1BLHA

Structure of a phosphonate-inhibited beta-lactamase. an analog of the tetrahedral transition state(slash)intermediate of beta-lactam hydrolysis
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
257
structure length
257
Chain Sequence
KELNDLEKKYNAHIGVYALDTKSGKEVKFNSDKRFAYASTSKAINSAILLEQVPYNKLNKKVHINKDDIVAYSPILEKYVGKDITLKALIEASMTYSDNTANNKIIKEIGGIKKVKQRLKELGDKVTNPVRYEIELNYYSPKSKKDTSTPAAFGKTLNKLIANGKLSKENKKFLLDLMLNNKSGDTLIKDGVPKDYKVADKSGQAITYASRNDVAFVYPKGQSEPIVLVIFTNKDNKSDKPNDKLISETAKSVMKEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase(beta-lactamase)
molecule keywords BETA-LACTAMASE
publication title Structure of a phosphonate-inhibited beta-lactamase. An analog of the tetrahedral transition state/intermediate of beta-lactam hydrolysis.
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 94
structure length 257
sequence length 257
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 1993-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 1blhA00
3G31A 4KG5A 1CEFA 2OSUA 5KMWA 2G2UA 3WS2A 2EX9A 3MKEA 3N6IA 1ERMA 1ALQA 1OMEA 4RVAA 1ONGA 1QMFA 1KDSA 1EWZA 2VGKA 2VGJA 5FQKA 1SHVA 1KGEA 4R23A 3OZHA 4DE1A 1ES3A 2B5RA 3VP4A 2WYXA 1RGZA 3PAGA 3IH9A 4BQMA 4BL3A 3VFHA 3CZDA 4S2LA 3DW0A 2CC1A 1BSGA 1FR6A 1WYCA 4JXSA 5EVLA 4WM9A 4DXCA 1JWPA 1LL5A 2WKHA 4IBRA 1ESUA 2WGWB 1W7FA 3ZDJA 2OLUA 4Y0UA 2J9OA 4S2IA 1K54A 2ZM2A 4WMCD 3SS4A 1M6KA 1IEMA 1MY8A 4IVKA 4KG6A 3ZVWA 2HDRA 1IYPA 3E2KA 1PI5A 4HEFA 1W79A 1XXMA 4GDBA 4A5RA 2HP5A 2V20A 3NI9A 2HDUA 1DJCA 5A91A 2XR0A 1H8YA 1FSWA 2ZC5B 3NBLA 3N8LA 3MKFA 3UPOA 3HUMA 1E4DA 4KG2A 5CHUA 3NIAA 3BFGA 5FQIA 3BLMA 1NY0A 4GKUA 2XQZA 4KQOA 3VOYA 1ES5A 2ZJ9A 3S4XA 2HP9A 3RJUA 1E3UD 4R3BA 1JTGA 1TEMA 4OOLA 5M18A 2UWXA 3G34A 1CI8A 3O88A 4JF6A 3NCKA 3WS5A 5AQ7A 3UE1A 3IT9A 3TSGA 4JXWA 3AGEA 3ISGA 1FR1A 1GA9A 3A3EA 1BLSA 4IVIA 4UA6A 4DE2A 1HTZA 1EROA 2Z2MB 5FASA 3ZFZA 3D4FA 4BL2A 1ES4A 1K25A 4PM6A 5TR7A 3DTMA 3GQZA 2XK1A 3TOIA 4LCLA 1KVMA 4X53A 3BECA 5GL9A 4E3KA 1LL9A 2V1ZA 3PAEA 3ZG7B 2WGWA 3BYDA 3W4QA 4OOMA 4EBLA 1NJ4A 4WMCA 1YT4A 2QPNA 4E3IA 2EFUA 1PI4A 3ZG8B 2PU2A 3MZEA 4B88A 3WS1A 3FKVA 1MXOA 4OPYA 5EPHA 4JLFA 1TDGA 1NRFA 2IWCA 1I2WA 3VP3A 3BFFA 2QZ6A 1MWSA 3GVBA 3FYZA 3HL9A 1PW1A 4KZBA 4E3JA 1H8ZA 1ONHA 1MBLA 2Y2KA 3HUNA 3C7UA 4S2MA 3UNWA 3ZG5A 4X56A 3BRMA 2Y2OA 3HVFA 4Y0TA 1E3UA 4O7DA 1J9MA 2ZQ9A 2WAEA 3UN7A 1XA7A 4DXBA 3FZCA 1Z6FA 5DF8A 3ZHHA 2WGVA 2EFXA 1MWUA 2DCFA 2P9VA 2A49A 2R9WA 3QHYA 4OQHA 5CERA 3E2LA 3M6BA 4S2PA 4HESA 1H5XA 1L0DA 3IXBA 1PIOA 3O87A 5EECA 3V39A 4MLLA 1PYYA 3HLBA 4FSFA 4MBHA 5FAQA 5CEDA 4K0WA 5CHJA 4ZAMA 4PM5A 4E3LA 2J9PA 5EOOA 4BLMA 4OPQA 4FD8A 5CGXA 3CG5A 3QNCA 4KENB 4GD6A 1CI9A 1FCOA 1PWDA 1FCMA 1XKZA 2E8IA 2H0TA 3NY4A 3OC2A 4PM7A 5HW3A 2P74A 4X55A 4KZ9A 1RP5A 5EE8A 1N9BA 1BTLA 3MBZA 4OP8A 5F82A 1K4FA 1FOFA 3N7WA 5CTMA 4MBFA 1MWRA 4P6BA 3VSKA 5KSCA 1MWTA 2G2WA 4DDSA 5EUAA 4OVDA 2H10A 4H8RA 4RA7A 5CRFA 3G4PA 5DTKA 3EQUA 4MNRA 4P85A 5G18A 1M40A 4OONA 4MEZA 1G68A 4U3TA 3PBSA 3IHAA 1IKIA 1KVLA 2WUQA 4D2OA 2Q9NA 4IEDA 1BULA 4OKPA 5HX9A 1XGJA 2ZM0A 1XX2A 3SH9A 1PW8A 2ZQAA 4X68A 4ZBEA 1PWCA 2WZXA 3HLDA 3BEBA 3GMWA 3VMAA 1WE4A 1ZG6A 2BG1A 1W8QA 1HVBA 4GOGA 2HPBA 3S22A 2GDNA 3JYIA 2Y2MA 4R4SA 2Y4AA 5EOEA 3IHBA 4R0QA 4LV3A 4WELA 3ZCZA 5AQ9A 4P0MA 4QU3A 1KE4A 4ZTKA 5HFOA 4EBPA 5E2FA 4OH0A 5M19A 3C7VA 3HLFA 1GHIA 1TDLA 3W4OA 4ZDXA 3G2YA 4C6YA 1K6RA 2IWDA 4JKTA 3VFFA 1YMSA 5CXWA 1LI9A 4K0XA 3MZDA 4ID4A 5FI6A 3W4PA 5AQAA 4GN2A 4E3OA 4KQQA 4YFMA 1G6AA 3OPHA 1U60A 4PPRA 5AQBA 5CGWA 4NETA 4GZBA 2FFYA 2X02A 1Q2QA 3Q7VB 1WYBA 3P98A 3I7JA 3MFDA 3RXWA 4KZ5A 2PU4A 3SS3A 2Y2HA 3ZVTA 3UE3A 1PZPA 1KE0A 4XUXA 1ES2A 3SH8A 4CPKA 1JTDA 3ZNYA 2P9VB 3A3DA 3M2KA 4U0TA 4ZJ1A 4BD1A 4OLGA 5EVID 5E2HA 3BM6A 5JYPA 1YQSA 4KQRA 4R1GA 1BLPA 1VM1A 4JF5A 4JBFA 3Q82A 1XP4A 4MBKA 4QD4A 3UDIA 3A3JA 5JYOA 5FQ9A 4KZ8A 4XUZA 3Q7ZA 1K38A 4KZ4A 1SDEA 5CEBA 2XLNA 1K55C 1SCWA 3IXDA 2WKEA 1GHMA 2EX6A 3PBRA 4DE3A 2BLSA 5GLCA 3CJMA 4QHCA 1YLWA 2ZQ7A 3WRTA 1O7EA 5A93A 4BENA 4KZ6A 3OPPA 2QMIA 1JWZA 1IYQA 4NK3A 1K57A 3BFCA 5HAQA 1YLPA 3GV9A 4IBXA 2DNSA 1NZOA 3ZNTA 4GNUA 3BLSA 1BLCA 1DJAA 3CMZA 4X6TA 3UO9A 2X71A 3A3FA 3ZGAB 1ZKJA 4QY6A 5FQQA 5FAPA 2XD5A 3RXXA 2ZQDA 4OP5A 1BT5A 1NZUA 5FQJA 3W8KA 3Q7VA 3OCLA 1LI0A 1L0FA 1SKFA 4UAAA 4EV4A 5KZHA 5HL1A 3UPPA 1I2SA 4HBTA 1RCJA 1RGYA 2Y2PA 5D3OA 2C5WB 2JE5A 3IWOA 2ZMAA 5TFQA 4FCFA 1DY6A 4N92A 5GHYA 5KSHA 1TVFA 5GLBA 4BD0A 4LCMA 4KZ3A 1LLBA 4WYYA 5I94A 4Y0OA 1W5DA 4GD8A 4R3JA 2XH9A 4JPMA 4JXVA 2ZQ8A 2PBYA 1ERQA 4E3MA 4EUZA 3IF5A 1EI5A 4OOYA 2WAFA 2XFSA 4KZAA 3ZG0A 1KGFA 3SOIA 2ZM8A 4C3QA 4ZJ2A 3HLGA 3MXRA 3ZG9B 4F94A 3M2JA 3SH7A 2Y2IA 3EQVA 1VQQA 3LY4A 2Y2JA 4N1HA 4DF6A 3P09A 1ZG4A 4WZ4A 4CJNA 3DWKA 1YLZA 4FH2A 4N1XA 3NDEA 4QB8A 3WRZA 1YMXA 4EQIA 4R4RA 5BOHA 1Q2PA 1YLJA 2DRWA 4L0LA 1K55A 3ITAA 2WZZA 1L2SA 4OLDA 1GA0A 5GHXA 1HD8A 3WWXA 1SDNA 2XF3A 5FATA 5FSRA 3VP1A 3OCNA 2XFTA 1GCEA 4DKIA 1BZAA 2EXBA 3WS0A 1KDWA 4RX3A 1KGGA 1PWGA 2Z2LB 3UE0A 5TGFA 5FDHA 4DDYA 2J8YA 1HZOA 1NXYA 1K57C 2ZC4B 3LO7A 2EX2A 4E6XA 2JBFA 2XEPA 1C3BA 3VP2A 5A92A 5CGSA 4LV0A 1BUEA 3SS5A 1BLHA 4Q8IA 2A3UA 2V2FF 3IQAA 4OQGA 3HBRA 4PMAA 3Q07A 3LEZA 3G30A 3IF6C 5GLAA 2ZD8A 1CEGA 1XA1A 3OPLA 3AGFA 2JCHA 4QJGA 4JF4A 4WZ5A 4GDNA 1L0EA 3M6HA 2HDQA 4PM8A 1L0GA 3A3IA 4N9KA 3V50A 2FFFB 4QY5A 2R9XA 1IYSA 2Y2QA 3DWZA 2Y2LA 3IF6B 4S2OA 4UHUA 5E43A 5EVIC 4B4ZA 4GB7A 4WEJA 3TG9A 3O86A 3G35A 1GHPA 1I5QA 3GTCA 2J7VA 3BFDA 5M1AA 2WGIA 3N8SA 3Q81A 5EVIB 4FH4A 4RX2A 3UY6A 1N4OA 3V3SA 1Y54A 3C5AA 4YINA 5GHZA 1S0WA 4PM9A 4X69A 4S2NC 1XPBA 3FKWA 3LCEA 1YLTA 2XGNA 3O3VA 1NYMA 5FI2A 2IWBA 5DTSA 3FV7A 3IXHA 3HLWA 3G2ZA 3N4IA 1PZOA 3OPRA 3VP0A 2Y91A 3PBQA 1E25A 5F83A 1AXBA 1FQGA 1O07A 3MXSA 2EX8A 1CK3A 4OQIA 3HLCA 2Q9MA 5GLDA 4EBNA 5IHVA 1MKIA 4WEKA 5FI7A 4KZ7A 1IKGA 5HARA 4C75A 4DE0A 2ZC6B 3IXGA 4LV2A 2X01A 3B3XA 3IWIA 3BFEA 1K56D 4LV1A 3V3RA 3VOZA 1QMEA 4OQ0A 3NDGA 3UPNA 5CTNA 4WBGA 3ITBA 3FWLA 4HBUA 1IELA 1ESIA 1LHYA 2C6WB 3N8RA 2WADA 2WK0A 3PBNA 1K4EA 3C4PA 4E3NA 5L2FA 4S2JA 5DF7A 2Y55A 3S1YA 3IH8A 3IF6A 2ZQCA 4U0XA 5HAIA 3G32A 3HUOA 2ZLYA 2EXAA 4OPZA 4OPRA 5J8XA 4Y7PA 3LY3A 1W8YA 1FCNA 2Y2NA 5DVAA 3GR2A 5FQMA 5EVIA 1S6RA 2XD1A 4RYEA 4UA9A 1JWVA 4Z9QA 4S2KA 4K91A 4E6WA 2H0YA 4WZ5C 5CECA 4N9LA 5FA7A 3HLEA 3NC8A 1JVJA 1K54C 2ZC3B 1DJBA 3AGDA 3PBTA 2OV5A 3V5MA 4BJPA 5F1FA 3MZFA 3C4OA 4S2NA 5HAPA 3Q1FA 1NYYA 4XXRA 5DF9A 5A90A 3UDFA 2Y59A 5E2GA 2XDMA 4JXGA 1MPLA 3UDXA 2RL3A 1ZC2A 2Y2GA 3VSLA 1K56A 2H5SA 4UA7A 5E2EA 1YLYA 2I72A 3PTEA 1YM1A 1XGIA 2JC7A 1FSYA 2HP6A 2HDSA 3HREA 5F1GA 4ZJ3A 2WKIA 4B4XA 3GRJA 2RCXA 4M3KA 2ZC7A 5CHMA 5DTTA 4DRTA 3WS4A 3GSGA 2OLVA 3PBOA 1IYOA 1K6SA 5U47A 3IWQA 4LENA 4EWFA 1KE3A 5FAOA 4P87A 3QNBA
chains in the Genus database with same CATH superfamily
2XSSA 3T1XA 2W3GA 3BY8A 5DKKA 2EX9A 1ONGA 5FQKA 1EWZA 2VGKA 4ME4A 3VFHA 1CF0A 2G7UA 5TBMB 4JXSA 3IS2B 5L8MA 2WKHA 4IBRA 1ACFA 2A24A 5K5BA 4Y0UA 3SS4A 2V0WA 4IVKA 3H82A 3E2KA 1IYPA 5TJJA 2L4RA 1W79A 4A5RA 2V20A 2HDUA 4R6LA 3F1OA 3MKFA 4WL9A 5CHUA 3IX4A 3NIAA 5FQIA 5HDDA 1NY0A 4KQOA 1D1JA 3RJUA 1JTGA 1TEMA 4OOLA 3UB6A 4JF6A 3NCKA 1S4RA 2BASA 3TSGA 3AGEA 3VV4A 1GA9A 5FASA 2Z2MB 3CLOA 2EA9A 2P7JA 2VJWA 4BL2A 2J3TD 3DTMA 1KVMA 3PAEA 3ZG7B 2WGWA 4EBLA 4WMCA 1IOUA 4JLFA 3L9KA 1I2WA 3BFFA 3HL9A 3KYZA 3MR0A 5G4ZA 4E3JA 2OOLA 1TD5A 3IX8A 2V8FA 3S7PA 3ZG5A 1J9MA 1N9NA 3QP2A 3JPUA 2P9VA 3QHYA 5CERA 3O87A 3T50A 2FZ0A 3HLBA 4FSFA 4PM5A 4E3LA 2J9PA 3QP6A 2W1RA 1CI9A 3ULFA 1FCMA 1XKZA 4NKPA 3SZTA 1VHMA 4Q0HA 4OP8A 3LR0A 1K4FA 1FOFA 1MWRA 2VX8A 4IJGA 4P85A 1YSPA 5G18A 4OONA 4MEZA 1G68A 1KVLA 1VEUB 2Q9NA 4IEDA 4IUHA 4OKPA 5HX9A 1XX2A 5HD5A 1MZUA 4ZBEA 2WZXA 3HLDA 5HD3A 1WE4A 1ZG6A 4DRTA 2HPBA 4WLAA 5EOEA 2JKTM 3IHBA 4R0QA 1CJFA 5AQ9A 3RH8B 4P0MA 4OH0A 4MCWA 5M19A 3W4OA 4ZDXA 2IWDA 5G4YA 5FI6A 3W4PA 4HHDA 2HV1A 4KQQA 4EERA 2K7SA 4PPRA 3S7NA 1JNUA 4GZBA 2X02A 1P97A 3S7OA 3MFDA 3RXWA 4KZ5A 4DJ3A 5CX7A 4DMZA 2JKTI 4CPKA 5EVID 3BM6A 4KQRA 4JF5A 4HJ4A 5JYOA 4QD4A 4KZ4A 1HLUP 1SCWA 4ETZA 5GLCA 1YLWA 3OLOA 5A93A 4BENA 4KZ6A 1IFQA 2JHEA 4NK3A 1K57A 3BFCA 3GV9A 2DNSA 3EOIA 4R38A 1SKOA 2P08A 4BWIA 3T12B 1ZKJA 3CPTB 4QY6A 3W8KA 4O01A 3OCLA 1L0FA 4PKYA 4UEYA 2C5WB 2PAVP 3R7WA 3IWOA 4PHTA 4D60A 5GHYA 5KSHA 4BD0A 5L09A 4Y0OA 4LRZE 4GD8A 4JXVA 3H7WA 2ZQ8A 3E4OA 2JKGA 3IF5A 1TS6A 3LGOA 3O5YA 4ZJ2A 3HLGA 3SH7A 3EQVA 4LLOB 4FH2A 2VV6A 3MF0A 1YMXA 2ZL1B 3P01A 2VGLS 1K55A 1L2SA 4Y5FA 1HD8A 5FSRA 3MSHA 1KGGA 3UE0A 4DDYA 3LICA 3LI8A 2VKSA 1Y28A 2V2FF 3PXPA 3K2NA 5GLAA 1XA1A 1F9IA 2ZBBA 3AGFA 3LEQA 4KQDA 2JCHA 2W1TB 4GDNA 2UV0E 5J7EA 4AFIA 4B4ZA 4UHUA 5E43A 4GB7A 3MFXA 3O86A 2J7VA 3Q81A 3BJNA 4PM9A 4X69A 1XPBA 3LCEA 3UE6A 2XGNA 2D01A 1NYMA 2EWVA 5DTSA 3HLWA 3R4KA 3VP0A 3OPRA 1AXBA 4ETXA 4OQIA 2Q9MA 5F6AA 3T1SA 5FI7A 4KZ7A 1IKGA 3NECA 5HZHA 3QP5A 4BD1A 4LV1A 1K56D 5DFXA 1ESIA 3BQAA 3EGXC 3B42A 2HJ9C 3NULA 1DP8A 3JVUA 3TJZC 1X0OA 4OPRA 3UMEA 4E6WA 4RYEA 2VA0A 1JWVA 4N9LA 5FA7A 5IU1A 2A24B 3NOUC 1V9YA 5E2GA 1ZC2A 3H82B 1YLYA 2Y79A 1YM1A 3HREA 5F1GA 2WKIA 4B4XA 2RCXA 3F1OB 4PKYG 4NXBA 3GSGA 2OLVA 4HJ6A 2VZWA 4P87A 3LIAA 1CEFA 5KMWA 4EW7A 3N6IA 1ERMA 1ALQA 5HWVA 4RVAA 2PYPA 2VGJA 1KGEA 3OZHA 1OTDA 2WYXA 1RGZA 4BQMA 2QJ5A 1BSGA 3BQ8A 1FR6A 5KIZA 4WM9A 2WGWB 4EXOA 4S2IA 1K54A 1IEMA 1OTAA 2VV7A 3NI9A 5A91A 2XR0A 1FSWA 1N9LA 2ZC5B 3NBLA 2P04A 3N8LA 3EGDC 3UPOA 3BFGA 1DP6A 3VOYA 2ZJ9A 1E3UD 3OBFA 2UWXA 3O88A 1H8MA 3WS5A 4FUWA 4HP9A 3ISGA 2XRNA 1GSWA 1BLSA 3FPWA 4IVIA 4MN6A 1HTZA 4UA6A 2GJ3A 1OT9A 4X53A 5GL9A 4E3KA 5F68A 3BYDA 3MJQA 4OOMA 1YT4A 4E3IA 2EFUA 2J3WA 2PU2A 4B88A 3FKVA 1MXOA 4OPYA 4B93A 2WKRA 2IWCA 2QZ6A 4Y13A 4O8GA 3FYZA 3C38A 3LIDA 4PAUA 5C5KA 4EEUA 3UNWA 2Y2KA 4IUKA 2L1MA 3HVFA 2WAEA 3UN7A 1XA7A 1TF1A 1Z6FA 5DF8A 2R9WA 3PYPA 2A49A 4HESA 1PIOA 5EECA 3V39A 5F69A 4QPRA 4K0WA 5EOOA 4BLMA 4OPQA 4FD8A 3LI9A 3QNCA 5J3WA 4KENB 1FCOA 1PWDA 3OC2A 5HW3A 1MC0A 4KZ9A 5EE8A 2PBDP 1BTLA 3U4LP 1P0ZA 5HPFA 3IX3A 5F82A 5CTMA 4MBFA 3VSKA 5KSCA 4K08A 4DDSA 4OVDA 2H10A 4G3WA 5CRFA 3EQUA 4MNRA 1S4SA 4U3TA 4HOIA 3PBSA 1UGUA 1F2KA 1PW8A 2ZQAA 4X68A 2GX5A 3GMWA 5FL3A 1S66L 2BG1A 1W8QA 4GOGA 3V67A 2GDNA 4CLCE 5HDSA 3ZCZA 3FG8A 4ZTKA 1SZVA 4JKTA 3VFFA 1W63Q 1YMSA 4HY8A 1SKOB 4YFMA 3OPHA 2FFYA 1Q2QA 3ZQ5A 2QJ7A 3CUEC 3I7JA 3SS3A 1PZPA 3R7WB 3ZNYA 4ZJ1A 4I3IA 5JYPA 1YQSA 3H7WB 1VM1A 4JBFA 4MBKA 1XP4A 3EEHA 5FQ9A 1SDEA 1K55C 3IXDA 2NUTC 2BLSA 5DKLA 4QHCA 3OOVA 4EQ1A 2QYBA 4I3JA 3LFVA 4KUOA 1IYQA 5HAQA 4IBXA 4NEED 3CMZA 1YAXA 1T1CA 5FAPA 5HL6A 2XD5A 3RXXA 1LSVA 4OP5A 5FQJA 3Q7VA 1LI0A 5KZHA 3UPPA 1I2SA 4HBTA 4CQHA 1RGYA 2HGVA 2JE5A 4Y2FA 1TVFA 5GLBA 4KZ3A 2XH9A 4OOYA 1KGFA 4C3QA 2YKHA 3ZG9B 2Y2IA 4GHIA 2Y2JA 4N1HA 4DF6A 3E4PA 4WZ4A 4CJNA 2V0UA 2JKFA 1XJ2A 3NDEA 4EQIA 1S67L 1GSXA 1Q2PA 2JN7A 4ZRRA 2DRWA 3ITAA 2WZZA 4OLDA 3T4TA 3MXQA 1GA0A 5I5LA 1SDNA 1XFNA 1G6OA 3VP1A 4BBTA 4DKIA 1NRJA 1BZAA 2EXBA 4RX3A 3KYEA 5FDHA 4JGOA 3E98A 2J8YA 3LO7A 2EX2A 4E6XA 4FTXA 4Q8IA 1BLHA 2A3UA 3IQAA 2B02A 4OQGA 4I39A 3Q07A 2ZD8A 3OPLA 4QJGA 4JF4A 3F1NA 4WZ5A 1L0EA 4PM8A 1L0GA 3V50A 2R9XA 2Y2QA 5L07A 1P9WA 4WEJA 3G35A 1GHPA 5F5YA 4MDZA 3N8SA 3UY6A 3V3SA 1Y54A 3C5AA 2PHYA 4M4XA 3TW8A 3LIEA 2ZMFA 3N4IA 1PZOA 2Y91A 5F83A 5GLDA 3SW1A 4WEKA 2INWA 4HI4A 4G3KA 4XT2A 5DFYA 2LB5A 2X01A 3A0VA 2GZAA 3LIBA 1T1AA 4WBGA 3ITBA 2K31A 2K2NA 3N8RA 4L9EA 2WK0A 3PBNA 2O0YA 3C4PA 1EW0A 3G6OA 3S1YA 3VOLA 1Z09A 2O9AA 2Z6DA 3LR5A 3GR2A 5FQMA 2IA2A 4S2KA 2OAQ1 1N9OA 1XFQA 1K54C 3B47A 3AGDA 2OV5A 4MN7A 5F1FA 3MZFA 3KSGA 3Q1FA 3LR4A 3UDXA 2RL3A 2Y2GA 3VSLA 1K56A 2H5SA 4UA7A 2I72A 3PTEA 5HWTA 1XGIA 2HP6A 2HDSA 3GRJA 2ZC7A 5CHMA 1IYOA 1K6SA 1PFLA 3IWQA 4EWFA 1KE3A 5FAOA 4YWZA 3MQ0A 3G31A 1LSXA 2OSUA 3WS2A 1G5UA 1OMEA 1QMFA 1KDSA 3T4KA 1SHVA 2XROA 4DE1A 2B5RA 3VP4A 3PAGA 3QP1A 3IH9A 4ARZA 4BL3A 4R3AA 4S2LA 3DW0A 2CC1A 5EM0A 1WYCA 5EVLA 4DXCA 1JWPA 4HP4A 2OLUA 1M6KA 1MY8A 4KG6A 1PI5A 4NXEA 1XXMA 2HP5A 4KUKA 1DJCA 2ZMVA 1DRMA 2QKPA 4KG2A 3KSIA 4GKUA 2HP9A 5M18A 1CI8A 2W27A 5AQ7A 1D06A 2EWWA 3UE1A 3IT9A 2J3TC 3D9YA 2WKQA 3A3EA 1OT6A 2Z6CA 4DE2A 3ZFZA 4R70A 4PM6A 5TR7A 3GQZA 3TOIA 4LCLA 3EEAA 1LL9A 3MMHA 4EEPA 1FILA 3BW6A 2DMWA 2V8CA 3ZG8B 3MZEA 3WS1A 5EFWA 5EPHA 4JGPA 3K3CA 3VE4A 3VP3A 1MWSA 2PRFA 3GVBA 3A0RA 1H8ZA 3DTIA 3HUNA 3C7UA 3BRMA 1E3UA 4DXBA 2ZOIA 3ZHHA 2DCFA 4E04A 1YKDA 2QHKA 3IXBA 1XJ4A 4MLLA 3UMDA 5CEDA 3KO6A 4ZAMA 5CHJA 2KDKA 5CGXA 3CG5A 5A8BA 2V1BA 3NY4A 2H0TA 2MJ6A 2E8IA 3P7NA 4PM7A 2P74A 3A0SA 2PT7A 4G3VA 4P6BA 4II7A 2G2WA 3HCYA 4RA7A 4H8RA 5DTKA 2NUPC 4H6JA 1M40A 3T4OA 2PR5A 3IHAA 1IKIA 3S7QA 4P6ZM 2ZM0A 3SH9A 1H0MA 1MKMA 3BEBA 1LT0A 3JYIA 4R4SA 4IHQA 4WELA 5HPIA 3IBJA 2KX6A 3EWKA 5HFOA 4EBPA 3DTEA 5E2FA 4Y17A 3C7VA 1TDLA 4CLCA 3G2YA 3GECA 1VETA 5CXWA 4WF0A 1LI9A 4K0XA 3MZDA 4ID4A 4E3OA 1G6AA 1WA9A 2HJEA 5AQBA 3C2WA 4NETA 3Q7VB 2Y2HA 4YOFA 3UE3A 4XUXA 1KE0A 4B9OA 2P9VB 4U0TA 5E2HA 2O99A 2B95A 4R1GA 1BLPA 3MS6A 3UDIA 4KZ8A 2R78A 4GHIB 2WKEA 4DE3A 2EX6A 3PBRA 3FPVA 3CJMA 3WRTA 3CAXA 1O7EA 1PNEA 3OPPA 3NOTC 2VLGA 3ZNTA 3BLSA 1BLCA 1DJAA 3UO9A 3A3FA 4Y3IA 5AJGA 2ZQDA 1BT5A 4UAAA 4EV4A 2PYRA 5HL1A 3LIFA 5D3OA 2Y2PA 2W3DA 4LRYC 2ZMAA 1DY6A 4N92A 4LCMA 1LLBA 1W5DA 4R3JA 3NOPC 4EUZA 4NG2A 3LR3A 2XFSA 4KZAA 3SOIA 4NXGA 3MXRA 3DTKA 3LY4A 3F1NB 3P09A 1ZG4A 3DWKA 4QB8A 3WRZA 3C8CA 3UB7A 3FC7A 4R4RA 1YLJA 4L0LA 3WWXA 2XF3A 3JVVA 3OCNA 2XFTA 1GCEA 2KLIA 3HJKA 1AWIA 3WS0A 1KDWA 2W3EA 2Z2LB 5TGFA 3ZYTA 1T19A 3DAVA 1K57C 4NXFA 2JBFA 3VP2A 2PR6A 5A92A 4LV0A 1BUEA 3SS5A 4XT2B 3BY9A 3HBRA 3CWFA 1CEGA 4BBVA 1IYSA 2Y2LA 3E0YA 4S2OA 4GCZA 3IBRA 2ACGA 1I5QA 1TS0A 2HF6A 3BFDA 4FH4A 1N4OA 1OTBA 5GHZA 1S0WA 5HSQA 3FKWA 2M7UA 2BTFP 3B33A 1XJ6A 3O3VA 2YKFA 3G2ZA 4EETB 1E25A 1A0KA 1FQGA 1O07A 3MXSA 1CK3A 4DN0A 3HLCA 5AVEA 4DE0A 3IXGA 3V3RA 3BFEA 4OQ0A 3UPNA 5CTNA 3FWLA 1IELA 2C6WB 1YPRA 1OTIA 1K4EA 4E3NA 5L2FA 5DF7A 2Y55A 3IH8A 3IF6A 2ZQCA 5HAIA 1ZTUA 3RTYA 2EXAA 2ZOHA 4Y7PA 4EESA 2Y2NA 5DVAA 4GW9A 3K3DA 5EVIA 2XD1A 1F98A 2H0YA 5CECA 3E4QA 3HLEA 4ARZB 2O9BA 3NC8A 2VEAA 5L10A 1L3LA 4BJPA 4I5SA 4JGRA 4O0PA 4S2NA 5HAPA 2W0NA 1NYYA 2Y59A 4JXGA 3HJIA 1MPLA 1J3WA 2J80A 2O9CA 5E2EA 5MC7A 1F5MA 2JC7A 1FSYA 2VK3A 4BMWA 5LBRA 2HZ5A 3PBOA 4YNRA 4LENA 3MQQA 1TS8A 2V9AA 3QNBA 4Y15A 2H28A 4KG5A 4P6ZS 4DJ2A 2G2UA 2A2LA 3MKEA 3KX0X 2W3FA 4R23A 1ES3A 3CZDA 5FDSA 1S1YA 1LL5A 3F1PA 4X1LA 1ESUA 1P9RA 1W7FA 3ZDJA 2J9OA 2ZM2A 4WMCD 3ZVWA 2HDRA 4HIAA 4HEFA 4GDBA 4GS9A 1D7EA 1G28A 1H8YA 2AVXA 4Q0IA 2OWJA 3HUMA 1E4DA 4F3LA 1BYWA 3BLMA 2XQZA 1ES5A 4MN5A 3S4XA 4R3BA 3G34A 2OWHA 4L9GA 4JXWA 3UB9A 1FR1A 1ZHHB 1T1BA 1EROA 3PR6A 3D4FA 1ES4A 1K25A 1W63M 5TBMA 2XK1A 3BECA 3IS2A 2V1ZA 3W4QA 1NJ4A 2QPNA 1PI4A 1VB6A 3T4JA 5DJTA 3KSFA 1TDGA 1NRFA 1V9ZA 4UQIM 4H6JB 2M1CA 1PW1A 4KZBA 1ONHA 1MBLA 2JKRM 4S2MA 1OJ5A 4X56A 2Y2OA 4Y0TA 4O7DA 3T4LA 2ZQ9A 4GJ4A 3QP8A 3FZCA 4CLCC 2WGVA 2EFXA 1MWUA 4OQHA 3E2LA 3M6BA 3CUEA 4S2PA 1H5XA 1L0DA 2W3HA 2OAP1 5FEGA 1PYYA 3DBAA 5FAQA 4CLCB 4MBHA 1VETB 4GD6A 2JKRI 4X55A 1RP5A 2GNXA 1N9BA 3MBZA 2M7VA 3N7WA 1MWTA 1FIKA 3NHQA 5EUAA 4LGWA 3G4PA 4QWOA 5FEFA 2XA7M 3KYQA 2WUQA 4D2OA 1BULA 1XGJA 1YSQA 1PWCA 3UB8A 4HJ3A 3VMAA 1HVBA 3S22A 3D3OA 2Y2MA 2Y4AA 4LV3A 4QU3A 1KE4A 3L7HA 3HLFA 1GHIA 4C6YA 1K6RA 2PDRA 5IS1A 5AQAA 4GN2A 3T4SA 1U60A 5CGWA 4X25A 4JGQA 1WYBA 1H3QA 3P98A 5EV0A 4X1MA 2PU4A 3ZVTA 2D02A 1ES2A 3SH8A 4WUJA 1JTDA 3A3DA 3M2KA 4OLGA 4ESPA 3T4QA 1PRQA 4EU0A 4LFUA 4HNBA 1OTEA 1VEUA 2QWSA 3T1RA 3Q82A 3A3JA 1GSVA 1TS7A 3Q7ZA 1K38A 4XUZA 2B18A 1LL8A 5CEBA 2XLNA 1GHMA 5AVFA 2ZQ7A 3T1QB 2QMIA 1JWZA 3TRCA 1YLPA 4Q0JA 4LRXC 1NZOA 4GNUA 4X6TA 3QP4A 2X71A 3D72A 3ZGAB 5FQQA 1NZUA 4EUVA 1SKFA 4GLQA 3CITA 3RFBA 1RCJA 4Z1WA 3ICYA 1XJ3A 1K0KA 5TFQA 4FCFA 4WYYA 5I94A 2Q0OA 4JPMA 2PBYA 1ERQA 4E3MA 1EI5A 2WAFA 3TE8A 3ZG0A 2ZM8A 4F94A 3M2JA 1VQQA 3NJAA 5HDCA 1YLZA 4N1XA 5EM1A 1Y4OA 5BOHA 5GHXA 5FATA 1NLYA 2LB9A 4LPZA 3CPTA 2I9VA 1PWGA 3CHWP 5DJUA 1HZOA 1NXYA 3H9WA 2ZC4B 2E8JA 3MQOA 2XEPA 3C30A 1C3BA 4MMNA 5CGSA 4RQ9A 4PMAA 3LEZA 3G30A 3IF6C 3UB5P 5IT5A 3M6HA 2HDQA 3A3IA 4N9KA 2FFFB 4QY5A 3IF6B 3DWZA 5EVIC 4I3AA 2ZL1A 1UWNX 1STZA 3TG9A 1NWZA 4L9FA 3GTCA 5M1AA 2WGIA 5EVIB 4RX2A 4YINA 2Y8HA 1ODVA 4S2NC 4HQAA 5HWWA 4HH3A 1YLTA 1LSWA 3LYXA 5FI2A 1T18A 2IWBA 3FV7A 3IXHA 3PBQA 4BBUA 2FH5A 2EX8A 4EBNA 5IHVA 1MKIA 4C75A 5HARA 2KOIA 2ZC6B 4LV2A 3W2ZA 3B3XA 3IWIA 3VOZA 1QMEA 1UWPX 3NDGA 2PD8A 2VV8A 4HBUA 1LHYA 2W1TA 2WADA 5J4EA 4UQIS 4U0XA 1OPXA 3G32A 2L0WA 3HUOA 2ZLYA 4OPZA 5J8XA 3LY3A 1W8YA 1FCNA 3CI6A 3U2AA 1CQAA 1OJGA 1S6RA 4I38A 4UA9A 1KOUA 4Z9QA 3PHYA 4K91A 5EVEA 4WN5A 4WZ5C 1S1ZA 3LUQA 1JVJA 2ZC3B 1DJBA 3PBTA 3V5MA 3C4OA 3KSHA 3BWLA 3F1PB 4XXRA 5DF9A 5A90A 3UDFA 2XDMA 4HH2A 1DP9A 2V1AA 3GDIA 2PD7A 4CLCD 4FOFA 4GS9B 1NLZA 4ZJ3A 4M3KA 2VGLM 2WKPA 5DTTA 3VE3A 3WS4A 4F3LB 2CMNA 5U47A 2XA7S 4S2JA
chains in the Genus database with same CATH topology
3G31A 4KG5A 1CEFA 2OSUA 5KMWA 2G2UA 3WS2A 2EX9A 3MKEA 3N6IA 1ERMA 1ALQA 1OMEA 4RVAA 1ONGA 1QMFA 1KDSA 1EWZA 2VGKA 2VGJA 5FQKA 1SHVA 1KGEA 4R23A 3OZHA 4DE1A 1ES3A 2B5RA 3VP4A 2WYXA 1RGZA 3PAGA 3IH9A 4BQMA 4BL3A 3VFHA 3CZDA 4S2LA 3DW0A 2CC1A 1BSGA 1FR6A 1WYCA 4JXSA 5EVLA 4WM9A 4DXCA 1JWPA 1LL5A 2WKHA 4IBRA 1ESUA 2WGWB 1W7FA 3ZDJA 2OLUA 4Y0UA 2J9OA 4S2IA 1K54A 2ZM2A 4WMCD 3SS4A 1M6KA 1IEMA 1MY8A 4IVKA 4KG6A 3ZVWA 2HDRA 1IYPA 3E2KA 1PI5A 4HEFA 1W79A 1XXMA 4GDBA 4A5RA 2HP5A 2V20A 3NI9A 2HDUA 1DJCA 5A91A 2XR0A 1H8YA 1FSWA 2ZC5B 3NBLA 3N8LA 3MKFA 3UPOA 3HUMA 1E4DA 4KG2A 5CHUA 3NIAA 3BFGA 5FQIA 3BLMA 1NY0A 4GKUA 2XQZA 4KQOA 3VOYA 1ES5A 2ZJ9A 3S4XA 2HP9A 3RJUA 1E3UD 4R3BA 1JTGA 1TEMA 4OOLA 5M18A 2UWXA 3G34A 1CI8A 3O88A 4JF6A 3NCKA 3WS5A 5AQ7A 3UE1A 3IT9A 3TSGA 4JXWA 3AGEA 3ISGA 1FR1A 1GA9A 3A3EA 1BLSA 4IVIA 4UA6A 4DE2A 1HTZA 1EROA 2Z2MB 5FASA 3ZFZA 3D4FA 4BL2A 1ES4A 1K25A 4PM6A 5TR7A 3DTMA 3GQZA 2XK1A 3TOIA 4LCLA 1KVMA 4X53A 3BECA 5GL9A 4E3KA 1LL9A 2V1ZA 3PAEA 3ZG7B 2WGWA 3BYDA 3W4QA 4OOMA 4EBLA 1NJ4A 4WMCA 1YT4A 2QPNA 4E3IA 2EFUA 1PI4A 3ZG8B 2PU2A 3MZEA 4B88A 3WS1A 3FKVA 1MXOA 4OPYA 5EPHA 4JLFA 1TDGA 1NRFA 2IWCA 1I2WA 3VP3A 3BFFA 2QZ6A 1MWSA 3GVBA 3FYZA 3HL9A 1PW1A 4KZBA 4E3JA 1H8ZA 1ONHA 1MBLA 2Y2KA 3HUNA 3C7UA 4S2MA 3UNWA 3ZG5A 4X56A 3BRMA 2Y2OA 3HVFA 4Y0TA 1E3UA 4O7DA 1J9MA 2ZQ9A 2WAEA 3UN7A 1XA7A 4DXBA 3FZCA 1Z6FA 5DF8A 3ZHHA 2WGVA 2EFXA 1MWUA 2DCFA 2P9VA 2A49A 2R9WA 3QHYA 4OQHA 5CERA 3E2LA 3M6BA 4S2PA 4HESA 1H5XA 1L0DA 3IXBA 1PIOA 3O87A 5EECA 3V39A 4MLLA 1PYYA 3HLBA 4FSFA 4MBHA 5FAQA 5CEDA 4K0WA 5CHJA 4ZAMA 4PM5A 4E3LA 2J9PA 5EOOA 4BLMA 4OPQA 4FD8A 5CGXA 3CG5A 3QNCA 4KENB 4GD6A 1CI9A 1FCOA 1PWDA 1FCMA 1XKZA 2E8IA 2H0TA 3NY4A 3OC2A 4PM7A 5HW3A 2P74A 4X55A 4KZ9A 1RP5A 5EE8A 1N9BA 1BTLA 3MBZA 4OP8A 5F82A 1K4FA 1FOFA 3N7WA 5CTMA 4MBFA 1MWRA 4P6BA 3VSKA 5KSCA 1MWTA 2G2WA 4DDSA 5EUAA 4OVDA 2H10A 4H8RA 4RA7A 5CRFA 3G4PA 5DTKA 3EQUA 4MNRA 4P85A 5G18A 1M40A 4OONA 4MEZA 1G68A 4U3TA 3PBSA 3IHAA 1IKIA 1KVLA 2WUQA 4D2OA 2Q9NA 4IEDA 1BULA 4OKPA 5HX9A 1XGJA 2ZM0A 1XX2A 3SH9A 1PW8A 2ZQAA 4X68A 4ZBEA 1PWCA 2WZXA 3HLDA 3BEBA 3GMWA 3VMAA 1WE4A 1ZG6A 2BG1A 1W8QA 1HVBA 4GOGA 2HPBA 3S22A 2GDNA 3JYIA 2Y2MA 4R4SA 2Y4AA 5EOEA 3IHBA 4R0QA 4LV3A 4WELA 3ZCZA 5AQ9A 4P0MA 4QU3A 1KE4A 4ZTKA 5HFOA 4EBPA 5E2FA 4OH0A 5M19A 3C7VA 3HLFA 1GHIA 1TDLA 3W4OA 4ZDXA 3G2YA 4C6YA 1K6RA 2IWDA 4JKTA 3VFFA 1YMSA 5CXWA 1LI9A 4K0XA 3MZDA 4ID4A 5FI6A 3W4PA 5AQAA 4GN2A 4E3OA 4KQQA 4YFMA 1G6AA 3OPHA 1U60A 4PPRA 5AQBA 5CGWA 4NETA 4GZBA 2FFYA 2X02A 1Q2QA 3Q7VB 1WYBA 3P98A 3I7JA 3MFDA 3RXWA 4KZ5A 2PU4A 3SS3A 2Y2HA 3ZVTA 3UE3A 1PZPA 1KE0A 4XUXA 1ES2A 3SH8A 4CPKA 1JTDA 3ZNYA 2P9VB 3A3DA 3M2KA 4U0TA 4ZJ1A 4BD1A 4OLGA 5EVID 5E2HA 3BM6A 5JYPA 1YQSA 4KQRA 4R1GA 1BLPA 1VM1A 4JF5A 4JBFA 3Q82A 1XP4A 4MBKA 4QD4A 3UDIA 3A3JA 5JYOA 5FQ9A 4KZ8A 4XUZA 3Q7ZA 1K38A 4KZ4A 1SDEA 5CEBA 2XLNA 1K55C 1SCWA 3IXDA 2WKEA 1GHMA 2EX6A 3PBRA 4DE3A 2BLSA 5GLCA 3CJMA 4QHCA 1YLWA 2ZQ7A 3WRTA 1O7EA 5A93A 4BENA 4KZ6A 3OPPA 2QMIA 1JWZA 1IYQA 4NK3A 1K57A 3BFCA 5HAQA 1YLPA 3GV9A 4IBXA 2DNSA 1NZOA 3ZNTA 4GNUA 3BLSA 1BLCA 1DJAA 3CMZA 4X6TA 3UO9A 2X71A 3A3FA 3ZGAB 1ZKJA 4QY6A 5FQQA 5FAPA 2XD5A 3RXXA 2ZQDA 4OP5A 1BT5A 1NZUA 5FQJA 3W8KA 3Q7VA 3OCLA 1LI0A 1L0FA 1SKFA 4UAAA 4EV4A 5KZHA 5HL1A 3UPPA 1I2SA 4HBTA 1RCJA 1RGYA 2Y2PA 5D3OA 2C5WB 2JE5A 3IWOA 2ZMAA 5TFQA 4FCFA 1DY6A 4N92A 5GHYA 5KSHA 1TVFA 5GLBA 4BD0A 4LCMA 4KZ3A 1LLBA 4WYYA 5I94A 4Y0OA 1W5DA 4GD8A 4R3JA 2XH9A 4JPMA 4JXVA 2ZQ8A 2PBYA 1ERQA 4E3MA 4EUZA 3IF5A 1EI5A 4OOYA 2WAFA 2XFSA 4KZAA 3ZG0A 1KGFA 3SOIA 2ZM8A 4C3QA 4ZJ2A 3HLGA 3MXRA 3ZG9B 4F94A 3M2JA 3SH7A 2Y2IA 3EQVA 1VQQA 3LY4A 2Y2JA 4N1HA 4DF6A 3P09A 1ZG4A 4WZ4A 4CJNA 3DWKA 1YLZA 4FH2A 4N1XA 3NDEA 4QB8A 3WRZA 1YMXA 4EQIA 4R4RA 5BOHA 1Q2PA 1YLJA 2DRWA 4L0LA 1K55A 3ITAA 2WZZA 1L2SA 4OLDA 1GA0A 5GHXA 1HD8A 3WWXA 1SDNA 2XF3A 5FATA 5FSRA 3VP1A 3OCNA 2XFTA 1GCEA 4DKIA 1BZAA 2EXBA 3WS0A 1KDWA 4RX3A 1KGGA 1PWGA 2Z2LB 3UE0A 5TGFA 5FDHA 4DDYA 2J8YA 1HZOA 1NXYA 1K57C 2ZC4B 3LO7A 2EX2A 4E6XA 2JBFA 2XEPA 1C3BA 3VP2A 5A92A 5CGSA 4LV0A 1BUEA 3SS5A 1BLHA 4Q8IA 2A3UA 2V2FF 3IQAA 4OQGA 3HBRA 4PMAA 3Q07A 3LEZA 3G30A 3IF6C 5GLAA 2ZD8A 1CEGA 1XA1A 3OPLA 3AGFA 2JCHA 4QJGA 4JF4A 4WZ5A 4GDNA 1L0EA 3M6HA 2HDQA 4PM8A 1L0GA 3A3IA 4N9KA 3V50A 2FFFB 4QY5A 2R9XA 1IYSA 2Y2QA 3DWZA 2Y2LA 3IF6B 4S2OA 4UHUA 5E43A 5EVIC 4B4ZA 4GB7A 4WEJA 3TG9A 3O86A 3G35A 1GHPA 1I5QA 3GTCA 2J7VA 3BFDA 5M1AA 2WGIA 3N8SA 3Q81A 5EVIB 4FH4A 4RX2A 3UY6A 1N4OA 3V3SA 1Y54A 3C5AA 4YINA 5GHZA 1S0WA 4PM9A 4X69A 4S2NC 1XPBA 3FKWA 3LCEA 1YLTA 2XGNA 3O3VA 1NYMA 5FI2A 2IWBA 5DTSA 3FV7A 3IXHA 3HLWA 3G2ZA 3N4IA 1PZOA 3OPRA 3VP0A 2Y91A 3PBQA 1E25A 5F83A 1AXBA 1FQGA 1O07A 3MXSA 2EX8A 1CK3A 4OQIA 3HLCA 2Q9MA 5GLDA 4EBNA 5IHVA 1MKIA 4WEKA 5FI7A 4KZ7A 1IKGA 5HARA 4C75A 4DE0A 2ZC6B 3IXGA 4LV2A 2X01A 3B3XA 3IWIA 3BFEA 1K56D 4LV1A 3V3RA 3VOZA 1QMEA 4OQ0A 3NDGA 3UPNA 5CTNA 4WBGA 3ITBA 3FWLA 4HBUA 1IELA 1ESIA 1LHYA 2C6WB 3N8RA 2WADA 2WK0A 3PBNA 1K4EA 3C4PA 4E3NA 5L2FA 4S2JA 5DF7A 2Y55A 3S1YA 3IH8A 3IF6A 2ZQCA 4U0XA 5HAIA 3G32A 3HUOA 2ZLYA 2EXAA 4OPZA 4OPRA 5J8XA 4Y7PA 3LY3A 1W8YA 1FCNA 2Y2NA 5DVAA 3GR2A 5FQMA 5EVIA 1S6RA 2XD1A 4RYEA 4UA9A 1JWVA 4Z9QA 4S2KA 4K91A 4E6WA 2H0YA 4WZ5C 5CECA 4N9LA 5FA7A 3HLEA 3NC8A 1JVJA 1K54C 2ZC3B 1DJBA 3AGDA 3PBTA 2OV5A 3V5MA 4BJPA 5F1FA 3MZFA 3C4OA 4S2NA 5HAPA 3Q1FA 1NYYA 4XXRA 5DF9A 5A90A 3UDFA 2Y59A 5E2GA 2XDMA 4JXGA 1MPLA 3UDXA 2RL3A 1ZC2A 2Y2GA 3VSLA 1K56A 2H5SA 4UA7A 5E2EA 1YLYA 2I72A 3PTEA 1YM1A 1XGIA 2JC7A 1FSYA 2HP6A 2HDSA 3HREA 5F1GA 4ZJ3A 2WKIA 4B4XA 3GRJA 2RCXA 4M3KA 2ZC7A 5CHMA 5DTTA 4DRTA 3WS4A 3GSGA 2OLVA 3PBOA 1IYOA 1K6SA 5U47A 3IWQA 4LENA 4EWFA 1KE3A 5FAOA 4P87A 3QNBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3G31 A;  4KG5 A;  1CEF A;  2OSU A;  5KMW A;  2G2U A;  3WS2 A;  2EX9 A;  3MKE A;  3N6I A;  1ERM A;  1ALQ A;  1OME A;  4RVA A;  1ONG A;  1QMF A;  1KDS A;  1EWZ A;  2VGK A;  2VGJ A;  5FQK A;  1SHV A;  1KGE A;  4R23 A;  3OZH A;  4DE1 A;  1ES3 A;  2B5R A;  3VP4 A;  2WYX A;  1RGZ A;  3PAG A;  3IH9 A;  4BQM A;  4BL3 A;  3VFH A;  3CZD A;  4S2L A;  3DW0 A;  2CC1 A;  1BSG A;  1FR6 A;  1WYC A;  4JXS A;  5EVL A;  4WM9 A;  4DXC A;  1JWP A;  1LL5 A;  2WKH A;  4IBR A;  1ESU A;  2WGW B;  1W7F A;  3ZDJ A;  2OLU A;  4Y0U A;  2J9O A;  4S2I A;  1K54 A;  2ZM2 A;  4WMC D;  3SS4 A;  1M6K A;  1IEM A;  1MY8 A;  4IVK A;  4KG6 A;  3ZVW A;  2HDR A;  1IYP A;  3E2K A;  1PI5 A;  4HEF A;  1W79 A;  1XXM A;  4GDB A;  4A5R A;  2HP5 A;  2V20 A;  3NI9 A;  2HDU A;  1DJC A;  5A91 A;  2XR0 A;  1H8Y A;  1FSW A;  2ZC5 B;  3NBL A;  3N8L A;  3MKF A;  3UPO A;  3HUM A;  1E4D A;  4KG2 A;  5CHU A;  3NIA A;  3BFG A;  5FQI A;  3BLM A;  1NY0 A;  4GKU A;  2XQZ A;  4KQO A;  3VOY A;  1ES5 A;  2ZJ9 A;  3S4X A;  2HP9 A;  3RJU A;  1E3U D;  4R3B A;  1JTG A;  1TEM A;  4OOL A;  5M18 A;  2UWX A;  3G34 A;  1CI8 A;  3O88 A;  4JF6 A;  3NCK A;  3WS5 A;  5AQ7 A;  3UE1 A;  3IT9 A;  3TSG A;  4JXW A;  3AGE A;  3ISG A;  1FR1 A;  1GA9 A;  3A3E A;  1BLS A;  4IVI A;  4UA6 A;  4DE2 A;  1HTZ A;  1ERO A;  2Z2M B;  5FAS A;  3ZFZ A;  3D4F A;  4BL2 A;  1ES4 A;  1K25 A;  4PM6 A;  5TR7 A;  3DTM A;  3GQZ A;  2XK1 A;  3TOI A;  4LCL A;  1KVM A;  4X53 A;  3BEC A;  5GL9 A;  4E3K A;  1LL9 A;  2V1Z A;  3PAE A;  3ZG7 B;  2WGW A;  3BYD A;  3W4Q A;  4OOM A;  4EBL A;  1NJ4 A;  4WMC A;  1YT4 A;  2QPN A;  4E3I A;  2EFU A;  1PI4 A;  3ZG8 B;  2PU2 A;  3MZE A;  4B88 A;  3WS1 A;  3FKV A;  1MXO A;  4OPY A;  5EPH A;  4JLF A;  1TDG A;  1NRF A;  2IWC A;  1I2W A;  3VP3 A;  3BFF A;  2QZ6 A;  1MWS A;  3GVB A;  3FYZ A;  3HL9 A;  1PW1 A;  4KZB A;  4E3J A;  1H8Z A;  1ONH A;  1MBL A;  2Y2K A;  3HUN A;  3C7U A;  4S2M A;  3UNW A;  3ZG5 A;  4X56 A;  3BRM A;  2Y2O A;  3HVF A;  4Y0T A;  1E3U A;  4O7D A;  1J9M A;  2ZQ9 A;  2WAE A;  3UN7 A;  1XA7 A;  4DXB A;  3FZC A;  1Z6F A;  5DF8 A;  3ZHH A;  2WGV A;  2EFX A;  1MWU A;  2DCF A;  2P9V A;  2A49 A;  2R9W A;  3QHY A;  4OQH A;  5CER A;  3E2L A;  3M6B A;  4S2P A;  4HES A;  1H5X A;  1L0D A;  3IXB A;  1PIO A;  3O87 A;  5EEC A;  3V39 A;  4MLL A;  1PYY A;  3HLB A;  4FSF A;  4MBH A;  5FAQ A;  5CED A;  4K0W A;  5CHJ A;  4ZAM A;  4PM5 A;  4E3L A;  2J9P A;  5EOO A;  4BLM A;  4OPQ A;  4FD8 A;  5CGX A;  3CG5 A;  3QNC A;  4KEN B;  4GD6 A;  1CI9 A;  1FCO A;  1PWD A;  1FCM A;  1XKZ A;  2E8I A;  2H0T A;  3NY4 A;  3OC2 A;  4PM7 A;  5HW3 A;  2P74 A;  4X55 A;  4KZ9 A;  1RP5 A;  5EE8 A;  1N9B A;  1BTL A;  3MBZ A;  4OP8 A;  5F82 A;  1K4F A;  1FOF A;  3N7W A;  5CTM A;  4MBF A;  1MWR A;  4P6B A;  3VSK A;  5KSC A;  1MWT A;  2G2W A;  4DDS A;  5EUA A;  4OVD A;  2H10 A;  4H8R A;  4RA7 A;  5CRF A;  3G4P A;  5DTK A;  3EQU A;  4MNR A;  4P85 A;  5G18 A;  1M40 A;  4OON A;  4MEZ A;  1G68 A;  4U3T A;  3PBS A;  3IHA A;  1IKI A;  1KVL A;  2WUQ A;  4D2O A;  2Q9N A;  4IED A;  1BUL A;  4OKP A;  5HX9 A;  1XGJ A;  2ZM0 A;  1XX2 A;  3SH9 A;  1PW8 A;  2ZQA A;  4X68 A;  4ZBE A;  1PWC A;  2WZX A;  3HLD A;  3BEB A;  3GMW A;  3VMA A;  1WE4 A;  1ZG6 A;  2BG1 A;  1W8Q A;  1HVB A;  4GOG A;  2HPB A;  3S22 A;  2GDN A;  3JYI A;  2Y2M A;  4R4S A;  2Y4A A;  5EOE A;  3IHB A;  4R0Q A;  4LV3 A;  4WEL A;  3ZCZ A;  5AQ9 A;  4P0M A;  4QU3 A;  1KE4 A;  4ZTK A;  5HFO A;  4EBP A;  5E2F A;  4OH0 A;  5M19 A;  3C7V A;  3HLF A;  1GHI A;  1TDL A;  3W4O A;  4ZDX A;  3G2Y A;  4C6Y A;  1K6R A;  2IWD A;  4JKT A;  3VFF A;  1YMS A;  5CXW A;  1LI9 A;  4K0X A;  3MZD A;  4ID4 A;  5FI6 A;  3W4P A;  5AQA A;  4GN2 A;  4E3O A;  4KQQ A;  4YFM A;  1G6A A;  3OPH A;  1U60 A;  4PPR A;  5AQB A;  5CGW A;  4NET A;  4GZB A;  2FFY A;  2X02 A;  1Q2Q A;  3Q7V B;  1WYB A;  3P98 A;  3I7J A;  3MFD A;  3RXW A;  4KZ5 A;  2PU4 A;  3SS3 A;  2Y2H A;  3ZVT A;  3UE3 A;  1PZP A;  1KE0 A;  4XUX A;  1ES2 A;  3SH8 A;  4CPK A;  1JTD A;  3ZNY A;  2P9V B;  3A3D A;  3M2K A;  4U0T A;  4ZJ1 A;  4BD1 A;  4OLG A;  5EVI D;  5E2H A;  3BM6 A;  5JYP A;  1YQS A;  4KQR A;  4R1G A;  1BLP A;  1VM1 A;  4JF5 A;  4JBF A;  3Q82 A;  1XP4 A;  4MBK A;  4QD4 A;  3UDI A;  3A3J A;  5JYO A;  5FQ9 A;  4KZ8 A;  4XUZ A;  3Q7Z A;  1K38 A;  4KZ4 A;  1SDE A;  5CEB A;  2XLN A;  1K55 C;  1SCW A;  3IXD A;  2WKE A;  1GHM A;  2EX6 A;  3PBR A;  4DE3 A;  2BLS A;  5GLC A;  3CJM A;  4QHC A;  1YLW A;  2ZQ7 A;  3WRT A;  1O7E A;  5A93 A;  4BEN A;  4KZ6 A;  3OPP A;  2QMI A;  1JWZ A;  1IYQ A;  4NK3 A;  1K57 A;  3BFC A;  5HAQ A;  1YLP A;  3GV9 A;  4IBX A;  2DNS A;  1NZO A;  3ZNT A;  4GNU A;  3BLS A;  1BLC A;  1DJA A;  3CMZ A;  4X6T A;  3UO9 A;  2X71 A;  3A3F A;  3ZGA B;  1ZKJ A;  4QY6 A;  5FQQ A;  5FAP A;  2XD5 A;  3RXX A;  2ZQD A;  4OP5 A;  1BT5 A;  1NZU A;  5FQJ A;  3W8K A;  3Q7V A;  3OCL A;  1LI0 A;  1L0F A;  1SKF A;  4UAA A;  4EV4 A;  5KZH A;  5HL1 A;  3UPP A;  1I2S A;  4HBT A;  1RCJ A;  1RGY A;  2Y2P A;  5D3O A;  2C5W B;  2JE5 A;  3IWO A;  2ZMA A;  5TFQ A;  4FCF A;  1DY6 A;  4N92 A;  5GHY A;  5KSH A;  1TVF A;  5GLB A;  4BD0 A;  4LCM A;  4KZ3 A;  1LLB A;  4WYY A;  5I94 A;  4Y0O A;  1W5D A;  4GD8 A;  4R3J A;  2XH9 A;  4JPM A;  4JXV A;  2ZQ8 A;  2PBY A;  1ERQ A;  4E3M A;  4EUZ A;  3IF5 A;  1EI5 A;  4OOY A;  2WAF A;  2XFS A;  4KZA A;  3ZG0 A;  1KGF A;  3SOI A;  2ZM8 A;  4C3Q A;  4ZJ2 A;  3HLG A;  3MXR A;  3ZG9 B;  4F94 A;  3M2J A;  3SH7 A;  2Y2I A;  3EQV A;  1VQQ A;  3LY4 A;  2Y2J A;  4N1H A;  4DF6 A;  3P09 A;  1ZG4 A;  4WZ4 A;  4CJN A;  3DWK A;  1YLZ A;  4FH2 A;  4N1X A;  3NDE A;  4QB8 A;  3WRZ A;  1YMX A;  4EQI A;  4R4R A;  5BOH A;  1Q2P A;  1YLJ A;  2DRW A;  4L0L A;  1K55 A;  3ITA A;  2WZZ A;  1L2S A;  4OLD A;  1GA0 A;  5GHX A;  1HD8 A;  3WWX A;  1SDN A;  2XF3 A;  5FAT A;  5FSR A;  3VP1 A;  3OCN A;  2XFT A;  1GCE A;  4DKI A;  1BZA A;  2EXB A;  3WS0 A;  1KDW A;  4RX3 A;  1KGG A;  1PWG A;  2Z2L B;  3UE0 A;  5TGF A;  5FDH A;  4DDY A;  2J8Y A;  1HZO A;  1NXY A;  1K57 C;  2ZC4 B;  3LO7 A;  2EX2 A;  4E6X A;  2JBF A;  2XEP A;  1C3B A;  3VP2 A;  5A92 A;  5CGS A;  4LV0 A;  1BUE A;  3SS5 A;  1BLH A;  4Q8I A;  2A3U A;  2V2F F;  3IQA A;  4OQG A;  3HBR A;  4PMA A;  3Q07 A;  3LEZ A;  3G30 A;  3IF6 C;  5GLA A;  2ZD8 A;  1CEG A;  1XA1 A;  3OPL A;  3AGF A;  2JCH A;  4QJG A;  4JF4 A;  4WZ5 A;  4GDN A;  1L0E A;  3M6H A;  2HDQ A;  4PM8 A;  1L0G A;  3A3I A;  4N9K A;  3V50 A;  2FFF B;  4QY5 A;  2R9X A;  1IYS A;  2Y2Q A;  3DWZ A;  2Y2L A;  3IF6 B;  4S2O A;  4UHU A;  5E43 A;  5EVI C;  4B4Z A;  4GB7 A;  4WEJ A;  3TG9 A;  3O86 A;  3G35 A;  1GHP A;  1I5Q A;  3GTC A;  2J7V A;  3BFD A;  5M1A A;  2WGI A;  3N8S A;  3Q81 A;  5EVI B;  4FH4 A;  4RX2 A;  3UY6 A;  1N4O A;  3V3S A;  1Y54 A;  3C5A A;  4YIN A;  5GHZ A;  1S0W A;  4PM9 A;  4X69 A;  4S2N C;  1XPB A;  3FKW A;  3LCE A;  1YLT A;  2XGN A;  3O3V A;  1NYM A;  5FI2 A;  2IWB A;  5DTS A;  3FV7 A;  3IXH A;  3HLW A;  3G2Z A;  3N4I A;  1PZO A;  3OPR A;  3VP0 A;  2Y91 A;  3PBQ A;  1E25 A;  5F83 A;  1AXB A;  1FQG A;  1O07 A;  3MXS A;  2EX8 A;  1CK3 A;  4OQI A;  3HLC A;  2Q9M A;  5GLD A;  4EBN A;  5IHV A;  1MKI A;  4WEK A;  5FI7 A;  4KZ7 A;  1IKG A;  5HAR A;  4C75 A;  4DE0 A;  2ZC6 B;  3IXG A;  4LV2 A;  2X01 A;  3B3X A;  3IWI A;  3BFE A;  1K56 D;  4LV1 A;  3V3R A;  3VOZ A;  1QME A;  4OQ0 A;  3NDG A;  3UPN A;  5CTN A;  4WBG A;  3ITB A;  3FWL A;  4HBU A;  1IEL A;  1ESI A;  1LHY A;  2C6W B;  3N8R A;  2WAD A;  2WK0 A;  3PBN A;  1K4E A;  3C4P A;  4E3N A;  5L2F A;  4S2J A;  5DF7 A;  2Y55 A;  3S1Y A;  3IH8 A;  3IF6 A;  2ZQC A;  4U0X A;  5HAI A;  3G32 A;  3HUO A;  2ZLY A;  2EXA A;  4OPZ A;  4OPR A;  5J8X A;  4Y7P A;  3LY3 A;  1W8Y A;  1FCN A;  2Y2N A;  5DVA A;  3GR2 A;  5FQM A;  5EVI A;  1S6R A;  2XD1 A;  4RYE A;  4UA9 A;  1JWV A;  4Z9Q A;  4S2K A;  4K91 A;  4E6W A;  2H0Y A;  4WZ5 C;  5CEC A;  4N9L A;  5FA7 A;  3HLE A;  3NC8 A;  1JVJ A;  1K54 C;  2ZC3 B;  1DJB A;  3AGD A;  3PBT A;  2OV5 A;  3V5M A;  4BJP A;  5F1F A;  3MZF A;  3C4O A;  4S2N A;  5HAP A;  3Q1F A;  1NYY A;  4XXR A;  5DF9 A;  5A90 A;  3UDF A;  2Y59 A;  5E2G A;  2XDM A;  4JXG A;  1MPL A;  3UDX A;  2RL3 A;  1ZC2 A;  2Y2G A;  3VSL A;  1K56 A;  2H5S A;  4UA7 A;  5E2E A;  1YLY A;  2I72 A;  3PTE A;  1YM1 A;  1XGI A;  2JC7 A;  1FSY A;  2HP6 A;  2HDS A;  3HRE A;  5F1G A;  4ZJ3 A;  2WKI A;  4B4X A;  3GRJ A;  2RCX A;  4M3K A;  2ZC7 A;  5CHM A;  5DTT A;  4DRT A;  3WS4 A;  3GSG A;  2OLV A;  3PBO A;  1IYO A;  1K6S A;  5U47 A;  3IWQ A;  4LEN A;  4EWF A;  1KE3 A;  5FAO A;  4P87 A;  3QNB A; 
#chains in the Genus database with same CATH topology
 2XSS A;  3T1X A;  2W3G A;  3BY8 A;  5DKK A;  2EX9 A;  1ONG A;  5FQK A;  1EWZ A;  2VGK A;  4ME4 A;  3VFH A;  1CF0 A;  2G7U A;  5TBM B;  4JXS A;  3IS2 B;  5L8M A;  2WKH A;  4IBR A;  1ACF A;  2A24 A;  5K5B A;  4Y0U A;  3SS4 A;  2V0W A;  4IVK A;  3H82 A;  3E2K A;  1IYP A;  5TJJ A;  2L4R A;  1W79 A;  4A5R A;  2V20 A;  2HDU A;  4R6L A;  3F1O A;  3MKF A;  4WL9 A;  5CHU A;  3IX4 A;  3NIA A;  5FQI A;  5HDD A;  1NY0 A;  4KQO A;  1D1J A;  3RJU A;  1JTG A;  1TEM A;  4OOL A;  3UB6 A;  4JF6 A;  3NCK A;  1S4R A;  2BAS A;  3TSG A;  3AGE A;  3VV4 A;  1GA9 A;  5FAS A;  2Z2M B;  3CLO A;  2EA9 A;  2P7J A;  2VJW A;  4BL2 A;  2J3T D;  3DTM A;  1KVM A;  3PAE A;  3ZG7 B;  2WGW A;  4EBL A;  4WMC A;  1IOU A;  4JLF A;  3L9K A;  1I2W A;  3BFF A;  3HL9 A;  3KYZ A;  3MR0 A;  5G4Z A;  4E3J A;  2OOL A;  1TD5 A;  3IX8 A;  2V8F A;  3S7P A;  3ZG5 A;  1J9M A;  1N9N A;  3QP2 A;  3JPU A;  2P9V A;  3QHY A;  5CER A;  3O87 A;  3T50 A;  2FZ0 A;  3HLB A;  4FSF A;  4PM5 A;  4E3L A;  2J9P A;  3QP6 A;  2W1R A;  1CI9 A;  3ULF A;  1FCM A;  1XKZ A;  4NKP A;  3SZT A;  1VHM A;  4Q0H A;  4OP8 A;  3LR0 A;  1K4F A;  1FOF A;  1MWR A;  2VX8 A;  4IJG A;  4P85 A;  1YSP A;  5G18 A;  4OON A;  4MEZ A;  1G68 A;  1KVL A;  1VEU B;  2Q9N A;  4IED A;  4IUH A;  4OKP A;  5HX9 A;  1XX2 A;  5HD5 A;  1MZU A;  4ZBE A;  2WZX A;  3HLD A;  5HD3 A;  1WE4 A;  1ZG6 A;  4DRT A;  2HPB A;  4WLA A;  5EOE A;  2JKT M;  3IHB A;  4R0Q A;  1CJF A;  5AQ9 A;  3RH8 B;  4P0M A;  4OH0 A;  4MCW A;  5M19 A;  3W4O A;  4ZDX A;  2IWD A;  5G4Y A;  5FI6 A;  3W4P A;  4HHD A;  2HV1 A;  4KQQ A;  4EER A;  2K7S A;  4PPR A;  3S7N A;  1JNU A;  4GZB A;  2X02 A;  1P97 A;  3S7O A;  3MFD A;  3RXW A;  4KZ5 A;  4DJ3 A;  5CX7 A;  4DMZ A;  2JKT I;  4CPK A;  5EVI D;  3BM6 A;  4KQR A;  4JF5 A;  4HJ4 A;  5JYO A;  4QD4 A;  4KZ4 A;  1HLU P;  1SCW A;  4ETZ A;  5GLC A;  1YLW A;  3OLO A;  5A93 A;  4BEN A;  4KZ6 A;  1IFQ A;  2JHE A;  4NK3 A;  1K57 A;  3BFC A;  3GV9 A;  2DNS A;  3EOI A;  4R38 A;  1SKO A;  2P08 A;  4BWI A;  3T12 B;  1ZKJ A;  3CPT B;  4QY6 A;  3W8K A;  4O01 A;  3OCL A;  1L0F A;  4PKY A;  4UEY A;  2C5W B;  2PAV P;  3R7W A;  3IWO A;  4PHT A;  4D60 A;  5GHY A;  5KSH A;  4BD0 A;  5L09 A;  4Y0O A;  4LRZ E;  4GD8 A;  4JXV A;  3H7W A;  2ZQ8 A;  3E4O A;  2JKG A;  3IF5 A;  1TS6 A;  3LGO A;  3O5Y A;  4ZJ2 A;  3HLG A;  3SH7 A;  3EQV A;  4LLO B;  4FH2 A;  2VV6 A;  3MF0 A;  1YMX A;  2ZL1 B;  3P01 A;  2VGL S;  1K55 A;  1L2S A;  4Y5F A;  1HD8 A;  5FSR A;  3MSH A;  1KGG A;  3UE0 A;  4DDY A;  3LIC A;  3LI8 A;  2VKS A;  1Y28 A;  2V2F F;  3PXP A;  3K2N A;  5GLA A;  1XA1 A;  1F9I A;  2ZBB A;  3AGF A;  3LEQ A;  4KQD A;  2JCH A;  2W1T B;  4GDN A;  2UV0 E;  5J7E A;  4AFI A;  4B4Z A;  4UHU A;  5E43 A;  4GB7 A;  3MFX A;  3O86 A;  2J7V A;  3Q81 A;  3BJN A;  4PM9 A;  4X69 A;  1XPB A;  3LCE A;  3UE6 A;  2XGN A;  2D01 A;  1NYM A;  2EWV A;  5DTS A;  3HLW A;  3R4K A;  3VP0 A;  3OPR A;  1AXB A;  4ETX A;  4OQI A;  2Q9M A;  5F6A A;  3T1S A;  5FI7 A;  4KZ7 A;  1IKG A;  3NEC A;  5HZH A;  3QP5 A;  4BD1 A;  4LV1 A;  1K56 D;  5DFX A;  1ESI A;  3BQA A;  3EGX C;  3B42 A;  2HJ9 C;  3NUL A;  1DP8 A;  3JVU A;  3TJZ C;  1X0O A;  4OPR A;  3UME A;  4E6W A;  4RYE A;  2VA0 A;  1JWV A;  4N9L A;  5FA7 A;  5IU1 A;  2A24 B;  3NOU C;  1V9Y A;  5E2G A;  1ZC2 A;  3H82 B;  1YLY A;  2Y79 A;  1YM1 A;  3HRE A;  5F1G A;  2WKI A;  4B4X A;  2RCX A;  3F1O B;  4PKY G;  4NXB A;  3GSG A;  2OLV A;  4HJ6 A;  2VZW A;  4P87 A;  3LIA A;  1CEF A;  5KMW A;  4EW7 A;  3N6I A;  1ERM A;  1ALQ A;  5HWV A;  4RVA A;  2PYP A;  2VGJ A;  1KGE A;  3OZH A;  1OTD A;  2WYX A;  1RGZ A;  4BQM A;  2QJ5 A;  1BSG A;  3BQ8 A;  1FR6 A;  5KIZ A;  4WM9 A;  2WGW B;  4EXO A;  4S2I A;  1K54 A;  1IEM A;  1OTA A;  2VV7 A;  3NI9 A;  5A91 A;  2XR0 A;  1FSW A;  1N9L A;  2ZC5 B;  3NBL A;  2P04 A;  3N8L A;  3EGD C;  3UPO A;  3BFG A;  1DP6 A;  3VOY A;  2ZJ9 A;  1E3U D;  3OBF A;  2UWX A;  3O88 A;  1H8M A;  3WS5 A;  4FUW A;  4HP9 A;  3ISG A;  2XRN A;  1GSW A;  1BLS A;  3FPW A;  4IVI A;  4MN6 A;  1HTZ A;  4UA6 A;  2GJ3 A;  1OT9 A;  4X53 A;  5GL9 A;  4E3K A;  5F68 A;  3BYD A;  3MJQ A;  4OOM A;  1YT4 A;  4E3I A;  2EFU A;  2J3W A;  2PU2 A;  4B88 A;  3FKV A;  1MXO A;  4OPY A;  4B93 A;  2WKR A;  2IWC A;  2QZ6 A;  4Y13 A;  4O8G A;  3FYZ A;  3C38 A;  3LID A;  4PAU A;  5C5K A;  4EEU A;  3UNW A;  2Y2K A;  4IUK A;  2L1M A;  3HVF A;  2WAE A;  3UN7 A;  1XA7 A;  1TF1 A;  1Z6F A;  5DF8 A;  2R9W A;  3PYP A;  2A49 A;  4HES A;  1PIO A;  5EEC A;  3V39 A;  5F69 A;  4QPR A;  4K0W A;  5EOO A;  4BLM A;  4OPQ A;  4FD8 A;  3LI9 A;  3QNC A;  5J3W A;  4KEN B;  1FCO A;  1PWD A;  3OC2 A;  5HW3 A;  1MC0 A;  4KZ9 A;  5EE8 A;  2PBD P;  1BTL A;  3U4L P;  1P0Z A;  5HPF A;  3IX3 A;  5F82 A;  5CTM A;  4MBF A;  3VSK A;  5KSC A;  4K08 A;  4DDS A;  4OVD A;  2H10 A;  4G3W A;  5CRF A;  3EQU A;  4MNR A;  1S4S A;  4U3T A;  4HOI A;  3PBS A;  1UGU A;  1F2K A;  1PW8 A;  2ZQA A;  4X68 A;  2GX5 A;  3GMW A;  5FL3 A;  1S66 L;  2BG1 A;  1W8Q A;  4GOG A;  3V67 A;  2GDN A;  4CLC E;  5HDS A;  3ZCZ A;  3FG8 A;  4ZTK A;  1SZV A;  4JKT A;  3VFF A;  1W63 Q;  1YMS A;  4HY8 A;  1SKO B;  4YFM A;  3OPH A;  2FFY A;  1Q2Q A;  3ZQ5 A;  2QJ7 A;  3CUE C;  3I7J A;  3SS3 A;  1PZP A;  3R7W B;  3ZNY A;  4ZJ1 A;  4I3I A;  5JYP A;  1YQS A;  3H7W B;  1VM1 A;  4JBF A;  4MBK A;  1XP4 A;  3EEH A;  5FQ9 A;  1SDE A;  1K55 C;  3IXD A;  2NUT C;  2BLS A;  5DKL A;  4QHC A;  3OOV A;  4EQ1 A;  2QYB A;  4I3J A;  3LFV A;  4KUO A;  1IYQ A;  5HAQ A;  4IBX A;  4NEE D;  3CMZ A;  1YAX A;  1T1C A;  5FAP A;  5HL6 A;  2XD5 A;  3RXX A;  1LSV A;  4OP5 A;  5FQJ A;  3Q7V A;  1LI0 A;  5KZH A;  3UPP A;  1I2S A;  4HBT A;  4CQH A;  1RGY A;  2HGV A;  2JE5 A;  4Y2F A;  1TVF A;  5GLB A;  4KZ3 A;  2XH9 A;  4OOY A;  1KGF A;  4C3Q A;  2YKH A;  3ZG9 B;  2Y2I A;  4GHI A;  2Y2J A;  4N1H A;  4DF6 A;  3E4P A;  4WZ4 A;  4CJN A;  2V0U A;  2JKF A;  1XJ2 A;  3NDE A;  4EQI A;  1S67 L;  1GSX A;  1Q2P A;  2JN7 A;  4ZRR A;  2DRW A;  3ITA A;  2WZZ A;  4OLD A;  3T4T A;  3MXQ A;  1GA0 A;  5I5L A;  1SDN A;  1XFN A;  1G6O A;  3VP1 A;  4BBT A;  4DKI A;  1NRJ A;  1BZA A;  2EXB A;  4RX3 A;  3KYE A;  5FDH A;  4JGO A;  3E98 A;  2J8Y A;  3LO7 A;  2EX2 A;  4E6X A;  4FTX A;  4Q8I A;  1BLH A;  2A3U A;  3IQA A;  2B02 A;  4OQG A;  4I39 A;  3Q07 A;  2ZD8 A;  3OPL A;  4QJG A;  4JF4 A;  3F1N A;  4WZ5 A;  1L0E A;  4PM8 A;  1L0G A;  3V50 A;  2R9X A;  2Y2Q A;  5L07 A;  1P9W A;  4WEJ A;  3G35 A;  1GHP A;  5F5Y A;  4MDZ A;  3N8S A;  3UY6 A;  3V3S A;  1Y54 A;  3C5A A;  2PHY A;  4M4X A;  3TW8 A;  3LIE A;  2ZMF A;  3N4I A;  1PZO A;  2Y91 A;  5F83 A;  5GLD A;  3SW1 A;  4WEK A;  2INW A;  4HI4 A;  4G3K A;  4XT2 A;  5DFY A;  2LB5 A;  2X01 A;  3A0V A;  2GZA A;  3LIB A;  1T1A A;  4WBG A;  3ITB A;  2K31 A;  2K2N A;  3N8R A;  4L9E A;  2WK0 A;  3PBN A;  2O0Y A;  3C4P A;  1EW0 A;  3G6O A;  3S1Y A;  3VOL A;  1Z09 A;  2O9A A;  2Z6D A;  3LR5 A;  3GR2 A;  5FQM A;  2IA2 A;  4S2K A;  2OAQ 1;  1N9O A;  1XFQ A;  1K54 C;  3B47 A;  3AGD A;  2OV5 A;  4MN7 A;  5F1F A;  3MZF A;  3KSG A;  3Q1F A;  3LR4 A;  3UDX A;  2RL3 A;  2Y2G A;  3VSL A;  1K56 A;  2H5S A;  4UA7 A;  2I72 A;  3PTE A;  5HWT A;  1XGI A;  2HP6 A;  2HDS A;  3GRJ A;  2ZC7 A;  5CHM A;  1IYO A;  1K6S A;  1PFL A;  3IWQ A;  4EWF A;  1KE3 A;  5FAO A;  4YWZ A;  3MQ0 A;  3G31 A;  1LSX A;  2OSU A;  3WS2 A;  1G5U A;  1OME A;  1QMF A;  1KDS A;  3T4K A;  1SHV A;  2XRO A;  4DE1 A;  2B5R A;  3VP4 A;  3PAG A;  3QP1 A;  3IH9 A;  4ARZ A;  4BL3 A;  4R3A A;  4S2L A;  3DW0 A;  2CC1 A;  5EM0 A;  1WYC A;  5EVL A;  4DXC A;  1JWP A;  4HP4 A;  2OLU A;  1M6K A;  1MY8 A;  4KG6 A;  1PI5 A;  4NXE A;  1XXM A;  2HP5 A;  4KUK A;  1DJC A;  2ZMV A;  1DRM A;  2QKP A;  4KG2 A;  3KSI A;  4GKU A;  2HP9 A;  5M18 A;  1CI8 A;  2W27 A;  5AQ7 A;  1D06 A;  2EWW A;  3UE1 A;  3IT9 A;  2J3T C;  3D9Y A;  2WKQ A;  3A3E A;  1OT6 A;  2Z6C A;  4DE2 A;  3ZFZ A;  4R70 A;  4PM6 A;  5TR7 A;  3GQZ A;  3TOI A;  4LCL A;  3EEA A;  1LL9 A;  3MMH A;  4EEP A;  1FIL A;  3BW6 A;  2DMW A;  2V8C A;  3ZG8 B;  3MZE A;  3WS1 A;  5EFW A;  5EPH A;  4JGP A;  3K3C A;  3VE4 A;  3VP3 A;  1MWS A;  2PRF A;  3GVB A;  3A0R A;  1H8Z A;  3DTI A;  3HUN A;  3C7U A;  3BRM A;  1E3U A;  4DXB A;  2ZOI A;  3ZHH A;  2DCF A;  4E04 A;  1YKD A;  2QHK A;  3IXB A;  1XJ4 A;  4MLL A;  3UMD A;  5CED A;  3KO6 A;  4ZAM A;  5CHJ A;  2KDK A;  5CGX A;  3CG5 A;  5A8B A;  2V1B A;  3NY4 A;  2H0T A;  2MJ6 A;  2E8I A;  3P7N A;  4PM7 A;  2P74 A;  3A0S A;  2PT7 A;  4G3V A;  4P6B A;  4II7 A;  2G2W A;  3HCY A;  4RA7 A;  4H8R A;  5DTK A;  2NUP C;  4H6J A;  1M40 A;  3T4O A;  2PR5 A;  3IHA A;  1IKI A;  3S7Q A;  4P6Z M;  2ZM0 A;  3SH9 A;  1H0M A;  1MKM A;  3BEB A;  1LT0 A;  3JYI A;  4R4S A;  4IHQ A;  4WEL A;  5HPI A;  3IBJ A;  2KX6 A;  3EWK A;  5HFO A;  4EBP A;  3DTE A;  5E2F A;  4Y17 A;  3C7V A;  1TDL A;  4CLC A;  3G2Y A;  3GEC A;  1VET A;  5CXW A;  4WF0 A;  1LI9 A;  4K0X A;  3MZD A;  4ID4 A;  4E3O A;  1G6A A;  1WA9 A;  2HJE A;  5AQB A;  3C2W A;  4NET A;  3Q7V B;  2Y2H A;  4YOF A;  3UE3 A;  4XUX A;  1KE0 A;  4B9O A;  2P9V B;  4U0T A;  5E2H A;  2O99 A;  2B95 A;  4R1G A;  1BLP A;  3MS6 A;  3UDI A;  4KZ8 A;  2R78 A;  4GHI B;  2WKE A;  4DE3 A;  2EX6 A;  3PBR A;  3FPV A;  3CJM A;  3WRT A;  3CAX A;  1O7E A;  1PNE A;  3OPP A;  3NOT C;  2VLG A;  3ZNT A;  3BLS A;  1BLC A;  1DJA A;  3UO9 A;  3A3F A;  4Y3I A;  5AJG A;  2ZQD A;  1BT5 A;  4UAA A;  4EV4 A;  2PYR A;  5HL1 A;  3LIF A;  5D3O A;  2Y2P A;  2W3D A;  4LRY C;  2ZMA A;  1DY6 A;  4N92 A;  4LCM A;  1LLB A;  1W5D A;  4R3J A;  3NOP C;  4EUZ A;  4NG2 A;  3LR3 A;  2XFS A;  4KZA A;  3SOI A;  4NXG A;  3MXR A;  3DTK A;  3LY4 A;  3F1N B;  3P09 A;  1ZG4 A;  3DWK A;  4QB8 A;  3WRZ A;  3C8C A;  3UB7 A;  3FC7 A;  4R4R A;  1YLJ A;  4L0L A;  3WWX A;  2XF3 A;  3JVV A;  3OCN A;  2XFT A;  1GCE A;  2KLI A;  3HJK A;  1AWI A;  3WS0 A;  1KDW A;  2W3E A;  2Z2L B;  5TGF A;  3ZYT A;  1T19 A;  3DAV A;  1K57 C;  4NXF A;  2JBF A;  3VP2 A;  2PR6 A;  5A92 A;  4LV0 A;  1BUE A;  3SS5 A;  4XT2 B;  3BY9 A;  3HBR A;  3CWF A;  1CEG A;  4BBV A;  1IYS A;  2Y2L A;  3E0Y A;  4S2O A;  4GCZ A;  3IBR A;  2ACG A;  1I5Q A;  1TS0 A;  2HF6 A;  3BFD A;  4FH4 A;  1N4O A;  1OTB A;  5GHZ A;  1S0W A;  5HSQ A;  3FKW A;  2M7U A;  2BTF P;  3B33 A;  1XJ6 A;  3O3V A;  2YKF A;  3G2Z A;  4EET B;  1E25 A;  1A0K A;  1FQG A;  1O07 A;  3MXS A;  1CK3 A;  4DN0 A;  3HLC A;  5AVE A;  4DE0 A;  3IXG A;  3V3R A;  3BFE A;  4OQ0 A;  3UPN A;  5CTN A;  3FWL A;  1IEL A;  2C6W B;  1YPR A;  1OTI A;  1K4E A;  4E3N A;  5L2F A;  5DF7 A;  2Y55 A;  3IH8 A;  3IF6 A;  2ZQC A;  5HAI A;  1ZTU A;  3RTY A;  2EXA A;  2ZOH A;  4Y7P A;  4EES A;  2Y2N A;  5DVA A;  4GW9 A;  3K3D A;  5EVI A;  2XD1 A;  1F98 A;  2H0Y A;  5CEC A;  3E4Q A;  3HLE A;  4ARZ B;  2O9B A;  3NC8 A;  2VEA A;  5L10 A;  1L3L A;  4BJP A;  4I5S A;  4JGR A;  4O0P A;  4S2N A;  5HAP A;  2W0N A;  1NYY A;  2Y59 A;  4JXG A;  3HJI A;  1MPL A;  1J3W A;  2J80 A;  2O9C A;  5E2E A;  5MC7 A;  1F5M A;  2JC7 A;  1FSY A;  2VK3 A;  4BMW A;  5LBR A;  2HZ5 A;  3PBO A;  4YNR A;  4LEN A;  3MQQ A;  1TS8 A;  2V9A A;  3QNB A;  4Y15 A;  2H28 A;  4KG5 A;  4P6Z S;  4DJ2 A;  2G2U A;  2A2L A;  3MKE A;  3KX0 X;  2W3F A;  4R23 A;  1ES3 A;  3CZD A;  5FDS A;  1S1Y A;  1LL5 A;  3F1P A;  4X1L A;  1ESU A;  1P9R A;  1W7F A;  3ZDJ A;  2J9O A;  2ZM2 A;  4WMC D;  3ZVW A;  2HDR A;  4HIA A;  4HEF A;  4GDB A;  4GS9 A;  1D7E A;  1G28 A;  1H8Y A;  2AVX A;  4Q0I A;  2OWJ A;  3HUM A;  1E4D A;  4F3L A;  1BYW A;  3BLM A;  2XQZ A;  1ES5 A;  4MN5 A;  3S4X A;  4R3B A;  3G34 A;  2OWH A;  4L9G A;  4JXW A;  3UB9 A;  1FR1 A;  1ZHH B;  1T1B A;  1ERO A;  3PR6 A;  3D4F A;  1ES4 A;  1K25 A;  1W63 M;  5TBM A;  2XK1 A;  3BEC A;  3IS2 A;  2V1Z A;  3W4Q A;  1NJ4 A;  2QPN A;  1PI4 A;  1VB6 A;  3T4J A;  5DJT A;  3KSF A;  1TDG A;  1NRF A;  1V9Z A;  4UQI M;  4H6J B;  2M1C A;  1PW1 A;  4KZB A;  1ONH A;  1MBL A;  2JKR M;  4S2M A;  1OJ5 A;  4X56 A;  2Y2O A;  4Y0T A;  4O7D A;  3T4L A;  2ZQ9 A;  4GJ4 A;  3QP8 A;  3FZC A;  4CLC C;  2WGV A;  2EFX A;  1MWU A;  4OQH A;  3E2L A;  3M6B A;  3CUE A;  4S2P A;  1H5X A;  1L0D A;  2W3H A;  2OAP 1;  5FEG A;  1PYY A;  3DBA A;  5FAQ A;  4CLC B;  4MBH A;  1VET B;  4GD6 A;  2JKR I;  4X55 A;  1RP5 A;  2GNX A;  1N9B A;  3MBZ A;  2M7V A;  3N7W A;  1MWT A;  1FIK A;  3NHQ A;  5EUA A;  4LGW A;  3G4P A;  4QWO A;  5FEF A;  2XA7 M;  3KYQ A;  2WUQ A;  4D2O A;  1BUL A;  1XGJ A;  1YSQ A;  1PWC A;  3UB8 A;  4HJ3 A;  3VMA A;  1HVB A;  3S22 A;  3D3O A;  2Y2M A;  2Y4A A;  4LV3 A;  4QU3 A;  1KE4 A;  3L7H A;  3HLF A;  1GHI A;  4C6Y A;  1K6R A;  2PDR A;  5IS1 A;  5AQA A;  4GN2 A;  3T4S A;  1U60 A;  5CGW A;  4X25 A;  4JGQ A;  1WYB A;  1H3Q A;  3P98 A;  5EV0 A;  4X1M A;  2PU4 A;  3ZVT A;  2D02 A;  1ES2 A;  3SH8 A;  4WUJ A;  1JTD A;  3A3D A;  3M2K A;  4OLG A;  4ESP A;  3T4Q A;  1PRQ A;  4EU0 A;  4LFU A;  4HNB A;  1OTE A;  1VEU A;  2QWS A;  3T1R A;  3Q82 A;  3A3J A;  1GSV A;  1TS7 A;  3Q7Z A;  1K38 A;  4XUZ A;  2B18 A;  1LL8 A;  5CEB A;  2XLN A;  1GHM A;  5AVF A;  2ZQ7 A;  3T1Q B;  2QMI A;  1JWZ A;  3TRC A;  1YLP A;  4Q0J A;  4LRX C;  1NZO A;  4GNU A;  4X6T A;  3QP4 A;  2X71 A;  3D72 A;  3ZGA B;  5FQQ A;  1NZU A;  4EUV A;  1SKF A;  4GLQ A;  3CIT A;  3RFB A;  1RCJ A;  4Z1W A;  3ICY A;  1XJ3 A;  1K0K A;  5TFQ A;  4FCF A;  4WYY A;  5I94 A;  2Q0O A;  4JPM A;  2PBY A;  1ERQ A;  4E3M A;  1EI5 A;  2WAF A;  3TE8 A;  3ZG0 A;  2ZM8 A;  4F94 A;  3M2J A;  1VQQ A;  3NJA A;  5HDC A;  1YLZ A;  4N1X A;  5EM1 A;  1Y4O A;  5BOH A;  5GHX A;  5FAT A;  1NLY A;  2LB9 A;  4LPZ A;  3CPT A;  2I9V A;  1PWG A;  3CHW P;  5DJU A;  1HZO A;  1NXY A;  3H9W A;  2ZC4 B;  2E8J A;  3MQO A;  2XEP A;  3C30 A;  1C3B A;  4MMN A;  5CGS A;  4RQ9 A;  4PMA A;  3LEZ A;  3G30 A;  3IF6 C;  3UB5 P;  5IT5 A;  3M6H A;  2HDQ A;  3A3I A;  4N9K A;  2FFF B;  4QY5 A;  3IF6 B;  3DWZ A;  5EVI C;  4I3A A;  2ZL1 A;  1UWN X;  1STZ A;  3TG9 A;  1NWZ A;  4L9F A;  3GTC A;  5M1A A;  2WGI A;  5EVI B;  4RX2 A;  4YIN A;  2Y8H A;  1ODV A;  4S2N C;  4HQA A;  5HWW A;  4HH3 A;  1YLT A;  1LSW A;  3LYX A;  5FI2 A;  1T18 A;  2IWB A;  3FV7 A;  3IXH A;  3PBQ A;  4BBU A;  2FH5 A;  2EX8 A;  4EBN A;  5IHV A;  1MKI A;  4C75 A;  5HAR A;  2KOI A;  2ZC6 B;  4LV2 A;  3W2Z A;  3B3X A;  3IWI A;  3VOZ A;  1QME A;  1UWP X;  3NDG A;  2PD8 A;  2VV8 A;  4HBU A;  1LHY A;  2W1T A;  2WAD A;  5J4E A;  4UQI S;  4U0X A;  1OPX A;  3G32 A;  2L0W A;  3HUO A;  2ZLY A;  4OPZ A;  5J8X A;  3LY3 A;  1W8Y A;  1FCN A;  3CI6 A;  3U2A A;  1CQA A;  1OJG A;  1S6R A;  4I38 A;  4UA9 A;  1KOU A;  4Z9Q A;  3PHY A;  4K91 A;  5EVE A;  4WN5 A;  4WZ5 C;  1S1Z A;  3LUQ A;  1JVJ A;  2ZC3 B;  1DJB A;  3PBT A;  3V5M A;  3C4O A;  3KSH A;  3BWL A;  3F1P B;  4XXR A;  5DF9 A;  5A90 A;  3UDF A;  2XDM A;  4HH2 A;  1DP9 A;  2V1A A;  3GDI A;  2PD7 A;  4CLC D;  4FOF A;  4GS9 B;  1NLZ A;  4ZJ3 A;  4M3K A;  2VGL M;  2WKP A;  5DTT A;  3VE3 A;  3WS4 A;  4F3L B;  2CMN A;  5U47 A;  2XA7 S;  4S2J A; 
#chains in the Genus database with same CATH homology
 3G31 A;  4KG5 A;  1CEF A;  2OSU A;  5KMW A;  2G2U A;  3WS2 A;  2EX9 A;  3MKE A;  3N6I A;  1ERM A;  1ALQ A;  1OME A;  4RVA A;  1ONG A;  1QMF A;  1KDS A;  1EWZ A;  2VGK A;  2VGJ A;  5FQK A;  1SHV A;  1KGE A;  4R23 A;  3OZH A;  4DE1 A;  1ES3 A;  2B5R A;  3VP4 A;  2WYX A;  1RGZ A;  3PAG A;  3IH9 A;  4BQM A;  4BL3 A;  3VFH A;  3CZD A;  4S2L A;  3DW0 A;  2CC1 A;  1BSG A;  1FR6 A;  1WYC A;  4JXS A;  5EVL A;  4WM9 A;  4DXC A;  1JWP A;  1LL5 A;  2WKH A;  4IBR A;  1ESU A;  2WGW B;  1W7F A;  3ZDJ A;  2OLU A;  4Y0U A;  2J9O A;  4S2I A;  1K54 A;  2ZM2 A;  4WMC D;  3SS4 A;  1M6K A;  1IEM A;  1MY8 A;  4IVK A;  4KG6 A;  3ZVW A;  2HDR A;  1IYP A;  3E2K A;  1PI5 A;  4HEF A;  1W79 A;  1XXM A;  4GDB A;  4A5R A;  2HP5 A;  2V20 A;  3NI9 A;  2HDU A;  1DJC A;  5A91 A;  2XR0 A;  1H8Y A;  1FSW A;  2ZC5 B;  3NBL A;  3N8L A;  3MKF A;  3UPO A;  3HUM A;  1E4D A;  4KG2 A;  5CHU A;  3NIA A;  3BFG A;  5FQI A;  3BLM A;  1NY0 A;  4GKU A;  2XQZ A;  4KQO A;  3VOY A;  1ES5 A;  2ZJ9 A;  3S4X A;  2HP9 A;  3RJU A;  1E3U D;  4R3B A;  1JTG A;  1TEM A;  4OOL A;  5M18 A;  2UWX A;  3G34 A;  1CI8 A;  3O88 A;  4JF6 A;  3NCK A;  3WS5 A;  5AQ7 A;  3UE1 A;  3IT9 A;  3TSG A;  4JXW A;  3AGE A;  3ISG A;  1FR1 A;  1GA9 A;  3A3E A;  1BLS A;  4IVI A;  4UA6 A;  4DE2 A;  1HTZ A;  1ERO A;  2Z2M B;  5FAS A;  3ZFZ A;  3D4F A;  4BL2 A;  1ES4 A;  1K25 A;  4PM6 A;  5TR7 A;  3DTM A;  3GQZ A;  2XK1 A;  3TOI A;  4LCL A;  1KVM A;  4X53 A;  3BEC A;  5GL9 A;  4E3K A;  1LL9 A;  2V1Z A;  3PAE A;  3ZG7 B;  2WGW A;  3BYD A;  3W4Q A;  4OOM A;  4EBL A;  1NJ4 A;  4WMC A;  1YT4 A;  2QPN A;  4E3I A;  2EFU A;  1PI4 A;  3ZG8 B;  2PU2 A;  3MZE A;  4B88 A;  3WS1 A;  3FKV A;  1MXO A;  4OPY A;  5EPH A;  4JLF A;  1TDG A;  1NRF A;  2IWC A;  1I2W A;  3VP3 A;  3BFF A;  2QZ6 A;  1MWS A;  3GVB A;  3FYZ A;  3HL9 A;  1PW1 A;  4KZB A;  4E3J A;  1H8Z A;  1ONH A;  1MBL A;  2Y2K A;  3HUN A;  3C7U A;  4S2M A;  3UNW A;  3ZG5 A;  4X56 A;  3BRM A;  2Y2O A;  3HVF A;  4Y0T A;  1E3U A;  4O7D A;  1J9M A;  2ZQ9 A;  2WAE A;  3UN7 A;  1XA7 A;  4DXB A;  3FZC A;  1Z6F A;  5DF8 A;  3ZHH A;  2WGV A;  2EFX A;  1MWU A;  2DCF A;  2P9V A;  2A49 A;  2R9W A;  3QHY A;  4OQH A;  5CER A;  3E2L A;  3M6B A;  4S2P A;  4HES A;  1H5X A;  1L0D A;  3IXB A;  1PIO A;  3O87 A;  5EEC A;  3V39 A;  4MLL A;  1PYY A;  3HLB A;  4FSF A;  4MBH A;  5FAQ A;  5CED A;  4K0W A;  5CHJ A;  4ZAM A;  4PM5 A;  4E3L A;  2J9P A;  5EOO A;  4BLM A;  4OPQ A;  4FD8 A;  5CGX A;  3CG5 A;  3QNC A;  4KEN B;  4GD6 A;  1CI9 A;  1FCO A;  1PWD A;  1FCM A;  1XKZ A;  2E8I A;  2H0T A;  3NY4 A;  3OC2 A;  4PM7 A;  5HW3 A;  2P74 A;  4X55 A;  4KZ9 A;  1RP5 A;  5EE8 A;  1N9B A;  1BTL A;  3MBZ A;  4OP8 A;  5F82 A;  1K4F A;  1FOF A;  3N7W A;  5CTM A;  4MBF A;  1MWR A;  4P6B A;  3VSK A;  5KSC A;  1MWT A;  2G2W A;  4DDS A;  5EUA A;  4OVD A;  2H10 A;  4H8R A;  4RA7 A;  5CRF A;  3G4P A;  5DTK A;  3EQU A;  4MNR A;  4P85 A;  5G18 A;  1M40 A;  4OON A;  4MEZ A;  1G68 A;  4U3T A;  3PBS A;  3IHA A;  1IKI A;  1KVL A;  2WUQ A;  4D2O A;  2Q9N A;  4IED A;  1BUL A;  4OKP A;  5HX9 A;  1XGJ A;  2ZM0 A;  1XX2 A;  3SH9 A;  1PW8 A;  2ZQA A;  4X68 A;  4ZBE A;  1PWC A;  2WZX A;  3HLD A;  3BEB A;  3GMW A;  3VMA A;  1WE4 A;  1ZG6 A;  2BG1 A;  1W8Q A;  1HVB A;  4GOG A;  2HPB A;  3S22 A;  2GDN A;  3JYI A;  2Y2M A;  4R4S A;  2Y4A A;  5EOE A;  3IHB A;  4R0Q A;  4LV3 A;  4WEL A;  3ZCZ A;  5AQ9 A;  4P0M A;  4QU3 A;  1KE4 A;  4ZTK A;  5HFO A;  4EBP A;  5E2F A;  4OH0 A;  5M19 A;  3C7V A;  3HLF A;  1GHI A;  1TDL A;  3W4O A;  4ZDX A;  3G2Y A;  4C6Y A;  1K6R A;  2IWD A;  4JKT A;  3VFF A;  1YMS A;  5CXW A;  1LI9 A;  4K0X A;  3MZD A;  4ID4 A;  5FI6 A;  3W4P A;  5AQA A;  4GN2 A;  4E3O A;  4KQQ A;  4YFM A;  1G6A A;  3OPH A;  1U60 A;  4PPR A;  5AQB A;  5CGW A;  4NET A;  4GZB A;  2FFY A;  2X02 A;  1Q2Q A;  3Q7V B;  1WYB A;  3P98 A;  3I7J A;  3MFD A;  3RXW A;  4KZ5 A;  2PU4 A;  3SS3 A;  2Y2H A;  3ZVT A;  3UE3 A;  1PZP A;  1KE0 A;  4XUX A;  1ES2 A;  3SH8 A;  4CPK A;  1JTD A;  3ZNY A;  2P9V B;  3A3D A;  3M2K A;  4U0T A;  4ZJ1 A;  4BD1 A;  4OLG A;  5EVI D;  5E2H A;  3BM6 A;  5JYP A;  1YQS A;  4KQR A;  4R1G A;  1BLP A;  1VM1 A;  4JF5 A;  4JBF A;  3Q82 A;  1XP4 A;  4MBK A;  4QD4 A;  3UDI A;  3A3J A;  5JYO A;  5FQ9 A;  4KZ8 A;  4XUZ A;  3Q7Z A;  1K38 A;  4KZ4 A;  1SDE A;  5CEB A;  2XLN A;  1K55 C;  1SCW A;  3IXD A;  2WKE A;  1GHM A;  2EX6 A;  3PBR A;  4DE3 A;  2BLS A;  5GLC A;  3CJM A;  4QHC A;  1YLW A;  2ZQ7 A;  3WRT A;  1O7E A;  5A93 A;  4BEN A;  4KZ6 A;  3OPP A;  2QMI A;  1JWZ A;  1IYQ A;  4NK3 A;  1K57 A;  3BFC A;  5HAQ A;  1YLP A;  3GV9 A;  4IBX A;  2DNS A;  1NZO A;  3ZNT A;  4GNU A;  3BLS A;  1BLC A;  1DJA A;  3CMZ A;  4X6T A;  3UO9 A;  2X71 A;  3A3F A;  3ZGA B;  1ZKJ A;  4QY6 A;  5FQQ A;  5FAP A;  2XD5 A;  3RXX A;  2ZQD A;  4OP5 A;  1BT5 A;  1NZU A;  5FQJ A;  3W8K A;  3Q7V A;  3OCL A;  1LI0 A;  1L0F A;  1SKF A;  4UAA A;  4EV4 A;  5KZH A;  5HL1 A;  3UPP A;  1I2S A;  4HBT A;  1RCJ A;  1RGY A;  2Y2P A;  5D3O A;  2C5W B;  2JE5 A;  3IWO A;  2ZMA A;  5TFQ A;  4FCF A;  1DY6 A;  4N92 A;  5GHY A;  5KSH A;  1TVF A;  5GLB A;  4BD0 A;  4LCM A;  4KZ3 A;  1LLB A;  4WYY A;  5I94 A;  4Y0O A;  1W5D A;  4GD8 A;  4R3J A;  2XH9 A;  4JPM A;  4JXV A;  2ZQ8 A;  2PBY A;  1ERQ A;  4E3M A;  4EUZ A;  3IF5 A;  1EI5 A;  4OOY A;  2WAF A;  2XFS A;  4KZA A;  3ZG0 A;  1KGF A;  3SOI A;  2ZM8 A;  4C3Q A;  4ZJ2 A;  3HLG A;  3MXR A;  3ZG9 B;  4F94 A;  3M2J A;  3SH7 A;  2Y2I A;  3EQV A;  1VQQ A;  3LY4 A;  2Y2J A;  4N1H A;  4DF6 A;  3P09 A;  1ZG4 A;  4WZ4 A;  4CJN A;  3DWK A;  1YLZ A;  4FH2 A;  4N1X A;  3NDE A;  4QB8 A;  3WRZ A;  1YMX A;  4EQI A;  4R4R A;  5BOH A;  1Q2P A;  1YLJ A;  2DRW A;  4L0L A;  1K55 A;  3ITA A;  2WZZ A;  1L2S A;  4OLD A;  1GA0 A;  5GHX A;  1HD8 A;  3WWX A;  1SDN A;  2XF3 A;  5FAT A;  5FSR A;  3VP1 A;  3OCN A;  2XFT A;  1GCE A;  4DKI A;  1BZA A;  2EXB A;  3WS0 A;  1KDW A;  4RX3 A;  1KGG A;  1PWG A;  2Z2L B;  3UE0 A;  5TGF A;  5FDH A;  4DDY A;  2J8Y A;  1HZO A;  1NXY A;  1K57 C;  2ZC4 B;  3LO7 A;  2EX2 A;  4E6X A;  2JBF A;  2XEP A;  1C3B A;  3VP2 A;  5A92 A;  5CGS A;  4LV0 A;  1BUE A;  3SS5 A;  1BLH A;  4Q8I A;  2A3U A;  2V2F F;  3IQA A;  4OQG A;  3HBR A;  4PMA A;  3Q07 A;  3LEZ A;  3G30 A;  3IF6 C;  5GLA A;  2ZD8 A;  1CEG A;  1XA1 A;  3OPL A;  3AGF A;  2JCH A;  4QJG A;  4JF4 A;  4WZ5 A;  4GDN A;  1L0E A;  3M6H A;  2HDQ A;  4PM8 A;  1L0G A;  3A3I A;  4N9K A;  3V50 A;  2FFF B;  4QY5 A;  2R9X A;  1IYS A;  2Y2Q A;  3DWZ A;  2Y2L A;  3IF6 B;  4S2O A;  4UHU A;  5E43 A;  5EVI C;  4B4Z A;  4GB7 A;  4WEJ A;  3TG9 A;  3O86 A;  3G35 A;  1GHP A;  1I5Q A;  3GTC A;  2J7V A;  3BFD A;  5M1A A;  2WGI A;  3N8S A;  3Q81 A;  5EVI B;  4FH4 A;  4RX2 A;  3UY6 A;  1N4O A;  3V3S A;  1Y54 A;  3C5A A;  4YIN A;  5GHZ A;  1S0W A;  4PM9 A;  4X69 A;  4S2N C;  1XPB A;  3FKW A;  3LCE A;  1YLT A;  2XGN A;  3O3V A;  1NYM A;  5FI2 A;  2IWB A;  5DTS A;  3FV7 A;  3IXH A;  3HLW A;  3G2Z A;  3N4I A;  1PZO A;  3OPR A;  3VP0 A;  2Y91 A;  3PBQ A;  1E25 A;  5F83 A;  1AXB A;  1FQG A;  1O07 A;  3MXS A;  2EX8 A;  1CK3 A;  4OQI A;  3HLC A;  2Q9M A;  5GLD A;  4EBN A;  5IHV A;  1MKI A;  4WEK A;  5FI7 A;  4KZ7 A;  1IKG A;  5HAR A;  4C75 A;  4DE0 A;  2ZC6 B;  3IXG A;  4LV2 A;  2X01 A;  3B3X A;  3IWI A;  3BFE A;  1K56 D;  4LV1 A;  3V3R A;  3VOZ A;  1QME A;  4OQ0 A;  3NDG A;  3UPN A;  5CTN A;  4WBG A;  3ITB A;  3FWL A;  4HBU A;  1IEL A;  1ESI A;  1LHY A;  2C6W B;  3N8R A;  2WAD A;  2WK0 A;  3PBN A;  1K4E A;  3C4P A;  4E3N A;  5L2F A;  4S2J A;  5DF7 A;  2Y55 A;  3S1Y A;  3IH8 A;  3IF6 A;  2ZQC A;  4U0X A;  5HAI A;  3G32 A;  3HUO A;  2ZLY A;  2EXA A;  4OPZ A;  4OPR A;  5J8X A;  4Y7P A;  3LY3 A;  1W8Y A;  1FCN A;  2Y2N A;  5DVA A;  3GR2 A;  5FQM A;  5EVI A;  1S6R A;  2XD1 A;  4RYE A;  4UA9 A;  1JWV A;  4Z9Q A;  4S2K A;  4K91 A;  4E6W A;  2H0Y A;  4WZ5 C;  5CEC A;  4N9L A;  5FA7 A;  3HLE A;  3NC8 A;  1JVJ A;  1K54 C;  2ZC3 B;  1DJB A;  3AGD A;  3PBT A;  2OV5 A;  3V5M A;  4BJP A;  5F1F A;  3MZF A;  3C4O A;  4S2N A;  5HAP A;  3Q1F A;  1NYY A;  4XXR A;  5DF9 A;  5A90 A;  3UDF A;  2Y59 A;  5E2G A;  2XDM A;  4JXG A;  1MPL A;  3UDX A;  2RL3 A;  1ZC2 A;  2Y2G A;  3VSL A;  1K56 A;  2H5S A;  4UA7 A;  5E2E A;  1YLY A;  2I72 A;  3PTE A;  1YM1 A;  1XGI A;  2JC7 A;  1FSY A;  2HP6 A;  2HDS A;  3HRE A;  5F1G A;  4ZJ3 A;  2WKI A;  4B4X A;  3GRJ A;  2RCX A;  4M3K A;  2ZC7 A;  5CHM A;  5DTT A;  4DRT A;  3WS4 A;  3GSG A;  2OLV A;  3PBO A;  1IYO A;  1K6S A;  5U47 A;  3IWQ A;  4LEN A;  4EWF A;  1KE3 A;  5FAO A;  4P87 A;  3QNB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...