1D7EA

Crystal structure of the p65 crystal form of photoactive yellow protein
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
122
structure length
119
Chain Sequence
VAFGSEDIENTLAKMDDGQLDGLAFGAIQLDGDGNILQYNAAEGDITGRDPKQVIGKNFFKDVAPCTDSPEFYGKFKEGVASGNLNTMFEYTFDYQMTPTKVKVHMKKALSYWVFVKRV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Photosynthesis
molecule keywords PHOTOACTIVE YELLOW PROTEIN
publication title Conformational substates in different crystal forms of the photoactive yellow protein--correlation with theoretical and experimental flexibility.
pubmed rcsb
source organism Halorhodospira halophila
total genus 32
structure length 119
sequence length 122
ec nomenclature
pdb deposition date 1999-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00989 PAS PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 1d7eA00
3LI8A 1V9ZA 5J7EA 3MQQA 4HJ3A 3NOUC 2CMNA 5F5YA 3BWLA 3NHQA 1UWPX 4NXGA 1X0OA 2V1BA 3EWKA 4R70A 2WKRA 3C2WA 4WF0A 5HSQA 2WKQA 4B9OA 3NOTC 5DKKA 1DP8A 1S4SA 1UGUA 3LIEA 5AVFA 1N9LA 2V9AA 2Z6CA 4HY8A 4KUKA 4BBVA 2HV1A 4HQAA 3UB8A 3F1NA 3PHYA 2PYRA 4LLOB 5J3WA 5DJUA 5IU1A 2YKFA 4L9GA 3RH8B 4JGRA 3T50A 3IBRA 4GS9B 4NXBA 3E4PA 5A8BA 3MQOA 4I3AA 5HD3A 3ULFA 3LICA 4R3AA 1OTIA 5F68A 4L9FA 4JGPA 5HD5A 4LRXC 4MN6A 3RTYA 4NXFA 3PYPA 1T1CA 1T1AA 2VV7A 4WN5A 4R38A 1EW0A 4EQ1A 2QHKA 4EEUA 1ODVA 1TS8A 4PKYG 2M1CA 3ICYA 3LUQA 1JNUA 1DP9A 3H7WB 2PR5A 1XJ2A 4F3LB 1S66L 4I3IA 2PDRA 4KUOA 4HNBA 3E4OA 1P0ZA 2PYPA 1LL8A 3UMEA 3LIBA 4BBTA 2ZBBA 3CAXA 4EW7A 4GW9A 1LT0A 4GCZA 1TS0A 1GSVA 1XFNA 1OTDA 2OWJA 3MFXA 1T18A 2PHYA 4HJ6A 1OTEA 3H7WA 4F3LA 3KX0X 3UMDA 2INWA 5EFWA 3ZQ5A 2KX6A 5HDSA 3P7NA 5IS1A 4BBUA 1G28A 1XJ3A 3LIDA 5HWVA 4DJ2A 3E4QA 1LSWA 3OLOA 4L9EA 4WLAA 4WL9A 4HJ4A 2ZOHA 4XT2B 4RQ9A 1DP6A 2R78A 2A24B 3LIFA 3D72A 5G4ZA 1GSXA 4EEPA 2W27A 1S4RA 3H82B 4HH3A 4YWZA 1P97A 1N9OA 4M4XA 2YKHA 4GHIB 4I5SA 4HH2A 4E04A 3MJQA 2K7SA 2EA9A 4LRZE 1S1YA 4HOIA 5I5LA 1MZUA 1VB6A 5TBMB 3BY8A 4EERA 3H9WA 4PKYA 2QKPA 4GS9A 4H6JB 2V0WA 4XT2A 1S1ZA 4HP4A 2A24A 5F69A 5F6AA 4LRYC 3A0SA 1OT9A 3H82A 3B33A 1F98A 4JGOA 3G6OA 4I3JA 3VE3A 1S67L 3UB7A 2B02A 4HIAA 5AVEA 3C8CA 3F1PB 3MXQA 3HJKA 2WKPA 3CWFA 5TBMA 2V0UA 3SW1A 4R6LA 2JN7A 3K3DA 3MR0A 4H6JA 2PD8A 1OJ5A 1LSXA 2H28A 3F1NB 2VLGA 5J4EA 3UB6A 3UE6A 1T19A 1T1BA 2I9VA 2V1AA 1TS6A 4HP9A 2QJ7A 3GDIA 2L1MA 2VV6A 1Y28A 4HHDA 2L4RA 4JGQA 3F1PA 4I39A 3GECA 1OT6A 3BY9A 3K3CA 1WA9A 4K08A 1XFQA 1UWNX 2GJ3A 2QWSA 3FC7A 3F1OB 5KIZA 1TS7A 1D7EA 1F9IA 2PD7A 3HJIA 3LI9A 3IS2B 4MN5A 1LSVA 1OJGA 2QJ5A 1XJ4A 2L0WA 1OTBA 2KDKA 1NWZA 3NJAA 4KQDA 4NXEA 2D01A 5HWWA 5G4YA 1XJ6A 3UB9A 2JHEA 2ZOIA 5HDCA 4EESA 3A0RA 3F1OA 5HDDA 4EXOA 3CLOA 2Z6DA 3FG8A 3IS2A 1V9YA 4EETB 4I38A 1D06A 3LIAA 1OTAA 1DRMA 2VV8A 4GHIA 5HZHA 2VEAA 4LPZA 5DKLA 1GSWA 2J80A 3VE4A 3EEHA 4HI4A 1BYWA 5DJTA 1N9NA 4WUJA 3VOLA 2D02A 5HWTA 2OOLA 4DJ3A 2BASA 2PR6A 2P7JA 1KOUA 3LYXA 3NOPC 2W0NA 2OWHA 3A0VA
chains in the Genus database with same CATH superfamily
3U2AA 4PPRA 1SDEA 2ZLYA 1K54C 5J7EA 4Q8IA 1ZTUA 4XUZA 3L7HA 4Y2FA 2HDSA 3OBFA 2WKHA 3I7JA 3NOUC 2J3TD 3NHQA 4Y13A 1SKOB 2V1BA 3JVVA 1Z09A 4O7DA 3NOTC 1W79A 4LV2A 2P08A 4JXSA 3N7WA 3D3OA 2HV1A 2P9VB 4L0LA 1VQQA 3UDIA 4L9GA 2Y2NA 3T50A 4OQIA 1NRFA 4NXBA 1FOFA 3E4PA 3IXBA 4E3OA 2XH9A 2VA0A 3NULA 1LL9A 5FAPA 2B5RA 4R3AA 4WM9A 4JGPA 4E6XA 1SKOA 2GZAA 3Q07A 2ZQ9A 4KZ5A 2G2WA 4GDNA 1T1AA 2H0TA 3A3IA 4ZDXA 5GHZA 4FH4A 4BD1A 1IYQA 4EQ1A 3FPWA 2QHKA 4EEUA 1TS8A 4WYYA 1G6OA 5DFYA 4S2PA 3O87A 4S2LA 4X55A 1XJ2A 3T4OA 1S66L 1CF0A 2Y2PA 3DAVA 1XX2A 3IHBA 5FSRA 1GA9A 3KYQA 3ZG0A 3E4OA 2HP5A 3T4KA 2PYPA 4OH0A 2XSSA 3NDEA 3Q7ZA 2M7VA 3RJUA 3G2ZA 1O7EA 5EOEA 2M7UA 1LT0A 4WMCA 3QP6A 4GCZA 3TE8A 3G35A 4Y3IA 4YINA 3LGOA 4OOLA 5AQ7A 5KMWA 2OWJA 3R4KA 3MQ0A 5EPHA 3PBOA 4HBTA 3OCLA 1K0KA 4C75A 2WADA 3KX0X 5CHMA 2XD1A 2INWA 1BZAA 4X53A 1BSGA 3E2LA 3B3XA 3C4PA 2OV5A 4OPQA 2QMIA 5HAIA 4UQIM 4ZJ2A 1ES5A 3TJZC 4RX2A 4P6BA 4NEED 1F5MA 3WWXA 5MC7A 3FZCA 4BBUA 4IBRA 2G2UA 1MPLA 3BEBA 2X02A 5HWVA 3IXDA 3MFDA 2OAQ1 5F1GA 4S2IA 4HBUA 3M6BA 1K57C 2DCFA 4OLDA 3BFEA 2ZOHA 4KZBA 4XT2B 4RQ9A 1DP6A 1IYSA 4DE3A 1K4FA 2A24B 3LIFA 2PBDP 1GSXA 1ZC2A 1VM1A 4CLCC 3H82B 3TG9A 3O3VA 4ZAMA 1P97A 5A91A 1JWZA 4M4XA 5DF9A 5HL1A 2YKHA 3ZG8B 2PU2A 4ME4A 4I5SA 5HAPA 4ETZA 4LFUA 4O0PA 4LRZE 3WRTA 1MZUA 1VB6A 2ZMAA 4OKPA 4E3MA 4EERA 1PIOA 4UA6A 3H9WA 4PKYA 4GS9A 1M40A 3C38A 1K6SA 3MKEA 1PWCA 4XT2A 4HP4A 3NC8A 2A24A 4ID4A 3ZG5A 3UPPA 1H8YA 1YPRA 3A0SA 5FEFA 3H82A 4GOGA 1KVMA 1KGFA 1XA7A 3UO9A 3N8LA 4BJPA 5AVEA 3C8CA 1BLHA 4LGWA 3VOZA 2ZMFA 3MXQA 1IKGA 3HJKA 3CWFA 3PBSA 2V0UA 1YAXA 1JVJA 4R6LA 3LR0A 3K3DA 4MCWA 3VP1A 2R9WA 3F1NB 1LI9A 3OC2A 1YMSA 3VFHA 2XK1A 3EQVA 1HZOA 1DJBA 2QJ7A 5EVID 2L1MA 1K38A 5GLAA 2JE5A 3KSFA 4X1LA 3P98A 5M1AA 2UWXA 4JGQA 3C5AA 1STZA 1Q2PA 4U3TA 5CTMA 3TW8A 1WA9A 4Y0UA 5AQAA 1UWNX 2QWSA 3FC7A 3F1OB 2ACGA 1NY0A 5EV0A 4X1MA 3A3DA 1Q2QA 5GLBA 1GCEA 3HJIA 5FI6A 4R4SA 1H8MA 5FQ9A 4N9KA 4EBNA 5HL6A 4JPMA 3KSHA 1OTBA 1NWZA 4KQDA 2XD5A 1JTGA 4NXEA 1IELA 1PZPA 1K56A 3ISGA 2IWDA 1KGGA 5KSHA 2FFYA 3UB9A 2JHEA 4BLMA 2ZOIA 5CEBA 3F1OA 5F1FA 2WYXA 1PRQA 5C5KA 2Y2KA 2Y4AA 1FSYA 4EXOA 4NK3A 2Z6DA 1S0WA 1V9YA 4IJGA 5FDHA 3R7WB 5TFQA 3BFCA 3LIAA 3SS4A 3DTIA 1ZG6A 2XDMA 5DKLA 4NKPA 3DTMA 1XPBA 2WZZA 4JF4A 5CTNA 3EEHA 4KZ7A 2PRFA 5DJTA 4QD4A 1CEFA 1YLTA 3VOLA 2H0YA 2OOLA 1L0EA 4DKIA 4MNRA 4GJ4A 1CK3A 2PR6A 3CHWP 4OPRA 4E6WA 2WAEA 3LYXA 3SH9A 3IXGA 1BLCA 4WMCD 3RXWA 3FPVA 3LI8A 1V9ZA 1WYCA 5M19A 3BJNA 2ZQ8A 3MQQA 3R7WA 2JKFA 3C7VA 5F5YA 3BWLA 1UWPX 2HP6A 4NXGA 1X0OA 3BLMA 5HARA 4WF0A 5FATA 3IX4A 1U60A 3Q82A 2V2FF 4B9OA 1PW1A 4ZBEA 4OVDA 4ARZB 3HLGA 4U0XA 5EVIC 5DTSA 5GLDA 3OCNA 1DP8A 5FQKA 3PBTA 1SZVA 5AVFA 1IFQA 3LFVA 5DF7A 4HQAA 3OZHA 3PXPA 2C6WB 2Y2HA 5J3WA 1ZG4A 2YKFA 3HVFA 3CZDA 2OAP1 4S2JA 4G3WA 3MQOA 3IWQA 3ULFA 4CLCE 3LICA 1OTIA 5HD5A 4LRXC 1PZOA 4MN6A 3RTYA 4WZ5C 4WEKA 4ARZA 3ZG9B 2VV7A 2W3HA 3C7UA 2J9PA 4R38A 2V20A 1EW0A 3ZVWA 4Y7PA 3QNBA 4IVKA 3UE3A 5E43A 1CEGA 3LUQA 2Y2IA 5IT5A 4P0MA 2XGNA 1FQGA 4OOMA 2PDRA 3MS6A 3MF0A 2RCXA 4B88A 1PFLA 4KUOA 1ERMA 1P0ZA 3T4SA 5L8MA 5EUAA 3UMEA 4KZAA 4BBTA 3LR5A 2ZBBA 3JYIA 3CAXA 4EQIA 4EW7A 4E3KA 4JLFA 2H10A 3M6HA 4GW9A 1JWVA 3OPLA 1ES4A 2ZQCA 1HD8A 1OTDA 2O99A 3AGEA 5A90A 1YLZA 4NETA 1OTEA 4WBGA 1MC0A 3UMDA 4MBKA 1IYPA 2VGLS 3CUEA 3MXSA 4LV1A 3B42A 2DRWA 3KO6A 1BUEA 2W3FA 3IWOA 4R1GA 5FQQA 4PM9A 4S2NC 3P01A 4B4XA 3IT9A 5HX9A 1G28A 3IF6B 1LLBA 1E25A 4IVIA 1RGYA 5FL3A 3QP2A 2Y2JA 4UAAA 2WUQA 4L9EA 1K4EA 2ZL1B 4WLAA 3NDGA 4WL9A 4HJ4A 3T1XA 1BLSA 1VEUB 3DW0A 5IHVA 1MKMA 4DE2A 4Z9QA 4ESPA 2WGVA 1K55C 5KZHA 1KDWA 4EEPA 4WELA 4Q0HA 3T4JA 2W27A 2ZM2A 3B47A 2JKRM 4HH3A 5A92A 4PAUA 4D60A 1F2KA 4DXCA 4GHIB 2PBYA 3IF6A 4X25A 4M3KA 3SZTA 3MJQA 2P9VA 3MKFA 5AQ9A 1S1YA 2ZL1A 1MY8A 4KG6A 2QKPA 1VEUA 2ZQAA 1YSPA 3G30A 3MZFA 5FI2A 2V0WA 4ZTKA 2J7VA 1WYBA 1W8QA 2V8CA 2ZM8A 4QY6A 1S6RA 4DF6A 5F6AA 3G4PA 5EM1A 1K56D 3IH9A 1OT9A 2HJEA 3T4LA 2EXBA 4I3JA 3VE3A 1ZKJA 3OPPA 4GN2A 3UB5P 2Y2QA 2JKTM 1D1JA 1EWZA 2VZWA 3GV9A 3SOIA 1I5QA 3F1PB 1GHMA 1FR1A 2WK0A 5AJGA 3T4QA 3O86A 5CGXA 1NJ4A 4EBLA 3LEQA 4DMZA 1MXOA 2R9XA 1YLWA 3S4XA 4NG2A 1NYYA 3V50A 4B4ZA 4OLGA 4IUKA 4QPRA 1PW8A 3UB6A 3UE6A 2V1AA 2I9VA 3BQAA 3CI6A 3DBAA 3GDIA 1YSQA 5LBRA 2J3TC 2VV6A 3PBNA 3V39A 4Q0JA 1FSWA 3F1PA 3GECA 3E98A 2LB9A 1VHMA 4FD8A 3BY9A 1CQAA 4HEFA 3RXXA 4IEDA 1TVFA 3HCYA 2XF3A 1ONHA 3HUMA 3KYZA 5F83A 4S2OA 2Q9NA 1TS7A 4FTXA 1D7EA 1F9IA 1IOUA 3BW6A 2PD7A 1OPXA 4R3JA 3WS2A 3GSGA 2P74A 1LSVA 1A0KA 1XJ4A 4BWIA 2L0WA 3SH7A 2KDKA 5EECA 3TRCA 3EGXC 3MSHA 4G3VA 2D01A 5K5BA 5G4YA 1P9RA 1XJ6A 1M6KA 3S7PA 1YM1A 4O01A 2HZ5A 3E2KA 2FFFB 2ZQ7A 3EOIA 3IQAA 1SCWA 4EWFA 3EGDC 5FI7A 4EESA 1ES3A 2VGJA 3E0YA 2J8YA 1RGZA 4Z1WA 3G34A 1BT5A 1EROA 2XR0A 5CRFA 2WZXA 5HDDA 4RYEA 1YKDA 5DVAA 4I38A 1H0MA 1XP4A 1AWIA 1DRMA 2VV8A 2VEAA 4LPZA 1L3LA 2PAVP 2Q9MA 3VE4A 4BENA 1BYWA 3ZNYA 3VP3A 4GD8A 2XFSA 5HPFA 4ZJ1A 2D02A 4BD0A 3VV4A 3UNWA 3VOYA 4CLCB 4Y0TA 3DTKA 3LCEA 5M18A 1KDSA 1HLUP 3LR4A 4AFIA 4Y15A 5E2EA 3TOIA 3NOPC 2W0NA 5FQJA 3UE0A 5FAOA 1VETB 4P87A 1ESIA 4R23A 4PM5A 4KZ6A 4PM7A 3W2ZA 2QPNA 2EX2A 4P85A 3GMWA 3GR2A 4HJ3A 3O88A 3P09A 3ZDJA 2VGLM 1XGJA 3NY4A 3EWKA 2XLNA 5DTTA 2WKRA 3C2WA 2DNSA 2XRNA 5HSQA 2O9BA 1KE4A 4KZ8A 1NXYA 4YFMA 3OPHA 4LV0A 4CLCA 3LIEA 1IKIA 5GL9A 2V9AA 4HY8A 2Z6CA 4KUKA 4CPKA 3F1NA 3PHYA 2Y59A 3PBQA 3HUNA 4K0XA 2XFTA 5IU1A 3K2NA 1VETA 4JGRA 4JF6A 3IBRA 2GNXA 3D9YA 1J3WA 5A8BA 5HD3A 4L9FA 3UY6A 1J9MA 4R0QA 3PYPA 4EUVA 1XA1A 3FKWA 3VFFA 4ZRRA 1H3QA 3MMHA 1GA0A 2JKRI 4WN5A 4OQ0A 1CI9A 3UDFA 1O07A 4EV4A 2M1CA 3ICYA 1JNUA 3CMZA 3H7WB 2EFXA 4F3LB 3ZFZA 2RL3A 4I3IA 2VK3A 3Q81A 4DN0A 4FUWA 4HNBA 1AXBA 5D3OA 3BYDA 1H8ZA 3LIBA 3MBZA 5HW3A 1FIKA 4CQHA 2A49A 2O9CA 1L0DA 3T1SA 3HLWA 4QJGA 4BMWA 2I72A 1TS0A 1ALQA 1ESUA 3V3SA 1XFNA 3MFXA 5FQIA 2JBFA 3HUOA 4HJ6A 3FKVA 2JKTI 2ZC4B 2E8JA 2EWVA 3H7WA 4F3LA 4LENA 2K31A 3GRJA 3ZQ5A 1YMXA 1W63Q 1Y4OA 2IWBA 3IX3A 1I2SA 1PNEA 2KX6A 5HDSA 3BFFA 1TEMA 3NCKA 2ZC3B 1I2WA 5L07A 2HDRA 3HBRA 1XJ3A 5U47A 1DJCA 3LIDA 1XGIA 4DJ2A 1LSWA 4DE1A 3OLOA 2W1TB 3IBJA 1RCJA 4X68A 3CUEC 1MKIA 2BG1A 4GDBA 3OOVA 2ZC5B 5I94A 2EX9A 2WGWB 4FOFA 1XKZA 5GHXA 3V67A 3D72A 5G4ZA 2LB5A 2XEPA 2Y2GA 1PWDA 3ZNTA 2O0YA 3MZDA 1SDNA 1N9OA 3N6IA 1IEMA 2HP9A 3M2KA 4OONA 3BLSA 4FSFA 2B95A 4E04A 3LR3A 2K7SA 5TR7A 4S2KA 2W1TA 4UEYA 4HOIA 2EX8A 5FEGA 3BY8A 3EQUA 2WGWA 3QP1A 4JBFA 5L10A 4H6JB 2V8FA 3PTEA 1XXMA 4KZ4A 5L09A 5EVIB 4LRYC 4YOFA 2NUTC 4DDYA 5HAQA 2QYBA 3B33A 3D4FA 1F98A 4JGOA 3O5YA 3KSGA 4S2MA 1FILA 3QP5A 5CGWA 4EU0A 3ZGAB 1FCNA 2WKPA 4JXWA 1FCOA 5DFXA 3SW1A 4E3LA 2ZJ9A 1NLYA 4QB8A 2JN7A 3GVBA 4P6ZS 5TGFA 3MR0A 4H6JA 5TJJA 2PD8A 4LCMA 2Y55A 1OJ5A 3ZVTA 2H5SA 5L2FA 4OQGA 5J4EA 3C4OA 4OP5A 5F82A 1T19A 1HVBA 4HP9A 2Y79A 4IUHA 4OP8A 2ZC7A 1Y28A 1PI5A 1L0FA 4Y17A 3HLDA 1ERQA 2HF6A 2Z2LB 1W7FA 1DY6A 3T1QB 4F94A 2UV0E 3CJMA 3ITAA 4K08A 3G2YA 1GHPA 5J8XA 3PBRA 1XFQA 4WZ5A 2GJ3A 5KIZA 4E3NA 4DXBA 4E3IA 4FH2A 4EUZA 4R4RA 4OPZA 5DTKA 3KSIA 4B93A 4CLCD 1W5DA 4WZ4A 3IS2B 4MN5A 2XA7S 4U0TA 1YLJA 4JF5A 5EM0A 3DWZA 1OJGA 2IA2A 4KG2A 3HL9A 2QJ5A 2WKIA 2HDUA 3NJAA 3BECA 4WEJA 5CGSA 2A3UA 3IXHA 5HWWA 3Q7VB 3BRMA 4JXVA 1BTLA 3RFBA 1ES2A 2PT7A 4BL3A 3T1RA 5HDCA 4IBXA 2OSUA 4PHTA 3VP4A 1C3BA 4MBHA 3QP4A 4RVAA 3IS2A 2EWWA 1PWGA 2OLVA 3HREA 1ONGA 4GHIA 5HZHA 4UA7A 3HLFA 5KSCA 1K54A 3HLBA 4R3BA 3EEAA 1LHYA 2K2NA 4KZ9A 3BFDA 3QNCA 5FAQA 1N9NA 4WUJA 1WE4A 3Q7VA 5HWTA 2HPBA 5E2FA 2VJWA 4DJ3A 1OMEA 2OLUA 3SH8A 1N4OA 4N1HA 3W4OA 2P7JA 5FQMA 3OPRA 4S2NA 2PU4A 2W3GA 2OWHA 3TSGA 3IF5A 3LY4A 3S7OA 5A93A 2CMNA 1YQSA 4R70A 2WKQA 2Y2OA 1CI8A 1Z6FA 4O8GA 1K55A 2GDNA 3CPTB 4MDZA 3WS0A 1LI0A 3W4PA 5DKKA 1S4SA 1L0GA 1UGUA 1ZHHB 1YT4A 3UDXA 1N9LA 3CG5A 4BBVA 2ZM0A 2V1ZA 3UB8A 2ZMVA 3DWKA 3S22A 3SS3A 1G6AA 1YLPA 3N4IA 2PYRA 4LLOB 5DJUA 5E2HA 3RH8B 4Y0OA 5EVEA 2AVXA 4GS9B 1W8YA 3NECA 4GKUA 4PMAA 4I3AA 4GLQA 1P9WA 4GD6A 3VP0A 2EX6A 4X6TA 5DF8A 1TDGA 5F68A 4KQOA 1N9BA 3ZG7B 5CXWA 4KQRA 4NXFA 1T1CA 4K91A 1E3UA 3CPTA 4A5RA 4DE0A 1JTDA 3FWLA 3JVUA 2GX5A 2XQZA 4GZBA 1ODVA 2ZD8A 4PKYG 1DP9A 5CHJA 3LEZA 1EI5A 2PR5A 4N92A 2WAFA 4XXRA 4OQHA 2MJ6A 2VKSA 2A2LA 2EXAA 5FA7A 5HFOA 1LL8A 1FCMA 4ETXA 4C6YA 2E8IA 4X56A 4LV3A 5FASA 3MZEA 1ACFA 2W3EA 1MWSA 1GSVA 1E4DA 4XUXA 1T18A 3IWIA 1L2SA 2WGIA 2PHYA 1K25A 1SHVA 3VSKA 4KENB 5FDSA 1Y54A 3BQ8A 3JPUA 3IH8A 4P6ZM 3AGFA 2VX8A 5EFWA 3S7NA 1K57A 5EE8A 4CJNA 4K0WA 3M2JA 2HJ9C 2G7UA 3WS4A 3UPOA 1SKFA 4RA7A 4GNUA 2P04A 3P7NA 5IS1A 1JWPA 4UHUA 3C30A 3WS5A 1GHIA 5JYPA 1DJAA 4Y5FA 5E2GA 3E4QA 2VGKA 3T4TA 4OPYA 3KYEA 2WKEA 3IHAA 4X69A 4UA9A 2ZC6B 1KE0A 3G31A 1KE3A 2R78A 4MN7A 2JCHA 3HLEA 5EOOA 2Z2MB 5HPIA 2BLSA 1S4RA 3UN7A 3ITBA 3QP8A 3SS5A 2BTFP 3V5MA 4YWZA 4N1XA 1HTZA 4JKTA 3VP2A 1MBLA 2XA7M 2IWCA 4DRTA 2EFUA 3FV7A 3T12B 2JC7A 4HH2A 3VSLA 3IX8A 4QHCA 2C5WB 3NBLA 2J9OA 2EA9A 3GQZA 5CERA 5I5LA 5TBMB 2XROA 1CJFA 4QWOA 4KQQA 4IHQA 4HESA 3PAEA 1S1ZA 5CECA 1YLYA 4E3JA 5F69A 3PAGA 1RP5A 4ZJ3A 2W1RA 1NRJA 5CX7A 4MBFA 3G6OA 4KZ3A 2ZQDA 1KGEA 5EVLA 3NI9A 1S67L 3UB7A 1W63M 1IYOA 2W3DA 1KVLA 2B02A 3S7QA 3UE1A 3BFGA 4HIAA 4G3KA 1NZOA 2J3WA 2X71A 3GTCA 3FYZA 5TBMA 1TF1A 1G68A 3W4QA 4KG5A 1TD5A 4EBPA 4UQIS 1LL5A 3LO7A 1LSXA 2H28A 3ZHHA 2Y8HA 2HDQA 2VLGA 2HGVA 4MMNA 2KLIA 1T1BA 2KOIA 1TS6A 2Q0OA 3MXRA 1NYMA 1FR6A 3LY3A 5G18A 4HHDA 4DDSA 2NUPC 2L4RA 4I39A 3AGDA 1OT6A 3HLCA 1G5UA 3K3CA 3CITA 2O9AA 4PM8A 3DTEA 2Y2LA 5AQBA 4D2OA 4PM6A 2CC1A 4BQMA 4YNRA 1K6RA 4Q0IA 1QMEA 1TDLA 3LI9A 1BULA 3PR6A 1BLPA 2QZ6A 4MLLA 3Q1FA 3U4LP 5JYOA 3W8KA 5CEDA 1NLZA 4FCFA 4GB7A 5CHUA 1PYYA 3WRZA 1MWUA 3G32A 2X01A 3ZYTA 1PI4A 4LCLA 1MWRA 3L9KA 4OOYA 3A0RA 4QY5A 4MEZA 3V3RA 1E3UD 2Y2MA 3A3FA 3N8RA 3IF6C 2B18A 3CLOA 4C3QA 3FG8A 4EETB 4QU3A 3A3JA 5BOHA 1D06A 3ZCZA 2FH5A 1OTAA 3UPNA 1NZUA 3BM6A 4JXGA 3VMAA 4BL2A 1GSWA 1MWTA 2J80A 1H5XA 4HI4A 3WS1A 4RX3A 4II7A 5GHYA 3A3EA 4H8RA 3QHYA 2BASA 2FZ0A 2Y91A 1QMFA 1KOUA 3NIAA 5EVIA 3N8SA 4N9LA 5GLCA 3S1YA 2DMWA 2JKGA 3A0VA
chains in the Genus database with same CATH topology
3FPVA 3U2AA 3LI8A 3W2ZA 1V9ZA 5J7EA 3BJNA 1ZTUA 3MQQA 3R7WA 4HJ3A 3S7OA 4Y2FA 3OBFA 2VGLM 3NOUC 2CMNA 5F5YA 2J3TD 3BWLA 3NHQA 1UWPX 4NXGA 1X0OA 2V1BA 3EWKA 3JVVA 4R70A 2WKRA 3C2WA 4WF0A 2XRNA 5HSQA 2WKQA 4B9OA 4O8GA 3NOTC 2O9BA 4ARZB 2P08A 4MDZA 3OCNA 5DKKA 1DP8A 1S4SA 4CLCA 1UGUA 1ZHHB 3D3OA 3PBTA 3LIEA 5AVFA 1IFQA 3LFVA 1N9LA 2V9AA 2Z6CA 4HY8A 4KUKA 4BBVA 2HV1A 4HQAA 3UB8A 2ZMVA 3F1NA 3PXPA 4L0LA 3PHYA 2PYRA 4LLOB 5J3WA 3PBQA 5DJUA 5IU1A 2YKFA 3K2NA 4L9GA 3RH8B 4JGRA 3T50A 3IBRA 4GS9B 2GNXA 4NXBA 2OAP1 3E4PA 4G3WA 5A8BA 3MQOA 4I3AA 4GLQA 1P9WA 2VA0A 5HD3A 3ULFA 4CLCE 3LICA 4R3AA 1OTIA 5F68A 4L9FA 4JGPA 4KQOA 5HD5A 4LRXC 2GZAA 4MN6A 3RTYA 4WEKA 4NXFA 3PYPA 4EUVA 1T1CA 1T1AA 4ARZA 4ZRRA 2VV7A 1H3QA 3MMHA 2W3HA 2JKRI 4R38A 4WN5A 1EW0A 3JVUA 2GX5A 4EQ1A 3FPWA 2QHKA 4EEUA 1ODVA 1TS8A 1G6OA 3UE3A 4PKYG 5DFYA 2M1CA 3ICYA 3LUQA 1JNUA 1DP9A 3H7WB 2PR5A 5IT5A 1XJ2A 4F3LB 3T4OA 1S66L 4I3IA 4OOMA 2PDRA 3MF0A 4KUOA 2MJ6A 2VKSA 4DN0A 3KYQA 2A2LA 4HNBA 3E4OA 1P0ZA 3T4KA 3T4SA 2PYPA 1LL8A 5L8MA 3UMEA 2XSSA 3LIBA 4ETXA 4BBTA 3LR5A 2ZBBA 4CQHA 2M7VA 2O9CA 3CAXA 4EW7A 4GW9A 2M7UA 1LT0A 4BMWA 4GCZA 3TE8A 1TS0A 2W3EA 4Y3IA 1GSVA 4OOLA 1XFNA 1OTDA 2O99A 2OWJA 3MFXA 3R4KA 1T18A 3MQ0A 2PHYA 3PBOA 4HJ6A 3OCLA 2JKTI 1OTEA 2EWVA 3H7WA 4F3LA 3BQ8A 3KX0X 1MC0A 3UMDA 2INWA 4P6ZM 2VX8A 5EFWA 2K31A 3S7NA 2VGLS 3CUEA 4UQIM 3ZQ5A 1W63Q 3B42A 3TJZC 3KO6A 2HJ9C 2G7UA 2W3FA 2KX6A 4NEED 1F5MA 5HDSA 2P04A 3P7NA 5MC7A 5IS1A 3C30A 4BBUA 3P01A 1G28A 1XJ3A 4Y5FA 3LIDA 5HWVA 4DJ2A 5FL3A 3E4QA 1LSWA 2OAQ1 3OLOA 2W1TB 3IBJA 4L9EA 3T4TA 3CUEC 3OOVA 4WLAA 4WL9A 4HJ4A 2ZOHA 4FOFA 1MKMA 4XT2B 4RQ9A 1DP6A 2R78A 4MN7A 3V67A 2A24B 3LIFA 3D72A 5G4ZA 1GSXA 2LB5A 4EEPA 4WELA 4Q0HA 3T4JA 2W27A 5HPIA 4CLCC 1S4RA 3B47A 3H82B 2JKRM 2O0YA 4HH3A 4YWZA 1P97A 1N9OA 4PAUA 4M4XA 2XA7M 5DF9A 2YKHA 4FSFA 4ME4A 4GHIB 4I5SA 4HH2A 4E04A 4ETZA 3MJQA 3LR3A 2K7SA 2EA9A 4O0PA 4LRZE 2W1TA 4UEYA 1S1YA 4HOIA 5I5LA 1MZUA 1VB6A 5TBMB 2XROA 3BY8A 4EERA 3EQUA 3H9WA 4PKYA 2QKPA 4GS9A 1YSPA 3C38A 4IHQA 4H6JB 2V0WA 4XT2A 1S1ZA 4HP4A 2A24A 5F69A 5F6AA 4LRYC 3A0SA 4YOFA 2W1RA 2NUTC 1OT9A 2HJEA 2QYBA 3B33A 3H82A 3T4LA 1F98A 1NRJA 4JGOA 5CX7A 3G6OA 4I3JA 3VE3A 3O5YA 1S67L 3KSGA 3UB7A 1W63M 2W3DA 2B02A 2JKTM 3S7QA 4BJPA 4EU0A 4HIAA 5AVEA 3C8CA 2VZWA 2ZMFA 3F1PB 3MXQA 3HJKA 4G3KA 2WKPA 3CWFA 2J3WA 5AJGA 3PBSA 5TBMA 2V0UA 3T4QA 5DFXA 3SW1A 1TF1A 1NLYA 1YAXA 4R6LA 3LR0A 2JN7A 4P6ZS 4DMZA 3K3DA 4MCWA 3MR0A 1TD5A 4H6JA 4UQIS 5TJJA 2PD8A 1OJ5A 1LSXA 2H28A 3F1NB 2Y8HA 4IUKA 2VLGA 4QPRA 5J4EA 2HGVA 4MMNA 3UB6A 2KLIA 3OC2A 3UE6A 1T19A 1T1BA 2I9VA 2V1AA 2KOIA 3BQAA 1TS6A 3CI6A 3EQVA 4HP9A 3DBAA 2Y79A 2QJ7A 3GDIA 1YSQA 4IUHA 2L1MA 5LBRA 2J3TC 2VV6A 3PBNA 1Y28A 4HHDA 2NUPC 2L4RA 3KSFA 4Q0JA 4JGQA 3F1PA 4I39A 3GECA 1STZA 2HF6A 3E98A 2LB9A 1OT6A 3TW8A 1VHMA 3BY9A 3K3CA 1WA9A 4K08A 3CITA 2O9AA 3PBRA 3HCYA 1XFQA 3KYZA 1UWNX 2GJ3A 2QWSA 3FC7A 3F1OB 5KIZA 1TS7A 1D7EA 1F9IA 4YNRA 3KSIA 1IOUA 4B93A 3BW6A 2PD7A 4Q0IA 1OPXA 4CLCD 3HJIA 3LI9A 3IS2B 4MN5A 2XA7S 1H8MA 3PR6A 1LSVA 1OJGA 2IA2A 2QJ5A 5HL6A 1XJ4A 4BWIA 3KSHA 2L0WA 1OTBA 2KDKA 1NWZA 3NJAA 4KQDA 3TRCA 4WEJA 4NXEA 3EGXC 1NLZA 4G3VA 2D01A 5K5BA 5HWWA 5G4YA 1P9RA 1XJ6A 3S7PA 3RFBA 5KSHA 4O01A 3UB9A 3EOIA 2PT7A 2JHEA 3ZYTA 2ZOIA 3EGDC 5HDCA 4EESA 3A0RA 3E0YA 3F1OA 4Z1WA 4PHTA 5C5KA 2B18A 5HDDA 4EXOA 3CLOA 2Z6DA 3FG8A 3IS2A 1V9YA 2EWWA 1YKDA 4EETB 4IJGA 4I38A 1D06A 3R7WB 3LIAA 2FH5A 1OTAA 1DRMA 2VV8A 4GHIA 5HZHA 2VEAA 4LPZA 5DKLA 4NKPA 1GSWA 2J80A 3VE4A 3EEHA 3EEAA 4HI4A 2K2NA 4II7A 1BYWA 5DJTA 1N9NA 4WUJA 5HPFA 3VOLA 2D02A 5HWTA 2VJWA 2OOLA 3VV4A 4DJ3A 4CLCB 2BASA 4GJ4A 2PR6A 2P7JA 3LR4A 4AFIA 2FZ0A 1KOUA 3LYXA 3NOPC 2W0NA 2W3GA 2DMWA 2OWHA 3A0VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LI8 A;  1V9Z A;  5J7E A;  3MQQ A;  4HJ3 A;  3NOU C;  2CMN A;  5F5Y A;  3BWL A;  3NHQ A;  1UWP X;  4NXG A;  1X0O A;  2V1B A;  3EWK A;  4R70 A;  2WKR A;  3C2W A;  4WF0 A;  5HSQ A;  2WKQ A;  4B9O A;  3NOT C;  5DKK A;  1DP8 A;  1S4S A;  1UGU A;  3LIE A;  5AVF A;  1N9L A;  2V9A A;  2Z6C A;  4HY8 A;  4KUK A;  4BBV A;  2HV1 A;  4HQA A;  3UB8 A;  3F1N A;  3PHY A;  2PYR A;  4LLO B;  5J3W A;  5DJU A;  5IU1 A;  2YKF A;  4L9G A;  3RH8 B;  4JGR A;  3T50 A;  3IBR A;  4GS9 B;  4NXB A;  3E4P A;  5A8B A;  3MQO A;  4I3A A;  5HD3 A;  3ULF A;  3LIC A;  4R3A A;  1OTI A;  5F68 A;  4L9F A;  4JGP A;  5HD5 A;  4LRX C;  4MN6 A;  3RTY A;  4NXF A;  3PYP A;  1T1C A;  1T1A A;  2VV7 A;  4WN5 A;  4R38 A;  1EW0 A;  4EQ1 A;  2QHK A;  4EEU A;  1ODV A;  1TS8 A;  4PKY G;  2M1C A;  3ICY A;  3LUQ A;  1JNU A;  1DP9 A;  3H7W B;  2PR5 A;  1XJ2 A;  4F3L B;  1S66 L;  4I3I A;  2PDR A;  4KUO A;  4HNB A;  3E4O A;  1P0Z A;  2PYP A;  1LL8 A;  3UME A;  3LIB A;  4BBT A;  2ZBB A;  3CAX A;  4EW7 A;  4GW9 A;  1LT0 A;  4GCZ A;  1TS0 A;  1GSV A;  1XFN A;  1OTD A;  2OWJ A;  3MFX A;  1T18 A;  2PHY A;  4HJ6 A;  1OTE A;  3H7W A;  4F3L A;  3KX0 X;  3UMD A;  2INW A;  5EFW A;  3ZQ5 A;  2KX6 A;  5HDS A;  3P7N A;  5IS1 A;  4BBU A;  1G28 A;  1XJ3 A;  3LID A;  5HWV A;  4DJ2 A;  3E4Q A;  1LSW A;  3OLO A;  4L9E A;  4WLA A;  4WL9 A;  4HJ4 A;  2ZOH A;  4XT2 B;  4RQ9 A;  1DP6 A;  2R78 A;  2A24 B;  3LIF A;  3D72 A;  5G4Z A;  1GSX A;  4EEP A;  2W27 A;  1S4R A;  3H82 B;  4HH3 A;  4YWZ A;  1P97 A;  1N9O A;  4M4X A;  2YKH A;  4GHI B;  4I5S A;  4HH2 A;  4E04 A;  3MJQ A;  2K7S A;  2EA9 A;  4LRZ E;  1S1Y A;  4HOI A;  5I5L A;  1MZU A;  1VB6 A;  5TBM B;  3BY8 A;  4EER A;  3H9W A;  4PKY A;  2QKP A;  4GS9 A;  4H6J B;  2V0W A;  4XT2 A;  1S1Z A;  4HP4 A;  2A24 A;  5F69 A;  5F6A A;  4LRY C;  3A0S A;  1OT9 A;  3H82 A;  3B33 A;  1F98 A;  4JGO A;  3G6O A;  4I3J A;  3VE3 A;  1S67 L;  3UB7 A;  2B02 A;  4HIA A;  5AVE A;  3C8C A;  3F1P B;  3MXQ A;  3HJK A;  2WKP A;  3CWF A;  5TBM A;  2V0U A;  3SW1 A;  4R6L A;  2JN7 A;  3K3D A;  3MR0 A;  4H6J A;  2PD8 A;  1OJ5 A;  1LSX A;  2H28 A;  3F1N B;  2VLG A;  5J4E A;  3UB6 A;  3UE6 A;  1T19 A;  1T1B A;  2I9V A;  2V1A A;  1TS6 A;  4HP9 A;  2QJ7 A;  3GDI A;  2L1M A;  2VV6 A;  1Y28 A;  4HHD A;  2L4R A;  4JGQ A;  3F1P A;  4I39 A;  3GEC A;  1OT6 A;  3BY9 A;  3K3C A;  1WA9 A;  4K08 A;  1XFQ A;  1UWN X;  2GJ3 A;  2QWS A;  3FC7 A;  3F1O B;  5KIZ A;  1TS7 A;  1D7E A;  1F9I A;  2PD7 A;  3HJI A;  3LI9 A;  3IS2 B;  4MN5 A;  1LSV A;  1OJG A;  2QJ5 A;  1XJ4 A;  2L0W A;  1OTB A;  2KDK A;  1NWZ A;  3NJA A;  4KQD A;  4NXE A;  2D01 A;  5HWW A;  5G4Y A;  1XJ6 A;  3UB9 A;  2JHE A;  2ZOI A;  5HDC A;  4EES A;  3A0R A;  3F1O A;  5HDD A;  4EXO A;  3CLO A;  2Z6D A;  3FG8 A;  3IS2 A;  1V9Y A;  4EET B;  4I38 A;  1D06 A;  3LIA A;  1OTA A;  1DRM A;  2VV8 A;  4GHI A;  5HZH A;  2VEA A;  4LPZ A;  5DKL A;  1GSW A;  2J80 A;  3VE4 A;  3EEH A;  4HI4 A;  1BYW A;  5DJT A;  1N9N A;  4WUJ A;  3VOL A;  2D02 A;  5HWT A;  2OOL A;  4DJ3 A;  2BAS A;  2PR6 A;  2P7J A;  1KOU A;  3LYX A;  3NOP C;  2W0N A;  2OWH A;  3A0V A; 
#chains in the Genus database with same CATH topology
 3U2A A;  4PPR A;  1SDE A;  2ZLY A;  1K54 C;  5J7E A;  4Q8I A;  1ZTU A;  4XUZ A;  3L7H A;  4Y2F A;  2HDS A;  3OBF A;  2WKH A;  3I7J A;  3NOU C;  2J3T D;  3NHQ A;  4Y13 A;  1SKO B;  2V1B A;  3JVV A;  1Z09 A;  4O7D A;  3NOT C;  1W79 A;  4LV2 A;  2P08 A;  4JXS A;  3N7W A;  3D3O A;  2HV1 A;  2P9V B;  4L0L A;  1VQQ A;  3UDI A;  4L9G A;  2Y2N A;  3T50 A;  4OQI A;  1NRF A;  4NXB A;  1FOF A;  3E4P A;  3IXB A;  4E3O A;  2XH9 A;  2VA0 A;  3NUL A;  1LL9 A;  5FAP A;  2B5R A;  4R3A A;  4WM9 A;  4JGP A;  4E6X A;  1SKO A;  2GZA A;  3Q07 A;  2ZQ9 A;  4KZ5 A;  2G2W A;  4GDN A;  1T1A A;  2H0T A;  3A3I A;  4ZDX A;  5GHZ A;  4FH4 A;  4BD1 A;  1IYQ A;  4EQ1 A;  3FPW A;  2QHK A;  4EEU A;  1TS8 A;  4WYY A;  1G6O A;  5DFY A;  4S2P A;  3O87 A;  4S2L A;  4X55 A;  1XJ2 A;  3T4O A;  1S66 L;  1CF0 A;  2Y2P A;  3DAV A;  1XX2 A;  3IHB A;  5FSR A;  1GA9 A;  3KYQ A;  3ZG0 A;  3E4O A;  2HP5 A;  3T4K A;  2PYP A;  4OH0 A;  2XSS A;  3NDE A;  3Q7Z A;  2M7V A;  3RJU A;  3G2Z A;  1O7E A;  5EOE A;  2M7U A;  1LT0 A;  4WMC A;  3QP6 A;  4GCZ A;  3TE8 A;  3G35 A;  4Y3I A;  4YIN A;  3LGO A;  4OOL A;  5AQ7 A;  5KMW A;  2OWJ A;  3R4K A;  3MQ0 A;  5EPH A;  3PBO A;  4HBT A;  3OCL A;  1K0K A;  4C75 A;  2WAD A;  3KX0 X;  5CHM A;  2XD1 A;  2INW A;  1BZA A;  4X53 A;  1BSG A;  3E2L A;  3B3X A;  3C4P A;  2OV5 A;  4OPQ A;  2QMI A;  5HAI A;  4UQI M;  4ZJ2 A;  1ES5 A;  3TJZ C;  4RX2 A;  4P6B A;  4NEE D;  1F5M A;  3WWX A;  5MC7 A;  3FZC A;  4BBU A;  4IBR A;  2G2U A;  1MPL A;  3BEB A;  2X02 A;  5HWV A;  3IXD A;  3MFD A;  2OAQ 1;  5F1G A;  4S2I A;  4HBU A;  3M6B A;  1K57 C;  2DCF A;  4OLD A;  3BFE A;  2ZOH A;  4KZB A;  4XT2 B;  4RQ9 A;  1DP6 A;  1IYS A;  4DE3 A;  1K4F A;  2A24 B;  3LIF A;  2PBD P;  1GSX A;  1ZC2 A;  1VM1 A;  4CLC C;  3H82 B;  3TG9 A;  3O3V A;  4ZAM A;  1P97 A;  5A91 A;  1JWZ A;  4M4X A;  5DF9 A;  5HL1 A;  2YKH A;  3ZG8 B;  2PU2 A;  4ME4 A;  4I5S A;  5HAP A;  4ETZ A;  4LFU A;  4O0P A;  4LRZ E;  3WRT A;  1MZU A;  1VB6 A;  2ZMA A;  4OKP A;  4E3M A;  4EER A;  1PIO A;  4UA6 A;  3H9W A;  4PKY A;  4GS9 A;  1M40 A;  3C38 A;  1K6S A;  3MKE A;  1PWC A;  4XT2 A;  4HP4 A;  3NC8 A;  2A24 A;  4ID4 A;  3ZG5 A;  3UPP A;  1H8Y A;  1YPR A;  3A0S A;  5FEF A;  3H82 A;  4GOG A;  1KVM A;  1KGF A;  1XA7 A;  3UO9 A;  3N8L A;  4BJP A;  5AVE A;  3C8C A;  1BLH A;  4LGW A;  3VOZ A;  2ZMF A;  3MXQ A;  1IKG A;  3HJK A;  3CWF A;  3PBS A;  2V0U A;  1YAX A;  1JVJ A;  4R6L A;  3LR0 A;  3K3D A;  4MCW A;  3VP1 A;  2R9W A;  3F1N B;  1LI9 A;  3OC2 A;  1YMS A;  3VFH A;  2XK1 A;  3EQV A;  1HZO A;  1DJB A;  2QJ7 A;  5EVI D;  2L1M A;  1K38 A;  5GLA A;  2JE5 A;  3KSF A;  4X1L A;  3P98 A;  5M1A A;  2UWX A;  4JGQ A;  3C5A A;  1STZ A;  1Q2P A;  4U3T A;  5CTM A;  3TW8 A;  1WA9 A;  4Y0U A;  5AQA A;  1UWN X;  2QWS A;  3FC7 A;  3F1O B;  2ACG A;  1NY0 A;  5EV0 A;  4X1M A;  3A3D A;  1Q2Q A;  5GLB A;  1GCE A;  3HJI A;  5FI6 A;  4R4S A;  1H8M A;  5FQ9 A;  4N9K A;  4EBN A;  5HL6 A;  4JPM A;  3KSH A;  1OTB A;  1NWZ A;  4KQD A;  2XD5 A;  1JTG A;  4NXE A;  1IEL A;  1PZP A;  1K56 A;  3ISG A;  2IWD A;  1KGG A;  5KSH A;  2FFY A;  3UB9 A;  2JHE A;  4BLM A;  2ZOI A;  5CEB A;  3F1O A;  5F1F A;  2WYX A;  1PRQ A;  5C5K A;  2Y2K A;  2Y4A A;  1FSY A;  4EXO A;  4NK3 A;  2Z6D A;  1S0W A;  1V9Y A;  4IJG A;  5FDH A;  3R7W B;  5TFQ A;  3BFC A;  3LIA A;  3SS4 A;  3DTI A;  1ZG6 A;  2XDM A;  5DKL A;  4NKP A;  3DTM A;  1XPB A;  2WZZ A;  4JF4 A;  5CTN A;  3EEH A;  4KZ7 A;  2PRF A;  5DJT A;  4QD4 A;  1CEF A;  1YLT A;  3VOL A;  2H0Y A;  2OOL A;  1L0E A;  4DKI A;  4MNR A;  4GJ4 A;  1CK3 A;  2PR6 A;  3CHW P;  4OPR A;  4E6W A;  2WAE A;  3LYX A;  3SH9 A;  3IXG A;  1BLC A;  4WMC D;  3RXW A;  3FPV A;  3LI8 A;  1V9Z A;  1WYC A;  5M19 A;  3BJN A;  2ZQ8 A;  3MQQ A;  3R7W A;  2JKF A;  3C7V A;  5F5Y A;  3BWL A;  1UWP X;  2HP6 A;  4NXG A;  1X0O A;  3BLM A;  5HAR A;  4WF0 A;  5FAT A;  3IX4 A;  1U60 A;  3Q82 A;  2V2F F;  4B9O A;  1PW1 A;  4ZBE A;  4OVD A;  4ARZ B;  3HLG A;  4U0X A;  5EVI C;  5DTS A;  5GLD A;  3OCN A;  1DP8 A;  5FQK A;  3PBT A;  1SZV A;  5AVF A;  1IFQ A;  3LFV A;  5DF7 A;  4HQA A;  3OZH A;  3PXP A;  2C6W B;  2Y2H A;  5J3W A;  1ZG4 A;  2YKF A;  3HVF A;  3CZD A;  2OAP 1;  4S2J A;  4G3W A;  3MQO A;  3IWQ A;  3ULF A;  4CLC E;  3LIC A;  1OTI A;  5HD5 A;  4LRX C;  1PZO A;  4MN6 A;  3RTY A;  4WZ5 C;  4WEK A;  4ARZ A;  3ZG9 B;  2VV7 A;  2W3H A;  3C7U A;  2J9P A;  4R38 A;  2V20 A;  1EW0 A;  3ZVW A;  4Y7P A;  3QNB A;  4IVK A;  3UE3 A;  5E43 A;  1CEG A;  3LUQ A;  2Y2I A;  5IT5 A;  4P0M A;  2XGN A;  1FQG A;  4OOM A;  2PDR A;  3MS6 A;  3MF0 A;  2RCX A;  4B88 A;  1PFL A;  4KUO A;  1ERM A;  1P0Z A;  3T4S A;  5L8M A;  5EUA A;  3UME A;  4KZA A;  4BBT A;  3LR5 A;  2ZBB A;  3JYI A;  3CAX A;  4EQI A;  4EW7 A;  4E3K A;  4JLF A;  2H10 A;  3M6H A;  4GW9 A;  1JWV A;  3OPL A;  1ES4 A;  2ZQC A;  1HD8 A;  1OTD A;  2O99 A;  3AGE A;  5A90 A;  1YLZ A;  4NET A;  1OTE A;  4WBG A;  1MC0 A;  3UMD A;  4MBK A;  1IYP A;  2VGL S;  3CUE A;  3MXS A;  4LV1 A;  3B42 A;  2DRW A;  3KO6 A;  1BUE A;  2W3F A;  3IWO A;  4R1G A;  5FQQ A;  4PM9 A;  4S2N C;  3P01 A;  4B4X A;  3IT9 A;  5HX9 A;  1G28 A;  3IF6 B;  1LLB A;  1E25 A;  4IVI A;  1RGY A;  5FL3 A;  3QP2 A;  2Y2J A;  4UAA A;  2WUQ A;  4L9E A;  1K4E A;  2ZL1 B;  4WLA A;  3NDG A;  4WL9 A;  4HJ4 A;  3T1X A;  1BLS A;  1VEU B;  3DW0 A;  5IHV A;  1MKM A;  4DE2 A;  4Z9Q A;  4ESP A;  2WGV A;  1K55 C;  5KZH A;  1KDW A;  4EEP A;  4WEL A;  4Q0H A;  3T4J A;  2W27 A;  2ZM2 A;  3B47 A;  2JKR M;  4HH3 A;  5A92 A;  4PAU A;  4D60 A;  1F2K A;  4DXC A;  4GHI B;  2PBY A;  3IF6 A;  4X25 A;  4M3K A;  3SZT A;  3MJQ A;  2P9V A;  3MKF A;  5AQ9 A;  1S1Y A;  2ZL1 A;  1MY8 A;  4KG6 A;  2QKP A;  1VEU A;  2ZQA A;  1YSP A;  3G30 A;  3MZF A;  5FI2 A;  2V0W A;  4ZTK A;  2J7V A;  1WYB A;  1W8Q A;  2V8C A;  2ZM8 A;  4QY6 A;  1S6R A;  4DF6 A;  5F6A A;  3G4P A;  5EM1 A;  1K56 D;  3IH9 A;  1OT9 A;  2HJE A;  3T4L A;  2EXB A;  4I3J A;  3VE3 A;  1ZKJ A;  3OPP A;  4GN2 A;  3UB5 P;  2Y2Q A;  2JKT M;  1D1J A;  1EWZ A;  2VZW A;  3GV9 A;  3SOI A;  1I5Q A;  3F1P B;  1GHM A;  1FR1 A;  2WK0 A;  5AJG A;  3T4Q A;  3O86 A;  5CGX A;  1NJ4 A;  4EBL A;  3LEQ A;  4DMZ A;  1MXO A;  2R9X A;  1YLW A;  3S4X A;  4NG2 A;  1NYY A;  3V50 A;  4B4Z A;  4OLG A;  4IUK A;  4QPR A;  1PW8 A;  3UB6 A;  3UE6 A;  2V1A A;  2I9V A;  3BQA A;  3CI6 A;  3DBA A;  3GDI A;  1YSQ A;  5LBR A;  2J3T C;  2VV6 A;  3PBN A;  3V39 A;  4Q0J A;  1FSW A;  3F1P A;  3GEC A;  3E98 A;  2LB9 A;  1VHM A;  4FD8 A;  3BY9 A;  1CQA A;  4HEF A;  3RXX A;  4IED A;  1TVF A;  3HCY A;  2XF3 A;  1ONH A;  3HUM A;  3KYZ A;  5F83 A;  4S2O A;  2Q9N A;  1TS7 A;  4FTX A;  1D7E A;  1F9I A;  1IOU A;  3BW6 A;  2PD7 A;  1OPX A;  4R3J A;  3WS2 A;  3GSG A;  2P74 A;  1LSV A;  1A0K A;  1XJ4 A;  4BWI A;  2L0W A;  3SH7 A;  2KDK A;  5EEC A;  3TRC A;  3EGX C;  3MSH A;  4G3V A;  2D01 A;  5K5B A;  5G4Y A;  1P9R A;  1XJ6 A;  1M6K A;  3S7P A;  1YM1 A;  4O01 A;  2HZ5 A;  3E2K A;  2FFF B;  2ZQ7 A;  3EOI A;  3IQA A;  1SCW A;  4EWF A;  3EGD C;  5FI7 A;  4EES A;  1ES3 A;  2VGJ A;  3E0Y A;  2J8Y A;  1RGZ A;  4Z1W A;  3G34 A;  1BT5 A;  1ERO A;  2XR0 A;  5CRF A;  2WZX A;  5HDD A;  4RYE A;  1YKD A;  5DVA A;  4I38 A;  1H0M A;  1XP4 A;  1AWI A;  1DRM A;  2VV8 A;  2VEA A;  4LPZ A;  1L3L A;  2PAV P;  2Q9M A;  3VE4 A;  4BEN A;  1BYW A;  3ZNY A;  3VP3 A;  4GD8 A;  2XFS A;  5HPF A;  4ZJ1 A;  2D02 A;  4BD0 A;  3VV4 A;  3UNW A;  3VOY A;  4CLC B;  4Y0T A;  3DTK A;  3LCE A;  5M18 A;  1KDS A;  1HLU P;  3LR4 A;  4AFI A;  4Y15 A;  5E2E A;  3TOI A;  3NOP C;  2W0N A;  5FQJ A;  3UE0 A;  5FAO A;  1VET B;  4P87 A;  1ESI A;  4R23 A;  4PM5 A;  4KZ6 A;  4PM7 A;  3W2Z A;  2QPN A;  2EX2 A;  4P85 A;  3GMW A;  3GR2 A;  4HJ3 A;  3O88 A;  3P09 A;  3ZDJ A;  2VGL M;  1XGJ A;  3NY4 A;  3EWK A;  2XLN A;  5DTT A;  2WKR A;  3C2W A;  2DNS A;  2XRN A;  5HSQ A;  2O9B A;  1KE4 A;  4KZ8 A;  1NXY A;  4YFM A;  3OPH A;  4LV0 A;  4CLC A;  3LIE A;  1IKI A;  5GL9 A;  2V9A A;  4HY8 A;  2Z6C A;  4KUK A;  4CPK A;  3F1N A;  3PHY A;  2Y59 A;  3PBQ A;  3HUN A;  4K0X A;  2XFT A;  5IU1 A;  3K2N A;  1VET A;  4JGR A;  4JF6 A;  3IBR A;  2GNX A;  3D9Y A;  1J3W A;  5A8B A;  5HD3 A;  4L9F A;  3UY6 A;  1J9M A;  4R0Q A;  3PYP A;  4EUV A;  1XA1 A;  3FKW A;  3VFF A;  4ZRR A;  1H3Q A;  3MMH A;  1GA0 A;  2JKR I;  4WN5 A;  4OQ0 A;  1CI9 A;  3UDF A;  1O07 A;  4EV4 A;  2M1C A;  3ICY A;  1JNU A;  3CMZ A;  3H7W B;  2EFX A;  4F3L B;  3ZFZ A;  2RL3 A;  4I3I A;  2VK3 A;  3Q81 A;  4DN0 A;  4FUW A;  4HNB A;  1AXB A;  5D3O A;  3BYD A;  1H8Z A;  3LIB A;  3MBZ A;  5HW3 A;  1FIK A;  4CQH A;  2A49 A;  2O9C A;  1L0D A;  3T1S A;  3HLW A;  4QJG A;  4BMW A;  2I72 A;  1TS0 A;  1ALQ A;  1ESU A;  3V3S A;  1XFN A;  3MFX A;  5FQI A;  2JBF A;  3HUO A;  4HJ6 A;  3FKV A;  2JKT I;  2ZC4 B;  2E8J A;  2EWV A;  3H7W A;  4F3L A;  4LEN A;  2K31 A;  3GRJ A;  3ZQ5 A;  1YMX A;  1W63 Q;  1Y4O A;  2IWB A;  3IX3 A;  1I2S A;  1PNE A;  2KX6 A;  5HDS A;  3BFF A;  1TEM A;  3NCK A;  2ZC3 B;  1I2W A;  5L07 A;  2HDR A;  3HBR A;  1XJ3 A;  5U47 A;  1DJC A;  3LID A;  1XGI A;  4DJ2 A;  1LSW A;  4DE1 A;  3OLO A;  2W1T B;  3IBJ A;  1RCJ A;  4X68 A;  3CUE C;  1MKI A;  2BG1 A;  4GDB A;  3OOV A;  2ZC5 B;  5I94 A;  2EX9 A;  2WGW B;  4FOF A;  1XKZ A;  5GHX A;  3V67 A;  3D72 A;  5G4Z A;  2LB5 A;  2XEP A;  2Y2G A;  1PWD A;  3ZNT A;  2O0Y A;  3MZD A;  1SDN A;  1N9O A;  3N6I A;  1IEM A;  2HP9 A;  3M2K A;  4OON A;  3BLS A;  4FSF A;  2B95 A;  4E04 A;  3LR3 A;  2K7S A;  5TR7 A;  4S2K A;  2W1T A;  4UEY A;  4HOI A;  2EX8 A;  5FEG A;  3BY8 A;  3EQU A;  2WGW A;  3QP1 A;  4JBF A;  5L10 A;  4H6J B;  2V8F A;  3PTE A;  1XXM A;  4KZ4 A;  5L09 A;  5EVI B;  4LRY C;  4YOF A;  2NUT C;  4DDY A;  5HAQ A;  2QYB A;  3B33 A;  3D4F A;  1F98 A;  4JGO A;  3O5Y A;  3KSG A;  4S2M A;  1FIL A;  3QP5 A;  5CGW A;  4EU0 A;  3ZGA B;  1FCN A;  2WKP A;  4JXW A;  1FCO A;  5DFX A;  3SW1 A;  4E3L A;  2ZJ9 A;  1NLY A;  4QB8 A;  2JN7 A;  3GVB A;  4P6Z S;  5TGF A;  3MR0 A;  4H6J A;  5TJJ A;  2PD8 A;  4LCM A;  2Y55 A;  1OJ5 A;  3ZVT A;  2H5S A;  5L2F A;  4OQG A;  5J4E A;  3C4O A;  4OP5 A;  5F82 A;  1T19 A;  1HVB A;  4HP9 A;  2Y79 A;  4IUH A;  4OP8 A;  2ZC7 A;  1Y28 A;  1PI5 A;  1L0F A;  4Y17 A;  3HLD A;  1ERQ A;  2HF6 A;  2Z2L B;  1W7F A;  1DY6 A;  3T1Q B;  4F94 A;  2UV0 E;  3CJM A;  3ITA A;  4K08 A;  3G2Y A;  1GHP A;  5J8X A;  3PBR A;  1XFQ A;  4WZ5 A;  2GJ3 A;  5KIZ A;  4E3N A;  4DXB A;  4E3I A;  4FH2 A;  4EUZ A;  4R4R A;  4OPZ A;  5DTK A;  3KSI A;  4B93 A;  4CLC D;  1W5D A;  4WZ4 A;  3IS2 B;  4MN5 A;  2XA7 S;  4U0T A;  1YLJ A;  4JF5 A;  5EM0 A;  3DWZ A;  1OJG A;  2IA2 A;  4KG2 A;  3HL9 A;  2QJ5 A;  2WKI A;  2HDU A;  3NJA A;  3BEC A;  4WEJ A;  5CGS A;  2A3U A;  3IXH A;  5HWW A;  3Q7V B;  3BRM A;  4JXV A;  1BTL A;  3RFB A;  1ES2 A;  2PT7 A;  4BL3 A;  3T1R A;  5HDC A;  4IBX A;  2OSU A;  4PHT A;  3VP4 A;  1C3B A;  4MBH A;  3QP4 A;  4RVA A;  3IS2 A;  2EWW A;  1PWG A;  2OLV A;  3HRE A;  1ONG A;  4GHI A;  5HZH A;  4UA7 A;  3HLF A;  5KSC A;  1K54 A;  3HLB A;  4R3B A;  3EEA A;  1LHY A;  2K2N A;  4KZ9 A;  3BFD A;  3QNC A;  5FAQ A;  1N9N A;  4WUJ A;  1WE4 A;  3Q7V A;  5HWT A;  2HPB A;  5E2F A;  2VJW A;  4DJ3 A;  1OME A;  2OLU A;  3SH8 A;  1N4O A;  4N1H A;  3W4O A;  2P7J A;  5FQM A;  3OPR A;  4S2N A;  2PU4 A;  2W3G A;  2OWH A;  3TSG A;  3IF5 A;  3LY4 A;  3S7O A;  5A93 A;  2CMN A;  1YQS A;  4R70 A;  2WKQ A;  2Y2O A;  1CI8 A;  1Z6F A;  4O8G A;  1K55 A;  2GDN A;  3CPT B;  4MDZ A;  3WS0 A;  1LI0 A;  3W4P A;  5DKK A;  1S4S A;  1L0G A;  1UGU A;  1ZHH B;  1YT4 A;  3UDX A;  1N9L A;  3CG5 A;  4BBV A;  2ZM0 A;  2V1Z A;  3UB8 A;  2ZMV A;  3DWK A;  3S22 A;  3SS3 A;  1G6A A;  1YLP A;  3N4I A;  2PYR A;  4LLO B;  5DJU A;  5E2H A;  3RH8 B;  4Y0O A;  5EVE A;  2AVX A;  4GS9 B;  1W8Y A;  3NEC A;  4GKU A;  4PMA A;  4I3A A;  4GLQ A;  1P9W A;  4GD6 A;  3VP0 A;  2EX6 A;  4X6T A;  5DF8 A;  1TDG A;  5F68 A;  4KQO A;  1N9B A;  3ZG7 B;  5CXW A;  4KQR A;  4NXF A;  1T1C A;  4K91 A;  1E3U A;  3CPT A;  4A5R A;  4DE0 A;  1JTD A;  3FWL A;  3JVU A;  2GX5 A;  2XQZ A;  4GZB A;  1ODV A;  2ZD8 A;  4PKY G;  1DP9 A;  5CHJ A;  3LEZ A;  1EI5 A;  2PR5 A;  4N92 A;  2WAF A;  4XXR A;  4OQH A;  2MJ6 A;  2VKS A;  2A2L A;  2EXA A;  5FA7 A;  5HFO A;  1LL8 A;  1FCM A;  4ETX A;  4C6Y A;  2E8I A;  4X56 A;  4LV3 A;  5FAS A;  3MZE A;  1ACF A;  2W3E A;  1MWS A;  1GSV A;  1E4D A;  4XUX A;  1T18 A;  3IWI A;  1L2S A;  2WGI A;  2PHY A;  1K25 A;  1SHV A;  3VSK A;  4KEN B;  5FDS A;  1Y54 A;  3BQ8 A;  3JPU A;  3IH8 A;  4P6Z M;  3AGF A;  2VX8 A;  5EFW A;  3S7N A;  1K57 A;  5EE8 A;  4CJN A;  4K0W A;  3M2J A;  2HJ9 C;  2G7U A;  3WS4 A;  3UPO A;  1SKF A;  4RA7 A;  4GNU A;  2P04 A;  3P7N A;  5IS1 A;  1JWP A;  4UHU A;  3C30 A;  3WS5 A;  1GHI A;  5JYP A;  1DJA A;  4Y5F A;  5E2G A;  3E4Q A;  2VGK A;  3T4T A;  4OPY A;  3KYE A;  2WKE A;  3IHA A;  4X69 A;  4UA9 A;  2ZC6 B;  1KE0 A;  3G31 A;  1KE3 A;  2R78 A;  4MN7 A;  2JCH A;  3HLE A;  5EOO A;  2Z2M B;  5HPI A;  2BLS A;  1S4R A;  3UN7 A;  3ITB A;  3QP8 A;  3SS5 A;  2BTF P;  3V5M A;  4YWZ A;  4N1X A;  1HTZ A;  4JKT A;  3VP2 A;  1MBL A;  2XA7 M;  2IWC A;  4DRT A;  2EFU A;  3FV7 A;  3T12 B;  2JC7 A;  4HH2 A;  3VSL A;  3IX8 A;  4QHC A;  2C5W B;  3NBL A;  2J9O A;  2EA9 A;  3GQZ A;  5CER A;  5I5L A;  5TBM B;  2XRO A;  1CJF A;  4QWO A;  4KQQ A;  4IHQ A;  4HES A;  3PAE A;  1S1Z A;  5CEC A;  1YLY A;  4E3J A;  5F69 A;  3PAG A;  1RP5 A;  4ZJ3 A;  2W1R A;  1NRJ A;  5CX7 A;  4MBF A;  3G6O A;  4KZ3 A;  2ZQD A;  1KGE A;  5EVL A;  3NI9 A;  1S67 L;  3UB7 A;  1W63 M;  1IYO A;  2W3D A;  1KVL A;  2B02 A;  3S7Q A;  3UE1 A;  3BFG A;  4HIA A;  4G3K A;  1NZO A;  2J3W A;  2X71 A;  3GTC A;  3FYZ A;  5TBM A;  1TF1 A;  1G68 A;  3W4Q A;  4KG5 A;  1TD5 A;  4EBP A;  4UQI S;  1LL5 A;  3LO7 A;  1LSX A;  2H28 A;  3ZHH A;  2Y8H A;  2HDQ A;  2VLG A;  2HGV A;  4MMN A;  2KLI A;  1T1B A;  2KOI A;  1TS6 A;  2Q0O A;  3MXR A;  1NYM A;  1FR6 A;  3LY3 A;  5G18 A;  4HHD A;  4DDS A;  2NUP C;  2L4R A;  4I39 A;  3AGD A;  1OT6 A;  3HLC A;  1G5U A;  3K3C A;  3CIT A;  2O9A A;  4PM8 A;  3DTE A;  2Y2L A;  5AQB A;  4D2O A;  4PM6 A;  2CC1 A;  4BQM A;  4YNR A;  1K6R A;  4Q0I A;  1QME A;  1TDL A;  3LI9 A;  1BUL A;  3PR6 A;  1BLP A;  2QZ6 A;  4MLL A;  3Q1F A;  3U4L P;  5JYO A;  3W8K A;  5CED A;  1NLZ A;  4FCF A;  4GB7 A;  5CHU A;  1PYY A;  3WRZ A;  1MWU A;  3G32 A;  2X01 A;  3ZYT A;  1PI4 A;  4LCL A;  1MWR A;  3L9K A;  4OOY A;  3A0R A;  4QY5 A;  4MEZ A;  3V3R A;  1E3U D;  2Y2M A;  3A3F A;  3N8R A;  3IF6 C;  2B18 A;  3CLO A;  4C3Q A;  3FG8 A;  4EET B;  4QU3 A;  3A3J A;  5BOH A;  1D06 A;  3ZCZ A;  2FH5 A;  1OTA A;  3UPN A;  1NZU A;  3BM6 A;  4JXG A;  3VMA A;  4BL2 A;  1GSW A;  1MWT A;  2J80 A;  1H5X A;  4HI4 A;  3WS1 A;  4RX3 A;  4II7 A;  5GHY A;  3A3E A;  4H8R A;  3QHY A;  2BAS A;  2FZ0 A;  2Y91 A;  1QMF A;  1KOU A;  3NIA A;  5EVI A;  3N8S A;  4N9L A;  5GLC A;  3S1Y A;  2DMW A;  2JKG A;  3A0V A; 
#chains in the Genus database with same CATH homology
 3FPV A;  3U2A A;  3LI8 A;  3W2Z A;  1V9Z A;  5J7E A;  3BJN A;  1ZTU A;  3MQQ A;  3R7W A;  4HJ3 A;  3S7O A;  4Y2F A;  3OBF A;  2VGL M;  3NOU C;  2CMN A;  5F5Y A;  2J3T D;  3BWL A;  3NHQ A;  1UWP X;  4NXG A;  1X0O A;  2V1B A;  3EWK A;  3JVV A;  4R70 A;  2WKR A;  3C2W A;  4WF0 A;  2XRN A;  5HSQ A;  2WKQ A;  4B9O A;  4O8G A;  3NOT C;  2O9B A;  4ARZ B;  2P08 A;  4MDZ A;  3OCN A;  5DKK A;  1DP8 A;  1S4S A;  4CLC A;  1UGU A;  1ZHH B;  3D3O A;  3PBT A;  3LIE A;  5AVF A;  1IFQ A;  3LFV A;  1N9L A;  2V9A A;  2Z6C A;  4HY8 A;  4KUK A;  4BBV A;  2HV1 A;  4HQA A;  3UB8 A;  2ZMV A;  3F1N A;  3PXP A;  4L0L A;  3PHY A;  2PYR A;  4LLO B;  5J3W A;  3PBQ A;  5DJU A;  5IU1 A;  2YKF A;  3K2N A;  4L9G A;  3RH8 B;  4JGR A;  3T50 A;  3IBR A;  4GS9 B;  2GNX A;  4NXB A;  2OAP 1;  3E4P A;  4G3W A;  5A8B A;  3MQO A;  4I3A A;  4GLQ A;  1P9W A;  2VA0 A;  5HD3 A;  3ULF A;  4CLC E;  3LIC A;  4R3A A;  1OTI A;  5F68 A;  4L9F A;  4JGP A;  4KQO A;  5HD5 A;  4LRX C;  2GZA A;  4MN6 A;  3RTY A;  4WEK A;  4NXF A;  3PYP A;  4EUV A;  1T1C A;  1T1A A;  4ARZ A;  4ZRR A;  2VV7 A;  1H3Q A;  3MMH A;  2W3H A;  2JKR I;  4R38 A;  4WN5 A;  1EW0 A;  3JVU A;  2GX5 A;  4EQ1 A;  3FPW A;  2QHK A;  4EEU A;  1ODV A;  1TS8 A;  1G6O A;  3UE3 A;  4PKY G;  5DFY A;  2M1C A;  3ICY A;  3LUQ A;  1JNU A;  1DP9 A;  3H7W B;  2PR5 A;  5IT5 A;  1XJ2 A;  4F3L B;  3T4O A;  1S66 L;  4I3I A;  4OOM A;  2PDR A;  3MF0 A;  4KUO A;  2MJ6 A;  2VKS A;  4DN0 A;  3KYQ A;  2A2L A;  4HNB A;  3E4O A;  1P0Z A;  3T4K A;  3T4S A;  2PYP A;  1LL8 A;  5L8M A;  3UME A;  2XSS A;  3LIB A;  4ETX A;  4BBT A;  3LR5 A;  2ZBB A;  4CQH A;  2M7V A;  2O9C A;  3CAX A;  4EW7 A;  4GW9 A;  2M7U A;  1LT0 A;  4BMW A;  4GCZ A;  3TE8 A;  1TS0 A;  2W3E A;  4Y3I A;  1GSV A;  4OOL A;  1XFN A;  1OTD A;  2O99 A;  2OWJ A;  3MFX A;  3R4K A;  1T18 A;  3MQ0 A;  2PHY A;  3PBO A;  4HJ6 A;  3OCL A;  2JKT I;  1OTE A;  2EWV A;  3H7W A;  4F3L A;  3BQ8 A;  3KX0 X;  1MC0 A;  3UMD A;  2INW A;  4P6Z M;  2VX8 A;  5EFW A;  2K31 A;  3S7N A;  2VGL S;  3CUE A;  4UQI M;  3ZQ5 A;  1W63 Q;  3B42 A;  3TJZ C;  3KO6 A;  2HJ9 C;  2G7U A;  2W3F A;  2KX6 A;  4NEE D;  1F5M A;  5HDS A;  2P04 A;  3P7N A;  5MC7 A;  5IS1 A;  3C30 A;  4BBU A;  3P01 A;  1G28 A;  1XJ3 A;  4Y5F A;  3LID A;  5HWV A;  4DJ2 A;  5FL3 A;  3E4Q A;  1LSW A;  2OAQ 1;  3OLO A;  2W1T B;  3IBJ A;  4L9E A;  3T4T A;  3CUE C;  3OOV A;  4WLA A;  4WL9 A;  4HJ4 A;  2ZOH A;  4FOF A;  1MKM A;  4XT2 B;  4RQ9 A;  1DP6 A;  2R78 A;  4MN7 A;  3V67 A;  2A24 B;  3LIF A;  3D72 A;  5G4Z A;  1GSX A;  2LB5 A;  4EEP A;  4WEL A;  4Q0H A;  3T4J A;  2W27 A;  5HPI A;  4CLC C;  1S4R A;  3B47 A;  3H82 B;  2JKR M;  2O0Y A;  4HH3 A;  4YWZ A;  1P97 A;  1N9O A;  4PAU A;  4M4X A;  2XA7 M;  5DF9 A;  2YKH A;  4FSF A;  4ME4 A;  4GHI B;  4I5S A;  4HH2 A;  4E04 A;  4ETZ A;  3MJQ A;  3LR3 A;  2K7S A;  2EA9 A;  4O0P A;  4LRZ E;  2W1T A;  4UEY A;  1S1Y A;  4HOI A;  5I5L A;  1MZU A;  1VB6 A;  5TBM B;  2XRO A;  3BY8 A;  4EER A;  3EQU A;  3H9W A;  4PKY A;  2QKP A;  4GS9 A;  1YSP A;  3C38 A;  4IHQ A;  4H6J B;  2V0W A;  4XT2 A;  1S1Z A;  4HP4 A;  2A24 A;  5F69 A;  5F6A A;  4LRY C;  3A0S A;  4YOF A;  2W1R A;  2NUT C;  1OT9 A;  2HJE A;  2QYB A;  3B33 A;  3H82 A;  3T4L A;  1F98 A;  1NRJ A;  4JGO A;  5CX7 A;  3G6O A;  4I3J A;  3VE3 A;  3O5Y A;  1S67 L;  3KSG A;  3UB7 A;  1W63 M;  2W3D A;  2B02 A;  2JKT M;  3S7Q A;  4BJP A;  4EU0 A;  4HIA A;  5AVE A;  3C8C A;  2VZW A;  2ZMF A;  3F1P B;  3MXQ A;  3HJK A;  4G3K A;  2WKP A;  3CWF A;  2J3W A;  5AJG A;  3PBS A;  5TBM A;  2V0U A;  3T4Q A;  5DFX A;  3SW1 A;  1TF1 A;  1NLY A;  1YAX A;  4R6L A;  3LR0 A;  2JN7 A;  4P6Z S;  4DMZ A;  3K3D A;  4MCW A;  3MR0 A;  1TD5 A;  4H6J A;  4UQI S;  5TJJ A;  2PD8 A;  1OJ5 A;  1LSX A;  2H28 A;  3F1N B;  2Y8H A;  4IUK A;  2VLG A;  4QPR A;  5J4E A;  2HGV A;  4MMN A;  3UB6 A;  2KLI A;  3OC2 A;  3UE6 A;  1T19 A;  1T1B A;  2I9V A;  2V1A A;  2KOI A;  3BQA A;  1TS6 A;  3CI6 A;  3EQV A;  4HP9 A;  3DBA A;  2Y79 A;  2QJ7 A;  3GDI A;  1YSQ A;  4IUH A;  2L1M A;  5LBR A;  2J3T C;  2VV6 A;  3PBN A;  1Y28 A;  4HHD A;  2NUP C;  2L4R A;  3KSF A;  4Q0J A;  4JGQ A;  3F1P A;  4I39 A;  3GEC A;  1STZ A;  2HF6 A;  3E98 A;  2LB9 A;  1OT6 A;  3TW8 A;  1VHM A;  3BY9 A;  3K3C A;  1WA9 A;  4K08 A;  3CIT A;  2O9A A;  3PBR A;  3HCY A;  1XFQ A;  3KYZ A;  1UWN X;  2GJ3 A;  2QWS A;  3FC7 A;  3F1O B;  5KIZ A;  1TS7 A;  1D7E A;  1F9I A;  4YNR A;  3KSI A;  1IOU A;  4B93 A;  3BW6 A;  2PD7 A;  4Q0I A;  1OPX A;  4CLC D;  3HJI A;  3LI9 A;  3IS2 B;  4MN5 A;  2XA7 S;  1H8M A;  3PR6 A;  1LSV A;  1OJG A;  2IA2 A;  2QJ5 A;  5HL6 A;  1XJ4 A;  4BWI A;  3KSH A;  2L0W A;  1OTB A;  2KDK A;  1NWZ A;  3NJA A;  4KQD A;  3TRC A;  4WEJ A;  4NXE A;  3EGX C;  1NLZ A;  4G3V A;  2D01 A;  5K5B A;  5HWW A;  5G4Y A;  1P9R A;  1XJ6 A;  3S7P A;  3RFB A;  5KSH A;  4O01 A;  3UB9 A;  3EOI A;  2PT7 A;  2JHE A;  3ZYT A;  2ZOI A;  3EGD C;  5HDC A;  4EES A;  3A0R A;  3E0Y A;  3F1O A;  4Z1W A;  4PHT A;  5C5K A;  2B18 A;  5HDD A;  4EXO A;  3CLO A;  2Z6D A;  3FG8 A;  3IS2 A;  1V9Y A;  2EWW A;  1YKD A;  4EET B;  4IJG A;  4I38 A;  1D06 A;  3R7W B;  3LIA A;  2FH5 A;  1OTA A;  1DRM A;  2VV8 A;  4GHI A;  5HZH A;  2VEA A;  4LPZ A;  5DKL A;  4NKP A;  1GSW A;  2J80 A;  3VE4 A;  3EEH A;  3EEA A;  4HI4 A;  2K2N A;  4II7 A;  1BYW A;  5DJT A;  1N9N A;  4WUJ A;  5HPF A;  3VOL A;  2D02 A;  5HWT A;  2VJW A;  2OOL A;  3VV4 A;  4DJ3 A;  4CLC B;  2BAS A;  4GJ4 A;  2PR6 A;  2P7J A;  3LR4 A;  4AFI A;  2FZ0 A;  1KOU A;  3LYX A;  3NOP C;  2W0N A;  2W3G A;  2DMW A;  2OWH A;  3A0V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...