7VA 4IVIA 5CHMA 1ES3A 3HLEA 5KMWA 3ITBA 4GD8A 4WZ5A 1NXYA 4RA7A 2WAEA 4QD4A 1ZG4A 3DW0A 3O87A 3ISGA 4UA9A 1KVLA 1PW8A 3HUNA 2ZC3B 3GVBA 3MZDA 5J8XA 5HAIA 2Y2OA 1IELA 5DF9A 5E2HA 4U3TA 3IF6B 1YMSA 2JC7A 4O7DA 2ZC5B 4QHCA 1XPBA 2G2WA 2JE5A 3OCNA 4HBUA 5EOOA 2PU2A 3ITAA 1BT5A 3C7UA 4RVAA 1FR6A 3AGDA 2EXBA 2QZ6A 1ES5A 3M6BA 3BFDA 4MLLA 1ZC2A 1JWZA 4NETA 4R3BA 3MFDA 1GCEA 5CHUA 3W4QA 4DF6A 3G4PA 3BECA 1BLSA 1S0WA 3HLWA 3MZEA 3PBTA 4BLMA 4OPRA 3GV9A 4JXSA 3FYZA 3NC8A 4PM6A 5CXWA 4WZ5C 5FQ9A 1Q2PA 3UDIA 4MBFA 2ZQAA 2WKEA 3WRTA 4A5RA 4DXCA 1FCOA 3UN7A 1JWPA 1ES2A 3N8RA 3SS3A 4E3JA 5CRFA 2DRWA 2I72A 5DF7A 5BOHA 1DJAA 1K25A 2EX9A 1EI5A 4LENA 4HESA 3M2JA 5EVLA 3MKEA 2EFUA 2Y55A 1PI5A 5FQMA 4HEFA 1MY8A 3LY3A 3GTCA 3V3SA 2Y2JA 4K0XA 3G31A 4C6YA 1BLCA 4JBFA 1IYQA 2J7VA 5CTMA 2HDRA 1W8YA 4KZ6A 4QU3A 3VP4A 5GLAA 4N92A 1WYCA 3HVFA 4JPMA 4KZ5A 3FKVA 4KZAA 1XA7A 2GDNA 2WKHA 3BM6A 3VOYA 4N1HA 4GD6A 1KDSA 4OQIA 5CTNA 5FATA 2WGWA 1PWDA 3E2KA 3ZG0A 3QNCA 2WUQA 3ZG9B 4WM9A 3A3JA 3PBOA 4N9KA 3NDEA 1BZAA 2HP6A 2OLVA 2WGIA 3G30A 3WS0A 1N4OA 1NZUA 1PYYA 3ZGAB 5CEBA 2QMIA 1I5QA 1ESIA 2VGJA 3S4XA 2P9VA 1L0EA 1VM1A 3ZHHA 5A90A 5HAPA 1IYOA 3C5AA 3HLFA 3LCEA 2QPNA 4L0LA 3S1YA 1YLWA 1ZG6A 4KZ4A 1W79A 1DJCA 4ZBEA 5FQQA 4PM7A 2V2FF 4DE1A 2A49A 4GB7A 2PBYA 1G68A 2BLSA 2Z2LB 1GHIA 4CJNA 3BEBA 1J9MA 2ZC4B 4KG6A 5TGFA 1EWZA 3TSGA 3NI9A 2HDQA 2Y59A 3LEZA 3ZDJA 5KSCA 3IF6A 4XUZA 4D2OA 4ZJ2A 1KDWA 4OONA 4MEZA 4R4RA 1NJ4A 2ZQ9A 3IWOA 4JXGA 4XUXA 1K4EA 4EV4A 3FKWA 3MKFA 1NY0A 4WEKA 1E4DA 2V20A 4ID4A 1KVMA 2X71A 1TDLA 3VMAA 4OLGA 3PBRA 1YT4A 1MXOA 2WAFA 1LI9A 2VGKA 3CZDA 3NDGA 2Z2MB 3SOIA 1ZKJA 4FSFA 3VP0A 1M6KA 1MWUA 2WGWB 3HBRA 4Y7PA 3FZCA 3TG9A 2OSUA 4PM8A 1U60A 1WE4A 1K54C 3IH8A 1E25A 1XGIA 2XD5A 3DWZA 2WGVA 3WWXA 3AGEA 2J8YA 4OPQA 2ZC7A 4RYEA 1NYMA 5EVIB 3UE3A 3IF6C 1MBLA 2ZLYA 3V3RA 3C7VA 3QNBA 2WKIA 1HTZA 4KG5A 4CPKA 2RCXA 3A3IA 3CMZA 2Y2MA 3HL9A 3N6IA 1JVJA 4FH2A 5GHXA 4KENB 1CEGA 3DWKA 3IH9A 1K6RA 4OP5A 3PAGA 3M6HA 1K6SA 4F94A 4LV0A 4R23A 2DNSA 4E3IA 5AQBA 3VP1A 4DDYA 4OOMA 3ZG5A 1GHPA 2XGNA 3MZFA 4UA7A 3WRZA 4ZJ1A 3IXBA 1YMXA 2G2UA 4EBPA 1PI4A 3QHYA 5U47A 2PU4A 2JBFA 3BYDA 4E6WA 4ZAMA 4OQ0A 3NY4A 2X01A 3VSKA 1VQQA 1KE0A 1BUEA 3NCKA 1GA0A 3SS4A 5JYPA 4U0TA 2Y2HA 1L2SA 4S2MA 3W4OA 5DF8A 4KZ3A 3VFHA 3OCLA 1YLPA 1L0GA 4X53A 2HPBA 3LY4A 4LV2A 5CGSA 3GRJA 5HW3A 2Y91A 1FSWA 1BLHA 5JYOA 1SDEA 3UE1A 2ZM2A 4UAAA 5TFQA 4N1XA 1JWVA 4KZBA 2A3UA 4OPZA 3IF5A 3UPOA 4GDBA 4P85A 2ZQDA 3P98A 2ZMAA 1I2SA 5FQJA 3N4IA 2EXAA 1Q2QA 2ZC6B 5FAQA 3O88A 1XX2A 2BG1A 2XQZA 5E2GA 4OOLA 2UWXA 1O7EA 3OZHA 3PBQA 4S2KA 3MBZA 4E3NA 1K57C 1LHYA 2J9PA 2IWCA 3ZVWA 5DTSA 4FCFA 4PM9A 2H10A 3UNWA 1YLTA 2XEPA 4KZ8A 1ERQA 4B4ZA 5I94A 4Q8IA 5EVIA 5F83A 5HARA 3FWLA 3Q1FA 1YLZA 4QY6A 1S6RA 5FAOA 5A93A 2ZQCA 4WBGA 5HX9A 4C75A 1W5DA 1I2WA 4RX3A 2FFYA 4QJGA 3JYIA 2WZZA 4X55A 1ERMA 4JF4A 4B88A 2XK1A 3BRMA 5F82A 4KZ7A 3HLCA 5EVID 3NBLA 1GHMA 5HFOA 5FI7A 3HLBA 4IVKA 5E2FA 1IKIA 2XR0A 5F1GA 1DY6A 3UO9A 1C3BA 3NIAA 3VOZA 1K54A 4P0MA 3WS4A 3MXRA 3VFFA 3BFCA 4S2IA 4K0WA 3N7WA 1K38A 2XF3A 4HBTA 4DE0A 2XFSA 1KE4A 2Y2QA 3BFFA 3IXDA 4OKPA 4OPYA 5CEDA 1NZOA 5EVIC 1RP5A 4EUZA 4BD1A 3CG5A 1G6AA 4MBKA 4X56A 5GLBA 1KGEA 5M1AA 5AQAA 5A91A 4U0XA 1JTGA 3BLMA 3N8SA 3VP3A 2Q9MA 1KGFA 5EE8A 2FFFB 3IHBA 4EWFA 3P09A 5CGXA 4M3KA 2Q9NA 3UDFA 1K4FA 1RCJA 1RGZA 3OC2A 3PBNA 4BJPA 4DDSA 5FDHA 5FASA 2JCHA 2Y2IA 4LCLA 1IYPA 4GOGA 3TOIA 1K55A 1PWCA 2WK0A 3MXSA 3ZVTA 3SH9A 1CI8A 4LV3A 3A3DA 5HAQA 4S2LA 1FCNA 3UY6A 2Y2GA 4ZTKA 1KE3A 2ZJ9A 1ALQA 1BLPA 3RXWA 4EBLA 3ZG8B 1LLBA 2X02A 4B4XA 1E3UA 4E3OA 1FR1A 5E43A 4JXWA 1BULA 3FV7A 2ZQ8A 5FA7A 4K91A 1BTLA 4S2NA 2J9OA 4BENA 3HREA 4GN2A 5EUAA 3ZNTA 1XA1A 1ONHA
chains in the Genus database with same CATH superfamily
4QWOA 1E3UD 3KSFA 1PW1A 5HD5A 5HDDA 2H0YA 4P6ZS 2ZMVA 3A0RA 3Q07A 4XT2B 2Y2LA 2IWDA 2HDSA 2KOIA 2PR6A 1SKFA 3I7JA 1Y4OA 5CX7A 3IBRA 4S2PA 4KQQA 2CMNA 1IEMA 2W0NA 1FCMA 3NHQA 3W4PA 4YINA 3WS5A 2A2LA 1SKOA 5CGWA 4JXVA 3RFBA 3HUMA 5F5YA 2V1ZA 2XLNA 4E6XA 5HL1A 1PZPA 1XJ4A 4X69A 4ZJ3A 1CI9A 4L9GA 2DCFA 1MWRA 2P08A 3F1PB 3IHAA 3SZTA 1WYBA 3LFVA 1GA9A 1GSXA 1NRFA 4MN5A 3UB7A 1W8QA 1QMFA 1FSYA 3DBAA 5FQIA 5F1FA 4CLCD 4WZ4A 3G2ZA 4BMWA 2GJ3A 1CEFA 1G28A 5M19A 3BJNA 2HP5A 3D72A 3JVVA 1H0MA 2KDKA 5J4EA 3OPRA 2BTFP 3TRCA 2LB5A 4WMCD 3V39A 1BYWA 4S2OA 3V50A 5LBRA 1N9BA 4HY8A 4R3JA 1MC0A 4G3KA 2EX2A 3PYPA 4GDNA 4MNRA 4YFMA 1K56D 2Y8HA 5FI2A 3T4KA 2CC1A 2WYXA 3O3VA 3LIDA 2ACGA 4LRXC 1ESUA 1Y28A 2Y2NA 1IKGA 2XRNA 3LGOA 3W8KA 1OTEA 3E98A 4I38A 4BD0A 3K2NA 4ESPA 3IBJA 1SHVA 2RL3A 2A24A 5GHZA 2H5SA 3DTIA 1YLJA 4DXBA 4UEYA 4OQHA 4KG2A 3RTYA 2PT7A 5DVAA 4FD8A 1PFLA 1AWIA 3IXGA 3CJMA 1P9RA 5CHMA 1ES3A 1NXYA 4UA9A 1G5UA 3HUNA 3GVBA 5J8XA 5HAIA 2Y2OA 3JPUA 3UE6A 5DF9A 5E2HA 4G3VA 3IF6B 2GZAA 2ZC5B 4ETZA 2JE5A 4HBUA 3M6BA 3U4LP 1ZC2A 3BY9A 5CHUA 4DF6A 4UQIM 5TBMB 5FQ9A 2ZQAA 2WKEA 1FCOA 2UV0E 1ES2A 3B47A 4E3JA 3TE8A 1EI5A 4HESA 4Y3IA 3MKEA 1OTDA 3T12B 4KZ6A 4HHDA 1MZUA 2GDNA 3VOYA 3BM6A 5CTNA 2WUQA 4WM9A 3V67A 3NDEA 2ZMFA 2XA7M 3WS0A 1NZUA 5CEBA 1I5QA 3ZHHA 5A90A 3C5AA 4EETB 3QP2A 1W79A 4ZBEA 2A49A 4Y13A 2PBYA 2L0WA 1G68A 2BLSA 1S4RA 4KG6A 2V8CA 3NI9A 5KSCA 4XUZA 2PD7A 3O5YA 2ZQ9A 4EV4A 1NY0A 3L9KA 3R7WB 2V20A 4NXFA 1KVMA 3ICYA 2O9BA 1YT4A 1LI9A 5HD3A 5I5LA 3SOIA 4FSFA 1M6KA 3HBRA 1WE4A 1K54C 5FEFA 2ZC7A 2WKPA 3P7NA 3C7VA 4NXEA 5DFXA 4KUKA 4B9OA 3CMZA 1JVJA 3LI8A 1GSWA 4KENB 2W3DA 4DJ3A 3EGXC 1S1YA 3PAGA 4LV0A 5HL6A 3T4QA 4E3IA 3ZG5A 3HJKA 1GHPA 4UA7A 3PXPA 1ACFA 4RQ9A 3LI9A 4ZJ1A 1YMXA 2G2UA 4EBPA 3T4OA 3IX3A 5U47A 2PU4A 4E6WA 4ZAMA 2X01A 3LR3A 1BUEA 3EWKA 2OAQ1 1LSWA 1S67L 1YLPA 4X53A 3EOIA 2Y91A 4MN6A 1BLHA 2O99A 4UAAA 4N1XA 4KZBA 3LR0A 4FUWA 4L9EA 1I2SA 3VV4A 1Q2QA 2B18A 4D60A 4OOLA 3EGDC 4S2KA 3MBZA 2W1TB 3ZVWA 4FCFA 2W3FA 4KZ8A 4B4ZA 5I94A 1YLZA 4ETXA 5A93A 2ZQCA 4C75A 1OTAA 1W5DA 2INWA 2WZZA 1XJ3A 3KO6A 1ZHHB 4B88A 5F82A 4HIAA 3HLBA 4IVKA 2XR0A 3NIAA 4S2IA 4K0WA 1XJ6A 3KSHA 1KE4A 2Y2QA 2L4RA 4CLCC 3CG5A 1G6AA 5GLBA 5M1AA 2VLGA 4GS9A 2FFFB 5CGXA 4GOGA 3UB6A 3TOIA 3MXSA 3FG8A 1T1BA 3CLOA 3BQAA 1KE3A 2ZJ9A 3E4QA 4EBLA 1DRMA 2ZQ8A 3LR4A 1BTLA 4Q0JA 4DJ2A 4GN2A 2JHEA 1V9YA 5TR7A 4PMAA 2E8IA 5AQ7A 1DP9A 1N9OA 1YM1A 3D3OA 1HZOA 5GL9A 4IBRA 3IWIA 4C3QA 2VV8A 3SH7A 4L9FA 3S7NA 3NJAA 1EROA 1XXMA 4EU0A 5EPHA 2VA0A 1ES4A 5C5KA 4GKUA 1L0FA 5MC7A 1K57A 3DTMA 4CLCE 2W3EA 5L2FA 2R9WA 3A3EA 3BQ8A 2VGLM 5CECA 4YNRA 3BLSA 4EW7A 4GW9A 1OPXA 4OQGA 1ONGA 1XFNA 4NXGA 4WEJA 3MFXA 4NEED 2A24B 5GLCA 1XKZA 1N9NA 3ZNYA 5KZHA 2XFTA 1LSVA 4R4SA 3MMHA 3LIBA 3H7WA 3HCYA 3IT9A 1TEMA 3ZCZA 4IEDA 4LCMA 4JLFA 1PIOA 2NUPC 4WLAA 2JKRI 2C5WB 1OJ5A 3GMWA 3PAEA 3AGFA 3CAXA 3IX8A 2XH9A 2Y4AA 1JNUA 1H5XA 5FAPA 1PWGA 1SCWA 3BW6A 3OPLA 5F6AA 4E3MA 1JTDA 2WZXA 2E8JA 4GNUA 3NOUC 3LIFA 3BFGA 3OPHA 3MF0A 4FOFA 1XP4A 3S7QA 4R3AA 4NK3A 4R0QA 4OH0A 3UPNA 1BSGA 1MPLA 4EQIA 3B3XA 3MQOA 1Y54A 1YQSA 1LL5A 2V0WA 4DKIA 1H8ZA 4Y0UA 4B93A 5GHYA 3WS1A 4M4XA 1LT0A 3D4FA 1IYSA 2FH5A 3NECA 4PPRA 4Z9QA 1J3WA 2OOLA 1MKIA 2Y2KA 3LO7A 4H8RA 4MN7A 4WL9A 3C4PA 4P6BA 3BWLA 4HP9A 4IVIA 4DN0A 4EQ1A 4RA7A 5G4YA 4HH3A 3ISGA 1L3LA 5HPIA 1PW8A 1IELA 4H6JA 4U3TA 2JC7A 4O7DA 3ULFA 5IU1A 2G2WA 5EOOA 5HZHA 1ES5A 4MLLA 4NETA 1GCEA 4BBUA 3G4PA 1S0WA 4OPRA 3GV9A 4JXSA 1K0KA 4PM6A 3H82A 4GHIA 4MBFA 2K2NA 4DXCA 1JWPA 5CRFA 5HPFA 2VV6A 3GECA 1DJAA 2K7SA 1K25A 4HJ6A 1TS7A 4LENA 4WUJA 4HEFA 1MY8A 3LY3A 3E4PA 1BLCA 2J7VA 1SZVA 5GLAA 5FEGA 3MR0A 4JPMA 4KZAA 2K31A 5DJTA 1VETA 4Y17A 5FATA 2WGWA 3T4TA 2V0UA 3FC7A 5HDCA 3PBOA 3S7OA 2QMIA 1MKMA 2P9VA 3MXQA 3LIEA 4Y2FA 3S1YA 4KZ4A 1YKDA 1DJCA 2DMWA 4HI4A 4PM7A 4X1LA 3ZYTA 4GB7A 4I3AA 3T1XA 2JKGA 2HV1A 2JKFA 4CJNA 3BEBA 2ZC4B 3E0YA 3ZDJA 3LEZA 3NOTC 5L10A 1KDWA 4OONA 4XUXA 4K08A 3IWOA 1K4EA 3FKWA 2PYRA 1YSPA 4JGOA 3KYQA 4ID4A 1TDLA 4EUVA 1MXOA 1ZKJA 3VP0A 2B95A 5FL3A 2OSUA 1U60A 2WGVA 2J8YA 1NWZA 1NYMA 3UE3A 5HWWA 3QNBA 4CPKA 4HOIA 3QP6A 3IX4A 3VOLA 5GHXA 1K6RA 4OP5A 5TJJA 4DDYA 2XGNA 3WRZA 1D7EA 3IXBA 4I5SA 3OOVA 3VSKA 1KE0A 3JVUA 3QP1A 4GS9B 4S2MA 5K5BA 1CF0A 3W4OA 4YOFA 2J3TD 1W63Q 5CGSA 3GRJA 4MDZA 2QJ7A 5JYOA 2O9AA 5TFQA 3IS2A 3P98A 4EESA 2OAP1 4BBVA 4EEPA 3FPWA 1T18A 2HGVA 5E2GA 5L8MA 3H9WA 1YPRA 1Z09A 1W63M 2IWCA 4PHTA 4PM9A 2H10A 3UNWA 1YLTA 4G3WA 2HJ9C 5EVIA 5HX9A 4QJGA 2FFYA 4JGRA 4JF4A 3HLCA 5L07A 3NBLA 1GHMA 5FI7A 4EERA 1IKIA 3UO9A 1K54A 3VFFA 4PAUA 1K38A 4HBTA 4O0PA 4QPRA 4DMZA 4OKPA 4LFUA 5EM0A 5EVIC 1RP5A 4EUZA 4BD1A 4X56A 3MSHA 3NOPC 5A91A 3BLMA 3KSGA 3N8SA 2Q9MA 5EE8A 4GCZA 4PKYG 2Q9NA 5FDHA 1IYPA 1K55A 3C30A 3ZVTA 1CI8A 3UY6A 2Y2GA 4ZTKA 3D9YA 2ZBBA 2EA9A 2X02A 1E3UA 4B4XA 4E3OA 5FA7A 4S2NA 3MQ0A 1OMEA 2OLUA 1XGJA 1HVBA 4X68A 1TVFA 2BASA 5CHJA 4Y0TA 2EX8A 5HDSA 4UQIS 5EECA 1K55C 4E04A 3QP8A 3HLDA 3IXHA 2V1BA 3SS5A 3DAVA 2D02A 2KX6A 2EX6A 5EOEA 4S2NC 4UHUA 4N9LA 4DE3A 3V5MA 3MJQA 4RX2A 4MMNA 5DTTA 4LV1A 2VK3A 1H8YA 3Q82A 4HNBA 1ZTUA 3TW8A 3F1NA 1LI0A 2J3WA 2XA7S 3RH8B 4E3KA 2Y2PA 2JKTI 4DE2A 2PBDP 3PR6A 4DRTA 2HP9A 2ZOIA 2WKRA 2YKHA 4S2JA 1PZOA 5DTKA 2H0TA 3UPPA 1F2KA 4CLCA 1TS8A 4LGWA 4NXBA 5EV0A 4X6TA 3SH8A 5FSRA 4IBXA 2EFXA 2R9XA 3C4OA 4BL2A 3LR5A 4OOYA 5A8BA 1KGGA 1DJBA 1YLYA 3VP2A 1LL9A 5DKKA 3VE3A 3T4JA 4WMCA 1T19A 4H6JB 4FH4A 2KLIA 1Z6FA 4EBNA 4GZBA 2P74A 3G32A 3S22A 1K56A 3HLGA 5EFWA 1SKOB 1F5MA 4OVDA 4JF5A 1P97A 3H82B 4GHIB 1G6OA 4PM5A 4NKPA 3ZFZA 3CPTA 4MCWA 1MWSA 1AXBA 4X25A 5F68A 5M18A 2OV5A 4ZDXA 1FIKA 1S66L 3L7HA 3N8LA 4QB8A 3P01A 5TBMA 4HH2A 1VETB 1P0ZA 2PRFA 5CERA 2B5RA 3BFEA 2H28A 1M40A 1RGYA 4BQMA 4QY5A 3UDXA 4OLDA 2P9VB 4FTXA 4Y15A 3Q7VA 2M7UA 3HLEA 5KMWA 4WF0A 3ITBA 4LRZE 2WAEA 4QD4A 1A0KA 1KVLA 3MZDA 2JKTM 5EVEA 4QHCA 4R70A 1BT5A 3C7UA 4EEUA 1FR6A 2EXBA 2QZ6A 3BFDA 1JWZA 1TS6A 4R3BA 1BLSA 3HLWA 2M1CA 3PBTA 3VE4A 3FYZA 3NC8A 1D06A 2QJ5A 1CQAA 5CXWA 4P6ZM 3UDIA 4A5RA 3UN7A 4F3LA 1GSVA 5DF7A 3KYZA 1UGUA 5HSQA 3M2JA 3NULA 5EVLA 2EFUA 2Y55A 1PI5A 3V3SA 3GTCA 4C6YA 2VJWA 1IYQA 5CTMA 2HDRA 1W8YA 4QU3A 2J3TC 4BBTA 1WYCA 3HVFA 4KZ5A 1XA7A 4GD6A 2M7VA 1VB6A 3C8CA 4OQIA 4I3IA 5AJGA 5DFYA 4BWIA 3A3JA 1BZAA 2WGIA 3G30A 4WN5A 2W3GA 1N4OA 2VV7A 2XROA 1ESIA 2VGJA 3LEQA 1LL8A 5F69A 1IYOA 2QYBA 1OT6A 1YLWA 1ZG6A 2V2FF 2P04A 4DE1A 2PAVP 3FPVA 2Z2LB 1GHIA 5TGFA 1J9MA 3TSGA 3UB5P 4ARZA 4D2OA 1KOUA 4MEZA 1NJ4A 3GDIA 2D01A 3IS2B 4WEKA 1NLZA 3CITA 4OLGA 1WA9A 3PBRA 3S7PA 2VGKA 3CZDA 3NDGA 3UMEA 3B33A 3G6OA 4Y7PA 3FZCA 2ZOHA 2OWHA 3CUEA 1F98A 3IH8A 2XD5A 3DWZA 3WWXA 2J80A 3AGEA 4OPQA 3CHWP 5IS1A 5EVIB 2ZLYA 2WKIA 1HTZA 4KG5A 5IT5A 2RCXA 3U2AA 2Y2MA 3HL9A 1CEGA 3IH9A 2VGLS 2B02A 2W1TA 3M6HA 1K6SA 4F94A 2DNSA 1TD5A 2I9VA 5AQBA 3CUEC 3T4SA 5J7EA 3T1RA 1PI4A 3OLOA 3SW1A 1DP8A 4OQ0A 3NY4A 1TF1A 3UB8A 3SS4A 5JYPA 2Y2HA 1L2SA 5DF8A 4KZ3A 3VFHA 4AFIA 5HW3A 2Y79A 1T1CA 1SDEA 3UE1A 1CJFA 2ZM2A 3W2ZA 2A3UA 3UPOA 4GDBA 2Z6DA 2JKRM 2ZMAA 4IHQA 5FQJA 1PNEA 3N4IA 2EXAA 5FAQA 2LB9A 4HJ4A 2XQZA 3PBQA 1S4SA 1NRJA 2IA2A 1H8MA 2J9PA 5HWVA 3OBFA 3LICA 3Q1FA 3CWFA 1H3QA 5FAOA 1D1JA 1I2WA 2O9CA 3JYIA 2PDRA 1ERMA 4Z1WA 2V1AA 4Q0HA 3BRMA 5E2FA 5F1GA 1C3BA 3VOZA 4P0MA 3N7WA 3BFFA 4OPYA 5CEDA 4MBKA 2YKFA 1KGEA 3F1NB 3VP3A 1KGFA 4EWFA 1LSXA 4IUHA 4M3KA 3QP5A 1RGZA 4DDSA 2JCHA 1F9IA 5HAQA 1FCNA 2V9AA 1ALQA 4CQHA 1LLBA 4CLCB 4JXWA 1BULA 5G4ZA 5FDSA 4BENA 3HREA 4I39A 3DTKA 3IQAA 2C6WB 1UWPX 3EEAA 3EQUA 3MS6A 4OP8A 5AQ9A 4E3LA 4NG2A 1FOFA 3PBSA 1W7FA 2R78A 4MBHA 4JF6A 4KQRA 4KQDA 4R6LA 4XXRA 1PRQA 2OWJA 1L0DA 3E4OA 3G34A 5IHVA 4WELA 5AVEA 1V9ZA 4HJ3A 3LIAA 1QMEA 3RXXA 3VSLA 3Q81A 5GLDA 1CK3A 1OT9A 2ZM8A 1FQGA 2WKQA 3LYXA 1TS0A 2ZQ7A 5FI6A 3TJZC 3CPTB 4KQOA 3BY8A 2QKPA 3C2WA 1VEUA 3GSGA 3EEHA 4KZ9A 5DJUA 3PTEA 3RJUA 3HJIA 1MWTA 5D3OA 3F1OA 3GQZA 4P87A 1S1ZA 2ZL1A 1TDGA 4HP4A 3HUOA 4Y0OA 3K3CA 3Q7VB 2WADA 3KYEA 3M2KA 2EWVA 4LPZA 2MJ6A 1YAXA 3IWQA 1YSQA 3PHYA 5A92A 2IWBA 4XT2A 4JKTA 4X1MA 3UE0A 2XD1A 3ZG7B 4O8GA 3WS2A 2GNXA 5KSHA 2ZD8A 2AVXA 3E2LA 4PKYA 3G35A 1HD8A 5G18A 1XJ2A 4F3LB 1OJGA 2VX8A 1SDNA 3T1SA 4Y5FA 2XDMA 3H7WB 4UA6A 2VZWA 3G2YA 3UMDA 3A3FA 3GR2A 1DP6A 4BL3A 5KIZA 5E2EA 1O07A 2PYPA 4EXOA 1UWNX 5FQKA 3OPPA 3QP4A 1OTBA 4R1GA 1NYYA 3O86A 3Q7ZA 4WYYA 4ME4A 3EQVA 4IUKA 4GLQA 5L09A 3T50A 3F1PA 2HDUA 2ZM0A 5EM1A 4GD8A 4WZ5A 1ZG4A 3DW0A 3O87A 2ZC3B 3A0SA 2VKSA 2V8FA 1FILA 1YMSA 4ARZB 1T1AA 1XPBA 3OCNA 2PU2A 3ITAA 1HLUP 4RVAA 3AGDA 1OTIA 3MFDA 3W4QA 3BECA 4O01A 4BLMA 3MZEA 4WZ5C 3T4LA 1Q2PA 3WRTA 3N8RA 3SS3A 2DRWA 2I72A 5BOHA 2EX9A 5AVFA 2VEAA 5FQMA 2Y2JA 4K0XA 3G31A 1IFQA 4JBFA 3VP4A 4KUOA 4N92A 3FKVA 2WKHA 5DKLA 4N1HA 1KDSA 1PWDA 2XSSA 3E2KA 1EW0A 3ZG0A 3QNCA 3ZG9B 3CI6A 1ODVA 3KSIA 4LLOB 4N9KA 2PR5A 2HP6A 2OLVA 2PD8A 2W1RA 1PYYA 2W3HA 3ZGAB 3S4XA 2EWWA 1L0EA 1VM1A 3C38A 5HAPA 3HLFA 4YWZA 4Q0IA 3LCEA 2QPNA 4L0LA 5FQQA 2PHYA 1VHMA 1EWZA 2HDQA 2Y59A 3IF6A 1IOUA 4ZJ2A 4R4RA 4JXGA 3MKFA 1E4DA 2X71A 3VMAA 2WAFA 2Z2MB 4I3JA 1MWUA 2WGWB 3ZQ5A 3TG9A 1STZA 4PM8A 3K3DA 1E25A 1XGIA 4RYEA 3IF6C 1MBLA 3V3RA 2GX5A 5J3WA 3A3IA 3N6IA 4FH2A 3DWKA 2HJEA 2Z6CA 4R23A 3VP1A 4OOMA 3UB9A 3MZFA 1NLYA 3QHYA 2JBFA 3BYDA 1VQQA 3MQQA 3NCKA 1GA0A 4U0TA 3OCLA 1L0GA 2HPBA 3LY4A 4LV2A 1FSWA 2P7JA 3R4KA 2NUTC 4LRYC 1N9LA 1JWVA 4OPZA 3IF5A 4P85A 2ZQDA 3R7WA 3T1QB 3A0VA 2ZC6B 3O88A 4II7A 1XX2A 2BG1A 2UWXA 1O7EA 3OZHA 4E3NA 3KX0X 1K57C 1LHYA 3DTEA 5DTSA 2XEPA 1ERQA 5HWTA 4Q8IA 2L1MA 5F83A 5HARA 3FWLA 2JN7A 4QY6A 1S6RA 4WBGA 4RX3A 2HZ5A 4X55A 2XK1A 2HF6A 4KZ7A 5EVID 5HFOA 1DY6A 4R38A 3WS4A 3MXRA 3BFCA 4JGQA 2XF3A 4DE0A 2XFSA 4IJGA 3IXDA 1NZOA 1X0OA 1VEUB 4HQAA 2W27A 4ZRRA 5AQAA 4U0XA 1JTGA 3IHBA 3P09A 4GJ4A 3UDFA 1K4FA 1RCJA 3OC2A 3PBNA 3B42A 4BJPA 5FASA 2Y2IA 4LCLA 1PWCA 2WK0A 2FZ0A 3SH9A 4LV3A 3A3DA 4S2LA 3F1OB 2O0YA 1P9WA 3LUQA 1BLPA 2Q0OA 3RXWA 3ZG8B 2QWSA 1XFQA 1FR1A 5E43A 4JGPA 3FV7A 2ZL1B 4K91A 2G7UA 2J9OA 2QHKA 5EUAA 3ZNTA 1XA1A 1ONHA
chains in the Genus database with same CATH topology
1OMEA 5TR7A 4PMAA 2OLUA 3IQAA 1XGJA 2E8IA 5AQ7A 2C6WB 1E3UD 3EQUA 1HVBA 4X68A 1TVFA 4OP8A 5CHJA 1YM1A 5AQ9A 4E3LA 4Y0TA 1HZOA 2EX8A 1PW1A 5GL9A 5EECA 1K55C 4IBRA 3IWIA 1FOFA 3HLDA 3IXHA 3PBSA 1W7FA 4C3QA 3SS5A 2H0YA 3SH7A 3Q07A 4MBHA 4JF6A 4KQRA 1EROA 1XXMA 4XXRA 2Y2LA 2IWDA 5EPHA 2HDSA 1L0DA 2EX6A 5EOEA 3G34A 1ES4A 5IHVA 4GKUA 1L0FA 4S2NC 1SKFA 4UHUA 1K57A 4WELA 3I7JA 4N9LA 3DTMA 4S2PA 4KQQA 4DE3A 3V5MA 1IEMA 1QMEA 3RXXA 3VSLA 4RX2A 3Q81A 5GLDA 5L2FA 1CK3A 2ZM8A 1FCMA 1FQGA 2R9WA 3A3EA 5FI6A 2ZQ7A 5DTTA 4KQOA 4LV1A 5CECA 1H8YA 3Q82A 3BLSA 4YINA 3W4PA 3GSGA 3WS5A 1LI0A 4OQGA 4KZ9A 1ONGA 3PTEA 4E3KA 5CGWA 3RJUA 2Y2PA 4JXVA 4DE2A 4WEJA 3HUMA 4DRTA 1MWTA 2V1ZA 2XLNA 2HP9A 5D3OA 5GLCA 1XKZA 4E6XA 3ZNYA 5KZHA 2XFTA 5HL1A 1PZPA 4X69A 4S2JA 1PZOA 4R4SA 4ZJ3A 1CI9A 5DTKA 3GQZA 2H0TA 3UPPA 4P87A 2DCFA 1TDGA 3HUOA 3IT9A 1MWRA 4X6TA 4Y0OA 3IHAA 3SH8A 1TEMA 1WYBA 3ZCZA 1GA9A 5FSRA 4IBXA 2EFXA 3Q7VB 2R9XA 4IEDA 4LCMA 4JLFA 1PIOA 1NRFA 3C4OA 4BL2A 4OOYA 1W8QA 2WADA 1QMFA 1FSYA 5FQIA 1KGGA 5F1FA 1DJBA 3M2KA 4WZ4A 3G2ZA 1YLYA 3VP2A 1LL9A 1CEFA 5M19A 4WMCA 2HP5A 3IWQA 2C5WB 3GMWA 4FH4A 5A92A 3PAEA 2IWBA 3OPRA 3AGFA 1Z6FA 2XH9A 2Y4AA 4GZBA 4EBNA 1H5XA 2P74A 4JKTA 5FAPA 1PWGA 1SCWA 4WMCD 3UE0A 3OPLA 2XD1A 3G32A 3ZG7B 3S22A 1K56A 3V39A 3WS2A 4S2OA 3HLGA 1JTDA 4E3MA 5KSHA 2ZD8A 2WZXA 3V50A 1N9BA 3E2LA 4GNUA 4OVDA 4JF5A 4R3JA 3G35A 3BFGA 3OPHA 2EX2A 1HD8A 5G18A 4GDNA 1XP4A 4MNRA 4YFMA 4PM5A 1K56D 5FI2A 3ZFZA 1MWSA 1AXBA 1SDNA 4NK3A 4R0QA 4OH0A 2XDMA 2CC1A 2WYXA 3O3VA 3UPNA 5M18A 1BSGA 2OV5A 4ZDXA 4UA6A 3G2YA 3A3FA 1ESUA 1MPLA 3GR2A 3B3XA 3N8LA 4QB8A 2Y2NA 5E2EA 1O07A 4BL3A 4EQIA 1Y54A 1IKGA 3W8KA 5FQKA 1YQSA 1LL5A 3OPPA 4DKIA 5CERA 4BD0A 1H8ZA 4Y0UA 4R1GA 1SHVA 2RL3A 5GHYA 2B5RA 1NYYA 3WS1A 5GHZA 2H5SA 3BFEA 1YLJA 4DXBA 3O86A 3Q7ZA 4WYYA 1M40A 3D4FA 1RGYA 3EQVA 4OQHA 4BQMA 1IYSA 4KG2A 4QY5A 4PPRA 4Z9QA 1MKIA 2Y2KA 5DVAA 4OLDA 3LO7A 3UDXA 2P9VB 4H8RA 3C4PA 4P6BA 4FD8A 2HDUA 3IXGA 2ZM0A 3CJMA 3Q7VA 4IVIA 5CHMA 1ES3A 3HLEA 5KMWA 3ITBA 4GD8A 4WZ5A 1NXYA 4RA7A 2WAEA 4QD4A 1ZG4A 3DW0A 3O87A 3ISGA 4UA9A 1KVLA 1PW8A 3HUNA 2ZC3B 3GVBA 3MZDA 5J8XA 5HAIA 2Y2OA 1IELA 5DF9A 5E2HA 4U3TA 3IF6B 1YMSA 2JC7A 4O7DA 2ZC5B 4QHCA 1XPBA 2G2WA 2JE5A 3OCNA 4HBUA 5EOOA 2PU2A 3ITAA 1BT5A 3C7UA 4RVAA 1FR6A 3AGDA 2EXBA 2QZ6A 1ES5A 3M6BA 3BFDA 4MLLA 1ZC2A 1JWZA 4NETA 4R3BA 3MFDA 1GCEA 5CHUA 3W4QA 4DF6A 3G4PA 3BECA 1BLSA 1S0WA 3HLWA 3MZEA 3PBTA 4BLMA 4OPRA 3GV9A 4JXSA 3FYZA 3NC8A 4PM6A 5CXWA 4WZ5C 5FQ9A 1Q2PA 3UDIA 4MBFA 2ZQAA 2WKEA 3WRTA 4A5RA 4DXCA 1FCOA 3UN7A 1JWPA 1ES2A 3N8RA 3SS3A 4E3JA 5CRFA 2DRWA 2I72A 5DF7A 5BOHA 1DJAA 1K25A 2EX9A 1EI5A 4LENA 4HESA 3M2JA 5EVLA 3MKEA 2EFUA 2Y55A 1PI5A 5FQMA 4HEFA 1MY8A 3LY3A 3GTCA 3V3SA 2Y2JA 4K0XA 3G31A 4C6YA 1BLCA 4JBFA 1IYQA 2J7VA 5CTMA 2HDRA 1W8YA 4KZ6A 4QU3A 3VP4A 5GLAA 4N92A 1WYCA 3HVFA 4JPMA 4KZ5A 3FKVA 4KZAA 1XA7A 2GDNA 2WKHA 3BM6A 3VOYA 4N1HA 4GD6A 1KDSA 4OQIA 5CTNA 5FATA 2WGWA 1PWDA 3E2KA 3ZG0A 3QNCA 2WUQA 3ZG9B 4WM9A 3A3JA 3PBOA 4N9KA 3NDEA 1BZAA 2HP6A 2OLVA 2WGIA 3G30A 3WS0A 1N4OA 1NZUA 1PYYA 3ZGAB 5CEBA 2QMIA 1I5QA 1ESIA 2VGJA 3S4XA 2P9VA 1L0EA 1VM1A 3ZHHA 5A90A 5HAPA 1IYOA 3C5AA 3HLFA 3LCEA 2QPNA 4L0LA 3S1YA 1YLWA 1ZG6A 4KZ4A 1W79A 1DJCA 4ZBEA 5FQQA 4PM7A 2V2FF 4DE1A 2A49A 4GB7A 2PBYA 1G68A 2BLSA 2Z2LB 1GHIA 4CJNA 3BEBA 1J9MA 2ZC4B 4KG6A 5TGFA 1EWZA 3TSGA 3NI9A 2HDQA 2Y59A 3LEZA 3ZDJA 5KSCA 3IF6A 4XUZA 4D2OA 4ZJ2A 1KDWA 4OONA 4MEZA 4R4RA 1NJ4A 2ZQ9A 3IWOA 4JXGA 4XUXA 1K4EA 4EV4A 3FKWA 3MKFA 1NY0A 4WEKA 1E4DA 2V20A 4ID4A 1KVMA 2X71A 1TDLA 3VMAA 4OLGA 3PBRA 1YT4A 1MXOA 2WAFA 1LI9A 2VGKA 3CZDA 3NDGA 2Z2MB 3SOIA 1ZKJA 4FSFA 3VP0A 1M6KA 1MWUA 2WGWB 3HBRA 4Y7PA 3FZCA 3TG9A 2OSUA 4PM8A 1U60A 1WE4A 1K54C 3IH8A 1E25A 1XGIA 2XD5A 3DWZA 2WGVA 3WWXA 3AGEA 2J8YA 4OPQA 2ZC7A 4RYEA 1NYMA 5EVIB 3UE3A 3IF6C 1MBLA 2ZLYA 3V3RA 3C7VA 3QNBA 2WKIA 1HTZA 4KG5A 4CPKA 2RCXA 3A3IA 3CMZA 2Y2MA 3HL9A 3N6IA 1JVJA 4FH2A 5GHXA 4KENB 1CEGA 3DWKA 3IH9A 1K6RA 4OP5A 3PAGA 3M6HA 1K6SA 4F94A 4LV0A 4R23A 2DNSA 4E3IA 5AQBA 3VP1A 4DDYA 4OOMA 3ZG5A 1GHPA 2XGNA 3MZFA 4UA7A 3WRZA 4ZJ1A 3IXBA 1YMXA 2G2UA 4EBPA 1PI4A 3QHYA 5U47A 2PU4A 2JBFA 3BYDA 4E6WA 4ZAMA 4OQ0A 3NY4A 2X01A 3VSKA 1VQQA 1KE0A 1BUEA 3NCKA 1GA0A 3SS4A 5JYPA 4U0TA 2Y2HA 1L2SA 4S2MA 3W4OA 5DF8A 4KZ3A 3VFHA 3OCLA 1YLPA 1L0GA 4X53A 2HPBA 3LY4A 4LV2A 5CGSA 3GRJA 5HW3A 2Y91A 1FSWA 1BLHA 5JYOA 1SDEA 3UE1A 2ZM2A 4UAAA 5TFQA 4N1XA 1JWVA 4KZBA 2A3UA 4OPZA 3IF5A 3UPOA 4GDBA 4P85A 2ZQDA 3P98A 2ZMAA 1I2SA 5FQJA 3N4IA 2EXAA 1Q2QA 2ZC6B 5FAQA 3O88A 1XX2A 2BG1A 2XQZA 5E2GA 4OOLA 2UWXA 1O7EA 3OZHA 3PBQA 4S2KA 3MBZA 4E3NA 1K57C 1LHYA 2J9PA 2IWCA 3ZVWA 5DTSA 4FCFA 4PM9A 2H10A 3UNWA 1YLTA 2XEPA 4KZ8A 1ERQA 4B4ZA 5I94A 4Q8IA 5EVIA 5F83A 5HARA 3FWLA 3Q1FA 1YLZA 4QY6A 1S6RA 5FAOA 5A93A 2ZQCA 4WBGA 5HX9A 4C75A 1W5DA 1I2WA 4RX3A 2FFYA 4QJGA 3JYIA 2WZZA 4X55A 1ERMA 4JF4A 4B88A 2XK1A 3BRMA 5F82A 4KZ7A 3HLCA 5EVID 3NBLA 1GHMA 5HFOA 5FI7A 3HLBA 4IVKA 5E2FA 1IKIA 2XR0A 5F1GA 1DY6A 3UO9A 1C3BA 3NIAA 3VOZA 1K54A 4P0MA 3WS4A 3MXRA 3VFFA 3BFCA 4S2IA 4K0WA 3N7WA 1K38A 2XF3A 4HBTA 4DE0A 2XFSA 1KE4A 2Y2QA 3BFFA 3IXDA 4OKPA 4OPYA 5CEDA 1NZOA 5EVIC 1RP5A 4EUZA 4BD1A 3CG5A 1G6AA 4MBKA 4X56A 5GLBA 1KGEA 5M1AA 5AQAA 5A91A 4U0XA 1JTGA 3BLMA 3N8SA 3VP3A 2Q9MA 1KGFA 5EE8A 2FFFB 3IHBA 4EWFA 3P09A 5CGXA 4M3KA 2Q9NA 3UDFA 1K4FA 1RCJA 1RGZA 3OC2A 3PBNA 4BJPA 4DDSA 5FDHA 5FASA 2JCHA 2Y2IA 4LCLA 1IYPA 4GOGA 3TOIA 1K55A 1PWCA 2WK0A 3MXSA 3ZVTA 3SH9A 1CI8A 4LV3A 3A3DA 5HAQA 4S2LA 1FCNA 3UY6A 2Y2GA 4ZTKA 1KE3A 2ZJ9A 1ALQA 1BLPA 3RXWA 4EBLA 3ZG8B 1LLBA 2X02A 4B4XA 1E3UA 4E3OA 1FR1A 5E43A 4JXWA 1BULA 3FV7A 2ZQ8A 5FA7A 4K91A 1BTLA 4S2NA 2J9OA 4BENA 3HREA 4GN2A 5EUAA 3ZNTA 1XA1A 1ONHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OME A;  5TR7 A;  4PMA A;  2OLU A;  3IQA A;  1XGJ A;  2E8I A;  5AQ7 A;  2C6W B;  1E3U D;  3EQU A;  1HVB A;  4X68 A;  1TVF A;  4OP8 A;  5CHJ A;  1YM1 A;  5AQ9 A;  4E3L A;  4Y0T A;  1HZO A;  2EX8 A;  1PW1 A;  5GL9 A;  5EEC A;  1K55 C;  4IBR A;  3IWI A;  1FOF A;  3HLD A;  3IXH A;  3PBS A;  1W7F A;  4C3Q A;  3SS5 A;  2H0Y A;  3SH7 A;  3Q07 A;  4MBH A;  4JF6 A;  4KQR A;  1ERO A;  1XXM A;  4XXR A;  2Y2L A;  2IWD A;  5EPH A;  2HDS A;  1L0D A;  2EX6 A;  5EOE A;  3G34 A;  1ES4 A;  5IHV A;  4GKU A;  1L0F A;  4S2N C;  1SKF A;  4UHU A;  1K57 A;  4WEL A;  3I7J A;  4N9L A;  3DTM A;  4S2P A;  4KQQ A;  4DE3 A;  3V5M A;  1IEM A;  1QME A;  3RXX A;  3VSL A;  4RX2 A;  3Q81 A;  5GLD A;  5L2F A;  1CK3 A;  2ZM8 A;  1FCM A;  1FQG A;  2R9W A;  3A3E A;  5FI6 A;  2ZQ7 A;  5DTT A;  4KQO A;  4LV1 A;  5CEC A;  1H8Y A;  3Q82 A;  3BLS A;  4YIN A;  3W4P A;  3GSG A;  3WS5 A;  1LI0 A;  4OQG A;  4KZ9 A;  1ONG A;  3PTE A;  4E3K A;  5CGW A;  3RJU A;  2Y2P A;  4JXV A;  4DE2 A;  4WEJ A;  3HUM A;  4DRT A;  1MWT A;  2V1Z A;  2XLN A;  2HP9 A;  5D3O A;  5GLC A;  1XKZ A;  4E6X A;  3ZNY A;  5KZH A;  2XFT A;  5HL1 A;  1PZP A;  4X69 A;  4S2J A;  1PZO A;  4R4S A;  4ZJ3 A;  1CI9 A;  5DTK A;  3GQZ A;  2H0T A;  3UPP A;  4P87 A;  2DCF A;  1TDG A;  3HUO A;  3IT9 A;  1MWR A;  4X6T A;  4Y0O A;  3IHA A;  3SH8 A;  1TEM A;  1WYB A;  3ZCZ A;  1GA9 A;  5FSR A;  4IBX A;  2EFX A;  3Q7V B;  2R9X A;  4IED A;  4LCM A;  4JLF A;  1PIO A;  1NRF A;  3C4O A;  4BL2 A;  4OOY A;  1W8Q A;  2WAD A;  1QMF A;  1FSY A;  5FQI A;  1KGG A;  5F1F A;  1DJB A;  3M2K A;  4WZ4 A;  3G2Z A;  1YLY A;  3VP2 A;  1LL9 A;  1CEF A;  5M19 A;  4WMC A;  2HP5 A;  3IWQ A;  2C5W B;  3GMW A;  4FH4 A;  5A92 A;  3PAE A;  2IWB A;  3OPR A;  3AGF A;  1Z6F A;  2XH9 A;  2Y4A A;  4GZB A;  4EBN A;  1H5X A;  2P74 A;  4JKT A;  5FAP A;  1PWG A;  1SCW A;  4WMC D;  3UE0 A;  3OPL A;  2XD1 A;  3G32 A;  3ZG7 B;  3S22 A;  1K56 A;  3V39 A;  3WS2 A;  4S2O A;  3HLG A;  1JTD A;  4E3M A;  5KSH A;  2ZD8 A;  2WZX A;  3V50 A;  1N9B A;  3E2L A;  4GNU A;  4OVD A;  4JF5 A;  4R3J A;  3G35 A;  3BFG A;  3OPH A;  2EX2 A;  1HD8 A;  5G18 A;  4GDN A;  1XP4 A;  4MNR A;  4YFM A;  4PM5 A;  1K56 D;  5FI2 A;  3ZFZ A;  1MWS A;  1AXB A;  1SDN A;  4NK3 A;  4R0Q A;  4OH0 A;  2XDM A;  2CC1 A;  2WYX A;  3O3V A;  3UPN A;  5M18 A;  1BSG A;  2OV5 A;  4ZDX A;  4UA6 A;  3G2Y A;  3A3F A;  1ESU A;  1MPL A;  3GR2 A;  3B3X A;  3N8L A;  4QB8 A;  2Y2N A;  5E2E A;  1O07 A;  4BL3 A;  4EQI A;  1Y54 A;  1IKG A;  3W8K A;  5FQK A;  1YQS A;  1LL5 A;  3OPP A;  4DKI A;  5CER A;  4BD0 A;  1H8Z A;  4Y0U A;  4R1G A;  1SHV A;  2RL3 A;  5GHY A;  2B5R A;  1NYY A;  3WS1 A;  5GHZ A;  2H5S A;  3BFE A;  1YLJ A;  4DXB A;  3O86 A;  3Q7Z A;  4WYY A;  1M40 A;  3D4F A;  1RGY A;  3EQV A;  4OQH A;  4BQM A;  1IYS A;  4KG2 A;  4QY5 A;  4PPR A;  4Z9Q A;  1MKI A;  2Y2K A;  5DVA A;  4OLD A;  3LO7 A;  3UDX A;  2P9V B;  4H8R A;  3C4P A;  4P6B A;  4FD8 A;  2HDU A;  3IXG A;  2ZM0 A;  3CJM A;  3Q7V A;  4IVI A;  5CHM A;  1ES3 A;  3HLE A;  5KMW A;  3ITB A;  4GD8 A;  4WZ5 A;  1NXY A;  4RA7 A;  2WAE A;  4QD4 A;  1ZG4 A;  3DW0 A;  3O87 A;  3ISG A;  4UA9 A;  1KVL A;  1PW8 A;  3HUN A;  2ZC3 B;  3GVB A;  3MZD A;  5J8X A;  5HAI A;  2Y2O A;  1IEL A;  5DF9 A;  5E2H A;  4U3T A;  3IF6 B;  1YMS A;  2JC7 A;  4O7D A;  2ZC5 B;  4QHC A;  1XPB A;  2G2W A;  2JE5 A;  3OCN A;  4HBU A;  5EOO A;  2PU2 A;  3ITA A;  1BT5 A;  3C7U A;  4RVA A;  1FR6 A;  3AGD A;  2EXB A;  2QZ6 A;  1ES5 A;  3M6B A;  3BFD A;  4MLL A;  1ZC2 A;  1JWZ A;  4NET A;  4R3B A;  3MFD A;  1GCE A;  5CHU A;  3W4Q A;  4DF6 A;  3G4P A;  3BEC A;  1BLS A;  1S0W A;  3HLW A;  3MZE A;  3PBT A;  4BLM A;  4OPR A;  3GV9 A;  4JXS A;  3FYZ A;  3NC8 A;  4PM6 A;  5CXW A;  4WZ5 C;  5FQ9 A;  1Q2P A;  3UDI A;  4MBF A;  2ZQA A;  2WKE A;  3WRT A;  4A5R A;  4DXC A;  1FCO A;  3UN7 A;  1JWP A;  1ES2 A;  3N8R A;  3SS3 A;  4E3J A;  5CRF A;  2DRW A;  2I72 A;  5DF7 A;  5BOH A;  1DJA A;  1K25 A;  2EX9 A;  1EI5 A;  4LEN A;  4HES A;  3M2J A;  5EVL A;  3MKE A;  2EFU A;  2Y55 A;  1PI5 A;  5FQM A;  4HEF A;  1MY8 A;  3LY3 A;  3GTC A;  3V3S A;  2Y2J A;  4K0X A;  3G31 A;  4C6Y A;  1BLC A;  4JBF A;  1IYQ A;  2J7V A;  5CTM A;  2HDR A;  1W8Y A;  4KZ6 A;  4QU3 A;  3VP4 A;  5GLA A;  4N92 A;  1WYC A;  3HVF A;  4JPM A;  4KZ5 A;  3FKV A;  4KZA A;  1XA7 A;  2GDN A;  2WKH A;  3BM6 A;  3VOY A;  4N1H A;  4GD6 A;  1KDS A;  4OQI A;  5CTN A;  5FAT A;  2WGW A;  1PWD A;  3E2K A;  3ZG0 A;  3QNC A;  2WUQ A;  3ZG9 B;  4WM9 A;  3A3J A;  3PBO A;  4N9K A;  3NDE A;  1BZA A;  2HP6 A;  2OLV A;  2WGI A;  3G30 A;  3WS0 A;  1N4O A;  1NZU A;  1PYY A;  3ZGA B;  5CEB A;  2QMI A;  1I5Q A;  1ESI A;  2VGJ A;  3S4X A;  2P9V A;  1L0E A;  1VM1 A;  3ZHH A;  5A90 A;  5HAP A;  1IYO A;  3C5A A;  3HLF A;  3LCE A;  2QPN A;  4L0L A;  3S1Y A;  1YLW A;  1ZG6 A;  4KZ4 A;  1W79 A;  1DJC A;  4ZBE A;  5FQQ A;  4PM7 A;  2V2F F;  4DE1 A;  2A49 A;  4GB7 A;  2PBY A;  1G68 A;  2BLS A;  2Z2L B;  1GHI A;  4CJN A;  3BEB A;  1J9M A;  2ZC4 B;  4KG6 A;  5TGF A;  1EWZ A;  3TSG A;  3NI9 A;  2HDQ A;  2Y59 A;  3LEZ A;  3ZDJ A;  5KSC A;  3IF6 A;  4XUZ A;  4D2O A;  4ZJ2 A;  1KDW A;  4OON A;  4MEZ A;  4R4R A;  1NJ4 A;  2ZQ9 A;  3IWO A;  4JXG A;  4XUX A;  1K4E A;  4EV4 A;  3FKW A;  3MKF A;  1NY0 A;  4WEK A;  1E4D A;  2V20 A;  4ID4 A;  1KVM A;  2X71 A;  1TDL A;  3VMA A;  4OLG A;  3PBR A;  1YT4 A;  1MXO A;  2WAF A;  1LI9 A;  2VGK A;  3CZD A;  3NDG A;  2Z2M B;  3SOI A;  1ZKJ A;  4FSF A;  3VP0 A;  1M6K A;  1MWU A;  2WGW B;  3HBR A;  4Y7P A;  3FZC A;  3TG9 A;  2OSU A;  4PM8 A;  1U60 A;  1WE4 A;  1K54 C;  3IH8 A;  1E25 A;  1XGI A;  2XD5 A;  3DWZ A;  2WGV A;  3WWX A;  3AGE A;  2J8Y A;  4OPQ A;  2ZC7 A;  4RYE A;  1NYM A;  5EVI B;  3UE3 A;  3IF6 C;  1MBL A;  2ZLY A;  3V3R A;  3C7V A;  3QNB A;  2WKI A;  1HTZ A;  4KG5 A;  4CPK A;  2RCX A;  3A3I A;  3CMZ A;  2Y2M A;  3HL9 A;  3N6I A;  1JVJ A;  4FH2 A;  5GHX A;  4KEN B;  1CEG A;  3DWK A;  3IH9 A;  1K6R A;  4OP5 A;  3PAG A;  3M6H A;  1K6S A;  4F94 A;  4LV0 A;  4R23 A;  2DNS A;  4E3I A;  5AQB A;  3VP1 A;  4DDY A;  4OOM A;  3ZG5 A;  1GHP A;  2XGN A;  3MZF A;  4UA7 A;  3WRZ A;  4ZJ1 A;  3IXB A;  1YMX A;  2G2U A;  4EBP A;  1PI4 A;  3QHY A;  5U47 A;  2PU4 A;  2JBF A;  3BYD A;  4E6W A;  4ZAM A;  4OQ0 A;  3NY4 A;  2X01 A;  3VSK A;  1VQQ A;  1KE0 A;  1BUE A;  3NCK A;  1GA0 A;  3SS4 A;  5JYP A;  4U0T A;  2Y2H A;  1L2S A;  4S2M A;  3W4O A;  5DF8 A;  4KZ3 A;  3VFH A;  3OCL A;  1YLP A;  1L0G A;  4X53 A;  2HPB A;  3LY4 A;  4LV2 A;  5CGS A;  3GRJ A;  5HW3 A;  2Y91 A;  1FSW A;  1BLH A;  5JYO A;  1SDE A;  3UE1 A;  2ZM2 A;  4UAA A;  5TFQ A;  4N1X A;  1JWV A;  4KZB A;  2A3U A;  4OPZ A;  3IF5 A;  3UPO A;  4GDB A;  4P85 A;  2ZQD A;  3P98 A;  2ZMA A;  1I2S A;  5FQJ A;  3N4I A;  2EXA A;  1Q2Q A;  2ZC6 B;  5FAQ A;  3O88 A;  1XX2 A;  2BG1 A;  2XQZ A;  5E2G A;  4OOL A;  2UWX A;  1O7E A;  3OZH A;  3PBQ A;  4S2K A;  3MBZ A;  4E3N A;  1K57 C;  1LHY A;  2J9P A;  2IWC A;  3ZVW A;  5DTS A;  4FCF A;  4PM9 A;  2H10 A;  3UNW A;  1YLT A;  2XEP A;  4KZ8 A;  1ERQ A;  4B4Z A;  5I94 A;  4Q8I A;  5EVI A;  5F83 A;  5HAR A;  3FWL A;  3Q1F A;  1YLZ A;  4QY6 A;  1S6R A;  5FAO A;  5A93 A;  2ZQC A;  4WBG A;  5HX9 A;  4C75 A;  1W5D A;  1I2W A;  4RX3 A;  2FFY A;  4QJG A;  3JYI A;  2WZZ A;  4X55 A;  1ERM A;  4JF4 A;  4B88 A;  2XK1 A;  3BRM A;  5F82 A;  4KZ7 A;  3HLC A;  5EVI D;  3NBL A;  1GHM A;  5HFO A;  5FI7 A;  3HLB A;  4IVK A;  5E2F A;  1IKI A;  2XR0 A;  5F1G A;  1DY6 A;  3UO9 A;  1C3B A;  3NIA A;  3VOZ A;  1K54 A;  4P0M A;  3WS4 A;  3MXR A;  3VFF A;  3BFC A;  4S2I A;  4K0W A;  3N7W A;  1K38 A;  2XF3 A;  4HBT A;  4DE0 A;  2XFS A;  1KE4 A;  2Y2Q A;  3BFF A;  3IXD A;  4OKP A;  4OPY A;  5CED A;  1NZO A;  5EVI C;  1RP5 A;  4EUZ A;  4BD1 A;  3CG5 A;  1G6A A;  4MBK A;  4X56 A;  5GLB A;  1KGE A;  5M1A A;  5AQA A;  5A91 A;  4U0X A;  1JTG A;  3BLM A;  3N8S A;  3VP3 A;  2Q9M A;  1KGF A;  5EE8 A;  2FFF B;  3IHB A;  4EWF A;  3P09 A;  5CGX A;  4M3K A;  2Q9N A;  3UDF A;  1K4F A;  1RCJ A;  1RGZ A;  3OC2 A;  3PBN A;  4BJP A;  4DDS A;  5FDH A;  5FAS A;  2JCH A;  2Y2I A;  4LCL A;  1IYP A;  4GOG A;  3TOI A;  1K55 A;  1PWC A;  2WK0 A;  3MXS A;  3ZVT A;  3SH9 A;  1CI8 A;  4LV3 A;  3A3D A;  5HAQ A;  4S2L A;  1FCN A;  3UY6 A;  2Y2G A;  4ZTK A;  1KE3 A;  2ZJ9 A;  1ALQ A;  1BLP A;  3RXW A;  4EBL A;  3ZG8 B;  1LLB A;  2X02 A;  4B4X A;  1E3U A;  4E3O A;  1FR1 A;  5E43 A;  4JXW A;  1BUL A;  3FV7 A;  2ZQ8 A;  5FA7 A;  4K91 A;  1BTL A;  4S2N A;  2J9O A;  4BEN A;  3HRE A;  4GN2 A;  5EUA A;  3ZNT A;  1XA1 A;  1ONH A; 
#chains in the Genus database with same CATH topology
 4QWO A;  1E3U D;  3KSF A;  1PW1 A;  5HD5 A;  5HDD A;  2H0Y A;  4P6Z S;  2ZMV A;  3A0R A;  3Q07 A;  4XT2 B;  2Y2L A;  2IWD A;  2HDS A;  2KOI A;  2PR6 A;  1SKF A;  3I7J A;  1Y4O A;  5CX7 A;  3IBR A;  4S2P A;  4KQQ A;  2CMN A;  1IEM A;  2W0N A;  1FCM A;  3NHQ A;  3W4P A;  4YIN A;  3WS5 A;  2A2L A;  1SKO A;  5CGW A;  4JXV A;  3RFB A;  3HUM A;  5F5Y A;  2V1Z A;  2XLN A;  4E6X A;  5HL1 A;  1PZP A;  1XJ4 A;  4X69 A;  4ZJ3 A;  1CI9 A;  4L9G A;  2DCF A;  1MWR A;  2P08 A;  3F1P B;  3IHA A;  3SZT A;  1WYB A;  3LFV A;  1GA9 A;  1GSX A;  1NRF A;  4MN5 A;  3UB7 A;  1W8Q A;  1QMF A;  1FSY A;  3DBA A;  5FQI A;  5F1F A;  4CLC D;  4WZ4 A;  3G2Z A;  4BMW A;  2GJ3 A;  1CEF A;  1G28 A;  5M19 A;  3BJN A;  2HP5 A;  3D72 A;  3JVV A;  1H0M A;  2KDK A;  5J4E A;  3OPR A;  2BTF P;  3TRC A;  2LB5 A;  4WMC D;  3V39 A;  1BYW A;  4S2O A;  3V50 A;  5LBR A;  1N9B A;  4HY8 A;  4R3J A;  1MC0 A;  4G3K A;  2EX2 A;  3PYP A;  4GDN A;  4MNR A;  4YFM A;  1K56 D;  2Y8H A;  5FI2 A;  3T4K A;  2CC1 A;  2WYX A;  3O3V A;  3LID A;  2ACG A;  4LRX C;  1ESU A;  1Y28 A;  2Y2N A;  1IKG A;  2XRN A;  3LGO A;  3W8K A;  1OTE A;  3E98 A;  4I38 A;  4BD0 A;  3K2N A;  4ESP A;  3IBJ A;  1SHV A;  2RL3 A;  2A24 A;  5GHZ A;  2H5S A;  3DTI A;  1YLJ A;  4DXB A;  4UEY A;  4OQH A;  4KG2 A;  3RTY A;  2PT7 A;  5DVA A;  4FD8 A;  1PFL A;  1AWI A;  3IXG A;  3CJM A;  1P9R A;  5CHM A;  1ES3 A;  1NXY A;  4UA9 A;  1G5U A;  3HUN A;  3GVB A;  5J8X A;  5HAI A;  2Y2O A;  3JPU A;  3UE6 A;  5DF9 A;  5E2H A;  4G3V A;  3IF6 B;  2GZA A;  2ZC5 B;  4ETZ A;  2JE5 A;  4HBU A;  3M6B A;  3U4L P;  1ZC2 A;  3BY9 A;  5CHU A;  4DF6 A;  4UQI M;  5TBM B;  5FQ9 A;  2ZQA A;  2WKE A;  1FCO A;  2UV0 E;  1ES2 A;  3B47 A;  4E3J A;  3TE8 A;  1EI5 A;  4HES A;  4Y3I A;  3MKE A;  1OTD A;  3T12 B;  4KZ6 A;  4HHD A;  1MZU A;  2GDN A;  3VOY A;  3BM6 A;  5CTN A;  2WUQ A;  4WM9 A;  3V67 A;  3NDE A;  2ZMF A;  2XA7 M;  3WS0 A;  1NZU A;  5CEB A;  1I5Q A;  3ZHH A;  5A90 A;  3C5A A;  4EET B;  3QP2 A;  1W79 A;  4ZBE A;  2A49 A;  4Y13 A;  2PBY A;  2L0W A;  1G68 A;  2BLS A;  1S4R A;  4KG6 A;  2V8C A;  3NI9 A;  5KSC A;  4XUZ A;  2PD7 A;  3O5Y A;  2ZQ9 A;  4EV4 A;  1NY0 A;  3L9K A;  3R7W B;  2V20 A;  4NXF A;  1KVM A;  3ICY A;  2O9B A;  1YT4 A;  1LI9 A;  5HD3 A;  5I5L A;  3SOI A;  4FSF A;  1M6K A;  3HBR A;  1WE4 A;  1K54 C;  5FEF A;  2ZC7 A;  2WKP A;  3P7N A;  3C7V A;  4NXE A;  5DFX A;  4KUK A;  4B9O A;  3CMZ A;  1JVJ A;  3LI8 A;  1GSW A;  4KEN B;  2W3D A;  4DJ3 A;  3EGX C;  1S1Y A;  3PAG A;  4LV0 A;  5HL6 A;  3T4Q A;  4E3I A;  3ZG5 A;  3HJK A;  1GHP A;  4UA7 A;  3PXP A;  1ACF A;  4RQ9 A;  3LI9 A;  4ZJ1 A;  1YMX A;  2G2U A;  4EBP A;  3T4O A;  3IX3 A;  5U47 A;  2PU4 A;  4E6W A;  4ZAM A;  2X01 A;  3LR3 A;  1BUE A;  3EWK A;  2OAQ 1;  1LSW A;  1S67 L;  1YLP A;  4X53 A;  3EOI A;  2Y91 A;  4MN6 A;  1BLH A;  2O99 A;  4UAA A;  4N1X A;  4KZB A;  3LR0 A;  4FUW A;  4L9E A;  1I2S A;  3VV4 A;  1Q2Q A;  2B18 A;  4D60 A;  4OOL A;  3EGD C;  4S2K A;  3MBZ A;  2W1T B;  3ZVW A;  4FCF A;  2W3F A;  4KZ8 A;  4B4Z A;  5I94 A;  1YLZ A;  4ETX A;  5A93 A;  2ZQC A;  4C75 A;  1OTA A;  1W5D A;  2INW A;  2WZZ A;  1XJ3 A;  3KO6 A;  1ZHH B;  4B88 A;  5F82 A;  4HIA A;  3HLB A;  4IVK A;  2XR0 A;  3NIA A;  4S2I A;  4K0W A;  1XJ6 A;  3KSH A;  1KE4 A;  2Y2Q A;  2L4R A;  4CLC C;  3CG5 A;  1G6A A;  5GLB A;  5M1A A;  2VLG A;  4GS9 A;  2FFF B;  5CGX A;  4GOG A;  3UB6 A;  3TOI A;  3MXS A;  3FG8 A;  1T1B A;  3CLO A;  3BQA A;  1KE3 A;  2ZJ9 A;  3E4Q A;  4EBL A;  1DRM A;  2ZQ8 A;  3LR4 A;  1BTL A;  4Q0J A;  4DJ2 A;  4GN2 A;  2JHE A;  1V9Y A;  5TR7 A;  4PMA A;  2E8I A;  5AQ7 A;  1DP9 A;  1N9O A;  1YM1 A;  3D3O A;  1HZO A;  5GL9 A;  4IBR A;  3IWI A;  4C3Q A;  2VV8 A;  3SH7 A;  4L9F A;  3S7N A;  3NJA A;  1ERO A;  1XXM A;  4EU0 A;  5EPH A;  2VA0 A;  1ES4 A;  5C5K A;  4GKU A;  1L0F A;  5MC7 A;  1K57 A;  3DTM A;  4CLC E;  2W3E A;  5L2F A;  2R9W A;  3A3E A;  3BQ8 A;  2VGL M;  5CEC A;  4YNR A;  3BLS A;  4EW7 A;  4GW9 A;  1OPX A;  4OQG A;  1ONG A;  1XFN A;  4NXG A;  4WEJ A;  3MFX A;  4NEE D;  2A24 B;  5GLC A;  1XKZ A;  1N9N A;  3ZNY A;  5KZH A;  2XFT A;  1LSV A;  4R4S A;  3MMH A;  3LIB A;  3H7W A;  3HCY A;  3IT9 A;  1TEM A;  3ZCZ A;  4IED A;  4LCM A;  4JLF A;  1PIO A;  2NUP C;  4WLA A;  2JKR I;  2C5W B;  1OJ5 A;  3GMW A;  3PAE A;  3AGF A;  3CAX A;  3IX8 A;  2XH9 A;  2Y4A A;  1JNU A;  1H5X A;  5FAP A;  1PWG A;  1SCW A;  3BW6 A;  3OPL A;  5F6A A;  4E3M A;  1JTD A;  2WZX A;  2E8J A;  4GNU A;  3NOU C;  3LIF A;  3BFG A;  3OPH A;  3MF0 A;  4FOF A;  1XP4 A;  3S7Q A;  4R3A A;  4NK3 A;  4R0Q A;  4OH0 A;  3UPN A;  1BSG A;  1MPL A;  4EQI A;  3B3X A;  3MQO A;  1Y54 A;  1YQS A;  1LL5 A;  2V0W A;  4DKI A;  1H8Z A;  4Y0U A;  4B93 A;  5GHY A;  3WS1 A;  4M4X A;  1LT0 A;  3D4F A;  1IYS A;  2FH5 A;  3NEC A;  4PPR A;  4Z9Q A;  1J3W A;  2OOL A;  1MKI A;  2Y2K A;  3LO7 A;  4H8R A;  4MN7 A;  4WL9 A;  3C4P A;  4P6B A;  3BWL A;  4HP9 A;  4IVI A;  4DN0 A;  4EQ1 A;  4RA7 A;  5G4Y A;  4HH3 A;  3ISG A;  1L3L A;  5HPI A;  1PW8 A;  1IEL A;  4H6J A;  4U3T A;  2JC7 A;  4O7D A;  3ULF A;  5IU1 A;  2G2W A;  5EOO A;  5HZH A;  1ES5 A;  4MLL A;  4NET A;  1GCE A;  4BBU A;  3G4P A;  1S0W A;  4OPR A;  3GV9 A;  4JXS A;  1K0K A;  4PM6 A;  3H82 A;  4GHI A;  4MBF A;  2K2N A;  4DXC A;  1JWP A;  5CRF A;  5HPF A;  2VV6 A;  3GEC A;  1DJA A;  2K7S A;  1K25 A;  4HJ6 A;  1TS7 A;  4LEN A;  4WUJ A;  4HEF A;  1MY8 A;  3LY3 A;  3E4P A;  1BLC A;  2J7V A;  1SZV A;  5GLA A;  5FEG A;  3MR0 A;  4JPM A;  4KZA A;  2K31 A;  5DJT A;  1VET A;  4Y17 A;  5FAT A;  2WGW A;  3T4T A;  2V0U A;  3FC7 A;  5HDC A;  3PBO A;  3S7O A;  2QMI A;  1MKM A;  2P9V A;  3MXQ A;  3LIE A;  4Y2F A;  3S1Y A;  4KZ4 A;  1YKD A;  1DJC A;  2DMW A;  4HI4 A;  4PM7 A;  4X1L A;  3ZYT A;  4GB7 A;  4I3A A;  3T1X A;  2JKG A;  2HV1 A;  2JKF A;  4CJN A;  3BEB A;  2ZC4 B;  3E0Y A;  3ZDJ A;  3LEZ A;  3NOT C;  5L10 A;  1KDW A;  4OON A;  4XUX A;  4K08 A;  3IWO A;  1K4E A;  3FKW A;  2PYR A;  1YSP A;  4JGO A;  3KYQ A;  4ID4 A;  1TDL A;  4EUV A;  1MXO A;  1ZKJ A;  3VP0 A;  2B95 A;  5FL3 A;  2OSU A;  1U60 A;  2WGV A;  2J8Y A;  1NWZ A;  1NYM A;  3UE3 A;  5HWW A;  3QNB A;  4CPK A;  4HOI A;  3QP6 A;  3IX4 A;  3VOL A;  5GHX A;  1K6R A;  4OP5 A;  5TJJ A;  4DDY A;  2XGN A;  3WRZ A;  1D7E A;  3IXB A;  4I5S A;  3OOV A;  3VSK A;  1KE0 A;  3JVU A;  3QP1 A;  4GS9 B;  4S2M A;  5K5B A;  1CF0 A;  3W4O A;  4YOF A;  2J3T D;  1W63 Q;  5CGS A;  3GRJ A;  4MDZ A;  2QJ7 A;  5JYO A;  2O9A A;  5TFQ A;  3IS2 A;  3P98 A;  4EES A;  2OAP 1;  4BBV A;  4EEP A;  3FPW A;  1T18 A;  2HGV A;  5E2G A;  5L8M A;  3H9W A;  1YPR A;  1Z09 A;  1W63 M;  2IWC A;  4PHT A;  4PM9 A;  2H10 A;  3UNW A;  1YLT A;  4G3W A;  2HJ9 C;  5EVI A;  5HX9 A;  4QJG A;  2FFY A;  4JGR A;  4JF4 A;  3HLC A;  5L07 A;  3NBL A;  1GHM A;  5FI7 A;  4EER A;  1IKI A;  3UO9 A;  1K54 A;  3VFF A;  4PAU A;  1K38 A;  4HBT A;  4O0P A;  4QPR A;  4DMZ A;  4OKP A;  4LFU A;  5EM0 A;  5EVI C;  1RP5 A;  4EUZ A;  4BD1 A;  4X56 A;  3MSH A;  3NOP C;  5A91 A;  3BLM A;  3KSG A;  3N8S A;  2Q9M A;  5EE8 A;  4GCZ A;  4PKY G;  2Q9N A;  5FDH A;  1IYP A;  1K55 A;  3C30 A;  3ZVT A;  1CI8 A;  3UY6 A;  2Y2G A;  4ZTK A;  3D9Y A;  2ZBB A;  2EA9 A;  2X02 A;  1E3U A;  4B4X A;  4E3O A;  5FA7 A;  4S2N A;  3MQ0 A;  1OME A;  2OLU A;  1XGJ A;  1HVB A;  4X68 A;  1TVF A;  2BAS A;  5CHJ A;  4Y0T A;  2EX8 A;  5HDS A;  4UQI S;  5EEC A;  1K55 C;  4E04 A;  3QP8 A;  3HLD A;  3IXH A;  2V1B A;  3SS5 A;  3DAV A;  2D02 A;  2KX6 A;  2EX6 A;  5EOE A;  4S2N C;  4UHU A;  4N9L A;  4DE3 A;  3V5M A;  3MJQ A;  4RX2 A;  4MMN A;  5DTT A;  4LV1 A;  2VK3 A;  1H8Y A;  3Q82 A;  4HNB A;  1ZTU A;  3TW8 A;  3F1N A;  1LI0 A;  2J3W A;  2XA7 S;  3RH8 B;  4E3K A;  2Y2P A;  2JKT I;  4DE2 A;  2PBD P;  3PR6 A;  4DRT A;  2HP9 A;  2ZOI A;  2WKR A;  2YKH A;  4S2J A;  1PZO A;  5DTK A;  2H0T A;  3UPP A;  1F2K A;  4CLC A;  1TS8 A;  4LGW A;  4NXB A;  5EV0 A;  4X6T A;  3SH8 A;  5FSR A;  4IBX A;  2EFX A;  2R9X A;  3C4O A;  4BL2 A;  3LR5 A;  4OOY A;  5A8B A;  1KGG A;  1DJB A;  1YLY A;  3VP2 A;  1LL9 A;  5DKK A;  3VE3 A;  3T4J A;  4WMC A;  1T19 A;  4H6J B;  4FH4 A;  2KLI A;  1Z6F A;  4EBN A;  4GZB A;  2P74 A;  3G32 A;  3S22 A;  1K56 A;  3HLG A;  5EFW A;  1SKO B;  1F5M A;  4OVD A;  4JF5 A;  1P97 A;  3H82 B;  4GHI B;  1G6O A;  4PM5 A;  4NKP A;  3ZFZ A;  3CPT A;  4MCW A;  1MWS A;  1AXB A;  4X25 A;  5F68 A;  5M18 A;  2OV5 A;  4ZDX A;  1FIK A;  1S66 L;  3L7H A;  3N8L A;  4QB8 A;  3P01 A;  5TBM A;  4HH2 A;  1VET B;  1P0Z A;  2PRF A;  5CER A;  2B5R A;  3BFE A;  2H28 A;  1M40 A;  1RGY A;  4BQM A;  4QY5 A;  3UDX A;  4OLD A;  2P9V B;  4FTX A;  4Y15 A;  3Q7V A;  2M7U A;  3HLE A;  5KMW A;  4WF0 A;  3ITB A;  4LRZ E;  2WAE A;  4QD4 A;  1A0K A;  1KVL A;  3MZD A;  2JKT M;  5EVE A;  4QHC A;  4R70 A;  1BT5 A;  3C7U A;  4EEU A;  1FR6 A;  2EXB A;  2QZ6 A;  3BFD A;  1JWZ A;  1TS6 A;  4R3B A;  1BLS A;  3HLW A;  2M1C A;  3PBT A;  3VE4 A;  3FYZ A;  3NC8 A;  1D06 A;  2QJ5 A;  1CQA A;  5CXW A;  4P6Z M;  3UDI A;  4A5R A;  3UN7 A;  4F3L A;  1GSV A;  5DF7 A;  3KYZ A;  1UGU A;  5HSQ A;  3M2J A;  3NUL A;  5EVL A;  2EFU A;  2Y55 A;  1PI5 A;  3V3S A;  3GTC A;  4C6Y A;  2VJW A;  1IYQ A;  5CTM A;  2HDR A;  1W8Y A;  4QU3 A;  2J3T C;  4BBT A;  1WYC A;  3HVF A;  4KZ5 A;  1XA7 A;  4GD6 A;  2M7V A;  1VB6 A;  3C8C A;  4OQI A;  4I3I A;  5AJG A;  5DFY A;  4BWI A;  3A3J A;  1BZA A;  2WGI A;  3G30 A;  4WN5 A;  2W3G A;  1N4O A;  2VV7 A;  2XRO A;  1ESI A;  2VGJ A;  3LEQ A;  1LL8 A;  5F69 A;  1IYO A;  2QYB A;  1OT6 A;  1YLW A;  1ZG6 A;  2V2F F;  2P04 A;  4DE1 A;  2PAV P;  3FPV A;  2Z2L B;  1GHI A;  5TGF A;  1J9M A;  3TSG A;  3UB5 P;  4ARZ A;  4D2O A;  1KOU A;  4MEZ A;  1NJ4 A;  3GDI A;  2D01 A;  3IS2 B;  4WEK A;  1NLZ A;  3CIT A;  4OLG A;  1WA9 A;  3PBR A;  3S7P A;  2VGK A;  3CZD A;  3NDG A;  3UME A;  3B33 A;  3G6O A;  4Y7P A;  3FZC A;  2ZOH A;  2OWH A;  3CUE A;  1F98 A;  3IH8 A;  2XD5 A;  3DWZ A;  3WWX A;  2J80 A;  3AGE A;  4OPQ A;  3CHW P;  5IS1 A;  5EVI B;  2ZLY A;  2WKI A;  1HTZ A;  4KG5 A;  5IT5 A;  2RCX A;  3U2A A;  2Y2M A;  3HL9 A;  1CEG A;  3IH9 A;  2VGL S;  2B02 A;  2W1T A;  3M6H A;  1K6S A;  4F94 A;  2DNS A;  1TD5 A;  2I9V A;  5AQB A;  3CUE C;  3T4S A;  5J7E A;  3T1R A;  1PI4 A;  3OLO A;  3SW1 A;  1DP8 A;  4OQ0 A;  3NY4 A;  1TF1 A;  3UB8 A;  3SS4 A;  5JYP A;  2Y2H A;  1L2S A;  5DF8 A;  4KZ3 A;  3VFH A;  4AFI A;  5HW3 A;  2Y79 A;  1T1C A;  1SDE A;  3UE1 A;  1CJF A;  2ZM2 A;  3W2Z A;  2A3U A;  3UPO A;  4GDB A;  2Z6D A;  2JKR M;  2ZMA A;  4IHQ A;  5FQJ A;  1PNE A;  3N4I A;  2EXA A;  5FAQ A;  2LB9 A;  4HJ4 A;  2XQZ A;  3PBQ A;  1S4S A;  1NRJ A;  2IA2 A;  1H8M A;  2J9P A;  5HWV A;  3OBF A;  3LIC A;  3Q1F A;  3CWF A;  1H3Q A;  5FAO A;  1D1J A;  1I2W A;  2O9C A;  3JYI A;  2PDR A;  1ERM A;  4Z1W A;  2V1A A;  4Q0H A;  3BRM A;  5E2F A;  5F1G A;  1C3B A;  3VOZ A;  4P0M A;  3N7W A;  3BFF A;  4OPY A;  5CED A;  4MBK A;  2YKF A;  1KGE A;  3F1N B;  3VP3 A;  1KGF A;  4EWF A;  1LSX A;  4IUH A;  4M3K A;  3QP5 A;  1RGZ A;  4DDS A;  2JCH A;  1F9I A;  5HAQ A;  1FCN A;  2V9A A;  1ALQ A;  4CQH A;  1LLB A;  4CLC B;  4JXW A;  1BUL A;  5G4Z A;  5FDS A;  4BEN A;  3HRE A;  4I39 A;  3DTK A;  3IQA A;  2C6W B;  1UWP X;  3EEA A;  3EQU A;  3MS6 A;  4OP8 A;  5AQ9 A;  4E3L A;  4NG2 A;  1FOF A;  3PBS A;  1W7F A;  2R78 A;  4MBH A;  4JF6 A;  4KQR A;  4KQD A;  4R6L A;  4XXR A;  1PRQ A;  2OWJ A;  1L0D A;  3E4O A;  3G34 A;  5IHV A;  4WEL A;  5AVE A;  1V9Z A;  4HJ3 A;  3LIA A;  1QME A;  3RXX A;  3VSL A;  3Q81 A;  5GLD A;  1CK3 A;  1OT9 A;  2ZM8 A;  1FQG A;  2WKQ A;  3LYX A;  1TS0 A;  2ZQ7 A;  5FI6 A;  3TJZ C;  3CPT B;  4KQO A;  3BY8 A;  2QKP A;  3C2W A;  1VEU A;  3GSG A;  3EEH A;  4KZ9 A;  5DJU A;  3PTE A;  3RJU A;  3HJI A;  1MWT A;  5D3O A;  3F1O A;  3GQZ A;  4P87 A;  1S1Z A;  2ZL1 A;  1TDG A;  4HP4 A;  3HUO A;  4Y0O A;  3K3C A;  3Q7V B;  2WAD A;  3KYE A;  3M2K A;  2EWV A;  4LPZ A;  2MJ6 A;  1YAX A;  3IWQ A;  1YSQ A;  3PHY A;  5A92 A;  2IWB A;  4XT2 A;  4JKT A;  4X1M A;  3UE0 A;  2XD1 A;  3ZG7 B;  4O8G A;  3WS2 A;  2GNX A;  5KSH A;  2ZD8 A;  2AVX A;  3E2L A;  4PKY A;  3G35 A;  1HD8 A;  5G18 A;  1XJ2 A;  4F3L B;  1OJG A;  2VX8 A;  1SDN A;  3T1S A;  4Y5F A;  2XDM A;  3H7W B;  4UA6 A;  2VZW A;  3G2Y A;  3UMD A;  3A3F A;  3GR2 A;  1DP6 A;  4BL3 A;  5KIZ A;  5E2E A;  1O07 A;  2PYP A;  4EXO A;  1UWN X;  5FQK A;  3OPP A;  3QP4 A;  1OTB A;  4R1G A;  1NYY A;  3O86 A;  3Q7Z A;  4WYY A;  4ME4 A;  3EQV A;  4IUK A;  4GLQ A;  5L09 A;  3T50 A;  3F1P A;  2HDU A;  2ZM0 A;  5EM1 A;  4GD8 A;  4WZ5 A;  1ZG4 A;  3DW0 A;  3O87 A;  2ZC3 B;  3A0S A;  2VKS A;  2V8F A;  1FIL A;  1YMS A;  4ARZ B;  1T1A A;  1XPB A;  3OCN A;  2PU2 A;  3ITA A;  1HLU P;  4RVA A;  3AGD A;  1OTI A;  3MFD A;  3W4Q A;  3BEC A;  4O01 A;  4BLM A;  3MZE A;  4WZ5 C;  3T4L A;  1Q2P A;  3WRT A;  3N8R A;  3SS3 A;  2DRW A;  2I72 A;  5BOH A;  2EX9 A;  5AVF A;  2VEA A;  5FQM A;  2Y2J A;  4K0X A;  3G31 A;  1IFQ A;  4JBF A;  3VP4 A;  4KUO A;  4N92 A;  3FKV A;  2WKH A;  5DKL A;  4N1H A;  1KDS A;  1PWD A;  2XSS A;  3E2K A;  1EW0 A;  3ZG0 A;  3QNC A;  3ZG9 B;  3CI6 A;  1ODV A;  3KSI A;  4LLO B;  4N9K A;  2PR5 A;  2HP6 A;  2OLV A;  2PD8 A;  2W1R A;  1PYY A;  2W3H A;  3ZGA B;  3S4X A;  2EWW A;  1L0E A;  1VM1 A;  3C38 A;  5HAP A;  3HLF A;  4YWZ A;  4Q0I A;  3LCE A;  2QPN A;  4L0L A;  5FQQ A;  2PHY A;  1VHM A;  1EWZ A;  2HDQ A;  2Y59 A;  3IF6 A;  1IOU A;  4ZJ2 A;  4R4R A;  4JXG A;  3MKF A;  1E4D A;  2X71 A;  3VMA A;  2WAF A;  2Z2M B;  4I3J A;  1MWU A;  2WGW B;  3ZQ5 A;  3TG9 A;  1STZ A;  4PM8 A;  3K3D A;  1E25 A;  1XGI A;  4RYE A;  3IF6 C;  1MBL A;  3V3R A;  2GX5 A;  5J3W A;  3A3I A;  3N6I A;  4FH2 A;  3DWK A;  2HJE A;  2Z6C A;  4R23 A;  3VP1 A;  4OOM A;  3UB9 A;  3MZF A;  1NLY A;  3QHY A;  2JBF A;  3BYD A;  1VQQ A;  3MQQ A;  3NCK A;  1GA0 A;  4U0T A;  3OCL A;  1L0G A;  2HPB A;  3LY4 A;  4LV2 A;  1FSW A;  2P7J A;  3R4K A;  2NUT C;  4LRY C;  1N9L A;  1JWV A;  4OPZ A;  3IF5 A;  4P85 A;  2ZQD A;  3R7W A;  3T1Q B;  3A0V A;  2ZC6 B;  3O88 A;  4II7 A;  1XX2 A;  2BG1 A;  2UWX A;  1O7E A;  3OZH A;  4E3N A;  3KX0 X;  1K57 C;  1LHY A;  3DTE A;  5DTS A;  2XEP A;  1ERQ A;  5HWT A;  4Q8I A;  2L1M A;  5F83 A;  5HAR A;  3FWL A;  2JN7 A;  4QY6 A;  1S6R A;  4WBG A;  4RX3 A;  2HZ5 A;  4X55 A;  2XK1 A;  2HF6 A;  4KZ7 A;  5EVI D;  5HFO A;  1DY6 A;  4R38 A;  3WS4 A;  3MXR A;  3BFC A;  4JGQ A;  2XF3 A;  4DE0 A;  2XFS A;  4IJG A;  3IXD A;  1NZO A;  1X0O A;  1VEU B;  4HQA A;  2W27 A;  4ZRR A;  5AQA A;  4U0X A;  1JTG A;  3IHB A;  3P09 A;  4GJ4 A;  3UDF A;  1K4F A;  1RCJ A;  3OC2 A;  3PBN A;  3B42 A;  4BJP A;  5FAS A;  2Y2I A;  4LCL A;  1PWC A;  2WK0 A;  2FZ0 A;  3SH9 A;  4LV3 A;  3A3D A;  4S2L A;  3F1O B;  2O0Y A;  1P9W A;  3LUQ A;  1BLP A;  2Q0O A;  3RXW A;  3ZG8 B;  2QWS A;  1XFQ A;  1FR1 A;  5E43 A;  4JGP A;  3FV7 A;  2ZL1 B;  4K91 A;  2G7U A;  2J9O A;  2QHK A;  5EUA A;  3ZNT A;  1XA1 A;  1ONH A; 
#chains in the Genus database with same CATH homology
 1OME A;  5TR7 A;  4PMA A;  2OLU A;  3IQA A;  1XGJ A;  2E8I A;  5AQ7 A;  2C6W B;  1E3U D;  3EQU A;  1HVB A;  4X68 A;  1TVF A;  4OP8 A;  5CHJ A;  1YM1 A;  5AQ9 A;  4E3L A;  4Y0T A;  1HZO A;  2EX8 A;  1PW1 A;  5GL9 A;  5EEC A;  1K55 C;  4IBR A;  3IWI A;  1FOF A;  3HLD A;  3IXH A;  3PBS A;  1W7F A;  4C3Q A;  3SS5 A;  2H0Y A;  3SH7 A;  3Q07 A;  4MBH A;  4JF6 A;  4KQR A;  1ERO A;  1XXM A;  4XXR A;  2Y2L A;  2IWD A;  5EPH A;  2HDS A;  1L0D A;  2EX6 A;  5EOE A;  3G34 A;  1ES4 A;  5IHV A;  4GKU A;  1L0F A;  4S2N C;  1SKF A;  4UHU A;  1K57 A;  4WEL A;  3I7J A;  4N9L A;  3DTM A;  4S2P A;  4KQQ A;  4DE3 A;  3V5M A;  1IEM A;  1QME A;  3RXX A;  3VSL A;  4RX2 A;  3Q81 A;  5GLD A;  5L2F A;  1CK3 A;  2ZM8 A;  1FCM A;  1FQG A;  2R9W A;  3A3E A;  5FI6 A;  2ZQ7 A;  5DTT A;  4KQO A;  4LV1 A;  5CEC A;  1H8Y A;  3Q82 A;  3BLS A;  4YIN A;  3W4P A;  3GSG A;  3WS5 A;  1LI0 A;  4OQG A;  4KZ9 A;  1ONG A;  3PTE A;  4E3K A;  5CGW A;  3RJU A;  2Y2P A;  4JXV A;  4DE2 A;  4WEJ A;  3HUM A;  4DRT A;  1MWT A;  2V1Z A;  2XLN A;  2HP9 A;  5D3O A;  5GLC A;  1XKZ A;  4E6X A;  3ZNY A;  5KZH A;  2XFT A;  5HL1 A;  1PZP A;  4X69 A;  4S2J A;  1PZO A;  4R4S A;  4ZJ3 A;  1CI9 A;  5DTK A;  3GQZ A;  2H0T A;  3UPP A;  4P87 A;  2DCF A;  1TDG A;  3HUO A;  3IT9 A;  1MWR A;  4X6T A;  4Y0O A;  3IHA A;  3SH8 A;  1TEM A;  1WYB A;  3ZCZ A;  1GA9 A;  5FSR A;  4IBX A;  2EFX A;  3Q7V B;  2R9X A;  4IED A;  4LCM A;  4JLF A;  1PIO A;  1NRF A;  3C4O A;  4BL2 A;  4OOY A;  1W8Q A;  2WAD A;  1QMF A;  1FSY A;  5FQI A;  1KGG A;  5F1F A;  1DJB A;  3M2K A;  4WZ4 A;  3G2Z A;  1YLY A;  3VP2 A;  1LL9 A;  1CEF A;  5M19 A;  4WMC A;  2HP5 A;  3IWQ A;  2C5W B;  3GMW A;  4FH4 A;  5A92 A;  3PAE A;  2IWB A;  3OPR A;  3AGF A;  1Z6F A;  2XH9 A;  2Y4A A;  4GZB A;  4EBN A;  1H5X A;  2P74 A;  4JKT A;  5FAP A;  1PWG A;  1SCW A;  4WMC D;  3UE0 A;  3OPL A;  2XD1 A;  3G32 A;  3ZG7 B;  3S22 A;  1K56 A;  3V39 A;  3WS2 A;  4S2O A;  3HLG A;  1JTD A;  4E3M A;  5KSH A;  2ZD8 A;  2WZX A;  3V50 A;  1N9B A;  3E2L A;  4GNU A;  4OVD A;  4JF5 A;  4R3J A;  3G35 A;  3BFG A;  3OPH A;  2EX2 A;  1HD8 A;  5G18 A;  4GDN A;  1XP4 A;  4MNR A;  4YFM A;  4PM5 A;  1K56 D;  5FI2 A;  3ZFZ A;  1MWS A;  1AXB A;  1SDN A;  4NK3 A;  4R0Q A;  4OH0 A;  2XDM A;  2CC1 A;  2WYX A;  3O3V A;  3UPN A;  5M18 A;  1BSG A;  2OV5 A;  4ZDX A;  4UA6 A;  3G2Y A;  3A3F A;  1ESU A;  1MPL A;  3GR2 A;  3B3X A;  3N8L A;  4QB8 A;  2Y2N A;  5E2E A;  1O07 A;  4BL3 A;  4EQI A;  1Y54 A;  1IKG A;  3W8K A;  5FQK A;  1YQS A;  1LL5 A;  3OPP A;  4DKI A;  5CER A;  4BD0 A;  1H8Z A;  4Y0U A;  4R1G A;  1SHV A;  2RL3 A;  5GHY A;  2B5R A;  1NYY A;  3WS1 A;  5GHZ A;  2H5S A;  3BFE A;  1YLJ A;  4DXB A;  3O86 A;  3Q7Z A;  4WYY A;  1M40 A;  3D4F A;  1RGY A;  3EQV A;  4OQH A;  4BQM A;  1IYS A;  4KG2 A;  4QY5 A;  4PPR A;  4Z9Q A;  1MKI A;  2Y2K A;  5DVA A;  4OLD A;  3LO7 A;  3UDX A;  2P9V B;  4H8R A;  3C4P A;  4P6B A;  4FD8 A;  2HDU A;  3IXG A;  2ZM0 A;  3CJM A;  3Q7V A;  4IVI A;  5CHM A;  1ES3 A;  3HLE A;  5KMW A;  3ITB A;  4GD8 A;  4WZ5 A;  1NXY A;  4RA7 A;  2WAE A;  4QD4 A;  1ZG4 A;  3DW0 A;  3O87 A;  3ISG A;  4UA9 A;  1KVL A;  1PW8 A;  3HUN A;  2ZC3 B;  3GVB A;  3MZD A;  5J8X A;  5HAI A;  2Y2O A;  1IEL A;  5DF9 A;  5E2H A;  4U3T A;  3IF6 B;  1YMS A;  2JC7 A;  4O7D A;  2ZC5 B;  4QHC A;  1XPB A;  2G2W A;  2JE5 A;  3OCN A;  4HBU A;  5EOO A;  2PU2 A;  3ITA A;  1BT5 A;  3C7U A;  4RVA A;  1FR6 A;  3AGD A;  2EXB A;  2QZ6 A;  1ES5 A;  3M6B A;  3BFD A;  4MLL A;  1ZC2 A;  1JWZ A;  4NET A;  4R3B A;  3MFD A;  1GCE A;  5CHU A;  3W4Q A;  4DF6 A;  3G4P A;  3BEC A;  1BLS A;  1S0W A;  3HLW A;  3MZE A;  3PBT A;  4BLM A;  4OPR A;  3GV9 A;  4JXS A;  3FYZ A;  3NC8 A;  4PM6 A;  5CXW A;  4WZ5 C;  5FQ9 A;  1Q2P A;  3UDI A;  4MBF A;  2ZQA A;  2WKE A;  3WRT A;  4A5R A;  4DXC A;  1FCO A;  3UN7 A;  1JWP A;  1ES2 A;  3N8R A;  3SS3 A;  4E3J A;  5CRF A;  2DRW A;  2I72 A;  5DF7 A;  5BOH A;  1DJA A;  1K25 A;  2EX9 A;  1EI5 A;  4LEN A;  4HES A;  3M2J A;  5EVL A;  3MKE A;  2EFU A;  2Y55 A;  1PI5 A;  5FQM A;  4HEF A;  1MY8 A;  3LY3 A;  3GTC A;  3V3S A;  2Y2J A;  4K0X A;  3G31 A;  4C6Y A;  1BLC A;  4JBF A;  1IYQ A;  2J7V A;  5CTM A;  2HDR A;  1W8Y A;  4KZ6 A;  4QU3 A;  3VP4 A;  5GLA A;  4N92 A;  1WYC A;  3HVF A;  4JPM A;  4KZ5 A;  3FKV A;  4KZA A;  1XA7 A;  2GDN A;  2WKH A;  3BM6 A;  3VOY A;  4N1H A;  4GD6 A;  1KDS A;  4OQI A;  5CTN A;  5FAT A;  2WGW A;  1PWD A;  3E2K A;  3ZG0 A;  3QNC A;  2WUQ A;  3ZG9 B;  4WM9 A;  3A3J A;  3PBO A;  4N9K A;  3NDE A;  1BZA A;  2HP6 A;  2OLV A;  2WGI A;  3G30 A;  3WS0 A;  1N4O A;  1NZU A;  1PYY A;  3ZGA B;  5CEB A;  2QMI A;  1I5Q A;  1ESI A;  2VGJ A;  3S4X A;  2P9V A;  1L0E A;  1VM1 A;  3ZHH A;  5A90 A;  5HAP A;  1IYO A;  3C5A A;  3HLF A;  3LCE A;  2QPN A;  4L0L A;  3S1Y A;  1YLW A;  1ZG6 A;  4KZ4 A;  1W79 A;  1DJC A;  4ZBE A;  5FQQ A;  4PM7 A;  2V2F F;  4DE1 A;  2A49 A;  4GB7 A;  2PBY A;  1G68 A;  2BLS A;  2Z2L B;  1GHI A;  4CJN A;  3BEB A;  1J9M A;  2ZC4 B;  4KG6 A;  5TGF A;  1EWZ A;  3TSG A;  3NI9 A;  2HDQ A;  2Y59 A;  3LEZ A;  3ZDJ A;  5KSC A;  3IF6 A;  4XUZ A;  4D2O A;  4ZJ2 A;  1KDW A;  4OON A;  4MEZ A;  4R4R A;  1NJ4 A;  2ZQ9 A;  3IWO A;  4JXG A;  4XUX A;  1K4E A;  4EV4 A;  3FKW A;  3MKF A;  1NY0 A;  4WEK A;  1E4D A;  2V20 A;  4ID4 A;  1KVM A;  2X71 A;  1TDL A;  3VMA A;  4OLG A;  3PBR A;  1YT4 A;  1MXO A;  2WAF A;  1LI9 A;  2VGK A;  3CZD A;  3NDG A;  2Z2M B;  3SOI A;  1ZKJ A;  4FSF A;  3VP0 A;  1M6K A;  1MWU A;  2WGW B;  3HBR A;  4Y7P A;  3FZC A;  3TG9 A;  2OSU A;  4PM8 A;  1U60 A;  1WE4 A;  1K54 C;  3IH8 A;  1E25 A;  1XGI A;  2XD5 A;  3DWZ A;  2WGV A;  3WWX A;  3AGE A;  2J8Y A;  4OPQ A;  2ZC7 A;  4RYE A;  1NYM A;  5EVI B;  3UE3 A;  3IF6 C;  1MBL A;  2ZLY A;  3V3R A;  3C7V A;  3QNB A;  2WKI A;  1HTZ A;  4KG5 A;  4CPK A;  2RCX A;  3A3I A;  3CMZ A;  2Y2M A;  3HL9 A;  3N6I A;  1JVJ A;  4FH2 A;  5GHX A;  4KEN B;  1CEG A;  3DWK A;  3IH9 A;  1K6R A;  4OP5 A;  3PAG A;  3M6H A;  1K6S A;  4F94 A;  4LV0 A;  4R23 A;  2DNS A;  4E3I A;  5AQB A;  3VP1 A;  4DDY A;  4OOM A;  3ZG5 A;  1GHP A;  2XGN A;  3MZF A;  4UA7 A;  3WRZ A;  4ZJ1 A;  3IXB A;  1YMX A;  2G2U A;  4EBP A;  1PI4 A;  3QHY A;  5U47 A;  2PU4 A;  2JBF A;  3BYD A;  4E6W A;  4ZAM A;  4OQ0 A;  3NY4 A;  2X01 A;  3VSK A;  1VQQ A;  1KE0 A;  1BUE A;  3NCK A;  1GA0 A;  3SS4 A;  5JYP A;  4U0T A;  2Y2H A;  1L2S A;  4S2M A;  3W4O A;  5DF8 A;  4KZ3 A;  3VFH A;  3OCL A;  1YLP A;  1L0G A;  4X53 A;  2HPB A;  3LY4 A;  4LV2 A;  5CGS A;  3GRJ A;  5HW3 A;  2Y91 A;  1FSW A;  1BLH A;  5JYO A;  1SDE A;  3UE1 A;  2ZM2 A;  4UAA A;  5TFQ A;  4N1X A;  1JWV A;  4KZB A;  2A3U A;  4OPZ A;  3IF5 A;  3UPO A;  4GDB A;  4P85 A;  2ZQD A;  3P98 A;  2ZMA A;  1I2S A;  5FQJ A;  3N4I A;  2EXA A;  1Q2Q A;  2ZC6 B;  5FAQ A;  3O88 A;  1XX2 A;  2BG1 A;  2XQZ A;  5E2G A;  4OOL A;  2UWX A;  1O7E A;  3OZH A;  3PBQ A;  4S2K A;  3MBZ A;  4E3N A;  1K57 C;  1LHY A;  2J9P A;  2IWC A;  3ZVW A;  5DTS A;  4FCF A;  4PM9 A;  2H10 A;  3UNW A;  1YLT A;  2XEP A;  4KZ8 A;  1ERQ A;  4B4Z A;  5I94 A;  4Q8I A;  5EVI A;  5F83 A;  5HAR A;  3FWL A;  3Q1F A;  1YLZ A;  4QY6 A;  1S6R A;  5FAO A;  5A93 A;  2ZQC A;  4WBG A;  5HX9 A;  4C75 A;  1W5D A;  1I2W A;  4RX3 A;  2FFY A;  4QJG A;  3JYI A;  2WZZ A;  4X55 A;  1ERM A;  4JF4 A;  4B88 A;  2XK1 A;  3BRM A;  5F82 A;  4KZ7 A;  3HLC A;  5EVI D;  3NBL A;  1GHM A;  5HFO A;  5FI7 A;  3HLB A;  4IVK A;  5E2F A;  1IKI A;  2XR0 A;  5F1G A;  1DY6 A;  3UO9 A;  1C3B A;  3NIA A;  3VOZ A;  1K54 A;  4P0M A;  3WS4 A;  3MXR A;  3VFF A;  3BFC A;  4S2I A;  4K0W A;  3N7W A;  1K38 A;  2XF3 A;  4HBT A;  4DE0 A;  2XFS A;  1KE4 A;  2Y2Q A;  3BFF A;  3IXD A;  4OKP A;  4OPY A;  5CED A;  1NZO A;  5EVI C;  1RP5 A;  4EUZ A;  4BD1 A;  3CG5 A;  1G6A A;  4MBK A;  4X56 A;  5GLB A;  1KGE A;  5M1A A;  5AQA A;  5A91 A;  4U0X A;  1JTG A;  3BLM A;  3N8S A;  3VP3 A;  2Q9M A;  1KGF A;  5EE8 A;  2FFF B;  3IHB A;  4EWF A;  3P09 A;  5CGX A;  4M3K A;  2Q9N A;  3UDF A;  1K4F A;  1RCJ A;  1RGZ A;  3OC2 A;  3PBN A;  4BJP A;  4DDS A;  5FDH A;  5FAS A;  2JCH A;  2Y2I A;  4LCL A;  1IYP A;  4GOG A;  3TOI A;  1K55 A;  1PWC A;  2WK0 A;  3MXS A;  3ZVT A;  3SH9 A;  1CI8 A;  4LV3 A;  3A3D A;  5HAQ A;  4S2L A;  1FCN A;  3UY6 A;  2Y2G A;  4ZTK A;  1KE3 A;  2ZJ9 A;  1ALQ A;  1BLP A;  3RXW A;  4EBL A;  3ZG8 B;  1LLB A;  2X02 A;  4B4X A;  1E3U A;  4E3O A;  1FR1 A;  5E43 A;  4JXW A;  1BUL A;  3FV7 A;  2ZQ8 A;  5FA7 A;  4K91 A;  1BTL A;  4S2N A;  2J9O A;  4BEN A;  3HRE A;  4GN2 A;  5EUA A;  3ZNT A;  1XA1 A;  1ONH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...