4PM5A

Crystal structure of ctx-m-14 s70g beta-lactamase in complex with cefotaxime at 1.26 angstroms resolution
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
263
structure length
263
Chain Sequence
QTSAVQQKLAALEKSSGGRLGVALIDTADNTQVLYRGDERFPMCGTSKVMAAAAVLKQSETQKQLLNQPVEIKPADLVNYNPIAEKHVNGTMTLAELSAAALQYSDNTAMNKLIAQLGGPGGVTAFARAIGDETFRLDRTEPTLNTAIPGDPRDTTTPRAMAQTLRQLTLGHALGETQRAQLVTWLKGNTTGAASIRAGLPTSWTVGDKTGSGDYGTTNDIAVIWPQGRAPLVLVTYFTQPQQNAESRRDVLASAARIIAEGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactamase CTX-M-14
publication title Molecular Basis for the Catalytic Specificity of the CTX-M Extended-Spectrum beta-Lactamases.
pubmed doi rcsb
source organism Klebsiella pneumoniae subsp. pneumoniae
molecule tags Hydrolase/antibiotic
total genus 95
structure length 263
sequence length 263
ec nomenclature
pdb deposition date 2014-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 4pm5A00
3SS3A 4QD4A 2DRWA 1ES5A 1BTLA 1BT5A 1XA7A 2Y59A 1VQQA 2V1ZA 5AQAA 4ZJ3A 1K54A 4KZBA 2FFFB 3IT9A 1JTGA 4JF6A 4IBXA 4WEKA 1K56D 1KVMA 3IF6C 4N9KA 1O7EA 1FCNA 4DE1A 1EROA 2HP5A 2J7VA 4QY5A 1LL9A 1JWZA 4PMAA 5FQJA 5DF9A 5AQ9A 2Z2LB 3BLSA 4EUZA 5CRFA 1NZOA 3P98A 3BFDA 5F83A 2VGJA 1YMSA 2UWXA 3NDEA 3C7VA 3N8LA 4HESA 2ZD8A 1K56A 5FI6A 4BD0A 5KZHA 5CHUA 4IBRA 2ZC4B 3WS5A 1L0DA 4EQIA 2WGWB 2JBFA 2Q9NA 3CMZA 1XXMA 2XEPA 5EPHA 4DDSA 3WS0A 2EXBA 5E2HA 2Y55A 2QZ6A 2XFTA 1DY6A 3MFDA 3S1YA 4EBLA 3N4IA 3C4PA 5M1AA 1FSYA 1N9BA 1IYOA 4OLGA 2GDNA 3HUNA 4MBKA 5E2FA 2J8YA 1YQSA 1MXOA 5CTNA 5FI2A 3WS1A 1MWTA 3FKWA 4OQHA 1W7FA 3IF6A 2VGKA 3HLWA 3M2JA 4OVDA 4P6BA 2ZC7A 4FH4A 1I2WA 3HVFA 2ZM8A 3OC2A 3OZHA 4BJPA 5FASA 1S0WA 3VMAA 2V2FF 1G6AA 4PM8A 5GHZA 1FOFA 2Y91A 1DJCA 1W79A 5D3OA 1LHYA 3HLEA 3QNCA 1PIOA 1BUEA 4MBHA 4QY6A 3ZDJA 4E3KA 4D2OA 3UE1A 4S2OA 3ITAA 3LEZA 5GLDA 4CJNA 1K55C 3W4PA 5EOOA 3BECA 2A49A 4UAAA 5EVLA 2ZQDA 1K38A 1IYQA 3WWXA 1KE0A 3CG5A 1IYPA 3NCKA 4WELA 1J9MA 4EBPA 3A3EA 5AQBA 4QU3A 2WK0A 1TVFA 1OMEA 3HUMA 3RJUA 2Y4AA 3RXWA 2Q9MA 2ZQ9A 4U0TA 3GRJA 4KZ7A 1Q2QA 1XP4A 5GL9A 3IXBA 2ZQ8A 5IHVA 1H8YA 5FQKA 3ZG8B 3ZG0A 5CEDA 5E2GA 1BLCA 3MBZA 5FA7A 2Z2MB 4NETA 4DXBA 5G18A 3E2LA 4S2PA 5EOEA 3SOIA 4PPRA 3HLDA 4GB7A 2IWCA 3PBRA 1KE3A 3PBSA 3MXSA 3UE3A 1VM1A 1K55A 4ZJ1A 1BULA 3GSGA 4E3JA 4E3IA 1L0GA 3UN7A 4HBTA 1W8YA 4OQIA 5FAQA 3S4XA 1RP5A 3Q07A 4JBFA 1DJAA 3E2KA 1H5XA 5GLAA 4UA7A 5CGSA 4B88A 2P9VB 1Q2PA 1NY0A 4OPRA 3HLFA 3AGEA 4IVKA 1ES3A 1XX2A 5HFOA 2FFYA 3SH9A 4OPZA 2EFXA 1NYYA 1PW8A 2XF3A 1L0FA 1SHVA 2Y2OA 3M6BA 3V5MA 3UPNA 1L0EA 3V3RA 1K57C 1MWRA 1U60A 5EUAA 3VP0A 3FV7A 3ZVWA 3Q7VB 4KZ5A 1QMFA 2WKIA 2WAFA 1FSWA 1PWCA 4H8RA 4LV2A 3PAEA 2H0YA 2R9WA 4A5RA 4HBUA 3IXHA 1K6RA 2XGNA 4RYEA 5HX9A 2PU4A 3PBQA 5E2EA 3CJMA 1M6KA 4MNRA 1JWVA 3AGFA 4E3OA 2Y2PA 1CEFA 1W8QA 3I7JA 4KQRA 1CK3A 5HARA 2HPBA 3HLCA 4GD8A 4OKPA 1LLBA 4RX2A 1ES2A 4S2LA 4UHUA 3G32A 1WYCA 2IWDA 3IF5A 4LV1A 4OLDA 1FR6A 4KG5A 1YLYA 1CEGA 1JVJA 1KDWA 1O07A 5EE8A 5CHMA 4P85A 5TR7A 3DW0A 1PW1A 4OOLA 4DF6A 3OPHA 2Y2QA 2XH9A 5J8XA 1LI9A 1K57A 1N4OA 1YLZA 3Q7ZA 3G4PA 4Y0UA 2RCXA 4LCMA 3G34A 4U0XA 5A92A 4DDYA 3SH8A 1QMEA 4EWFA 3IWOA 1ESIA 3HLBA 4NK3A 3N6IA 4ZTKA 3UDXA 2ZM2A 1TEMA 1YLPA 3IXDA 2Y2NA 4JXSA 4JPMA 4N9LA 4N1HA 4BENA 4GNUA 3WRTA 3TSGA 3OCLA 4PM7A 4OOMA 4S2NA 4WBGA 3IXGA 5EVIA 2J9OA 4QHCA 3ZNTA 4OP5A 4OP8A 1PZPA 4JLFA 3Q1FA 4X56A 3NBLA 1ALQA 3V3SA 3MKEA 3PAGA 2XDMA 1IKIA 3GV9A 4UA6A 5EECA 3MXRA 2Y2LA 3HLGA 3DWKA 5FAOA 3C4OA 3BEBA 3M6HA 1LI0A 3UNWA 4IVIA 1Z6FA 4F94A 4EBNA 2Y2GA 3MZDA 4WMCA 1BZAA 4L0LA 2IWBA 4R0QA 3IF6B 4Q8IA 2XD1A 4FCFA 3VFHA 3BFFA 4RX3A 3IH8A 1YLTA 3VFFA 3UE0A 1K4EA 5DTKA 2HDQA 1WYBA 5DVAA 5GLCA 2WZZA 1BSGA 4GDBA 3GMWA 2XLNA 5CGWA 4R23A 3UY6A 1KGEA 1MPLA 1GHMA 3PTEA 2EX8A 3M2KA 1E3UA 1KE4A 4ID4A 4WEJA 2I72A 3AGDA 1C3BA 3HBRA 5F1GA 1SDEA 4BLMA 4BL3A 4DE0A 5JYOA 5DTSA 2HDSA 4KZ6A 2EX9A 2Y2IA 4QB8A 5A90A 1EI5A 5GHXA 3DTMA 5CGXA 1GHIA 4MBFA 4WM9A 1MWSA 4WZ4A 1L2SA 3D4FA 4KG6A 2P74A 3UPPA 1ZG6A 4Y7PA 3VSKA 5DTTA 3S22A 1WE4A 1NJ4A 1PYYA 2ZQ7A 4N92A 1CI8A 1NZUA 4YFMA 4KZAA 5F1FA 3BM6A 2RL3A 3EQVA 2WUQA 1YT4A 5TFQA 3BRMA 2V20A 1E4DA 4IEDA 4CPKA 2ZMAA 2WKHA 1ZC2A 1NXYA 4OPYA 3IWQA 4PM9A 4UA9A 2H10A 4S2JA 3N8RA 2Y2KA 5FQIA 4XXRA 3ZVTA 4BL2A 2R9XA 4Y0OA 4BQMA 2JCHA 3FYZA 5DF8A 3UO9A 4WZ5C 5FAPA 5CERA 3N8SA 2ZC5B 1BLSA 4X55A 3G2YA 4X68A 1GA9A 1IEMA 1JTDA 3NY4A 3VP1A 4DE2A 2DNSA 2ZC3B 2ZQCA 4X53A 2XK1A 1ERMA 3VP4A 2WKEA 1XKZA 3LY4A 4GKUA 4HEFA 3ISGA 1IYSA 2E8IA 4QJGA 2WZXA 4N1XA 1KGGA 3A3IA 5FI7A 2Y2HA 5HAQA 4ZBEA 1RGZA 2HP6A 4S2NC 4C75A 3WS2A 4GZBA 5EVIC 1E25A 1K4FA 2EX2A 3FWLA 3ZNYA 2ZC6B 1JWPA 3N7WA 4OQGA 5GHYA 3A3FA 3A3DA 1NYMA 3GQZA 4KQQA 1MKIA 1RGYA 4OQ0A 5HAPA 3W4OA 3LY3A 3Q82A 5FDHA 1PI5A 4GD6A 1IELA 3NC8A 4WZ5A 3WS4A 3IH9A 4EV4A 4JF5A 1M40A 4R4SA 1ONHA 5EVID 3P09A 3TG9A 1FQGA 2WYXA 3OPLA 2X02A 4R3BA 4ZJ2A 1GHPA 3GR2A 5A91A 3RXXA 3UDIA 1GA0A 1ES4A 1KVLA 1XGJA 2HDRA 3C5AA 3HL9A 2BLSA 4GN2A 4DE3A 4KZ8A 1I5QA 4BD1A 3VP2A 3IHBA 4O7DA 5BOHA 3ZHHA 3MKFA 1YLJA 4XUXA 4K0XA 5KSHA 5JYPA 1FCMA 4JXVA 4LENA 3MZFA 2ZJ9A 1S6RA 1BLPA 4FSFA 3O88A 1PWGA 5L2FA 3TOIA 4WMCD 3OPPA 2WGVA 3NI9A 4JF4A 2BG1A 1HD8A 2X01A 1PWDA 1KDSA 4U3TA 1AXBA 2OSUA 5EVIB 3W4QA 2QPNA 4JXWA 5FQ9A 1HZOA 4ZDXA 3FZCA 4OPQA 1IKGA 2H5SA 4S2IA 2WGWA 1RCJA 4FH2A 1ZG4A 1BLHA 2CC1A 2DCFA 4PM6A 3G31A 2Y2MA 1TDLA 2EX6A 4LV3A 5DF7A 3ZFZA 1GCEA 1MWUA 4B4ZA 4P87A 2XFSA 1XPBA 3SS4A 3IQAA 2QMIA 2H0TA 1W5DA 2B5RA 1E3UD 1ESUA 3ZG7B 4Z9QA 5CEBA 3G30A 2XD5A 4XUZA 3UDFA 5FSRA 2PU2A 4GDNA 5GLBA 1SCWA 3BFGA 1MBLA 2XQZA 1I2SA 3W8KA 2EFUA 3G35A 3O86A 2OV5A 4E3NA 3V50A 4OONA 2Y2JA 2HDUA 4DXCA 4R1GA 4C6YA 5FQMA 4PM5A 4E3MA 3O87A 2A3UA 5HW3A 1HTZA 3ZCZA 4E6WA 1XGIA 1MY8A 2EXAA 3VP3A 1K25A 4Y0TA 3OCNA 4KZ4A 4C3QA 4KZ3A 4DKIA 1EWZA 4P0MA 3UPOA 2J9PA 3B3XA 3CZDA 1NRFA 1YLWA 2OLVA 3BFEA 3HREA 5KSCA 1ERQA 3BFCA 3GVBA 1SDNA 3A3JA 5CTMA 3O3VA 4MLLA 1HVBA 4WYYA 1YMXA 3VSLA 1G68A 3FKVA 4X6TA 1DJBA 1H8ZA 3BYDA 4S2KA 1FCOA 4E3LA 1XA1A 5KMWA 4OOYA 3HUOA 2OLUA 2C5WB 3PBTA 1KGFA 1Y54A 1K6SA 2WAEA 4KENB 1TDGA 5AQ7A 5HL1A 3ZG9B 1PI4A 3LO7A 3PBOA 5CHJA 3Q81A 5U47A 1ZKJA 3ITBA 5CECA 3NIAA 4K91A 2WGIA 4FD8A 3QHYA 4DRTA 3PBNA 4R3JA 4GOGA 2P9VA 2ZQAA 5CXWA 3SH7A 3DWZA 1ONGA 3NDGA 3MZEA 3C7UA 4RVAA 3GTCA 4E6XA 5M18A 3VOZA 4JKTA 4LV0A 4M3KA 3LCEA 2JE5A 2ZLYA 4X69A 4OH0A 2X71A 1K54C 3Q7VA 3QNBA 5F82A 3G2ZA 4LCLA 2G2UA 2G2WA 2HP9A 3IWIA 4K0WA 3VOYA 3ZGAB 1YM1A 3EQUA 4B4XA 5A93A 2WADA 5TGFA 4KZ9A 5FATA 5FQQA 4S2MA 1CI9A 4JXGA 1SKFA 1FR1A 2C6WB 3V39A 4MEZA 5I94A 3WRZA 5E43A 3OPRA 4RA7A 1LL5A 2JC7A 4KG2A 4ZAMA 5HAIA 3ZG5A 2XR0A 2ZM0A 4KQOA 3IHAA 4YINA 4R4RA 2PBYA 5M19A 1PZOA 3JYIA 3SS5A 3BLMA
chains in the Genus database with same CATH superfamily
3SS3A 1YAXA 2XROA 2VZWA 1BTLA 1P97A 5AQAA 2V1ZA 4ZJ3A 1A0KA 1IFQA 4JF6A 1S4RA 4I38A 2VGLM 4N9KA 4UEYA 2J7VA 5FQJA 4Y5FA 4KUKA 4EUZA 1NZOA 5F83A 2VGJA 1MZUA 2UWXA 3NDEA 3N8LA 4HESA 1K56A 2Q9NA 2V1AA 2QZ6A 1DY6A 4D60A 1N9BA 2A24B 3HUNA 1LT0A 3D72A 5FI2A 2GX5A 4OQHA 3FKWA 3HLWA 3OC2A 3OZHA 4BJPA 5FASA 2V2FF 5GHZA 1FOFA 3H9WA 4HOIA 3QP8A 4E3KA 4QY6A 1YSPA 3LEZA 5EV0A 5EOOA 3BECA 1ZHHB 4UAAA 5EVLA 1W63M 1KE0A 1IYPA 4WELA 1J9MA 3A3EA 3UE6A 3RJUA 2Q9MA 1Q2QA 3QP5A 5GL9A 3ZG8B 3ZG0A 5E2GA 4HJ6A 4B93A 5FA7A 1GSVA 3LR5A 5EOEA 1V9ZA 3LUQA 3UE3A 1VM1A 5FL3A 4ZJ1A 2JKRI 4E3IA 1L0GA 5HWVA 4ZRRA 1RP5A 4JBFA 4DJ3A 3L7HA 4UA7A 1Q2PA 4HY8A 3AGEA 2D01A 1XX2A 4Q0JA 4OPZA 2EFXA 4CLCC 5J3WA 3VP0A 3ZVWA 3Q7VB 1PWCA 3KSFA 4RYEA 4YOFA 2HZ5A 2PU4A 5E2EA 1M6KA 3H82A 3AGFA 5DJTA 2Y2PA 3MSHA 2HPBA 4GD8A 4OKPA 4S2LA 4UHUA 4HI4A 2Y79A 3IF5A 1YKDA 5TBMB 1YLYA 3FC7A 1JVJA 4DF6A 4P85A 1PW1A 3C2WA 4OOLA 3OPHA 2Y2QA 2D02A 1K57A 1N4OA 2O0YA 1YLZA 2RCXA 4LCMA 3SH8A 3IS2A 4UQIS 3N6IA 2ZM2A 1ACFA 3T4TA 2ZBBA 1UWPX 5J4EA 3OCLA 3H7WA 3LR4A 2J9OA 4F3LA 4I5SA 1PZPA 3NECA 4KUOA 3NBLA 2Y8HA 1IKIA 5FAOA 1L3LA 1X0OA 2WKRA 4EBNA 2B18A 2M1CA 3IF6B 2XD1A 4FCFA 3BFFA 5CX7A 1D06A 5DTKA 2HDQA 3IBRA 4GDBA 2QYBA 5EFWA 1GHMA 2EX8A 3M2KA 4EEPA 3PXPA 4WEJA 1SDEA 3KYEA 2HF6A 5GHXA 3D4FA 4Y7PA 3VSKA 4YFMA 5F1FA 2WUQA 1YPRA 2V20A 3HJKA 4DN0A 4CPKA 2ZMAA 2WKHA 1ZC2A 3IWQA 2EWVA 4S2JA 5HDCA 4XXRA 2R9XA 3U4LP 4Y0OA 2JKFA 4I39A 3T1QB 4X25A 3G2YA 1IEMA 1S67L 3ZYTA 3ISGA 1IYSA 1KGGA 1RGZA 2HP6A 5I5LA 4C75A 4CLCD 2HJEA 5EVIC 4MN5A 1K4FA 3ZNYA 3GQZA 4KQQA 3ZQ5A 5HAPA 5FDHA 3ICYA 1D7EA 2J3WA 3BQAA 3IH9A 4EV4A 1S4SA 3TG9A 1FQGA 2X02A 1GHPA 1XGJA 3C5AA 2P08A 1PRQA 4XUXA 1F98A 5KSHA 4L9EA 2GZAA 2INWA 3O88A 1VB6A 3TOIA 2K31A 2WGVA 4FUWA 4GHIA 3UB6A 1P9RA 2WKPA 3W4QA 2QPNA 4UQIM 1RCJA 4PM6A 1P9WA 2Y2MA 3A0RA 2EX6A 4LV3A 1H8MA 4B4ZA 5EVEA 1XPBA 3SS4A 2QMIA 1E3UD 5CEBA 4Z9QA 3UDFA 5HWWA 1MBLA 4E3NA 3QP2A 4L9FA 4PM5A 4E3MA 4EERA 3LI8A 3T4OA 1HTZA 4E6WA 4R38A 1XGIA 2V1BA 2EXAA 1K25A 3OCNA 4KZ4A 4XT2A 1YLWA 2OLVA 3BFCA 3GVBA 3UB5P 4WLAA 1YMXA 1G68A 3FKVA 4S2KA 2IA2A 3PYPA 2OWJA 1XA1A 3HUOA 1STZA 2W27A 1K6SA 3OLOA 3PBOA 3BWLA 4K91A 3QHYA 2BASA 3PBNA 4R3JA 5J7EA 3T1SA 1ONGA 3VOZA 4LV0A 2W3FA 3QNBA 5F82A 3G2ZA 4K0WA 2HV1A 1CI9A 3HCYA 3V39A 1LL5A 4KG2A 5DJUA 4YINA 4BBVA 4R4RA 4AFIA 4P87A 2PYRA 4FTXA 4QD4A 2DRWA 1ES5A 2Y59A 1BT5A 5KSCA 1VQQA 1K54A 4KZBA 5HPFA 3IT9A 1K56D 1KVMA 3IF6C 4JGQA 1O7EA 2HP5A 4QY5A 4PMAA 5DF9A 5AQ9A 3DTKA 2W0NA 1XJ3A 3C7VA 1SKOA 2JKRM 3T4SA 4Y3IA 3WS5A 2WGWB 3CMZA 1XXMA 2XEPA 4R6LA 3CAXA 2KDKA 3S1YA 2XFTA 3MFDA 1IYOA 4OLGA 2GDNA 4I3IA 5E2FA 2J8YA 1TS6A 1MXOA 1DP9A 2VGKA 3KSGA 4OVDA 4P6BA 3T12B 3LYXA 3VMAA 4HP9A 4PM8A 3QP4A 1W79A 4NXFA 2PD7A 3HLEA 4II7A 2G7UA 1PIOA 1BUEA 4MBHA 4D2OA 4S2OA 2JKTI 1TD5A 4CJNA 1K55C 2ZQDA 1K38A 5L09A 3NCKA 4PKYA 2WK0A 1OMEA 1F5MA 3HUMA 2W1RA 3T4JA 2ZQ9A 4QWOA 4ARZB 1H8YA 3BW6A 3E2LA 4S2PA 3SOIA 3HLDA 1ODVA 3PBRA 1KE3A 3PBSA 2EA9A 4H6JA 3OOVA 1DJAA 3O5YA 4PAUA 2MJ6A 2W3GA 4B88A 3SW1A 2P9VB 1NY0A 3CLOA 4IVKA 3K2NA 2FFYA 3MS6A 1PW8A 3V5MA 3RH8B 2PT7A 3UPNA 1L0EA 1U60A 4KZ5A 1QMFA 2H0YA 2R9WA 5MC7A 3IX4A 4BMWA 3CJMA 3MJQA 4MNRA 3GECA 4E3OA 5HARA 4G3VA 3MFXA 1LLBA 4RX2A 4Y15A 1CEGA 2ZMVA 1O07A 4Z1WA 1K0KA 2XA7S 3VV4A 3Q7ZA 4DDYA 1QMEA 1S1YA 2Y2NA 2NUPC 4JXSA 3E4QA 4N1HA 3TW8A 3IXGA 2WKQA 5EVIA 4QHCA 4OP5A 3LIAA 3MKEA 5EECA 3MXRA 2Y2LA 3BEBA 1LI0A 5K5BA 1Z6FA 3CPTA 1BZAA 4L0LA 3D9YA 5HD3A 4R0QA 2K2NA 3T4KA 3IH8A 3VFFA 3UE0A 2PYPA 1WYBA 5DVAA 5GLCA 2WZZA 2XLNA 3S7OA 1MPLA 3PTEA 1GSXA 5HSQA 2I72A 3AGDA 4DE0A 3PHYA 3KX0X 3T4QA 5A90A 2V8FA 4HJ4A 5CGXA 1GHIA 4MBFA 4WM9A 1MWSA 2P74A 3UPPA 2W1TA 3UB7A 1WE4A 1NJ4A 1PYYA 4N92A 1CI8A 4Q0IA 1YT4A 1PNEA 4IEDA 3TRCA 2A2LA 5C5KA 4UA9A 3N8RA 3F1PA 3ZVTA 3FPVA 3EEHA 4BQMA 3FYZA 5FEFA 3LR0A 1BLSA 4X68A 1GA9A 2ZC3B 4EUVA 1ERMA 2QHKA 4HEFA 4QJGA 4N1XA 5HAQA 2Y2HA 4ZBEA 1E25A 1VEUA 2EX2A 2ZC6B 4ESPA 4OQGA 3H82B 1PI5A 4GD6A 1G28A 5F68A 1D1JA 4E04A 3MQOA 4WZ5A 3WS4A 4QPRA 4R4SA 2WYXA 4ZJ2A 4R3BA 2E8JA 1GA0A 2P7JA 4MDZA 5TJJA 1KVLA 3LFVA 4Q0HA 2BLSA 4DE3A 1I5QA 2VV8A 3VP2A 3IHBA 4WN5A 1F9IA 3MKFA 3IS2B 4R3AA 4JXVA 5JYPA 4LENA 2ZJ9A 4FSFA 1PWGA 4WMCD 3NULA 3C30A 4JF4A 2BG1A 2X01A 4U3TA 1N9LA 1AXBA 2XA7M 2OSUA 3H7WB 5HD5A 4F3LB 2PDRA 4OPQA 3CI6A 4S2IA 4FH2A 2CC1A 3G31A 1TDLA 1EW0A 4B9OA 4ETXA 3MF0A 5AJGA 2XFSA 3IQAA 2H0TA 4ETZA 3MQ0A 1ESUA 5L07A 2VV7A 3NHQA 4XUZA 5DFXA 5FSRA 2EWWA 2XQZA 3W8KA 3O86A 2VKSA 1LSXA 2Y2JA 3VOLA 4DXCA 3O87A 3DBAA 2QJ5A 3CUEC 1NLZA 3VP3A 4BBUA 4WL9A 4Y0TA 4C3QA 4P0MA 1MKMA 2J9PA 3B3XA 3CZDA 3HREA 2B95A 3EGXC 1ERQA 3VE3A 1WA9A 2JKGA 3A3JA 1HVBA 4WYYA 4LGWA 2JHEA 2C5WB 5F5YA 3PBTA 2FH5A 3GDIA 1T18A 4KENB 5AQ7A 3ZG9B 4K08A 3ULFA 3ITBA 3NIAA 5CXWA 2PR6A 1F2KA 2W3EA 2VV6A 3NDGA 3C7UA 5M18A 3GTCA 5FEGA 4M3KA 4LPZA 3IWIA 3VOYA 2HP9A 4B4XA 3JPUA 4KZ9A 1SKFA 2O9BA 3S7NA 4MEZA 3FG8A 2JC7A 2ZM0A 2JKTM 4O0PA 1FIKA 3BLMA 4EW7A 4HIAA 4IUKA 2J3TD 3B42A 4FOFA 4WEKA 3TE8A 1FCNA 1EROA 1LL9A 2GJ3A 1UWNX 3E0YA 1Z09A 1OT6A 2Z2LB 3BLSA 3BFDA 4GHIB 2Z6DA 1TS0A 3IBJA 2ZC4B 4EQIA 3G6OA 4LFUA 5EPHA 4DDSA 3WS0A 2JN7A 1OJ5A 2KX6A 3N4IA 4GW9A 4MBKA 2HGVA 1W7FA 3M2JA 4FH4A 3HVFA 1S0WA 2Y91A 1DJCA 4GS9A 1LHYA 4BBTA 3E4PA 3F1NA 3ZDJA 2CMNA 3UE1A 1N9OA 1ZTUA 3W4PA 1IYQA 3TJZC 3E4OA 3CG5A 3WWXA 3T4LA 4DMZA 5AQBA 4QU3A 4XT2B 2Y4AA 3RXWA 3GRJA 1XP4A 3KSIA 5IHVA 2ZQ8A 3R7WA 5FQKA 1BLCA 2V0WA 3MBZA 2L0WA 4MMNA 4NETA 5G18A 4GB7A 2IWCA 3A0VA 2V9AA 2VK3A 3MXSA 3GSGA 3LIDA 4HBTA 4OQIA 5FAQA 3Q07A 1VHMA 1OT9A 4X1LA 3C8CA 3NOPC 5GLAA 4OPRA 3HLFA 3QP6A 1ES3A 5HFOA 1NYYA 4Y13A 2Y2OA 1SHVA 1K57C 1MWRA 3FV7A 1OTAA 4H8RA 2WAFA 1UGUA 3LEQA 4A5RA 5IS1A 5KIZA 2XGNA 3PBQA 3A0SA 3I7JA 1CEFA 1W8QA 4KQRA 1CK3A 2VEAA 1ES2A 4EETB 3IX8A 4LV1A 3LGOA 2H28A 5EE8A 5CHMA 5TR7A 3NJAA 4CLCA 1LI9A 3KYQA 3G4PA 5IT5A 4EWFA 1ESIA 3HLBA 4ZTKA 4MN6A 1TEMA 1YLPA 2PRFA 4JPMA 4N9LA 2ZOIA 4BENA 1GSWA 1P0ZA 4PM7A 5EM0A 3B33A 5A8BA 2PAVP 3ZNTA 1VETA 4JLFA 4X56A 3V3SA 1SKOB 3PAGA 3MXQA 2ZL1A 4UA6A 3HLGA 1NRJA 3DWKA 4RQ9A 3M6HA 4JGOA 4IVIA 3MZDA 2OAQ1 2IWBA 4Q8IA 4RX3A 3DTEA 3MQQA 1TF1A 2NUTC 3UB8A 1BSGA 3C38A 2QJ7A 3T50A 3GMWA 4R23A 3W2ZA 2M7UA 1KGEA 1MC0A 4YWZA 1E3UA 1KE4A 4PHTA 3HBRA 4BLMA 4HP4A 5DTSA 1KOUA 2Y2IA 4QB8A 1EI5A 3UMDA 3DTMA 2P04A 1L2SA 3V67A 1AWIA 1ZG6A 5F6AA 3S7QA 3S22A 1V9YA 3DTIA 4CLCE 4KZAA 2RL3A 3EQVA 4I3AA 1E4DA 3E98A 1NXYA 4H6JB 1YSQA 2H10A 2B02A 5FQIA 4BL2A 3PR6A 2JCHA 3LIFA 3UO9A 5FAPA 2ZC5B 5DFYA 5HPIA 1JTDA 4HJ3A 2DNSA 2ZQCA 1N9NA 2XK1A 1XJ4A 3F1OA 2WKEA 2E8IA 2K7SA 2WZXA 3A3IA 5FI7A 4S2NC 3WS2A 2VLGA 1S66L 3FWLA 1OPXA 3LICA 5GHYA 3A3FA 3A3DA 1NYMA 1MKIA 4OQ0A 2J80A 3W4OA 2R78A 3LY3A 3Q82A 1IELA 2KLIA 2UV0E 1TS7A 3P09A 2W3DA 2O9AA 3OPLA 3RXXA 3GR2A 3UDIA 1ES4A 2HDRA 4KZ8A 4BD1A 3EGDC 4DJ2A 4O7DA 2M7VA 3KSHA 1T1CA 1YLJA 4K0XA 1FCMA 3MZFA 3NI9A 1HD8A 1PWDA 2YKHA 4PKYG 5EVIB 1Y28A 1HZOA 3FZCA 1IKGA 2H5SA 1ZG4A 1BLHA 2DCFA 2ZMFA 3ZFZA 4YNRA 1GCEA 2A24A 4NXEA 3MR0A 4EEUA 1W5DA 2B5RA 3CPTB 3BY9A 4LRXC 4EXOA 2XD5A 5GLBA 1DP6A 4GDNA 1SCWA 3BFGA 3UMEA 3B47A 2EFUA 3G35A 4C6YA 5FQMA 2A3UA 5HW3A 3EOIA 1MY8A 1DRMA 4DKIA 4KZ3A 1EWZA 3P01A 3BFEA 1SDNA 1XJ6A 5CTMA 3T1RA 4MLLA 2LB9A 3VSLA 5IU1A 1DJBA 1H8ZA 2W1TB 4OOYA 5L8MA 5HDDA 2OLUA 1KGFA 4NXGA 4L9GA 1TDGA 1PI4A 3Q81A 5U47A 2WGIA 3F1PB 4O8GA 2ZQAA 3K3CA 3MMHA 3BY8A 1CJFA 3MZEA 4RVAA 4E6XA 4Y17A 3JVVA 2JE5A 2ZLYA 4OH0A 1K54C 3Q7VA 5EM1A 2G2UA 2G2WA 3ZGAB 4R70A 1YM1A 3EQUA 1BYWA 5TGFA 5FATA 3FPWA 4GCZA 4JXGA 1FR1A 2C6WB 1VEUB 4JGPA 4IJGA 5E43A 3OPRA 4RA7A 5HAIA 4ZAMA 3ZG5A 2XR0A 2J3TC 4CQHA 3BQ8A 5DKKA 5TBMA 2PBYA 2VJWA 1PZOA 3JYIA 5A93A 1OTIA 2YKFA 3NOTC 1XA7A 2FFFB 1JTGA 4IBXA 4DE1A 1JWZA 1XFQA 5CRFA 3P98A 1YMSA 1J3WA 2ZD8A 1OTEA 5FDSA 5FI6A 4BD0A 5CHUA 4IBRA 5KZHA 2DMWA 2XSSA 3D3OA 1L0DA 2JBFA 2AVXA 2EXBA 2Y55A 5E2HA 4EBLA 3C4PA 5M1AA 1JNUA 1FSYA 2LB5A 1YQSA 3WS1A 5CTNA 3EWKA 1MWTA 3IF6A 4O01A 2ZC7A 1I2WA 5HDSA 2ZM8A 4P6ZS 2ZOHA 1G6AA 1OTBA 5D3OA 2GNXA 3QNCA 4NEED 5LBRA 3ITAA 5GLDA 2PR5A 2A49A 3QP1A 2I9VA 4EBPA 3HJIA 3LR3A 1TVFA 4LRZE 2O9CA 4LRYC 1OJGA 1DP8A 4U0TA 4KZ7A 3CITA 3IXBA 5L10A 5CEDA 2Z2MB 2Q0OA 4DXBA 4PPRA 1G6OA 1K55A 4E3JA 1BULA 3UN7A 1W8YA 3S4XA 5G4ZA 3E2KA 1H5XA 5CGSA 3KYZA 1HLUP 3SH9A 3M6BA 5DKLA 2XF3A 1L0FA 4GJ4A 3V3RA 5EUAA 2WKIA 3LIBA 1FSWA 4LV2A 4WF0A 3PAEA 4HBUA 3IXHA 1K6RA 4GLQA 5HX9A 1H3QA 1PFLA 1JWVA 3KO6A 5HL6A 3HLCA 4I3JA 5AVEA 3G32A 1WYCA 2IWDA 4OLDA 5G4YA 1FR6A 3K3DA 4KG5A 1KDWA 5HZHA 3DW0A 2XH9A 3UB9A 5J8XA 4IUHA 4Y0UA 4ME4A 5A92A 3G34A 4U0XA 3IWOA 3P7NA 2OOLA 4NK3A 3UDXA 3T1XA 4Y2FA 3IXDA 4GNUA 3WRTA 3TSGA 4OOMA 4S2NA 4WBGA 2V8CA 4OP8A 2L4RA 3Q1FA 1ALQA 2XDMA 3GV9A 3OBFA 2QWSA 3C4OA 4M4XA 1T1AA 4G3WA 1CQAA 3UNWA 4F94A 2VA0A 2Y2GA 4WMCA 1SZVA 1H0MA 1G5UA 3VFHA 2BTFP 2PD8A 1YLTA 4GS9B 3EEAA 1K4EA 3F1NB 1XJ2A 5CGWA 3UY6A 4P6ZM 4ID4A 5F1GA 1C3BA 5JYOA 4BL3A 2HDSA 4JGRA 3LI9A 4KZ6A 2EX9A 2Z6CA 1TS8A 3CWFA 4BWIA 4WZ4A 4KG6A 3R7WB 4HHDA 2L1MA 2PHYA 5DTTA 2HJ9C 2ZQ7A 4HH3A 1NZUA 3BM6A 3VE4A 5TFQA 3BRMA 4IHQA 4NXBA 2O99A 4OPYA 4PM9A 2Y2KA 1CF0A 5DF8A 4WZ5C 5CERA 3N8SA 3DAVA 4HNBA 4NKPA 4X55A 3NY4A 3VP1A 4DE2A 4X53A 3VP4A 1XKZA 3LY4A 4GKUA 4NG2A 4X1MA 4GZBA 3IX3A 1JWPA 3N7WA 2FZ0A 1RGYA 2VGLS 3NC8A 4KQDA 1OTDA 4JF5A 1M40A 5EVID 1ONHA 5A91A 1LL8A 4EU0A 5HWTA 3HL9A 4CLCB 4GN2A 5BOHA 4MCWA 4G3KA 3ZHHA 5AVFA 2XRNA 3L9KA 1S6RA 1BLPA 5L2FA 3OPPA 3NOUC 1KDSA 2KOIA 1XFNA 4JXWA 1VETB 5FQ9A 4ZDXA 2OAP1 1W63Q 2VX8A 2WGWA 2ZL1B 3R4KA 1IOUA 5DF7A 1MWUA 2QKPA 3RTYA 3ZG7B 3G30A 2ACGA 1LSWA 2PU2A 1I2SA 3S7PA 2OV5A 3CHWP 3V50A 4OONA 2HDUA 4MN7A 1NWZA 4R1GA 3ZCZA 3JVUA 1FILA 3UPOA 3BJNA 2V0UA 1NRFA 3RFBA 1LSVA 3O3VA 1NLYA 4ARZA 2OWHA 4EQ1A 4X6TA 3BYDA 4HH2A 1FCOA 4E3LA 5KMWA 4WUJA 1Y54A 2WAEA 5HL1A 5CHJA 3LO7A 3CUEA 3LIEA 1Y4OA 1ZKJA 5CECA 4FD8A 4HQAA 4DRTA 4GOGA 2P9VA 3SZTA 3SH7A 3DWZA 1S1ZA 4JKTA 4LLOB 3LCEA 4X69A 2X71A 3F1OB 4LCLA 1T1BA 2WADA 5FQQA 4S2MA 5F69A 5I94A 3WRZA 3U2AA 4EESA 2PBDP 4KQOA 1T19A 3IHAA 2W3HA 5M19A 3SS5A
chains in the Genus database with same CATH topology
3SS3A 4QD4A 2DRWA 1ES5A 1BTLA 1BT5A 1XA7A 2Y59A 1VQQA 2V1ZA 5AQAA 4ZJ3A 1K54A 4KZBA 2FFFB 3IT9A 1JTGA 4JF6A 4IBXA 4WEKA 1K56D 1KVMA 3IF6C 4N9KA 1O7EA 1FCNA 4DE1A 1EROA 2HP5A 2J7VA 4QY5A 1LL9A 1JWZA 4PMAA 5FQJA 5DF9A 5AQ9A 2Z2LB 3BLSA 4EUZA 5CRFA 1NZOA 3P98A 3BFDA 5F83A 2VGJA 1YMSA 2UWXA 3NDEA 3C7VA 3N8LA 4HESA 2ZD8A 1K56A 5FI6A 4BD0A 5KZHA 5CHUA 4IBRA 2ZC4B 3WS5A 1L0DA 4EQIA 2WGWB 2JBFA 2Q9NA 3CMZA 1XXMA 2XEPA 5EPHA 4DDSA 3WS0A 2EXBA 5E2HA 2Y55A 2QZ6A 2XFTA 1DY6A 3MFDA 3S1YA 4EBLA 3N4IA 3C4PA 5M1AA 1FSYA 1N9BA 1IYOA 4OLGA 2GDNA 3HUNA 4MBKA 5E2FA 2J8YA 1YQSA 1MXOA 5CTNA 5FI2A 3WS1A 1MWTA 3FKWA 4OQHA 1W7FA 3IF6A 2VGKA 3HLWA 3M2JA 4OVDA 4P6BA 2ZC7A 4FH4A 1I2WA 3HVFA 2ZM8A 3OC2A 3OZHA 4BJPA 5FASA 1S0WA 3VMAA 2V2FF 1G6AA 4PM8A 5GHZA 1FOFA 2Y91A 1DJCA 1W79A 5D3OA 1LHYA 3HLEA 3QNCA 1PIOA 1BUEA 4MBHA 4QY6A 3ZDJA 4E3KA 4D2OA 3UE1A 4S2OA 3ITAA 3LEZA 5GLDA 4CJNA 1K55C 3W4PA 5EOOA 3BECA 2A49A 4UAAA 5EVLA 2ZQDA 1K38A 1IYQA 3WWXA 1KE0A 3CG5A 1IYPA 3NCKA 4WELA 1J9MA 4EBPA 3A3EA 5AQBA 4QU3A 2WK0A 1TVFA 1OMEA 3HUMA 3RJUA 2Y4AA 3RXWA 2Q9MA 2ZQ9A 4U0TA 3GRJA 4KZ7A 1Q2QA 1XP4A 5GL9A 3IXBA 2ZQ8A 5IHVA 1H8YA 5FQKA 3ZG8B 3ZG0A 5CEDA 5E2GA 1BLCA 3MBZA 5FA7A 2Z2MB 4NETA 4DXBA 5G18A 3E2LA 4S2PA 5EOEA 3SOIA 4PPRA 3HLDA 4GB7A 2IWCA 3PBRA 1KE3A 3PBSA 3MXSA 3UE3A 1VM1A 1K55A 4ZJ1A 1BULA 3GSGA 4E3JA 4E3IA 1L0GA 3UN7A 4HBTA 1W8YA 4OQIA 5FAQA 3S4XA 1RP5A 3Q07A 4JBFA 1DJAA 3E2KA 1H5XA 5GLAA 4UA7A 5CGSA 4B88A 2P9VB 1Q2PA 1NY0A 4OPRA 3HLFA 3AGEA 4IVKA 1ES3A 1XX2A 5HFOA 2FFYA 3SH9A 4OPZA 2EFXA 1NYYA 1PW8A 2XF3A 1L0FA 1SHVA 2Y2OA 3M6BA 3V5MA 3UPNA 1L0EA 3V3RA 1K57C 1MWRA 1U60A 5EUAA 3VP0A 3FV7A 3ZVWA 3Q7VB 4KZ5A 1QMFA 2WKIA 2WAFA 1FSWA 1PWCA 4H8RA 4LV2A 3PAEA 2H0YA 2R9WA 4A5RA 4HBUA 3IXHA 1K6RA 2XGNA 4RYEA 5HX9A 2PU4A 3PBQA 5E2EA 3CJMA 1M6KA 4MNRA 1JWVA 3AGFA 4E3OA 2Y2PA 1CEFA 1W8QA 3I7JA 4KQRA 1CK3A 5HARA 2HPBA 3HLCA 4GD8A 4OKPA 1LLBA 4RX2A 1ES2A 4S2LA 4UHUA 3G32A 1WYCA 2IWDA 3IF5A 4LV1A 4OLDA 1FR6A 4KG5A 1YLYA 1CEGA 1JVJA 1KDWA 1O07A 5EE8A 5CHMA 4P85A 5TR7A 3DW0A 1PW1A 4OOLA 4DF6A 3OPHA 2Y2QA 2XH9A 5J8XA 1LI9A 1K57A 1N4OA 1YLZA 3Q7ZA 3G4PA 4Y0UA 2RCXA 4LCMA 3G34A 4U0XA 5A92A 4DDYA 3SH8A 1QMEA 4EWFA 3IWOA 1ESIA 3HLBA 4NK3A 3N6IA 4ZTKA 3UDXA 2ZM2A 1TEMA 1YLPA 3IXDA 2Y2NA 4JXSA 4JPMA 4N9LA 4N1HA 4BENA 4GNUA 3WRTA 3TSGA 3OCLA 4PM7A 4OOMA 4S2NA 4WBGA 3IXGA 5EVIA 2J9OA 4QHCA 3ZNTA 4OP5A 4OP8A 1PZPA 4JLFA 3Q1FA 4X56A 3NBLA 1ALQA 3V3SA 3MKEA 3PAGA 2XDMA 1IKIA 3GV9A 4UA6A 5EECA 3MXRA 2Y2LA 3HLGA 3DWKA 5FAOA 3C4OA 3BEBA 3M6HA 1LI0A 3UNWA 4IVIA 1Z6FA 4F94A 4EBNA 2Y2GA 3MZDA 4WMCA 1BZAA 4L0LA 2IWBA 4R0QA 3IF6B 4Q8IA 2XD1A 4FCFA 3VFHA 3BFFA 4RX3A 3IH8A 1YLTA 3VFFA 3UE0A 1K4EA 5DTKA 2HDQA 1WYBA 5DVAA 5GLCA 2WZZA 1BSGA 4GDBA 3GMWA 2XLNA 5CGWA 4R23A 3UY6A 1KGEA 1MPLA 1GHMA 3PTEA 2EX8A 3M2KA 1E3UA 1KE4A 4ID4A 4WEJA 2I72A 3AGDA 1C3BA 3HBRA 5F1GA 1SDEA 4BLMA 4BL3A 4DE0A 5JYOA 5DTSA 2HDSA 4KZ6A 2EX9A 2Y2IA 4QB8A 5A90A 1EI5A 5GHXA 3DTMA 5CGXA 1GHIA 4MBFA 4WM9A 1MWSA 4WZ4A 1L2SA 3D4FA 4KG6A 2P74A 3UPPA 1ZG6A 4Y7PA 3VSKA 5DTTA 3S22A 1WE4A 1NJ4A 1PYYA 2ZQ7A 4N92A 1CI8A 1NZUA 4YFMA 4KZAA 5F1FA 3BM6A 2RL3A 3EQVA 2WUQA 1YT4A 5TFQA 3BRMA 2V20A 1E4DA 4IEDA 4CPKA 2ZMAA 2WKHA 1ZC2A 1NXYA 4OPYA 3IWQA 4PM9A 4UA9A 2H10A 4S2JA 3N8RA 2Y2KA 5FQIA 4XXRA 3ZVTA 4BL2A 2R9XA 4Y0OA 4BQMA 2JCHA 3FYZA 5DF8A 3UO9A 4WZ5C 5FAPA 5CERA 3N8SA 2ZC5B 1BLSA 4X55A 3G2YA 4X68A 1GA9A 1IEMA 1JTDA 3NY4A 3VP1A 4DE2A 2DNSA 2ZC3B 2ZQCA 4X53A 2XK1A 1ERMA 3VP4A 2WKEA 1XKZA 3LY4A 4GKUA 4HEFA 3ISGA 1IYSA 2E8IA 4QJGA 2WZXA 4N1XA 1KGGA 3A3IA 5FI7A 2Y2HA 5HAQA 4ZBEA 1RGZA 2HP6A 4S2NC 4C75A 3WS2A 4GZBA 5EVIC 1E25A 1K4FA 2EX2A 3FWLA 3ZNYA 2ZC6B 1JWPA 3N7WA 4OQGA 5GHYA 3A3FA 3A3DA 1NYMA 3GQZA 4KQQA 1MKIA 1RGYA 4OQ0A 5HAPA 3W4OA 3LY3A 3Q82A 5FDHA 1PI5A 4GD6A 1IELA 3NC8A 4WZ5A 3WS4A 3IH9A 4EV4A 4JF5A 1M40A 4R4SA 1ONHA 5EVID 3P09A 3TG9A 1FQGA 2WYXA 3OPLA 2X02A 4R3BA 4ZJ2A 1GHPA 3GR2A 5A91A 3RXXA 3UDIA 1GA0A 1ES4A 1KVLA 1XGJA 2HDRA 3C5AA 3HL9A 2BLSA 4GN2A 4DE3A 4KZ8A 1I5QA 4BD1A 3VP2A 3IHBA 4O7DA 5BOHA 3ZHHA 3MKFA 1YLJA 4XUXA 4K0XA 5KSHA 5JYPA 1FCMA 4JXVA 4LENA 3MZFA 2ZJ9A 1S6RA 1BLPA 4FSFA 3O88A 1PWGA 5L2FA 3TOIA 4WMCD 3OPPA 2WGVA 3NI9A 4JF4A 2BG1A 1HD8A 2X01A 1PWDA 1KDSA 4U3TA 1AXBA 2OSUA 5EVIB 3W4QA 2QPNA 4JXWA 5FQ9A 1HZOA 4ZDXA 3FZCA 4OPQA 1IKGA 2H5SA 4S2IA 2WGWA 1RCJA 4FH2A 1ZG4A 1BLHA 2CC1A 2DCFA 4PM6A 3G31A 2Y2MA 1TDLA 2EX6A 4LV3A 5DF7A 3ZFZA 1GCEA 1MWUA 4B4ZA 4P87A 2XFSA 1XPBA 3SS4A 3IQAA 2QMIA 2H0TA 1W5DA 2B5RA 1E3UD 1ESUA 3ZG7B 4Z9QA 5CEBA 3G30A 2XD5A 4XUZA 3UDFA 5FSRA 2PU2A 4GDNA 5GLBA 1SCWA 3BFGA 1MBLA 2XQZA 1I2SA 3W8KA 2EFUA 3G35A 3O86A 2OV5A 4E3NA 3V50A 4OONA 2Y2JA 2HDUA 4DXCA 4R1GA 4C6YA 5FQMA 4PM5A 4E3MA 3O87A 2A3UA 5HW3A 1HTZA 3ZCZA 4E6WA 1XGIA 1MY8A 2EXAA 3VP3A 1K25A 4Y0TA 3OCNA 4KZ4A 4C3QA 4KZ3A 4DKIA 1EWZA 4P0MA 3UPOA 2J9PA 3B3XA 3CZDA 1NRFA 1YLWA 2OLVA 3BFEA 3HREA 5KSCA 1ERQA 3BFCA 3GVBA 1SDNA 3A3JA 5CTMA 3O3VA 4MLLA 1HVBA 4WYYA 1YMXA 3VSLA 1G68A 3FKVA 4X6TA 1DJBA 1H8ZA 3BYDA 4S2KA 1FCOA 4E3LA 1XA1A 5KMWA 4OOYA 3HUOA 2OLUA 2C5WB 3PBTA 1KGFA 1Y54A 1K6SA 2WAEA 4KENB 1TDGA 5AQ7A 5HL1A 3ZG9B 1PI4A 3LO7A 3PBOA 5CHJA 3Q81A 5U47A 1ZKJA 3ITBA 5CECA 3NIAA 4K91A 2WGIA 4FD8A 3QHYA 4DRTA 3PBNA 4R3JA 4GOGA 2P9VA 2ZQAA 5CXWA 3SH7A 3DWZA 1ONGA 3NDGA 3MZEA 3C7UA 4RVAA 3GTCA 4E6XA 5M18A 3VOZA 4JKTA 4LV0A 4M3KA 3LCEA 2JE5A 2ZLYA 4X69A 4OH0A 2X71A 1K54C 3Q7VA 3QNBA 5F82A 3G2ZA 4LCLA 2G2UA 2G2WA 2HP9A 3IWIA 4K0WA 3VOYA 3ZGAB 1YM1A 3EQUA 4B4XA 5A93A 2WADA 5TGFA 4KZ9A 5FATA 5FQQA 4S2MA 1CI9A 4JXGA 1SKFA 1FR1A 2C6WB 3V39A 4MEZA 5I94A 3WRZA 5E43A 3OPRA 4RA7A 1LL5A 2JC7A 4KG2A 4ZAMA 5HAIA 3ZG5A 2XR0A 2ZM0A 4KQOA 3IHAA 4YINA 4R4RA 2PBYA 5M19A 1PZOA 3JYIA 3SS5A 3BLMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SS3 A;  4QD4 A;  2DRW A;  1ES5 A;  1BTL A;  1BT5 A;  1XA7 A;  2Y59 A;  1VQQ A;  2V1Z A;  5AQA A;  4ZJ3 A;  1K54 A;  4KZB A;  2FFF B;  3IT9 A;  1JTG A;  4JF6 A;  4IBX A;  4WEK A;  1K56 D;  1KVM A;  3IF6 C;  4N9K A;  1O7E A;  1FCN A;  4DE1 A;  1ERO A;  2HP5 A;  2J7V A;  4QY5 A;  1LL9 A;  1JWZ A;  4PMA A;  5FQJ A;  5DF9 A;  5AQ9 A;  2Z2L B;  3BLS A;  4EUZ A;  5CRF A;  1NZO A;  3P98 A;  3BFD A;  5F83 A;  2VGJ A;  1YMS A;  2UWX A;  3NDE A;  3C7V A;  3N8L A;  4HES A;  2ZD8 A;  1K56 A;  5FI6 A;  4BD0 A;  5KZH A;  5CHU A;  4IBR A;  2ZC4 B;  3WS5 A;  1L0D A;  4EQI A;  2WGW B;  2JBF A;  2Q9N A;  3CMZ A;  1XXM A;  2XEP A;  5EPH A;  4DDS A;  3WS0 A;  2EXB A;  5E2H A;  2Y55 A;  2QZ6 A;  2XFT A;  1DY6 A;  3MFD A;  3S1Y A;  4EBL A;  3N4I A;  3C4P A;  5M1A A;  1FSY A;  1N9B A;  1IYO A;  4OLG A;  2GDN A;  3HUN A;  4MBK A;  5E2F A;  2J8Y A;  1YQS A;  1MXO A;  5CTN A;  5FI2 A;  3WS1 A;  1MWT A;  3FKW A;  4OQH A;  1W7F A;  3IF6 A;  2VGK A;  3HLW A;  3M2J A;  4OVD A;  4P6B A;  2ZC7 A;  4FH4 A;  1I2W A;  3HVF A;  2ZM8 A;  3OC2 A;  3OZH A;  4BJP A;  5FAS A;  1S0W A;  3VMA A;  2V2F F;  1G6A A;  4PM8 A;  5GHZ A;  1FOF A;  2Y91 A;  1DJC A;  1W79 A;  5D3O A;  1LHY A;  3HLE A;  3QNC A;  1PIO A;  1BUE A;  4MBH A;  4QY6 A;  3ZDJ A;  4E3K A;  4D2O A;  3UE1 A;  4S2O A;  3ITA A;  3LEZ A;  5GLD A;  4CJN A;  1K55 C;  3W4P A;  5EOO A;  3BEC A;  2A49 A;  4UAA A;  5EVL A;  2ZQD A;  1K38 A;  1IYQ A;  3WWX A;  1KE0 A;  3CG5 A;  1IYP A;  3NCK A;  4WEL A;  1J9M A;  4EBP A;  3A3E A;  5AQB A;  4QU3 A;  2WK0 A;  1TVF A;  1OME A;  3HUM A;  3RJU A;  2Y4A A;  3RXW A;  2Q9M A;  2ZQ9 A;  4U0T A;  3GRJ A;  4KZ7 A;  1Q2Q A;  1XP4 A;  5GL9 A;  3IXB A;  2ZQ8 A;  5IHV A;  1H8Y A;  5FQK A;  3ZG8 B;  3ZG0 A;  5CED A;  5E2G A;  1BLC A;  3MBZ A;  5FA7 A;  2Z2M B;  4NET A;  4DXB A;  5G18 A;  3E2L A;  4S2P A;  5EOE A;  3SOI A;  4PPR A;  3HLD A;  4GB7 A;  2IWC A;  3PBR A;  1KE3 A;  3PBS A;  3MXS A;  3UE3 A;  1VM1 A;  1K55 A;  4ZJ1 A;  1BUL A;  3GSG A;  4E3J A;  4E3I A;  1L0G A;  3UN7 A;  4HBT A;  1W8Y A;  4OQI A;  5FAQ A;  3S4X A;  1RP5 A;  3Q07 A;  4JBF A;  1DJA A;  3E2K A;  1H5X A;  5GLA A;  4UA7 A;  5CGS A;  4B88 A;  2P9V B;  1Q2P A;  1NY0 A;  4OPR A;  3HLF A;  3AGE A;  4IVK A;  1ES3 A;  1XX2 A;  5HFO A;  2FFY A;  3SH9 A;  4OPZ A;  2EFX A;  1NYY A;  1PW8 A;  2XF3 A;  1L0F A;  1SHV A;  2Y2O A;  3M6B A;  3V5M A;  3UPN A;  1L0E A;  3V3R A;  1K57 C;  1MWR A;  1U60 A;  5EUA A;  3VP0 A;  3FV7 A;  3ZVW A;  3Q7V B;  4KZ5 A;  1QMF A;  2WKI A;  2WAF A;  1FSW A;  1PWC A;  4H8R A;  4LV2 A;  3PAE A;  2H0Y A;  2R9W A;  4A5R A;  4HBU A;  3IXH A;  1K6R A;  2XGN A;  4RYE A;  5HX9 A;  2PU4 A;  3PBQ A;  5E2E A;  3CJM A;  1M6K A;  4MNR A;  1JWV A;  3AGF A;  4E3O A;  2Y2P A;  1CEF A;  1W8Q A;  3I7J A;  4KQR A;  1CK3 A;  5HAR A;  2HPB A;  3HLC A;  4GD8 A;  4OKP A;  1LLB A;  4RX2 A;  1ES2 A;  4S2L A;  4UHU A;  3G32 A;  1WYC A;  2IWD A;  3IF5 A;  4LV1 A;  4OLD A;  1FR6 A;  4KG5 A;  1YLY A;  1CEG A;  1JVJ A;  1KDW A;  1O07 A;  5EE8 A;  5CHM A;  4P85 A;  5TR7 A;  3DW0 A;  1PW1 A;  4OOL A;  4DF6 A;  3OPH A;  2Y2Q A;  2XH9 A;  5J8X A;  1LI9 A;  1K57 A;  1N4O A;  1YLZ A;  3Q7Z A;  3G4P A;  4Y0U A;  2RCX A;  4LCM A;  3G34 A;  4U0X A;  5A92 A;  4DDY A;  3SH8 A;  1QME A;  4EWF A;  3IWO A;  1ESI A;  3HLB A;  4NK3 A;  3N6I A;  4ZTK A;  3UDX A;  2ZM2 A;  1TEM A;  1YLP A;  3IXD A;  2Y2N A;  4JXS A;  4JPM A;  4N9L A;  4N1H A;  4BEN A;  4GNU A;  3WRT A;  3TSG A;  3OCL A;  4PM7 A;  4OOM A;  4S2N A;  4WBG A;  3IXG A;  5EVI A;  2J9O A;  4QHC A;  3ZNT A;  4OP5 A;  4OP8 A;  1PZP A;  4JLF A;  3Q1F A;  4X56 A;  3NBL A;  1ALQ A;  3V3S A;  3MKE A;  3PAG A;  2XDM A;  1IKI A;  3GV9 A;  4UA6 A;  5EEC A;  3MXR A;  2Y2L A;  3HLG A;  3DWK A;  5FAO A;  3C4O A;  3BEB A;  3M6H A;  1LI0 A;  3UNW A;  4IVI A;  1Z6F A;  4F94 A;  4EBN A;  2Y2G A;  3MZD A;  4WMC A;  1BZA A;  4L0L A;  2IWB A;  4R0Q A;  3IF6 B;  4Q8I A;  2XD1 A;  4FCF A;  3VFH A;  3BFF A;  4RX3 A;  3IH8 A;  1YLT A;  3VFF A;  3UE0 A;  1K4E A;  5DTK A;  2HDQ A;  1WYB A;  5DVA A;  5GLC A;  2WZZ A;  1BSG A;  4GDB A;  3GMW A;  2XLN A;  5CGW A;  4R23 A;  3UY6 A;  1KGE A;  1MPL A;  1GHM A;  3PTE A;  2EX8 A;  3M2K A;  1E3U A;  1KE4 A;  4ID4 A;  4WEJ A;  2I72 A;  3AGD A;  1C3B A;  3HBR A;  5F1G A;  1SDE A;  4BLM A;  4BL3 A;  4DE0 A;  5JYO A;  5DTS A;  2HDS A;  4KZ6 A;  2EX9 A;  2Y2I A;  4QB8 A;  5A90 A;  1EI5 A;  5GHX A;  3DTM A;  5CGX A;  1GHI A;  4MBF A;  4WM9 A;  1MWS A;  4WZ4 A;  1L2S A;  3D4F A;  4KG6 A;  2P74 A;  3UPP A;  1ZG6 A;  4Y7P A;  3VSK A;  5DTT A;  3S22 A;  1WE4 A;  1NJ4 A;  1PYY A;  2ZQ7 A;  4N92 A;  1CI8 A;  1NZU A;  4YFM A;  4KZA A;  5F1F A;  3BM6 A;  2RL3 A;  3EQV A;  2WUQ A;  1YT4 A;  5TFQ A;  3BRM A;  2V20 A;  1E4D A;  4IED A;  4CPK A;  2ZMA A;  2WKH A;  1ZC2 A;  1NXY A;  4OPY A;  3IWQ A;  4PM9 A;  4UA9 A;  2H10 A;  4S2J A;  3N8R A;  2Y2K A;  5FQI A;  4XXR A;  3ZVT A;  4BL2 A;  2R9X A;  4Y0O A;  4BQM A;  2JCH A;  3FYZ A;  5DF8 A;  3UO9 A;  4WZ5 C;  5FAP A;  5CER A;  3N8S A;  2ZC5 B;  1BLS A;  4X55 A;  3G2Y A;  4X68 A;  1GA9 A;  1IEM A;  1JTD A;  3NY4 A;  3VP1 A;  4DE2 A;  2DNS A;  2ZC3 B;  2ZQC A;  4X53 A;  2XK1 A;  1ERM A;  3VP4 A;  2WKE A;  1XKZ A;  3LY4 A;  4GKU A;  4HEF A;  3ISG A;  1IYS A;  2E8I A;  4QJG A;  2WZX A;  4N1X A;  1KGG A;  3A3I A;  5FI7 A;  2Y2H A;  5HAQ A;  4ZBE A;  1RGZ A;  2HP6 A;  4S2N C;  4C75 A;  3WS2 A;  4GZB A;  5EVI C;  1E25 A;  1K4F A;  2EX2 A;  3FWL A;  3ZNY A;  2ZC6 B;  1JWP A;  3N7W A;  4OQG A;  5GHY A;  3A3F A;  3A3D A;  1NYM A;  3GQZ A;  4KQQ A;  1MKI A;  1RGY A;  4OQ0 A;  5HAP A;  3W4O A;  3LY3 A;  3Q82 A;  5FDH A;  1PI5 A;  4GD6 A;  1IEL A;  3NC8 A;  4WZ5 A;  3WS4 A;  3IH9 A;  4EV4 A;  4JF5 A;  1M40 A;  4R4S A;  1ONH A;  5EVI D;  3P09 A;  3TG9 A;  1FQG A;  2WYX A;  3OPL A;  2X02 A;  4R3B A;  4ZJ2 A;  1GHP A;  3GR2 A;  5A91 A;  3RXX A;  3UDI A;  1GA0 A;  1ES4 A;  1KVL A;  1XGJ A;  2HDR A;  3C5A A;  3HL9 A;  2BLS A;  4GN2 A;  4DE3 A;  4KZ8 A;  1I5Q A;  4BD1 A;  3VP2 A;  3IHB A;  4O7D A;  5BOH A;  3ZHH A;  3MKF A;  1YLJ A;  4XUX A;  4K0X A;  5KSH A;  5JYP A;  1FCM A;  4JXV A;  4LEN A;  3MZF A;  2ZJ9 A;  1S6R A;  1BLP A;  4FSF A;  3O88 A;  1PWG A;  5L2F A;  3TOI A;  4WMC D;  3OPP A;  2WGV A;  3NI9 A;  4JF4 A;  2BG1 A;  1HD8 A;  2X01 A;  1PWD A;  1KDS A;  4U3T A;  1AXB A;  2OSU A;  5EVI B;  3W4Q A;  2QPN A;  4JXW A;  5FQ9 A;  1HZO A;  4ZDX A;  3FZC A;  4OPQ A;  1IKG A;  2H5S A;  4S2I A;  2WGW A;  1RCJ A;  4FH2 A;  1ZG4 A;  1BLH A;  2CC1 A;  2DCF A;  4PM6 A;  3G31 A;  2Y2M A;  1TDL A;  2EX6 A;  4LV3 A;  5DF7 A;  3ZFZ A;  1GCE A;  1MWU A;  4B4Z A;  4P87 A;  2XFS A;  1XPB A;  3SS4 A;  3IQA A;  2QMI A;  2H0T A;  1W5D A;  2B5R A;  1E3U D;  1ESU A;  3ZG7 B;  4Z9Q A;  5CEB A;  3G30 A;  2XD5 A;  4XUZ A;  3UDF A;  5FSR A;  2PU2 A;  4GDN A;  5GLB A;  1SCW A;  3BFG A;  1MBL A;  2XQZ A;  1I2S A;  3W8K A;  2EFU A;  3G35 A;  3O86 A;  2OV5 A;  4E3N A;  3V50 A;  4OON A;  2Y2J A;  2HDU A;  4DXC A;  4R1G A;  4C6Y A;  5FQM A;  4PM5 A;  4E3M A;  3O87 A;  2A3U A;  5HW3 A;  1HTZ A;  3ZCZ A;  4E6W A;  1XGI A;  1MY8 A;  2EXA A;  3VP3 A;  1K25 A;  4Y0T A;  3OCN A;  4KZ4 A;  4C3Q A;  4KZ3 A;  4DKI A;  1EWZ A;  4P0M A;  3UPO A;  2J9P A;  3B3X A;  3CZD A;  1NRF A;  1YLW A;  2OLV A;  3BFE A;  3HRE A;  5KSC A;  1ERQ A;  3BFC A;  3GVB A;  1SDN A;  3A3J A;  5CTM A;  3O3V A;  4MLL A;  1HVB A;  4WYY A;  1YMX A;  3VSL A;  1G68 A;  3FKV A;  4X6T A;  1DJB A;  1H8Z A;  3BYD A;  4S2K A;  1FCO A;  4E3L A;  1XA1 A;  5KMW A;  4OOY A;  3HUO A;  2OLU A;  2C5W B;  3PBT A;  1KGF A;  1Y54 A;  1K6S A;  2WAE A;  4KEN B;  1TDG A;  5AQ7 A;  5HL1 A;  3ZG9 B;  1PI4 A;  3LO7 A;  3PBO A;  5CHJ A;  3Q81 A;  5U47 A;  1ZKJ A;  3ITB A;  5CEC A;  3NIA A;  4K91 A;  2WGI A;  4FD8 A;  3QHY A;  4DRT A;  3PBN A;  4R3J A;  4GOG A;  2P9V A;  2ZQA A;  5CXW A;  3SH7 A;  3DWZ A;  1ONG A;  3NDG A;  3MZE A;  3C7U A;  4RVA A;  3GTC A;  4E6X A;  5M18 A;  3VOZ A;  4JKT A;  4LV0 A;  4M3K A;  3LCE A;  2JE5 A;  2ZLY A;  4X69 A;  4OH0 A;  2X71 A;  1K54 C;  3Q7V A;  3QNB A;  5F82 A;  3G2Z A;  4LCL A;  2G2U A;  2G2W A;  2HP9 A;  3IWI A;  4K0W A;  3VOY A;  3ZGA B;  1YM1 A;  3EQU A;  4B4X A;  5A93 A;  2WAD A;  5TGF A;  4KZ9 A;  5FAT A;  5FQQ A;  4S2M A;  1CI9 A;  4JXG A;  1SKF A;  1FR1 A;  2C6W B;  3V39 A;  4MEZ A;  5I94 A;  3WRZ A;  5E43 A;  3OPR A;  4RA7 A;  1LL5 A;  2JC7 A;  4KG2 A;  4ZAM A;  5HAI A;  3ZG5 A;  2XR0 A;  2ZM0 A;  4KQO A;  3IHA A;  4YIN A;  4R4R A;  2PBY A;  5M19 A;  1PZO A;  3JYI A;  3SS5 A;  3BLM A; 
#chains in the Genus database with same CATH topology
 3SS3 A;  1YAX A;  2XRO A;  2VZW A;  1BTL A;  1P97 A;  5AQA A;  2V1Z A;  4ZJ3 A;  1A0K A;  1IFQ A;  4JF6 A;  1S4R A;  4I38 A;  2VGL M;  4N9K A;  4UEY A;  2J7V A;  5FQJ A;  4Y5F A;  4KUK A;  4EUZ A;  1NZO A;  5F83 A;  2VGJ A;  1MZU A;  2UWX A;  3NDE A;  3N8L A;  4HES A;  1K56 A;  2Q9N A;  2V1A A;  2QZ6 A;  1DY6 A;  4D60 A;  1N9B A;  2A24 B;  3HUN A;  1LT0 A;  3D72 A;  5FI2 A;  2GX5 A;  4OQH A;  3FKW A;  3HLW A;  3OC2 A;  3OZH A;  4BJP A;  5FAS A;  2V2F F;  5GHZ A;  1FOF A;  3H9W A;  4HOI A;  3QP8 A;  4E3K A;  4QY6 A;  1YSP A;  3LEZ A;  5EV0 A;  5EOO A;  3BEC A;  1ZHH B;  4UAA A;  5EVL A;  1W63 M;  1KE0 A;  1IYP A;  4WEL A;  1J9M A;  3A3E A;  3UE6 A;  3RJU A;  2Q9M A;  1Q2Q A;  3QP5 A;  5GL9 A;  3ZG8 B;  3ZG0 A;  5E2G A;  4HJ6 A;  4B93 A;  5FA7 A;  1GSV A;  3LR5 A;  5EOE A;  1V9Z A;  3LUQ A;  3UE3 A;  1VM1 A;  5FL3 A;  4ZJ1 A;  2JKR I;  4E3I A;  1L0G A;  5HWV A;  4ZRR A;  1RP5 A;  4JBF A;  4DJ3 A;  3L7H A;  4UA7 A;  1Q2P A;  4HY8 A;  3AGE A;  2D01 A;  1XX2 A;  4Q0J A;  4OPZ A;  2EFX A;  4CLC C;  5J3W A;  3VP0 A;  3ZVW A;  3Q7V B;  1PWC A;  3KSF A;  4RYE A;  4YOF A;  2HZ5 A;  2PU4 A;  5E2E A;  1M6K A;  3H82 A;  3AGF A;  5DJT A;  2Y2P A;  3MSH A;  2HPB A;  4GD8 A;  4OKP A;  4S2L A;  4UHU A;  4HI4 A;  2Y79 A;  3IF5 A;  1YKD A;  5TBM B;  1YLY A;  3FC7 A;  1JVJ A;  4DF6 A;  4P85 A;  1PW1 A;  3C2W A;  4OOL A;  3OPH A;  2Y2Q A;  2D02 A;  1K57 A;  1N4O A;  2O0Y A;  1YLZ A;  2RCX A;  4LCM A;  3SH8 A;  3IS2 A;  4UQI S;  3N6I A;  2ZM2 A;  1ACF A;  3T4T A;  2ZBB A;  1UWP X;  5J4E A;  3OCL A;  3H7W A;  3LR4 A;  2J9O A;  4F3L A;  4I5S A;  1PZP A;  3NEC A;  4KUO A;  3NBL A;  2Y8H A;  1IKI A;  5FAO A;  1L3L A;  1X0O A;  2WKR A;  4EBN A;  2B18 A;  2M1C A;  3IF6 B;  2XD1 A;  4FCF A;  3BFF A;  5CX7 A;  1D06 A;  5DTK A;  2HDQ A;  3IBR A;  4GDB A;  2QYB A;  5EFW A;  1GHM A;  2EX8 A;  3M2K A;  4EEP A;  3PXP A;  4WEJ A;  1SDE A;  3KYE A;  2HF6 A;  5GHX A;  3D4F A;  4Y7P A;  3VSK A;  4YFM A;  5F1F A;  2WUQ A;  1YPR A;  2V20 A;  3HJK A;  4DN0 A;  4CPK A;  2ZMA A;  2WKH A;  1ZC2 A;  3IWQ A;  2EWV A;  4S2J A;  5HDC A;  4XXR A;  2R9X A;  3U4L P;  4Y0O A;  2JKF A;  4I39 A;  3T1Q B;  4X25 A;  3G2Y A;  1IEM A;  1S67 L;  3ZYT A;  3ISG A;  1IYS A;  1KGG A;  1RGZ A;  2HP6 A;  5I5L A;  4C75 A;  4CLC D;  2HJE A;  5EVI C;  4MN5 A;  1K4F A;  3ZNY A;  3GQZ A;  4KQQ A;  3ZQ5 A;  5HAP A;  5FDH A;  3ICY A;  1D7E A;  2J3W A;  3BQA A;  3IH9 A;  4EV4 A;  1S4S A;  3TG9 A;  1FQG A;  2X02 A;  1GHP A;  1XGJ A;  3C5A A;  2P08 A;  1PRQ A;  4XUX A;  1F98 A;  5KSH A;  4L9E A;  2GZA A;  2INW A;  3O88 A;  1VB6 A;  3TOI A;  2K31 A;  2WGV A;  4FUW A;  4GHI A;  3UB6 A;  1P9R A;  2WKP A;  3W4Q A;  2QPN A;  4UQI M;  1RCJ A;  4PM6 A;  1P9W A;  2Y2M A;  3A0R A;  2EX6 A;  4LV3 A;  1H8M A;  4B4Z A;  5EVE A;  1XPB A;  3SS4 A;  2QMI A;  1E3U D;  5CEB A;  4Z9Q A;  3UDF A;  5HWW A;  1MBL A;  4E3N A;  3QP2 A;  4L9F A;  4PM5 A;  4E3M A;  4EER A;  3LI8 A;  3T4O A;  1HTZ A;  4E6W A;  4R38 A;  1XGI A;  2V1B A;  2EXA A;  1K25 A;  3OCN A;  4KZ4 A;  4XT2 A;  1YLW A;  2OLV A;  3BFC A;  3GVB A;  3UB5 P;  4WLA A;  1YMX A;  1G68 A;  3FKV A;  4S2K A;  2IA2 A;  3PYP A;  2OWJ A;  1XA1 A;  3HUO A;  1STZ A;  2W27 A;  1K6S A;  3OLO A;  3PBO A;  3BWL A;  4K91 A;  3QHY A;  2BAS A;  3PBN A;  4R3J A;  5J7E A;  3T1S A;  1ONG A;  3VOZ A;  4LV0 A;  2W3F A;  3QNB A;  5F82 A;  3G2Z A;  4K0W A;  2HV1 A;  1CI9 A;  3HCY A;  3V39 A;  1LL5 A;  4KG2 A;  5DJU A;  4YIN A;  4BBV A;  4R4R A;  4AFI A;  4P87 A;  2PYR A;  4FTX A;  4QD4 A;  2DRW A;  1ES5 A;  2Y59 A;  1BT5 A;  5KSC A;  1VQQ A;  1K54 A;  4KZB A;  5HPF A;  3IT9 A;  1K56 D;  1KVM A;  3IF6 C;  4JGQ A;  1O7E A;  2HP5 A;  4QY5 A;  4PMA A;  5DF9 A;  5AQ9 A;  3DTK A;  2W0N A;  1XJ3 A;  3C7V A;  1SKO A;  2JKR M;  3T4S A;  4Y3I A;  3WS5 A;  2WGW B;  3CMZ A;  1XXM A;  2XEP A;  4R6L A;  3CAX A;  2KDK A;  3S1Y A;  2XFT A;  3MFD A;  1IYO A;  4OLG A;  2GDN A;  4I3I A;  5E2F A;  2J8Y A;  1TS6 A;  1MXO A;  1DP9 A;  2VGK A;  3KSG A;  4OVD A;  4P6B A;  3T12 B;  3LYX A;  3VMA A;  4HP9 A;  4PM8 A;  3QP4 A;  1W79 A;  4NXF A;  2PD7 A;  3HLE A;  4II7 A;  2G7U A;  1PIO A;  1BUE A;  4MBH A;  4D2O A;  4S2O A;  2JKT I;  1TD5 A;  4CJN A;  1K55 C;  2ZQD A;  1K38 A;  5L09 A;  3NCK A;  4PKY A;  2WK0 A;  1OME A;  1F5M A;  3HUM A;  2W1R A;  3T4J A;  2ZQ9 A;  4QWO A;  4ARZ B;  1H8Y A;  3BW6 A;  3E2L A;  4S2P A;  3SOI A;  3HLD A;  1ODV A;  3PBR A;  1KE3 A;  3PBS A;  2EA9 A;  4H6J A;  3OOV A;  1DJA A;  3O5Y A;  4PAU A;  2MJ6 A;  2W3G A;  4B88 A;  3SW1 A;  2P9V B;  1NY0 A;  3CLO A;  4IVK A;  3K2N A;  2FFY A;  3MS6 A;  1PW8 A;  3V5M A;  3RH8 B;  2PT7 A;  3UPN A;  1L0E A;  1U60 A;  4KZ5 A;  1QMF A;  2H0Y A;  2R9W A;  5MC7 A;  3IX4 A;  4BMW A;  3CJM A;  3MJQ A;  4MNR A;  3GEC A;  4E3O A;  5HAR A;  4G3V A;  3MFX A;  1LLB A;  4RX2 A;  4Y15 A;  1CEG A;  2ZMV A;  1O07 A;  4Z1W A;  1K0K A;  2XA7 S;  3VV4 A;  3Q7Z A;  4DDY A;  1QME A;  1S1Y A;  2Y2N A;  2NUP C;  4JXS A;  3E4Q A;  4N1H A;  3TW8 A;  3IXG A;  2WKQ A;  5EVI A;  4QHC A;  4OP5 A;  3LIA A;  3MKE A;  5EEC A;  3MXR A;  2Y2L A;  3BEB A;  1LI0 A;  5K5B A;  1Z6F A;  3CPT A;  1BZA A;  4L0L A;  3D9Y A;  5HD3 A;  4R0Q A;  2K2N A;  3T4K A;  3IH8 A;  3VFF A;  3UE0 A;  2PYP A;  1WYB A;  5DVA A;  5GLC A;  2WZZ A;  2XLN A;  3S7O A;  1MPL A;  3PTE A;  1GSX A;  5HSQ A;  2I72 A;  3AGD A;  4DE0 A;  3PHY A;  3KX0 X;  3T4Q A;  5A90 A;  2V8F A;  4HJ4 A;  5CGX A;  1GHI A;  4MBF A;  4WM9 A;  1MWS A;  2P74 A;  3UPP A;  2W1T A;  3UB7 A;  1WE4 A;  1NJ4 A;  1PYY A;  4N92 A;  1CI8 A;  4Q0I A;  1YT4 A;  1PNE A;  4IED A;  3TRC A;  2A2L A;  5C5K A;  4UA9 A;  3N8R A;  3F1P A;  3ZVT A;  3FPV A;  3EEH A;  4BQM A;  3FYZ A;  5FEF A;  3LR0 A;  1BLS A;  4X68 A;  1GA9 A;  2ZC3 B;  4EUV A;  1ERM A;  2QHK A;  4HEF A;  4QJG A;  4N1X A;  5HAQ A;  2Y2H A;  4ZBE A;  1E25 A;  1VEU A;  2EX2 A;  2ZC6 B;  4ESP A;  4OQG A;  3H82 B;  1PI5 A;  4GD6 A;  1G28 A;  5F68 A;  1D1J A;  4E04 A;  3MQO A;  4WZ5 A;  3WS4 A;  4QPR A;  4R4S A;  2WYX A;  4ZJ2 A;  4R3B A;  2E8J A;  1GA0 A;  2P7J A;  4MDZ A;  5TJJ A;  1KVL A;  3LFV A;  4Q0H A;  2BLS A;  4DE3 A;  1I5Q A;  2VV8 A;  3VP2 A;  3IHB A;  4WN5 A;  1F9I A;  3MKF A;  3IS2 B;  4R3A A;  4JXV A;  5JYP A;  4LEN A;  2ZJ9 A;  4FSF A;  1PWG A;  4WMC D;  3NUL A;  3C30 A;  4JF4 A;  2BG1 A;  2X01 A;  4U3T A;  1N9L A;  1AXB A;  2XA7 M;  2OSU A;  3H7W B;  5HD5 A;  4F3L B;  2PDR A;  4OPQ A;  3CI6 A;  4S2I A;  4FH2 A;  2CC1 A;  3G31 A;  1TDL A;  1EW0 A;  4B9O A;  4ETX A;  3MF0 A;  5AJG A;  2XFS A;  3IQA A;  2H0T A;  4ETZ A;  3MQ0 A;  1ESU A;  5L07 A;  2VV7 A;  3NHQ A;  4XUZ A;  5DFX A;  5FSR A;  2EWW A;  2XQZ A;  3W8K A;  3O86 A;  2VKS A;  1LSX A;  2Y2J A;  3VOL A;  4DXC A;  3O87 A;  3DBA A;  2QJ5 A;  3CUE C;  1NLZ A;  3VP3 A;  4BBU A;  4WL9 A;  4Y0T A;  4C3Q A;  4P0M A;  1MKM A;  2J9P A;  3B3X A;  3CZD A;  3HRE A;  2B95 A;  3EGX C;  1ERQ A;  3VE3 A;  1WA9 A;  2JKG A;  3A3J A;  1HVB A;  4WYY A;  4LGW A;  2JHE A;  2C5W B;  5F5Y A;  3PBT A;  2FH5 A;  3GDI A;  1T18 A;  4KEN B;  5AQ7 A;  3ZG9 B;  4K08 A;  3ULF A;  3ITB A;  3NIA A;  5CXW A;  2PR6 A;  1F2K A;  2W3E A;  2VV6 A;  3NDG A;  3C7U A;  5M18 A;  3GTC A;  5FEG A;  4M3K A;  4LPZ A;  3IWI A;  3VOY A;  2HP9 A;  4B4X A;  3JPU A;  4KZ9 A;  1SKF A;  2O9B A;  3S7N A;  4MEZ A;  3FG8 A;  2JC7 A;  2ZM0 A;  2JKT M;  4O0P A;  1FIK A;  3BLM A;  4EW7 A;  4HIA A;  4IUK A;  2J3T D;  3B42 A;  4FOF A;  4WEK A;  3TE8 A;  1FCN A;  1ERO A;  1LL9 A;  2GJ3 A;  1UWN X;  3E0Y A;  1Z09 A;  1OT6 A;  2Z2L B;  3BLS A;  3BFD A;  4GHI B;  2Z6D A;  1TS0 A;  3IBJ A;  2ZC4 B;  4EQI A;  3G6O A;  4LFU A;  5EPH A;  4DDS A;  3WS0 A;  2JN7 A;  1OJ5 A;  2KX6 A;  3N4I A;  4GW9 A;  4MBK A;  2HGV A;  1W7F A;  3M2J A;  4FH4 A;  3HVF A;  1S0W A;  2Y91 A;  1DJC A;  4GS9 A;  1LHY A;  4BBT A;  3E4P A;  3F1N A;  3ZDJ A;  2CMN A;  3UE1 A;  1N9O A;  1ZTU A;  3W4P A;  1IYQ A;  3TJZ C;  3E4O A;  3CG5 A;  3WWX A;  3T4L A;  4DMZ A;  5AQB A;  4QU3 A;  4XT2 B;  2Y4A A;  3RXW A;  3GRJ A;  1XP4 A;  3KSI A;  5IHV A;  2ZQ8 A;  3R7W A;  5FQK A;  1BLC A;  2V0W A;  3MBZ A;  2L0W A;  4MMN A;  4NET A;  5G18 A;  4GB7 A;  2IWC A;  3A0V A;  2V9A A;  2VK3 A;  3MXS A;  3GSG A;  3LID A;  4HBT A;  4OQI A;  5FAQ A;  3Q07 A;  1VHM A;  1OT9 A;  4X1L A;  3C8C A;  3NOP C;  5GLA A;  4OPR A;  3HLF A;  3QP6 A;  1ES3 A;  5HFO A;  1NYY A;  4Y13 A;  2Y2O A;  1SHV A;  1K57 C;  1MWR A;  3FV7 A;  1OTA A;  4H8R A;  2WAF A;  1UGU A;  3LEQ A;  4A5R A;  5IS1 A;  5KIZ A;  2XGN A;  3PBQ A;  3A0S A;  3I7J A;  1CEF A;  1W8Q A;  4KQR A;  1CK3 A;  2VEA A;  1ES2 A;  4EET B;  3IX8 A;  4LV1 A;  3LGO A;  2H28 A;  5EE8 A;  5CHM A;  5TR7 A;  3NJA A;  4CLC A;  1LI9 A;  3KYQ A;  3G4P A;  5IT5 A;  4EWF A;  1ESI A;  3HLB A;  4ZTK A;  4MN6 A;  1TEM A;  1YLP A;  2PRF A;  4JPM A;  4N9L A;  2ZOI A;  4BEN A;  1GSW A;  1P0Z A;  4PM7 A;  5EM0 A;  3B33 A;  5A8B A;  2PAV P;  3ZNT A;  1VET A;  4JLF A;  4X56 A;  3V3S A;  1SKO B;  3PAG A;  3MXQ A;  2ZL1 A;  4UA6 A;  3HLG A;  1NRJ A;  3DWK A;  4RQ9 A;  3M6H A;  4JGO A;  4IVI A;  3MZD A;  2OAQ 1;  2IWB A;  4Q8I A;  4RX3 A;  3DTE A;  3MQQ A;  1TF1 A;  2NUT C;  3UB8 A;  1BSG A;  3C38 A;  2QJ7 A;  3T50 A;  3GMW A;  4R23 A;  3W2Z A;  2M7U A;  1KGE A;  1MC0 A;  4YWZ A;  1E3U A;  1KE4 A;  4PHT A;  3HBR A;  4BLM A;  4HP4 A;  5DTS A;  1KOU A;  2Y2I A;  4QB8 A;  1EI5 A;  3UMD A;  3DTM A;  2P04 A;  1L2S A;  3V67 A;  1AWI A;  1ZG6 A;  5F6A A;  3S7Q A;  3S22 A;  1V9Y A;  3DTI A;  4CLC E;  4KZA A;  2RL3 A;  3EQV A;  4I3A A;  1E4D A;  3E98 A;  1NXY A;  4H6J B;  1YSQ A;  2H10 A;  2B02 A;  5FQI A;  4BL2 A;  3PR6 A;  2JCH A;  3LIF A;  3UO9 A;  5FAP A;  2ZC5 B;  5DFY A;  5HPI A;  1JTD A;  4HJ3 A;  2DNS A;  2ZQC A;  1N9N A;  2XK1 A;  1XJ4 A;  3F1O A;  2WKE A;  2E8I A;  2K7S A;  2WZX A;  3A3I A;  5FI7 A;  4S2N C;  3WS2 A;  2VLG A;  1S66 L;  3FWL A;  1OPX A;  3LIC A;  5GHY A;  3A3F A;  3A3D A;  1NYM A;  1MKI A;  4OQ0 A;  2J80 A;  3W4O A;  2R78 A;  3LY3 A;  3Q82 A;  1IEL A;  2KLI A;  2UV0 E;  1TS7 A;  3P09 A;  2W3D A;  2O9A A;  3OPL A;  3RXX A;  3GR2 A;  3UDI A;  1ES4 A;  2HDR A;  4KZ8 A;  4BD1 A;  3EGD C;  4DJ2 A;  4O7D A;  2M7V A;  3KSH A;  1T1C A;  1YLJ A;  4K0X A;  1FCM A;  3MZF A;  3NI9 A;  1HD8 A;  1PWD A;  2YKH A;  4PKY G;  5EVI B;  1Y28 A;  1HZO A;  3FZC A;  1IKG A;  2H5S A;  1ZG4 A;  1BLH A;  2DCF A;  2ZMF A;  3ZFZ A;  4YNR A;  1GCE A;  2A24 A;  4NXE A;  3MR0 A;  4EEU A;  1W5D A;  2B5R A;  3CPT B;  3BY9 A;  4LRX C;  4EXO A;  2XD5 A;  5GLB A;  1DP6 A;  4GDN A;  1SCW A;  3BFG A;  3UME A;  3B47 A;  2EFU A;  3G35 A;  4C6Y A;  5FQM A;  2A3U A;  5HW3 A;  3EOI A;  1MY8 A;  1DRM A;  4DKI A;  4KZ3 A;  1EWZ A;  3P01 A;  3BFE A;  1SDN A;  1XJ6 A;  5CTM A;  3T1R A;  4MLL A;  2LB9 A;  3VSL A;  5IU1 A;  1DJB A;  1H8Z A;  2W1T B;  4OOY A;  5L8M A;  5HDD A;  2OLU A;  1KGF A;  4NXG A;  4L9G A;  1TDG A;  1PI4 A;  3Q81 A;  5U47 A;  2WGI A;  3F1P B;  4O8G A;  2ZQA A;  3K3C A;  3MMH A;  3BY8 A;  1CJF A;  3MZE A;  4RVA A;  4E6X A;  4Y17 A;  3JVV A;  2JE5 A;  2ZLY A;  4OH0 A;  1K54 C;  3Q7V A;  5EM1 A;  2G2U A;  2G2W A;  3ZGA B;  4R70 A;  1YM1 A;  3EQU A;  1BYW A;  5TGF A;  5FAT A;  3FPW A;  4GCZ A;  4JXG A;  1FR1 A;  2C6W B;  1VEU B;  4JGP A;  4IJG A;  5E43 A;  3OPR A;  4RA7 A;  5HAI A;  4ZAM A;  3ZG5 A;  2XR0 A;  2J3T C;  4CQH A;  3BQ8 A;  5DKK A;  5TBM A;  2PBY A;  2VJW A;  1PZO A;  3JYI A;  5A93 A;  1OTI A;  2YKF A;  3NOT C;  1XA7 A;  2FFF B;  1JTG A;  4IBX A;  4DE1 A;  1JWZ A;  1XFQ A;  5CRF A;  3P98 A;  1YMS A;  1J3W A;  2ZD8 A;  1OTE A;  5FDS A;  5FI6 A;  4BD0 A;  5CHU A;  4IBR A;  5KZH A;  2DMW A;  2XSS A;  3D3O A;  1L0D A;  2JBF A;  2AVX A;  2EXB A;  2Y55 A;  5E2H A;  4EBL A;  3C4P A;  5M1A A;  1JNU A;  1FSY A;  2LB5 A;  1YQS A;  3WS1 A;  5CTN A;  3EWK A;  1MWT A;  3IF6 A;  4O01 A;  2ZC7 A;  1I2W A;  5HDS A;  2ZM8 A;  4P6Z S;  2ZOH A;  1G6A A;  1OTB A;  5D3O A;  2GNX A;  3QNC A;  4NEE D;  5LBR A;  3ITA A;  5GLD A;  2PR5 A;  2A49 A;  3QP1 A;  2I9V A;  4EBP A;  3HJI A;  3LR3 A;  1TVF A;  4LRZ E;  2O9C A;  4LRY C;  1OJG A;  1DP8 A;  4U0T A;  4KZ7 A;  3CIT A;  3IXB A;  5L10 A;  5CED A;  2Z2M B;  2Q0O A;  4DXB A;  4PPR A;  1G6O A;  1K55 A;  4E3J A;  1BUL A;  3UN7 A;  1W8Y A;  3S4X A;  5G4Z A;  3E2K A;  1H5X A;  5CGS A;  3KYZ A;  1HLU P;  3SH9 A;  3M6B A;  5DKL A;  2XF3 A;  1L0F A;  4GJ4 A;  3V3R A;  5EUA A;  2WKI A;  3LIB A;  1FSW A;  4LV2 A;  4WF0 A;  3PAE A;  4HBU A;  3IXH A;  1K6R A;  4GLQ A;  5HX9 A;  1H3Q A;  1PFL A;  1JWV A;  3KO6 A;  5HL6 A;  3HLC A;  4I3J A;  5AVE A;  3G32 A;  1WYC A;  2IWD A;  4OLD A;  5G4Y A;  1FR6 A;  3K3D A;  4KG5 A;  1KDW A;  5HZH A;  3DW0 A;  2XH9 A;  3UB9 A;  5J8X A;  4IUH A;  4Y0U A;  4ME4 A;  5A92 A;  3G34 A;  4U0X A;  3IWO A;  3P7N A;  2OOL A;  4NK3 A;  3UDX A;  3T1X A;  4Y2F A;  3IXD A;  4GNU A;  3WRT A;  3TSG A;  4OOM A;  4S2N A;  4WBG A;  2V8C A;  4OP8 A;  2L4R A;  3Q1F A;  1ALQ A;  2XDM A;  3GV9 A;  3OBF A;  2QWS A;  3C4O A;  4M4X A;  1T1A A;  4G3W A;  1CQA A;  3UNW A;  4F94 A;  2VA0 A;  2Y2G A;  4WMC A;  1SZV A;  1H0M A;  1G5U A;  3VFH A;  2BTF P;  2PD8 A;  1YLT A;  4GS9 B;  3EEA A;  1K4E A;  3F1N B;  1XJ2 A;  5CGW A;  3UY6 A;  4P6Z M;  4ID4 A;  5F1G A;  1C3B A;  5JYO A;  4BL3 A;  2HDS A;  4JGR A;  3LI9 A;  4KZ6 A;  2EX9 A;  2Z6C A;  1TS8 A;  3CWF A;  4BWI A;  4WZ4 A;  4KG6 A;  3R7W B;  4HHD A;  2L1M A;  2PHY A;  5DTT A;  2HJ9 C;  2ZQ7 A;  4HH3 A;  1NZU A;  3BM6 A;  3VE4 A;  5TFQ A;  3BRM A;  4IHQ A;  4NXB A;  2O99 A;  4OPY A;  4PM9 A;  2Y2K A;  1CF0 A;  5DF8 A;  4WZ5 C;  5CER A;  3N8S A;  3DAV A;  4HNB A;  4NKP A;  4X55 A;  3NY4 A;  3VP1 A;  4DE2 A;  4X53 A;  3VP4 A;  1XKZ A;  3LY4 A;  4GKU A;  4NG2 A;  4X1M A;  4GZB A;  3IX3 A;  1JWP A;  3N7W A;  2FZ0 A;  1RGY A;  2VGL S;  3NC8 A;  4KQD A;  1OTD A;  4JF5 A;  1M40 A;  5EVI D;  1ONH A;  5A91 A;  1LL8 A;  4EU0 A;  5HWT A;  3HL9 A;  4CLC B;  4GN2 A;  5BOH A;  4MCW A;  4G3K A;  3ZHH A;  5AVF A;  2XRN A;  3L9K A;  1S6R A;  1BLP A;  5L2F A;  3OPP A;  3NOU C;  1KDS A;  2KOI A;  1XFN A;  4JXW A;  1VET B;  5FQ9 A;  4ZDX A;  2OAP 1;  1W63 Q;  2VX8 A;  2WGW A;  2ZL1 B;  3R4K A;  1IOU A;  5DF7 A;  1MWU A;  2QKP A;  3RTY A;  3ZG7 B;  3G30 A;  2ACG A;  1LSW A;  2PU2 A;  1I2S A;  3S7P A;  2OV5 A;  3CHW P;  3V50 A;  4OON A;  2HDU A;  4MN7 A;  1NWZ A;  4R1G A;  3ZCZ A;  3JVU A;  1FIL A;  3UPO A;  3BJN A;  2V0U A;  1NRF A;  3RFB A;  1LSV A;  3O3V A;  1NLY A;  4ARZ A;  2OWH A;  4EQ1 A;  4X6T A;  3BYD A;  4HH2 A;  1FCO A;  4E3L A;  5KMW A;  4WUJ A;  1Y54 A;  2WAE A;  5HL1 A;  5CHJ A;  3LO7 A;  3CUE A;  3LIE A;  1Y4O A;  1ZKJ A;  5CEC A;  4FD8 A;  4HQA A;  4DRT A;  4GOG A;  2P9V A;  3SZT A;  3SH7 A;  3DWZ A;  1S1Z A;  4JKT A;  4LLO B;  3LCE A;  4X69 A;  2X71 A;  3F1O B;  4LCL A;  1T1B A;  2WAD A;  5FQQ A;  4S2M A;  5F69 A;  5I94 A;  3WRZ A;  3U2A A;  4EES A;  2PBD P;  4KQO A;  1T19 A;  3IHA A;  2W3H A;  5M19 A;  3SS5 A; 
#chains in the Genus database with same CATH homology
 3SS3 A;  4QD4 A;  2DRW A;  1ES5 A;  1BTL A;  1BT5 A;  1XA7 A;  2Y59 A;  1VQQ A;  2V1Z A;  5AQA A;  4ZJ3 A;  1K54 A;  4KZB A;  2FFF B;  3IT9 A;  1JTG A;  4JF6 A;  4IBX A;  4WEK A;  1K56 D;  1KVM A;  3IF6 C;  4N9K A;  1O7E A;  1FCN A;  4DE1 A;  1ERO A;  2HP5 A;  2J7V A;  4QY5 A;  1LL9 A;  1JWZ A;  4PMA A;  5FQJ A;  5DF9 A;  5AQ9 A;  2Z2L B;  3BLS A;  4EUZ A;  5CRF A;  1NZO A;  3P98 A;  3BFD A;  5F83 A;  2VGJ A;  1YMS A;  2UWX A;  3NDE A;  3C7V A;  3N8L A;  4HES A;  2ZD8 A;  1K56 A;  5FI6 A;  4BD0 A;  5KZH A;  5CHU A;  4IBR A;  2ZC4 B;  3WS5 A;  1L0D A;  4EQI A;  2WGW B;  2JBF A;  2Q9N A;  3CMZ A;  1XXM A;  2XEP A;  5EPH A;  4DDS A;  3WS0 A;  2EXB A;  5E2H A;  2Y55 A;  2QZ6 A;  2XFT A;  1DY6 A;  3MFD A;  3S1Y A;  4EBL A;  3N4I A;  3C4P A;  5M1A A;  1FSY A;  1N9B A;  1IYO A;  4OLG A;  2GDN A;  3HUN A;  4MBK A;  5E2F A;  2J8Y A;  1YQS A;  1MXO A;  5CTN A;  5FI2 A;  3WS1 A;  1MWT A;  3FKW A;  4OQH A;  1W7F A;  3IF6 A;  2VGK A;  3HLW A;  3M2J A;  4OVD A;  4P6B A;  2ZC7 A;  4FH4 A;  1I2W A;  3HVF A;  2ZM8 A;  3OC2 A;  3OZH A;  4BJP A;  5FAS A;  1S0W A;  3VMA A;  2V2F F;  1G6A A;  4PM8 A;  5GHZ A;  1FOF A;  2Y91 A;  1DJC A;  1W79 A;  5D3O A;  1LHY A;  3HLE A;  3QNC A;  1PIO A;  1BUE A;  4MBH A;  4QY6 A;  3ZDJ A;  4E3K A;  4D2O A;  3UE1 A;  4S2O A;  3ITA A;  3LEZ A;  5GLD A;  4CJN A;  1K55 C;  3W4P A;  5EOO A;  3BEC A;  2A49 A;  4UAA A;  5EVL A;  2ZQD A;  1K38 A;  1IYQ A;  3WWX A;  1KE0 A;  3CG5 A;  1IYP A;  3NCK A;  4WEL A;  1J9M A;  4EBP A;  3A3E A;  5AQB A;  4QU3 A;  2WK0 A;  1TVF A;  1OME A;  3HUM A;  3RJU A;  2Y4A A;  3RXW A;  2Q9M A;  2ZQ9 A;  4U0T A;  3GRJ A;  4KZ7 A;  1Q2Q A;  1XP4 A;  5GL9 A;  3IXB A;  2ZQ8 A;  5IHV A;  1H8Y A;  5FQK A;  3ZG8 B;  3ZG0 A;  5CED A;  5E2G A;  1BLC A;  3MBZ A;  5FA7 A;  2Z2M B;  4NET A;  4DXB A;  5G18 A;  3E2L A;  4S2P A;  5EOE A;  3SOI A;  4PPR A;  3HLD A;  4GB7 A;  2IWC A;  3PBR A;  1KE3 A;  3PBS A;  3MXS A;  3UE3 A;  1VM1 A;  1K55 A;  4ZJ1 A;  1BUL A;  3GSG A;  4E3J A;  4E3I A;  1L0G A;  3UN7 A;  4HBT A;  1W8Y A;  4OQI A;  5FAQ A;  3S4X A;  1RP5 A;  3Q07 A;  4JBF A;  1DJA A;  3E2K A;  1H5X A;  5GLA A;  4UA7 A;  5CGS A;  4B88 A;  2P9V B;  1Q2P A;  1NY0 A;  4OPR A;  3HLF A;  3AGE A;  4IVK A;  1ES3 A;  1XX2 A;  5HFO A;  2FFY A;  3SH9 A;  4OPZ A;  2EFX A;  1NYY A;  1PW8 A;  2XF3 A;  1L0F A;  1SHV A;  2Y2O A;  3M6B A;  3V5M A;  3UPN A;  1L0E A;  3V3R A;  1K57 C;  1MWR A;  1U60 A;  5EUA A;  3VP0 A;  3FV7 A;  3ZVW A;  3Q7V B;  4KZ5 A;  1QMF A;  2WKI A;  2WAF A;  1FSW A;  1PWC A;  4H8R A;  4LV2 A;  3PAE A;  2H0Y A;  2R9W A;  4A5R A;  4HBU A;  3IXH A;  1K6R A;  2XGN A;  4RYE A;  5HX9 A;  2PU4 A;  3PBQ A;  5E2E A;  3CJM A;  1M6K A;  4MNR A;  1JWV A;  3AGF A;  4E3O A;  2Y2P A;  1CEF A;  1W8Q A;  3I7J A;  4KQR A;  1CK3 A;  5HAR A;  2HPB A;  3HLC A;  4GD8 A;  4OKP A;  1LLB A;  4RX2 A;  1ES2 A;  4S2L A;  4UHU A;  3G32 A;  1WYC A;  2IWD A;  3IF5 A;  4LV1 A;  4OLD A;  1FR6 A;  4KG5 A;  1YLY A;  1CEG A;  1JVJ A;  1KDW A;  1O07 A;  5EE8 A;  5CHM A;  4P85 A;  5TR7 A;  3DW0 A;  1PW1 A;  4OOL A;  4DF6 A;  3OPH A;  2Y2Q A;  2XH9 A;  5J8X A;  1LI9 A;  1K57 A;  1N4O A;  1YLZ A;  3Q7Z A;  3G4P A;  4Y0U A;  2RCX A;  4LCM A;  3G34 A;  4U0X A;  5A92 A;  4DDY A;  3SH8 A;  1QME A;  4EWF A;  3IWO A;  1ESI A;  3HLB A;  4NK3 A;  3N6I A;  4ZTK A;  3UDX A;  2ZM2 A;  1TEM A;  1YLP A;  3IXD A;  2Y2N A;  4JXS A;  4JPM A;  4N9L A;  4N1H A;  4BEN A;  4GNU A;  3WRT A;  3TSG A;  3OCL A;  4PM7 A;  4OOM A;  4S2N A;  4WBG A;  3IXG A;  5EVI A;  2J9O A;  4QHC A;  3ZNT A;  4OP5 A;  4OP8 A;  1PZP A;  4JLF A;  3Q1F A;  4X56 A;  3NBL A;  1ALQ A;  3V3S A;  3MKE A;  3PAG A;  2XDM A;  1IKI A;  3GV9 A;  4UA6 A;  5EEC A;  3MXR A;  2Y2L A;  3HLG A;  3DWK A;  5FAO A;  3C4O A;  3BEB A;  3M6H A;  1LI0 A;  3UNW A;  4IVI A;  1Z6F A;  4F94 A;  4EBN A;  2Y2G A;  3MZD A;  4WMC A;  1BZA A;  4L0L A;  2IWB A;  4R0Q A;  3IF6 B;  4Q8I A;  2XD1 A;  4FCF A;  3VFH A;  3BFF A;  4RX3 A;  3IH8 A;  1YLT A;  3VFF A;  3UE0 A;  1K4E A;  5DTK A;  2HDQ A;  1WYB A;  5DVA A;  5GLC A;  2WZZ A;  1BSG A;  4GDB A;  3GMW A;  2XLN A;  5CGW A;  4R23 A;  3UY6 A;  1KGE A;  1MPL A;  1GHM A;  3PTE A;  2EX8 A;  3M2K A;  1E3U A;  1KE4 A;  4ID4 A;  4WEJ A;  2I72 A;  3AGD A;  1C3B A;  3HBR A;  5F1G A;  1SDE A;  4BLM A;  4BL3 A;  4DE0 A;  5JYO A;  5DTS A;  2HDS A;  4KZ6 A;  2EX9 A;  2Y2I A;  4QB8 A;  5A90 A;  1EI5 A;  5GHX A;  3DTM A;  5CGX A;  1GHI A;  4MBF A;  4WM9 A;  1MWS A;  4WZ4 A;  1L2S A;  3D4F A;  4KG6 A;  2P74 A;  3UPP A;  1ZG6 A;  4Y7P A;  3VSK A;  5DTT A;  3S22 A;  1WE4 A;  1NJ4 A;  1PYY A;  2ZQ7 A;  4N92 A;  1CI8 A;  1NZU A;  4YFM A;  4KZA A;  5F1F A;  3BM6 A;  2RL3 A;  3EQV A;  2WUQ A;  1YT4 A;  5TFQ A;  3BRM A;  2V20 A;  1E4D A;  4IED A;  4CPK A;  2ZMA A;  2WKH A;  1ZC2 A;  1NXY A;  4OPY A;  3IWQ A;  4PM9 A;  4UA9 A;  2H10 A;  4S2J A;  3N8R A;  2Y2K A;  5FQI A;  4XXR A;  3ZVT A;  4BL2 A;  2R9X A;  4Y0O A;  4BQM A;  2JCH A;  3FYZ A;  5DF8 A;  3UO9 A;  4WZ5 C;  5FAP A;  5CER A;  3N8S A;  2ZC5 B;  1BLS A;  4X55 A;  3G2Y A;  4X68 A;  1GA9 A;  1IEM A;  1JTD A;  3NY4 A;  3VP1 A;  4DE2 A;  2DNS A;  2ZC3 B;  2ZQC A;  4X53 A;  2XK1 A;  1ERM A;  3VP4 A;  2WKE A;  1XKZ A;  3LY4 A;  4GKU A;  4HEF A;  3ISG A;  1IYS A;  2E8I A;  4QJG A;  2WZX A;  4N1X A;  1KGG A;  3A3I A;  5FI7 A;  2Y2H A;  5HAQ A;  4ZBE A;  1RGZ A;  2HP6 A;  4S2N C;  4C75 A;  3WS2 A;  4GZB A;  5EVI C;  1E25 A;  1K4F A;  2EX2 A;  3FWL A;  3ZNY A;  2ZC6 B;  1JWP A;  3N7W A;  4OQG A;  5GHY A;  3A3F A;  3A3D A;  1NYM A;  3GQZ A;  4KQQ A;  1MKI A;  1RGY A;  4OQ0 A;  5HAP A;  3W4O A;  3LY3 A;  3Q82 A;  5FDH A;  1PI5 A;  4GD6 A;  1IEL A;  3NC8 A;  4WZ5 A;  3WS4 A;  3IH9 A;  4EV4 A;  4JF5 A;  1M40 A;  4R4S A;  1ONH A;  5EVI D;  3P09 A;  3TG9 A;  1FQG A;  2WYX A;  3OPL A;  2X02 A;  4R3B A;  4ZJ2 A;  1GHP A;  3GR2 A;  5A91 A;  3RXX A;  3UDI A;  1GA0 A;  1ES4 A;  1KVL A;  1XGJ A;  2HDR A;  3C5A A;  3HL9 A;  2BLS A;  4GN2 A;  4DE3 A;  4KZ8 A;  1I5Q A;  4BD1 A;  3VP2 A;  3IHB A;  4O7D A;  5BOH A;  3ZHH A;  3MKF A;  1YLJ A;  4XUX A;  4K0X A;  5KSH A;  5JYP A;  1FCM A;  4JXV A;  4LEN A;  3MZF A;  2ZJ9 A;  1S6R A;  1BLP A;  4FSF A;  3O88 A;  1PWG A;  5L2F A;  3TOI A;  4WMC D;  3OPP A;  2WGV A;  3NI9 A;  4JF4 A;  2BG1 A;  1HD8 A;  2X01 A;  1PWD A;  1KDS A;  4U3T A;  1AXB A;  2OSU A;  5EVI B;  3W4Q A;  2QPN A;  4JXW A;  5FQ9 A;  1HZO A;  4ZDX A;  3FZC A;  4OPQ A;  1IKG A;  2H5S A;  4S2I A;  2WGW A;  1RCJ A;  4FH2 A;  1ZG4 A;  1BLH A;  2CC1 A;  2DCF A;  4PM6 A;  3G31 A;  2Y2M A;  1TDL A;  2EX6 A;  4LV3 A;  5DF7 A;  3ZFZ A;  1GCE A;  1MWU A;  4B4Z A;  4P87 A;  2XFS A;  1XPB A;  3SS4 A;  3IQA A;  2QMI A;  2H0T A;  1W5D A;  2B5R A;  1E3U D;  1ESU A;  3ZG7 B;  4Z9Q A;  5CEB A;  3G30 A;  2XD5 A;  4XUZ A;  3UDF A;  5FSR A;  2PU2 A;  4GDN A;  5GLB A;  1SCW A;  3BFG A;  1MBL A;  2XQZ A;  1I2S A;  3W8K A;  2EFU A;  3G35 A;  3O86 A;  2OV5 A;  4E3N A;  3V50 A;  4OON A;  2Y2J A;  2HDU A;  4DXC A;  4R1G A;  4C6Y A;  5FQM A;  4PM5 A;  4E3M A;  3O87 A;  2A3U A;  5HW3 A;  1HTZ A;  3ZCZ A;  4E6W A;  1XGI A;  1MY8 A;  2EXA A;  3VP3 A;  1K25 A;  4Y0T A;  3OCN A;  4KZ4 A;  4C3Q A;  4KZ3 A;  4DKI A;  1EWZ A;  4P0M A;  3UPO A;  2J9P A;  3B3X A;  3CZD A;  1NRF A;  1YLW A;  2OLV A;  3BFE A;  3HRE A;  5KSC A;  1ERQ A;  3BFC A;  3GVB A;  1SDN A;  3A3J A;  5CTM A;  3O3V A;  4MLL A;  1HVB A;  4WYY A;  1YMX A;  3VSL A;  1G68 A;  3FKV A;  4X6T A;  1DJB A;  1H8Z A;  3BYD A;  4S2K A;  1FCO A;  4E3L A;  1XA1 A;  5KMW A;  4OOY A;  3HUO A;  2OLU A;  2C5W B;  3PBT A;  1KGF A;  1Y54 A;  1K6S A;  2WAE A;  4KEN B;  1TDG A;  5AQ7 A;  5HL1 A;  3ZG9 B;  1PI4 A;  3LO7 A;  3PBO A;  5CHJ A;  3Q81 A;  5U47 A;  1ZKJ A;  3ITB A;  5CEC A;  3NIA A;  4K91 A;  2WGI A;  4FD8 A;  3QHY A;  4DRT A;  3PBN A;  4R3J A;  4GOG A;  2P9V A;  2ZQA A;  5CXW A;  3SH7 A;  3DWZ A;  1ONG A;  3NDG A;  3MZE A;  3C7U A;  4RVA A;  3GTC A;  4E6X A;  5M18 A;  3VOZ A;  4JKT A;  4LV0 A;  4M3K A;  3LCE A;  2JE5 A;  2ZLY A;  4X69 A;  4OH0 A;  2X71 A;  1K54 C;  3Q7V A;  3QNB A;  5F82 A;  3G2Z A;  4LCL A;  2G2U A;  2G2W A;  2HP9 A;  3IWI A;  4K0W A;  3VOY A;  3ZGA B;  1YM1 A;  3EQU A;  4B4X A;  5A93 A;  2WAD A;  5TGF A;  4KZ9 A;  5FAT A;  5FQQ A;  4S2M A;  1CI9 A;  4JXG A;  1SKF A;  1FR1 A;  2C6W B;  3V39 A;  4MEZ A;  5I94 A;  3WRZ A;  5E43 A;  3OPR A;  4RA7 A;  1LL5 A;  2JC7 A;  4KG2 A;  4ZAM A;  5HAI A;  3ZG5 A;  2XR0 A;  2ZM0 A;  4KQO A;  3IHA A;  4YIN A;  4R4R A;  2PBY A;  5M19 A;  1PZO A;  3JYI A;  3SS5 A;  3BLM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...