4PM5A

Crystal structure of ctx-m-14 s70g beta-lactamase in complex with cefotaxime at 1.26 angstroms resolution
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
263
structure length
263
Chain Sequence
QTSAVQQKLAALEKSSGGRLGVALIDTADNTQVLYRGDERFPMCGTSKVMAAAAVLKQSETQKQLLNQPVEIKPADLVNYNPIAEKHVNGTMTLAELSAAALQYSDNTAMNKLIAQLGGPGGVTAFARAIGDETFRLDRTEPTLNTAIPGDPRDTTTPRAMAQTLRQLTLGHALGETQRAQLVTWLKGNTTGAASIRAGLPTSWTVGDKTGSGDYGTTNDIAVIWPQGRAPLVLVTYFTQPQQNAESRRDVLASAARIIAEGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular Basis for the Catalytic Specificity of the CTX-M Extended-Spectrum beta-Lactamases.
pubmed doi rcsb
source organism Klebsiella pneumoniae subsp. pneumoniae
molecule tags Hydrolase/antibiotic
molecule keywords Beta-lactamase CTX-M-14
total genus 95
structure length 263
sequence length 263
ec nomenclature
pdb deposition date 2014-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 4pm5A00
3OPHA 1K57A 3VSLA 1YM1A 3FYZA 4QY6A 1XA1A 4R4SA 1L0GA 1S6RA 1QMFA 2Q9MA 4R4RA 5CHJA 4A5RA 5TGFA 2RL3A 3P98A 4ZJ3A 4K0WA 5DF8A 3O88A 5FAQA 5HAQA 3VOYA 4MBFA 3AGEA 1K4EA 3C4OA 2H5SA 3G2ZA 5FATA 4B4XA 1GA0A 5E2HA 4JKTA 1OMEA 3HVFA 5CGXA 5HARA 1PZPA 5KMWA 5DVAA 4BLMA 2WAFA 3HLDA 3PBQA 3LEZA 3NIAA 4D2OA 4GN2A 4KG6A 3UDXA 5CRFA 1K6SA 2Y2LA 2Y2OA 1FSWA 2ZLYA 3N4IA 1AXBA 1FCOA 2XH9A 5FAOA 5FQ9A 1L0EA 1YLYA 2EX2A 3PTEA 2EX8A 4BD0A 1E3UD 1ESIA 1IKIA 4LV2A 1YLTA 5CGSA 3LY3A 4JF5A 4LCLA 2X02A 1H8YA 1C3BA 4NK3A 4OPYA 2JC7A 3IWOA 3WS2A 3WS0A 3TOIA 1TDGA 4DRTA 1MBLA 5CHMA 4B88A 4IBXA 4OQHA 3M2KA 1KDSA 1LI9A 2X01A 4U3TA 3BRMA 5AQBA 4JLFA 3ZHHA 1JVJA 3Q07A 3ZFZA 5CEDA 1M6KA 3HLEA 3NBLA 2PBYA 5M18A 4WYYA 2A3UA 4RX2A 4GD6A 4E3KA 4PPRA 2WADA 3HLFA 3PBOA 3A3DA 4ZDXA 3HUMA 3MZFA 2PU2A 1L0DA 3ISGA 1KGGA 4WZ5A 3WS4A 5DF9A 1PW8A 1L0FA 5EE8A 3BFCA 2HP9A 2FFYA 1HVBA 4K91A 5CGWA 3SS4A 4KG5A 5A92A 2HP5A 1H8ZA 1Y54A 1XGIA 1IYPA 1ZC2A 4S2IA 3FKWA 3E2KA 5FSRA 4LENA 4UHUA 1KVLA 1W8YA 1EWZA 4WBGA 3RXWA 4KZ8A 3OZHA 4S2NC 2XGNA 4ID4A 4JF4A 5G18A 3N6IA 3N8SA 1JTDA 1ZKJA 3BFFA 1XGJA 2DNSA 4YFMA 4OOMA 5CECA 3BLSA 4NETA 4KENB 3UO9A 4XXRA 1W79A 3G32A 2QMIA 4UA9A 4CJNA 4F94A 5EUAA 5L2FA 5EPHA 5CEBA 3AGFA 5FI6A 5DF7A 3QNCA 1CEFA 2XK1A 1TEMA 4WZ4A 1K55C 1IKGA 3MBZA 3GRJA 3ITBA 3UN7A 4Y0TA 1K6RA 3A3FA 3HLBA 4GOGA 2CC1A 1HTZA 2ZQDA 4KZ7A 4WEKA 4GDBA 2Y2MA 5D3OA 5E2FA 1L2SA 4P87A 2XD5A 3LO7A 5BOHA 2J8YA 1H5XA 2XQZA 3BFGA 3CZDA 3NCKA 5F1GA 4GKUA 1MY8A 1CI9A 1ONHA 4MBHA 2OLUA 4S2OA 2P9VA 2ZMAA 1ES4A 3IT9A 1YLWA 5EECA 5EOOA 3ZVWA 5IHVA 5M1AA 1KGFA 1BLHA 1IEMA 2EX6A 2ZQ9A 3GV9A 4BQMA 5AQ7A 3VP4A 1MXOA 3SS5A 5GLDA 1BSGA 3FV7A 2Y2QA 3E2LA 5JYPA 1MPLA 3M6HA 4OH0A 3VSKA 3HBRA 3I7JA 5AQ9A 1FR1A 1DY6A 1KE4A 4R0QA 2OV5A 2HDQA 1I2WA 3ZG8B 4E3JA 1LL9A 4IEDA 4JXVA 4E6WA 4KZ3A 4P6BA 2HDUA 3IWIA 3VP1A 4KZBA 3DW0A 4E3MA 4HBUA 4Y0OA 5GHXA 1BLPA 1NJ4A 2WKEA 1MWUA 3RJUA 1U60A 4KZ4A 1MWTA 3EQUA 2ZQAA 2A49A 4GDNA 1W7FA 1ZG6A 2WAEA 3NI9A 3V39A 3NY4A 1FR6A 3IQAA 1BLCA 1ES3A 4OQ0A 3MZDA 2ZQ7A 4RYEA 2ZC6B 2WKIA 2XR0A 3Q7ZA 5EVID 4QU3A 3UE3A 3UDFA 3IH9A 2XD1A 3CG5A 3MXRA 1YQSA 3SOIA 4QY5A 5GL9A 4BENA 4RVAA 1W8QA 3FKVA 5E43A 3OCNA 5GLAA 3DWZA 2Y55A 4JBFA 3G35A 2ZQCA 1FQGA 1W5DA 2VGKA 2Z2LB 3OCLA 5FQJA 1IYSA 1K57C 2R9XA 1E3UA 4GZBA 3IXBA 4Y7PA 2GDNA 3VP3A 4IBRA 1LHYA 1MWRA 1YT4A 1O07A 3HREA 3IH8A 4MEZA 1IYOA 1K55A 5FQMA 3V5MA 1LI0A 3VP0A 3Q7VA 3ZG9B 3ZNTA 1GCEA 1YLJA 5GLBA 3PBSA 2WYXA 1M40A 3BECA 1PW1A 4S2PA 3VFFA 3VP2A 1LL5A 4R1GA 3ZCZA 2BG1A 1ERMA 4LCMA 5FI2A 4OPQA 4OONA 2EX9A 4P85A 4KG2A 4KQOA 3BLMA 2DCFA 4WM9A 1I2SA 2WKHA 4PM7A 4B4ZA 4Q8IA 2WGIA 5HAIA 4M3KA 2WZZA 1NZUA 1FCMA 5F82A 3C7VA 4OOLA 3M6BA 2WGVA 4OP5A 5KSHA 1K4FA 1KE3A 3A3EA 4KZ6A 3PAEA 4E3IA 5GHYA 3V50A 2Y2KA 1YMXA 3HLWA 2B5RA 2V20A 4K0XA 5J8XA 3BEBA 3PAGA 3MXSA 4PMAA 3HUOA 4HEFA 1FSYA 2V1ZA 4C3QA 1KGEA 4UAAA 2Y2PA 2XDMA 4WZ5C 1S0WA 4OLDA 5HFOA 1GA9A 3RXXA 4U0XA 4IVKA 2ZM8A 2Y4AA 4JXGA 1NYMA 4IVIA 5A90A 3VMAA 2JCHA 5EVLA 3Q7VB 2UWXA 5EOEA 3OC2A 4X53A 4LV3A 4MBKA 2WZXA 4L0LA 3BFEA 1E4DA 1I5QA 1K54A 2ZM0A 4E3LA 4CPKA 4FH4A 2Q9NA 3GQZA 5EVIC 4DDYA 3V3SA 1NZOA 3IF6C 1NRFA 4YINA 3IXDA 4KZAA 1VM1A 4KQRA 4ZBEA 4X68A 2H0YA 2IWBA 3IXGA 2Y2JA 1XP4A 2J9PA 5CERA 1JWVA 2E8IA 3IHAA 2Y2GA 3Q1FA 1SDEA 5GHZA 4DE1A 3MFDA 2JE5A 2C5WB 3IF5A 1KVMA 1IELA 3P09A 1ES5A 4DE2A 1CI8A 1FOFA 2WGWB 1NY0A 4QB8A 3UDIA 5A93A 4E6XA 5EVIB 3Q82A 1PYYA 2ZC7A 3PBTA 4OP8A 4DKIA 1KE0A 4JF6A 4ZJ2A 2G2WA 1RP5A 5HW3A 4C6YA 3SH9A 4EBLA 3WS5A 2HDSA 3VOZA 1CK3A 5FDHA 4N9KA 3BYDA 1HD8A 3G30A 4Z9QA 3TSGA 3HL9A 5F1FA 4OPZA 2OLVA 1PWCA 5CTMA 4XUXA 3Q81A 4DF6A 3WWXA 4OOYA 3GMWA 5FA7A 2H0TA 4PM9A 2HPBA 3W4QA 1ZG4A 2Y59A 4OPRA 3D4FA 4EBNA 4DXCA 1JWPA 4X56A 5M19A 3MKEA 2Y2IA 4MNRA 3N8RA 4ZTKA 2XF3A 5HL1A 2XFTA 1RGZA 5CTNA 3G34A 5EVIA 3SH7A 4BL3A 3S1YA 3ZDJA 1K54C 4WMCD 1YLZA 1BZAA 2Y2HA 4QD4A 1ONGA 1K56D 1CEGA 4X69A 1NXYA 1XKZA 4N9LA 4OVDA 4X55A 1DJBA 2Y91A 1BULA 5I94A 1J9MA 5KSCA 3EQVA 3FZCA 3OPRA 4S2LA 4DDSA 1K25A 1IYQA 3TG9A 5FAPA 3W4PA 1FCNA 3CJMA 3FWLA 3NDEA 4FD8A 3W8KA 4OQIA 2DRWA 5FQKA 4DXBA 3IF6B 3SS3A 4XUZA 1N4OA 5F83A 1K56A 4R3BA 4HBTA 1XA7A 2ZQ8A 4KZ5A 3UE0A 1HZOA 2PU4A 1SHVA 4PM6A 1YLPA 1EI5A 1PI4A 4ZJ1A 5HAPA 2IWCA 1WE4A 3S4XA 1DJCA 1N9BA 2HDRA 3C4PA 4FSFA 3BFDA 2I72A 3MKFA 4GNUA 1SCWA 1SDNA 3O3VA 1DJAA 1GHMA 4QJGA 4OLGA 1G6AA 3O86A 4RA7A 2ZC4B 1K38A 4UA6A 4X6TA 2ZD8A 3NC8A 4HESA 4PM8A 4OKPA 4UA7A 3DTMA 1EROA 5A91A 3WRTA 3B3XA 1ALQA 3A3JA 3NDGA 4BD1A 2XFSA 1MKIA 4FCFA 3PBNA 2Y2NA 5FQIA 4BJPA 2RCXA 4WELA 3ZGAB 1JWZA 5CXWA 2BLSA 3G31A 1RCJA 2WUQA 3G2YA 3HLGA 1LLBA 3IXHA 4N1HA 4S2KA 4KZ9A 5JYOA 4RX3A 5FQQA 4LV0A 1GHPA 1XXMA 4WMCA 1PWDA 3UY6A 2WK0A 3W4OA 2FFFB 4S2MA 3ZVTA 1JTGA 1XX2A 2EFUA 4DE0A 3GSGA 4E3NA 2ZC3B 1TDLA 4E3OA 4P0MA 5KZHA 3AGDA 4QHCA 4EQIA 4EBPA 1YMSA 3PBRA 1E25A 4C75A 3V3RA 1BLSA 5FASA 5CHUA 4GD8A 1Z6FA 2EFXA 4O7DA 3JYIA 4JXWA 3WRZA 2G2UA 3N7WA 1O7EA 4N1XA 3GR2A 1NYYA 1G68A 4Y0UA 3ZG7B 4BL2A 2EXAA 1ES2A 2Z2MB 3S22A 5DTTA 5TFQA 1BT5A 5GLCA 4EUZA 4R23A 1Q2PA 2OSUA 4FH2A 1PZOA 2X71A 1WYCA 3ZNYA 1BTLA 3C5AA 2XEPA 2HP6A 3HLCA 1PIOA 4ZAMA 3ITAA 2V2FF 3IF6A 3SH8A 2ZJ9A 3UNWA 3CMZA 5DTSA 3IHBA 1SKFA 3QNBA 3M2JA 3HUNA 5TR7A 1PWGA 1GHIA 5AQAA 5HX9A 4JXSA 2J9OA 4S2JA 5E2EA 1ERQA 4EV4A 1WYBA 1MWSA 4U0TA 2VGJA 1Q2QA 3A3IA 3LCEA 1PI5A 4EWFA 2ZM2A 3WS1A 2P74A 5E2GA 2C6WB 1RGYA 4R3JA 2XLNA 4WEJA 2H10A 4N92A 3UE1A 3BM6A 3UPNA 3OPLA 3GTCA 4DE3A 4S2NA 3O87A 2EXBA 1XPBA 2QZ6A 2WGWA 3MZEA 3ZG0A 5U47A 3UPPA 4PM5A 3QHYA 2QPNA 4JPMA 3UPOA 2JBFA 2J7VA 3G4PA 3GVBA 3ZG5A 1KDWA 2P9VB 5FI7A 1BUEA 1TVFA 3N8LA 4H8RA 2R9WA 3DWKA 3LY4A 3OPPA 4MLLA 4GB7A 4OQGA 5DTKA 1ESUA 2IWDA 4KQQA 2ZC5B 1QMEA 3IWQA 4LV1A 3VFHA 1VQQA 3C7UA
chains in the Genus database with same CATH superfamily
3LIAA 1YM1A 3FYZA 1S1ZA 4R4SA 4Q0IA 2RL3A 4ZJ3A 3O88A 2K7SA 3KYEA 3C4OA 1OT6A 4JKTA 1OMEA 5KMWA 5K5BA 2PHYA 4BLMA 4PKYA 4D2OA 4GN2A 5I5LA 4Y15A 1L0EA 2W1TA 2EX8A 1IKIA 1N9NA 4LCLA 5TJJA 3P01A 3IWOA 3TOIA 4DRTA 1H8MA 5CHMA 3M2KA 5AQBA 3BRMA 3Q07A 3BJNA 4O0PA 4HI4A 3S7QA 5M18A 2PBYA 1S4SA 4GCZA 2A3UA 2WADA 3MZFA 2O9BA 4DN0A 2LB5A 2VEAA 3WS4A 1PW8A 1V9YA 1L0FA 3T1QB 3BFCA 2ZL1B 1HVBA 1H8ZA 1XGIA 3FPVA 3T4QA 3E2KA 4UHUA 4S2NC 3H82B 3DTKA 1ZKJA 1XGJA 2YKHA 4ME4A 3UO9A 1W79A 4EXOA 3G32A 3A0VA 4F94A 5EPHA 1TEMA 4I3JA 2OAQ1 1OTEA 3A3FA 3HLBA 1HTZA 2PT7A 4KZ7A 3KX0X 2V8CA 2J8YA 1H5XA 3NCKA 5F1GA 4GKUA 1CI9A 3OOVA 4MBHA 5EOOA 2P9VA 1YLWA 5IHVA 4EU0A 2EX6A 2ZQ9A 2VGLM 3VP4A 5EV0A 3M6HA 3VSKA 2OV5A 3ZG8B 2HDQA 3ICYA 4IEDA 2JKGA 2HDUA 4EEPA 3VP1A 4E3MA 4HBUA 4Y0OA 5GHXA 4EERA 1ZHHB 2EWVA 3RJUA 1ACFA 1W7FA 1ZG6A 3NI9A 3V39A 3NY4A 3IQAA 3MZDA 3T4JA 3UE3A 2B02A 3UDFA 3C38A 1OT9A 3R7WB 5GL9A 4RVAA 1W8QA 4JBFA 3G35A 2ZQCA 1W5DA 4H6JA 1E3UA 3CAXA 1YT4A 1O07A 5HD3A 1IYOA 5FQMA 1LI0A 3ZG9B 3TW8A 3PBSA 4WF0A 1M40A 4S2PA 4UQIM 3S7OA 3RTYA 2BG1A 4LCMA 2P04A 4OPQA 4KG2A 2DCFA 4B4ZA 4Q8IA 1FCMA 4KZ6A 3V50A 2VZWA 3HLWA 2B5RA 2W1TB 5HWTA 1VEUB 5J8XA 1MZUA 2Y2PA 4WZ5C 1S0WA 4HHDA 1GA9A 3RXXA 1KOUA 1NYMA 4IVIA 3MFXA 3CPTA 3Q7VB 1PFLA 4G3KA 4X53A 2ZM0A 4FH4A 3QP1A 4DDYA 3C2WA 1GSXA 4ZBEA 2H0YA 4FOFA 4HJ3A 2IWBA 4IJGA 1XP4A 2V1AA 5GHZA 4DE1A 2JE5A 3IF5A 3VE3A 4HH3A 3Q82A 1PYYA 3BY9A 4DKIA 1ODVA 4B93A 3LI8A 4ZJ2A 5HW3A 3JVVA 3SH9A 5HZHA 3WS5A 2HDSA 1YKDA 1TS7A 5FDHA 3BYDA 4ESPA 2OLVA 4L9GA 3Q81A 4DF6A 3WWXA 2AVXA 4OOYA 5FA7A 2H0TA 2PR6A 1ZG4A 1TD5A 2PD8A 4ZTKA 5HL1A 4LRZE 4K08A 5EVIA 3ZDJA 4WMCD 1YLZA 3NOTC 3FC7A 1BZAA 2Y79A 1K56D 4X69A 4N9LA 3EGXC 1J9MA 2HF6A 1STZA 4S2LA 3CJMA 3FWLA 4DXBA 3IF6B 2V8FA 4XUZA 1PRQA 2QJ5A 5IT5A 1LL8A 1SHVA 1WE4A 4FSFA 3BFDA 2FZ0A 2I72A 3MKFA 3ULFA 3NOPC 5A8BA 3O86A 3UB8A 4UA6A 2ZD8A 4HESA 1VEUA 5A91A 3B3XA 1MKIA 5FQIA 3ZYTA 4L9FA 2XRNA 4Y13A 3O5YA 1JWZA 2KLIA 4Q0JA 2BLSA 3G2YA 3HLGA 4N1HA 4S2KA 4KZ9A 5HL6A 4RX3A 1GHPA 4RQ9A 2QWSA 3VOLA 2O0YA 2PBDP 4S2MA 3GSGA 2M7VA 5KZHA 4QHCA 1EW0A 1YMSA 4Y2FA 1E25A 3V3RA 3KYQA 2W3DA 1YSQA 3WRZA 2G2UA 4MN6A 4BL2A 3R7WA 5F5YA 4CLCA 4R23A 2HV1A 1Q2PA 2OSUA 4FH2A 1WYCA 1OTDA 3ZNYA 2OAP1 2JKTM 1PIOA 4ZAMA 2ZJ9A 5J7EA 3IHBA 2OWJA 4EQ1A 2W3HA 3QNBA 3HUNA 5AQAA 4JXSA 4S2JA 3TE8A 2VGJA 3A3IA 3WS1A 4UQIS 2C6WB 2OOLA 1XFQA 2XLNA 1N9LA 2PYRA 3O87A 1AWIA 4PM5A 3B42A 5U47A 3U2AA 4JPMA 2JBFA 2J7VA 3T1XA 4MLLA 4OQGA 3T4KA 3F1NB 2O9CA 4KQQA 1VQQA 3OLOA 2D01A 3VSLA 1QMFA 4ARZA 5TGFA 3NULA 3LR4A 1OJGA 5FAQA 5HAQA 4MBFA 4NXBA 1UWNX 2H5SA 1TS6A 3LGOA 2L0WA 3QP4A 5DVAA 3FPWA 3NIAA 3H82A 1FSWA 1FCOA 5FDSA 5FAOA 5FQ9A 1YLYA 2XSSA 4LV2A 4IHQA 1H8YA 3QP6A 1P9WA 2JKRI 1VB6A 4GS9A 4B88A 2X01A 1KDSA 1LI9A 3ZHHA 4JLFA 3BQAA 4CLCB 1JVJA 3ZFZA 4NXGA 3NBLA 2J3TC 4RX2A 4GD6A 5HDSA 5AJGA 3PBOA 3A3DA 3KSIA 2PU2A 1BYWA 4WZ5A 3E0YA 5EE8A 5CGWA 2HJEA 1XFNA 2P7JA 1Y54A 3K3CA 1IYPA 1NRJA 5FSRA 3BY8A 4PAUA 4KZ8A 3OZHA 2XGNA 4JF4A 1H3QA 5G18A 2R78A 3K2NA 2DNSA 5CECA 3LIDA 4NETA 1SKOB 1TS8A 5C5KA 2QMIA 5EUAA 3AGFA 5FI6A 4E04A 5DF7A 1W63Q 3QP8A 4ZRRA 1IKGA 3MMHA 3GRJA 3UN7A 4Y0TA 5EVEA 4GOGA 4XT2B 5D3OA 2ZQDA 2Y2MA 1L2SA 3CZDA 1MY8A 2OLUA 3IT9A 5M1AA 2V0WA 1BLHA 3GV9A 1S4RA 5AQ7A 3LIBA 3SS5A 5GLDA 1BSGA 4OH0A 3I7JA 1DY6A 1KE4A 4E3JA 4E6WA 4JGPA 4KZBA 3T4LA 3DW0A 2JN7A 1PNEA 1U60A 4KZ4A 2VV6A 2A49A 2WAEA 2ZMFA 3C30A 4RYEA 2ZQ7A 2WKIA 3Q7ZA 4QU3A 4YNRA 1YQSA 4QY5A 5E43A 1XJ6A 2VLGA 2Y8HA 3FKVA 1OTBA 2Y55A 1FQGA 2L4RA 2P08A 1IYSA 1K57C 5DFYA 2GDNA 2M7UA 3LEQA 4IBRA 3V5MA 3T1RA 5EM1A 2W1RA 4NXFA 1TF1A 1DP6A 3VP2A 1PW1A 1LL5A 2O99A 2JKRM 2A24A 1I2SA 2WKHA 2WZZA 4M4XA 1NZUA 3M6BA 2WGVA 3IX3A 3TRCA 4NKPA 3E4OA 3UB9A 2W0NA 3UE6A 2Y2KA 1YMXA 2L1MA 4K0XA 2B95A 3PAGA 3MXSA 3KSGA 1T1BA 3NHQA 5MC7A 2HZ5A 5IS1A 1KGEA 4I5SA 4DJ3A 2VV8A 5AVEA 4IVKA 2ZM8A 4JXGA 4EETB 3VMAA 5EVLA 2UWXA 4O01A 3OC2A 3CLOA 2V0UA 1E4DA 1K54A 4CPKA 2Q9NA 1NZOA 2PAVP 4GJ4A 4MCWA 1VM1A 4BMWA 2K31A 3IXGA 2Y2JA 3LI9A 5CERA 1JWVA 2Y2GA 1LSVA 1SDEA 3CUEC 3MFDA 2C5WB 2XROA 1ES5A 2H28A 5A93A 4E6XA 2ZC7A 3PBTA 1DP8A 1KE0A 5F69A 3VOZA 1CK3A 3G30A 5F1FA 3HL9A 4NXEA 3RH8B 1P9RA 3RFBA 4FTXA 2HPBA 3IBRA 1LT0A 1JWPA 5M19A 4MNRA 2XF3A 3E4QA 4JGRA 3SH7A 3LICA 2A24B 4I3IA 2Y2HA 1ONGA 4NEED 4OVDA 1DJBA 2Y91A 5I94A 5KSCA 4R38A 4DDSA 1K25A 3UMDA 3TG9A 2Z6DA 4FD8A 4OQIA 5FQKA 1N4OA 5F83A 5F6AA 3LIFA 2PU4A 4GW9A 1YLPA 5HAPA 1DJCA 2HDRA 2FH5A 3C4PA 1DJAA 1GHMA 4OLGA 2ZC4B 1K38A 3L9KA 3DTEA 4UA7A 1EROA 3T1SA 4CQHA 3A3JA 3NDGA 3UB6A 2RCXA 3G31A 1LLBA 4NG2A 1XXMA 4WMCA 3UY6A 2WK0A 3CUEA 3W4OA 4QPRA 2UV0E 1XX2A 4E3NA 2ZC3B 3T4OA 1FILA 4E3OA 5FASA 5CHUA 1Z6FA 3JYIA 1O7EA 4N1XA 3GR2A 1G68A 4WL9A 1ES2A 3S22A 5DTTA 3KSHA 4YOFA 5L09A 4X25A 2X71A 3C5AA 2HP6A 2V2FF 3IF6A 3SH8A 3CMZA 1SKFA 1DP9A 3D3OA 1GHIA 1MWSA 2HJ9C 2NUPC 3D9YA 5E2GA 1UGUA 4WEJA 3UE1A 3OPLA 4KQDA 4S2NA 3MZEA 4WUJA 5DFXA 3UPOA 3DBAA 1BUEA 4H8RA 2R9WA 4GB7A 3T4TA 3S7NA 3L7HA 1QMEA 4LV1A 5LBRA 3OPHA 4H6JB 1K57A 1L0GA 1S67L 4R4RA 5CHJA 4K0WA 5DF8A 3AGEA 5FATA 1YAXA 5E2HA 3B47A 3HVFA 4Q0HA 3IX4A 2WAFA 3HLDA 3PBQA 3MR0A 3LUQA 3UDXA 4HOIA 5CRFA 2Y2LA 3IS2B 1YPRA 2EX2A 4HQAA 3PTEA 4BD0A 1YLTA 4CLCE 2VA0A 3IX8A 1C3BA 3F1NA 3LFVA 4NK3A 1OTAA 2JC7A 1F2KA 3QP5A 4OPYA 3WS0A 3LR0A 1MBLA 2A2LA 5CX7A 4U3TA 4BBVA 1LSWA 1M6KA 3PHYA 4E3KA 4ZDXA 3ISGA 1KGGA 1FIKA 2Q0OA 3QP2A 4QWOA 4K91A 2GNXA 2HP5A 2ZMVA 1ZC2A 4S2IA 3FKWA 4HY8A 1KVLA 3T12B 2B18A 4WBGA 3RXWA 3N6IA 5G4YA 4MDZA 4YFMA 3BLSA 4KENB 1T18A 1W63M 4GLQA 3V67A 2JKTI 1F9IA 1K55C 3VE4A 3CHWP 3MBZA 3ITBA 4WN5A 1MC0A 3IBJA 5E2FA 4GDBA 1D06A 2QYBA 5BOHA 3BFGA 2XQZA 3S7PA 2ZMAA 1ES4A 3ZVWA 1KGFA 4BQMA 1CJFA 1P97A 1F98A 5JYPA 4LRXC 1MPLA 3HBRA 5AQ9A 4GS9B 1FR1A 3CWFA 4P6BA 1NJ4A 5J4EA 1MWUA 1MWTA 2ZQAA 2PYPA 1BLCA 2IA2A 4OQ0A 5EVID 4Y17A 1TS0A 5GLAA 2GX5A 3DWZA 2Z2LB 2R9XA 3IXBA 3VP3A 4HNBA 1LHYA 1MWRA 5DKKA 3HREA 3IH8A 4MEZA 3C8CA 3VP0A 2WYXA 3BECA 5HDDA 1ERMA 2XA7M 2KOIA 4OONA 2EX9A 4P85A 1G28A 4BBTA 3BLMA 2I9VA 4PM7A 2WGIA 5HAIA 4M3KA 4DMZA 5F82A 4OOLA 1K4FA 1KE3A 3A3EA 1IOUA 2ZL1A 3PAEA 4E3IA 5GHYA 4EEUA 5HWWA 2V20A 4G3WA 4HJ4A 3BEBA 4PMAA 2W27A 2W3GA 1FSYA 2PDRA 2WKPA 2QJ7A 2XA7S 2VV7A 2V1BA 2ACGA 2XDMA 4OLDA 5HFOA 1J3WA 2Y4AA 5A90A 2JCHA 3T4SA 4LV3A 4R70A 4MBKA 2WZXA 4L0LA 2KX6A 1I5QA 4KUOA 2QKPA 3GQZA 5EVIC 3IF6C 4YINA 3OBFA 4KQRA 3F1OA 1D1JA 3JPUA 2J9PA 2E8IA 2EWWA 3PYPA 3P09A 1OPXA 4X1MA 1CI8A 1FOFA 1NY0A 4F3LB 5EVIB 2OWHA 4OP8A 2QHKA 3A0RA 2G2WA 1RP5A 4EBLA 3UB5P 4N9KA 2W3EA 2ZOHA 2HGVA 3E4PA 4OPZA 1PWCA 5CTMA 4PHTA 3SZTA 3GMWA 3W4QA 2Y59A 4EBNA 4X56A 4WLAA 2Y2IA 3N8RA 5TBMA 2WKQA 2XFTA 1RGZA 4BL3A 1K0KA 5EM0A 1MKMA 4F3LA 1IFQA 2EA9A 1GSVA 1CQAA 3EQVA 3FZCA 5FAPA 3W4PA 1FCNA 3NDEA 2M1CA 5KIZA 4LPZA 3H9WA 2VJWA 4R3BA 3D72A 2YKFA 3CPTB 4ZJ1A 1PI4A 4ETXA 4B9OA 4EW7A 3LIEA 3UB7A 3S4XA 2J80A 1N9BA 4GNUA 1SDNA 3O3VA 1D7EA 4QJGA 5DJUA 1G6AA 5L07A 4X6TA 4CLCC 3CITA 3LR3A 4PM8A 5FEGA 4OKPA 4HP4A 4BD1A 4FCFA 3PBNA 2PD7A 2LB9A 4WELA 3ZGAB 5CXWA 3HCYA 3P7NA 5FQQA 2BTFP 2O9AA 2FFFB 2EFUA 4DE0A 1DRMA 5DJTA 3AGDA 4EQIA 4EBPA 4C75A 1BLSA 4GD8A 4LLOB 2EFXA 4O7DA 4Z1WA 1NWZA 3N7WA 4P6ZS 2VX8A 4Y0UA 3ZG7B 3FG8A 1BT5A 5GLCA 4CLCD 1PZOA 2KDKA 2XEPA 3UNWA 3GDIA 5DTSA 3CI6A 5TR7A 1A0KA 2J9OA 5E2EA 4O8GA 1ERQA 4BWIA 3GECA 1F5MA 4U0TA 1Q2QA 3LCEA 1PI5A 2ZM2A 2P74A 1SKOA 2H10A 4N92A 4YWZA 1GSWA 3GTCA 5DKLA 2EXBA 2QZ6A 2WGWA 4MN7A 3ZG0A 3QHYA 3GVBA 1KDWA 1Y4OA 5FI7A 1TVFA 3DWKA 3LY4A 5DTKA 2IWDA 2ZC5B 3HJKA 5HSQA 3T50A 4QY6A 1XA1A 1S6RA 2Q9MA 4A5RA 3LR5A 3P98A 3VOYA 1K4EA 4R3AA 3G2ZA 4B4XA 1GA0A 5CGXA 5HARA 1PZPA 3MQ0A 1S1YA 4G3VA 4L9EA 3LEZA 1P0ZA 4KG6A 1K6SA 2Y2OA 2ZLYA 3N4IA 2BASA 1AXBA 2XH9A 1E3UD 1ESIA 2VK3A 3LY3A 4JF5A 5CGSA 2X02A 3W2ZA 3WS2A 1TDGA 4IBXA 4OQHA 3HJIA 3LYXA 5CEDA 1T1AA 3HLEA 2Z6CA 1H0MA 4WYYA 4PPRA 3HLFA 3HUMA 2GJ3A 1L0DA 5TBMB 5DF9A 3ZQ5A 2HP9A 2FFYA 3MS6A 3SS4A 4KG5A 5A92A 4LFUA 4KUKA 4MMNA 4LENA 1W8YA 1EWZA 1VETA 5FEFA 3IS2A 2ZOIA 3G6OA 4JGQA 1NLYA 4ID4A 3EOIA 3N8SA 3R4KA 1JTDA 3H7WB 3EEHA 3BFFA 4IUHA 1XJ4A 4OOMA 4XXRA 3PR6A 4UA9A 4CJNA 5L2FA 5CEBA 5HDCA 3QNCA 3BW6A 1CEFA 2XK1A 4WZ4A 1K6RA 4AFIA 2CC1A 4WEKA 2J3WA 4P87A 2XD5A 3LO7A 3KYZA 1NLZA 5HPFA 1ONHA 4GHIA 4S2OA 5EECA 4JGOA 4HIAA 1IEMA 1T19A 1MXOA 4EUVA 3FV7A 2Y2QA 3E2LA 2INWA 4R0QA 1I2WA 3H7WA 2J3TD 4R6LA 1LL9A 4JXVA 4KZ3A 3IWIA 4X1LA 5L10A 1Y28A 3NOUC 1BLPA 2WKEA 5F68A 5L8MA 3EQUA 4EESA 4GDNA 1FR6A 1ES3A 4DJ2A 2ZC6B 4II7A 3F1PB 2XR0A 4XT2A 1S66L 5HD5A 3IH9A 2XD1A 1SZVA 3CG5A 3MXRA 3SOIA 4BENA 1HLUP 3BWLA 3OCNA 3MF0A 3OCLA 3SW1A 2VGKA 5FQJA 3DAVA 4GZBA 4Y7PA 3UMEA 1K55A 2E8JA 3Q7VA 3ZNTA 1GCEA 1YLJA 5GLBA 3JVUA 3VFFA 4R1GA 3ZCZA 5EFWA 5FI2A 3KO6A 1ZTUA 4KQOA 2NUTC 2K2NA 3F1PA 4WM9A 3F1OB 1V9ZA 4HP9A 3MJQA 3C7VA 4OP5A 2JHEA 5KSHA 4Y3IA 2V9AA 4ETZA 3HUOA 4HEFA 2V1ZA 4C3QA 3MXQA 4UAAA 3NECA 1Z09A 4U0XA 1OTIA 1G5UA 3EGDC 3B33A 5EOEA 3BFEA 3EWKA 4E3LA 3V3SA 1NRFA 3IXDA 4KZAA 2MJ6A 4X68A 4HH2A 2JKFA 3IHAA 3Q1FA 4DE2A 1KVMA 1IELA 3MSHA 2WGWB 2ZBBA 4QB8A 3UDIA 4ARZB 4HJ6A 4JF6A 4PKYG 4C6YA 1XJ2A 5AVFA 1HD8A 4Z9QA 3TSGA 2W3FA 4XUXA 2WKRA 2CMNA 4PM9A 4OPRA 3D4FA 4DXCA 4I39A 3MKEA 5CTNA 3G34A 3S1YA 3DTIA 1K54C 4QD4A 3TJZC 1CEGA 1NXYA 1XKZA 4X55A 1BULA 1OJ5A 1X0OA 3OPRA 2PR5A 1IYQA 5IU1A 3W8KA 2DRWA 3SS3A 1K56A 2G7UA 4HBTA 1XA7A 2ZQ8A 4KZ5A 3UE0A 1HZOA 2VKSA 4FUWA 4Y5FA 4PM6A 1EI5A 3BQ8A 3U4LP 2IWCA 3VV4A 4I3AA 4UEYA 1SCWA 1VHMA 5HPIA 4RA7A 4P6ZM 3NC8A 4D60A 3DTMA 5J3WA 3WRTA 1ALQA 2XFSA 4BJPA 2Y2NA 2D02A 1RCJA 2WUQA 3IXHA 5JYOA 1XJ3A 4LV0A 3MQOA 1PWDA 3MQQA 3ZVTA 1JTGA 1TDLA 4P0MA 1T1CA 3NJAA 5FL3A 3PBRA 2VGLS 4JXWA 4IUKA 1NYYA 2GZAA 5HWVA 2EXAA 2DMWA 2Z2MB 5TFQA 4MN5A 4EUZA 4LGWA 5G4ZA 4BBUA 1BTLA 3HLCA 3ITAA 3EEAA 3KSFA 1G6OA 1VETB 1CF0A 3M2JA 1PWGA 1JNUA 5HX9A 1L3LA 1N9OA 4EV4A 1WYBA 4EWFA 3K3DA 2PRFA 3E98A 3A0SA 1RGYA 4R3JA 3BM6A 3UPNA 3PXPA 1WA9A 4DE3A 1XPBA 1LSXA 3UPPA 2QPNA 4I38A 4GHIB 3G4PA 3ZG5A 2P9VB 3N8LA 3OPPA 1YSPA 1ESUA 4LRYC 3IWQA 3VFHA 3C7UA 1UWPX
chains in the Genus database with same CATH topology
3OPHA 1K57A 3VSLA 1YM1A 3FYZA 4QY6A 1XA1A 4R4SA 1L0GA 1S6RA 1QMFA 2Q9MA 4R4RA 5CHJA 4A5RA 5TGFA 2RL3A 3P98A 4ZJ3A 4K0WA 5DF8A 3O88A 5FAQA 5HAQA 3VOYA 4MBFA 3AGEA 1K4EA 3C4OA 2H5SA 3G2ZA 5FATA 4B4XA 1GA0A 5E2HA 4JKTA 1OMEA 3HVFA 5CGXA 5HARA 1PZPA 5KMWA 5DVAA 4BLMA 2WAFA 3HLDA 3PBQA 3LEZA 3NIAA 4D2OA 4GN2A 4KG6A 3UDXA 5CRFA 1K6SA 2Y2LA 2Y2OA 1FSWA 2ZLYA 3N4IA 1AXBA 1FCOA 2XH9A 5FAOA 5FQ9A 1L0EA 1YLYA 2EX2A 3PTEA 2EX8A 4BD0A 1E3UD 1ESIA 1IKIA 4LV2A 1YLTA 5CGSA 3LY3A 4JF5A 4LCLA 2X02A 1H8YA 1C3BA 4NK3A 4OPYA 2JC7A 3IWOA 3WS2A 3WS0A 3TOIA 1TDGA 4DRTA 1MBLA 5CHMA 4B88A 4IBXA 4OQHA 3M2KA 1KDSA 1LI9A 2X01A 4U3TA 3BRMA 5AQBA 4JLFA 3ZHHA 1JVJA 3Q07A 3ZFZA 5CEDA 1M6KA 3HLEA 3NBLA 2PBYA 5M18A 4WYYA 2A3UA 4RX2A 4GD6A 4E3KA 4PPRA 2WADA 3HLFA 3PBOA 3A3DA 4ZDXA 3HUMA 3MZFA 2PU2A 1L0DA 3ISGA 1KGGA 4WZ5A 3WS4A 5DF9A 1PW8A 1L0FA 5EE8A 3BFCA 2HP9A 2FFYA 1HVBA 4K91A 5CGWA 3SS4A 4KG5A 5A92A 2HP5A 1H8ZA 1Y54A 1XGIA 1IYPA 1ZC2A 4S2IA 3FKWA 3E2KA 5FSRA 4LENA 4UHUA 1KVLA 1W8YA 1EWZA 4WBGA 3RXWA 4KZ8A 3OZHA 4S2NC 2XGNA 4ID4A 4JF4A 5G18A 3N6IA 3N8SA 1JTDA 1ZKJA 3BFFA 1XGJA 2DNSA 4YFMA 4OOMA 5CECA 3BLSA 4NETA 4KENB 3UO9A 4XXRA 1W79A 3G32A 2QMIA 4UA9A 4CJNA 4F94A 5EUAA 5L2FA 5EPHA 5CEBA 3AGFA 5FI6A 5DF7A 3QNCA 1CEFA 2XK1A 1TEMA 4WZ4A 1K55C 1IKGA 3MBZA 3GRJA 3ITBA 3UN7A 4Y0TA 1K6RA 3A3FA 3HLBA 4GOGA 2CC1A 1HTZA 2ZQDA 4KZ7A 4WEKA 4GDBA 2Y2MA 5D3OA 5E2FA 1L2SA 4P87A 2XD5A 3LO7A 5BOHA 2J8YA 1H5XA 2XQZA 3BFGA 3CZDA 3NCKA 5F1GA 4GKUA 1MY8A 1CI9A 1ONHA 4MBHA 2OLUA 4S2OA 2P9VA 2ZMAA 1ES4A 3IT9A 1YLWA 5EECA 5EOOA 3ZVWA 5IHVA 5M1AA 1KGFA 1BLHA 1IEMA 2EX6A 2ZQ9A 3GV9A 4BQMA 5AQ7A 3VP4A 1MXOA 3SS5A 5GLDA 1BSGA 3FV7A 2Y2QA 3E2LA 5JYPA 1MPLA 3M6HA 4OH0A 3VSKA 3HBRA 3I7JA 5AQ9A 1FR1A 1DY6A 1KE4A 4R0QA 2OV5A 2HDQA 1I2WA 3ZG8B 4E3JA 1LL9A 4IEDA 4JXVA 4E6WA 4KZ3A 4P6BA 2HDUA 3IWIA 3VP1A 4KZBA 3DW0A 4E3MA 4HBUA 4Y0OA 5GHXA 1BLPA 1NJ4A 2WKEA 1MWUA 3RJUA 1U60A 4KZ4A 1MWTA 3EQUA 2ZQAA 2A49A 4GDNA 1W7FA 1ZG6A 2WAEA 3NI9A 3V39A 3NY4A 1FR6A 3IQAA 1BLCA 1ES3A 4OQ0A 3MZDA 2ZQ7A 4RYEA 2ZC6B 2WKIA 2XR0A 3Q7ZA 5EVID 4QU3A 3UE3A 3UDFA 3IH9A 2XD1A 3CG5A 3MXRA 1YQSA 3SOIA 4QY5A 5GL9A 4BENA 4RVAA 1W8QA 3FKVA 5E43A 3OCNA 5GLAA 3DWZA 2Y55A 4JBFA 3G35A 2ZQCA 1FQGA 1W5DA 2VGKA 2Z2LB 3OCLA 5FQJA 1IYSA 1K57C 2R9XA 1E3UA 4GZBA 3IXBA 4Y7PA 2GDNA 3VP3A 4IBRA 1LHYA 1MWRA 1YT4A 1O07A 3HREA 3IH8A 4MEZA 1IYOA 1K55A 5FQMA 3V5MA 1LI0A 3VP0A 3Q7VA 3ZG9B 3ZNTA 1GCEA 1YLJA 5GLBA 3PBSA 2WYXA 1M40A 3BECA 1PW1A 4S2PA 3VFFA 3VP2A 1LL5A 4R1GA 3ZCZA 2BG1A 1ERMA 4LCMA 5FI2A 4OPQA 4OONA 2EX9A 4P85A 4KG2A 4KQOA 3BLMA 2DCFA 4WM9A 1I2SA 2WKHA 4PM7A 4B4ZA 4Q8IA 2WGIA 5HAIA 4M3KA 2WZZA 1NZUA 1FCMA 5F82A 3C7VA 4OOLA 3M6BA 2WGVA 4OP5A 5KSHA 1K4FA 1KE3A 3A3EA 4KZ6A 3PAEA 4E3IA 5GHYA 3V50A 2Y2KA 1YMXA 3HLWA 2B5RA 2V20A 4K0XA 5J8XA 3BEBA 3PAGA 3MXSA 4PMAA 3HUOA 4HEFA 1FSYA 2V1ZA 4C3QA 1KGEA 4UAAA 2Y2PA 2XDMA 4WZ5C 1S0WA 4OLDA 5HFOA 1GA9A 3RXXA 4U0XA 4IVKA 2ZM8A 2Y4AA 4JXGA 1NYMA 4IVIA 5A90A 3VMAA 2JCHA 5EVLA 3Q7VB 2UWXA 5EOEA 3OC2A 4X53A 4LV3A 4MBKA 2WZXA 4L0LA 3BFEA 1E4DA 1I5QA 1K54A 2ZM0A 4E3LA 4CPKA 4FH4A 2Q9NA 3GQZA 5EVIC 4DDYA 3V3SA 1NZOA 3IF6C 1NRFA 4YINA 3IXDA 4KZAA 1VM1A 4KQRA 4ZBEA 4X68A 2H0YA 2IWBA 3IXGA 2Y2JA 1XP4A 2J9PA 5CERA 1JWVA 2E8IA 3IHAA 2Y2GA 3Q1FA 1SDEA 5GHZA 4DE1A 3MFDA 2JE5A 2C5WB 3IF5A 1KVMA 1IELA 3P09A 1ES5A 4DE2A 1CI8A 1FOFA 2WGWB 1NY0A 4QB8A 3UDIA 5A93A 4E6XA 5EVIB 3Q82A 1PYYA 2ZC7A 3PBTA 4OP8A 4DKIA 1KE0A 4JF6A 4ZJ2A 2G2WA 1RP5A 5HW3A 4C6YA 3SH9A 4EBLA 3WS5A 2HDSA 3VOZA 1CK3A 5FDHA 4N9KA 3BYDA 1HD8A 3G30A 4Z9QA 3TSGA 3HL9A 5F1FA 4OPZA 2OLVA 1PWCA 5CTMA 4XUXA 3Q81A 4DF6A 3WWXA 4OOYA 3GMWA 5FA7A 2H0TA 4PM9A 2HPBA 3W4QA 1ZG4A 2Y59A 4OPRA 3D4FA 4EBNA 4DXCA 1JWPA 4X56A 5M19A 3MKEA 2Y2IA 4MNRA 3N8RA 4ZTKA 2XF3A 5HL1A 2XFTA 1RGZA 5CTNA 3G34A 5EVIA 3SH7A 4BL3A 3S1YA 3ZDJA 1K54C 4WMCD 1YLZA 1BZAA 2Y2HA 4QD4A 1ONGA 1K56D 1CEGA 4X69A 1NXYA 1XKZA 4N9LA 4OVDA 4X55A 1DJBA 2Y91A 1BULA 5I94A 1J9MA 5KSCA 3EQVA 3FZCA 3OPRA 4S2LA 4DDSA 1K25A 1IYQA 3TG9A 5FAPA 3W4PA 1FCNA 3CJMA 3FWLA 3NDEA 4FD8A 3W8KA 4OQIA 2DRWA 5FQKA 4DXBA 3IF6B 3SS3A 4XUZA 1N4OA 5F83A 1K56A 4R3BA 4HBTA 1XA7A 2ZQ8A 4KZ5A 3UE0A 1HZOA 2PU4A 1SHVA 4PM6A 1YLPA 1EI5A 1PI4A 4ZJ1A 5HAPA 2IWCA 1WE4A 3S4XA 1DJCA 1N9BA 2HDRA 3C4PA 4FSFA 3BFDA 2I72A 3MKFA 4GNUA 1SCWA 1SDNA 3O3VA 1DJAA 1GHMA 4QJGA 4OLGA 1G6AA 3O86A 4RA7A 2ZC4B 1K38A 4UA6A 4X6TA 2ZD8A 3NC8A 4HESA 4PM8A 4OKPA 4UA7A 3DTMA 1EROA 5A91A 3WRTA 3B3XA 1ALQA 3A3JA 3NDGA 4BD1A 2XFSA 1MKIA 4FCFA 3PBNA 2Y2NA 5FQIA 4BJPA 2RCXA 4WELA 3ZGAB 1JWZA 5CXWA 2BLSA 3G31A 1RCJA 2WUQA 3G2YA 3HLGA 1LLBA 3IXHA 4N1HA 4S2KA 4KZ9A 5JYOA 4RX3A 5FQQA 4LV0A 1GHPA 1XXMA 4WMCA 1PWDA 3UY6A 2WK0A 3W4OA 2FFFB 4S2MA 3ZVTA 1JTGA 1XX2A 2EFUA 4DE0A 3GSGA 4E3NA 2ZC3B 1TDLA 4E3OA 4P0MA 5KZHA 3AGDA 4QHCA 4EQIA 4EBPA 1YMSA 3PBRA 1E25A 4C75A 3V3RA 1BLSA 5FASA 5CHUA 4GD8A 1Z6FA 2EFXA 4O7DA 3JYIA 4JXWA 3WRZA 2G2UA 3N7WA 1O7EA 4N1XA 3GR2A 1NYYA 1G68A 4Y0UA 3ZG7B 4BL2A 2EXAA 1ES2A 2Z2MB 3S22A 5DTTA 5TFQA 1BT5A 5GLCA 4EUZA 4R23A 1Q2PA 2OSUA 4FH2A 1PZOA 2X71A 1WYCA 3ZNYA 1BTLA 3C5AA 2XEPA 2HP6A 3HLCA 1PIOA 4ZAMA 3ITAA 2V2FF 3IF6A 3SH8A 2ZJ9A 3UNWA 3CMZA 5DTSA 3IHBA 1SKFA 3QNBA 3M2JA 3HUNA 5TR7A 1PWGA 1GHIA 5AQAA 5HX9A 4JXSA 2J9OA 4S2JA 5E2EA 1ERQA 4EV4A 1WYBA 1MWSA 4U0TA 2VGJA 1Q2QA 3A3IA 3LCEA 1PI5A 4EWFA 2ZM2A 3WS1A 2P74A 5E2GA 2C6WB 1RGYA 4R3JA 2XLNA 4WEJA 2H10A 4N92A 3UE1A 3BM6A 3UPNA 3OPLA 3GTCA 4DE3A 4S2NA 3O87A 2EXBA 1XPBA 2QZ6A 2WGWA 3MZEA 3ZG0A 5U47A 3UPPA 4PM5A 3QHYA 2QPNA 4JPMA 3UPOA 2JBFA 2J7VA 3G4PA 3GVBA 3ZG5A 1KDWA 2P9VB 5FI7A 1BUEA 1TVFA 3N8LA 4H8RA 2R9WA 3DWKA 3LY4A 3OPPA 4MLLA 4GB7A 4OQGA 5DTKA 1ESUA 2IWDA 4KQQA 2ZC5B 1QMEA 3IWQA 4LV1A 3VFHA 1VQQA 3C7UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OPH A;  1K57 A;  3VSL A;  1YM1 A;  3FYZ A;  4QY6 A;  1XA1 A;  4R4S A;  1L0G A;  1S6R A;  1QMF A;  2Q9M A;  4R4R A;  5CHJ A;  4A5R A;  5TGF A;  2RL3 A;  3P98 A;  4ZJ3 A;  4K0W A;  5DF8 A;  3O88 A;  5FAQ A;  5HAQ A;  3VOY A;  4MBF A;  3AGE A;  1K4E A;  3C4O A;  2H5S A;  3G2Z A;  5FAT A;  4B4X A;  1GA0 A;  5E2H A;  4JKT A;  1OME A;  3HVF A;  5CGX A;  5HAR A;  1PZP A;  5KMW A;  5DVA A;  4BLM A;  2WAF A;  3HLD A;  3PBQ A;  3LEZ A;  3NIA A;  4D2O A;  4GN2 A;  4KG6 A;  3UDX A;  5CRF A;  1K6S A;  2Y2L A;  2Y2O A;  1FSW A;  2ZLY A;  3N4I A;  1AXB A;  1FCO A;  2XH9 A;  5FAO A;  5FQ9 A;  1L0E A;  1YLY A;  2EX2 A;  3PTE A;  2EX8 A;  4BD0 A;  1E3U D;  1ESI A;  1IKI A;  4LV2 A;  1YLT A;  5CGS A;  3LY3 A;  4JF5 A;  4LCL A;  2X02 A;  1H8Y A;  1C3B A;  4NK3 A;  4OPY A;  2JC7 A;  3IWO A;  3WS2 A;  3WS0 A;  3TOI A;  1TDG A;  4DRT A;  1MBL A;  5CHM A;  4B88 A;  4IBX A;  4OQH A;  3M2K A;  1KDS A;  1LI9 A;  2X01 A;  4U3T A;  3BRM A;  5AQB A;  4JLF A;  3ZHH A;  1JVJ A;  3Q07 A;  3ZFZ A;  5CED A;  1M6K A;  3HLE A;  3NBL A;  2PBY A;  5M18 A;  4WYY A;  2A3U A;  4RX2 A;  4GD6 A;  4E3K A;  4PPR A;  2WAD A;  3HLF A;  3PBO A;  3A3D A;  4ZDX A;  3HUM A;  3MZF A;  2PU2 A;  1L0D A;  3ISG A;  1KGG A;  4WZ5 A;  3WS4 A;  5DF9 A;  1PW8 A;  1L0F A;  5EE8 A;  3BFC A;  2HP9 A;  2FFY A;  1HVB A;  4K91 A;  5CGW A;  3SS4 A;  4KG5 A;  5A92 A;  2HP5 A;  1H8Z A;  1Y54 A;  1XGI A;  1IYP A;  1ZC2 A;  4S2I A;  3FKW A;  3E2K A;  5FSR A;  4LEN A;  4UHU A;  1KVL A;  1W8Y A;  1EWZ A;  4WBG A;  3RXW A;  4KZ8 A;  3OZH A;  4S2N C;  2XGN A;  4ID4 A;  4JF4 A;  5G18 A;  3N6I A;  3N8S A;  1JTD A;  1ZKJ A;  3BFF A;  1XGJ A;  2DNS A;  4YFM A;  4OOM A;  5CEC A;  3BLS A;  4NET A;  4KEN B;  3UO9 A;  4XXR A;  1W79 A;  3G32 A;  2QMI A;  4UA9 A;  4CJN A;  4F94 A;  5EUA A;  5L2F A;  5EPH A;  5CEB A;  3AGF A;  5FI6 A;  5DF7 A;  3QNC A;  1CEF A;  2XK1 A;  1TEM A;  4WZ4 A;  1K55 C;  1IKG A;  3MBZ A;  3GRJ A;  3ITB A;  3UN7 A;  4Y0T A;  1K6R A;  3A3F A;  3HLB A;  4GOG A;  2CC1 A;  1HTZ A;  2ZQD A;  4KZ7 A;  4WEK A;  4GDB A;  2Y2M A;  5D3O A;  5E2F A;  1L2S A;  4P87 A;  2XD5 A;  3LO7 A;  5BOH A;  2J8Y A;  1H5X A;  2XQZ A;  3BFG A;  3CZD A;  3NCK A;  5F1G A;  4GKU A;  1MY8 A;  1CI9 A;  1ONH A;  4MBH A;  2OLU A;  4S2O A;  2P9V A;  2ZMA A;  1ES4 A;  3IT9 A;  1YLW A;  5EEC A;  5EOO A;  3ZVW A;  5IHV A;  5M1A A;  1KGF A;  1BLH A;  1IEM A;  2EX6 A;  2ZQ9 A;  3GV9 A;  4BQM A;  5AQ7 A;  3VP4 A;  1MXO A;  3SS5 A;  5GLD A;  1BSG A;  3FV7 A;  2Y2Q A;  3E2L A;  5JYP A;  1MPL A;  3M6H A;  4OH0 A;  3VSK A;  3HBR A;  3I7J A;  5AQ9 A;  1FR1 A;  1DY6 A;  1KE4 A;  4R0Q A;  2OV5 A;  2HDQ A;  1I2W A;  3ZG8 B;  4E3J A;  1LL9 A;  4IED A;  4JXV A;  4E6W A;  4KZ3 A;  4P6B A;  2HDU A;  3IWI A;  3VP1 A;  4KZB A;  3DW0 A;  4E3M A;  4HBU A;  4Y0O A;  5GHX A;  1BLP A;  1NJ4 A;  2WKE A;  1MWU A;  3RJU A;  1U60 A;  4KZ4 A;  1MWT A;  3EQU A;  2ZQA A;  2A49 A;  4GDN A;  1W7F A;  1ZG6 A;  2WAE A;  3NI9 A;  3V39 A;  3NY4 A;  1FR6 A;  3IQA A;  1BLC A;  1ES3 A;  4OQ0 A;  3MZD A;  2ZQ7 A;  4RYE A;  2ZC6 B;  2WKI A;  2XR0 A;  3Q7Z A;  5EVI D;  4QU3 A;  3UE3 A;  3UDF A;  3IH9 A;  2XD1 A;  3CG5 A;  3MXR A;  1YQS A;  3SOI A;  4QY5 A;  5GL9 A;  4BEN A;  4RVA A;  1W8Q A;  3FKV A;  5E43 A;  3OCN A;  5GLA A;  3DWZ A;  2Y55 A;  4JBF A;  3G35 A;  2ZQC A;  1FQG A;  1W5D A;  2VGK A;  2Z2L B;  3OCL A;  5FQJ A;  1IYS A;  1K57 C;  2R9X A;  1E3U A;  4GZB A;  3IXB A;  4Y7P A;  2GDN A;  3VP3 A;  4IBR A;  1LHY A;  1MWR A;  1YT4 A;  1O07 A;  3HRE A;  3IH8 A;  4MEZ A;  1IYO A;  1K55 A;  5FQM A;  3V5M A;  1LI0 A;  3VP0 A;  3Q7V A;  3ZG9 B;  3ZNT A;  1GCE A;  1YLJ A;  5GLB A;  3PBS A;  2WYX A;  1M40 A;  3BEC A;  1PW1 A;  4S2P A;  3VFF A;  3VP2 A;  1LL5 A;  4R1G A;  3ZCZ A;  2BG1 A;  1ERM A;  4LCM A;  5FI2 A;  4OPQ A;  4OON A;  2EX9 A;  4P85 A;  4KG2 A;  4KQO A;  3BLM A;  2DCF A;  4WM9 A;  1I2S A;  2WKH A;  4PM7 A;  4B4Z A;  4Q8I A;  2WGI A;  5HAI A;  4M3K A;  2WZZ A;  1NZU A;  1FCM A;  5F82 A;  3C7V A;  4OOL A;  3M6B A;  2WGV A;  4OP5 A;  5KSH A;  1K4F A;  1KE3 A;  3A3E A;  4KZ6 A;  3PAE A;  4E3I A;  5GHY A;  3V50 A;  2Y2K A;  1YMX A;  3HLW A;  2B5R A;  2V20 A;  4K0X A;  5J8X A;  3BEB A;  3PAG A;  3MXS A;  4PMA A;  3HUO A;  4HEF A;  1FSY A;  2V1Z A;  4C3Q A;  1KGE A;  4UAA A;  2Y2P A;  2XDM A;  4WZ5 C;  1S0W A;  4OLD A;  5HFO A;  1GA9 A;  3RXX A;  4U0X A;  4IVK A;  2ZM8 A;  2Y4A A;  4JXG A;  1NYM A;  4IVI A;  5A90 A;  3VMA A;  2JCH A;  5EVL A;  3Q7V B;  2UWX A;  5EOE A;  3OC2 A;  4X53 A;  4LV3 A;  4MBK A;  2WZX A;  4L0L A;  3BFE A;  1E4D A;  1I5Q A;  1K54 A;  2ZM0 A;  4E3L A;  4CPK A;  4FH4 A;  2Q9N A;  3GQZ A;  5EVI C;  4DDY A;  3V3S A;  1NZO A;  3IF6 C;  1NRF A;  4YIN A;  3IXD A;  4KZA A;  1VM1 A;  4KQR A;  4ZBE A;  4X68 A;  2H0Y A;  2IWB A;  3IXG A;  2Y2J A;  1XP4 A;  2J9P A;  5CER A;  1JWV A;  2E8I A;  3IHA A;  2Y2G A;  3Q1F A;  1SDE A;  5GHZ A;  4DE1 A;  3MFD A;  2JE5 A;  2C5W B;  3IF5 A;  1KVM A;  1IEL A;  3P09 A;  1ES5 A;  4DE2 A;  1CI8 A;  1FOF A;  2WGW B;  1NY0 A;  4QB8 A;  3UDI A;  5A93 A;  4E6X A;  5EVI B;  3Q82 A;  1PYY A;  2ZC7 A;  3PBT A;  4OP8 A;  4DKI A;  1KE0 A;  4JF6 A;  4ZJ2 A;  2G2W A;  1RP5 A;  5HW3 A;  4C6Y A;  3SH9 A;  4EBL A;  3WS5 A;  2HDS A;  3VOZ A;  1CK3 A;  5FDH A;  4N9K A;  3BYD A;  1HD8 A;  3G30 A;  4Z9Q A;  3TSG A;  3HL9 A;  5F1F A;  4OPZ A;  2OLV A;  1PWC A;  5CTM A;  4XUX A;  3Q81 A;  4DF6 A;  3WWX A;  4OOY A;  3GMW A;  5FA7 A;  2H0T A;  4PM9 A;  2HPB A;  3W4Q A;  1ZG4 A;  2Y59 A;  4OPR A;  3D4F A;  4EBN A;  4DXC A;  1JWP A;  4X56 A;  5M19 A;  3MKE A;  2Y2I A;  4MNR A;  3N8R A;  4ZTK A;  2XF3 A;  5HL1 A;  2XFT A;  1RGZ A;  5CTN A;  3G34 A;  5EVI A;  3SH7 A;  4BL3 A;  3S1Y A;  3ZDJ A;  1K54 C;  4WMC D;  1YLZ A;  1BZA A;  2Y2H A;  4QD4 A;  1ONG A;  1K56 D;  1CEG A;  4X69 A;  1NXY A;  1XKZ A;  4N9L A;  4OVD A;  4X55 A;  1DJB A;  2Y91 A;  1BUL A;  5I94 A;  1J9M A;  5KSC A;  3EQV A;  3FZC A;  3OPR A;  4S2L A;  4DDS A;  1K25 A;  1IYQ A;  3TG9 A;  5FAP A;  3W4P A;  1FCN A;  3CJM A;  3FWL A;  3NDE A;  4FD8 A;  3W8K A;  4OQI A;  2DRW A;  5FQK A;  4DXB A;  3IF6 B;  3SS3 A;  4XUZ A;  1N4O A;  5F83 A;  1K56 A;  4R3B A;  4HBT A;  1XA7 A;  2ZQ8 A;  4KZ5 A;  3UE0 A;  1HZO A;  2PU4 A;  1SHV A;  4PM6 A;  1YLP A;  1EI5 A;  1PI4 A;  4ZJ1 A;  5HAP A;  2IWC A;  1WE4 A;  3S4X A;  1DJC A;  1N9B A;  2HDR A;  3C4P A;  4FSF A;  3BFD A;  2I72 A;  3MKF A;  4GNU A;  1SCW A;  1SDN A;  3O3V A;  1DJA A;  1GHM A;  4QJG A;  4OLG A;  1G6A A;  3O86 A;  4RA7 A;  2ZC4 B;  1K38 A;  4UA6 A;  4X6T A;  2ZD8 A;  3NC8 A;  4HES A;  4PM8 A;  4OKP A;  4UA7 A;  3DTM A;  1ERO A;  5A91 A;  3WRT A;  3B3X A;  1ALQ A;  3A3J A;  3NDG A;  4BD1 A;  2XFS A;  1MKI A;  4FCF A;  3PBN A;  2Y2N A;  5FQI A;  4BJP A;  2RCX A;  4WEL A;  3ZGA B;  1JWZ A;  5CXW A;  2BLS A;  3G31 A;  1RCJ A;  2WUQ A;  3G2Y A;  3HLG A;  1LLB A;  3IXH A;  4N1H A;  4S2K A;  4KZ9 A;  5JYO A;  4RX3 A;  5FQQ A;  4LV0 A;  1GHP A;  1XXM A;  4WMC A;  1PWD A;  3UY6 A;  2WK0 A;  3W4O A;  2FFF B;  4S2M A;  3ZVT A;  1JTG A;  1XX2 A;  2EFU A;  4DE0 A;  3GSG A;  4E3N A;  2ZC3 B;  1TDL A;  4E3O A;  4P0M A;  5KZH A;  3AGD A;  4QHC A;  4EQI A;  4EBP A;  1YMS A;  3PBR A;  1E25 A;  4C75 A;  3V3R A;  1BLS A;  5FAS A;  5CHU A;  4GD8 A;  1Z6F A;  2EFX A;  4O7D A;  3JYI A;  4JXW A;  3WRZ A;  2G2U A;  3N7W A;  1O7E A;  4N1X A;  3GR2 A;  1NYY A;  1G68 A;  4Y0U A;  3ZG7 B;  4BL2 A;  2EXA A;  1ES2 A;  2Z2M B;  3S22 A;  5DTT A;  5TFQ A;  1BT5 A;  5GLC A;  4EUZ A;  4R23 A;  1Q2P A;  2OSU A;  4FH2 A;  1PZO A;  2X71 A;  1WYC A;  3ZNY A;  1BTL A;  3C5A A;  2XEP A;  2HP6 A;  3HLC A;  1PIO A;  4ZAM A;  3ITA A;  2V2F F;  3IF6 A;  3SH8 A;  2ZJ9 A;  3UNW A;  3CMZ A;  5DTS A;  3IHB A;  1SKF A;  3QNB A;  3M2J A;  3HUN A;  5TR7 A;  1PWG A;  1GHI A;  5AQA A;  5HX9 A;  4JXS A;  2J9O A;  4S2J A;  5E2E A;  1ERQ A;  4EV4 A;  1WYB A;  1MWS A;  4U0T A;  2VGJ A;  1Q2Q A;  3A3I A;  3LCE A;  1PI5 A;  4EWF A;  2ZM2 A;  3WS1 A;  2P74 A;  5E2G A;  2C6W B;  1RGY A;  4R3J A;  2XLN A;  4WEJ A;  2H10 A;  4N92 A;  3UE1 A;  3BM6 A;  3UPN A;  3OPL A;  3GTC A;  4DE3 A;  4S2N A;  3O87 A;  2EXB A;  1XPB A;  2QZ6 A;  2WGW A;  3MZE A;  3ZG0 A;  5U47 A;  3UPP A;  4PM5 A;  3QHY A;  2QPN A;  4JPM A;  3UPO A;  2JBF A;  2J7V A;  3G4P A;  3GVB A;  3ZG5 A;  1KDW A;  2P9V B;  5FI7 A;  1BUE A;  1TVF A;  3N8L A;  4H8R A;  2R9W A;  3DWK A;  3LY4 A;  3OPP A;  4MLL A;  4GB7 A;  4OQG A;  5DTK A;  1ESU A;  2IWD A;  4KQQ A;  2ZC5 B;  1QME A;  3IWQ A;  4LV1 A;  3VFH A;  1VQQ A;  3C7U A; 
#chains in the Genus database with same CATH topology
 3LIA A;  1YM1 A;  3FYZ A;  1S1Z A;  4R4S A;  4Q0I A;  2RL3 A;  4ZJ3 A;  3O88 A;  2K7S A;  3KYE A;  3C4O A;  1OT6 A;  4JKT A;  1OME A;  5KMW A;  5K5B A;  2PHY A;  4BLM A;  4PKY A;  4D2O A;  4GN2 A;  5I5L A;  4Y15 A;  1L0E A;  2W1T A;  2EX8 A;  1IKI A;  1N9N A;  4LCL A;  5TJJ A;  3P01 A;  3IWO A;  3TOI A;  4DRT A;  1H8M A;  5CHM A;  3M2K A;  5AQB A;  3BRM A;  3Q07 A;  3BJN A;  4O0P A;  4HI4 A;  3S7Q A;  5M18 A;  2PBY A;  1S4S A;  4GCZ A;  2A3U A;  2WAD A;  3MZF A;  2O9B A;  4DN0 A;  2LB5 A;  2VEA A;  3WS4 A;  1PW8 A;  1V9Y A;  1L0F A;  3T1Q B;  3BFC A;  2ZL1 B;  1HVB A;  1H8Z A;  1XGI A;  3FPV A;  3T4Q A;  3E2K A;  4UHU A;  4S2N C;  3H82 B;  3DTK A;  1ZKJ A;  1XGJ A;  2YKH A;  4ME4 A;  3UO9 A;  1W79 A;  4EXO A;  3G32 A;  3A0V A;  4F94 A;  5EPH A;  1TEM A;  4I3J A;  2OAQ 1;  1OTE A;  3A3F A;  3HLB A;  1HTZ A;  2PT7 A;  4KZ7 A;  3KX0 X;  2V8C A;  2J8Y A;  1H5X A;  3NCK A;  5F1G A;  4GKU A;  1CI9 A;  3OOV A;  4MBH A;  5EOO A;  2P9V A;  1YLW A;  5IHV A;  4EU0 A;  2EX6 A;  2ZQ9 A;  2VGL M;  3VP4 A;  5EV0 A;  3M6H A;  3VSK A;  2OV5 A;  3ZG8 B;  2HDQ A;  3ICY A;  4IED A;  2JKG A;  2HDU A;  4EEP A;  3VP1 A;  4E3M A;  4HBU A;  4Y0O A;  5GHX A;  4EER A;  1ZHH B;  2EWV A;  3RJU A;  1ACF A;  1W7F A;  1ZG6 A;  3NI9 A;  3V39 A;  3NY4 A;  3IQA A;  3MZD A;  3T4J A;  3UE3 A;  2B02 A;  3UDF A;  3C38 A;  1OT9 A;  3R7W B;  5GL9 A;  4RVA A;  1W8Q A;  4JBF A;  3G35 A;  2ZQC A;  1W5D A;  4H6J A;  1E3U A;  3CAX A;  1YT4 A;  1O07 A;  5HD3 A;  1IYO A;  5FQM A;  1LI0 A;  3ZG9 B;  3TW8 A;  3PBS A;  4WF0 A;  1M40 A;  4S2P A;  4UQI M;  3S7O A;  3RTY A;  2BG1 A;  4LCM A;  2P04 A;  4OPQ A;  4KG2 A;  2DCF A;  4B4Z A;  4Q8I A;  1FCM A;  4KZ6 A;  3V50 A;  2VZW A;  3HLW A;  2B5R A;  2W1T B;  5HWT A;  1VEU B;  5J8X A;  1MZU A;  2Y2P A;  4WZ5 C;  1S0W A;  4HHD A;  1GA9 A;  3RXX A;  1KOU A;  1NYM A;  4IVI A;  3MFX A;  3CPT A;  3Q7V B;  1PFL A;  4G3K A;  4X53 A;  2ZM0 A;  4FH4 A;  3QP1 A;  4DDY A;  3C2W A;  1GSX A;  4ZBE A;  2H0Y A;  4FOF A;  4HJ3 A;  2IWB A;  4IJG A;  1XP4 A;  2V1A A;  5GHZ A;  4DE1 A;  2JE5 A;  3IF5 A;  3VE3 A;  4HH3 A;  3Q82 A;  1PYY A;  3BY9 A;  4DKI A;  1ODV A;  4B93 A;  3LI8 A;  4ZJ2 A;  5HW3 A;  3JVV A;  3SH9 A;  5HZH A;  3WS5 A;  2HDS A;  1YKD A;  1TS7 A;  5FDH A;  3BYD A;  4ESP A;  2OLV A;  4L9G A;  3Q81 A;  4DF6 A;  3WWX A;  2AVX A;  4OOY A;  5FA7 A;  2H0T A;  2PR6 A;  1ZG4 A;  1TD5 A;  2PD8 A;  4ZTK A;  5HL1 A;  4LRZ E;  4K08 A;  5EVI A;  3ZDJ A;  4WMC D;  1YLZ A;  3NOT C;  3FC7 A;  1BZA A;  2Y79 A;  1K56 D;  4X69 A;  4N9L A;  3EGX C;  1J9M A;  2HF6 A;  1STZ A;  4S2L A;  3CJM A;  3FWL A;  4DXB A;  3IF6 B;  2V8F A;  4XUZ A;  1PRQ A;  2QJ5 A;  5IT5 A;  1LL8 A;  1SHV A;  1WE4 A;  4FSF A;  3BFD A;  2FZ0 A;  2I72 A;  3MKF A;  3ULF A;  3NOP C;  5A8B A;  3O86 A;  3UB8 A;  4UA6 A;  2ZD8 A;  4HES A;  1VEU A;  5A91 A;  3B3X A;  1MKI A;  5FQI A;  3ZYT A;  4L9F A;  2XRN A;  4Y13 A;  3O5Y A;  1JWZ A;  2KLI A;  4Q0J A;  2BLS A;  3G2Y A;  3HLG A;  4N1H A;  4S2K A;  4KZ9 A;  5HL6 A;  4RX3 A;  1GHP A;  4RQ9 A;  2QWS A;  3VOL A;  2O0Y A;  2PBD P;  4S2M A;  3GSG A;  2M7V A;  5KZH A;  4QHC A;  1EW0 A;  1YMS A;  4Y2F A;  1E25 A;  3V3R A;  3KYQ A;  2W3D A;  1YSQ A;  3WRZ A;  2G2U A;  4MN6 A;  4BL2 A;  3R7W A;  5F5Y A;  4CLC A;  4R23 A;  2HV1 A;  1Q2P A;  2OSU A;  4FH2 A;  1WYC A;  1OTD A;  3ZNY A;  2OAP 1;  2JKT M;  1PIO A;  4ZAM A;  2ZJ9 A;  5J7E A;  3IHB A;  2OWJ A;  4EQ1 A;  2W3H A;  3QNB A;  3HUN A;  5AQA A;  4JXS A;  4S2J A;  3TE8 A;  2VGJ A;  3A3I A;  3WS1 A;  4UQI S;  2C6W B;  2OOL A;  1XFQ A;  2XLN A;  1N9L A;  2PYR A;  3O87 A;  1AWI A;  4PM5 A;  3B42 A;  5U47 A;  3U2A A;  4JPM A;  2JBF A;  2J7V A;  3T1X A;  4MLL A;  4OQG A;  3T4K A;  3F1N B;  2O9C A;  4KQQ A;  1VQQ A;  3OLO A;  2D01 A;  3VSL A;  1QMF A;  4ARZ A;  5TGF A;  3NUL A;  3LR4 A;  1OJG A;  5FAQ A;  5HAQ A;  4MBF A;  4NXB A;  1UWN X;  2H5S A;  1TS6 A;  3LGO A;  2L0W A;  3QP4 A;  5DVA A;  3FPW A;  3NIA A;  3H82 A;  1FSW A;  1FCO A;  5FDS A;  5FAO A;  5FQ9 A;  1YLY A;  2XSS A;  4LV2 A;  4IHQ A;  1H8Y A;  3QP6 A;  1P9W A;  2JKR I;  1VB6 A;  4GS9 A;  4B88 A;  2X01 A;  1KDS A;  1LI9 A;  3ZHH A;  4JLF A;  3BQA A;  4CLC B;  1JVJ A;  3ZFZ A;  4NXG A;  3NBL A;  2J3T C;  4RX2 A;  4GD6 A;  5HDS A;  5AJG A;  3PBO A;  3A3D A;  3KSI A;  2PU2 A;  1BYW A;  4WZ5 A;  3E0Y A;  5EE8 A;  5CGW A;  2HJE A;  1XFN A;  2P7J A;  1Y54 A;  3K3C A;  1IYP A;  1NRJ A;  5FSR A;  3BY8 A;  4PAU A;  4KZ8 A;  3OZH A;  2XGN A;  4JF4 A;  1H3Q A;  5G18 A;  2R78 A;  3K2N A;  2DNS A;  5CEC A;  3LID A;  4NET A;  1SKO B;  1TS8 A;  5C5K A;  2QMI A;  5EUA A;  3AGF A;  5FI6 A;  4E04 A;  5DF7 A;  1W63 Q;  3QP8 A;  4ZRR A;  1IKG A;  3MMH A;  3GRJ A;  3UN7 A;  4Y0T A;  5EVE A;  4GOG A;  4XT2 B;  5D3O A;  2ZQD A;  2Y2M A;  1L2S A;  3CZD A;  1MY8 A;  2OLU A;  3IT9 A;  5M1A A;  2V0W A;  1BLH A;  3GV9 A;  1S4R A;  5AQ7 A;  3LIB A;  3SS5 A;  5GLD A;  1BSG A;  4OH0 A;  3I7J A;  1DY6 A;  1KE4 A;  4E3J A;  4E6W A;  4JGP A;  4KZB A;  3T4L A;  3DW0 A;  2JN7 A;  1PNE A;  1U60 A;  4KZ4 A;  2VV6 A;  2A49 A;  2WAE A;  2ZMF A;  3C30 A;  4RYE A;  2ZQ7 A;  2WKI A;  3Q7Z A;  4QU3 A;  4YNR A;  1YQS A;  4QY5 A;  5E43 A;  1XJ6 A;  2VLG A;  2Y8H A;  3FKV A;  1OTB A;  2Y55 A;  1FQG A;  2L4R A;  2P08 A;  1IYS A;  1K57 C;  5DFY A;  2GDN A;  2M7U A;  3LEQ A;  4IBR A;  3V5M A;  3T1R A;  5EM1 A;  2W1R A;  4NXF A;  1TF1 A;  1DP6 A;  3VP2 A;  1PW1 A;  1LL5 A;  2O99 A;  2JKR M;  2A24 A;  1I2S A;  2WKH A;  2WZZ A;  4M4X A;  1NZU A;  3M6B A;  2WGV A;  3IX3 A;  3TRC A;  4NKP A;  3E4O A;  3UB9 A;  2W0N A;  3UE6 A;  2Y2K A;  1YMX A;  2L1M A;  4K0X A;  2B95 A;  3PAG A;  3MXS A;  3KSG A;  1T1B A;  3NHQ A;  5MC7 A;  2HZ5 A;  5IS1 A;  1KGE A;  4I5S A;  4DJ3 A;  2VV8 A;  5AVE A;  4IVK A;  2ZM8 A;  4JXG A;  4EET B;  3VMA A;  5EVL A;  2UWX A;  4O01 A;  3OC2 A;  3CLO A;  2V0U A;  1E4D A;  1K54 A;  4CPK A;  2Q9N A;  1NZO A;  2PAV P;  4GJ4 A;  4MCW A;  1VM1 A;  4BMW A;  2K31 A;  3IXG A;  2Y2J A;  3LI9 A;  5CER A;  1JWV A;  2Y2G A;  1LSV A;  1SDE A;  3CUE C;  3MFD A;  2C5W B;  2XRO A;  1ES5 A;  2H28 A;  5A93 A;  4E6X A;  2ZC7 A;  3PBT A;  1DP8 A;  1KE0 A;  5F69 A;  3VOZ A;  1CK3 A;  3G30 A;  5F1F A;  3HL9 A;  4NXE A;  3RH8 B;  1P9R A;  3RFB A;  4FTX A;  2HPB A;  3IBR A;  1LT0 A;  1JWP A;  5M19 A;  4MNR A;  2XF3 A;  3E4Q A;  4JGR A;  3SH7 A;  3LIC A;  2A24 B;  4I3I A;  2Y2H A;  1ONG A;  4NEE D;  4OVD A;  1DJB A;  2Y91 A;  5I94 A;  5KSC A;  4R38 A;  4DDS A;  1K25 A;  3UMD A;  3TG9 A;  2Z6D A;  4FD8 A;  4OQI A;  5FQK A;  1N4O A;  5F83 A;  5F6A A;  3LIF A;  2PU4 A;  4GW9 A;  1YLP A;  5HAP A;  1DJC A;  2HDR A;  2FH5 A;  3C4P A;  1DJA A;  1GHM A;  4OLG A;  2ZC4 B;  1K38 A;  3L9K A;  3DTE A;  4UA7 A;  1ERO A;  3T1S A;  4CQH A;  3A3J A;  3NDG A;  3UB6 A;  2RCX A;  3G31 A;  1LLB A;  4NG2 A;  1XXM A;  4WMC A;  3UY6 A;  2WK0 A;  3CUE A;  3W4O A;  4QPR A;  2UV0 E;  1XX2 A;  4E3N A;  2ZC3 B;  3T4O A;  1FIL A;  4E3O A;  5FAS A;  5CHU A;  1Z6F A;  3JYI A;  1O7E A;  4N1X A;  3GR2 A;  1G68 A;  4WL9 A;  1ES2 A;  3S22 A;  5DTT A;  3KSH A;  4YOF A;  5L09 A;  4X25 A;  2X71 A;  3C5A A;  2HP6 A;  2V2F F;  3IF6 A;  3SH8 A;  3CMZ A;  1SKF A;  1DP9 A;  3D3O A;  1GHI A;  1MWS A;  2HJ9 C;  2NUP C;  3D9Y A;  5E2G A;  1UGU A;  4WEJ A;  3UE1 A;  3OPL A;  4KQD A;  4S2N A;  3MZE A;  4WUJ A;  5DFX A;  3UPO A;  3DBA A;  1BUE A;  4H8R A;  2R9W A;  4GB7 A;  3T4T A;  3S7N A;  3L7H A;  1QME A;  4LV1 A;  5LBR A;  3OPH A;  4H6J B;  1K57 A;  1L0G A;  1S67 L;  4R4R A;  5CHJ A;  4K0W A;  5DF8 A;  3AGE A;  5FAT A;  1YAX A;  5E2H A;  3B47 A;  3HVF A;  4Q0H A;  3IX4 A;  2WAF A;  3HLD A;  3PBQ A;  3MR0 A;  3LUQ A;  3UDX A;  4HOI A;  5CRF A;  2Y2L A;  3IS2 B;  1YPR A;  2EX2 A;  4HQA A;  3PTE A;  4BD0 A;  1YLT A;  4CLC E;  2VA0 A;  3IX8 A;  1C3B A;  3F1N A;  3LFV A;  4NK3 A;  1OTA A;  2JC7 A;  1F2K A;  3QP5 A;  4OPY A;  3WS0 A;  3LR0 A;  1MBL A;  2A2L A;  5CX7 A;  4U3T A;  4BBV A;  1LSW A;  1M6K A;  3PHY A;  4E3K A;  4ZDX A;  3ISG A;  1KGG A;  1FIK A;  2Q0O A;  3QP2 A;  4QWO A;  4K91 A;  2GNX A;  2HP5 A;  2ZMV A;  1ZC2 A;  4S2I A;  3FKW A;  4HY8 A;  1KVL A;  3T12 B;  2B18 A;  4WBG A;  3RXW A;  3N6I A;  5G4Y A;  4MDZ A;  4YFM A;  3BLS A;  4KEN B;  1T18 A;  1W63 M;  4GLQ A;  3V67 A;  2JKT I;  1F9I A;  1K55 C;  3VE4 A;  3CHW P;  3MBZ A;  3ITB A;  4WN5 A;  1MC0 A;  3IBJ A;  5E2F A;  4GDB A;  1D06 A;  2QYB A;  5BOH A;  3BFG A;  2XQZ A;  3S7P A;  2ZMA A;  1ES4 A;  3ZVW A;  1KGF A;  4BQM A;  1CJF A;  1P97 A;  1F98 A;  5JYP A;  4LRX C;  1MPL A;  3HBR A;  5AQ9 A;  4GS9 B;  1FR1 A;  3CWF A;  4P6B A;  1NJ4 A;  5J4E A;  1MWU A;  1MWT A;  2ZQA A;  2PYP A;  1BLC A;  2IA2 A;  4OQ0 A;  5EVI D;  4Y17 A;  1TS0 A;  5GLA A;  2GX5 A;  3DWZ A;  2Z2L B;  2R9X A;  3IXB A;  3VP3 A;  4HNB A;  1LHY A;  1MWR A;  5DKK A;  3HRE A;  3IH8 A;  4MEZ A;  3C8C A;  3VP0 A;  2WYX A;  3BEC A;  5HDD A;  1ERM A;  2XA7 M;  2KOI A;  4OON A;  2EX9 A;  4P85 A;  1G28 A;  4BBT A;  3BLM A;  2I9V A;  4PM7 A;  2WGI A;  5HAI A;  4M3K A;  4DMZ A;  5F82 A;  4OOL A;  1K4F A;  1KE3 A;  3A3E A;  1IOU A;  2ZL1 A;  3PAE A;  4E3I A;  5GHY A;  4EEU A;  5HWW A;  2V20 A;  4G3W A;  4HJ4 A;  3BEB A;  4PMA A;  2W27 A;  2W3G A;  1FSY A;  2PDR A;  2WKP A;  2QJ7 A;  2XA7 S;  2VV7 A;  2V1B A;  2ACG A;  2XDM A;  4OLD A;  5HFO A;  1J3W A;  2Y4A A;  5A90 A;  2JCH A;  3T4S A;  4LV3 A;  4R70 A;  4MBK A;  2WZX A;  4L0L A;  2KX6 A;  1I5Q A;  4KUO A;  2QKP A;  3GQZ A;  5EVI C;  3IF6 C;  4YIN A;  3OBF A;  4KQR A;  3F1O A;  1D1J A;  3JPU A;  2J9P A;  2E8I A;  2EWW A;  3PYP A;  3P09 A;  1OPX A;  4X1M A;  1CI8 A;  1FOF A;  1NY0 A;  4F3L B;  5EVI B;  2OWH A;  4OP8 A;  2QHK A;  3A0R A;  2G2W A;  1RP5 A;  4EBL A;  3UB5 P;  4N9K A;  2W3E A;  2ZOH A;  2HGV A;  3E4P A;  4OPZ A;  1PWC A;  5CTM A;  4PHT A;  3SZT A;  3GMW A;  3W4Q A;  2Y59 A;  4EBN A;  4X56 A;  4WLA A;  2Y2I A;  3N8R A;  5TBM A;  2WKQ A;  2XFT A;  1RGZ A;  4BL3 A;  1K0K A;  5EM0 A;  1MKM A;  4F3L A;  1IFQ A;  2EA9 A;  1GSV A;  1CQA A;  3EQV A;  3FZC A;  5FAP A;  3W4P A;  1FCN A;  3NDE A;  2M1C A;  5KIZ A;  4LPZ A;  3H9W A;  2VJW A;  4R3B A;  3D72 A;  2YKF A;  3CPT B;  4ZJ1 A;  1PI4 A;  4ETX A;  4B9O A;  4EW7 A;  3LIE A;  3UB7 A;  3S4X A;  2J80 A;  1N9B A;  4GNU A;  1SDN A;  3O3V A;  1D7E A;  4QJG A;  5DJU A;  1G6A A;  5L07 A;  4X6T A;  4CLC C;  3CIT A;  3LR3 A;  4PM8 A;  5FEG A;  4OKP A;  4HP4 A;  4BD1 A;  4FCF A;  3PBN A;  2PD7 A;  2LB9 A;  4WEL A;  3ZGA B;  5CXW A;  3HCY A;  3P7N A;  5FQQ A;  2BTF P;  2O9A A;  2FFF B;  2EFU A;  4DE0 A;  1DRM A;  5DJT A;  3AGD A;  4EQI A;  4EBP A;  4C75 A;  1BLS A;  4GD8 A;  4LLO B;  2EFX A;  4O7D A;  4Z1W A;  1NWZ A;  3N7W A;  4P6Z S;  2VX8 A;  4Y0U A;  3ZG7 B;  3FG8 A;  1BT5 A;  5GLC A;  4CLC D;  1PZO A;  2KDK A;  2XEP A;  3UNW A;  3GDI A;  5DTS A;  3CI6 A;  5TR7 A;  1A0K A;  2J9O A;  5E2E A;  4O8G A;  1ERQ A;  4BWI A;  3GEC A;  1F5M A;  4U0T A;  1Q2Q A;  3LCE A;  1PI5 A;  2ZM2 A;  2P74 A;  1SKO A;  2H10 A;  4N92 A;  4YWZ A;  1GSW A;  3GTC A;  5DKL A;  2EXB A;  2QZ6 A;  2WGW A;  4MN7 A;  3ZG0 A;  3QHY A;  3GVB A;  1KDW A;  1Y4O A;  5FI7 A;  1TVF A;  3DWK A;  3LY4 A;  5DTK A;  2IWD A;  2ZC5 B;  3HJK A;  5HSQ A;  3T50 A;  4QY6 A;  1XA1 A;  1S6R A;  2Q9M A;  4A5R A;  3LR5 A;  3P98 A;  3VOY A;  1K4E A;  4R3A A;  3G2Z A;  4B4X A;  1GA0 A;  5CGX A;  5HAR A;  1PZP A;  3MQ0 A;  1S1Y A;  4G3V A;  4L9E A;  3LEZ A;  1P0Z A;  4KG6 A;  1K6S A;  2Y2O A;  2ZLY A;  3N4I A;  2BAS A;  1AXB A;  2XH9 A;  1E3U D;  1ESI A;  2VK3 A;  3LY3 A;  4JF5 A;  5CGS A;  2X02 A;  3W2Z A;  3WS2 A;  1TDG A;  4IBX A;  4OQH A;  3HJI A;  3LYX A;  5CED A;  1T1A A;  3HLE A;  2Z6C A;  1H0M A;  4WYY A;  4PPR A;  3HLF A;  3HUM A;  2GJ3 A;  1L0D A;  5TBM B;  5DF9 A;  3ZQ5 A;  2HP9 A;  2FFY A;  3MS6 A;  3SS4 A;  4KG5 A;  5A92 A;  4LFU A;  4KUK A;  4MMN A;  4LEN A;  1W8Y A;  1EWZ A;  1VET A;  5FEF A;  3IS2 A;  2ZOI A;  3G6O A;  4JGQ A;  1NLY A;  4ID4 A;  3EOI A;  3N8S A;  3R4K A;  1JTD A;  3H7W B;  3EEH A;  3BFF A;  4IUH A;  1XJ4 A;  4OOM A;  4XXR A;  3PR6 A;  4UA9 A;  4CJN A;  5L2F A;  5CEB A;  5HDC A;  3QNC A;  3BW6 A;  1CEF A;  2XK1 A;  4WZ4 A;  1K6R A;  4AFI A;  2CC1 A;  4WEK A;  2J3W A;  4P87 A;  2XD5 A;  3LO7 A;  3KYZ A;  1NLZ A;  5HPF A;  1ONH A;  4GHI A;  4S2O A;  5EEC A;  4JGO A;  4HIA A;  1IEM A;  1T19 A;  1MXO A;  4EUV A;  3FV7 A;  2Y2Q A;  3E2L A;  2INW A;  4R0Q A;  1I2W A;  3H7W A;  2J3T D;  4R6L A;  1LL9 A;  4JXV A;  4KZ3 A;  3IWI A;  4X1L A;  5L10 A;  1Y28 A;  3NOU C;  1BLP A;  2WKE A;  5F68 A;  5L8M A;  3EQU A;  4EES A;  4GDN A;  1FR6 A;  1ES3 A;  4DJ2 A;  2ZC6 B;  4II7 A;  3F1P B;  2XR0 A;  4XT2 A;  1S66 L;  5HD5 A;  3IH9 A;  2XD1 A;  1SZV A;  3CG5 A;  3MXR A;  3SOI A;  4BEN A;  1HLU P;  3BWL A;  3OCN A;  3MF0 A;  3OCL A;  3SW1 A;  2VGK A;  5FQJ A;  3DAV A;  4GZB A;  4Y7P A;  3UME A;  1K55 A;  2E8J A;  3Q7V A;  3ZNT A;  1GCE A;  1YLJ A;  5GLB A;  3JVU A;  3VFF A;  4R1G A;  3ZCZ A;  5EFW A;  5FI2 A;  3KO6 A;  1ZTU A;  4KQO A;  2NUT C;  2K2N A;  3F1P A;  4WM9 A;  3F1O B;  1V9Z A;  4HP9 A;  3MJQ A;  3C7V A;  4OP5 A;  2JHE A;  5KSH A;  4Y3I A;  2V9A A;  4ETZ A;  3HUO A;  4HEF A;  2V1Z A;  4C3Q A;  3MXQ A;  4UAA A;  3NEC A;  1Z09 A;  4U0X A;  1OTI A;  1G5U A;  3EGD C;  3B33 A;  5EOE A;  3BFE A;  3EWK A;  4E3L A;  3V3S A;  1NRF A;  3IXD A;  4KZA A;  2MJ6 A;  4X68 A;  4HH2 A;  2JKF A;  3IHA A;  3Q1F A;  4DE2 A;  1KVM A;  1IEL A;  3MSH A;  2WGW B;  2ZBB A;  4QB8 A;  3UDI A;  4ARZ B;  4HJ6 A;  4JF6 A;  4PKY G;  4C6Y A;  1XJ2 A;  5AVF A;  1HD8 A;  4Z9Q A;  3TSG A;  2W3F A;  4XUX A;  2WKR A;  2CMN A;  4PM9 A;  4OPR A;  3D4F A;  4DXC A;  4I39 A;  3MKE A;  5CTN A;  3G34 A;  3S1Y A;  3DTI A;  1K54 C;  4QD4 A;  3TJZ C;  1CEG A;  1NXY A;  1XKZ A;  4X55 A;  1BUL A;  1OJ5 A;  1X0O A;  3OPR A;  2PR5 A;  1IYQ A;  5IU1 A;  3W8K A;  2DRW A;  3SS3 A;  1K56 A;  2G7U A;  4HBT A;  1XA7 A;  2ZQ8 A;  4KZ5 A;  3UE0 A;  1HZO A;  2VKS A;  4FUW A;  4Y5F A;  4PM6 A;  1EI5 A;  3BQ8 A;  3U4L P;  2IWC A;  3VV4 A;  4I3A A;  4UEY A;  1SCW A;  1VHM A;  5HPI A;  4RA7 A;  4P6Z M;  3NC8 A;  4D60 A;  3DTM A;  5J3W A;  3WRT A;  1ALQ A;  2XFS A;  4BJP A;  2Y2N A;  2D02 A;  1RCJ A;  2WUQ A;  3IXH A;  5JYO A;  1XJ3 A;  4LV0 A;  3MQO A;  1PWD A;  3MQQ A;  3ZVT A;  1JTG A;  1TDL A;  4P0M A;  1T1C A;  3NJA A;  5FL3 A;  3PBR A;  2VGL S;  4JXW A;  4IUK A;  1NYY A;  2GZA A;  5HWV A;  2EXA A;  2DMW A;  2Z2M B;  5TFQ A;  4MN5 A;  4EUZ A;  4LGW A;  5G4Z A;  4BBU A;  1BTL A;  3HLC A;  3ITA A;  3EEA A;  3KSF A;  1G6O A;  1VET B;  1CF0 A;  3M2J A;  1PWG A;  1JNU A;  5HX9 A;  1L3L A;  1N9O A;  4EV4 A;  1WYB A;  4EWF A;  3K3D A;  2PRF A;  3E98 A;  3A0S A;  1RGY A;  4R3J A;  3BM6 A;  3UPN A;  3PXP A;  1WA9 A;  4DE3 A;  1XPB A;  1LSX A;  3UPP A;  2QPN A;  4I38 A;  4GHI B;  3G4P A;  3ZG5 A;  2P9V B;  3N8L A;  3OPP A;  1YSP A;  1ESU A;  4LRY C;  3IWQ A;  3VFH A;  3C7U A;  1UWP X; 
#chains in the Genus database with same CATH homology
 3OPH A;  1K57 A;  3VSL A;  1YM1 A;  3FYZ A;  4QY6 A;  1XA1 A;  4R4S A;  1L0G A;  1S6R A;  1QMF A;  2Q9M A;  4R4R A;  5CHJ A;  4A5R A;  5TGF A;  2RL3 A;  3P98 A;  4ZJ3 A;  4K0W A;  5DF8 A;  3O88 A;  5FAQ A;  5HAQ A;  3VOY A;  4MBF A;  3AGE A;  1K4E A;  3C4O A;  2H5S A;  3G2Z A;  5FAT A;  4B4X A;  1GA0 A;  5E2H A;  4JKT A;  1OME A;  3HVF A;  5CGX A;  5HAR A;  1PZP A;  5KMW A;  5DVA A;  4BLM A;  2WAF A;  3HLD A;  3PBQ A;  3LEZ A;  3NIA A;  4D2O A;  4GN2 A;  4KG6 A;  3UDX A;  5CRF A;  1K6S A;  2Y2L A;  2Y2O A;  1FSW A;  2ZLY A;  3N4I A;  1AXB A;  1FCO A;  2XH9 A;  5FAO A;  5FQ9 A;  1L0E A;  1YLY A;  2EX2 A;  3PTE A;  2EX8 A;  4BD0 A;  1E3U D;  1ESI A;  1IKI A;  4LV2 A;  1YLT A;  5CGS A;  3LY3 A;  4JF5 A;  4LCL A;  2X02 A;  1H8Y A;  1C3B A;  4NK3 A;  4OPY A;  2JC7 A;  3IWO A;  3WS2 A;  3WS0 A;  3TOI A;  1TDG A;  4DRT A;  1MBL A;  5CHM A;  4B88 A;  4IBX A;  4OQH A;  3M2K A;  1KDS A;  1LI9 A;  2X01 A;  4U3T A;  3BRM A;  5AQB A;  4JLF A;  3ZHH A;  1JVJ A;  3Q07 A;  3ZFZ A;  5CED A;  1M6K A;  3HLE A;  3NBL A;  2PBY A;  5M18 A;  4WYY A;  2A3U A;  4RX2 A;  4GD6 A;  4E3K A;  4PPR A;  2WAD A;  3HLF A;  3PBO A;  3A3D A;  4ZDX A;  3HUM A;  3MZF A;  2PU2 A;  1L0D A;  3ISG A;  1KGG A;  4WZ5 A;  3WS4 A;  5DF9 A;  1PW8 A;  1L0F A;  5EE8 A;  3BFC A;  2HP9 A;  2FFY A;  1HVB A;  4K91 A;  5CGW A;  3SS4 A;  4KG5 A;  5A92 A;  2HP5 A;  1H8Z A;  1Y54 A;  1XGI A;  1IYP A;  1ZC2 A;  4S2I A;  3FKW A;  3E2K A;  5FSR A;  4LEN A;  4UHU A;  1KVL A;  1W8Y A;  1EWZ A;  4WBG A;  3RXW A;  4KZ8 A;  3OZH A;  4S2N C;  2XGN A;  4ID4 A;  4JF4 A;  5G18 A;  3N6I A;  3N8S A;  1JTD A;  1ZKJ A;  3BFF A;  1XGJ A;  2DNS A;  4YFM A;  4OOM A;  5CEC A;  3BLS A;  4NET A;  4KEN B;  3UO9 A;  4XXR A;  1W79 A;  3G32 A;  2QMI A;  4UA9 A;  4CJN A;  4F94 A;  5EUA A;  5L2F A;  5EPH A;  5CEB A;  3AGF A;  5FI6 A;  5DF7 A;  3QNC A;  1CEF A;  2XK1 A;  1TEM A;  4WZ4 A;  1K55 C;  1IKG A;  3MBZ A;  3GRJ A;  3ITB A;  3UN7 A;  4Y0T A;  1K6R A;  3A3F A;  3HLB A;  4GOG A;  2CC1 A;  1HTZ A;  2ZQD A;  4KZ7 A;  4WEK A;  4GDB A;  2Y2M A;  5D3O A;  5E2F A;  1L2S A;  4P87 A;  2XD5 A;  3LO7 A;  5BOH A;  2J8Y A;  1H5X A;  2XQZ A;  3BFG A;  3CZD A;  3NCK A;  5F1G A;  4GKU A;  1MY8 A;  1CI9 A;  1ONH A;  4MBH A;  2OLU A;  4S2O A;  2P9V A;  2ZMA A;  1ES4 A;  3IT9 A;  1YLW A;  5EEC A;  5EOO A;  3ZVW A;  5IHV A;  5M1A A;  1KGF A;  1BLH A;  1IEM A;  2EX6 A;  2ZQ9 A;  3GV9 A;  4BQM A;  5AQ7 A;  3VP4 A;  1MXO A;  3SS5 A;  5GLD A;  1BSG A;  3FV7 A;  2Y2Q A;  3E2L A;  5JYP A;  1MPL A;  3M6H A;  4OH0 A;  3VSK A;  3HBR A;  3I7J A;  5AQ9 A;  1FR1 A;  1DY6 A;  1KE4 A;  4R0Q A;  2OV5 A;  2HDQ A;  1I2W A;  3ZG8 B;  4E3J A;  1LL9 A;  4IED A;  4JXV A;  4E6W A;  4KZ3 A;  4P6B A;  2HDU A;  3IWI A;  3VP1 A;  4KZB A;  3DW0 A;  4E3M A;  4HBU A;  4Y0O A;  5GHX A;  1BLP A;  1NJ4 A;  2WKE A;  1MWU A;  3RJU A;  1U60 A;  4KZ4 A;  1MWT A;  3EQU A;  2ZQA A;  2A49 A;  4GDN A;  1W7F A;  1ZG6 A;  2WAE A;  3NI9 A;  3V39 A;  3NY4 A;  1FR6 A;  3IQA A;  1BLC A;  1ES3 A;  4OQ0 A;  3MZD A;  2ZQ7 A;  4RYE A;  2ZC6 B;  2WKI A;  2XR0 A;  3Q7Z A;  5EVI D;  4QU3 A;  3UE3 A;  3UDF A;  3IH9 A;  2XD1 A;  3CG5 A;  3MXR A;  1YQS A;  3SOI A;  4QY5 A;  5GL9 A;  4BEN A;  4RVA A;  1W8Q A;  3FKV A;  5E43 A;  3OCN A;  5GLA A;  3DWZ A;  2Y55 A;  4JBF A;  3G35 A;  2ZQC A;  1FQG A;  1W5D A;  2VGK A;  2Z2L B;  3OCL A;  5FQJ A;  1IYS A;  1K57 C;  2R9X A;  1E3U A;  4GZB A;  3IXB A;  4Y7P A;  2GDN A;  3VP3 A;  4IBR A;  1LHY A;  1MWR A;  1YT4 A;  1O07 A;  3HRE A;  3IH8 A;  4MEZ A;  1IYO A;  1K55 A;  5FQM A;  3V5M A;  1LI0 A;  3VP0 A;  3Q7V A;  3ZG9 B;  3ZNT A;  1GCE A;  1YLJ A;  5GLB A;  3PBS A;  2WYX A;  1M40 A;  3BEC A;  1PW1 A;  4S2P A;  3VFF A;  3VP2 A;  1LL5 A;  4R1G A;  3ZCZ A;  2BG1 A;  1ERM A;  4LCM A;  5FI2 A;  4OPQ A;  4OON A;  2EX9 A;  4P85 A;  4KG2 A;  4KQO A;  3BLM A;  2DCF A;  4WM9 A;  1I2S A;  2WKH A;  4PM7 A;  4B4Z A;  4Q8I A;  2WGI A;  5HAI A;  4M3K A;  2WZZ A;  1NZU A;  1FCM A;  5F82 A;  3C7V A;  4OOL A;  3M6B A;  2WGV A;  4OP5 A;  5KSH A;  1K4F A;  1KE3 A;  3A3E A;  4KZ6 A;  3PAE A;  4E3I A;  5GHY A;  3V50 A;  2Y2K A;  1YMX A;  3HLW A;  2B5R A;  2V20 A;  4K0X A;  5J8X A;  3BEB A;  3PAG A;  3MXS A;  4PMA A;  3HUO A;  4HEF A;  1FSY A;  2V1Z A;  4C3Q A;  1KGE A;  4UAA A;  2Y2P A;  2XDM A;  4WZ5 C;  1S0W A;  4OLD A;  5HFO A;  1GA9 A;  3RXX A;  4U0X A;  4IVK A;  2ZM8 A;  2Y4A A;  4JXG A;  1NYM A;  4IVI A;  5A90 A;  3VMA A;  2JCH A;  5EVL A;  3Q7V B;  2UWX A;  5EOE A;  3OC2 A;  4X53 A;  4LV3 A;  4MBK A;  2WZX A;  4L0L A;  3BFE A;  1E4D A;  1I5Q A;  1K54 A;  2ZM0 A;  4E3L A;  4CPK A;  4FH4 A;  2Q9N A;  3GQZ A;  5EVI C;  4DDY A;  3V3S A;  1NZO A;  3IF6 C;  1NRF A;  4YIN A;  3IXD A;  4KZA A;  1VM1 A;  4KQR A;  4ZBE A;  4X68 A;  2H0Y A;  2IWB A;  3IXG A;  2Y2J A;  1XP4 A;  2J9P A;  5CER A;  1JWV A;  2E8I A;  3IHA A;  2Y2G A;  3Q1F A;  1SDE A;  5GHZ A;  4DE1 A;  3MFD A;  2JE5 A;  2C5W B;  3IF5 A;  1KVM A;  1IEL A;  3P09 A;  1ES5 A;  4DE2 A;  1CI8 A;  1FOF A;  2WGW B;  1NY0 A;  4QB8 A;  3UDI A;  5A93 A;  4E6X A;  5EVI B;  3Q82 A;  1PYY A;  2ZC7 A;  3PBT A;  4OP8 A;  4DKI A;  1KE0 A;  4JF6 A;  4ZJ2 A;  2G2W A;  1RP5 A;  5HW3 A;  4C6Y A;  3SH9 A;  4EBL A;  3WS5 A;  2HDS A;  3VOZ A;  1CK3 A;  5FDH A;  4N9K A;  3BYD A;  1HD8 A;  3G30 A;  4Z9Q A;  3TSG A;  3HL9 A;  5F1F A;  4OPZ A;  2OLV A;  1PWC A;  5CTM A;  4XUX A;  3Q81 A;  4DF6 A;  3WWX A;  4OOY A;  3GMW A;  5FA7 A;  2H0T A;  4PM9 A;  2HPB A;  3W4Q A;  1ZG4 A;  2Y59 A;  4OPR A;  3D4F A;  4EBN A;  4DXC A;  1JWP A;  4X56 A;  5M19 A;  3MKE A;  2Y2I A;  4MNR A;  3N8R A;  4ZTK A;  2XF3 A;  5HL1 A;  2XFT A;  1RGZ A;  5CTN A;  3G34 A;  5EVI A;  3SH7 A;  4BL3 A;  3S1Y A;  3ZDJ A;  1K54 C;  4WMC D;  1YLZ A;  1BZA A;  2Y2H A;  4QD4 A;  1ONG A;  1K56 D;  1CEG A;  4X69 A;  1NXY A;  1XKZ A;  4N9L A;  4OVD A;  4X55 A;  1DJB A;  2Y91 A;  1BUL A;  5I94 A;  1J9M A;  5KSC A;  3EQV A;  3FZC A;  3OPR A;  4S2L A;  4DDS A;  1K25 A;  1IYQ A;  3TG9 A;  5FAP A;  3W4P A;  1FCN A;  3CJM A;  3FWL A;  3NDE A;  4FD8 A;  3W8K A;  4OQI A;  2DRW A;  5FQK A;  4DXB A;  3IF6 B;  3SS3 A;  4XUZ A;  1N4O A;  5F83 A;  1K56 A;  4R3B A;  4HBT A;  1XA7 A;  2ZQ8 A;  4KZ5 A;  3UE0 A;  1HZO A;  2PU4 A;  1SHV A;  4PM6 A;  1YLP A;  1EI5 A;  1PI4 A;  4ZJ1 A;  5HAP A;  2IWC A;  1WE4 A;  3S4X A;  1DJC A;  1N9B A;  2HDR A;  3C4P A;  4FSF A;  3BFD A;  2I72 A;  3MKF A;  4GNU A;  1SCW A;  1SDN A;  3O3V A;  1DJA A;  1GHM A;  4QJG A;  4OLG A;  1G6A A;  3O86 A;  4RA7 A;  2ZC4 B;  1K38 A;  4UA6 A;  4X6T A;  2ZD8 A;  3NC8 A;  4HES A;  4PM8 A;  4OKP A;  4UA7 A;  3DTM A;  1ERO A;  5A91 A;  3WRT A;  3B3X A;  1ALQ A;  3A3J A;  3NDG A;  4BD1 A;  2XFS A;  1MKI A;  4FCF A;  3PBN A;  2Y2N A;  5FQI A;  4BJP A;  2RCX A;  4WEL A;  3ZGA B;  1JWZ A;  5CXW A;  2BLS A;  3G31 A;  1RCJ A;  2WUQ A;  3G2Y A;  3HLG A;  1LLB A;  3IXH A;  4N1H A;  4S2K A;  4KZ9 A;  5JYO A;  4RX3 A;  5FQQ A;  4LV0 A;  1GHP A;  1XXM A;  4WMC A;  1PWD A;  3UY6 A;  2WK0 A;  3W4O A;  2FFF B;  4S2M A;  3ZVT A;  1JTG A;  1XX2 A;  2EFU A;  4DE0 A;  3GSG A;  4E3N A;  2ZC3 B;  1TDL A;  4E3O A;  4P0M A;  5KZH A;  3AGD A;  4QHC A;  4EQI A;  4EBP A;  1YMS A;  3PBR A;  1E25 A;  4C75 A;  3V3R A;  1BLS A;  5FAS A;  5CHU A;  4GD8 A;  1Z6F A;  2EFX A;  4O7D A;  3JYI A;  4JXW A;  3WRZ A;  2G2U A;  3N7W A;  1O7E A;  4N1X A;  3GR2 A;  1NYY A;  1G68 A;  4Y0U A;  3ZG7 B;  4BL2 A;  2EXA A;  1ES2 A;  2Z2M B;  3S22 A;  5DTT A;  5TFQ A;  1BT5 A;  5GLC A;  4EUZ A;  4R23 A;  1Q2P A;  2OSU A;  4FH2 A;  1PZO A;  2X71 A;  1WYC A;  3ZNY A;  1BTL A;  3C5A A;  2XEP A;  2HP6 A;  3HLC A;  1PIO A;  4ZAM A;  3ITA A;  2V2F F;  3IF6 A;  3SH8 A;  2ZJ9 A;  3UNW A;  3CMZ A;  5DTS A;  3IHB A;  1SKF A;  3QNB A;  3M2J A;  3HUN A;  5TR7 A;  1PWG A;  1GHI A;  5AQA A;  5HX9 A;  4JXS A;  2J9O A;  4S2J A;  5E2E A;  1ERQ A;  4EV4 A;  1WYB A;  1MWS A;  4U0T A;  2VGJ A;  1Q2Q A;  3A3I A;  3LCE A;  1PI5 A;  4EWF A;  2ZM2 A;  3WS1 A;  2P74 A;  5E2G A;  2C6W B;  1RGY A;  4R3J A;  2XLN A;  4WEJ A;  2H10 A;  4N92 A;  3UE1 A;  3BM6 A;  3UPN A;  3OPL A;  3GTC A;  4DE3 A;  4S2N A;  3O87 A;  2EXB A;  1XPB A;  2QZ6 A;  2WGW A;  3MZE A;  3ZG0 A;  5U47 A;  3UPP A;  4PM5 A;  3QHY A;  2QPN A;  4JPM A;  3UPO A;  2JBF A;  2J7V A;  3G4P A;  3GVB A;  3ZG5 A;  1KDW A;  2P9V B;  5FI7 A;  1BUE A;  1TVF A;  3N8L A;  4H8R A;  2R9W A;  3DWK A;  3LY4 A;  3OPP A;  4MLL A;  4GB7 A;  4OQG A;  5DTK A;  1ESU A;  2IWD A;  4KQQ A;  2ZC5 B;  1QME A;  3IWQ A;  4LV1 A;  3VFH A;  1VQQ A;  3C7U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...