1BLHA

Structure of a phosphonate-inhibited beta-lactamase. an analog of the tetrahedral transition state(slash)intermediate of beta-lactam hydrolysis
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
257
structure length
257
Chain Sequence
b'KELNDLEKKYNAHIGVYALDTKSGKEVKFNSDKRFAYASTSKAINSAILLEQVPYNKLNKKVHINKDDIVAYSPILEKYVGKDITLKALIEASMTYSDNTANNKIIKEIGGIKKVKQRLKELGDKVTNPVRYEIELNYYSPKSKKDTSTPAAFGKTLNKLIANGKLSKENKKFLLDLMLNNKSGDTLIKDGVPKDYKVADKSGQAITYASRNDVAFVYPKGQSEPIVLVIFTNKDNKSDKPNDKLISETAKSVMKEF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA-LACTAMASE
publication title Structure of a phosphonate-inhibited beta-lactamase. An analog of the tetrahedral transition state/intermediate of beta-lactam hydrolysis.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase(beta-lactamase)
total genus 94
structure length 257
sequence length 257
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 1993-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 1blhA00
3NDGA 1Q2PA 3TSGA 1WYBA 5CXWA 4KZ3A 2XF3A 1YMXA 1JVJA 2G2WA 3HLBA 3IXGA 4UHUA 1ES3A 2Y2OA 3FKVA 3OPHA 1M40A 1IKIA 3ZG8B 4MNRA 4OH0A 3V3SA 3VP3A 3WWXA 3ITBA 4QJGA 5FA7A 4FD8A 4RVAA 1K55A 4OQGA 1E3UD 4E6WA 3FYZA 4ZAMA 2V1ZA 1G68A 2ZQ8A 1RGZA 4BD0A 2Y2JA 1BLCA 1ES4A 4XUXA 1KE0A 4KZ6A 3VFHA 5CGWA 5CTMA 1K38A 1HVBA 1TDGA 3QNCA 1NYMA 1ZG6A 1KE3A 2XDMA 3OZHA 4ZJ3A 4S2NA 3Q7VA 1FCMA 4R4RA 4HESA 4N9KA 1KDSA 1PW1A 3IF6B 1ZKJA 4QD4A 4WM9A 1PYYA 2FFYA 3MFDA 4DE0A 1NY0A 2ZQCA 3ZNTA 4S2KA 4EBLA 4EV4A 4Y0TA 4GN2A 3UPOA 1FSYA 3UY6A 3GMWA 4DXCA 1W7FA 4PPRA 2WGWB 4ZJ1A 4KZ5A 2XGNA 1XXMA 2XD1A 4IVIA 5EVIC 1PZPA 1JWZA 1NYYA 3M2JA 5M1AA 4BD1A 2X71A 2OLUA 4EBPA 2XK1A 4KZBA 3LO7A 4UA6A 4KG6A 5AQ9A 2HPBA 5FQIA 3ZNYA 2B5RA 1GHIA 1BLHA 1TDLA 4ZTKA 5AQAA 3MKEA 3MBZA 5FQJA 3N4IA 3UN7A 3GV9A 3G4PA 4C3QA 3FZCA 4GB7A 4KZ4A 4OPYA 4X6TA 4OOLA 3DWZA 4U0TA 3BFCA 2XFSA 5E2GA 3D4FA 1K54A 4M3KA 2QPNA 3HVFA 1JTGA 4OPZA 4C75A 1ESIA 4DE2A 1CI8A 5TFQA 3OPRA 1PIOA 3O88A 2ZM8A 1JTDA 5CHMA 4PM5A 1TEMA 3HUMA 1DJBA 4S2LA 1IYPA 3EQUA 3WS5A 1SKFA 1K56A 2EX6A 5E2EA 5EUAA 4WMCA 3C4OA 3IXDA 4LCLA 4IBRA 4R3BA 4D2OA 5KSCA 1OMEA 1XPBA 2EXAA 2WYXA 2HDSA 4N1HA 3O3VA 1GHPA 5CEBA 2WK0A 5FQMA 3BLSA 5EVLA 2A3UA 1HTZA 3AGEA 3HLEA 3LY4A 2ZM2A 3VSKA 4R3JA 4KZ7A 2OLVA 3G2YA 4U0XA 5GHZA 4E3JA 3SS5A 2WADA 5FSRA 3C7UA 3DWKA 2ZC7A 1Q2QA 4DE1A 4LENA 1FCOA 5KMWA 4DE3A 3MZEA 2IWBA 3ZCZA 4DXBA 1LL5A 3IF5A 5JYOA 2Y2LA 5G18A 5GLAA 4WZ5C 3BFGA 3IT9A 2Y4AA 3UDXA 2P9VA 2Q9MA 1MPLA 1LLBA 4FSFA 4LV0A 3TG9A 2WAEA 1KGEA 4BL2A 4S2IA 1LI0A 3W4OA 4QHCA 3IWQA 5AQ7A 1K57C 3HLFA 4YINA 4WYYA 3LEZA 1GA0A 1ZC2A 2Y2KA 5E43A 2H0TA 1YMSA 3G30A 2Y2IA 1EWZA 3GQZA 4R1GA 4E3MA 4UAAA 2JCHA 4EWFA 2DNSA 4GNUA 4MBHA 2V2FF 1PZOA 4UA7A 1K4EA 1H5XA 1BT5A 1MKIA 3ZGAB 5FI6A 1L0EA 3HBRA 4PMAA 5FAQA 4R0QA 2Z2LB 5HAQA 1SCWA 1PWCA 5HW3A 2ZD8A 3GTCA 2Y55A 3HREA 1EI5A 4PM7A 4WBGA 1JWVA 1DJCA 4Y0UA 2HDQA 1PW8A 2EFXA 3Q07A 3IH9A 4HBUA 3ZG5A 3UNWA 2J9PA 2QZ6A 3LY3A 1L2SA 3Q7VB 4DKIA 3WS2A 2PU2A 5EVIB 5FAPA 4KZ8A 2GDNA 1ES5A 2RCXA 4JXWA 4X56A 3NCKA 3RXWA 2EX8A 1QMFA 3G32A 4JXGA 1XKZA 2BLSA 4FH4A 3RXXA 5FQQA 2JE5A 3G2ZA 5EOEA 1IEMA 3BFFA 3ITAA 3CG5A 3BRMA 4GZBA 5CHJA 3NC8A 3MKFA 3S1YA 2XR0A 5CGSA 4MBFA 5KSHA 2XD5A 3PAEA 5EVIA 3VFFA 4HBTA 1XA7A 3OCNA 2XH9A 3UE1A 4NK3A 1DY6A 3A3DA 3EQVA 2J9OA 4OLDA 1Z6FA 4R4SA 5A92A 2Y2HA 3W8KA 3FV7A 1YLJA 2G2UA 2XEPA 4CPKA 4BENA 4JBFA 1YT4A 4GD6A 4K0XA 2E8IA 3PAGA 1IYQA 4WEKA 3GSGA 4Y7PA 4RYEA 4IBXA 1VM1A 2WKEA 4FH2A 4BL3A 4OKPA 3UDFA 1BSGA 1MWUA 4OP8A 1S6RA 2Y91A 3O86A 5GLCA 2JBFA 4OONA 1IYOA 5F82A 3SH8A 4H8RA 3W4QA 1JWPA 1GHMA 4QY5A 2EX2A 1I2WA 4XUZA 4E6XA 4XXRA 2IWCA 2PU4A 3WS0A 3PTEA 3FWLA 4ID4A 1NJ4A 5CERA 2ZQ9A 1KGFA 1YQSA 5FQKA 2WUQA 1L0GA 1FOFA 3MZFA 2OV5A 3HUNA 1ONGA 1XX2A 2C5WB 5F1GA 3VOZA 3CMZA 3BYDA 5DF8A 1DJAA 2ZC4B 3I7JA 4LV2A 5CTNA 1GCEA 5E2HA 4FCFA 1YLPA 1KVLA 2JC7A 4OQ0A 4QU3A 3IF6C 3A3EA 2X02A 3V50A 3IHAA 2R9XA 3SH9A 3BEBA 1XGIA 2QMIA 3OPLA 1BLSA 3DW0A 5A93A 3OC2A 2P9VB 4EBNA 4MBKA 4N9LA 3ZHHA 5FASA 3N7WA 4LV3A 3BECA 5EPHA 4WZ5A 2H5SA 1PI5A 3SOIA 3BFDA 2Y2NA 5FI2A 3OPPA 3SH7A 2BG1A 1MY8A 3NI9A 4X53A 5HX9A 2Y2QA 2ZC6B 3HUOA 3N8RA 3ZDJA 3ISGA 1K57A 3NBLA 4P85A 4EQIA 2Y2GA 1U60A 5HAPA 1RCJA 4JF4A 3N8LA 4QB8A 3IHBA 3BLMA 2VGKA 5CGXA 3LCEA 5EVID 3G34A 2WZXA 1K4FA 2HP6A 3PBOA 4IVKA 3WRZA 3Q1FA 3UE0A 5D3OA 4L0LA 1SHVA 1C3BA 4O7DA 3GVBA 4DRTA 4Q8IA 4X69A 5GL9A 3S4XA 4MLLA 5DTKA 4DF6A 3N8SA 1IKGA 4S2PA 5U47A 1K25A 1GA9A 3AGFA 1O7EA 3P09A 3V5MA 3VP2A 1J9MA 1N9BA 3IXHA 3PBTA 4IEDA 1NRFA 1L0DA 2XLNA 4LV1A 4OVDA 4P6BA 3V39A 3AGDA 1W79A 2HDRA 3FKWA 4GKUA 5FDHA 4DDYA 1K6SA 4A5RA 5I94A 4MEZA 1MWRA 3W4PA 1YLWA 4NETA 4PM6A 3BM6A 1MBLA 4JLFA 5GLBA 1ERQA 1XGJA 3UO9A 2WKHA 4UA9A 5TGFA 3ZG0A 3G31A 3C7VA 2Z2MB 5FATA 3ZG7B 3PBQA 1ALQA 1I2SA 1K56D 4QY6A 3DTMA 3HLGA 4WMCD 2DCFA 5AQBA 1BTLA 3JYIA 5DTSA 1KVMA 3C4PA 2IWDA 5HL1A 4P87A 5E2FA 5CECA 2ZMAA 1FR1A 1BLPA 2Y59A 3UPPA 1FQGA 3NIAA 3HL9A 3ZVWA 5HARA 2HP9A 3O87A 4Y0OA 4E3IA 3M6HA 3QNBA 1O07A 1CK3A 3A3IA 1M6KA 2XFTA 4GDNA 4KQRA 3VP0A 3UE3A 2WGVA 5DTTA 2I72A 3G35A 1Y54A 1YLTA 4JXVA 5HAIA 4GOGA 3PBRA 3P98A 3ZFZA 1MWSA 1YLYA 2Y2MA 1HZOA 3Q81A 4B88A 4OOYA 1H8ZA 1K55C 2C6WB 3NDEA 4Z9QA 5FAOA 4N92A 3E2LA 5F83A 1IELA 5IHVA 1ONHA 4KQQA 1XA1A 4DDSA 1SDNA 2FFFB 2DRWA 5M19A 3E2KA 1FR6A 4OLGA 4KQOA 1NZUA 3MXRA 3VMAA 2UWXA 4S2OA 1FSWA 3UPNA 1CEGA 4S2NC 3MZDA 1ESUA 2ZJ9A 1YM1A 1PI4A 3A3FA 5EE8A 2X01A 4X68A 3PBSA 4JPMA 2WZZA 1RGYA 4JF5A 1PWDA 2Q9NA 1W8QA 3HLDA 4KG5A 3BFEA 1EROA 3IF6A 1XP4A 4WZ4A 5FI7A 4U3TA 3WS4A 5EECA 3RJUA 1H8YA 4E3NA 3ZVTA 4KENB 2WGWA 3IQAA 2V20A 5A91A 4P0MA 1MWTA 5GHYA 4YFMA 1G6AA 3IXBA 4OQHA 4ZBEA 2J7VA 3SS3A 1CEFA 1KDWA 1I5QA 5EOOA 1TVFA 1BZAA 4PM9A 5HFOA 4B4ZA 1WYCA 3CZDA 1LL9A 5GHXA 4B4XA 3GR2A 5CRFA 4RX2A 1E4DA 1W5DA 1ZG4A 4OQIA 2RL3A 1BUEA 1E3UA 4GDBA 4OPRA 1CI9A 1KE4A 2VGJA 3M2KA 4BLMA 4EUZA 2WAFA 3N6IA 2WKIA 2Y2PA 5CHUA 5L2FA 1ERMA 1HD8A 4S2JA 2R9WA 3C5AA 4OOMA 3V3RA 1FCNA 1K54C 1VQQA 2HDUA 2EX9A 2HP5A 2A49A 1LI9A 4PM8A 2P74A 4R23A 4KG2A 5DVAA 4KZ9A 3VP4A 1E25A 3QHYA 3CJMA 4GD8A 2ZC3B 4E3KA 1QMEA 3MXSA 3Q7ZA 4OPQA 4K0WA 5DF7A 1WE4A 3VOYA 1ES2A 5DF9A 1LHYA 2PBYA 4CJNA 1AXBA 3PBNA 3HLCA 2WGIA 3WS1A 1BULA 2ZC5B 3IWIA 2EXBA 4JF6A 1MXOA 2EFUA 4ZJ2A 5GLDA 5J8XA 2ZQAA 4N1XA 2CC1A 5F1FA 4E3LA 4JXSA 4LCMA 3VSLA 4KZAA 1S0WA 3NY4A 4WELA 3GRJA 3WRTA 4K91A 1NXYA 2H10A 2OSUA 4X55A 4E3OA 4OP5A 2ZQDA 5M18A 2J8YA 3S22A 1IYSA 4RX3A 3M6BA 4BJPA 3A3JA 4S2MA 3TOIA 3HLWA 1NZOA 3OCLA 5BOHA 1SDEA 3Q82A 2ZM0A 1PWGA 3IH8A 5A90A 2ZQ7A 3IWOA 1W8YA 4BQMA 4F94A 5KZHA 3VP1A 4C6YA 2H0YA 1RP5A 4RA7A 1L0FA 1N4OA 1K6RA 5FQ9A 3UDIA 1KGGA 5CEDA 5TR7A 2ZLYA 3SS4A 4JKTA 5JYPA 3ZG9B 4ZDXA 3B3XA 1YLZA 4HEFA 2XQZA 4WEJA
chains in the Genus database with same CATH superfamily
3NDGA 2B95A 1WYBA 4R6LA 3IXGA 4UHUA 2KLIA 3VP3A 4GHIB 3WWXA 3B33A 3UB7A 3ITBA 2R78A 3IBRA 3LR0A 4QJGA 2XROA 4RVAA 4ETXA 3FYZA 2V1ZA 4M4XA 1S67L 1G68A 1NWZA 4BD0A 1BLCA 1ES4A 4XUXA 4KZ6A 3OZHA 4QPRA 4S2NA 3Q7VA 4R4RA 4HESA 1PW1A 3IF6B 1ZKJA 4QD4A 2ZQCA 4S2KA 1ACFA 3UPOA 4GN2A 4R3AA 4PPRA 2VA0A 2XRNA 5EVIC 3M2JA 2JKFA 4UA6A 5AQ9A 5FQIA 3OOVA 3ZNYA 1T19A 5AQAA 2PD7A 2V1BA 1VETA 3G4PA 3DWZA 2XFSA 4NEED 5TJJA 4C75A 1YAXA 1IOUA 4PM5A 3WS5A 1K56A 5EM0A 2EX6A 2QYBA 4R3BA 4IBRA 1OMEA 2EXAA 2WYXA 3BLSA 2A3UA 2OAP1 3HLEA 3LY4A 3TJZC 4U0XA 4KQDA 5GHZA 3LI8A 4E3JA 3V67A 3DWKA 2ZC7A 2HGVA 5KMWA 2IWBA 3ZCZA 4DXBA 3IF5A 5MC7A 2Y2LA 3UDXA 4BMWA 4Y2FA 1KGEA 4BL2A 3W4OA 4QHCA 1K57C 4YINA 3LEZA 3BJNA 1EWZA 2LB9A 4G3VA 4UA7A 1PZOA 3FPVA 1MKIA 4MN7A 2IA2A 5HSQA 3HBRA 4PMAA 3LFVA 3T4LA 2Y55A 1JWVA 3UE6A 2HDQA 2CMNA 2KX6A 3Q07A 1LSVA 5C5KA 2RCXA 1ES5A 4JXWA 2VKSA 2EX8A 4LRXC 2BASA 1XKZA 2JE5A 4WL9A 3OBFA 5G4ZA 3S1YA 3MKFA 3SW1A 4HBTA 3NJAA 4NK3A 4OLDA 5HWTA 4ZRRA 1YLJA 3F1OB 4X25A 4BENA 4GS9B 3PAGA 5AJGA 4WEKA 3ZQ5A 3UDFA 5GLCA 1IYOA 1N9LA 4QY5A 1TF1A 4E6XA 1I2WA 4FUWA 3WS0A 4QWOA 4GLQA 3HJKA 2B02A 2JKRI 3T1RA 4EXOA 5FQKA 1L0GA 3HUNA 3IX4A 3ICYA 3VOZA 3BYDA 2W1TA 2P08A 1DJAA 3A0SA 3OPLA 4LGWA 2P9VB 4EBNA 2Z6CA 4B93A 4BBVA 3BFDA 5HDCA 2Y2NA 3UMEA 1TD5A 3KYQA 2Y2QA 3LIAA 3ZDJA 3ISGA 3NBLA 5HD5A 3CPTB 5EVID 3G34A 2WZXA 2VJWA 3MQ0A 1SKOA 3F1NB 2P04A 1OJ5A 4L0LA 1C3BA 4DRTA 3O5YA 5DTKA 4DF6A 1IKGA 1J9MA 2FZ0A 3IXHA 3PBTA 5FEFA 2AVXA 4JLFA 2JHEA 2W3FA 5G4YA 1MKMA 5TGFA 3LR3A 3FC7A 3IS2A 5FATA 3ZG7B 1K56D 3C4PA 4LLOB 2Y8HA 5CECA 2ZMAA 1D06A 1FR1A 4H6JA 1F2KA 3MMHA 4EEPA 2Y79A 3HL9A 3O87A 4Y0OA 4E3IA 1O07A 1STZA 1Y54A 1YLTA 5HAIA 4GOGA 1IELA 5L10A 1XA1A 5KIZA 1XJ6A 2B18A 4KQOA 2UWXA 2P7JA 3UPNA 3MZDA 1ESUA 2ZJ9A 1YM1A 5EE8A 2ZMVA 5K5BA 2OOLA 2Q9NA 1EROA 3IF6A 4U3TA 3T4JA 2XSSA 3CI6A 5A91A 2V20A 3IXBA 3SS3A 2J7VA 1I5QA 5EOOA 2BTFP 1LL9A 5GHXA 4B4XA 1W5DA 4OQIA 2RL3A 3E4PA 1BUEA 4P6ZM 3M2KA 1KE4A 4LRZE 4BLMA 4EUZA 3N6IA 2Y2PA 1ERMA 4I3IA 3PR6A 5TBMA 2HP5A 2QJ7A 2P74A 2VV6A 4GD8A 2ZC3B 3SZTA 3MXSA 4K0WA 4CLCB 2W27A 2PBYA 3B47A 3PBNA 1YKDA 2HJ9C 1BULA 2ZC5B 4HH3A 3RH8B 2EXBA 5GLDA 2CC1A 4LCMA 3MF0A 3R7WB 1S0WA 3NY4A 2D02A 3WRTA 1OT6A 4E3OA 5M18A 2J8YA 4BJPA 3M6BA 3A3JA 4S2MA 3OCLA 2V1AA 2WKPA 4Q0HA 4Q0JA 3IWOA 1W8YA 5KZHA 4NXFA 4R70A 2H0YA 1RP5A 2V9AA 1L0FA 3UDIA 5TR7A 5JYPA 3ZG9B 1OTAA 3V3SA 4WEJA 4KZ3A 4HH2A 3BY8A 2G2WA 1JVJA 1ES3A 3FKVA 3OPHA 3CWFA 2XA7S 5FA7A 4IHQA 4OQGA 3L9KA 4E6WA 4ZAMA 3UB8A 2ZQ8A 3KYZA 1S1YA 1G6OA 5CTMA 1K38A 1HVBA 1TDGA 1DP8A 1PRQA 4WM9A 1PYYA 3MFDA 3LIBA 2MJ6A 1NY0A 4Y0TA 3T4OA 4EBLA 1FSYA 3UY6A 4XT2B 1W7FA 4D60A 1F9IA 4WF0A 1XXMA 2XD1A 1NYYA 4BD1A 2X71A 4KZBA 2GZAA 4Y13A 1UGUA 5FQJA 3UN7A 3N4IA 2LB5A 4OPYA 1YSPA 4OOLA 1G28A 3DTIA 1K54A 4M3KA 4OPZA 1PIOA 2ZM8A 1JTDA 1DJBA 3F1PA 5EUAA 3C4OA 2HV1A 2HDSA 3UB6A 1GHPA 2WK0A 4G3KA 1HTZA 3AGEA 3FG8A 4MN6A 5HPIA 3VSKA 2OLVA 2EA9A 2WADA 4LENA 1FCOA 4GJ4A 5HDSA 1LL5A 2VV7A 2HJEA 5GLAA 1P9WA 4WZ5C 3BFGA 3IT9A 3HJIA 2P9VA 1MPLA 2OWHA 4FSFA 4BWIA 3VE3A 3TG9A 2G7UA 5AQ7A 2EWWA 3D72A 5E43A 2EWVA 3G30A 4I3JA 5EFWA 3GQZA 3QP5A 4R1GA 3PXPA 4E3MA 2JKTI 4MN5A 4GNUA 2V2FF 3CPTA 3ZGAB 5FAQA 1SCWA 2ZD8A 3F1NA 1EI5A 3NOUC 4Y0UA 2VK3A 2PRFA 2V8CA 3IH9A 4HBUA 3UNWA 2J9PA 4NXGA 1L2SA 3MQOA 3LYXA 3P7NA 1XFQA 5FAPA 4NXBA 4X56A 3G32A 3CAXA 4Q0IA 5DKKA 3G2ZA 5EOEA 4X1MA 5CHJA 2KOIA 2XR0A 5CGSA 4HY8A 4Y17A 2FH5A 5EVIA 3KO6A 1XA7A 2XH9A 1ZTUA 3DTKA 4R4SA 1G5UA 2XEPA 4CPKA 3MJQA 4GD6A 2E8IA 3T4KA 1IYQA 3GSGA 1TS6A 4WUJA 4Y7PA 4FH2A 4OKPA 3JVUA 2JBFA 1P0ZA 4H8RA 3RTYA 4XUZA 4XXRA 1UWNX 1T1AA 1NJ4A 2WUQA 1FOFA 4DJ3A 2C5WB 4YOFA 1W63Q 2ZC4B 3I7JA 4LV2A 1GCEA 1YLPA 2JC7A 4OQ0A 3V50A 2J3WA 3BEBA 1XGIA 3OC2A 5CX7A 4JGQA 3K3DA 3BECA 1VB6A 3C38A 3E4QA 3SH7A 1MY8A 3NI9A 4EQIA 1K57A 4P85A 2Y2GA 1RCJA 1V9YA 4JF4A 1GSXA 4QB8A 1P9RA 3IHBA 2M7UA 3BLMA 3T50A 2VGKA 3BY9A 3LCEA 2ZOIA 3LICA 1XJ2A 4CQHA 4X69A 3S4XA 4MLLA 3DBAA 4S2PA 5U47A 1K25A 1GA9A 3P09A 3QP4A 1N9BA 4IEDA 2VGLM 4P6BA 3AGDA 2HDRA 4GKUA 4CLCC 5I94A 3R7WA 2GJ3A 2A24B 4MEZA 1MWRA 1YLWA 4NETA 1MBLA 1ERQA 1XGJA 2QWSA 4UA9A 2Z2MB 5FL3A 3A0RA 1I2SA 4HI4A 4BBTA 3HLGA 1BTLA 3JYIA 5DTSA 4Y5FA 5E2FA 1OTBA 2PR5A 3UPPA 3BW6A 5HARA 4I5SA 3QNBA 2OWJA 3U4LP 1FILA 3UE3A 5DTTA 3G35A 4LRYC 3CUEC 3LUQA 3ZFZA 3T4QA 1MWSA 2M1CA 1YLYA 3Q81A 4B88A 3IX3A 1K55C 4Z9QA 5HWVA 5FAOA 2HZ5A 5F83A 5IHVA 4O01A 4DDSA 1FR6A 4OLGA 3NULA 3MXRA 3VMAA 2J3TC 1FSWA 2ZOHA 1TS0A 4X68A 4WZ4A 2PD8A 5FI7A 5EECA 3H82B 3RJUA 4IUKA 4KENB 4XT2A 1GSVA 3IQAA 4YFMA 4OQHA 2K2NA 4HOIA 3T4TA 3CZDA 5HZHA 2H28A 2VGLS 5HDDA 4ESPA 3LGOA 4OPRA 5L2FA 5EVEA 1VQQA 2HDUA 2EX9A 4LFUA 2A49A 4KG2A 4KZ9A 3QHYA 1LSWA 3OLOA 5DF7A 1WE4A 3HLCA 2Z6DA 2KDKA 1A0KA 4X1LA 4ZJ2A 2ZQAA 5F1FA 3VSLA 4HP4A 2H10A 2J80A 3G6OA 3HLWA 5BOHA 1SDEA 3Q82A 1S1ZA 3UB9A 2ZQ7A 1CQAA 4C6YA 1K6RA 1NRJA 2ZLYA 3SS4A 4BBUA 4ZDXA 3T12B 5FI2A 3TSGA 2O9CA 5J3WA 1YMXA 3HLBA 1IKIA 4HHDA 3ZG8B 4OH0A 5F68A 2PBDP 3KX0X 3PHYA 2Y2JA 1KE0A 3VFHA 3TRCA 3QNCA 1KE3A 3NHQA 4ZJ3A 1FCMA 2VZWA 4GHIA 4N9KA 1KDSA 3DAVA 4EV4A 3GMWA 3IX8A 4ZJ1A 1VETB 4KZ5A 2XGNA 1JWZA 5M1AA 3GDIA 2OLUA 5IU1A 2XK1A 5F6AA 4KG6A 3E4OA 1BLHA 1GHIA 1TDLA 3MKEA 3MBZA 3LR4A 1IFQA 3FZCA 4ETZA 4GB7A 1MZUA 2XA7M 3BFCA 3D4FA 3HVFA 1JTGA 1ESIA 4DE2A 1CI8A 5TFQA 4EU0A 2W1RA 5CHMA 3EQUA 3IXDA 4LCLA 2VX8A 4EETB 5L07A 5CEBA 3PYPA 4JGOA 2W0NA 2ZM2A 3MR0A 2WKRA 1H3QA 3C7UA 1VEUB 1Q2QA 4DE3A 2O0YA 5JYOA 2Y4AA 5L8MA 1LLBA 1OT9A 2WAEA 4EESA 1T1CA 4WYYA 3H7WB 2Y2KA 1YMSA 4JGRA 4EWFA 3E0YA 1UWPX 3NECA 2V0UA 2W3EA 1H5XA 4I38A 1BT5A 3EOIA 5FI6A 3RFBA 2Z2LB 1PWCA 4PM7A 4WBGA 4LPZA 1TS8A 4E04A 4II7A 4HJ3A 2OAQ1 2QZ6A 3LY3A 4DKIA 2PU2A 4KZ8A 3QP2A 3NCKA 3RXWA 1NLZA 1QMFA 4FH4A 4UEYA 1IEMA 3BFFA 2K31A 2A24A 4MBFA 5KSHA 5AVFA 2XD5A 3L7HA 3PAEA 1XFNA 1OTIA 3VFFA 5AVEA 3A3DA 4JGPA 3EQVA 2J9OA 5A92A 5HWWA 2Y2HA 2L0WA 5J4EA 4K0XA 1D7EA 1DP9A 2WKQA 3VV4A 4DMZA 5EV0A 1XJ3A 4RQ9A 4IBXA 4BL3A 1MWUA 4OP8A 4OONA 5F82A 2ZMFA 3EGDC 3F1OA 3SH8A 3W4QA 1GHMA 2V0WA 4GS9A 4MCWA 2IWCA 3PTEA 5I5LA 5CERA 2ZQ9A 1H8MA 1KGFA 2OV5A 1ONGA 1XX2A 4DN0A 3CMZA 5E2HA 4O0PA 4FCFA 1KVLA 2JN7A 2X02A 3IHAA 5DFXA 2QMIA 1BLSA 3KSIA 3KYEA 5A93A 1LT0A 2W3GA 3ZHHA 4LV3A 4WZ5A 2H5SA 1PI5A 3T1SA 3OPPA 1SKOB 4G3WA 2ZC6B 3TW8A 1U60A 2O9AA 5CGXA 1K4FA 2HP6A 1N9OA 3ULFA 3GECA 1SHVA 1GSWA 4O7DA 3GVBA 5GL9A 3N8SA 3VP2A 1O7EA 4DJ2A 3C8CA 4B9OA 1L0DA 2L4RA 3FKWA 3P01A 4DDYA 1K6SA 2ZL1B 3W4PA 5GLBA 3MQQA 3ZG0A 3G31A 3C7VA 4F3LB 1ALQA 2E8JA 3DTMA 2DCFA 2IWDA 1N9NA 3MSHA 2GNXA 4I3AA 1FQGA 3ZVWA 4PKYA 2ZBBA 2HP9A 3M6HA 4KQRA 4GDNA 3VP0A 2WGVA 2PT7A 2I72A 3PBRA 3LI9A 2Y2MA 2C6WB 3NDEA 3E2LA 4NKPA 2VEAA 2FFFB 5M19A 3ZYTA 1NZUA 2M7VA 4S2OA 1NLYA 1CEGA 4S2NC 1PI4A 3A3FA 4PKYG 4JPMA 4JF5A 4EQ1A 1PWDA 1W8QA 1ODVA 3HLDA 4KG5A 4HJ6A 3VOLA 5HPFA 1T18A 1H8YA 5GHYA 5TBMB 1G6AA 4ZBEA 1CEFA 4FTXA 1K0KA 1TS7A 1TVFA 4B4ZA 4PM9A 5HFOA 1WYCA 3JPUA 5CRFA 4RX2A 2VLGA 3EWKA 4YNRA 3MS6A 4S2JA 3C5AA 4OOMA 3V3RA 1FCNA 3S7QA 4HNBA 4HQAA 4PM8A 3R4KA 3EEHA 3K3CA 5DVAA 3VP4A 3CJMA 4E3KA 1QMEA 4OPQA 3Q7ZA 3HCYA 2DMWA 4EERA 1ES2A 5DF9A 1LHYA 4CJNA 2WGIA 1S66L 1Y4OA 1XJ4A 3IWIA 1MXOA 5J8XA 4N1XA 4JXSA 4WELA 5DKLA 3GRJA 3U2AA 4K91A 1NXYA 4CLCA 2OSUA 4X55A 4FOFA 3S22A 1IYSA 4HIAA 1VEUA 1NZOA 2ZM0A 1PWGA 3IH8A 1OTDA 5A90A 4RA7A 5FQ9A 1KGGA 4YWZA 3S7NA 5CEDA 3C2WA 4JKTA 3LIFA 5DFYA 1OPXA 2Y91A 1YLZA 4HEFA 1V9ZA 1Q2PA 3H7WA 5CXWA 2XF3A 2JKTM 3FPWA 2Y2OA 3CUEA 1M40A 4L9FA 4MNRA 2NUPC 4IUHA 4ARZB 4FD8A 1K55A 1E3UD 2O99A 3NOTC 1RGZA 3LEQA 5IS1A 5CGWA 1NYMA 1ZG6A 2XDMA 3S7OA 1ZHHB 2FFYA 4DE0A 3ZNTA 5HL6A 4DXCA 2WGWB 4Z1WA 5L09A 4IVIA 1PZPA 4EBPA 1S4RA 3LO7A 2HPBA 2B5RA 4ZTKA 3F1PB 3GV9A 4C3QA 1Y28A 4KZ4A 4X6TA 4EUVA 4U0TA 4Y3IA 5E2GA 2QPNA 3T4SA 3OPRA 3O88A 1TEMA 3HUMA 4S2LA 1IYPA 1SKFA 4HJ4A 5E2EA 4WMCA 5KSCA 4D2OA 2ACGA 2QHKA 3W2ZA 1XPBA 4N1HA 3O3VA 5FQMA 4EEUA 5EVLA 4R3JA 4KZ7A 3C30A 3G2YA 3SS5A 2PHYA 5FSRA 1HLUP 4DE1A 1S4SA 4KUKA 2Q0OA 3MZEA 5LBRA 5DJUA 5G18A 3KSGA 4L9GA 3IBJA 2L1MA 5J7EA 1X0OA 2Q9MA 5F5YA 3K2NA 4LV0A 4PAUA 4S2IA 1LI0A 1JNUA 3IWQA 3HLFA 4PHTA 1GA0A 1ZC2A 2H0TA 2Y2IA 3QP1A 4UAAA 2JCHA 2DNSA 4UQIM 4MBHA 3BQAA 1K4EA 4KUOA 3DTEA 3E98A 1L0EA 5HAQA 4R0QA 4I39A 5HW3A 5FEGA 3GTCA 3HREA 1DJCA 1DRMA 3NOPC 3CHWP 1PW8A 2EFXA 3ZG5A 3LR5A 3QP6A 3CLOA 3Q7VB 5A8BA 2A2LA 3WS2A 2D01A 5EVIB 2GDNA 1WA9A 2I9VA 4JXGA 1LL8A 2BLSA 3RXXA 5FQQA 3ITAA 3CG5A 3BRMA 2ZL1A 1SZVA 4GZBA 3NC8A 1OTEA 3D9YA 3OCNA 3UE1A 2W3HA 1DY6A 4F3LA 4HP9A 3MXQA 1Z6FA 2QKPA 3W8KA 3FV7A 2G2UA 1BYWA 4JBFA 1YT4A 5F69A 3UB5P 2YKHA 4RYEA 1VM1A 2WKEA 4CLCD 2V8FA 1BSGA 1S6RA 3O86A 3T1QB 4CLCE 1OJGA 4NG2A 1JWPA 2QJ5A 2EX2A 2PU4A 4ID4A 3FWLA 4ME4A 4GCZA 1YQSA 3MZFA 5F1GA 3LIEA 5DF8A 4L9EA 5CTNA 4UQIS 1YSQA 2JKGA 4Y15A 2K7SA 4QU3A 3IF6C 2JKRM 3A3EA 1YPRA 2R9XA 2YKFA 3SH9A 3DW0A 1LSXA 4MBKA 4N9LA 5FASA 3N7WA 5EPHA 1VHMA 5IT5A 4AFIA 1PFLA 3SOIA 2BG1A 4X53A 5HX9A 3HUOA 3N8RA 4IJGA 5HAPA 1KOUA 3EEAA 3N8LA 2J3TD 3PBOA 1H0MA 4IVKA 3WRZA 3Q1FA 3UE0A 4O8GA 5D3OA 3UMDA 1L3LA 4Q8IA 2PYRA 4WLAA 3V5MA 3AGFA 1MC0A 3TE8A 1W63M 2PAVP 4GW9A 1NRFA 2XLNA 4LV1A 4OVDA 3V39A 1W79A 5FDHA 3KSFA 1EW0A 4A5RA 4K08A 4PM6A 3BM6A 3B42A 3UO9A 2WKHA 3PBQA 4QY6A 1CF0A 4WMCD 5AQBA 2HF6A 1Z09A 1KVMA 5HL1A 4P87A 2PDRA 3S7PA 1BLPA 2Y59A 4MMNA 3NIAA 4R38A 2GX5A 2INWA 3H9WA 1CK3A 3A3IA 1M6KA 2XFTA 3MFXA 4MDZA 2PYPA 3CITA 4JXVA 1FIKA 3P98A 1F98A 3JVVA 1HZOA 4P6ZS 4OOYA 3QP8A 1H8ZA 4WN5A 2VV8A 2PR6A 4N92A 4ARZA 1ONHA 4KQQA 1SDNA 1T1BA 2DRWA 3E2KA 2W1TB 2W3DA 2X01A 3T1XA 3PBSA 2WZZA 1RGYA 4NXEA 3BFEA 1XP4A 3WS4A 3BQ8A 1CJFA 4E3NA 3ZVTA 2WGWA 1F5MA 4P0MA 1MWTA 1AWIA 1KDWA 5DJTA 3D3OA 1BZAA 3GR2A 1E4DA 1ZG4A 1E3UA 3H82A 4GDBA 1CI9A 2VGJA 2WAFA 2WKIA 5CHUA 1HD8A 2R9WA 3BWLA 2NUTC 5EM1A 1K54C 1LI9A 1DP6A 4R23A 1E25A 3KSHA 1J3WA 3VOYA 1AXBA 3WS1A 4EW7A 3LIDA 4JF6A 2EFUA 3VE4A 4E3LA 3EGXC 4KZAA 1D1JA 5FDSA 4OP5A 2ZQDA 3IS2B 4RX3A 3TOIA 2UV0E 1P97A 1PNEA 4H6JB 4BQMA 4F94A 3A0VA 3VP1A 1N4OA 5HD3A 2O9BA 3B3XA 2XQZA
chains in the Genus database with same CATH topology
3NDGA 1Q2PA 3TSGA 1WYBA 5CXWA 4KZ3A 2XF3A 1YMXA 1JVJA 2G2WA 3HLBA 3IXGA 4UHUA 1ES3A 2Y2OA 3FKVA 3OPHA 1M40A 1IKIA 3ZG8B 4MNRA 4OH0A 3V3SA 3VP3A 3WWXA 3ITBA 4QJGA 5FA7A 4FD8A 4RVAA 1K55A 4OQGA 1E3UD 4E6WA 3FYZA 4ZAMA 2V1ZA 1G68A 2ZQ8A 1RGZA 4BD0A 2Y2JA 1BLCA 1ES4A 4XUXA 1KE0A 4KZ6A 3VFHA 5CGWA 5CTMA 1K38A 1HVBA 1TDGA 3QNCA 1NYMA 1ZG6A 1KE3A 2XDMA 3OZHA 4ZJ3A 4S2NA 3Q7VA 1FCMA 4R4RA 4HESA 4N9KA 1KDSA 1PW1A 3IF6B 1ZKJA 4QD4A 4WM9A 1PYYA 2FFYA 3MFDA 4DE0A 1NY0A 2ZQCA 3ZNTA 4S2KA 4EBLA 4EV4A 4Y0TA 4GN2A 3UPOA 1FSYA 3UY6A 3GMWA 4DXCA 1W7FA 4PPRA 2WGWB 4ZJ1A 4KZ5A 2XGNA 1XXMA 2XD1A 4IVIA 5EVIC 1PZPA 1JWZA 1NYYA 3M2JA 5M1AA 4BD1A 2X71A 2OLUA 4EBPA 2XK1A 4KZBA 3LO7A 4UA6A 4KG6A 5AQ9A 2HPBA 5FQIA 3ZNYA 2B5RA 1GHIA 1BLHA 1TDLA 4ZTKA 5AQAA 3MKEA 3MBZA 5FQJA 3N4IA 3UN7A 3GV9A 3G4PA 4C3QA 3FZCA 4GB7A 4KZ4A 4OPYA 4X6TA 4OOLA 3DWZA 4U0TA 3BFCA 2XFSA 5E2GA 3D4FA 1K54A 4M3KA 2QPNA 3HVFA 1JTGA 4OPZA 4C75A 1ESIA 4DE2A 1CI8A 5TFQA 3OPRA 1PIOA 3O88A 2ZM8A 1JTDA 5CHMA 4PM5A 1TEMA 3HUMA 1DJBA 4S2LA 1IYPA 3EQUA 3WS5A 1SKFA 1K56A 2EX6A 5E2EA 5EUAA 4WMCA 3C4OA 3IXDA 4LCLA 4IBRA 4R3BA 4D2OA 5KSCA 1OMEA 1XPBA 2EXAA 2WYXA 2HDSA 4N1HA 3O3VA 1GHPA 5CEBA 2WK0A 5FQMA 3BLSA 5EVLA 2A3UA 1HTZA 3AGEA 3HLEA 3LY4A 2ZM2A 3VSKA 4R3JA 4KZ7A 2OLVA 3G2YA 4U0XA 5GHZA 4E3JA 3SS5A 2WADA 5FSRA 3C7UA 3DWKA 2ZC7A 1Q2QA 4DE1A 4LENA 1FCOA 5KMWA 4DE3A 3MZEA 2IWBA 3ZCZA 4DXBA 1LL5A 3IF5A 5JYOA 2Y2LA 5G18A 5GLAA 4WZ5C 3BFGA 3IT9A 2Y4AA 3UDXA 2P9VA 2Q9MA 1MPLA 1LLBA 4FSFA 4LV0A 3TG9A 2WAEA 1KGEA 4BL2A 4S2IA 1LI0A 3W4OA 4QHCA 3IWQA 5AQ7A 1K57C 3HLFA 4YINA 4WYYA 3LEZA 1GA0A 1ZC2A 2Y2KA 5E43A 2H0TA 1YMSA 3G30A 2Y2IA 1EWZA 3GQZA 4R1GA 4E3MA 4UAAA 2JCHA 4EWFA 2DNSA 4GNUA 4MBHA 2V2FF 1PZOA 4UA7A 1K4EA 1H5XA 1BT5A 1MKIA 3ZGAB 5FI6A 1L0EA 3HBRA 4PMAA 5FAQA 4R0QA 2Z2LB 5HAQA 1SCWA 1PWCA 5HW3A 2ZD8A 3GTCA 2Y55A 3HREA 1EI5A 4PM7A 4WBGA 1JWVA 1DJCA 4Y0UA 2HDQA 1PW8A 2EFXA 3Q07A 3IH9A 4HBUA 3ZG5A 3UNWA 2J9PA 2QZ6A 3LY3A 1L2SA 3Q7VB 4DKIA 3WS2A 2PU2A 5EVIB 5FAPA 4KZ8A 2GDNA 1ES5A 2RCXA 4JXWA 4X56A 3NCKA 3RXWA 2EX8A 1QMFA 3G32A 4JXGA 1XKZA 2BLSA 4FH4A 3RXXA 5FQQA 2JE5A 3G2ZA 5EOEA 1IEMA 3BFFA 3ITAA 3CG5A 3BRMA 4GZBA 5CHJA 3NC8A 3MKFA 3S1YA 2XR0A 5CGSA 4MBFA 5KSHA 2XD5A 3PAEA 5EVIA 3VFFA 4HBTA 1XA7A 3OCNA 2XH9A 3UE1A 4NK3A 1DY6A 3A3DA 3EQVA 2J9OA 4OLDA 1Z6FA 4R4SA 5A92A 2Y2HA 3W8KA 3FV7A 1YLJA 2G2UA 2XEPA 4CPKA 4BENA 4JBFA 1YT4A 4GD6A 4K0XA 2E8IA 3PAGA 1IYQA 4WEKA 3GSGA 4Y7PA 4RYEA 4IBXA 1VM1A 2WKEA 4FH2A 4BL3A 4OKPA 3UDFA 1BSGA 1MWUA 4OP8A 1S6RA 2Y91A 3O86A 5GLCA 2JBFA 4OONA 1IYOA 5F82A 3SH8A 4H8RA 3W4QA 1JWPA 1GHMA 4QY5A 2EX2A 1I2WA 4XUZA 4E6XA 4XXRA 2IWCA 2PU4A 3WS0A 3PTEA 3FWLA 4ID4A 1NJ4A 5CERA 2ZQ9A 1KGFA 1YQSA 5FQKA 2WUQA 1L0GA 1FOFA 3MZFA 2OV5A 3HUNA 1ONGA 1XX2A 2C5WB 5F1GA 3VOZA 3CMZA 3BYDA 5DF8A 1DJAA 2ZC4B 3I7JA 4LV2A 5CTNA 1GCEA 5E2HA 4FCFA 1YLPA 1KVLA 2JC7A 4OQ0A 4QU3A 3IF6C 3A3EA 2X02A 3V50A 3IHAA 2R9XA 3SH9A 3BEBA 1XGIA 2QMIA 3OPLA 1BLSA 3DW0A 5A93A 3OC2A 2P9VB 4EBNA 4MBKA 4N9LA 3ZHHA 5FASA 3N7WA 4LV3A 3BECA 5EPHA 4WZ5A 2H5SA 1PI5A 3SOIA 3BFDA 2Y2NA 5FI2A 3OPPA 3SH7A 2BG1A 1MY8A 3NI9A 4X53A 5HX9A 2Y2QA 2ZC6B 3HUOA 3N8RA 3ZDJA 3ISGA 1K57A 3NBLA 4P85A 4EQIA 2Y2GA 1U60A 5HAPA 1RCJA 4JF4A 3N8LA 4QB8A 3IHBA 3BLMA 2VGKA 5CGXA 3LCEA 5EVID 3G34A 2WZXA 1K4FA 2HP6A 3PBOA 4IVKA 3WRZA 3Q1FA 3UE0A 5D3OA 4L0LA 1SHVA 1C3BA 4O7DA 3GVBA 4DRTA 4Q8IA 4X69A 5GL9A 3S4XA 4MLLA 5DTKA 4DF6A 3N8SA 1IKGA 4S2PA 5U47A 1K25A 1GA9A 3AGFA 1O7EA 3P09A 3V5MA 3VP2A 1J9MA 1N9BA 3IXHA 3PBTA 4IEDA 1NRFA 1L0DA 2XLNA 4LV1A 4OVDA 4P6BA 3V39A 3AGDA 1W79A 2HDRA 3FKWA 4GKUA 5FDHA 4DDYA 1K6SA 4A5RA 5I94A 4MEZA 1MWRA 3W4PA 1YLWA 4NETA 4PM6A 3BM6A 1MBLA 4JLFA 5GLBA 1ERQA 1XGJA 3UO9A 2WKHA 4UA9A 5TGFA 3ZG0A 3G31A 3C7VA 2Z2MB 5FATA 3ZG7B 3PBQA 1ALQA 1I2SA 1K56D 4QY6A 3DTMA 3HLGA 4WMCD 2DCFA 5AQBA 1BTLA 3JYIA 5DTSA 1KVMA 3C4PA 2IWDA 5HL1A 4P87A 5E2FA 5CECA 2ZMAA 1FR1A 1BLPA 2Y59A 3UPPA 1FQGA 3NIAA 3HL9A 3ZVWA 5HARA 2HP9A 3O87A 4Y0OA 4E3IA 3M6HA 3QNBA 1O07A 1CK3A 3A3IA 1M6KA 2XFTA 4GDNA 4KQRA 3VP0A 3UE3A 2WGVA 5DTTA 2I72A 3G35A 1Y54A 1YLTA 4JXVA 5HAIA 4GOGA 3PBRA 3P98A 3ZFZA 1MWSA 1YLYA 2Y2MA 1HZOA 3Q81A 4B88A 4OOYA 1H8ZA 1K55C 2C6WB 3NDEA 4Z9QA 5FAOA 4N92A 3E2LA 5F83A 1IELA 5IHVA 1ONHA 4KQQA 1XA1A 4DDSA 1SDNA 2FFFB 2DRWA 5M19A 3E2KA 1FR6A 4OLGA 4KQOA 1NZUA 3MXRA 3VMAA 2UWXA 4S2OA 1FSWA 3UPNA 1CEGA 4S2NC 3MZDA 1ESUA 2ZJ9A 1YM1A 1PI4A 3A3FA 5EE8A 2X01A 4X68A 3PBSA 4JPMA 2WZZA 1RGYA 4JF5A 1PWDA 2Q9NA 1W8QA 3HLDA 4KG5A 3BFEA 1EROA 3IF6A 1XP4A 4WZ4A 5FI7A 4U3TA 3WS4A 5EECA 3RJUA 1H8YA 4E3NA 3ZVTA 4KENB 2WGWA 3IQAA 2V20A 5A91A 4P0MA 1MWTA 5GHYA 4YFMA 1G6AA 3IXBA 4OQHA 4ZBEA 2J7VA 3SS3A 1CEFA 1KDWA 1I5QA 5EOOA 1TVFA 1BZAA 4PM9A 5HFOA 4B4ZA 1WYCA 3CZDA 1LL9A 5GHXA 4B4XA 3GR2A 5CRFA 4RX2A 1E4DA 1W5DA 1ZG4A 4OQIA 2RL3A 1BUEA 1E3UA 4GDBA 4OPRA 1CI9A 1KE4A 2VGJA 3M2KA 4BLMA 4EUZA 2WAFA 3N6IA 2WKIA 2Y2PA 5CHUA 5L2FA 1ERMA 1HD8A 4S2JA 2R9WA 3C5AA 4OOMA 3V3RA 1FCNA 1K54C 1VQQA 2HDUA 2EX9A 2HP5A 2A49A 1LI9A 4PM8A 2P74A 4R23A 4KG2A 5DVAA 4KZ9A 3VP4A 1E25A 3QHYA 3CJMA 4GD8A 2ZC3B 4E3KA 1QMEA 3MXSA 3Q7ZA 4OPQA 4K0WA 5DF7A 1WE4A 3VOYA 1ES2A 5DF9A 1LHYA 2PBYA 4CJNA 1AXBA 3PBNA 3HLCA 2WGIA 3WS1A 1BULA 2ZC5B 3IWIA 2EXBA 4JF6A 1MXOA 2EFUA 4ZJ2A 5GLDA 5J8XA 2ZQAA 4N1XA 2CC1A 5F1FA 4E3LA 4JXSA 4LCMA 3VSLA 4KZAA 1S0WA 3NY4A 4WELA 3GRJA 3WRTA 4K91A 1NXYA 2H10A 2OSUA 4X55A 4E3OA 4OP5A 2ZQDA 5M18A 2J8YA 3S22A 1IYSA 4RX3A 3M6BA 4BJPA 3A3JA 4S2MA 3TOIA 3HLWA 1NZOA 3OCLA 5BOHA 1SDEA 3Q82A 2ZM0A 1PWGA 3IH8A 5A90A 2ZQ7A 3IWOA 1W8YA 4BQMA 4F94A 5KZHA 3VP1A 4C6YA 2H0YA 1RP5A 4RA7A 1L0FA 1N4OA 1K6RA 5FQ9A 3UDIA 1KGGA 5CEDA 5TR7A 2ZLYA 3SS4A 4JKTA 5JYPA 3ZG9B 4ZDXA 3B3XA 1YLZA 4HEFA 2XQZA 4WEJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NDG A;  1Q2P A;  3TSG A;  1WYB A;  5CXW A;  4KZ3 A;  2XF3 A;  1YMX A;  1JVJ A;  2G2W A;  3HLB A;  3IXG A;  4UHU A;  1ES3 A;  2Y2O A;  3FKV A;  3OPH A;  1M40 A;  1IKI A;  3ZG8 B;  4MNR A;  4OH0 A;  3V3S A;  3VP3 A;  3WWX A;  3ITB A;  4QJG A;  5FA7 A;  4FD8 A;  4RVA A;  1K55 A;  4OQG A;  1E3U D;  4E6W A;  3FYZ A;  4ZAM A;  2V1Z A;  1G68 A;  2ZQ8 A;  1RGZ A;  4BD0 A;  2Y2J A;  1BLC A;  1ES4 A;  4XUX A;  1KE0 A;  4KZ6 A;  3VFH A;  5CGW A;  5CTM A;  1K38 A;  1HVB A;  1TDG A;  3QNC A;  1NYM A;  1ZG6 A;  1KE3 A;  2XDM A;  3OZH A;  4ZJ3 A;  4S2N A;  3Q7V A;  1FCM A;  4R4R A;  4HES A;  4N9K A;  1KDS A;  1PW1 A;  3IF6 B;  1ZKJ A;  4QD4 A;  4WM9 A;  1PYY A;  2FFY A;  3MFD A;  4DE0 A;  1NY0 A;  2ZQC A;  3ZNT A;  4S2K A;  4EBL A;  4EV4 A;  4Y0T A;  4GN2 A;  3UPO A;  1FSY A;  3UY6 A;  3GMW A;  4DXC A;  1W7F A;  4PPR A;  2WGW B;  4ZJ1 A;  4KZ5 A;  2XGN A;  1XXM A;  2XD1 A;  4IVI A;  5EVI C;  1PZP A;  1JWZ A;  1NYY A;  3M2J A;  5M1A A;  4BD1 A;  2X71 A;  2OLU A;  4EBP A;  2XK1 A;  4KZB A;  3LO7 A;  4UA6 A;  4KG6 A;  5AQ9 A;  2HPB A;  5FQI A;  3ZNY A;  2B5R A;  1GHI A;  1BLH A;  1TDL A;  4ZTK A;  5AQA A;  3MKE A;  3MBZ A;  5FQJ A;  3N4I A;  3UN7 A;  3GV9 A;  3G4P A;  4C3Q A;  3FZC A;  4GB7 A;  4KZ4 A;  4OPY A;  4X6T A;  4OOL A;  3DWZ A;  4U0T A;  3BFC A;  2XFS A;  5E2G A;  3D4F A;  1K54 A;  4M3K A;  2QPN A;  3HVF A;  1JTG A;  4OPZ A;  4C75 A;  1ESI A;  4DE2 A;  1CI8 A;  5TFQ A;  3OPR A;  1PIO A;  3O88 A;  2ZM8 A;  1JTD A;  5CHM A;  4PM5 A;  1TEM A;  3HUM A;  1DJB A;  4S2L A;  1IYP A;  3EQU A;  3WS5 A;  1SKF A;  1K56 A;  2EX6 A;  5E2E A;  5EUA A;  4WMC A;  3C4O A;  3IXD A;  4LCL A;  4IBR A;  4R3B A;  4D2O A;  5KSC A;  1OME A;  1XPB A;  2EXA A;  2WYX A;  2HDS A;  4N1H A;  3O3V A;  1GHP A;  5CEB A;  2WK0 A;  5FQM A;  3BLS A;  5EVL A;  2A3U A;  1HTZ A;  3AGE A;  3HLE A;  3LY4 A;  2ZM2 A;  3VSK A;  4R3J A;  4KZ7 A;  2OLV A;  3G2Y A;  4U0X A;  5GHZ A;  4E3J A;  3SS5 A;  2WAD A;  5FSR A;  3C7U A;  3DWK A;  2ZC7 A;  1Q2Q A;  4DE1 A;  4LEN A;  1FCO A;  5KMW A;  4DE3 A;  3MZE A;  2IWB A;  3ZCZ A;  4DXB A;  1LL5 A;  3IF5 A;  5JYO A;  2Y2L A;  5G18 A;  5GLA A;  4WZ5 C;  3BFG A;  3IT9 A;  2Y4A A;  3UDX A;  2P9V A;  2Q9M A;  1MPL A;  1LLB A;  4FSF A;  4LV0 A;  3TG9 A;  2WAE A;  1KGE A;  4BL2 A;  4S2I A;  1LI0 A;  3W4O A;  4QHC A;  3IWQ A;  5AQ7 A;  1K57 C;  3HLF A;  4YIN A;  4WYY A;  3LEZ A;  1GA0 A;  1ZC2 A;  2Y2K A;  5E43 A;  2H0T A;  1YMS A;  3G30 A;  2Y2I A;  1EWZ A;  3GQZ A;  4R1G A;  4E3M A;  4UAA A;  2JCH A;  4EWF A;  2DNS A;  4GNU A;  4MBH A;  2V2F F;  1PZO A;  4UA7 A;  1K4E A;  1H5X A;  1BT5 A;  1MKI A;  3ZGA B;  5FI6 A;  1L0E A;  3HBR A;  4PMA A;  5FAQ A;  4R0Q A;  2Z2L B;  5HAQ A;  1SCW A;  1PWC A;  5HW3 A;  2ZD8 A;  3GTC A;  2Y55 A;  3HRE A;  1EI5 A;  4PM7 A;  4WBG A;  1JWV A;  1DJC A;  4Y0U A;  2HDQ A;  1PW8 A;  2EFX A;  3Q07 A;  3IH9 A;  4HBU A;  3ZG5 A;  3UNW A;  2J9P A;  2QZ6 A;  3LY3 A;  1L2S A;  3Q7V B;  4DKI A;  3WS2 A;  2PU2 A;  5EVI B;  5FAP A;  4KZ8 A;  2GDN A;  1ES5 A;  2RCX A;  4JXW A;  4X56 A;  3NCK A;  3RXW A;  2EX8 A;  1QMF A;  3G32 A;  4JXG A;  1XKZ A;  2BLS A;  4FH4 A;  3RXX A;  5FQQ A;  2JE5 A;  3G2Z A;  5EOE A;  1IEM A;  3BFF A;  3ITA A;  3CG5 A;  3BRM A;  4GZB A;  5CHJ A;  3NC8 A;  3MKF A;  3S1Y A;  2XR0 A;  5CGS A;  4MBF A;  5KSH A;  2XD5 A;  3PAE A;  5EVI A;  3VFF A;  4HBT A;  1XA7 A;  3OCN A;  2XH9 A;  3UE1 A;  4NK3 A;  1DY6 A;  3A3D A;  3EQV A;  2J9O A;  4OLD A;  1Z6F A;  4R4S A;  5A92 A;  2Y2H A;  3W8K A;  3FV7 A;  1YLJ A;  2G2U A;  2XEP A;  4CPK A;  4BEN A;  4JBF A;  1YT4 A;  4GD6 A;  4K0X A;  2E8I A;  3PAG A;  1IYQ A;  4WEK A;  3GSG A;  4Y7P A;  4RYE A;  4IBX A;  1VM1 A;  2WKE A;  4FH2 A;  4BL3 A;  4OKP A;  3UDF A;  1BSG A;  1MWU A;  4OP8 A;  1S6R A;  2Y91 A;  3O86 A;  5GLC A;  2JBF A;  4OON A;  1IYO A;  5F82 A;  3SH8 A;  4H8R A;  3W4Q A;  1JWP A;  1GHM A;  4QY5 A;  2EX2 A;  1I2W A;  4XUZ A;  4E6X A;  4XXR A;  2IWC A;  2PU4 A;  3WS0 A;  3PTE A;  3FWL A;  4ID4 A;  1NJ4 A;  5CER A;  2ZQ9 A;  1KGF A;  1YQS A;  5FQK A;  2WUQ A;  1L0G A;  1FOF A;  3MZF A;  2OV5 A;  3HUN A;  1ONG A;  1XX2 A;  2C5W B;  5F1G A;  3VOZ A;  3CMZ A;  3BYD A;  5DF8 A;  1DJA A;  2ZC4 B;  3I7J A;  4LV2 A;  5CTN A;  1GCE A;  5E2H A;  4FCF A;  1YLP A;  1KVL A;  2JC7 A;  4OQ0 A;  4QU3 A;  3IF6 C;  3A3E A;  2X02 A;  3V50 A;  3IHA A;  2R9X A;  3SH9 A;  3BEB A;  1XGI A;  2QMI A;  3OPL A;  1BLS A;  3DW0 A;  5A93 A;  3OC2 A;  2P9V B;  4EBN A;  4MBK A;  4N9L A;  3ZHH A;  5FAS A;  3N7W A;  4LV3 A;  3BEC A;  5EPH A;  4WZ5 A;  2H5S A;  1PI5 A;  3SOI A;  3BFD A;  2Y2N A;  5FI2 A;  3OPP A;  3SH7 A;  2BG1 A;  1MY8 A;  3NI9 A;  4X53 A;  5HX9 A;  2Y2Q A;  2ZC6 B;  3HUO A;  3N8R A;  3ZDJ A;  3ISG A;  1K57 A;  3NBL A;  4P85 A;  4EQI A;  2Y2G A;  1U60 A;  5HAP A;  1RCJ A;  4JF4 A;  3N8L A;  4QB8 A;  3IHB A;  3BLM A;  2VGK A;  5CGX A;  3LCE A;  5EVI D;  3G34 A;  2WZX A;  1K4F A;  2HP6 A;  3PBO A;  4IVK A;  3WRZ A;  3Q1F A;  3UE0 A;  5D3O A;  4L0L A;  1SHV A;  1C3B A;  4O7D A;  3GVB A;  4DRT A;  4Q8I A;  4X69 A;  5GL9 A;  3S4X A;  4MLL A;  5DTK A;  4DF6 A;  3N8S A;  1IKG A;  4S2P A;  5U47 A;  1K25 A;  1GA9 A;  3AGF A;  1O7E A;  3P09 A;  3V5M A;  3VP2 A;  1J9M A;  1N9B A;  3IXH A;  3PBT A;  4IED A;  1NRF A;  1L0D A;  2XLN A;  4LV1 A;  4OVD A;  4P6B A;  3V39 A;  3AGD A;  1W79 A;  2HDR A;  3FKW A;  4GKU A;  5FDH A;  4DDY A;  1K6S A;  4A5R A;  5I94 A;  4MEZ A;  1MWR A;  3W4P A;  1YLW A;  4NET A;  4PM6 A;  3BM6 A;  1MBL A;  4JLF A;  5GLB A;  1ERQ A;  1XGJ A;  3UO9 A;  2WKH A;  4UA9 A;  5TGF A;  3ZG0 A;  3G31 A;  3C7V A;  2Z2M B;  5FAT A;  3ZG7 B;  3PBQ A;  1ALQ A;  1I2S A;  1K56 D;  4QY6 A;  3DTM A;  3HLG A;  4WMC D;  2DCF A;  5AQB A;  1BTL A;  3JYI A;  5DTS A;  1KVM A;  3C4P A;  2IWD A;  5HL1 A;  4P87 A;  5E2F A;  5CEC A;  2ZMA A;  1FR1 A;  1BLP A;  2Y59 A;  3UPP A;  1FQG A;  3NIA A;  3HL9 A;  3ZVW A;  5HAR A;  2HP9 A;  3O87 A;  4Y0O A;  4E3I A;  3M6H A;  3QNB A;  1O07 A;  1CK3 A;  3A3I A;  1M6K A;  2XFT A;  4GDN A;  4KQR A;  3VP0 A;  3UE3 A;  2WGV A;  5DTT A;  2I72 A;  3G35 A;  1Y54 A;  1YLT A;  4JXV A;  5HAI A;  4GOG A;  3PBR A;  3P98 A;  3ZFZ A;  1MWS A;  1YLY A;  2Y2M A;  1HZO A;  3Q81 A;  4B88 A;  4OOY A;  1H8Z A;  1K55 C;  2C6W B;  3NDE A;  4Z9Q A;  5FAO A;  4N92 A;  3E2L A;  5F83 A;  1IEL A;  5IHV A;  1ONH A;  4KQQ A;  1XA1 A;  4DDS A;  1SDN A;  2FFF B;  2DRW A;  5M19 A;  3E2K A;  1FR6 A;  4OLG A;  4KQO A;  1NZU A;  3MXR A;  3VMA A;  2UWX A;  4S2O A;  1FSW A;  3UPN A;  1CEG A;  4S2N C;  3MZD A;  1ESU A;  2ZJ9 A;  1YM1 A;  1PI4 A;  3A3F A;  5EE8 A;  2X01 A;  4X68 A;  3PBS A;  4JPM A;  2WZZ A;  1RGY A;  4JF5 A;  1PWD A;  2Q9N A;  1W8Q A;  3HLD A;  4KG5 A;  3BFE A;  1ERO A;  3IF6 A;  1XP4 A;  4WZ4 A;  5FI7 A;  4U3T A;  3WS4 A;  5EEC A;  3RJU A;  1H8Y A;  4E3N A;  3ZVT A;  4KEN B;  2WGW A;  3IQA A;  2V20 A;  5A91 A;  4P0M A;  1MWT A;  5GHY A;  4YFM A;  1G6A A;  3IXB A;  4OQH A;  4ZBE A;  2J7V A;  3SS3 A;  1CEF A;  1KDW A;  1I5Q A;  5EOO A;  1TVF A;  1BZA A;  4PM9 A;  5HFO A;  4B4Z A;  1WYC A;  3CZD A;  1LL9 A;  5GHX A;  4B4X A;  3GR2 A;  5CRF A;  4RX2 A;  1E4D A;  1W5D A;  1ZG4 A;  4OQI A;  2RL3 A;  1BUE A;  1E3U A;  4GDB A;  4OPR A;  1CI9 A;  1KE4 A;  2VGJ A;  3M2K A;  4BLM A;  4EUZ A;  2WAF A;  3N6I A;  2WKI A;  2Y2P A;  5CHU A;  5L2F A;  1ERM A;  1HD8 A;  4S2J A;  2R9W A;  3C5A A;  4OOM A;  3V3R A;  1FCN A;  1K54 C;  1VQQ A;  2HDU A;  2EX9 A;  2HP5 A;  2A49 A;  1LI9 A;  4PM8 A;  2P74 A;  4R23 A;  4KG2 A;  5DVA A;  4KZ9 A;  3VP4 A;  1E25 A;  3QHY A;  3CJM A;  4GD8 A;  2ZC3 B;  4E3K A;  1QME A;  3MXS A;  3Q7Z A;  4OPQ A;  4K0W A;  5DF7 A;  1WE4 A;  3VOY A;  1ES2 A;  5DF9 A;  1LHY A;  2PBY A;  4CJN A;  1AXB A;  3PBN A;  3HLC A;  2WGI A;  3WS1 A;  1BUL A;  2ZC5 B;  3IWI A;  2EXB A;  4JF6 A;  1MXO A;  2EFU A;  4ZJ2 A;  5GLD A;  5J8X A;  2ZQA A;  4N1X A;  2CC1 A;  5F1F A;  4E3L A;  4JXS A;  4LCM A;  3VSL A;  4KZA A;  1S0W A;  3NY4 A;  4WEL A;  3GRJ A;  3WRT A;  4K91 A;  1NXY A;  2H10 A;  2OSU A;  4X55 A;  4E3O A;  4OP5 A;  2ZQD A;  5M18 A;  2J8Y A;  3S22 A;  1IYS A;  4RX3 A;  3M6B A;  4BJP A;  3A3J A;  4S2M A;  3TOI A;  3HLW A;  1NZO A;  3OCL A;  5BOH A;  1SDE A;  3Q82 A;  2ZM0 A;  1PWG A;  3IH8 A;  5A90 A;  2ZQ7 A;  3IWO A;  1W8Y A;  4BQM A;  4F94 A;  5KZH A;  3VP1 A;  4C6Y A;  2H0Y A;  1RP5 A;  4RA7 A;  1L0F A;  1N4O A;  1K6R A;  5FQ9 A;  3UDI A;  1KGG A;  5CED A;  5TR7 A;  2ZLY A;  3SS4 A;  4JKT A;  5JYP A;  3ZG9 B;  4ZDX A;  3B3X A;  1YLZ A;  4HEF A;  2XQZ A;  4WEJ A; 
#chains in the Genus database with same CATH topology
 3NDG A;  2B95 A;  1WYB A;  4R6L A;  3IXG A;  4UHU A;  2KLI A;  3VP3 A;  4GHI B;  3WWX A;  3B33 A;  3UB7 A;  3ITB A;  2R78 A;  3IBR A;  3LR0 A;  4QJG A;  2XRO A;  4RVA A;  4ETX A;  3FYZ A;  2V1Z A;  4M4X A;  1S67 L;  1G68 A;  1NWZ A;  4BD0 A;  1BLC A;  1ES4 A;  4XUX A;  4KZ6 A;  3OZH A;  4QPR A;  4S2N A;  3Q7V A;  4R4R A;  4HES A;  1PW1 A;  3IF6 B;  1ZKJ A;  4QD4 A;  2ZQC A;  4S2K A;  1ACF A;  3UPO A;  4GN2 A;  4R3A A;  4PPR A;  2VA0 A;  2XRN A;  5EVI C;  3M2J A;  2JKF A;  4UA6 A;  5AQ9 A;  5FQI A;  3OOV A;  3ZNY A;  1T19 A;  5AQA A;  2PD7 A;  2V1B A;  1VET A;  3G4P A;  3DWZ A;  2XFS A;  4NEE D;  5TJJ A;  4C75 A;  1YAX A;  1IOU A;  4PM5 A;  3WS5 A;  1K56 A;  5EM0 A;  2EX6 A;  2QYB A;  4R3B A;  4IBR A;  1OME A;  2EXA A;  2WYX A;  3BLS A;  2A3U A;  2OAP 1;  3HLE A;  3LY4 A;  3TJZ C;  4U0X A;  4KQD A;  5GHZ A;  3LI8 A;  4E3J A;  3V67 A;  3DWK A;  2ZC7 A;  2HGV A;  5KMW A;  2IWB A;  3ZCZ A;  4DXB A;  3IF5 A;  5MC7 A;  2Y2L A;  3UDX A;  4BMW A;  4Y2F A;  1KGE A;  4BL2 A;  3W4O A;  4QHC A;  1K57 C;  4YIN A;  3LEZ A;  3BJN A;  1EWZ A;  2LB9 A;  4G3V A;  4UA7 A;  1PZO A;  3FPV A;  1MKI A;  4MN7 A;  2IA2 A;  5HSQ A;  3HBR A;  4PMA A;  3LFV A;  3T4L A;  2Y55 A;  1JWV A;  3UE6 A;  2HDQ A;  2CMN A;  2KX6 A;  3Q07 A;  1LSV A;  5C5K A;  2RCX A;  1ES5 A;  4JXW A;  2VKS A;  2EX8 A;  4LRX C;  2BAS A;  1XKZ A;  2JE5 A;  4WL9 A;  3OBF A;  5G4Z A;  3S1Y A;  3MKF A;  3SW1 A;  4HBT A;  3NJA A;  4NK3 A;  4OLD A;  5HWT A;  4ZRR A;  1YLJ A;  3F1O B;  4X25 A;  4BEN A;  4GS9 B;  3PAG A;  5AJG A;  4WEK A;  3ZQ5 A;  3UDF A;  5GLC A;  1IYO A;  1N9L A;  4QY5 A;  1TF1 A;  4E6X A;  1I2W A;  4FUW A;  3WS0 A;  4QWO A;  4GLQ A;  3HJK A;  2B02 A;  2JKR I;  3T1R A;  4EXO A;  5FQK A;  1L0G A;  3HUN A;  3IX4 A;  3ICY A;  3VOZ A;  3BYD A;  2W1T A;  2P08 A;  1DJA A;  3A0S A;  3OPL A;  4LGW A;  2P9V B;  4EBN A;  2Z6C A;  4B93 A;  4BBV A;  3BFD A;  5HDC A;  2Y2N A;  3UME A;  1TD5 A;  3KYQ A;  2Y2Q A;  3LIA A;  3ZDJ A;  3ISG A;  3NBL A;  5HD5 A;  3CPT B;  5EVI D;  3G34 A;  2WZX A;  2VJW A;  3MQ0 A;  1SKO A;  3F1N B;  2P04 A;  1OJ5 A;  4L0L A;  1C3B A;  4DRT A;  3O5Y A;  5DTK A;  4DF6 A;  1IKG A;  1J9M A;  2FZ0 A;  3IXH A;  3PBT A;  5FEF A;  2AVX A;  4JLF A;  2JHE A;  2W3F A;  5G4Y A;  1MKM A;  5TGF A;  3LR3 A;  3FC7 A;  3IS2 A;  5FAT A;  3ZG7 B;  1K56 D;  3C4P A;  4LLO B;  2Y8H A;  5CEC A;  2ZMA A;  1D06 A;  1FR1 A;  4H6J A;  1F2K A;  3MMH A;  4EEP A;  2Y79 A;  3HL9 A;  3O87 A;  4Y0O A;  4E3I A;  1O07 A;  1STZ A;  1Y54 A;  1YLT A;  5HAI A;  4GOG A;  1IEL A;  5L10 A;  1XA1 A;  5KIZ A;  1XJ6 A;  2B18 A;  4KQO A;  2UWX A;  2P7J A;  3UPN A;  3MZD A;  1ESU A;  2ZJ9 A;  1YM1 A;  5EE8 A;  2ZMV A;  5K5B A;  2OOL A;  2Q9N A;  1ERO A;  3IF6 A;  4U3T A;  3T4J A;  2XSS A;  3CI6 A;  5A91 A;  2V20 A;  3IXB A;  3SS3 A;  2J7V A;  1I5Q A;  5EOO A;  2BTF P;  1LL9 A;  5GHX A;  4B4X A;  1W5D A;  4OQI A;  2RL3 A;  3E4P A;  1BUE A;  4P6Z M;  3M2K A;  1KE4 A;  4LRZ E;  4BLM A;  4EUZ A;  3N6I A;  2Y2P A;  1ERM A;  4I3I A;  3PR6 A;  5TBM A;  2HP5 A;  2QJ7 A;  2P74 A;  2VV6 A;  4GD8 A;  2ZC3 B;  3SZT A;  3MXS A;  4K0W A;  4CLC B;  2W27 A;  2PBY A;  3B47 A;  3PBN A;  1YKD A;  2HJ9 C;  1BUL A;  2ZC5 B;  4HH3 A;  3RH8 B;  2EXB A;  5GLD A;  2CC1 A;  4LCM A;  3MF0 A;  3R7W B;  1S0W A;  3NY4 A;  2D02 A;  3WRT A;  1OT6 A;  4E3O A;  5M18 A;  2J8Y A;  4BJP A;  3M6B A;  3A3J A;  4S2M A;  3OCL A;  2V1A A;  2WKP A;  4Q0H A;  4Q0J A;  3IWO A;  1W8Y A;  5KZH A;  4NXF A;  4R70 A;  2H0Y A;  1RP5 A;  2V9A A;  1L0F A;  3UDI A;  5TR7 A;  5JYP A;  3ZG9 B;  1OTA A;  3V3S A;  4WEJ A;  4KZ3 A;  4HH2 A;  3BY8 A;  2G2W A;  1JVJ A;  1ES3 A;  3FKV A;  3OPH A;  3CWF A;  2XA7 S;  5FA7 A;  4IHQ A;  4OQG A;  3L9K A;  4E6W A;  4ZAM A;  3UB8 A;  2ZQ8 A;  3KYZ A;  1S1Y A;  1G6O A;  5CTM A;  1K38 A;  1HVB A;  1TDG A;  1DP8 A;  1PRQ A;  4WM9 A;  1PYY A;  3MFD A;  3LIB A;  2MJ6 A;  1NY0 A;  4Y0T A;  3T4O A;  4EBL A;  1FSY A;  3UY6 A;  4XT2 B;  1W7F A;  4D60 A;  1F9I A;  4WF0 A;  1XXM A;  2XD1 A;  1NYY A;  4BD1 A;  2X71 A;  4KZB A;  2GZA A;  4Y13 A;  1UGU A;  5FQJ A;  3UN7 A;  3N4I A;  2LB5 A;  4OPY A;  1YSP A;  4OOL A;  1G28 A;  3DTI A;  1K54 A;  4M3K A;  4OPZ A;  1PIO A;  2ZM8 A;  1JTD A;  1DJB A;  3F1P A;  5EUA A;  3C4O A;  2HV1 A;  2HDS A;  3UB6 A;  1GHP A;  2WK0 A;  4G3K A;  1HTZ A;  3AGE A;  3FG8 A;  4MN6 A;  5HPI A;  3VSK A;  2OLV A;  2EA9 A;  2WAD A;  4LEN A;  1FCO A;  4GJ4 A;  5HDS A;  1LL5 A;  2VV7 A;  2HJE A;  5GLA A;  1P9W A;  4WZ5 C;  3BFG A;  3IT9 A;  3HJI A;  2P9V A;  1MPL A;  2OWH A;  4FSF A;  4BWI A;  3VE3 A;  3TG9 A;  2G7U A;  5AQ7 A;  2EWW A;  3D72 A;  5E43 A;  2EWV A;  3G30 A;  4I3J A;  5EFW A;  3GQZ A;  3QP5 A;  4R1G A;  3PXP A;  4E3M A;  2JKT I;  4MN5 A;  4GNU A;  2V2F F;  3CPT A;  3ZGA B;  5FAQ A;  1SCW A;  2ZD8 A;  3F1N A;  1EI5 A;  3NOU C;  4Y0U A;  2VK3 A;  2PRF A;  2V8C A;  3IH9 A;  4HBU A;  3UNW A;  2J9P A;  4NXG A;  1L2S A;  3MQO A;  3LYX A;  3P7N A;  1XFQ A;  5FAP A;  4NXB A;  4X56 A;  3G32 A;  3CAX A;  4Q0I A;  5DKK A;  3G2Z A;  5EOE A;  4X1M A;  5CHJ A;  2KOI A;  2XR0 A;  5CGS A;  4HY8 A;  4Y17 A;  2FH5 A;  5EVI A;  3KO6 A;  1XA7 A;  2XH9 A;  1ZTU A;  3DTK A;  4R4S A;  1G5U A;  2XEP A;  4CPK A;  3MJQ A;  4GD6 A;  2E8I A;  3T4K A;  1IYQ A;  3GSG A;  1TS6 A;  4WUJ A;  4Y7P A;  4FH2 A;  4OKP A;  3JVU A;  2JBF A;  1P0Z A;  4H8R A;  3RTY A;  4XUZ A;  4XXR A;  1UWN X;  1T1A A;  1NJ4 A;  2WUQ A;  1FOF A;  4DJ3 A;  2C5W B;  4YOF A;  1W63 Q;  2ZC4 B;  3I7J A;  4LV2 A;  1GCE A;  1YLP A;  2JC7 A;  4OQ0 A;  3V50 A;  2J3W A;  3BEB A;  1XGI A;  3OC2 A;  5CX7 A;  4JGQ A;  3K3D A;  3BEC A;  1VB6 A;  3C38 A;  3E4Q A;  3SH7 A;  1MY8 A;  3NI9 A;  4EQI A;  1K57 A;  4P85 A;  2Y2G A;  1RCJ A;  1V9Y A;  4JF4 A;  1GSX A;  4QB8 A;  1P9R A;  3IHB A;  2M7U A;  3BLM A;  3T50 A;  2VGK A;  3BY9 A;  3LCE A;  2ZOI A;  3LIC A;  1XJ2 A;  4CQH A;  4X69 A;  3S4X A;  4MLL A;  3DBA A;  4S2P A;  5U47 A;  1K25 A;  1GA9 A;  3P09 A;  3QP4 A;  1N9B A;  4IED A;  2VGL M;  4P6B A;  3AGD A;  2HDR A;  4GKU A;  4CLC C;  5I94 A;  3R7W A;  2GJ3 A;  2A24 B;  4MEZ A;  1MWR A;  1YLW A;  4NET A;  1MBL A;  1ERQ A;  1XGJ A;  2QWS A;  4UA9 A;  2Z2M B;  5FL3 A;  3A0R A;  1I2S A;  4HI4 A;  4BBT A;  3HLG A;  1BTL A;  3JYI A;  5DTS A;  4Y5F A;  5E2F A;  1OTB A;  2PR5 A;  3UPP A;  3BW6 A;  5HAR A;  4I5S A;  3QNB A;  2OWJ A;  3U4L P;  1FIL A;  3UE3 A;  5DTT A;  3G35 A;  4LRY C;  3CUE C;  3LUQ A;  3ZFZ A;  3T4Q A;  1MWS A;  2M1C A;  1YLY A;  3Q81 A;  4B88 A;  3IX3 A;  1K55 C;  4Z9Q A;  5HWV A;  5FAO A;  2HZ5 A;  5F83 A;  5IHV A;  4O01 A;  4DDS A;  1FR6 A;  4OLG A;  3NUL A;  3MXR A;  3VMA A;  2J3T C;  1FSW A;  2ZOH A;  1TS0 A;  4X68 A;  4WZ4 A;  2PD8 A;  5FI7 A;  5EEC A;  3H82 B;  3RJU A;  4IUK A;  4KEN B;  4XT2 A;  1GSV A;  3IQA A;  4YFM A;  4OQH A;  2K2N A;  4HOI A;  3T4T A;  3CZD A;  5HZH A;  2H28 A;  2VGL S;  5HDD A;  4ESP A;  3LGO A;  4OPR A;  5L2F A;  5EVE A;  1VQQ A;  2HDU A;  2EX9 A;  4LFU A;  2A49 A;  4KG2 A;  4KZ9 A;  3QHY A;  1LSW A;  3OLO A;  5DF7 A;  1WE4 A;  3HLC A;  2Z6D A;  2KDK A;  1A0K A;  4X1L A;  4ZJ2 A;  2ZQA A;  5F1F A;  3VSL A;  4HP4 A;  2H10 A;  2J80 A;  3G6O A;  3HLW A;  5BOH A;  1SDE A;  3Q82 A;  1S1Z A;  3UB9 A;  2ZQ7 A;  1CQA A;  4C6Y A;  1K6R A;  1NRJ A;  2ZLY A;  3SS4 A;  4BBU A;  4ZDX A;  3T12 B;  5FI2 A;  3TSG A;  2O9C A;  5J3W A;  1YMX A;  3HLB A;  1IKI A;  4HHD A;  3ZG8 B;  4OH0 A;  5F68 A;  2PBD P;  3KX0 X;  3PHY A;  2Y2J A;  1KE0 A;  3VFH A;  3TRC A;  3QNC A;  1KE3 A;  3NHQ A;  4ZJ3 A;  1FCM A;  2VZW A;  4GHI A;  4N9K A;  1KDS A;  3DAV A;  4EV4 A;  3GMW A;  3IX8 A;  4ZJ1 A;  1VET B;  4KZ5 A;  2XGN A;  1JWZ A;  5M1A A;  3GDI A;  2OLU A;  5IU1 A;  2XK1 A;  5F6A A;  4KG6 A;  3E4O A;  1BLH A;  1GHI A;  1TDL A;  3MKE A;  3MBZ A;  3LR4 A;  1IFQ A;  3FZC A;  4ETZ A;  4GB7 A;  1MZU A;  2XA7 M;  3BFC A;  3D4F A;  3HVF A;  1JTG A;  1ESI A;  4DE2 A;  1CI8 A;  5TFQ A;  4EU0 A;  2W1R A;  5CHM A;  3EQU A;  3IXD A;  4LCL A;  2VX8 A;  4EET B;  5L07 A;  5CEB A;  3PYP A;  4JGO A;  2W0N A;  2ZM2 A;  3MR0 A;  2WKR A;  1H3Q A;  3C7U A;  1VEU B;  1Q2Q A;  4DE3 A;  2O0Y A;  5JYO A;  2Y4A A;  5L8M A;  1LLB A;  1OT9 A;  2WAE A;  4EES A;  1T1C A;  4WYY A;  3H7W B;  2Y2K A;  1YMS A;  4JGR A;  4EWF A;  3E0Y A;  1UWP X;  3NEC A;  2V0U A;  2W3E A;  1H5X A;  4I38 A;  1BT5 A;  3EOI A;  5FI6 A;  3RFB A;  2Z2L B;  1PWC A;  4PM7 A;  4WBG A;  4LPZ A;  1TS8 A;  4E04 A;  4II7 A;  4HJ3 A;  2OAQ 1;  2QZ6 A;  3LY3 A;  4DKI A;  2PU2 A;  4KZ8 A;  3QP2 A;  3NCK A;  3RXW A;  1NLZ A;  1QMF A;  4FH4 A;  4UEY A;  1IEM A;  3BFF A;  2K31 A;  2A24 A;  4MBF A;  5KSH A;  5AVF A;  2XD5 A;  3L7H A;  3PAE A;  1XFN A;  1OTI A;  3VFF A;  5AVE A;  3A3D A;  4JGP A;  3EQV A;  2J9O A;  5A92 A;  5HWW A;  2Y2H A;  2L0W A;  5J4E A;  4K0X A;  1D7E A;  1DP9 A;  2WKQ A;  3VV4 A;  4DMZ A;  5EV0 A;  1XJ3 A;  4RQ9 A;  4IBX A;  4BL3 A;  1MWU A;  4OP8 A;  4OON A;  5F82 A;  2ZMF A;  3EGD C;  3F1O A;  3SH8 A;  3W4Q A;  1GHM A;  2V0W A;  4GS9 A;  4MCW A;  2IWC A;  3PTE A;  5I5L A;  5CER A;  2ZQ9 A;  1H8M A;  1KGF A;  2OV5 A;  1ONG A;  1XX2 A;  4DN0 A;  3CMZ A;  5E2H A;  4O0P A;  4FCF A;  1KVL A;  2JN7 A;  2X02 A;  3IHA A;  5DFX A;  2QMI A;  1BLS A;  3KSI A;  3KYE A;  5A93 A;  1LT0 A;  2W3G A;  3ZHH A;  4LV3 A;  4WZ5 A;  2H5S A;  1PI5 A;  3T1S A;  3OPP A;  1SKO B;  4G3W A;  2ZC6 B;  3TW8 A;  1U60 A;  2O9A A;  5CGX A;  1K4F A;  2HP6 A;  1N9O A;  3ULF A;  3GEC A;  1SHV A;  1GSW A;  4O7D A;  3GVB A;  5GL9 A;  3N8S A;  3VP2 A;  1O7E A;  4DJ2 A;  3C8C A;  4B9O A;  1L0D A;  2L4R A;  3FKW A;  3P01 A;  4DDY A;  1K6S A;  2ZL1 B;  3W4P A;  5GLB A;  3MQQ A;  3ZG0 A;  3G31 A;  3C7V A;  4F3L B;  1ALQ A;  2E8J A;  3DTM A;  2DCF A;  2IWD A;  1N9N A;  3MSH A;  2GNX A;  4I3A A;  1FQG A;  3ZVW A;  4PKY A;  2ZBB A;  2HP9 A;  3M6H A;  4KQR A;  4GDN A;  3VP0 A;  2WGV A;  2PT7 A;  2I72 A;  3PBR A;  3LI9 A;  2Y2M A;  2C6W B;  3NDE A;  3E2L A;  4NKP A;  2VEA A;  2FFF B;  5M19 A;  3ZYT A;  1NZU A;  2M7V A;  4S2O A;  1NLY A;  1CEG A;  4S2N C;  1PI4 A;  3A3F A;  4PKY G;  4JPM A;  4JF5 A;  4EQ1 A;  1PWD A;  1W8Q A;  1ODV A;  3HLD A;  4KG5 A;  4HJ6 A;  3VOL A;  5HPF A;  1T18 A;  1H8Y A;  5GHY A;  5TBM B;  1G6A A;  4ZBE A;  1CEF A;  4FTX A;  1K0K A;  1TS7 A;  1TVF A;  4B4Z A;  4PM9 A;  5HFO A;  1WYC A;  3JPU A;  5CRF A;  4RX2 A;  2VLG A;  3EWK A;  4YNR A;  3MS6 A;  4S2J A;  3C5A A;  4OOM A;  3V3R A;  1FCN A;  3S7Q A;  4HNB A;  4HQA A;  4PM8 A;  3R4K A;  3EEH A;  3K3C A;  5DVA A;  3VP4 A;  3CJM A;  4E3K A;  1QME A;  4OPQ A;  3Q7Z A;  3HCY A;  2DMW A;  4EER A;  1ES2 A;  5DF9 A;  1LHY A;  4CJN A;  2WGI A;  1S66 L;  1Y4O A;  1XJ4 A;  3IWI A;  1MXO A;  5J8X A;  4N1X A;  4JXS A;  4WEL A;  5DKL A;  3GRJ A;  3U2A A;  4K91 A;  1NXY A;  4CLC A;  2OSU A;  4X55 A;  4FOF A;  3S22 A;  1IYS A;  4HIA A;  1VEU A;  1NZO A;  2ZM0 A;  1PWG A;  3IH8 A;  1OTD A;  5A90 A;  4RA7 A;  5FQ9 A;  1KGG A;  4YWZ A;  3S7N A;  5CED A;  3C2W A;  4JKT A;  3LIF A;  5DFY A;  1OPX A;  2Y91 A;  1YLZ A;  4HEF A;  1V9Z A;  1Q2P A;  3H7W A;  5CXW A;  2XF3 A;  2JKT M;  3FPW A;  2Y2O A;  3CUE A;  1M40 A;  4L9F A;  4MNR A;  2NUP C;  4IUH A;  4ARZ B;  4FD8 A;  1K55 A;  1E3U D;  2O99 A;  3NOT C;  1RGZ A;  3LEQ A;  5IS1 A;  5CGW A;  1NYM A;  1ZG6 A;  2XDM A;  3S7O A;  1ZHH B;  2FFY A;  4DE0 A;  3ZNT A;  5HL6 A;  4DXC A;  2WGW B;  4Z1W A;  5L09 A;  4IVI A;  1PZP A;  4EBP A;  1S4R A;  3LO7 A;  2HPB A;  2B5R A;  4ZTK A;  3F1P B;  3GV9 A;  4C3Q A;  1Y28 A;  4KZ4 A;  4X6T A;  4EUV A;  4U0T A;  4Y3I A;  5E2G A;  2QPN A;  3T4S A;  3OPR A;  3O88 A;  1TEM A;  3HUM A;  4S2L A;  1IYP A;  1SKF A;  4HJ4 A;  5E2E A;  4WMC A;  5KSC A;  4D2O A;  2ACG A;  2QHK A;  3W2Z A;  1XPB A;  4N1H A;  3O3V A;  5FQM A;  4EEU A;  5EVL A;  4R3J A;  4KZ7 A;  3C30 A;  3G2Y A;  3SS5 A;  2PHY A;  5FSR A;  1HLU P;  4DE1 A;  1S4S A;  4KUK A;  2Q0O A;  3MZE A;  5LBR A;  5DJU A;  5G18 A;  3KSG A;  4L9G A;  3IBJ A;  2L1M A;  5J7E A;  1X0O A;  2Q9M A;  5F5Y A;  3K2N A;  4LV0 A;  4PAU A;  4S2I A;  1LI0 A;  1JNU A;  3IWQ A;  3HLF A;  4PHT A;  1GA0 A;  1ZC2 A;  2H0T A;  2Y2I A;  3QP1 A;  4UAA A;  2JCH A;  2DNS A;  4UQI M;  4MBH A;  3BQA A;  1K4E A;  4KUO A;  3DTE A;  3E98 A;  1L0E A;  5HAQ A;  4R0Q A;  4I39 A;  5HW3 A;  5FEG A;  3GTC A;  3HRE A;  1DJC A;  1DRM A;  3NOP C;  3CHW P;  1PW8 A;  2EFX A;  3ZG5 A;  3LR5 A;  3QP6 A;  3CLO A;  3Q7V B;  5A8B A;  2A2L A;  3WS2 A;  2D01 A;  5EVI B;  2GDN A;  1WA9 A;  2I9V A;  4JXG A;  1LL8 A;  2BLS A;  3RXX A;  5FQQ A;  3ITA A;  3CG5 A;  3BRM A;  2ZL1 A;  1SZV A;  4GZB A;  3NC8 A;  1OTE A;  3D9Y A;  3OCN A;  3UE1 A;  2W3H A;  1DY6 A;  4F3L A;  4HP9 A;  3MXQ A;  1Z6F A;  2QKP A;  3W8K A;  3FV7 A;  2G2U A;  1BYW A;  4JBF A;  1YT4 A;  5F69 A;  3UB5 P;  2YKH A;  4RYE A;  1VM1 A;  2WKE A;  4CLC D;  2V8F A;  1BSG A;  1S6R A;  3O86 A;  3T1Q B;  4CLC E;  1OJG A;  4NG2 A;  1JWP A;  2QJ5 A;  2EX2 A;  2PU4 A;  4ID4 A;  3FWL A;  4ME4 A;  4GCZ A;  1YQS A;  3MZF A;  5F1G A;  3LIE A;  5DF8 A;  4L9E A;  5CTN A;  4UQI S;  1YSQ A;  2JKG A;  4Y15 A;  2K7S A;  4QU3 A;  3IF6 C;  2JKR M;  3A3E A;  1YPR A;  2R9X A;  2YKF A;  3SH9 A;  3DW0 A;  1LSX A;  4MBK A;  4N9L A;  5FAS A;  3N7W A;  5EPH A;  1VHM A;  5IT5 A;  4AFI A;  1PFL A;  3SOI A;  2BG1 A;  4X53 A;  5HX9 A;  3HUO A;  3N8R A;  4IJG A;  5HAP A;  1KOU A;  3EEA A;  3N8L A;  2J3T D;  3PBO A;  1H0M A;  4IVK A;  3WRZ A;  3Q1F A;  3UE0 A;  4O8G A;  5D3O A;  3UMD A;  1L3L A;  4Q8I A;  2PYR A;  4WLA A;  3V5M A;  3AGF A;  1MC0 A;  3TE8 A;  1W63 M;  2PAV P;  4GW9 A;  1NRF A;  2XLN A;  4LV1 A;  4OVD A;  3V39 A;  1W79 A;  5FDH A;  3KSF A;  1EW0 A;  4A5R A;  4K08 A;  4PM6 A;  3BM6 A;  3B42 A;  3UO9 A;  2WKH A;  3PBQ A;  4QY6 A;  1CF0 A;  4WMC D;  5AQB A;  2HF6 A;  1Z09 A;  1KVM A;  5HL1 A;  4P87 A;  2PDR A;  3S7P A;  1BLP A;  2Y59 A;  4MMN A;  3NIA A;  4R38 A;  2GX5 A;  2INW A;  3H9W A;  1CK3 A;  3A3I A;  1M6K A;  2XFT A;  3MFX A;  4MDZ A;  2PYP A;  3CIT A;  4JXV A;  1FIK A;  3P98 A;  1F98 A;  3JVV A;  1HZO A;  4P6Z S;  4OOY A;  3QP8 A;  1H8Z A;  4WN5 A;  2VV8 A;  2PR6 A;  4N92 A;  4ARZ A;  1ONH A;  4KQQ A;  1SDN A;  1T1B A;  2DRW A;  3E2K A;  2W1T B;  2W3D A;  2X01 A;  3T1X A;  3PBS A;  2WZZ A;  1RGY A;  4NXE A;  3BFE A;  1XP4 A;  3WS4 A;  3BQ8 A;  1CJF A;  4E3N A;  3ZVT A;  2WGW A;  1F5M A;  4P0M A;  1MWT A;  1AWI A;  1KDW A;  5DJT A;  3D3O A;  1BZA A;  3GR2 A;  1E4D A;  1ZG4 A;  1E3U A;  3H82 A;  4GDB A;  1CI9 A;  2VGJ A;  2WAF A;  2WKI A;  5CHU A;  1HD8 A;  2R9W A;  3BWL A;  2NUT C;  5EM1 A;  1K54 C;  1LI9 A;  1DP6 A;  4R23 A;  1E25 A;  3KSH A;  1J3W A;  3VOY A;  1AXB A;  3WS1 A;  4EW7 A;  3LID A;  4JF6 A;  2EFU A;  3VE4 A;  4E3L A;  3EGX C;  4KZA A;  1D1J A;  5FDS A;  4OP5 A;  2ZQD A;  3IS2 B;  4RX3 A;  3TOI A;  2UV0 E;  1P97 A;  1PNE A;  4H6J B;  4BQM A;  4F94 A;  3A0V A;  3VP1 A;  1N4O A;  5HD3 A;  2O9B A;  3B3X A;  2XQZ A; 
#chains in the Genus database with same CATH homology
 3NDG A;  1Q2P A;  3TSG A;  1WYB A;  5CXW A;  4KZ3 A;  2XF3 A;  1YMX A;  1JVJ A;  2G2W A;  3HLB A;  3IXG A;  4UHU A;  1ES3 A;  2Y2O A;  3FKV A;  3OPH A;  1M40 A;  1IKI A;  3ZG8 B;  4MNR A;  4OH0 A;  3V3S A;  3VP3 A;  3WWX A;  3ITB A;  4QJG A;  5FA7 A;  4FD8 A;  4RVA A;  1K55 A;  4OQG A;  1E3U D;  4E6W A;  3FYZ A;  4ZAM A;  2V1Z A;  1G68 A;  2ZQ8 A;  1RGZ A;  4BD0 A;  2Y2J A;  1BLC A;  1ES4 A;  4XUX A;  1KE0 A;  4KZ6 A;  3VFH A;  5CGW A;  5CTM A;  1K38 A;  1HVB A;  1TDG A;  3QNC A;  1NYM A;  1ZG6 A;  1KE3 A;  2XDM A;  3OZH A;  4ZJ3 A;  4S2N A;  3Q7V A;  1FCM A;  4R4R A;  4HES A;  4N9K A;  1KDS A;  1PW1 A;  3IF6 B;  1ZKJ A;  4QD4 A;  4WM9 A;  1PYY A;  2FFY A;  3MFD A;  4DE0 A;  1NY0 A;  2ZQC A;  3ZNT A;  4S2K A;  4EBL A;  4EV4 A;  4Y0T A;  4GN2 A;  3UPO A;  1FSY A;  3UY6 A;  3GMW A;  4DXC A;  1W7F A;  4PPR A;  2WGW B;  4ZJ1 A;  4KZ5 A;  2XGN A;  1XXM A;  2XD1 A;  4IVI A;  5EVI C;  1PZP A;  1JWZ A;  1NYY A;  3M2J A;  5M1A A;  4BD1 A;  2X71 A;  2OLU A;  4EBP A;  2XK1 A;  4KZB A;  3LO7 A;  4UA6 A;  4KG6 A;  5AQ9 A;  2HPB A;  5FQI A;  3ZNY A;  2B5R A;  1GHI A;  1BLH A;  1TDL A;  4ZTK A;  5AQA A;  3MKE A;  3MBZ A;  5FQJ A;  3N4I A;  3UN7 A;  3GV9 A;  3G4P A;  4C3Q A;  3FZC A;  4GB7 A;  4KZ4 A;  4OPY A;  4X6T A;  4OOL A;  3DWZ A;  4U0T A;  3BFC A;  2XFS A;  5E2G A;  3D4F A;  1K54 A;  4M3K A;  2QPN A;  3HVF A;  1JTG A;  4OPZ A;  4C75 A;  1ESI A;  4DE2 A;  1CI8 A;  5TFQ A;  3OPR A;  1PIO A;  3O88 A;  2ZM8 A;  1JTD A;  5CHM A;  4PM5 A;  1TEM A;  3HUM A;  1DJB A;  4S2L A;  1IYP A;  3EQU A;  3WS5 A;  1SKF A;  1K56 A;  2EX6 A;  5E2E A;  5EUA A;  4WMC A;  3C4O A;  3IXD A;  4LCL A;  4IBR A;  4R3B A;  4D2O A;  5KSC A;  1OME A;  1XPB A;  2EXA A;  2WYX A;  2HDS A;  4N1H A;  3O3V A;  1GHP A;  5CEB A;  2WK0 A;  5FQM A;  3BLS A;  5EVL A;  2A3U A;  1HTZ A;  3AGE A;  3HLE A;  3LY4 A;  2ZM2 A;  3VSK A;  4R3J A;  4KZ7 A;  2OLV A;  3G2Y A;  4U0X A;  5GHZ A;  4E3J A;  3SS5 A;  2WAD A;  5FSR A;  3C7U A;  3DWK A;  2ZC7 A;  1Q2Q A;  4DE1 A;  4LEN A;  1FCO A;  5KMW A;  4DE3 A;  3MZE A;  2IWB A;  3ZCZ A;  4DXB A;  1LL5 A;  3IF5 A;  5JYO A;  2Y2L A;  5G18 A;  5GLA A;  4WZ5 C;  3BFG A;  3IT9 A;  2Y4A A;  3UDX A;  2P9V A;  2Q9M A;  1MPL A;  1LLB A;  4FSF A;  4LV0 A;  3TG9 A;  2WAE A;  1KGE A;  4BL2 A;  4S2I A;  1LI0 A;  3W4O A;  4QHC A;  3IWQ A;  5AQ7 A;  1K57 C;  3HLF A;  4YIN A;  4WYY A;  3LEZ A;  1GA0 A;  1ZC2 A;  2Y2K A;  5E43 A;  2H0T A;  1YMS A;  3G30 A;  2Y2I A;  1EWZ A;  3GQZ A;  4R1G A;  4E3M A;  4UAA A;  2JCH A;  4EWF A;  2DNS A;  4GNU A;  4MBH A;  2V2F F;  1PZO A;  4UA7 A;  1K4E A;  1H5X A;  1BT5 A;  1MKI A;  3ZGA B;  5FI6 A;  1L0E A;  3HBR A;  4PMA A;  5FAQ A;  4R0Q A;  2Z2L B;  5HAQ A;  1SCW A;  1PWC A;  5HW3 A;  2ZD8 A;  3GTC A;  2Y55 A;  3HRE A;  1EI5 A;  4PM7 A;  4WBG A;  1JWV A;  1DJC A;  4Y0U A;  2HDQ A;  1PW8 A;  2EFX A;  3Q07 A;  3IH9 A;  4HBU A;  3ZG5 A;  3UNW A;  2J9P A;  2QZ6 A;  3LY3 A;  1L2S A;  3Q7V B;  4DKI A;  3WS2 A;  2PU2 A;  5EVI B;  5FAP A;  4KZ8 A;  2GDN A;  1ES5 A;  2RCX A;  4JXW A;  4X56 A;  3NCK A;  3RXW A;  2EX8 A;  1QMF A;  3G32 A;  4JXG A;  1XKZ A;  2BLS A;  4FH4 A;  3RXX A;  5FQQ A;  2JE5 A;  3G2Z A;  5EOE A;  1IEM A;  3BFF A;  3ITA A;  3CG5 A;  3BRM A;  4GZB A;  5CHJ A;  3NC8 A;  3MKF A;  3S1Y A;  2XR0 A;  5CGS A;  4MBF A;  5KSH A;  2XD5 A;  3PAE A;  5EVI A;  3VFF A;  4HBT A;  1XA7 A;  3OCN A;  2XH9 A;  3UE1 A;  4NK3 A;  1DY6 A;  3A3D A;  3EQV A;  2J9O A;  4OLD A;  1Z6F A;  4R4S A;  5A92 A;  2Y2H A;  3W8K A;  3FV7 A;  1YLJ A;  2G2U A;  2XEP A;  4CPK A;  4BEN A;  4JBF A;  1YT4 A;  4GD6 A;  4K0X A;  2E8I A;  3PAG A;  1IYQ A;  4WEK A;  3GSG A;  4Y7P A;  4RYE A;  4IBX A;  1VM1 A;  2WKE A;  4FH2 A;  4BL3 A;  4OKP A;  3UDF A;  1BSG A;  1MWU A;  4OP8 A;  1S6R A;  2Y91 A;  3O86 A;  5GLC A;  2JBF A;  4OON A;  1IYO A;  5F82 A;  3SH8 A;  4H8R A;  3W4Q A;  1JWP A;  1GHM A;  4QY5 A;  2EX2 A;  1I2W A;  4XUZ A;  4E6X A;  4XXR A;  2IWC A;  2PU4 A;  3WS0 A;  3PTE A;  3FWL A;  4ID4 A;  1NJ4 A;  5CER A;  2ZQ9 A;  1KGF A;  1YQS A;  5FQK A;  2WUQ A;  1L0G A;  1FOF A;  3MZF A;  2OV5 A;  3HUN A;  1ONG A;  1XX2 A;  2C5W B;  5F1G A;  3VOZ A;  3CMZ A;  3BYD A;  5DF8 A;  1DJA A;  2ZC4 B;  3I7J A;  4LV2 A;  5CTN A;  1GCE A;  5E2H A;  4FCF A;  1YLP A;  1KVL A;  2JC7 A;  4OQ0 A;  4QU3 A;  3IF6 C;  3A3E A;  2X02 A;  3V50 A;  3IHA A;  2R9X A;  3SH9 A;  3BEB A;  1XGI A;  2QMI A;  3OPL A;  1BLS A;  3DW0 A;  5A93 A;  3OC2 A;  2P9V B;  4EBN A;  4MBK A;  4N9L A;  3ZHH A;  5FAS A;  3N7W A;  4LV3 A;  3BEC A;  5EPH A;  4WZ5 A;  2H5S A;  1PI5 A;  3SOI A;  3BFD A;  2Y2N A;  5FI2 A;  3OPP A;  3SH7 A;  2BG1 A;  1MY8 A;  3NI9 A;  4X53 A;  5HX9 A;  2Y2Q A;  2ZC6 B;  3HUO A;  3N8R A;  3ZDJ A;  3ISG A;  1K57 A;  3NBL A;  4P85 A;  4EQI A;  2Y2G A;  1U60 A;  5HAP A;  1RCJ A;  4JF4 A;  3N8L A;  4QB8 A;  3IHB A;  3BLM A;  2VGK A;  5CGX A;  3LCE A;  5EVI D;  3G34 A;  2WZX A;  1K4F A;  2HP6 A;  3PBO A;  4IVK A;  3WRZ A;  3Q1F A;  3UE0 A;  5D3O A;  4L0L A;  1SHV A;  1C3B A;  4O7D A;  3GVB A;  4DRT A;  4Q8I A;  4X69 A;  5GL9 A;  3S4X A;  4MLL A;  5DTK A;  4DF6 A;  3N8S A;  1IKG A;  4S2P A;  5U47 A;  1K25 A;  1GA9 A;  3AGF A;  1O7E A;  3P09 A;  3V5M A;  3VP2 A;  1J9M A;  1N9B A;  3IXH A;  3PBT A;  4IED A;  1NRF A;  1L0D A;  2XLN A;  4LV1 A;  4OVD A;  4P6B A;  3V39 A;  3AGD A;  1W79 A;  2HDR A;  3FKW A;  4GKU A;  5FDH A;  4DDY A;  1K6S A;  4A5R A;  5I94 A;  4MEZ A;  1MWR A;  3W4P A;  1YLW A;  4NET A;  4PM6 A;  3BM6 A;  1MBL A;  4JLF A;  5GLB A;  1ERQ A;  1XGJ A;  3UO9 A;  2WKH A;  4UA9 A;  5TGF A;  3ZG0 A;  3G31 A;  3C7V A;  2Z2M B;  5FAT A;  3ZG7 B;  3PBQ A;  1ALQ A;  1I2S A;  1K56 D;  4QY6 A;  3DTM A;  3HLG A;  4WMC D;  2DCF A;  5AQB A;  1BTL A;  3JYI A;  5DTS A;  1KVM A;  3C4P A;  2IWD A;  5HL1 A;  4P87 A;  5E2F A;  5CEC A;  2ZMA A;  1FR1 A;  1BLP A;  2Y59 A;  3UPP A;  1FQG A;  3NIA A;  3HL9 A;  3ZVW A;  5HAR A;  2HP9 A;  3O87 A;  4Y0O A;  4E3I A;  3M6H A;  3QNB A;  1O07 A;  1CK3 A;  3A3I A;  1M6K A;  2XFT A;  4GDN A;  4KQR A;  3VP0 A;  3UE3 A;  2WGV A;  5DTT A;  2I72 A;  3G35 A;  1Y54 A;  1YLT A;  4JXV A;  5HAI A;  4GOG A;  3PBR A;  3P98 A;  3ZFZ A;  1MWS A;  1YLY A;  2Y2M A;  1HZO A;  3Q81 A;  4B88 A;  4OOY A;  1H8Z A;  1K55 C;  2C6W B;  3NDE A;  4Z9Q A;  5FAO A;  4N92 A;  3E2L A;  5F83 A;  1IEL A;  5IHV A;  1ONH A;  4KQQ A;  1XA1 A;  4DDS A;  1SDN A;  2FFF B;  2DRW A;  5M19 A;  3E2K A;  1FR6 A;  4OLG A;  4KQO A;  1NZU A;  3MXR A;  3VMA A;  2UWX A;  4S2O A;  1FSW A;  3UPN A;  1CEG A;  4S2N C;  3MZD A;  1ESU A;  2ZJ9 A;  1YM1 A;  1PI4 A;  3A3F A;  5EE8 A;  2X01 A;  4X68 A;  3PBS A;  4JPM A;  2WZZ A;  1RGY A;  4JF5 A;  1PWD A;  2Q9N A;  1W8Q A;  3HLD A;  4KG5 A;  3BFE A;  1ERO A;  3IF6 A;  1XP4 A;  4WZ4 A;  5FI7 A;  4U3T A;  3WS4 A;  5EEC A;  3RJU A;  1H8Y A;  4E3N A;  3ZVT A;  4KEN B;  2WGW A;  3IQA A;  2V20 A;  5A91 A;  4P0M A;  1MWT A;  5GHY A;  4YFM A;  1G6A A;  3IXB A;  4OQH A;  4ZBE A;  2J7V A;  3SS3 A;  1CEF A;  1KDW A;  1I5Q A;  5EOO A;  1TVF A;  1BZA A;  4PM9 A;  5HFO A;  4B4Z A;  1WYC A;  3CZD A;  1LL9 A;  5GHX A;  4B4X A;  3GR2 A;  5CRF A;  4RX2 A;  1E4D A;  1W5D A;  1ZG4 A;  4OQI A;  2RL3 A;  1BUE A;  1E3U A;  4GDB A;  4OPR A;  1CI9 A;  1KE4 A;  2VGJ A;  3M2K A;  4BLM A;  4EUZ A;  2WAF A;  3N6I A;  2WKI A;  2Y2P A;  5CHU A;  5L2F A;  1ERM A;  1HD8 A;  4S2J A;  2R9W A;  3C5A A;  4OOM A;  3V3R A;  1FCN A;  1K54 C;  1VQQ A;  2HDU A;  2EX9 A;  2HP5 A;  2A49 A;  1LI9 A;  4PM8 A;  2P74 A;  4R23 A;  4KG2 A;  5DVA A;  4KZ9 A;  3VP4 A;  1E25 A;  3QHY A;  3CJM A;  4GD8 A;  2ZC3 B;  4E3K A;  1QME A;  3MXS A;  3Q7Z A;  4OPQ A;  4K0W A;  5DF7 A;  1WE4 A;  3VOY A;  1ES2 A;  5DF9 A;  1LHY A;  2PBY A;  4CJN A;  1AXB A;  3PBN A;  3HLC A;  2WGI A;  3WS1 A;  1BUL A;  2ZC5 B;  3IWI A;  2EXB A;  4JF6 A;  1MXO A;  2EFU A;  4ZJ2 A;  5GLD A;  5J8X A;  2ZQA A;  4N1X A;  2CC1 A;  5F1F A;  4E3L A;  4JXS A;  4LCM A;  3VSL A;  4KZA A;  1S0W A;  3NY4 A;  4WEL A;  3GRJ A;  3WRT A;  4K91 A;  1NXY A;  2H10 A;  2OSU A;  4X55 A;  4E3O A;  4OP5 A;  2ZQD A;  5M18 A;  2J8Y A;  3S22 A;  1IYS A;  4RX3 A;  3M6B A;  4BJP A;  3A3J A;  4S2M A;  3TOI A;  3HLW A;  1NZO A;  3OCL A;  5BOH A;  1SDE A;  3Q82 A;  2ZM0 A;  1PWG A;  3IH8 A;  5A90 A;  2ZQ7 A;  3IWO A;  1W8Y A;  4BQM A;  4F94 A;  5KZH A;  3VP1 A;  4C6Y A;  2H0Y A;  1RP5 A;  4RA7 A;  1L0F A;  1N4O A;  1K6R A;  5FQ9 A;  3UDI A;  1KGG A;  5CED A;  5TR7 A;  2ZLY A;  3SS4 A;  4JKT A;  5JYP A;  3ZG9 B;  4ZDX A;  3B3X A;  1YLZ A;  4HEF A;  2XQZ A;  4WEJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...