4PM5A

Crystal structure of ctx-m-14 s70g beta-lactamase in complex with cefotaxime at 1.26 angstroms resolution
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
263
structure length
263
Chain Sequence
QTSAVQQKLAALEKSSGGRLGVALIDTADNTQVLYRGDERFPMCGTSKVMAAAAVLKQSETQKQLLNQPVEIKPADLVNYNPIAEKHVNGTMTLAELSAAALQYSDNTAMNKLIAQLGGPGGVTAFARAIGDETFRLDRTEPTLNTAIPGDPRDTTTPRAMAQTLRQLTLGHALGETQRAQLVTWLKGNTTGAASIRAGLPTSWTVGDKTGSGDYGTTNDIAVIWPQGRAPLVLVTYFTQPQQNAESRRDVLASAARIIAEGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/antibiotic
molecule keywords Beta-lactamase CTX-M-14
publication title Molecular Basis for the Catalytic Specificity of the CTX-M Extended-Spectrum beta-Lactamases.
pubmed doi rcsb
source organism Klebsiella pneumoniae subsp. pneumoniae
total genus 95
structure length 263
sequence length 263
ec nomenclature
pdb deposition date 2014-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 4pm5A00
1W5DA 4HESA 3UDXA 4K0WA 4ZJ3A 4GN2A 4MNRA 4PM8A 3ZNTA 5KSHA 2FFYA 4KZ3A 1PI5A 4FSFA 4GD8A 4KZAA 5M18A 3PBQA 3AGDA 4OVDA 3QNBA 4UA6A 1I2SA 2EXBA 4R0QA 1TVFA 4ID4A 2DNSA 5CTMA 4EQIA 3S1YA 5FAPA 5A91A 3MXSA 3ITBA 4KQOA 2G2WA 4X55A 1BZAA 1S0WA 1KVLA 1PZPA 3WS5A 3IHAA 3BFDA 5CEBA 2ZQ8A 4QD4A 2PU4A 4M3KA 1H8ZA 3UDIA 1CK3A 1ES3A 3P09A 3A3EA 3SS4A 2JE5A 5FA7A 2FFFB 2Q9NA 5GLAA 5A90A 4KQRA 2ZQAA 3V39A 2WAFA 5CECA 1QMEA 1LL5A 5CXWA 3FWLA 5FSRA 1G68A 3UDFA 1NY0A 2Y2MA 2WGWB 4L0LA 3WRTA 1XKZA 4OQIA 2Y4AA 4JF4A 3ZG5A 1ES2A 1NXYA 2J9OA 4IBXA 1SCWA 4WZ5C 3M6HA 4OP8A 3WS0A 1BLPA 2V1ZA 4Y0TA 3AGFA 4FCFA 2XFTA 1YLTA 3P98A 3NBLA 3UE0A 1W8QA 4PM7A 4RVAA 3WWXA 4DE2A 5DF7A 1K6RA 4E3NA 4UA9A 4S2IA 3ZVTA 4ZBEA 3BYDA 3IWQA 1O07A 1HTZA 4P85A 1E3UD 3LCEA 3IHBA 4KG5A 1OMEA 3C5AA 4X53A 3CMZA 4HBUA 5EVLA 2Y55A 3G31A 2A3UA 3GRJA 4JBFA 1M6KA 4JXVA 5EECA 2X01A 4PPRA 1WE4A 3HL9A 4OPRA 3Q1FA 5FATA 3ZG7B 2ZC4B 3N8LA 1YLPA 2OLUA 4PM6A 3SH7A 1BLHA 4C6YA 3GTCA 1MWTA 5CHJA 1O7EA 1HZOA 3RJUA 2X02A 1EI5A 5L2FA 1FSYA 3ZG9B 3IWOA 3HLFA 1HVBA 1IYSA 4K91A 4RYEA 4JF6A 2WZZA 5G18A 1K25A 1K55C 3EQVA 4EV4A 2Y2HA 3G2ZA 3RXXA 4N1XA 5CEDA 1IELA 3ZFZA 2WZXA 1N4OA 4FD8A 4BENA 3C4PA 5CRFA 2ZD8A 4JXGA 3OPRA 1K56A 4JPMA 3IF6C 3FZCA 4UHUA 3IXGA 1ESIA 1XX2A 1LI0A 3CJMA 3D4FA 1FR1A 1ZC2A 1DJAA 4OP5A 1XGIA 5GHXA 4P0MA 3M2KA 2R9XA 1GA0A 4QHCA 5HAQA 3E2LA 5CGWA 5IHVA 4BD1A 3CG5A 4WEJA 3Q81A 4BQMA 3AGEA 4DDSA 3HUMA 4QJGA 3G34A 3O87A 5J8XA 2WUQA 4PMAA 2Y2IA 3BEBA 5DF8A 4R1GA 5GL9A 4Q8IA 3NY4A 4GD6A 4KG2A 1ONGA 5CHUA 1ZG6A 3HUOA 3PBTA 5CERA 3QHYA 3IXDA 4B4ZA 1PWDA 3LY4A 3NDEA 2Y59A 4ZJ2A 3SOIA 1FOFA 3NDGA 1K57A 3VMAA 2EFXA 1ONHA 2DCFA 3UN7A 4OQ0A 4LENA 3Q7VA 1BT5A 1JWZA 4IBRA 5TGFA 1KVMA 3O3VA 2Y2QA 5FQJA 3W4OA 1CI8A 3I7JA 2H5SA 1Y54A 3N8SA 2WKEA 2VGJA 4S2NC 2P9VB 1FCNA 1ES4A 4U3TA 5A93A 3O86A 3NCKA 3VP0A 1TEMA 5F1GA 3ZG0A 2WYXA 3N4IA 3V5MA 1EWZA 4KZ7A 1JWVA 2DRWA 4OONA 4PM9A 3W8KA 2BLSA 4IEDA 4P6BA 4LV2A 2WGWA 1IYOA 2HP5A 4RX2A 1SKFA 2R9WA 2XK1A 4JKTA 3DWZA 4DE1A 5DVAA 2E8IA 1NRFA 1K54C 2HDRA 3C7VA 1PIOA 5F1FA 3IXBA 3A3JA 3LO7A 5CGXA 3VFHA 3VFFA 1BTLA 3ISGA 1XA1A 5I94A 3PBRA 1I5QA 1MPLA 2X71A 4K0XA 4S2OA 1YLYA 2PBYA 4WZ4A 1LL9A 5M19A 5E2FA 5KMWA 1E3UA 1YT4A 2ZM0A 2HDSA 2XFSA 4DE0A 2ZQ7A 1XA7A 5HW3A 2BG1A 5EVIA 1RGZA 2IWDA 4BL2A 1ZG4A 4KENB 5GLBA 3V3SA 3PTEA 4B88A 3IF6B 4WYYA 4E3KA 3N7WA 4Z9QA 2XH9A 2G2UA 4N9KA 4Y0OA 3W4PA 3MXRA 4GOGA 5GHYA 1L0FA 1K4FA 3OPPA 4OPQA 2ZM2A 3MFDA 2HP6A 2ZC5B 2WK0A 3A3DA 1L0DA 4X56A 3LY3A 3ZGAB 2RCXA 4IVKA 5TFQA 5E2HA 2ZC7A 3NIAA 1MWUA 5EUAA 3BLSA 2RL3A 5HX9A 5FI2A 3Q07A 1PZOA 2OV5A 3ZCZA 2H10A 1H5XA 4CPKA 4BD0A 5F83A 3FKVA 1YLZA 4MLLA 1GHIA 2CC1A 1KDWA 3HBRA 4KZ9A 3GVBA 2HP9A 4R4RA 3SS3A 4LV0A 3NI9A 2WADA 1Z6FA 1VM1A 3B3XA 4EBNA 2VGKA 2Y91A 5F82A 4OLGA 1BUEA 1IKGA 1W7FA 3SH8A 1ES5A 3GR2A 4GZBA 3M6BA 4E3LA 3BLMA 1KE4A 4OOYA 4X68A 5HAIA 1YM1A 4YINA 4LV1A 3DW0A 3VOYA 3WS2A 4E3IA 4IVIA 4DRTA 2EX6A 4MBHA 1PW8A 1PYYA 2Y2JA 4WEKA 5AQ7A 4KZBA 1QMFA 5GLDA 3SS5A 5A92A 1WYBA 3HREA 1ZKJA 2Z2MB 5D3OA 4WZ5A 4GB7A 4WMCD 1AXBA 4N92A 2WGVA 3PAEA 5GLCA 1JVJA 1FCMA 2V2FF 2XGNA 1BLCA 4XUZA 3DWKA 3PAGA 4E6WA 4FH4A 4DF6A 3NC8A 3UPOA 3IQAA 4OH0A 1LI9A 2EXAA 1N9BA 3S22A 1MY8A 4Y0UA 4KG6A 1CEFA 1ERMA 3ZHHA 5FAOA 3MKFA 5FDHA 2H0TA 5FI7A 3IH8A 2WKHA 4JXSA 1BULA 1ESUA 2C5WB 3VSLA 1GA9A 5FAQA 4C3QA 3ZG8B 4RX3A 5AQAA 2HDQA 1WYCA 3Q82A 4S2JA 1NZUA 1FR6A 2Y2PA 1KDSA 1NYYA 4A5RA 3E2KA 1GCEA 4E3OA 2C6WB 4BLMA 1H8YA 1JTDA 3M2JA 5DTTA 3PBSA 1SDEA 2ZJ9A 2XDMA 1K55A 4ZTKA 4ZDXA 2XEPA 2GDNA 2XD1A 4LCMA 2ZQCA 3WS1A 1TDLA 3MZFA 4EBPA 5EVIC 4DXCA 4UAAA 1FQGA 3BRMA 1XXMA 4S2MA 5BOHA 1LLBA 4JLFA 4NK3A 4OLDA 3VOZA 3VP4A 5EOOA 2EX2A 3VP3A 4OOMA 1XPBA 4HBTA 3HLWA 4WBGA 1FCOA 2ZQ9A 3VP1A 5KZHA 4R3BA 3UY6A 5E2EA 1SDNA 3HVFA 3MZEA 3WRZA 3FKWA 3ITAA 1YLJA 5AQBA 1PI4A 1I2WA 2ZC6B 4DKIA 4EWFA 1SHVA 1PWGA 4S2LA 4E3MA 4MBKA 2ZQDA 3ZNYA 3G4PA 5HL1A 1IEMA 3G35A 1GHMA 1LHYA 1ERQA 3G32A 1YLWA 3TG9A 2Z2LB 1K38A 4OOLA 1KGFA 2OLVA 3IT9A 3DTMA 3MKEA 2QPNA 4KZ8A 2ZM8A 2HPBA 1KGGA 4MBFA 3Q7VB 3VP2A 4MEZA 4S2NA 4PM5A 2A49A 3IXHA 4EUZA 1YQSA 5HARA 1L0GA 4JF5A 4QY6A 2Y2KA 5HAPA 3C4OA 3CZDA 2ZC3B 2WKIA 2XQZA 2V20A 4WELA 1J9MA 4LV3A 5FI6A 3N6IA 3GV9A 1E25A 3TOIA 1JWPA 2XR0A 1CEGA 1KE3A 1U60A 3UNWA 4QU3A 1PWCA 4B4XA 1MWSA 1Q2PA 2J9PA 2QMIA 4E6XA 2IWBA 2XF3A 3V3RA 5KSCA 4HEFA 3FYZA 1YMXA 5M1AA 1RP5A 4WMCA 4H8RA 1K54A 1RGYA 4GKUA 3N8RA 5FQ9A 1FSWA 1PW1A 3GSGA 1L0EA 3UPNA 5FQKA 2PU2A 3S4XA 4LCLA 1MKIA 1MXOA 2XD5A 3G2YA 5FQIA 1TDGA 5HFOA 3FV7A 4JXWA 3UO9A 2IWCA 4DXBA 5EOEA 3ZDJA 2WAEA 1W8YA 3OCLA 4EBLA 3MZDA 4QB8A 3JYIA 1NYMA 4U0XA 4CJNA 2EFUA 3OC2A 3UE3A 3V50A 1G6AA 5EVIB 3SH9A 1YMSA 4O7DA 5DTSA 5EVID 5FQQA 1K57C 4KZ6A 4U0TA 1KGEA 2EX9A 1IYPA 3HLCA 3HUNA 2XLNA 3QNCA 4DDYA 3UPPA 2HDUA 3HLDA 3PBNA 2P9VA 1NJ4A 4D2OA 5E43A 1HD8A 4C75A 5CTNA 4OPYA 4QY5A 4RA7A 3IWIA 1W79A 1MWRA 3BM6A 5JYPA 3LEZA 5EPHA 4R4SA 3BFCA 1EROA 2JC7A 4XUXA 3OZHA 4OPZA 4OQGA 3Q7ZA 4OQHA 3VSKA 4N1HA 4S2KA 2WGIA 2P74A 3HLGA 5TR7A 1IKIA 5FQMA 4KZ4A 3EQUA 3OPHA 3WS4A 3PBOA 3RXWA 4NETA 3TSGA 4GDNA 5JYOA 2B5RA 5DF9A 3GQZA 1DY6A 1GHPA 1BLSA 1K6SA 2J7VA 1BSGA 5CHMA 2JBFA 3IH9A 3BECA 4FH2A 1Q2QA 4GDBA 4ZJ1A 4BJPA 3BFGA 1XP4A 1M40A 2OSUA 3OCNA 3MBZA 2Q9MA 3O88A 4OKPA 1DJCA 1XGJA 1K4EA 1KE0A 2I72A 1CI9A 3GMWA 3BFEA 2H0YA 1E4DA 2EX8A 4KQQA 5E2GA 3A3FA 3G30A 4N9LA 5DTKA 3IF5A 2ZMAA 1L2SA 4R23A 1DJBA 1IYQA 4GNUA 2J8YA 4S2PA 3IF6A 4X6TA 2QZ6A 4UA7A 4BL3A 2UWXA 3A3IA 1K56D 1ALQA 4KZ5A 3BFFA 4P87A 5AQ9A 3UE1A 4XXRA 3ZVWA 2Y2GA 4F94A 3OPLA 1VQQA 3HLBA 1NZOA 1C3BA 3HLEA 5GHZA 1RCJA 4WM9A 5CGSA 3W4QA 3C7UA 5EE8A 2Y2LA 2ZLYA 4Y7PA 5FASA 1S6RA 4ZAMA 4E3JA 2JCHA 2Y2NA 2Y2OA 1JTGA 4DE3A 5U47A 4X69A 1MBLA 4YFMA 4R3JA
chains in the Genus database with same CATH superfamily
1W5DA 4HESA 4K0WA 4PM8A 2L1MA 4GD8A 3PBQA 4GLQA 1I2SA 2D01A 2HF6A 2DNSA 3O5YA 5A91A 4KQOA 2G2WA 1BZAA 1KVLA 3BFDA 4QD4A 1Y28A 1H8ZA 3A0RA 1ES3A 3P09A 1HLUP 2PBDP 5A90A 4KQRA 3D9YA 2ZQAA 3V39A 3BY9A 1LL5A 2R78A 3FWLA 5IU1A 1NY0A 2KLIA 3F1NA 4L0LA 3WRTA 2JKTI 2J9OA 3LFVA 3F1PA 1F9IA 2V1ZA 3KSGA 4FCFA 1YLTA 1OT6A 4UA9A 3IWQA 3C5AA 4X53A 3CMZA 2Y55A 2O0YA 2A3UA 4PPRA 3N8LA 4PM6A 5CHJA 3T4LA 4HP4A 1FSYA 3IWOA 1G28A 1K25A 3EQVA 3G2ZA 3ZFZA 1N4OA 4FD8A 4JXGA 1K56A 3IF6C 1LI0A 3D4FA 1ZC2A 4OP5A 4P0MA 1D7EA 3E2LA 1STZA 5CGWA 4G3KA 4BQMA 3Q81A 3BWLA 4QJGA 3G34A 3O87A 5J8XA 2Y2IA 4GD6A 2V1BA 5CHUA 3PBTA 1XJ3A 1PWDA 1MKMA 4ZJ2A 3NDGA 3RH8B 3P01A 1ONHA 4I3IA 4OQ0A 5TGFA 4KQDA 1CI8A 1W63Q 1Y54A 4B93A 5FDSA 2P9VB 1FCNA 3UB5P 3VP0A 4BBTA 2WYXA 3N4IA 3V5MA 3FG8A 3FPWA 4HJ6A 1JWVA 1LL8A 4PM9A 2BLSA 2B02A 4JGPA 3IBJA 3L7HA 4X25A 3H7WB 2E8IA 4MCWA 5F1FA 1OTBA 2L4RA 2OAP1 3UE6A 3PBRA 1MPLA 5L8MA 3LICA 4S2OA 1YLYA 3CHWP 5M19A 2ZL1B 5HW3A 2BG1A 4O8GA 3MS6A 4EEUA 1OT9A 1RGZA 1ZG4A 2W3DA 3V3SA 4B88A 3IF6B 4WYYA 4E3KA 4Z9QA 4Y0OA 3OPPA 2HP6A 1UWPX 4X56A 3LY3A 3CI6A 2RCXA 1TD5A 4GHIB 2RL3A 5HX9A 1PZOA 4NXBA 2CC1A 3HBRA 3GVBA 2HP9A 3JVVA 2ZMVA 3B3XA 1VM1A 2VGKA 2Y91A 3SH8A 1ES5A 4X68A 1V9ZA 4YINA 3KSFA 3WS2A 4E3IA 3OLOA 4KZBA 1QMFA 5EFWA 2H28A 4GB7A 3LUQA 4N92A 2OAQ1 2W3HA 2XGNA 1BLCA 4XUZA 1PFLA 1S66L 3IQAA 1LI9A 2O9BA 3S22A 1CEFA 5FAOA 3H7WA 3CLOA 2H0TA 1F98A 5FAQA 4C3QA 1WYCA 1FR6A 2VK3A 2HZ5A 4BLMA 4YWZA 3M2JA 2ZL1A 2ZQCA 2JN7A 3H82B 4QPRA 3WS1A 2HJEA 5EVIC 3T4QA 5EVEA 1FQGA 3BRMA 3NOPC 2ZBBA 3VP4A 5LBRA 4BBVA 2EX2A 1L3LA 5A8BA 1FCOA 4CLCE 4HNBA 2QYBA 3T4KA 4R3BA 3UY6A 5E2EA 1YLJA 1PI4A 1GSVA 4LFUA 4E3MA 4NKPA 2ZQDA 3DTIA 1BYWA 3G35A 1LHYA 4ME4A 1ERQA 3G32A 4GHIA 3MF0A 4FUWA 2PD7A 3DTMA 2ZM8A 3ZQ5A 3VP2A 4PM5A 2A49A 3IXHA 5HARA 5HAPA 3C4OA 2WKIA 1SKOB 2VLGA 2EA9A 1KE3A 4Y5FA 4B4XA 5F68A 1ODVA 3V3RA 2Z6CA 1YMXA 5M1AA 3N8RA 1CQAA 1FSWA 1PW1A 3LGOA 5FQKA 3MQQA 5FEFA 3MJQA 1XFQA 3TRCA 5FQIA 2GZAA 1TDGA 5HFOA 4R70A 1W8YA 3G6OA 4EBLA 5L10A 3A0VA 2QKPA 5EVIB 1YMSA 5DTSA 2EX9A 2VV7A 3HLCA 2YKHA 4H6JB 5HDSA 2XLNA 3UPPA 2HDUA 1NJ4A 5E43A 3P7NA 4QY5A 3IWIA 1MWRA 4WLAA 3H82A 2VA0A 3IBRA 2JC7A 5TR7A 1VETB 5FQMA 4KZ4A 3ULFA 3WS4A 3RXWA 3S7OA 1BLSA 1K6SA 3BECA 4FH2A 4GJ4A 4BJPA 3BFGA 1XP4A 3NECA 2OSUA 3OCNA 4L9FA 3PXPA 2H0YA 1E4DA 5E2GA 5DTKA 3IF5A 2ZMAA 1DJBA 1IYQA 4LRXC 4S2PA 2J8YA 4X6TA 2QZ6A 4UA7A 2D02A 2V9AA 1YKDA 4KZ5A 4P87A 2O9CA 4XXRA 4F94A 1VQQA 1YSPA 1CJFA 3HLEA 4I3AA 1SKOA 3VV4A 2Y2LA 4Y7PA 5FASA 1S6RA 4ZAMA 5J3WA 4R3AA 3LR4A 2JCHA 3CAXA 1MBLA 3ZNTA 3BJNA 2FFYA 1PI5A 3CITA 4OVDA 4UA6A 1NLYA 1TVFA 5CTMA 3F1OA 3S1YA 3ICYA 3ITBA 4X55A 1S0WA 5CEBA 3UDIA 3SS4A 5FA7A 1YSQA 2FFFB 5GLAA 4FOFA 3R7WA 3E98A 1CF0A 2WAFA 5CECA 2QJ5A 5CXWA 3C30A 3GECA 3UDFA 2Y2MA 4CLCC 1NXYA 4HHDA 3M6HA 3WS0A 4Y0TA 2IA2A 3QP1A 2XFTA 3NBLA 1TS6A 2VJWA 4DE2A 4YOFA 4S2IA 1N9LA 3BYDA 1HTZA 2V8CA 2W1RA 4JXVA 1LSWA 3HL9A 3Q1FA 5FATA 3EOIA 2ZC4B 3T1XA 4MN7A 1MWTA 1O7EA 2KOIA 5F6AA 3ZG9B 1IYSA 4K91A 4RYEA 4JF6A 2WZZA 1FILA 2Y2HA 3RXXA 2WZXA 5CRFA 3LIEA 3OPRA 3IXGA 1ESIA 1XX2A 5F5YA 5GHXA 4Z1WA 4GS9A 2WKPA 4WEJA 3BEBA 5GL9A 4Q8IA 3NY4A 4KG2A 4EU0A 4EETB 1ZG6A 5CERA 3IXDA 4B4ZA 2Y59A 1FOFA 4GW9A 3W4OA 1BT5A 1JWZA 4IBRA 3DTKA 2H5SA 4Y15A 3N8SA 2OOLA 4U3TA 1P0ZA 3O86A 1T1AA 2XA7M 1IFQA 1EWZA 4KUKA 3LIDA 2J3TC 1IYOA 4RX2A 4JKTA 5DVAA 2PD8A 4Q0HA 3LO7A 3ISGA 5I94A 2EWWA 5HD5A 3JPUA 3PR6A 2XRNA 5KMWA 1E3UA 1YT4A 2ZM0A 3T1QB 3UMEA 4DE0A 2Z6DA 5GLBA 3PTEA 1OTAA 1YAXA 2XH9A 1F5MA 2PR5A 3MXRA 5GHYA 5MC7A 2ZM2A 2QHKA 1L0DA 3IX8A 2LB5A 5TFQA 2ZC7A 3NIAA 3T12B 5L09A 1MWUA 3TW8A 3LI8A 2Q0OA 2H10A 4MLLA 4II7A 2ZOHA 4R4RA 3SS3A 3MSHA 4EBNA 2HJ9C 1S4RA 3VE4A 2PYPA 1IKGA 5IS1A 5EM0A 3GR2A 3M6BA 1VEUA 3C8CA 3VOYA 2JKGA 3SW1A 4IVIA 4DRTA 4PKYA 3RTYA 4WEKA 3W2ZA 3BQAA 4CLCA 5A92A 5HDCA 2Z2MB 5D3OA 1ACFA 1AXBA 3PAEA 5GLCA 3BW6A 3LR0A 2V2FF 5AVEA 4FH4A 1ZHHB 2CMNA 2WKHA 3VSLA 1S4SA 3A0SA 3K3CA 4LGWA 5G4ZA 1MC0A 4A5RA 4E3OA 2LB9A 1H8YA 4K08A 4EESA 2ZJ9A 3LR5A 4O0PA 4ZDXA 2XD1A 4IUHA 1TDLA 3MZFA 1DP8A 2W3GA 4EBPA 4NXFA 4UAAA 5BOHA 1XXMA 2M7UA 3T4OA 1XPBA 4HBTA 3HLWA 4WBGA 3VP1A 2ZMFA 1V9YA 2INWA 3WRZA 4DKIA 4S2LA 4HJ3A 2WKRA 3G4PA 3ZNYA 1OJGA 4LRYC 3IT9A 3MKEA 3KSIA 1LT0A 2XSSA 3FC7A 3Q7VB 1JNUA 4MEZA 2PR6A 4JF5A 3LIFA 2V20A 4WELA 1J9MA 4LV3A 5FI6A 2O9AA 3T4JA 1H3QA 2XR0A 4WN5A 2Y79A 2QMIA 2DMWA 2JKRI 4E6XA 2IWBA 2V8FA 2XF3A 5KSCA 4HEFA 4EW7A 3IX3A 4WMCA 3U2AA 3LI9A 2V0WA 4GKUA 1L0EA 4LCLA 2PT7A 1MKIA 4ZRRA 1MXOA 2XD5A 4M4XA 2K31A 4Y2FA 1OTEA 4DXBA 2WKQA 3ZDJA 2WAEA 1TF1A 2XROA 4QB8A 3JYIA 5TBMB 3UE3A 3V50A 1G6AA 5FQQA 1K57C 4KZ6A 3QNCA 4I3JA 4DDYA 4DN0A 2P9VA 1HD8A 5CTNA 5HZHA 3E4QA 3LEZA 5EPHA 1EROA 4S2KA 2P74A 1G5UA 1VB6A 4GDNA 3GQZA 5L07A 4BWIA 1BSGA 5CHMA 4MN5A 4JGOA 3IH9A 1Q2QA 3UB6A 1DJCA 3FPVA 1W63M 1K4EA 1KE0A 3GMWA 1YPRA 1ZTUA 3A3FA 1L2SA 4Y3IA 3S7NA 3IF6A 3IS2B 4NEED 1K56D 1ALQA 3UE1A 3ZVWA 2Y2GA 1S1ZA 4Q0IA 1NZOA 3W4QA 3C7UA 4E3JA 3RFBA 5U47A 2W3EA 3B33A 4GN2A 4MNRA 5KSHA 4KZ3A 4FSFA 3E4OA 4KZAA 5M18A 3AGDA 3QNBA 1T1BA 4WL9A 3CUEC 2GJ3A 2VV6A 4YNRA 4ID4A 4EQIA 3KYQA 3MXSA 1XJ2A 3WS5A 3LYXA 2ZQ8A 4M3KA 3NOUC 3A3EA 3MFXA 2JE5A 2W1TB 1G68A 2WGWB 1VHMA 1XKZA 1ES2A 4F3LB 3MMHA 1SCWA 2NUPC 4OP8A 1BLPA 2AVXA 2HGVA 1W8QA 3VOLA 3LIBA 3E4PA 4RVAA 1DP6A 5DF7A 1K6RA 3ZVTA 3EGDC 4HP9A 3IHBA 2FZ0A 4HBUA 5EVLA 3G31A 4JBFA 1WE4A 4OPRA 5IT5A 3ZG7B 1YLPA 3SH7A 3T4TA 4C6YA 3GTCA 1HZOA 3RJUA 2X02A 1EI5A 1HVBA 3MXQA 4EV4A 1N9OA 2KX6A 4N1XA 3S7PA 5CEDA 3QP5A 1IELA 2ZD8A 3IS2A 2YKFA 2JHEA 1FR1A 1DJAA 1XGIA 3LEQA 3M2KA 4DJ3A 1GA0A 4QHCA 2K2NA 5IHVA 4BD1A 3CG5A 3AGEA 3HUMA 2WUQA 4PMAA 3EWKA 5HPFA 1ONGA 4BBUA 3HUOA 4IJGA 3QHYA 3LY4A 3NDEA 4ESPA 3KYEA 3S7QA 1K57A 4EERA 2EFXA 5FQJA 2A2LA 4S2NC 5HWTA 5A93A 2W3FA 3NCKA 1TEMA 5F1GA 3ZG0A 5J7EA 1FIKA 2DRWA 4OONA 1EW0A 3W8KA 4P6BA 4LV2A 2WGWA 2HP5A 5DJTA 1A0KA 2R9WA 2XK1A 4DE1A 1NRFA 1K54C 2HDRA 1PIOA 3EEHA 3VFHA 3VFFA 1BTLA 5DJUA 1F2KA 4K0XA 2PBYA 4WZ4A 2JKFA 4Y13A 1LL9A 5E2FA 2HDSA 1IOUA 2ZQ7A 1XA7A 3CWFA 5EVIA 4BL2A 4H6JA 4R6LA 4IHQA 1KOUA 3N7WA 4GOGA 4I39A 1K4FA 3U4LP 3PYPA 4OPQA 4AFIA 4L9GA 1OPXA 3MFDA 1PNEA 5FEGA 2ZC5B 2OWJA 1H0MA 3ZGAB 5HL6A 4IVKA 1VETA 5EUAA 1UGUA 3BLSA 5HSQA 2UV0E 4HJ4A 3DTEA 4BD0A 3KYZA 2J3WA 4KZ9A 4LV0A 1Z6FA 4UQIS 1OTIA 5EV0A 5F82A 4OLGA 1W7FA 4GZBA 1WA9A 4OOYA 1YM1A 4LLOB 5HPIA 4HOIA 3DW0A 2EX6A 5AQ7A 1NRJA 4E04A 1XFNA 3HCYA 4EUVA 3F1PB 3DWKA 4DF6A 3NC8A 5KIZA 1MY8A 1NWZA 1ERMA 4LPZA 3ZHHA 2G7UA 2QWSA 3KX0X 5EM1A 1ESUA 4ARZB 1GA9A 3ZG8B 4RX3A 5AQAA 2HDQA 3Q82A 2Y2PA 1NYYA 3E2KA 4MN6A 3VE3A 2C6WB 1JTDA 2VKSA 4ZTKA 3JVUA 2P7JA 4DXCA 2VZWA 2V1AA 3HJIA 4S2MA 1LLBA 4NK3A 3K3DA 4OOMA 3UB9A 2M1CA 3LR3A 4G3WA 2ZQ9A 3BQ8A 4NG2A 1SDNA 3HVFA 3ITAA 2ZC6B 4WUJA 5HL1A 1IEMA 1GHMA 1YLWA 3TG9A 2Z2LB 1K38A 1KGFA 2OLVA 2QPNA 1D06A 2VEAA 4S2NA 4EUZA 1YQSA 2J80A 1L0GA 4QY6A 2ZC3B 1J3WA 3N6IA 1E25A 1JWPA 1CEGA 1U60A 4QU3A 1PWCA 5I5LA 4HIAA 1MWSA 1Q2PA 2J9PA 1G6OA 1RP5A 4H8RA 1K54A 1RGYA 5FQ9A 2PYRA 4O01A 1NLZA 4Y17A 3KSHA 3KO6A 3UO9A 2MJ6A 1PRQA 4CJNA 2EFUA 4P6ZS 4IUKA 3OC2A 4ARZA 1TS0A 5EVID 4U0TA 1IYPA 3HUNA 3HLDA 3PBNA 3QP8A 4D2OA 2QJ7A 4OPYA 4RA7A 3BM6A 3MQOA 5JYPA 4R4SA 4XUXA 1LSXA 3OZHA 3SZTA 4OPZA 4OQGA 3Q7ZA 3VSKA 3EQUA 3PBOA 3TSGA 4NETA 1GHPA 2Y8HA 4GDBA 1M40A 3MBZA 2I72A 1CI9A 3BFEA 2EX8A 5HWVA 3G30A 4EEPA 4P6ZM 4R38A 4CQHA 4PAUA 5AQ9A 3BFFA 2ZOIA 1P9RA 4GCZA 2B95A 2W0NA 2Y2OA 1JTGA 4YFMA 4R3JA 3UDXA 4ZJ3A 3QP6A 1S1YA 4EXOA 2EXBA 4R0QA 5DFYA 5FAPA 3OOVA 1PZPA 3IHAA 2PU4A 1CK3A 3NULA 3OBFA 1X0OA 1XJ6A 5DKKA 2Q9NA 2A24B 2EWVA 1QMEA 5FSRA 1MZUA 3TJZC 4UEYA 3MQ0A 4OQIA 3ZG5A 2Y4AA 4JF4A 4IBXA 1OJ5A 4WZ5C 3AGFA 3P98A 3UE0A 4LRZE 4ETXA 2V0UA 4X1MA 1GSWA 4PM7A 3WWXA 1D1JA 2P08A 4E3NA 4ZBEA 1O07A 5AVFA 5C5KA 4P85A 1E3UD 3LCEA 4KG5A 1OMEA 2KDKA 5EECA 3GRJA 4EQ1A 1M6KA 2X01A 4ETZA 3E0YA 2OLUA 1BLHA 1TS8A 5L2FA 1K0KA 5TJJA 3HLFA 5G18A 3D72A 1K55C 1GSXA 1T18A 4BENA 3C4PA 2VX8A 4JPMA 4MMNA 4G3VA 3FZCA 4UHUA 3CJMA 4JGRA 3UB7A 5G4YA 2R9XA 5HAQA 4QWOA 1SZVA 4DDSA 5DF8A 4R1GA 3QP2A 5DFXA 4HY8A 3SOIA 2BASA 3VMAA 1Y4OA 2DCFA 3UN7A 4LENA 3Q7VA 4KUOA 1KVMA 2P04A 2Y2QA 3O3VA 3I7JA 1H8MA 2WKEA 2VGJA 5FL3A 1XJ4A 5CX7A 4CLCD 1ES4A 3UMDA 3K2NA 4FTXA 3C38A 2VV8A 2A24A 4KZ7A 2L0WA 1N9NA 3H9WA 4DJ2A 4IEDA 1SKFA 3DWZA 2O99A 3C7VA 4HH3A 3IXBA 3A3JA 5CGXA 1XA1A 2HV1A 1I5QA 2X71A 3IX4A 2XFSA 3LIAA 5TBMA 2IWDA 4KENB 5DKLA 2G2UA 5HWWA 4N9KA 5F69A 3W4PA 1L0FA 3BY8A 2WK0A 3A3DA 2GX5A 4X1LA 2JKTM 1T1CA 5E2HA 1T19A 4NXEA 5FI2A 3Q07A 5HDDA 2OV5A 3ZCZA 1H5XA 4CPKA 5F83A 3FKVA 1YLZA 1GHIA 3TE8A 1KDWA 4MDZA 3F1OB 3NI9A 2WADA 1BUEA 4E3LA 3BLMA 1KE4A 3L9KA 5HAIA 3DBAA 3PHYA 4LV1A 4PKYG 2J3TD 4MBHA 3R7WB 1PW8A 1PYYA 2Y2JA 1LSVA 5GLDA 2PAVP 3SS5A 3DAVA 1WYBA 2FH5A 2VGLS 3HREA 1ZKJA 5AJGA 4WZ5A 4WMCD 2WGVA 1JVJA 1FCMA 3PAGA 4E6WA 3UPOA 3NHQA 4OH0A 2EXAA 1N9BA 3EGXC 4Y0UA 4KG6A 3MKFA 5FDHA 5FI7A 3IH8A 4JXSA 2M7VA 1BULA 3T1SA 2C5WB 2PHYA 1DRMA 4S2JA 3NJAA 1NZUA 3NOTC 1KDSA 1GCEA 5DTTA 3PBSA 1SDEA 2XDMA 1K55A 2XEPA 4WF0A 2GDNA 3D3OA 4LCMA 2W1TA 3CPTB 4JLFA 4OLDA 3V67A 3VOZA 5HD3A 4HI4A 5EOOA 1DP9A 4F3LA 3VP3A 4D60A 2VGLM 3B42A 3QP4A 3HJKA 5KZHA 2E8JA 4GS9B 3MR0A 3MZEA 3FKWA 5AQBA 4EWFA 1I2WA 1SHVA 1PWGA 2ACGA 4MBKA 4OOLA 1OTDA 5J4EA 4KZ8A 1AWIA 2HPBA 1KGGA 4MBFA 1S67L 4NXGA 2Y2KA 3CZDA 2XQZA 4RQ9A 4XT2B 3GV9A 3TOIA 4I5SA 4B9OA 3UNWA 3FYZA 2NUTC 4BMWA 1P97A 3GSGA 3CUEA 2BTFP 3UPNA 2PU2A 3S4XA 4JGQA 2JKRM 3G2YA 2PDRA 3FV7A 4JXWA 2IWCA 5EOEA 3OCLA 3MZDA 1NYMA 4U0XA 3GDIA 3SH9A 4O7DA 1KGEA 2GNXA 3F1NB 2K7SA 4C75A 1TS7A 2XA7S 1W79A 3B47A 4HQAA 1P9WA 3CPTA 2OWHA 3BFCA 4OQHA 4N1HA 1Z09A 2WGIA 3HLGA 4PHTA 1IKIA 3OPHA 4I38A 5JYOA 2B5RA 5DF9A 3T4SA 3T1RA 1UWNX 1DY6A 2J7VA 2JBFA 3T50A 2W27A 4ZJ1A 2Q9MA 3O88A 4OKPA 1XGJA 4UQIM 4Q0JA 3EEAA 4KQQA 4N9LA 3UB8A 1VEUB 4R23A 4GNUA 4BL3A 2UWXA 3A3IA 2PRFA 4CLCB 3OPLA 3HLBA 5K5BA 4HH2A 1C3BA 5GHZA 1RCJA 2I9VA 3R4KA 4WM9A 5CGSA 4XT2A 5EE8A 2ZLYA 3C2WA 4L9EA 2Y2NA 2B18A 4DE3A 3ZYTA 4X69A 4DMZA
chains in the Genus database with same CATH topology
1W5DA 4HESA 3UDXA 4K0WA 4ZJ3A 4GN2A 4MNRA 4PM8A 3ZNTA 5KSHA 2FFYA 4KZ3A 1PI5A 4FSFA 4GD8A 4KZAA 5M18A 3PBQA 3AGDA 4OVDA 3QNBA 4UA6A 1I2SA 2EXBA 4R0QA 1TVFA 4ID4A 2DNSA 5CTMA 4EQIA 3S1YA 5FAPA 5A91A 3MXSA 3ITBA 4KQOA 2G2WA 4X55A 1BZAA 1S0WA 1KVLA 1PZPA 3WS5A 3IHAA 3BFDA 5CEBA 2ZQ8A 4QD4A 2PU4A 4M3KA 1H8ZA 3UDIA 1CK3A 1ES3A 3P09A 3A3EA 3SS4A 2JE5A 5FA7A 2FFFB 2Q9NA 5GLAA 5A90A 4KQRA 2ZQAA 3V39A 2WAFA 5CECA 1QMEA 1LL5A 5CXWA 3FWLA 5FSRA 1G68A 3UDFA 1NY0A 2Y2MA 2WGWB 4L0LA 3WRTA 1XKZA 4OQIA 2Y4AA 4JF4A 3ZG5A 1ES2A 1NXYA 2J9OA 4IBXA 1SCWA 4WZ5C 3M6HA 4OP8A 3WS0A 1BLPA 2V1ZA 4Y0TA 3AGFA 4FCFA 2XFTA 1YLTA 3P98A 3NBLA 3UE0A 1W8QA 4PM7A 4RVAA 3WWXA 4DE2A 5DF7A 1K6RA 4E3NA 4UA9A 4S2IA 3ZVTA 4ZBEA 3BYDA 3IWQA 1O07A 1HTZA 4P85A 1E3UD 3LCEA 3IHBA 4KG5A 1OMEA 3C5AA 4X53A 3CMZA 4HBUA 5EVLA 2Y55A 3G31A 2A3UA 3GRJA 4JBFA 1M6KA 4JXVA 5EECA 2X01A 4PPRA 1WE4A 3HL9A 4OPRA 3Q1FA 5FATA 3ZG7B 2ZC4B 3N8LA 1YLPA 2OLUA 4PM6A 3SH7A 1BLHA 4C6YA 3GTCA 1MWTA 5CHJA 1O7EA 1HZOA 3RJUA 2X02A 1EI5A 5L2FA 1FSYA 3ZG9B 3IWOA 3HLFA 1HVBA 1IYSA 4K91A 4RYEA 4JF6A 2WZZA 5G18A 1K25A 1K55C 3EQVA 4EV4A 2Y2HA 3G2ZA 3RXXA 4N1XA 5CEDA 1IELA 3ZFZA 2WZXA 1N4OA 4FD8A 4BENA 3C4PA 5CRFA 2ZD8A 4JXGA 3OPRA 1K56A 4JPMA 3IF6C 3FZCA 4UHUA 3IXGA 1ESIA 1XX2A 1LI0A 3CJMA 3D4FA 1FR1A 1ZC2A 1DJAA 4OP5A 1XGIA 5GHXA 4P0MA 3M2KA 2R9XA 1GA0A 4QHCA 5HAQA 3E2LA 5CGWA 5IHVA 4BD1A 3CG5A 4WEJA 3Q81A 4BQMA 3AGEA 4DDSA 3HUMA 4QJGA 3G34A 3O87A 5J8XA 2WUQA 4PMAA 2Y2IA 3BEBA 5DF8A 4R1GA 5GL9A 4Q8IA 3NY4A 4GD6A 4KG2A 1ONGA 5CHUA 1ZG6A 3HUOA 3PBTA 5CERA 3QHYA 3IXDA 4B4ZA 1PWDA 3LY4A 3NDEA 2Y59A 4ZJ2A 3SOIA 1FOFA 3NDGA 1K57A 3VMAA 2EFXA 1ONHA 2DCFA 3UN7A 4OQ0A 4LENA 3Q7VA 1BT5A 1JWZA 4IBRA 5TGFA 1KVMA 3O3VA 2Y2QA 5FQJA 3W4OA 1CI8A 3I7JA 2H5SA 1Y54A 3N8SA 2WKEA 2VGJA 4S2NC 2P9VB 1FCNA 1ES4A 4U3TA 5A93A 3O86A 3NCKA 3VP0A 1TEMA 5F1GA 3ZG0A 2WYXA 3N4IA 3V5MA 1EWZA 4KZ7A 1JWVA 2DRWA 4OONA 4PM9A 3W8KA 2BLSA 4IEDA 4P6BA 4LV2A 2WGWA 1IYOA 2HP5A 4RX2A 1SKFA 2R9WA 2XK1A 4JKTA 3DWZA 4DE1A 5DVAA 2E8IA 1NRFA 1K54C 2HDRA 3C7VA 1PIOA 5F1FA 3IXBA 3A3JA 3LO7A 5CGXA 3VFHA 3VFFA 1BTLA 3ISGA 1XA1A 5I94A 3PBRA 1I5QA 1MPLA 2X71A 4K0XA 4S2OA 1YLYA 2PBYA 4WZ4A 1LL9A 5M19A 5E2FA 5KMWA 1E3UA 1YT4A 2ZM0A 2HDSA 2XFSA 4DE0A 2ZQ7A 1XA7A 5HW3A 2BG1A 5EVIA 1RGZA 2IWDA 4BL2A 1ZG4A 4KENB 5GLBA 3V3SA 3PTEA 4B88A 3IF6B 4WYYA 4E3KA 3N7WA 4Z9QA 2XH9A 2G2UA 4N9KA 4Y0OA 3W4PA 3MXRA 4GOGA 5GHYA 1L0FA 1K4FA 3OPPA 4OPQA 2ZM2A 3MFDA 2HP6A 2ZC5B 2WK0A 3A3DA 1L0DA 4X56A 3LY3A 3ZGAB 2RCXA 4IVKA 5TFQA 5E2HA 2ZC7A 3NIAA 1MWUA 5EUAA 3BLSA 2RL3A 5HX9A 5FI2A 3Q07A 1PZOA 2OV5A 3ZCZA 2H10A 1H5XA 4CPKA 4BD0A 5F83A 3FKVA 1YLZA 4MLLA 1GHIA 2CC1A 1KDWA 3HBRA 4KZ9A 3GVBA 2HP9A 4R4RA 3SS3A 4LV0A 3NI9A 2WADA 1Z6FA 1VM1A 3B3XA 4EBNA 2VGKA 2Y91A 5F82A 4OLGA 1BUEA 1IKGA 1W7FA 3SH8A 1ES5A 3GR2A 4GZBA 3M6BA 4E3LA 3BLMA 1KE4A 4OOYA 4X68A 5HAIA 1YM1A 4YINA 4LV1A 3DW0A 3VOYA 3WS2A 4E3IA 4IVIA 4DRTA 2EX6A 4MBHA 1PW8A 1PYYA 2Y2JA 4WEKA 5AQ7A 4KZBA 1QMFA 5GLDA 3SS5A 5A92A 1WYBA 3HREA 1ZKJA 2Z2MB 5D3OA 4WZ5A 4GB7A 4WMCD 1AXBA 4N92A 2WGVA 3PAEA 5GLCA 1JVJA 1FCMA 2V2FF 2XGNA 1BLCA 4XUZA 3DWKA 3PAGA 4E6WA 4FH4A 4DF6A 3NC8A 3UPOA 3IQAA 4OH0A 1LI9A 2EXAA 1N9BA 3S22A 1MY8A 4Y0UA 4KG6A 1CEFA 1ERMA 3ZHHA 5FAOA 3MKFA 5FDHA 2H0TA 5FI7A 3IH8A 2WKHA 4JXSA 1BULA 1ESUA 2C5WB 3VSLA 1GA9A 5FAQA 4C3QA 3ZG8B 4RX3A 5AQAA 2HDQA 1WYCA 3Q82A 4S2JA 1NZUA 1FR6A 2Y2PA 1KDSA 1NYYA 4A5RA 3E2KA 1GCEA 4E3OA 2C6WB 4BLMA 1H8YA 1JTDA 3M2JA 5DTTA 3PBSA 1SDEA 2ZJ9A 2XDMA 1K55A 4ZTKA 4ZDXA 2XEPA 2GDNA 2XD1A 4LCMA 2ZQCA 3WS1A 1TDLA 3MZFA 4EBPA 5EVIC 4DXCA 4UAAA 1FQGA 3BRMA 1XXMA 4S2MA 5BOHA 1LLBA 4JLFA 4NK3A 4OLDA 3VOZA 3VP4A 5EOOA 2EX2A 3VP3A 4OOMA 1XPBA 4HBTA 3HLWA 4WBGA 1FCOA 2ZQ9A 3VP1A 5KZHA 4R3BA 3UY6A 5E2EA 1SDNA 3HVFA 3MZEA 3WRZA 3FKWA 3ITAA 1YLJA 5AQBA 1PI4A 1I2WA 2ZC6B 4DKIA 4EWFA 1SHVA 1PWGA 4S2LA 4E3MA 4MBKA 2ZQDA 3ZNYA 3G4PA 5HL1A 1IEMA 3G35A 1GHMA 1LHYA 1ERQA 3G32A 1YLWA 3TG9A 2Z2LB 1K38A 4OOLA 1KGFA 2OLVA 3IT9A 3DTMA 3MKEA 2QPNA 4KZ8A 2ZM8A 2HPBA 1KGGA 4MBFA 3Q7VB 3VP2A 4MEZA 4S2NA 4PM5A 2A49A 3IXHA 4EUZA 1YQSA 5HARA 1L0GA 4JF5A 4QY6A 2Y2KA 5HAPA 3C4OA 3CZDA 2ZC3B 2WKIA 2XQZA 2V20A 4WELA 1J9MA 4LV3A 5FI6A 3N6IA 3GV9A 1E25A 3TOIA 1JWPA 2XR0A 1CEGA 1KE3A 1U60A 3UNWA 4QU3A 1PWCA 4B4XA 1MWSA 1Q2PA 2J9PA 2QMIA 4E6XA 2IWBA 2XF3A 3V3RA 5KSCA 4HEFA 3FYZA 1YMXA 5M1AA 1RP5A 4WMCA 4H8RA 1K54A 1RGYA 4GKUA 3N8RA 5FQ9A 1FSWA 1PW1A 3GSGA 1L0EA 3UPNA 5FQKA 2PU2A 3S4XA 4LCLA 1MKIA 1MXOA 2XD5A 3G2YA 5FQIA 1TDGA 5HFOA 3FV7A 4JXWA 3UO9A 2IWCA 4DXBA 5EOEA 3ZDJA 2WAEA 1W8YA 3OCLA 4EBLA 3MZDA 4QB8A 3JYIA 1NYMA 4U0XA 4CJNA 2EFUA 3OC2A 3UE3A 3V50A 1G6AA 5EVIB 3SH9A 1YMSA 4O7DA 5DTSA 5EVID 5FQQA 1K57C 4KZ6A 4U0TA 1KGEA 2EX9A 1IYPA 3HLCA 3HUNA 2XLNA 3QNCA 4DDYA 3UPPA 2HDUA 3HLDA 3PBNA 2P9VA 1NJ4A 4D2OA 5E43A 1HD8A 4C75A 5CTNA 4OPYA 4QY5A 4RA7A 3IWIA 1W79A 1MWRA 3BM6A 5JYPA 3LEZA 5EPHA 4R4SA 3BFCA 1EROA 2JC7A 4XUXA 3OZHA 4OPZA 4OQGA 3Q7ZA 4OQHA 3VSKA 4N1HA 4S2KA 2WGIA 2P74A 3HLGA 5TR7A 1IKIA 5FQMA 4KZ4A 3EQUA 3OPHA 3WS4A 3PBOA 3RXWA 4NETA 3TSGA 4GDNA 5JYOA 2B5RA 5DF9A 3GQZA 1DY6A 1GHPA 1BLSA 1K6SA 2J7VA 1BSGA 5CHMA 2JBFA 3IH9A 3BECA 4FH2A 1Q2QA 4GDBA 4ZJ1A 4BJPA 3BFGA 1XP4A 1M40A 2OSUA 3OCNA 3MBZA 2Q9MA 3O88A 4OKPA 1DJCA 1XGJA 1K4EA 1KE0A 2I72A 1CI9A 3GMWA 3BFEA 2H0YA 1E4DA 2EX8A 4KQQA 5E2GA 3A3FA 3G30A 4N9LA 5DTKA 3IF5A 2ZMAA 1L2SA 4R23A 1DJBA 1IYQA 4GNUA 2J8YA 4S2PA 3IF6A 4X6TA 2QZ6A 4UA7A 4BL3A 2UWXA 3A3IA 1K56D 1ALQA 4KZ5A 3BFFA 4P87A 5AQ9A 3UE1A 4XXRA 3ZVWA 2Y2GA 4F94A 3OPLA 1VQQA 3HLBA 1NZOA 1C3BA 3HLEA 5GHZA 1RCJA 4WM9A 5CGSA 3W4QA 3C7UA 5EE8A 2Y2LA 2ZLYA 4Y7PA 5FASA 1S6RA 4ZAMA 4E3JA 2JCHA 2Y2NA 2Y2OA 1JTGA 4DE3A 5U47A 4X69A 1MBLA 4YFMA 4R3JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1W5D A;  4HES A;  3UDX A;  4K0W A;  4ZJ3 A;  4GN2 A;  4MNR A;  4PM8 A;  3ZNT A;  5KSH A;  2FFY A;  4KZ3 A;  1PI5 A;  4FSF A;  4GD8 A;  4KZA A;  5M18 A;  3PBQ A;  3AGD A;  4OVD A;  3QNB A;  4UA6 A;  1I2S A;  2EXB A;  4R0Q A;  1TVF A;  4ID4 A;  2DNS A;  5CTM A;  4EQI A;  3S1Y A;  5FAP A;  5A91 A;  3MXS A;  3ITB A;  4KQO A;  2G2W A;  4X55 A;  1BZA A;  1S0W A;  1KVL A;  1PZP A;  3WS5 A;  3IHA A;  3BFD A;  5CEB A;  2ZQ8 A;  4QD4 A;  2PU4 A;  4M3K A;  1H8Z A;  3UDI A;  1CK3 A;  1ES3 A;  3P09 A;  3A3E A;  3SS4 A;  2JE5 A;  5FA7 A;  2FFF B;  2Q9N A;  5GLA A;  5A90 A;  4KQR A;  2ZQA A;  3V39 A;  2WAF A;  5CEC A;  1QME A;  1LL5 A;  5CXW A;  3FWL A;  5FSR A;  1G68 A;  3UDF A;  1NY0 A;  2Y2M A;  2WGW B;  4L0L A;  3WRT A;  1XKZ A;  4OQI A;  2Y4A A;  4JF4 A;  3ZG5 A;  1ES2 A;  1NXY A;  2J9O A;  4IBX A;  1SCW A;  4WZ5 C;  3M6H A;  4OP8 A;  3WS0 A;  1BLP A;  2V1Z A;  4Y0T A;  3AGF A;  4FCF A;  2XFT A;  1YLT A;  3P98 A;  3NBL A;  3UE0 A;  1W8Q A;  4PM7 A;  4RVA A;  3WWX A;  4DE2 A;  5DF7 A;  1K6R A;  4E3N A;  4UA9 A;  4S2I A;  3ZVT A;  4ZBE A;  3BYD A;  3IWQ A;  1O07 A;  1HTZ A;  4P85 A;  1E3U D;  3LCE A;  3IHB A;  4KG5 A;  1OME A;  3C5A A;  4X53 A;  3CMZ A;  4HBU A;  5EVL A;  2Y55 A;  3G31 A;  2A3U A;  3GRJ A;  4JBF A;  1M6K A;  4JXV A;  5EEC A;  2X01 A;  4PPR A;  1WE4 A;  3HL9 A;  4OPR A;  3Q1F A;  5FAT A;  3ZG7 B;  2ZC4 B;  3N8L A;  1YLP A;  2OLU A;  4PM6 A;  3SH7 A;  1BLH A;  4C6Y A;  3GTC A;  1MWT A;  5CHJ A;  1O7E A;  1HZO A;  3RJU A;  2X02 A;  1EI5 A;  5L2F A;  1FSY A;  3ZG9 B;  3IWO A;  3HLF A;  1HVB A;  1IYS A;  4K91 A;  4RYE A;  4JF6 A;  2WZZ A;  5G18 A;  1K25 A;  1K55 C;  3EQV A;  4EV4 A;  2Y2H A;  3G2Z A;  3RXX A;  4N1X A;  5CED A;  1IEL A;  3ZFZ A;  2WZX A;  1N4O A;  4FD8 A;  4BEN A;  3C4P A;  5CRF A;  2ZD8 A;  4JXG A;  3OPR A;  1K56 A;  4JPM A;  3IF6 C;  3FZC A;  4UHU A;  3IXG A;  1ESI A;  1XX2 A;  1LI0 A;  3CJM A;  3D4F A;  1FR1 A;  1ZC2 A;  1DJA A;  4OP5 A;  1XGI A;  5GHX A;  4P0M A;  3M2K A;  2R9X A;  1GA0 A;  4QHC A;  5HAQ A;  3E2L A;  5CGW A;  5IHV A;  4BD1 A;  3CG5 A;  4WEJ A;  3Q81 A;  4BQM A;  3AGE A;  4DDS A;  3HUM A;  4QJG A;  3G34 A;  3O87 A;  5J8X A;  2WUQ A;  4PMA A;  2Y2I A;  3BEB A;  5DF8 A;  4R1G A;  5GL9 A;  4Q8I A;  3NY4 A;  4GD6 A;  4KG2 A;  1ONG A;  5CHU A;  1ZG6 A;  3HUO A;  3PBT A;  5CER A;  3QHY A;  3IXD A;  4B4Z A;  1PWD A;  3LY4 A;  3NDE A;  2Y59 A;  4ZJ2 A;  3SOI A;  1FOF A;  3NDG A;  1K57 A;  3VMA A;  2EFX A;  1ONH A;  2DCF A;  3UN7 A;  4OQ0 A;  4LEN A;  3Q7V A;  1BT5 A;  1JWZ A;  4IBR A;  5TGF A;  1KVM A;  3O3V A;  2Y2Q A;  5FQJ A;  3W4O A;  1CI8 A;  3I7J A;  2H5S A;  1Y54 A;  3N8S A;  2WKE A;  2VGJ A;  4S2N C;  2P9V B;  1FCN A;  1ES4 A;  4U3T A;  5A93 A;  3O86 A;  3NCK A;  3VP0 A;  1TEM A;  5F1G A;  3ZG0 A;  2WYX A;  3N4I A;  3V5M A;  1EWZ A;  4KZ7 A;  1JWV A;  2DRW A;  4OON A;  4PM9 A;  3W8K A;  2BLS A;  4IED A;  4P6B A;  4LV2 A;  2WGW A;  1IYO A;  2HP5 A;  4RX2 A;  1SKF A;  2R9W A;  2XK1 A;  4JKT A;  3DWZ A;  4DE1 A;  5DVA A;  2E8I A;  1NRF A;  1K54 C;  2HDR A;  3C7V A;  1PIO A;  5F1F A;  3IXB A;  3A3J A;  3LO7 A;  5CGX A;  3VFH A;  3VFF A;  1BTL A;  3ISG A;  1XA1 A;  5I94 A;  3PBR A;  1I5Q A;  1MPL A;  2X71 A;  4K0X A;  4S2O A;  1YLY A;  2PBY A;  4WZ4 A;  1LL9 A;  5M19 A;  5E2F A;  5KMW A;  1E3U A;  1YT4 A;  2ZM0 A;  2HDS A;  2XFS A;  4DE0 A;  2ZQ7 A;  1XA7 A;  5HW3 A;  2BG1 A;  5EVI A;  1RGZ A;  2IWD A;  4BL2 A;  1ZG4 A;  4KEN B;  5GLB A;  3V3S A;  3PTE A;  4B88 A;  3IF6 B;  4WYY A;  4E3K A;  3N7W A;  4Z9Q A;  2XH9 A;  2G2U A;  4N9K A;  4Y0O A;  3W4P A;  3MXR A;  4GOG A;  5GHY A;  1L0F A;  1K4F A;  3OPP A;  4OPQ A;  2ZM2 A;  3MFD A;  2HP6 A;  2ZC5 B;  2WK0 A;  3A3D A;  1L0D A;  4X56 A;  3LY3 A;  3ZGA B;  2RCX A;  4IVK A;  5TFQ A;  5E2H A;  2ZC7 A;  3NIA A;  1MWU A;  5EUA A;  3BLS A;  2RL3 A;  5HX9 A;  5FI2 A;  3Q07 A;  1PZO A;  2OV5 A;  3ZCZ A;  2H10 A;  1H5X A;  4CPK A;  4BD0 A;  5F83 A;  3FKV A;  1YLZ A;  4MLL A;  1GHI A;  2CC1 A;  1KDW A;  3HBR A;  4KZ9 A;  3GVB A;  2HP9 A;  4R4R A;  3SS3 A;  4LV0 A;  3NI9 A;  2WAD A;  1Z6F A;  1VM1 A;  3B3X A;  4EBN A;  2VGK A;  2Y91 A;  5F82 A;  4OLG A;  1BUE A;  1IKG A;  1W7F A;  3SH8 A;  1ES5 A;  3GR2 A;  4GZB A;  3M6B A;  4E3L A;  3BLM A;  1KE4 A;  4OOY A;  4X68 A;  5HAI A;  1YM1 A;  4YIN A;  4LV1 A;  3DW0 A;  3VOY A;  3WS2 A;  4E3I A;  4IVI A;  4DRT A;  2EX6 A;  4MBH A;  1PW8 A;  1PYY A;  2Y2J A;  4WEK A;  5AQ7 A;  4KZB A;  1QMF A;  5GLD A;  3SS5 A;  5A92 A;  1WYB A;  3HRE A;  1ZKJ A;  2Z2M B;  5D3O A;  4WZ5 A;  4GB7 A;  4WMC D;  1AXB A;  4N92 A;  2WGV A;  3PAE A;  5GLC A;  1JVJ A;  1FCM A;  2V2F F;  2XGN A;  1BLC A;  4XUZ A;  3DWK A;  3PAG A;  4E6W A;  4FH4 A;  4DF6 A;  3NC8 A;  3UPO A;  3IQA A;  4OH0 A;  1LI9 A;  2EXA A;  1N9B A;  3S22 A;  1MY8 A;  4Y0U A;  4KG6 A;  1CEF A;  1ERM A;  3ZHH A;  5FAO A;  3MKF A;  5FDH A;  2H0T A;  5FI7 A;  3IH8 A;  2WKH A;  4JXS A;  1BUL A;  1ESU A;  2C5W B;  3VSL A;  1GA9 A;  5FAQ A;  4C3Q A;  3ZG8 B;  4RX3 A;  5AQA A;  2HDQ A;  1WYC A;  3Q82 A;  4S2J A;  1NZU A;  1FR6 A;  2Y2P A;  1KDS A;  1NYY A;  4A5R A;  3E2K A;  1GCE A;  4E3O A;  2C6W B;  4BLM A;  1H8Y A;  1JTD A;  3M2J A;  5DTT A;  3PBS A;  1SDE A;  2ZJ9 A;  2XDM A;  1K55 A;  4ZTK A;  4ZDX A;  2XEP A;  2GDN A;  2XD1 A;  4LCM A;  2ZQC A;  3WS1 A;  1TDL A;  3MZF A;  4EBP A;  5EVI C;  4DXC A;  4UAA A;  1FQG A;  3BRM A;  1XXM A;  4S2M A;  5BOH A;  1LLB A;  4JLF A;  4NK3 A;  4OLD A;  3VOZ A;  3VP4 A;  5EOO A;  2EX2 A;  3VP3 A;  4OOM A;  1XPB A;  4HBT A;  3HLW A;  4WBG A;  1FCO A;  2ZQ9 A;  3VP1 A;  5KZH A;  4R3B A;  3UY6 A;  5E2E A;  1SDN A;  3HVF A;  3MZE A;  3WRZ A;  3FKW A;  3ITA A;  1YLJ A;  5AQB A;  1PI4 A;  1I2W A;  2ZC6 B;  4DKI A;  4EWF A;  1SHV A;  1PWG A;  4S2L A;  4E3M A;  4MBK A;  2ZQD A;  3ZNY A;  3G4P A;  5HL1 A;  1IEM A;  3G35 A;  1GHM A;  1LHY A;  1ERQ A;  3G32 A;  1YLW A;  3TG9 A;  2Z2L B;  1K38 A;  4OOL A;  1KGF A;  2OLV A;  3IT9 A;  3DTM A;  3MKE A;  2QPN A;  4KZ8 A;  2ZM8 A;  2HPB A;  1KGG A;  4MBF A;  3Q7V B;  3VP2 A;  4MEZ A;  4S2N A;  4PM5 A;  2A49 A;  3IXH A;  4EUZ A;  1YQS A;  5HAR A;  1L0G A;  4JF5 A;  4QY6 A;  2Y2K A;  5HAP A;  3C4O A;  3CZD A;  2ZC3 B;  2WKI A;  2XQZ A;  2V20 A;  4WEL A;  1J9M A;  4LV3 A;  5FI6 A;  3N6I A;  3GV9 A;  1E25 A;  3TOI A;  1JWP A;  2XR0 A;  1CEG A;  1KE3 A;  1U60 A;  3UNW A;  4QU3 A;  1PWC A;  4B4X A;  1MWS A;  1Q2P A;  2J9P A;  2QMI A;  4E6X A;  2IWB A;  2XF3 A;  3V3R A;  5KSC A;  4HEF A;  3FYZ A;  1YMX A;  5M1A A;  1RP5 A;  4WMC A;  4H8R A;  1K54 A;  1RGY A;  4GKU A;  3N8R A;  5FQ9 A;  1FSW A;  1PW1 A;  3GSG A;  1L0E A;  3UPN A;  5FQK A;  2PU2 A;  3S4X A;  4LCL A;  1MKI A;  1MXO A;  2XD5 A;  3G2Y A;  5FQI A;  1TDG A;  5HFO A;  3FV7 A;  4JXW A;  3UO9 A;  2IWC A;  4DXB A;  5EOE A;  3ZDJ A;  2WAE A;  1W8Y A;  3OCL A;  4EBL A;  3MZD A;  4QB8 A;  3JYI A;  1NYM A;  4U0X A;  4CJN A;  2EFU A;  3OC2 A;  3UE3 A;  3V50 A;  1G6A A;  5EVI B;  3SH9 A;  1YMS A;  4O7D A;  5DTS A;  5EVI D;  5FQQ A;  1K57 C;  4KZ6 A;  4U0T A;  1KGE A;  2EX9 A;  1IYP A;  3HLC A;  3HUN A;  2XLN A;  3QNC A;  4DDY A;  3UPP A;  2HDU A;  3HLD A;  3PBN A;  2P9V A;  1NJ4 A;  4D2O A;  5E43 A;  1HD8 A;  4C75 A;  5CTN A;  4OPY A;  4QY5 A;  4RA7 A;  3IWI A;  1W79 A;  1MWR A;  3BM6 A;  5JYP A;  3LEZ A;  5EPH A;  4R4S A;  3BFC A;  1ERO A;  2JC7 A;  4XUX A;  3OZH A;  4OPZ A;  4OQG A;  3Q7Z A;  4OQH A;  3VSK A;  4N1H A;  4S2K A;  2WGI A;  2P74 A;  3HLG A;  5TR7 A;  1IKI A;  5FQM A;  4KZ4 A;  3EQU A;  3OPH A;  3WS4 A;  3PBO A;  3RXW A;  4NET A;  3TSG A;  4GDN A;  5JYO A;  2B5R A;  5DF9 A;  3GQZ A;  1DY6 A;  1GHP A;  1BLS A;  1K6S A;  2J7V A;  1BSG A;  5CHM A;  2JBF A;  3IH9 A;  3BEC A;  4FH2 A;  1Q2Q A;  4GDB A;  4ZJ1 A;  4BJP A;  3BFG A;  1XP4 A;  1M40 A;  2OSU A;  3OCN A;  3MBZ A;  2Q9M A;  3O88 A;  4OKP A;  1DJC A;  1XGJ A;  1K4E A;  1KE0 A;  2I72 A;  1CI9 A;  3GMW A;  3BFE A;  2H0Y A;  1E4D A;  2EX8 A;  4KQQ A;  5E2G A;  3A3F A;  3G30 A;  4N9L A;  5DTK A;  3IF5 A;  2ZMA A;  1L2S A;  4R23 A;  1DJB A;  1IYQ A;  4GNU A;  2J8Y A;  4S2P A;  3IF6 A;  4X6T A;  2QZ6 A;  4UA7 A;  4BL3 A;  2UWX A;  3A3I A;  1K56 D;  1ALQ A;  4KZ5 A;  3BFF A;  4P87 A;  5AQ9 A;  3UE1 A;  4XXR A;  3ZVW A;  2Y2G A;  4F94 A;  3OPL A;  1VQQ A;  3HLB A;  1NZO A;  1C3B A;  3HLE A;  5GHZ A;  1RCJ A;  4WM9 A;  5CGS A;  3W4Q A;  3C7U A;  5EE8 A;  2Y2L A;  2ZLY A;  4Y7P A;  5FAS A;  1S6R A;  4ZAM A;  4E3J A;  2JCH A;  2Y2N A;  2Y2O A;  1JTG A;  4DE3 A;  5U47 A;  4X69 A;  1MBL A;  4YFM A;  4R3J A; 
#chains in the Genus database with same CATH topology
 1W5D A;  4HES A;  4K0W A;  4PM8 A;  2L1M A;  4GD8 A;  3PBQ A;  4GLQ A;  1I2S A;  2D01 A;  2HF6 A;  2DNS A;  3O5Y A;  5A91 A;  4KQO A;  2G2W A;  1BZA A;  1KVL A;  3BFD A;  4QD4 A;  1Y28 A;  1H8Z A;  3A0R A;  1ES3 A;  3P09 A;  1HLU P;  2PBD P;  5A90 A;  4KQR A;  3D9Y A;  2ZQA A;  3V39 A;  3BY9 A;  1LL5 A;  2R78 A;  3FWL A;  5IU1 A;  1NY0 A;  2KLI A;  3F1N A;  4L0L A;  3WRT A;  2JKT I;  2J9O A;  3LFV A;  3F1P A;  1F9I A;  2V1Z A;  3KSG A;  4FCF A;  1YLT A;  1OT6 A;  4UA9 A;  3IWQ A;  3C5A A;  4X53 A;  3CMZ A;  2Y55 A;  2O0Y A;  2A3U A;  4PPR A;  3N8L A;  4PM6 A;  5CHJ A;  3T4L A;  4HP4 A;  1FSY A;  3IWO A;  1G28 A;  1K25 A;  3EQV A;  3G2Z A;  3ZFZ A;  1N4O A;  4FD8 A;  4JXG A;  1K56 A;  3IF6 C;  1LI0 A;  3D4F A;  1ZC2 A;  4OP5 A;  4P0M A;  1D7E A;  3E2L A;  1STZ A;  5CGW A;  4G3K A;  4BQM A;  3Q81 A;  3BWL A;  4QJG A;  3G34 A;  3O87 A;  5J8X A;  2Y2I A;  4GD6 A;  2V1B A;  5CHU A;  3PBT A;  1XJ3 A;  1PWD A;  1MKM A;  4ZJ2 A;  3NDG A;  3RH8 B;  3P01 A;  1ONH A;  4I3I A;  4OQ0 A;  5TGF A;  4KQD A;  1CI8 A;  1W63 Q;  1Y54 A;  4B93 A;  5FDS A;  2P9V B;  1FCN A;  3UB5 P;  3VP0 A;  4BBT A;  2WYX A;  3N4I A;  3V5M A;  3FG8 A;  3FPW A;  4HJ6 A;  1JWV A;  1LL8 A;  4PM9 A;  2BLS A;  2B02 A;  4JGP A;  3IBJ A;  3L7H A;  4X25 A;  3H7W B;  2E8I A;  4MCW A;  5F1F A;  1OTB A;  2L4R A;  2OAP 1;  3UE6 A;  3PBR A;  1MPL A;  5L8M A;  3LIC A;  4S2O A;  1YLY A;  3CHW P;  5M19 A;  2ZL1 B;  5HW3 A;  2BG1 A;  4O8G A;  3MS6 A;  4EEU A;  1OT9 A;  1RGZ A;  1ZG4 A;  2W3D A;  3V3S A;  4B88 A;  3IF6 B;  4WYY A;  4E3K A;  4Z9Q A;  4Y0O A;  3OPP A;  2HP6 A;  1UWP X;  4X56 A;  3LY3 A;  3CI6 A;  2RCX A;  1TD5 A;  4GHI B;  2RL3 A;  5HX9 A;  1PZO A;  4NXB A;  2CC1 A;  3HBR A;  3GVB A;  2HP9 A;  3JVV A;  2ZMV A;  3B3X A;  1VM1 A;  2VGK A;  2Y91 A;  3SH8 A;  1ES5 A;  4X68 A;  1V9Z A;  4YIN A;  3KSF A;  3WS2 A;  4E3I A;  3OLO A;  4KZB A;  1QMF A;  5EFW A;  2H28 A;  4GB7 A;  3LUQ A;  4N92 A;  2OAQ 1;  2W3H A;  2XGN A;  1BLC A;  4XUZ A;  1PFL A;  1S66 L;  3IQA A;  1LI9 A;  2O9B A;  3S22 A;  1CEF A;  5FAO A;  3H7W A;  3CLO A;  2H0T A;  1F98 A;  5FAQ A;  4C3Q A;  1WYC A;  1FR6 A;  2VK3 A;  2HZ5 A;  4BLM A;  4YWZ A;  3M2J A;  2ZL1 A;  2ZQC A;  2JN7 A;  3H82 B;  4QPR A;  3WS1 A;  2HJE A;  5EVI C;  3T4Q A;  5EVE A;  1FQG A;  3BRM A;  3NOP C;  2ZBB A;  3VP4 A;  5LBR A;  4BBV A;  2EX2 A;  1L3L A;  5A8B A;  1FCO A;  4CLC E;  4HNB A;  2QYB A;  3T4K A;  4R3B A;  3UY6 A;  5E2E A;  1YLJ A;  1PI4 A;  1GSV A;  4LFU A;  4E3M A;  4NKP A;  2ZQD A;  3DTI A;  1BYW A;  3G35 A;  1LHY A;  4ME4 A;  1ERQ A;  3G32 A;  4GHI A;  3MF0 A;  4FUW A;  2PD7 A;  3DTM A;  2ZM8 A;  3ZQ5 A;  3VP2 A;  4PM5 A;  2A49 A;  3IXH A;  5HAR A;  5HAP A;  3C4O A;  2WKI A;  1SKO B;  2VLG A;  2EA9 A;  1KE3 A;  4Y5F A;  4B4X A;  5F68 A;  1ODV A;  3V3R A;  2Z6C A;  1YMX A;  5M1A A;  3N8R A;  1CQA A;  1FSW A;  1PW1 A;  3LGO A;  5FQK A;  3MQQ A;  5FEF A;  3MJQ A;  1XFQ A;  3TRC A;  5FQI A;  2GZA A;  1TDG A;  5HFO A;  4R70 A;  1W8Y A;  3G6O A;  4EBL A;  5L10 A;  3A0V A;  2QKP A;  5EVI B;  1YMS A;  5DTS A;  2EX9 A;  2VV7 A;  3HLC A;  2YKH A;  4H6J B;  5HDS A;  2XLN A;  3UPP A;  2HDU A;  1NJ4 A;  5E43 A;  3P7N A;  4QY5 A;  3IWI A;  1MWR A;  4WLA A;  3H82 A;  2VA0 A;  3IBR A;  2JC7 A;  5TR7 A;  1VET B;  5FQM A;  4KZ4 A;  3ULF A;  3WS4 A;  3RXW A;  3S7O A;  1BLS A;  1K6S A;  3BEC A;  4FH2 A;  4GJ4 A;  4BJP A;  3BFG A;  1XP4 A;  3NEC A;  2OSU A;  3OCN A;  4L9F A;  3PXP A;  2H0Y A;  1E4D A;  5E2G A;  5DTK A;  3IF5 A;  2ZMA A;  1DJB A;  1IYQ A;  4LRX C;  4S2P A;  2J8Y A;  4X6T A;  2QZ6 A;  4UA7 A;  2D02 A;  2V9A A;  1YKD A;  4KZ5 A;  4P87 A;  2O9C A;  4XXR A;  4F94 A;  1VQQ A;  1YSP A;  1CJF A;  3HLE A;  4I3A A;  1SKO A;  3VV4 A;  2Y2L A;  4Y7P A;  5FAS A;  1S6R A;  4ZAM A;  5J3W A;  4R3A A;  3LR4 A;  2JCH A;  3CAX A;  1MBL A;  3ZNT A;  3BJN A;  2FFY A;  1PI5 A;  3CIT A;  4OVD A;  4UA6 A;  1NLY A;  1TVF A;  5CTM A;  3F1O A;  3S1Y A;  3ICY A;  3ITB A;  4X55 A;  1S0W A;  5CEB A;  3UDI A;  3SS4 A;  5FA7 A;  1YSQ A;  2FFF B;  5GLA A;  4FOF A;  3R7W A;  3E98 A;  1CF0 A;  2WAF A;  5CEC A;  2QJ5 A;  5CXW A;  3C30 A;  3GEC A;  3UDF A;  2Y2M A;  4CLC C;  1NXY A;  4HHD A;  3M6H A;  3WS0 A;  4Y0T A;  2IA2 A;  3QP1 A;  2XFT A;  3NBL A;  1TS6 A;  2VJW A;  4DE2 A;  4YOF A;  4S2I A;  1N9L A;  3BYD A;  1HTZ A;  2V8C A;  2W1R A;  4JXV A;  1LSW A;  3HL9 A;  3Q1F A;  5FAT A;  3EOI A;  2ZC4 B;  3T1X A;  4MN7 A;  1MWT A;  1O7E A;  2KOI A;  5F6A A;  3ZG9 B;  1IYS A;  4K91 A;  4RYE A;  4JF6 A;  2WZZ A;  1FIL A;  2Y2H A;  3RXX A;  2WZX A;  5CRF A;  3LIE A;  3OPR A;  3IXG A;  1ESI A;  1XX2 A;  5F5Y A;  5GHX A;  4Z1W A;  4GS9 A;  2WKP A;  4WEJ A;  3BEB A;  5GL9 A;  4Q8I A;  3NY4 A;  4KG2 A;  4EU0 A;  4EET B;  1ZG6 A;  5CER A;  3IXD A;  4B4Z A;  2Y59 A;  1FOF A;  4GW9 A;  3W4O A;  1BT5 A;  1JWZ A;  4IBR A;  3DTK A;  2H5S A;  4Y15 A;  3N8S A;  2OOL A;  4U3T A;  1P0Z A;  3O86 A;  1T1A A;  2XA7 M;  1IFQ A;  1EWZ A;  4KUK A;  3LID A;  2J3T C;  1IYO A;  4RX2 A;  4JKT A;  5DVA A;  2PD8 A;  4Q0H A;  3LO7 A;  3ISG A;  5I94 A;  2EWW A;  5HD5 A;  3JPU A;  3PR6 A;  2XRN A;  5KMW A;  1E3U A;  1YT4 A;  2ZM0 A;  3T1Q B;  3UME A;  4DE0 A;  2Z6D A;  5GLB A;  3PTE A;  1OTA A;  1YAX A;  2XH9 A;  1F5M A;  2PR5 A;  3MXR A;  5GHY A;  5MC7 A;  2ZM2 A;  2QHK A;  1L0D A;  3IX8 A;  2LB5 A;  5TFQ A;  2ZC7 A;  3NIA A;  3T12 B;  5L09 A;  1MWU A;  3TW8 A;  3LI8 A;  2Q0O A;  2H10 A;  4MLL A;  4II7 A;  2ZOH A;  4R4R A;  3SS3 A;  3MSH A;  4EBN A;  2HJ9 C;  1S4R A;  3VE4 A;  2PYP A;  1IKG A;  5IS1 A;  5EM0 A;  3GR2 A;  3M6B A;  1VEU A;  3C8C A;  3VOY A;  2JKG A;  3SW1 A;  4IVI A;  4DRT A;  4PKY A;  3RTY A;  4WEK A;  3W2Z A;  3BQA A;  4CLC A;  5A92 A;  5HDC A;  2Z2M B;  5D3O A;  1ACF A;  1AXB A;  3PAE A;  5GLC A;  3BW6 A;  3LR0 A;  2V2F F;  5AVE A;  4FH4 A;  1ZHH B;  2CMN A;  2WKH A;  3VSL A;  1S4S A;  3A0S A;  3K3C A;  4LGW A;  5G4Z A;  1MC0 A;  4A5R A;  4E3O A;  2LB9 A;  1H8Y A;  4K08 A;  4EES A;  2ZJ9 A;  3LR5 A;  4O0P A;  4ZDX A;  2XD1 A;  4IUH A;  1TDL A;  3MZF A;  1DP8 A;  2W3G A;  4EBP A;  4NXF A;  4UAA A;  5BOH A;  1XXM A;  2M7U A;  3T4O A;  1XPB A;  4HBT A;  3HLW A;  4WBG A;  3VP1 A;  2ZMF A;  1V9Y A;  2INW A;  3WRZ A;  4DKI A;  4S2L A;  4HJ3 A;  2WKR A;  3G4P A;  3ZNY A;  1OJG A;  4LRY C;  3IT9 A;  3MKE A;  3KSI A;  1LT0 A;  2XSS A;  3FC7 A;  3Q7V B;  1JNU A;  4MEZ A;  2PR6 A;  4JF5 A;  3LIF A;  2V20 A;  4WEL A;  1J9M A;  4LV3 A;  5FI6 A;  2O9A A;  3T4J A;  1H3Q A;  2XR0 A;  4WN5 A;  2Y79 A;  2QMI A;  2DMW A;  2JKR I;  4E6X A;  2IWB A;  2V8F A;  2XF3 A;  5KSC A;  4HEF A;  4EW7 A;  3IX3 A;  4WMC A;  3U2A A;  3LI9 A;  2V0W A;  4GKU A;  1L0E A;  4LCL A;  2PT7 A;  1MKI A;  4ZRR A;  1MXO A;  2XD5 A;  4M4X A;  2K31 A;  4Y2F A;  1OTE A;  4DXB A;  2WKQ A;  3ZDJ A;  2WAE A;  1TF1 A;  2XRO A;  4QB8 A;  3JYI A;  5TBM B;  3UE3 A;  3V50 A;  1G6A A;  5FQQ A;  1K57 C;  4KZ6 A;  3QNC A;  4I3J A;  4DDY A;  4DN0 A;  2P9V A;  1HD8 A;  5CTN A;  5HZH A;  3E4Q A;  3LEZ A;  5EPH A;  1ERO A;  4S2K A;  2P74 A;  1G5U A;  1VB6 A;  4GDN A;  3GQZ A;  5L07 A;  4BWI A;  1BSG A;  5CHM A;  4MN5 A;  4JGO A;  3IH9 A;  1Q2Q A;  3UB6 A;  1DJC A;  3FPV A;  1W63 M;  1K4E A;  1KE0 A;  3GMW A;  1YPR A;  1ZTU A;  3A3F A;  1L2S A;  4Y3I A;  3S7N A;  3IF6 A;  3IS2 B;  4NEE D;  1K56 D;  1ALQ A;  3UE1 A;  3ZVW A;  2Y2G A;  1S1Z A;  4Q0I A;  1NZO A;  3W4Q A;  3C7U A;  4E3J A;  3RFB A;  5U47 A;  2W3E A;  3B33 A;  4GN2 A;  4MNR A;  5KSH A;  4KZ3 A;  4FSF A;  3E4O A;  4KZA A;  5M18 A;  3AGD A;  3QNB A;  1T1B A;  4WL9 A;  3CUE C;  2GJ3 A;  2VV6 A;  4YNR A;  4ID4 A;  4EQI A;  3KYQ A;  3MXS A;  1XJ2 A;  3WS5 A;  3LYX A;  2ZQ8 A;  4M3K A;  3NOU C;  3A3E A;  3MFX A;  2JE5 A;  2W1T B;  1G68 A;  2WGW B;  1VHM A;  1XKZ A;  1ES2 A;  4F3L B;  3MMH A;  1SCW A;  2NUP C;  4OP8 A;  1BLP A;  2AVX A;  2HGV A;  1W8Q A;  3VOL A;  3LIB A;  3E4P A;  4RVA A;  1DP6 A;  5DF7 A;  1K6R A;  3ZVT A;  3EGD C;  4HP9 A;  3IHB A;  2FZ0 A;  4HBU A;  5EVL A;  3G31 A;  4JBF A;  1WE4 A;  4OPR A;  5IT5 A;  3ZG7 B;  1YLP A;  3SH7 A;  3T4T A;  4C6Y A;  3GTC A;  1HZO A;  3RJU A;  2X02 A;  1EI5 A;  1HVB A;  3MXQ A;  4EV4 A;  1N9O A;  2KX6 A;  4N1X A;  3S7P A;  5CED A;  3QP5 A;  1IEL A;  2ZD8 A;  3IS2 A;  2YKF A;  2JHE A;  1FR1 A;  1DJA A;  1XGI A;  3LEQ A;  3M2K A;  4DJ3 A;  1GA0 A;  4QHC A;  2K2N A;  5IHV A;  4BD1 A;  3CG5 A;  3AGE A;  3HUM A;  2WUQ A;  4PMA A;  3EWK A;  5HPF A;  1ONG A;  4BBU A;  3HUO A;  4IJG A;  3QHY A;  3LY4 A;  3NDE A;  4ESP A;  3KYE A;  3S7Q A;  1K57 A;  4EER A;  2EFX A;  5FQJ A;  2A2L A;  4S2N C;  5HWT A;  5A93 A;  2W3F A;  3NCK A;  1TEM A;  5F1G A;  3ZG0 A;  5J7E A;  1FIK A;  2DRW A;  4OON A;  1EW0 A;  3W8K A;  4P6B A;  4LV2 A;  2WGW A;  2HP5 A;  5DJT A;  1A0K A;  2R9W A;  2XK1 A;  4DE1 A;  1NRF A;  1K54 C;  2HDR A;  1PIO A;  3EEH A;  3VFH A;  3VFF A;  1BTL A;  5DJU A;  1F2K A;  4K0X A;  2PBY A;  4WZ4 A;  2JKF A;  4Y13 A;  1LL9 A;  5E2F A;  2HDS A;  1IOU A;  2ZQ7 A;  1XA7 A;  3CWF A;  5EVI A;  4BL2 A;  4H6J A;  4R6L A;  4IHQ A;  1KOU A;  3N7W A;  4GOG A;  4I39 A;  1K4F A;  3U4L P;  3PYP A;  4OPQ A;  4AFI A;  4L9G A;  1OPX A;  3MFD A;  1PNE A;  5FEG A;  2ZC5 B;  2OWJ A;  1H0M A;  3ZGA B;  5HL6 A;  4IVK A;  1VET A;  5EUA A;  1UGU A;  3BLS A;  5HSQ A;  2UV0 E;  4HJ4 A;  3DTE A;  4BD0 A;  3KYZ A;  2J3W A;  4KZ9 A;  4LV0 A;  1Z6F A;  4UQI S;  1OTI A;  5EV0 A;  5F82 A;  4OLG A;  1W7F A;  4GZB A;  1WA9 A;  4OOY A;  1YM1 A;  4LLO B;  5HPI A;  4HOI A;  3DW0 A;  2EX6 A;  5AQ7 A;  1NRJ A;  4E04 A;  1XFN A;  3HCY A;  4EUV A;  3F1P B;  3DWK A;  4DF6 A;  3NC8 A;  5KIZ A;  1MY8 A;  1NWZ A;  1ERM A;  4LPZ A;  3ZHH A;  2G7U A;  2QWS A;  3KX0 X;  5EM1 A;  1ESU A;  4ARZ B;  1GA9 A;  3ZG8 B;  4RX3 A;  5AQA A;  2HDQ A;  3Q82 A;  2Y2P A;  1NYY A;  3E2K A;  4MN6 A;  3VE3 A;  2C6W B;  1JTD A;  2VKS A;  4ZTK A;  3JVU A;  2P7J A;  4DXC A;  2VZW A;  2V1A A;  3HJI A;  4S2M A;  1LLB A;  4NK3 A;  3K3D A;  4OOM A;  3UB9 A;  2M1C A;  3LR3 A;  4G3W A;  2ZQ9 A;  3BQ8 A;  4NG2 A;  1SDN A;  3HVF A;  3ITA A;  2ZC6 B;  4WUJ A;  5HL1 A;  1IEM A;  1GHM A;  1YLW A;  3TG9 A;  2Z2L B;  1K38 A;  1KGF A;  2OLV A;  2QPN A;  1D06 A;  2VEA A;  4S2N A;  4EUZ A;  1YQS A;  2J80 A;  1L0G A;  4QY6 A;  2ZC3 B;  1J3W A;  3N6I A;  1E25 A;  1JWP A;  1CEG A;  1U60 A;  4QU3 A;  1PWC A;  5I5L A;  4HIA A;  1MWS A;  1Q2P A;  2J9P A;  1G6O A;  1RP5 A;  4H8R A;  1K54 A;  1RGY A;  5FQ9 A;  2PYR A;  4O01 A;  1NLZ A;  4Y17 A;  3KSH A;  3KO6 A;  3UO9 A;  2MJ6 A;  1PRQ A;  4CJN A;  2EFU A;  4P6Z S;  4IUK A;  3OC2 A;  4ARZ A;  1TS0 A;  5EVI D;  4U0T A;  1IYP A;  3HUN A;  3HLD A;  3PBN A;  3QP8 A;  4D2O A;  2QJ7 A;  4OPY A;  4RA7 A;  3BM6 A;  3MQO A;  5JYP A;  4R4S A;  4XUX A;  1LSX A;  3OZH A;  3SZT A;  4OPZ A;  4OQG A;  3Q7Z A;  3VSK A;  3EQU A;  3PBO A;  3TSG A;  4NET A;  1GHP A;  2Y8H A;  4GDB A;  1M40 A;  3MBZ A;  2I72 A;  1CI9 A;  3BFE A;  2EX8 A;  5HWV A;  3G30 A;  4EEP A;  4P6Z M;  4R38 A;  4CQH A;  4PAU A;  5AQ9 A;  3BFF A;  2ZOI A;  1P9R A;  4GCZ A;  2B95 A;  2W0N A;  2Y2O A;  1JTG A;  4YFM A;  4R3J A;  3UDX A;  4ZJ3 A;  3QP6 A;  1S1Y A;  4EXO A;  2EXB A;  4R0Q A;  5DFY A;  5FAP A;  3OOV A;  1PZP A;  3IHA A;  2PU4 A;  1CK3 A;  3NUL A;  3OBF A;  1X0O A;  1XJ6 A;  5DKK A;  2Q9N A;  2A24 B;  2EWV A;  1QME A;  5FSR A;  1MZU A;  3TJZ C;  4UEY A;  3MQ0 A;  4OQI A;  3ZG5 A;  2Y4A A;  4JF4 A;  4IBX A;  1OJ5 A;  4WZ5 C;  3AGF A;  3P98 A;  3UE0 A;  4LRZ E;  4ETX A;  2V0U A;  4X1M A;  1GSW A;  4PM7 A;  3WWX A;  1D1J A;  2P08 A;  4E3N A;  4ZBE A;  1O07 A;  5AVF A;  5C5K A;  4P85 A;  1E3U D;  3LCE A;  4KG5 A;  1OME A;  2KDK A;  5EEC A;  3GRJ A;  4EQ1 A;  1M6K A;  2X01 A;  4ETZ A;  3E0Y A;  2OLU A;  1BLH A;  1TS8 A;  5L2F A;  1K0K A;  5TJJ A;  3HLF A;  5G18 A;  3D72 A;  1K55 C;  1GSX A;  1T18 A;  4BEN A;  3C4P A;  2VX8 A;  4JPM A;  4MMN A;  4G3V A;  3FZC A;  4UHU A;  3CJM A;  4JGR A;  3UB7 A;  5G4Y A;  2R9X A;  5HAQ A;  4QWO A;  1SZV A;  4DDS A;  5DF8 A;  4R1G A;  3QP2 A;  5DFX A;  4HY8 A;  3SOI A;  2BAS A;  3VMA A;  1Y4O A;  2DCF A;  3UN7 A;  4LEN A;  3Q7V A;  4KUO A;  1KVM A;  2P04 A;  2Y2Q A;  3O3V A;  3I7J A;  1H8M A;  2WKE A;  2VGJ A;  5FL3 A;  1XJ4 A;  5CX7 A;  4CLC D;  1ES4 A;  3UMD A;  3K2N A;  4FTX A;  3C38 A;  2VV8 A;  2A24 A;  4KZ7 A;  2L0W A;  1N9N A;  3H9W A;  4DJ2 A;  4IED A;  1SKF A;  3DWZ A;  2O99 A;  3C7V A;  4HH3 A;  3IXB A;  3A3J A;  5CGX A;  1XA1 A;  2HV1 A;  1I5Q A;  2X71 A;  3IX4 A;  2XFS A;  3LIA A;  5TBM A;  2IWD A;  4KEN B;  5DKL A;  2G2U A;  5HWW A;  4N9K A;  5F69 A;  3W4P A;  1L0F A;  3BY8 A;  2WK0 A;  3A3D A;  2GX5 A;  4X1L A;  2JKT M;  1T1C A;  5E2H A;  1T19 A;  4NXE A;  5FI2 A;  3Q07 A;  5HDD A;  2OV5 A;  3ZCZ A;  1H5X A;  4CPK A;  5F83 A;  3FKV A;  1YLZ A;  1GHI A;  3TE8 A;  1KDW A;  4MDZ A;  3F1O B;  3NI9 A;  2WAD A;  1BUE A;  4E3L A;  3BLM A;  1KE4 A;  3L9K A;  5HAI A;  3DBA A;  3PHY A;  4LV1 A;  4PKY G;  2J3T D;  4MBH A;  3R7W B;  1PW8 A;  1PYY A;  2Y2J A;  1LSV A;  5GLD A;  2PAV P;  3SS5 A;  3DAV A;  1WYB A;  2FH5 A;  2VGL S;  3HRE A;  1ZKJ A;  5AJG A;  4WZ5 A;  4WMC D;  2WGV A;  1JVJ A;  1FCM A;  3PAG A;  4E6W A;  3UPO A;  3NHQ A;  4OH0 A;  2EXA A;  1N9B A;  3EGX C;  4Y0U A;  4KG6 A;  3MKF A;  5FDH A;  5FI7 A;  3IH8 A;  4JXS A;  2M7V A;  1BUL A;  3T1S A;  2C5W B;  2PHY A;  1DRM A;  4S2J A;  3NJA A;  1NZU A;  3NOT C;  1KDS A;  1GCE A;  5DTT A;  3PBS A;  1SDE A;  2XDM A;  1K55 A;  2XEP A;  4WF0 A;  2GDN A;  3D3O A;  4LCM A;  2W1T A;  3CPT B;  4JLF A;  4OLD A;  3V67 A;  3VOZ A;  5HD3 A;  4HI4 A;  5EOO A;  1DP9 A;  4F3L A;  3VP3 A;  4D60 A;  2VGL M;  3B42 A;  3QP4 A;  3HJK A;  5KZH A;  2E8J A;  4GS9 B;  3MR0 A;  3MZE A;  3FKW A;  5AQB A;  4EWF A;  1I2W A;  1SHV A;  1PWG A;  2ACG A;  4MBK A;  4OOL A;  1OTD A;  5J4E A;  4KZ8 A;  1AWI A;  2HPB A;  1KGG A;  4MBF A;  1S67 L;  4NXG A;  2Y2K A;  3CZD A;  2XQZ A;  4RQ9 A;  4XT2 B;  3GV9 A;  3TOI A;  4I5S A;  4B9O A;  3UNW A;  3FYZ A;  2NUT C;  4BMW A;  1P97 A;  3GSG A;  3CUE A;  2BTF P;  3UPN A;  2PU2 A;  3S4X A;  4JGQ A;  2JKR M;  3G2Y A;  2PDR A;  3FV7 A;  4JXW A;  2IWC A;  5EOE A;  3OCL A;  3MZD A;  1NYM A;  4U0X A;  3GDI A;  3SH9 A;  4O7D A;  1KGE A;  2GNX A;  3F1N B;  2K7S A;  4C75 A;  1TS7 A;  2XA7 S;  1W79 A;  3B47 A;  4HQA A;  1P9W A;  3CPT A;  2OWH A;  3BFC A;  4OQH A;  4N1H A;  1Z09 A;  2WGI A;  3HLG A;  4PHT A;  1IKI A;  3OPH A;  4I38 A;  5JYO A;  2B5R A;  5DF9 A;  3T4S A;  3T1R A;  1UWN X;  1DY6 A;  2J7V A;  2JBF A;  3T50 A;  2W27 A;  4ZJ1 A;  2Q9M A;  3O88 A;  4OKP A;  1XGJ A;  4UQI M;  4Q0J A;  3EEA A;  4KQQ A;  4N9L A;  3UB8 A;  1VEU B;  4R23 A;  4GNU A;  4BL3 A;  2UWX A;  3A3I A;  2PRF A;  4CLC B;  3OPL A;  3HLB A;  5K5B A;  4HH2 A;  1C3B A;  5GHZ A;  1RCJ A;  2I9V A;  3R4K A;  4WM9 A;  5CGS A;  4XT2 A;  5EE8 A;  2ZLY A;  3C2W A;  4L9E A;  2Y2N A;  2B18 A;  4DE3 A;  3ZYT A;  4X69 A;  4DMZ A; 
#chains in the Genus database with same CATH homology
 1W5D A;  4HES A;  3UDX A;  4K0W A;  4ZJ3 A;  4GN2 A;  4MNR A;  4PM8 A;  3ZNT A;  5KSH A;  2FFY A;  4KZ3 A;  1PI5 A;  4FSF A;  4GD8 A;  4KZA A;  5M18 A;  3PBQ A;  3AGD A;  4OVD A;  3QNB A;  4UA6 A;  1I2S A;  2EXB A;  4R0Q A;  1TVF A;  4ID4 A;  2DNS A;  5CTM A;  4EQI A;  3S1Y A;  5FAP A;  5A91 A;  3MXS A;  3ITB A;  4KQO A;  2G2W A;  4X55 A;  1BZA A;  1S0W A;  1KVL A;  1PZP A;  3WS5 A;  3IHA A;  3BFD A;  5CEB A;  2ZQ8 A;  4QD4 A;  2PU4 A;  4M3K A;  1H8Z A;  3UDI A;  1CK3 A;  1ES3 A;  3P09 A;  3A3E A;  3SS4 A;  2JE5 A;  5FA7 A;  2FFF B;  2Q9N A;  5GLA A;  5A90 A;  4KQR A;  2ZQA A;  3V39 A;  2WAF A;  5CEC A;  1QME A;  1LL5 A;  5CXW A;  3FWL A;  5FSR A;  1G68 A;  3UDF A;  1NY0 A;  2Y2M A;  2WGW B;  4L0L A;  3WRT A;  1XKZ A;  4OQI A;  2Y4A A;  4JF4 A;  3ZG5 A;  1ES2 A;  1NXY A;  2J9O A;  4IBX A;  1SCW A;  4WZ5 C;  3M6H A;  4OP8 A;  3WS0 A;  1BLP A;  2V1Z A;  4Y0T A;  3AGF A;  4FCF A;  2XFT A;  1YLT A;  3P98 A;  3NBL A;  3UE0 A;  1W8Q A;  4PM7 A;  4RVA A;  3WWX A;  4DE2 A;  5DF7 A;  1K6R A;  4E3N A;  4UA9 A;  4S2I A;  3ZVT A;  4ZBE A;  3BYD A;  3IWQ A;  1O07 A;  1HTZ A;  4P85 A;  1E3U D;  3LCE A;  3IHB A;  4KG5 A;  1OME A;  3C5A A;  4X53 A;  3CMZ A;  4HBU A;  5EVL A;  2Y55 A;  3G31 A;  2A3U A;  3GRJ A;  4JBF A;  1M6K A;  4JXV A;  5EEC A;  2X01 A;  4PPR A;  1WE4 A;  3HL9 A;  4OPR A;  3Q1F A;  5FAT A;  3ZG7 B;  2ZC4 B;  3N8L A;  1YLP A;  2OLU A;  4PM6 A;  3SH7 A;  1BLH A;  4C6Y A;  3GTC A;  1MWT A;  5CHJ A;  1O7E A;  1HZO A;  3RJU A;  2X02 A;  1EI5 A;  5L2F A;  1FSY A;  3ZG9 B;  3IWO A;  3HLF A;  1HVB A;  1IYS A;  4K91 A;  4RYE A;  4JF6 A;  2WZZ A;  5G18 A;  1K25 A;  1K55 C;  3EQV A;  4EV4 A;  2Y2H A;  3G2Z A;  3RXX A;  4N1X A;  5CED A;  1IEL A;  3ZFZ A;  2WZX A;  1N4O A;  4FD8 A;  4BEN A;  3C4P A;  5CRF A;  2ZD8 A;  4JXG A;  3OPR A;  1K56 A;  4JPM A;  3IF6 C;  3FZC A;  4UHU A;  3IXG A;  1ESI A;  1XX2 A;  1LI0 A;  3CJM A;  3D4F A;  1FR1 A;  1ZC2 A;  1DJA A;  4OP5 A;  1XGI A;  5GHX A;  4P0M A;  3M2K A;  2R9X A;  1GA0 A;  4QHC A;  5HAQ A;  3E2L A;  5CGW A;  5IHV A;  4BD1 A;  3CG5 A;  4WEJ A;  3Q81 A;  4BQM A;  3AGE A;  4DDS A;  3HUM A;  4QJG A;  3G34 A;  3O87 A;  5J8X A;  2WUQ A;  4PMA A;  2Y2I A;  3BEB A;  5DF8 A;  4R1G A;  5GL9 A;  4Q8I A;  3NY4 A;  4GD6 A;  4KG2 A;  1ONG A;  5CHU A;  1ZG6 A;  3HUO A;  3PBT A;  5CER A;  3QHY A;  3IXD A;  4B4Z A;  1PWD A;  3LY4 A;  3NDE A;  2Y59 A;  4ZJ2 A;  3SOI A;  1FOF A;  3NDG A;  1K57 A;  3VMA A;  2EFX A;  1ONH A;  2DCF A;  3UN7 A;  4OQ0 A;  4LEN A;  3Q7V A;  1BT5 A;  1JWZ A;  4IBR A;  5TGF A;  1KVM A;  3O3V A;  2Y2Q A;  5FQJ A;  3W4O A;  1CI8 A;  3I7J A;  2H5S A;  1Y54 A;  3N8S A;  2WKE A;  2VGJ A;  4S2N C;  2P9V B;  1FCN A;  1ES4 A;  4U3T A;  5A93 A;  3O86 A;  3NCK A;  3VP0 A;  1TEM A;  5F1G A;  3ZG0 A;  2WYX A;  3N4I A;  3V5M A;  1EWZ A;  4KZ7 A;  1JWV A;  2DRW A;  4OON A;  4PM9 A;  3W8K A;  2BLS A;  4IED A;  4P6B A;  4LV2 A;  2WGW A;  1IYO A;  2HP5 A;  4RX2 A;  1SKF A;  2R9W A;  2XK1 A;  4JKT A;  3DWZ A;  4DE1 A;  5DVA A;  2E8I A;  1NRF A;  1K54 C;  2HDR A;  3C7V A;  1PIO A;  5F1F A;  3IXB A;  3A3J A;  3LO7 A;  5CGX A;  3VFH A;  3VFF A;  1BTL A;  3ISG A;  1XA1 A;  5I94 A;  3PBR A;  1I5Q A;  1MPL A;  2X71 A;  4K0X A;  4S2O A;  1YLY A;  2PBY A;  4WZ4 A;  1LL9 A;  5M19 A;  5E2F A;  5KMW A;  1E3U A;  1YT4 A;  2ZM0 A;  2HDS A;  2XFS A;  4DE0 A;  2ZQ7 A;  1XA7 A;  5HW3 A;  2BG1 A;  5EVI A;  1RGZ A;  2IWD A;  4BL2 A;  1ZG4 A;  4KEN B;  5GLB A;  3V3S A;  3PTE A;  4B88 A;  3IF6 B;  4WYY A;  4E3K A;  3N7W A;  4Z9Q A;  2XH9 A;  2G2U A;  4N9K A;  4Y0O A;  3W4P A;  3MXR A;  4GOG A;  5GHY A;  1L0F A;  1K4F A;  3OPP A;  4OPQ A;  2ZM2 A;  3MFD A;  2HP6 A;  2ZC5 B;  2WK0 A;  3A3D A;  1L0D A;  4X56 A;  3LY3 A;  3ZGA B;  2RCX A;  4IVK A;  5TFQ A;  5E2H A;  2ZC7 A;  3NIA A;  1MWU A;  5EUA A;  3BLS A;  2RL3 A;  5HX9 A;  5FI2 A;  3Q07 A;  1PZO A;  2OV5 A;  3ZCZ A;  2H10 A;  1H5X A;  4CPK A;  4BD0 A;  5F83 A;  3FKV A;  1YLZ A;  4MLL A;  1GHI A;  2CC1 A;  1KDW A;  3HBR A;  4KZ9 A;  3GVB A;  2HP9 A;  4R4R A;  3SS3 A;  4LV0 A;  3NI9 A;  2WAD A;  1Z6F A;  1VM1 A;  3B3X A;  4EBN A;  2VGK A;  2Y91 A;  5F82 A;  4OLG A;  1BUE A;  1IKG A;  1W7F A;  3SH8 A;  1ES5 A;  3GR2 A;  4GZB A;  3M6B A;  4E3L A;  3BLM A;  1KE4 A;  4OOY A;  4X68 A;  5HAI A;  1YM1 A;  4YIN A;  4LV1 A;  3DW0 A;  3VOY A;  3WS2 A;  4E3I A;  4IVI A;  4DRT A;  2EX6 A;  4MBH A;  1PW8 A;  1PYY A;  2Y2J A;  4WEK A;  5AQ7 A;  4KZB A;  1QMF A;  5GLD A;  3SS5 A;  5A92 A;  1WYB A;  3HRE A;  1ZKJ A;  2Z2M B;  5D3O A;  4WZ5 A;  4GB7 A;  4WMC D;  1AXB A;  4N92 A;  2WGV A;  3PAE A;  5GLC A;  1JVJ A;  1FCM A;  2V2F F;  2XGN A;  1BLC A;  4XUZ A;  3DWK A;  3PAG A;  4E6W A;  4FH4 A;  4DF6 A;  3NC8 A;  3UPO A;  3IQA A;  4OH0 A;  1LI9 A;  2EXA A;  1N9B A;  3S22 A;  1MY8 A;  4Y0U A;  4KG6 A;  1CEF A;  1ERM A;  3ZHH A;  5FAO A;  3MKF A;  5FDH A;  2H0T A;  5FI7 A;  3IH8 A;  2WKH A;  4JXS A;  1BUL A;  1ESU A;  2C5W B;  3VSL A;  1GA9 A;  5FAQ A;  4C3Q A;  3ZG8 B;  4RX3 A;  5AQA A;  2HDQ A;  1WYC A;  3Q82 A;  4S2J A;  1NZU A;  1FR6 A;  2Y2P A;  1KDS A;  1NYY A;  4A5R A;  3E2K A;  1GCE A;  4E3O A;  2C6W B;  4BLM A;  1H8Y A;  1JTD A;  3M2J A;  5DTT A;  3PBS A;  1SDE A;  2ZJ9 A;  2XDM A;  1K55 A;  4ZTK A;  4ZDX A;  2XEP A;  2GDN A;  2XD1 A;  4LCM A;  2ZQC A;  3WS1 A;  1TDL A;  3MZF A;  4EBP A;  5EVI C;  4DXC A;  4UAA A;  1FQG A;  3BRM A;  1XXM A;  4S2M A;  5BOH A;  1LLB A;  4JLF A;  4NK3 A;  4OLD A;  3VOZ A;  3VP4 A;  5EOO A;  2EX2 A;  3VP3 A;  4OOM A;  1XPB A;  4HBT A;  3HLW A;  4WBG A;  1FCO A;  2ZQ9 A;  3VP1 A;  5KZH A;  4R3B A;  3UY6 A;  5E2E A;  1SDN A;  3HVF A;  3MZE A;  3WRZ A;  3FKW A;  3ITA A;  1YLJ A;  5AQB A;  1PI4 A;  1I2W A;  2ZC6 B;  4DKI A;  4EWF A;  1SHV A;  1PWG A;  4S2L A;  4E3M A;  4MBK A;  2ZQD A;  3ZNY A;  3G4P A;  5HL1 A;  1IEM A;  3G35 A;  1GHM A;  1LHY A;  1ERQ A;  3G32 A;  1YLW A;  3TG9 A;  2Z2L B;  1K38 A;  4OOL A;  1KGF A;  2OLV A;  3IT9 A;  3DTM A;  3MKE A;  2QPN A;  4KZ8 A;  2ZM8 A;  2HPB A;  1KGG A;  4MBF A;  3Q7V B;  3VP2 A;  4MEZ A;  4S2N A;  4PM5 A;  2A49 A;  3IXH A;  4EUZ A;  1YQS A;  5HAR A;  1L0G A;  4JF5 A;  4QY6 A;  2Y2K A;  5HAP A;  3C4O A;  3CZD A;  2ZC3 B;  2WKI A;  2XQZ A;  2V20 A;  4WEL A;  1J9M A;  4LV3 A;  5FI6 A;  3N6I A;  3GV9 A;  1E25 A;  3TOI A;  1JWP A;  2XR0 A;  1CEG A;  1KE3 A;  1U60 A;  3UNW A;  4QU3 A;  1PWC A;  4B4X A;  1MWS A;  1Q2P A;  2J9P A;  2QMI A;  4E6X A;  2IWB A;  2XF3 A;  3V3R A;  5KSC A;  4HEF A;  3FYZ A;  1YMX A;  5M1A A;  1RP5 A;  4WMC A;  4H8R A;  1K54 A;  1RGY A;  4GKU A;  3N8R A;  5FQ9 A;  1FSW A;  1PW1 A;  3GSG A;  1L0E A;  3UPN A;  5FQK A;  2PU2 A;  3S4X A;  4LCL A;  1MKI A;  1MXO A;  2XD5 A;  3G2Y A;  5FQI A;  1TDG A;  5HFO A;  3FV7 A;  4JXW A;  3UO9 A;  2IWC A;  4DXB A;  5EOE A;  3ZDJ A;  2WAE A;  1W8Y A;  3OCL A;  4EBL A;  3MZD A;  4QB8 A;  3JYI A;  1NYM A;  4U0X A;  4CJN A;  2EFU A;  3OC2 A;  3UE3 A;  3V50 A;  1G6A A;  5EVI B;  3SH9 A;  1YMS A;  4O7D A;  5DTS A;  5EVI D;  5FQQ A;  1K57 C;  4KZ6 A;  4U0T A;  1KGE A;  2EX9 A;  1IYP A;  3HLC A;  3HUN A;  2XLN A;  3QNC A;  4DDY A;  3UPP A;  2HDU A;  3HLD A;  3PBN A;  2P9V A;  1NJ4 A;  4D2O A;  5E43 A;  1HD8 A;  4C75 A;  5CTN A;  4OPY A;  4QY5 A;  4RA7 A;  3IWI A;  1W79 A;  1MWR A;  3BM6 A;  5JYP A;  3LEZ A;  5EPH A;  4R4S A;  3BFC A;  1ERO A;  2JC7 A;  4XUX A;  3OZH A;  4OPZ A;  4OQG A;  3Q7Z A;  4OQH A;  3VSK A;  4N1H A;  4S2K A;  2WGI A;  2P74 A;  3HLG A;  5TR7 A;  1IKI A;  5FQM A;  4KZ4 A;  3EQU A;  3OPH A;  3WS4 A;  3PBO A;  3RXW A;  4NET A;  3TSG A;  4GDN A;  5JYO A;  2B5R A;  5DF9 A;  3GQZ A;  1DY6 A;  1GHP A;  1BLS A;  1K6S A;  2J7V A;  1BSG A;  5CHM A;  2JBF A;  3IH9 A;  3BEC A;  4FH2 A;  1Q2Q A;  4GDB A;  4ZJ1 A;  4BJP A;  3BFG A;  1XP4 A;  1M40 A;  2OSU A;  3OCN A;  3MBZ A;  2Q9M A;  3O88 A;  4OKP A;  1DJC A;  1XGJ A;  1K4E A;  1KE0 A;  2I72 A;  1CI9 A;  3GMW A;  3BFE A;  2H0Y A;  1E4D A;  2EX8 A;  4KQQ A;  5E2G A;  3A3F A;  3G30 A;  4N9L A;  5DTK A;  3IF5 A;  2ZMA A;  1L2S A;  4R23 A;  1DJB A;  1IYQ A;  4GNU A;  2J8Y A;  4S2P A;  3IF6 A;  4X6T A;  2QZ6 A;  4UA7 A;  4BL3 A;  2UWX A;  3A3I A;  1K56 D;  1ALQ A;  4KZ5 A;  3BFF A;  4P87 A;  5AQ9 A;  3UE1 A;  4XXR A;  3ZVW A;  2Y2G A;  4F94 A;  3OPL A;  1VQQ A;  3HLB A;  1NZO A;  1C3B A;  3HLE A;  5GHZ A;  1RCJ A;  4WM9 A;  5CGS A;  3W4Q A;  3C7U A;  5EE8 A;  2Y2L A;  2ZLY A;  4Y7P A;  5FAS A;  1S6R A;  4ZAM A;  4E3J A;  2JCH A;  2Y2N A;  2Y2O A;  1JTG A;  4DE3 A;  5U47 A;  4X69 A;  1MBL A;  4YFM A;  4R3J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...