1D7EA

Crystal structure of the p65 crystal form of photoactive yellow protein
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
122
structure length
119
Chain Sequence
VAFGSEDIENTLAKMDDGQLDGLAFGAIQLDGDGNILQYNAAEGDITGRDPKQVIGKNFFKDVAPCTDSPEFYGKFKEGVASGNLNTMFEYTFDYQMTPTKVKVHMKKALSYWVFVKRV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Conformational substates in different crystal forms of the photoactive yellow protein--correlation with theoretical and experimental flexibility.
pubmed rcsb
source organism Halorhodospira halophila
molecule tags Photosynthesis
molecule keywords PHOTOACTIVE YELLOW PROTEIN
total genus 32
structure length 119
sequence length 122
ec nomenclature
pdb deposition date 1999-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00989 PAS PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 1d7eA00
2QWSA 3LIEA 1TS7A 1T1CA 3EWKA 3F1NB 3LYXA 2OWJA 3OLOA 2L1MA 2PHYA 3F1OA 4H6JA 1JNUA 1LSXA 3BY9A 4KUOA 4EERA 1XFQA 3E4QA 4MN5A 3D72A 2PR6A 3LUQA 3K3CA 2EA9A 4LLOB 1XJ3A 4LRYC 5IU1A 2ZBBA 2WKPA 4GW9A 2VV6A 4HH3A 5DKLA 2B02A 3CAXA 3UE6A 3F1NA 1V9ZA 2VEAA 1S4SA 3HJKA 4GCZA 4HQAA 3VE3A 3SW1A 4HI4A 1LL8A 4BBVA 1OT6A 5TBMB 2PYRA 4I38A 3UMEA 4F3LB 5HWVA 2GJ3A 1OJGA 2W27A 3F1PA 2VV7A 3LIFA 4JGRA 5IS1A 3CLOA 1DP6A 3RTYA 2A24A 1N9NA 2QJ7A 2Z6CA 3PYPA 1TS8A 5J3WA 3CWFA 3ULFA 3NHQA 4WLAA 3MQOA 2QHKA 2Z6DA 3MXQA 4GS9B 4I3AA 4WN5A 4EEPA 3UB7A 5G4YA 4NXEA 1WA9A 1D7EA 3KX0X 5AVEA 4L9GA 5DKKA 4HJ6A 2INWA 5HDCA 2A24B 4HHDA 4JGQA 3UB9A 2BASA 3ICYA 3A0RA 1N9OA 1MZUA 2KDKA 3BWLA 5DJUA 2JN7A 2P7JA 3FC7A 4HH2A 2PDRA 3G6OA 5TBMA 1S1ZA 3RH8B 4I3JA 4MN6A 5F69A 3UMDA 2VV8A 1OTBA 3VE4A 3VOLA 2YKHA 1OTDA 5HD5A 4BBUA 1T1BA 1P0ZA 3H82A 4GHIB 4HJ3A 3BY8A 4R3AA 3LIDA 4RQ9A 4XT2A 1OT9A 1XFNA 1UWNX 2PD7A 2HV1A 3E4PA 3H7WA 3MQQA 2W0NA 1X0OA 3LI8A 3C2WA 3NOTC 3NOUC 1DP8A 4GS9A 4E04A 4R6LA 2OOLA 4H6JB 2V9AA 4LRXC 5HDSA 2JHEA 2J80A 2PR5A 4JGPA 2PD8A 4HNBA 4EEUA 4KUKA 3ZQ5A 4WL9A 1T18A 4KQDA 4I3IA 3B33A 3UB6A 3NJAA 4L9FA 2R78A 5EFWA 3MFXA 4HP4A 1XJ4A 2VLGA 4BBTA 4NXBA 2QJ5A 5J4EA 1S4RA 1V9YA 5J7EA 5F68A 3MR0A 1EW0A 1XJ6A 1N9LA 1P97A 1VB6A 5DJTA 4R70A 2PYPA 5KIZA 1GSXA 1KOUA 1T19A 4HY8A 3EEHA 3GECA 2M1CA 4HIAA 4DJ3A 1DRMA 3A0SA 1T1AA 4HJ4A 3LI9A 1LSVA 3FG8A 1LSWA 4PKYA 4EW7A 4LRZE 2D02A 1OJ5A 1F98A 1NWZA 3NOPC 4LPZA 1Y28A 1G28A 2WKRA 4R38A 1TS0A 4B9OA 4F3LA 1XJ2A 1S1YA 5G4ZA 2CMNA 1BYWA 1DP9A 2L0WA 1GSWA 2V1AA 2QKPA 2WKQA 3F1OB 4K08A 3MJQA 3UB8A 4DJ2A 2D01A 1TS6A 1OTIA 2V0WA 5HDDA 2H28A 4I5SA 2KX6A 3K3DA 4I39A 4M4XA 1S67L 4HP9A 4PKYG 2K7SA 3E4OA 5A8BA 2YKFA 4XT2B 3P7NA 5HSQA 5F5YA 5I5LA 3T50A 4HOIA 4NXGA 3A0VA 3LICA 3IS2A 2V0UA 3PHYA 4WUJA 5HD3A 3HJIA 4EQ1A 1D06A 3LIAA 3IBRA 5F6AA 1UGUA 2V1BA 3H9WA 4EXOA 2ZOHA 5HZHA 4L9EA 3GDIA 4JGOA 3C8CA 5HWWA 4EETB 2I9VA 1UWPX 4YWZA 1GSVA 3IS2B 1S66L 2ZOIA 3LIBA 2L4RA 1OTEA 4WF0A 3H82B 4GHIA 1LT0A 1F9IA 4NXFA 5AVFA 1OTAA 3F1PB 2OWHA 3H7WB 5HWTA 1ODVA 4EESA
chains in the Genus database with same CATH superfamily
4WEJA 3LYXA 3ZDJA 4H6JA 3DAVA 3B47A 5GL9A 3G34A 5IU1A 2VV6A 5DKLA 3O86A 4OH0A 2PBYA 2HP6A 4OPYA 5HARA 1OJGA 4X25A 1TS8A 1QMFA 3AGDA 3JVVA 3VSLA 2B18A 3MXQA 3R7WB 3FPWA 5G4YA 2BLSA 5CX7A 5FI2A 2JN7A 5F69A 2YKHA 1IYQA 3WS2A 2JKFA 2OLVA 1YPRA 4QU3A 2Y2OA 3MS6A 2OAP1 1K55A 3KSHA 3OPRA 2PYPA 3EEHA 1FSYA 1T1AA 1Z6FA 1IKGA 5A8BA 3FG8A 4M3KA 3BJNA 1TS0A 3QP8A 5K5BA 4CLCC 4ARZA 3UO9A 2KX6A 2FFFB 4OVDA 3BECA 2WADA 2VGLS 4DN0A 1ZG4A 1IYSA 2DNSA 4FD8A 3C4OA 3PHYA 1G6OA 5HD3A 3IXBA 5HFOA 1KVMA 4EXOA 1XPBA 3QP1A 3IS2B 5FDSA 2EX9A 4JXGA 3IXHA 3T4JA 4O01A 3KYEA 3ITBA 2PR6A 3UPOA 3LUQA 5A91A 5FI7A 2WGIA 1ALQA 3HJKA 3VE3A 2XQZA 4BD1A 3F1PA 3Q7VB 3UDIA 2A24A 1YLWA 4E3NA 2PRFA 1H8ZA 4WZ5C 3UB7A 2G2UA 1LI9A 5CHJA 2W1TA 3ZG7B 1OMEA 3KSGA 1L0FA 5HD5A 3WS0A 1PWGA 3MZFA 1SZVA 1YLTA 1W5DA 3NOUC 1CEFA 4HBUA 4IEDA 3G32A 1YSQA 2V9AA 2J80A 2JKRM 3EGXC 4YINA 3W2ZA 1S4RA 4C3QA 1H3QA 3CITA 3HREA 3U2AA 2XRNA 4Q0JA 4ZAMA 1P9WA 3QP6A 1IKIA 5F83A 1YSPA 5MC7A 3PBOA 1LSWA 4AFIA 3FV7A 3HUMA 3OBFA 3BQ8A 1PRQA 5FL3A 3JYIA 2Y2GA 2FH5A 4IUKA 1F2KA 1ES2A 2J8YA 5HSQA 5DTSA 1GHMA 1YAXA 1ES3A 3WRTA 4QY6A 3JVUA 3HJIA 2I72A 4NEED 1D06A 2ZC4B 3N8SA 5HZHA 4WYYA 1XA7A 4YWZA 1S66L 1KDWA 4JPMA 3T1SA 1LT0A 1K54C 2QMIA 3OLOA 4R70A 1W8YA 4PHTA 4DKIA 3BEBA 3KSFA 5E2GA 4EERA 3T4LA 1ZTUA 1BSGA 1Z09A 3UMEA 4N1HA 5EM0A 1CI9A 4H8RA 4C75A 3PBQA 4EEPA 3BFCA 5AVEA 2INWA 2JE5A 4IHQA 2E8IA 4EQIA 1N9OA 2P9VB 3BWLA 2XSSA 5EOOA 4JF6A 1T1BA 3H82A 1NLYA 1L0EA 4WELA 3ZG0A 3S7NA 1XA1A 2W1RA 4FH2A 4GS9A 3QP5A 4LCMA 1HTZA 5GLBA 2Y2NA 2Z2LB 4P6BA 4ZRRA 3IF6A 2OLUA 3LFVA 3Q7VA 1GA0A 2X01A 4RVAA 5EFWA 3WS5A 5EOEA 4R4RA 5TR7A 4P0MA 5CTNA 4HY8A 1KE3A 3MKFA 3HUNA 5GLDA 3EOIA 5CGWA 1F98A 3IH9A 1BUEA 1W7FA 1XJ2A 4A5RA 3A3JA 2WKQA 2QKPA 5HL6A 1JWZA 1J9MA 5E2FA 2B5RA 1N4OA 5F6AA 3HL9A 1UGUA 5FQMA 4EETB 3HLCA 3T4OA 1K0KA 1GSVA 4K0XA 1TDLA 3ZCZA 3VMAA 2X71A 5A92A 2EX2A 4CLCD 3ZG9B 2EX6A 3EWKA 1E3UD 2EFXA 2A3UA 3SH7A 4S2PA 4MN5A 3HBRA 4JXWA 4UA6A 4GNUA 2KOIA 5AQBA 1YLYA 2W3HA 4B4ZA 2XA7M 2Y2KA 4CQHA 1C3BA 3NHQA 4I3AA 5CHMA 4ETZA 4F3LA 3M6BA 2GNXA 2Y91A 2A24B 2W3FA 5HAPA 3V50A 2ZQ9A 3DW0A 4I3JA 3DTKA 4KZ9A 1PWCA 5FEFA 2XLNA 3O5YA 5J7EA 3LI8A 3C2WA 4E3OA 3ZNYA 2PR5A 4O8GA 3VP0A 1YM1A 3E98A 1RP5A 1LL9A 1MY8A 4IVKA 4PPRA 4LV0A 3CPTB 3BW6A 2PU2A 1NZOA 3NC8A 5AJGA 4ZJ2A 3PAGA 3GECA 1CQAA 4DJ3A 1KGFA 4IUHA 4HJ4A 4LRZE 4FCFA 3S7QA 3IHAA 3WRZA 5FQJA 1BYWA 1VM1A 2K7SA 2DCFA 3MF0A 2Y2HA 4GDBA 2V0UA 1G68A 3BQAA 3GDIA 4Y15A 5HWWA 4E3MA 3L9KA 1JTGA 4UQIS 4JBFA 5HWTA 3UPPA 3Q82A 1LSXA 1J3WA 4YOFA 1WYCA 3E0YA 4Y17A 3KO6A 2WGVA 2ZL1A 1PI4A 3MKEA 4GCZA 4R4SA 5TBMB 3O3VA 5G18A 3RTYA 5HPIA 2Y2LA 4DXCA 5J3WA 4DE3A 4WLAA 4OOLA 2WYXA 3C30A 3VP2A 1TD5A 5HAIA 5HDCA 3U4LP 1JTDA 1D1JA 1DY6A 4GDNA 2BASA 1YLZA 2Y4AA 5FQQA 2Y2MA 3NY4A 5F82A 3G2YA 2HV1A 3NOTC 5E2HA 5EUAA 2OOLA 2ZC3B 4QHCA 1CK3A 2IWDA 1YKDA 4KUKA 4GJ4A 1ONHA 3DTMA 4PM6A 3IF6B 4MEZA 4R23A 1NRFA 1M40A 3S1YA 3D4FA 3ZHHA 4B93A 2W3EA 3LO7A 1W63M 2ZM2A 1NJ4A 1SDNA 3TRCA 1ZG6A 3M2JA 4X68A 1OJ5A 1NWZA 3IXDA 5IHVA 1Y28A 3F1OB 3MJQA 3NBLA 3OCNA 1TS6A 3TJZC 3CHWP 4E3KA 4XT2B 4NXGA 5CEDA 1YLPA 3S7OA 3N7WA 5CEBA 2V1BA 3RXXA 5EE8A 3ITAA 2W1TB 4B88A 4JGOA 5EVEA 4CPKA 3LIBA 4ZJ3A 3HUOA 3HLWA 3MXRA 3UNWA 4G3KA 1HZOA 3FKVA 3LIEA 2HPBA 1JNUA 3BY9A 3QP2A 4HBTA 4KZ5A 3L7HA 2Y2IA 3NI9A 4IJGA 4ESPA 4FUWA 2ACGA 2EWVA 4O0PA 3AGEA 3KX0X 2HJ9C 3QNCA 2P7JA 1BT5A 3NDEA 3VOLA 2ZC6B 1IYOA 3LIDA 5L07A 3QNBA 3IF6C 5U47A 4QY5A 5HDSA 4E6XA 1XX2A 1KDSA 1Q2PA 1T18A 4WMCA 5D3OA 3V5MA 3MQ0A 4XUZA 5EVIB 1JWVA 2Y2QA 3GRJA 1EWZA 4P6ZS 2Q9MA 2EWWA 5KZHA 2WGWA 4PM9A 3HLDA 2O0YA 2WKRA 5G4ZA 3UB6A 1GSWA 2CC1A 3IT9A 2D01A 2H0TA 4I5SA 4KZ8A 5AQAA 4LV3A 4M4XA 3NCKA 2P9VA 4CLCB 3UN7A 2ZQ7A 5JYOA 1FR1A 1VETA 3VSKA 1OTEA 4EBLA 3OC2A 5GLCA 3H82B 4NXFA 1GCEA 2WAFA 2WZZA 3OPLA 3BFGA 2QWSA 3F1NB 3F1OA 1K57A 2NUPC 3CJMA 3EQVA 1XFQA 3IF5A 1IFQA 3EGDC 3EQUA 1SKFA 3I7JA 3ZYTA 3UE6A 1V9ZA 4N1XA 3WS4A 3S7PA 3B42A 4JGRA 3V39A 2H10A 2GX5A 3CWFA 3NECA 4WN5A 5FSRA 2WK0A 2O9BA 1WA9A 3DTIA 2EFUA 3IHBA 1SHVA 1Y4OA 5M18A 4D60A 5DF9A 3SW1A 2JKRI 4FOFA 2VJWA 3OOVA 2PD8A 1K4FA 3IX8A 4PAUA 4R3JA 2J3WA 1F5MA 3LY3A 4EU0A 4L9FA 1MC0A 2R78A 2VLGA 1WYBA 1SKOA 1VB6A 2Q0OA 1QMEA 3WS1A 4BL3A 1I5QA 2E8JA 3RFBA 4B9OA 1NLZA 2XA7S 3UB8A 4BENA 1PIOA 3LEZA 5DFXA 4GZBA 1PNEA 3P7NA 5CERA 1BLHA 2ZMAA 5HX9A 2ZQAA 4LCLA 2A2LA 1BTLA 2ZOHA 4UHUA 5JYPA 2ZL1B 3IBJA 5AVFA 3Q81A 4E3JA 1ODVA 5FQKA 1E25A 1TS7A 3HVFA 2OWJA 4E6WA 4G3WA 4NK3A 1XXMA 5EVID 3K3CA 4LRYC 3CAXA 5A90A 2J9PA 4HQAA 3CPTA 2HZ5A 3VP4A 2HDQA 3SH8A 4KENB 4Y0OA 2QJ7A 4MMNA 4QB8A 3ULFA 3DWKA 2ZLYA 4FTXA 5CHUA 1L0GA 4S2NA 4HEFA 2J3TC 3UB9A 4OQ0A 4DJ2A 1EROA 1K56A 1XGIA 5TBMA 5L09A 4KZ4A 4R3BA 4QWOA 4BJPA 2WKIA 2XFSA 4R3AA 2V8FA 1CF0A 1UWNX 4X6TA 3HLFA 2JKGA 3BM6A 4X69A 4KZBA 2UV0E 5CGSA 1DJCA 2PBDP 4OKPA 4KZ7A 4HP4A 3V3SA 4OOYA 4OPZA 1IYPA 2LB5A 4O7DA 2VA0A 5EVIA 4N9LA 2M7UA 3JPUA 3GV9A 3VFHA 1BULA 1N9BA 3HLGA 3LY4A 4FH4A 2V0WA 2XDMA 2ZC7A 4GN2A 1FOFA 4DDYA 5I5LA 3O87A 2WAEA 4EQ1A 4LFUA 2K2NA 5DVAA 5DTTA 2Q9NA 5BOHA 4MBHA 3S22A 3UE3A 1UWPX 5HW3A 3MSHA 2PU4A 3UB5P 4WF0A 4MBFA 4BLMA 1OTAA 3H7WB 3W8KA 1TVFA 4HH2A 3KYQA 1I2WA 4KQQA 2Y8HA 4Q0HA 3T4TA 4P87A 3BFDA 3MFDA 2MJ6A 3F1NA 4Y7PA 4KG6A 1YQSA 3G31A 3T1XA 1LL8A 2RL3A 2PYRA 3PXPA 1DP6A 5EM1A 3P01A 4OP8A 1FCOA 1HLUP 2OSUA 4KG2A 3MBZA 4E3IA 4RX2A 3T12B 3FC7A 3DBAA 4S2LA 5FI6A 2VV8A 4N92A 4LV1A 1OTDA 3PBSA 4BBUA 2VK3A 4XT2A 1NZUA 3MQQA 3CI6A 4R6LA 2GZAA 1S0WA 3ISGA 2JCHA 3UDFA 4KQDA 2Y2PA 4KQRA 2ZD8A 3NJAA 3VP1A 3CUEA 2P74A 3PR6A 3MFXA 4X55A 4NXBA 5J4EA 5L2FA 2Y79A 3IXGA 1N9LA 2ZM0A 5DJTA 4OONA 4QD4A 1FCNA 2V2FF 2W3GA 3A0SA 1ACFA 4PKYA 2P08A 4LPZA 3SZTA 5HPFA 2Y59A 4RYEA 3G30A 4DRTA 5FDHA 1K4EA 3A0VA 4PM8A 5J8XA 3IS2A 5HL1A 3LIAA 5KSCA 2K31A 4P6ZM 1G6AA 3UDXA 1K6RA 4QPRA 4GHIA 4BL2A 4U0XA 1H8MA 2NUTC 2OWHA 1MKMA 4S2JA 2PHYA 2AVXA 2VGLM 1O7EA 3VOYA 4HI4A 4S2MA 3ZFZA 3LCEA 2Y2JA 2W27A 2P04A 4KQOA 1PI5A 3N8RA 3MMHA 2Z6CA 3FPVA 1L3LA 1ZHHB 4MBKA 4UA9A 3ZVWA 4JXSA 1FSWA 5E43A 3TSGA 5DJUA 3CMZA 2KDKA 1LHYA 2ZQDA 4EWFA 1HVBA 4MN6A 3CG5A 3P98A 3E2LA 4EUZA 3C4PA 4ZDXA 4HESA 4Y3IA 3W4PA 4X53A 3ZQ5A 4EBNA 3UY6A 3B33A 1PFLA 3IX3A 1SCWA 3GQZA 4LV2A 4X1LA 1PZPA 4GB7A 4WZ4A 5FATA 5AQ7A 3C38A 1RGYA 5F68A 2ZMVA 3WWXA 5C5KA 1T19A 2EXAA 4HIAA 4ZBEA 5FEGA 1DRMA 2C5WB 2J9OA 4Q0IA 3LR0A 3NULA 1G28A 3IX4A 3IH8A 2WZXA 4DF6A 5DTKA 1HD8A 3T50A 4OPRA 4BD0A 4JKTA 5DFYA 4X1MA 2V20A 4L9EA 3K2NA 4UA7A 3V3RA 4XUXA 1U60A 3BLMA 1FILA 3C7VA 4LLOB 2HDUA 2ZBBA 4GW9A 2B02A 2BTFP 2HDRA 3V67A 4EV4A 5HWVA 5IS1A 3GMWA 4R0QA 1NY0A 1IEMA 4MDZA 3ZVTA 5CECA 4JGQA 1ONGA 4WZ5A 3A0RA 3PBRA 5GLAA 3B3XA 1S1ZA 2HJEA 1OTBA 3DTEA 5A93A 5FQ9A 4E04A 2HF6A 4JGPA 2G7UA 3UE0A 3LR5A 3T1RA 4GOGA 4MNRA 3VV4A 5F1FA 1ES4A 4CLCE 4CJNA 4BBTA 1MWRA 1NRJA 1V9YA 3MR0A 4UQIM 2KLIA 4DE2A 5FASA 1KGEA 1GHIA 1YT4A 4X56A 1S1YA 3VP3A 2EX8A 3NDGA 2ZM8A 2H28A 2M7VA 5IT5A 2O9CA 3K3DA 1ERQA 3C7UA 4HP9A 4EBPA 1VHMA 3MZEA 1MKIA 3T4SA 3IQAA 2X02A 1XGJA 5TFQA 3C5AA 5EVLA 3T4KA 1W79A 3IWOA 5CXWA 1YMXA 5HAQA 1JWPA 2XF3A 4DXBA 4ZJ1A 1PYYA 3CZDA 4OPQA 3MZDA 1TDGA 5FQIA 1K54A 3D72A 4JF5A 1GHPA 2H0YA 3OPPA 4DMZA 2WKPA 2BG1A 4Y13A 4N9KA 2PAVP 4BBVA 4B4XA 4OQHA 3D3OA 4F3LB 2QPNA 5FAPA 5M1AA 3CLOA 3A3DA 1M6KA 4NETA 4NXEA 5DKKA 2JKTI 3ICYA 1MZUA 2R9WA 1MWTA 1P0ZA 4GD8A 2JC7A 4GKUA 2FZ0A 4OQIA 2JHEA 4EEUA 4HNBA 4Z9QA 4K91A 3PTEA 2O9AA 4E3LA 5F1GA 1XJ4A 2FFYA 1ZC2A 2HDSA 1SDEA 3TG9A 3PAEA 2ZJ9A 4WEKA 3W4QA 1GSXA 2IA2A 2D02A 4G3VA 1PW1A 4R38A 1W8QA 3LGOA 4JF4A 1S67L 3SS4A 5F5YA 2ZC5B 3GVBA 3BYDA 1ZKJA 1MXOA 1ES5A 4JXVA 1EI5A 2L4RA 1MPLA 3E2KA 1F9IA 3RJUA 2VKSA 3AGFA 4KZ3A 1STZA 4QJGA 3PBTA 4MCWA 1CI8A 5AQ9A 5M19A 4ARZB 5EVIC 2VEAA 4I38A 2GJ3A 4WM9A 4EUVA 1LLBA 2VZWA 2Z2MB 3A3FA 3MQOA 2Z6DA 1FCMA 4KZAA 1TF1A 2HGVA 4L9GA 1KE4A 1LL5A 1KGGA 4LENA 1NXYA 4CLCA 4KG5A 4U3TA 1DJBA 4IBXA 3IWIA 3BRMA 5L8MA 1LI0A 4RQ9A 2W0NA 3IWQA 4H6JB 4Y2FA 2B95A 2O99A 1KE0A 3A3EA 3Q07A 1EW0A 1RCJA 5KIZA 4P85A 4JLFA 1IOUA 1TEMA 3HLEA 1E4DA 5E2EA 4ETXA 1BLSA 3MXSA 1LSVA 4EW7A 1O07A 2VX8A 4OQGA 2OV5A 5GHYA 1H5XA 2L0WA 2XGNA 3SS5A 4GD6A 3RXWA 3W4OA 3LICA 4WUJA 3G35A 3TOIA 1K25A 1L2SA 3FKWA 2GDNA 1CJFA 4IVIA 4PMAA 4OLGA 4ME4A 1T1CA 3EEAA 5LBRA 4OOMA 5EV0A 1KVLA 2EA9A 3D9YA 4R1GA 1ESUA 4DDSA 3OPHA 3ZGAB 2OAQ1 5KSHA 3LEQA 5L10A 3FZCA 3M2KA 1N9NA 3PYPA 4F94A 2IWCA 3S4XA 3BFEA 3BFFA 2EXBA 3RH8B 3VOZA 1PW8A 1AXBA 3E4PA 1YMSA 3M6HA 4LRXC 4FSFA 3PBNA 3R4KA 5TGFA 2QJ5A 1K38A 1K55C 2XR0A 4BWIA 1VEUA 4DE1A 4K0WA 1XJ6A 4Q8IA 1K57C 1XKZA 1WE4A 2V1ZA 4D2OA 4K08A 2QYBA 2WGWB 3N8LA 3FWLA 4I39A 3TE8A 1BLPA 1L0DA 5EECA 1FIKA 4Y0UA 2HP5A 3IBRA 1K56D 3C8CA 3KYZA 1MBLA 3SOIA 4NG2A 3F1PB 5FAOA 1VETB 4KUOA 2VGKA 5DF7A 1W63Q 3G2ZA 1XJ3A 5I94A 3HLBA 4NKPA 1S4SA 1OT6A 1GA9A 3R7WA 2VV7A 4WMCD 2ZMFA 1OPXA 2QHKA 3G4PA 3TW8A 1VQQA 4WBGA 4HHDA 1K6SA 3GTCA 3UE1A 3ZG5A 5KMWA 4UAAA 1FR6A 3VE4A 3ZNTA 3UMDA 1ERMA 3NIAA 1H0MA 3UPNA 4KZ6A 2Y55A 4HJ3A 2QZ6A 3BY8A 4PM7A 1OT9A 2PD7A 3H7WA 1X0OA 1DP8A 5DF8A 2ZQCA 1DJAA 4RX3A 4BMWA 4WL9A 4I3IA 4IBRA 3N4IA 2W3DA 2R9XA 2XFTA 3OZHA 2V8CA 1P97A 3VFFA 1SKOB 1BZAA 4PM5A 5EPHA 3KSIA 3NOPC 3OCLA 2H5SA 2ZQ8A 3ZG8B 2CMNA 2JKTM 1E3UA 1DP9A 2RCXA 5CTMA 2XEPA 1Y54A 2PT7A 1OTIA 5HDDA 2C6WB 1RGZA 4PKYG 1S6RA 1CEGA 4S2KA 2YKFA 5GHXA 4S2NC 4HOIA 3A3IA 2XK1A 2DMWA 3BLSA 1YLJA 3P09A 4RA7A 1NYMA 4MLLA 2DRWA 2I9VA 4Y0TA 4ID4A 1BLCA 5TJJA 3T4QA 4MN7A 1MWUA 3HCYA 5FAQA 3SH9A 2L1MA 3LR4A 3Q7ZA 1P9RA 3N6IA 3E4QA 3LR3A 4UEYA 4HH3A 2XH9A 2JBFA 4YNRA 3LIFA 4C6YA 4S2IA 1PWDA 1AWIA 4GS9B 3O88A 1D7EA 1G5UA 2A49A 4HJ6A 1MWSA 4Z1WA 1XP4A 2J3TD 2PDRA 3G6OA 2LB9A 1JVJA 5GHZA 3GR2A 4GLQA 3T1QB 4GHIB 2WKEA 1XFNA 2XD1A 4S2OA 3CUEC 2IWBA 3GSGA 3QP4A 1H8YA 2UWXA 3DWZA 3FYZA 1A0KA 3SS3A 5CGXA 4OLDA 4LGWA 5FA7A 4XXRA 4L0LA 4YFMA 1KOUA 1ESIA 2VGJA 2M1CA 3Q1FA 4OP5A 4ZTKA 1VEUB 3LI9A 1Q2QA 2V1AA 1IELA 4BQMA 1PZOA 2XROA 2XD5A 3E4OA 2G2WA 3QHYA 2WUQA 2WKHA 4DE0A 1FQGA 3H9WA 4Y5FA 1I2SA 5CRFA 2J7VA 2ZOIA 2HP9A 4II7A 4U0TA 4EESA 1NYYA
chains in the Genus database with same CATH topology
1STZA 4WEJA 3LYXA 4HH2A 3PBTA 3KYQA 4H6JA 1LSXA 4MCWA 4YOFA 3E0YA 3B47A 2Y8HA 4Q0HA 4ARZB 3KO6A 5IU1A 3T4TA 2VV6A 5DKLA 2MJ6A 3F1NA 2VEAA 4GCZA 1LL8A 5TBMB 2PYRA 4I38A 3PXPA 2GJ3A 1OJGA 4EUVA 3RTYA 1DP6A 2VZWA 5HPIA 5J3WA 3P01A 1TS8A 3JVVA 4WLAA 2B18A 2Z6DA 3MQOA 3MXQA 4OOLA 3R7WB 3FPWA 3C30A 5G4YA 1TD5A 1TF1A 2HGVA 4L9GA 5CX7A 5HDCA 2BASA 4CLCA 2JN7A 3FC7A 3DBAA 5F69A 2VV8A 2YKHA 1OTDA 3PBSA 4BBUA 5L8MA 4RQ9A 4XT2A 2HV1A 3NOTC 3MQQA 2W0NA 3CI6A 4R6LA 2GZAA 2OOLA 4H6JB 1YKDA 4KUKA 4KQDA 2OAP1 4Y2FA 3NJAA 3CUEA 2O99A 4GJ4A 3KSHA 3PR6A 3MFXA 4NXBA 5J4EA 2Y79A 1EW0A 1N9LA 5DJTA 2PYPA 5KIZA 4B93A 1IOUA 3EEHA 2W3EA 1W63M 2W3GA 3TRCA 4ETXA 3A0SA 1T1AA 1LSVA 3FG8A 4PKYA 2P08A 4EW7A 5A8BA 1OJ5A 1NWZA 2VX8A 4LPZA 1Y28A 3BJNA 1TS0A 3F1OB 2L0WA 5K5BA 5HPFA 3MJQA 3OCNA 1TS6A 4CLCC 3TJZC 4ARZA 2KX6A 4XT2B 2VGLS 4DN0A 4NXGA 3A0VA 3LICA 3IS2A 3PHYA 3S7OA 1G6OA 4WUJA 5HD3A 3LIAA 2V1BA 2K31A 4P6ZM 4EXOA 2W1TB 4JGOA 3IS2B 3LIBA 4QPRA 4GHIA 4G3KA 1H8MA 2NUTC 2OWHA 1MKMA 4ME4A 3LIEA 1T1CA 3T4JA 4O01A 3EEAA 2PHYA 1JNUA 3BY9A 5LBRA 2PR6A 4OOMA 4IJGA 3LUQA 2EA9A 2VGLM 3HJKA 3VE3A 4HI4A 2OAQ1 2W27A 2P04A 3F1PA 4KQOA 5KSHA 2EWVA 2A24A 4O0PA 3MMHA 1N9NA 2Z6CA 3PYPA 3FPVA 1ZHHB 3UB7A 3KX0X 2HJ9C 5DJUA 2W1TA 2KDKA 2P7JA 3RH8B 4MN6A 3VOLA 3KSGA 5HD5A 3LIDA 3E4PA 3NOUC 4Y3IA 1YSQA 2V9AA 4LRXC 5HDSA 4FSFA 2J80A 2JKRM 3ZQ5A 1T18A 3B33A 3PBNA 3EGXC 3R4KA 3W2ZA 3MQ0A 2QJ5A 1S4RA 4BWIA 3C38A 1H3QA 3CITA 5F68A 1XJ6A 3U2AA 2ZMVA 2XRNA 4Q0JA 1P9WA 5C5KA 1T19A 4P6ZS 4HIAA 2EWWA 1DRMA 1YSPA 5MC7A 3PBOA 1LSWA 4AFIA 4Q0IA 2O0YA 3LR0A 3OBFA 1G28A 2WKRA 3BQ8A 5G4ZA 3UB6A 5FL3A 1GSWA 4K08A 2QYBA 2D01A 2FH5A 4IUKA 4I5SA 4I39A 4M4XA 5HSQA 3TE8A 1YAXA 3T50A 3JVUA 3HJIA 4NEED 1D06A 3IBRA 5DFYA 4CLCB 5HZHA 4L9EA 3C8CA 4YWZA 1S66L 3KYZA 1OTEA 3OC2A 3K2NA 3H82B 1LT0A 4NXFA 3F1PB 2QWSA 3OLOA 4R70A 3F1NB 4PHTA 3F1OA 2NUPC 4KUOA 3KSFA 3EQVA 4EERA 1XFQA 3T4LA 1ZTUA 1W63Q 1IFQA 3EGDC 3EQUA 1XJ3A 4LLOB 2ZBBA 4GW9A 3ZYTA 4NKPA 2B02A 3UE6A 1V9ZA 1S4SA 3V67A 1OT6A 3S7PA 3R7WA 3UMEA 5HWVA 2VV7A 3B42A 4JGRA 2ZMFA 5IS1A 1OPXA 2GX5A 3CWFA 3PBQA 2QHKA 3TW8A 4WN5A 4EEPA 4MDZA 2O9BA 1WA9A 5AVEA 2INWA 4JGQA 4HHDA 4IHQA 3A0RA 3PBRA 1N9OA 3BWLA 1S1ZA 2HJEA 2XSSA 3VE4A 3UMDA 1OTBA 1T1BA 3H82A 4HJ3A 5DF9A 3BY8A 1NLYA 4WELA 1OT9A 2PD7A 3S7NA 3H7WA 3SW1A 2JKRI 2W1RA 1X0OA 4FOFA 4E04A 4GS9A 1DP8A 2VJWA 3OOVA 2HF6A 4JGPA 2G7UA 2PD8A 4ZRRA 3LR5A 4PAUA 4BMWA 4WL9A 3VV4A 2J3WA 4I3IA 3LFVA 1F5MA 4EU0A 4L9FA 1MC0A 2R78A 5EFWA 4CLCE 2W3DA 4BBTA 2VLGA 1NRJA 1V9YA 3MR0A 4UQIM 2KLIA 1P97A 1VB6A 4HY8A 3EOIA 3RFBA 1F98A 3KSIA 3NOPC 3OCLA 4B9OA 1NLZA 1XJ2A 1S1YA 2XA7S 2CMNA 2JKTM 1DP9A 2WKQA 2QKPA 3UB8A 5HL6A 2PT7A 1OTIA 5HDDA 2H28A 2M7VA 5IT5A 2O9CA 3K3DA 4PKYG 4HP9A 5DFXA 2YKFA 1VHMA 3P7NA 4HOIA 3T4SA 2DMWA 5F6AA 1UGUA 2A2LA 2ZOHA 4EETB 2I9VA 3T4OA 1GSVA 3T4KA 5TJJA 3T4QA 4MN7A 3IBJA 5AVFA 1ODVA 4CLCD 3HCYA 1TS7A 3EWKA 2OWJA 2L1MA 3LR4A 1P9RA 4G3WA 4MN5A 3E4QA 3LR3A 3D72A 3K3CA 4UEYA 4LRYC 4DMZA 2WKPA 4HH3A 3CAXA 2KOIA 4HQAA 4BBVA 2W3HA 4F3LB 3D3OA 4YNRA 3LIFA 2XA7M 3CLOA 4CQHA 2QJ7A 4MMNA 3ULFA 3NHQA 4I3AA 4ETZA 4GS9B 4F3LA 2GNXA 4NXEA 1D7EA 5DKKA 4HJ6A 2JKTI 2A24B 2J3TC 2W3FA 4Z1WA 2J3TD 3UB9A 3ICYA 1MZUA 4DJ2A 2PDRA 3G6OA 5TBMA 4I3JA 2LB9A 4GLQA 4BJPA 1P0ZA 4GHIB 4R3AA 3O5YA 2FZ0A 1XFNA 1UWNX 5J7EA 3LI8A 3C2WA 3CUEC 2JHEA 4EEUA 2PR5A 4HNBA 4O8GA 3E98A 2O9AA 4HP4A 1XJ4A 3BW6A 4WEKA 5AJGA 4L0LA 2LB5A 1GSXA 1KOUA 3GECA 2M1CA 2VA0A 4DJ3A 4IUHA 4HJ4A 2IA2A 3LI9A 2M7UA 4LRZE 2D02A 3S7QA 4G3VA 4R38A 1BYWA 2V1AA 2V0WA 1S67L 2XROA 2K7SA 3E4OA 3MF0A 5F5YA 5I5LA 2V0UA 4EQ1A 2K2NA 3H9WA 4Y5FA 3BQAA 3GDIA 5HWWA 3UE3A 1UWPX 2ZOIA 2L4RA 4UQIS 4WF0A 1F9IA 1OTAA 4II7A 3H7WB 5HWTA 4EESA 2VKSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QWS A;  3LIE A;  1TS7 A;  1T1C A;  3EWK A;  3F1N B;  3LYX A;  2OWJ A;  3OLO A;  2L1M A;  2PHY A;  3F1O A;  4H6J A;  1JNU A;  1LSX A;  3BY9 A;  4KUO A;  4EER A;  1XFQ A;  3E4Q A;  4MN5 A;  3D72 A;  2PR6 A;  3LUQ A;  3K3C A;  2EA9 A;  4LLO B;  1XJ3 A;  4LRY C;  5IU1 A;  2ZBB A;  2WKP A;  4GW9 A;  2VV6 A;  4HH3 A;  5DKL A;  2B02 A;  3CAX A;  3UE6 A;  3F1N A;  1V9Z A;  2VEA A;  1S4S A;  3HJK A;  4GCZ A;  4HQA A;  3VE3 A;  3SW1 A;  4HI4 A;  1LL8 A;  4BBV A;  1OT6 A;  5TBM B;  2PYR A;  4I38 A;  3UME A;  4F3L B;  5HWV A;  2GJ3 A;  1OJG A;  2W27 A;  3F1P A;  2VV7 A;  3LIF A;  4JGR A;  5IS1 A;  3CLO A;  1DP6 A;  3RTY A;  2A24 A;  1N9N A;  2QJ7 A;  2Z6C A;  3PYP A;  1TS8 A;  5J3W A;  3CWF A;  3ULF A;  3NHQ A;  4WLA A;  3MQO A;  2QHK A;  2Z6D A;  3MXQ A;  4GS9 B;  4I3A A;  4WN5 A;  4EEP A;  3UB7 A;  5G4Y A;  4NXE A;  1WA9 A;  1D7E A;  3KX0 X;  5AVE A;  4L9G A;  5DKK A;  4HJ6 A;  2INW A;  5HDC A;  2A24 B;  4HHD A;  4JGQ A;  3UB9 A;  2BAS A;  3ICY A;  3A0R A;  1N9O A;  1MZU A;  2KDK A;  3BWL A;  5DJU A;  2JN7 A;  2P7J A;  3FC7 A;  4HH2 A;  2PDR A;  3G6O A;  5TBM A;  1S1Z A;  3RH8 B;  4I3J A;  4MN6 A;  5F69 A;  3UMD A;  2VV8 A;  1OTB A;  3VE4 A;  3VOL A;  2YKH A;  1OTD A;  5HD5 A;  4BBU A;  1T1B A;  1P0Z A;  3H82 A;  4GHI B;  4HJ3 A;  3BY8 A;  4R3A A;  3LID A;  4RQ9 A;  4XT2 A;  1OT9 A;  1XFN A;  1UWN X;  2PD7 A;  2HV1 A;  3E4P A;  3H7W A;  3MQQ A;  2W0N A;  1X0O A;  3LI8 A;  3C2W A;  3NOT C;  3NOU C;  1DP8 A;  4GS9 A;  4E04 A;  4R6L A;  2OOL A;  4H6J B;  2V9A A;  4LRX C;  5HDS A;  2JHE A;  2J80 A;  2PR5 A;  4JGP A;  2PD8 A;  4HNB A;  4EEU A;  4KUK A;  3ZQ5 A;  4WL9 A;  1T18 A;  4KQD A;  4I3I A;  3B33 A;  3UB6 A;  3NJA A;  4L9F A;  2R78 A;  5EFW A;  3MFX A;  4HP4 A;  1XJ4 A;  2VLG A;  4BBT A;  4NXB A;  2QJ5 A;  5J4E A;  1S4R A;  1V9Y A;  5J7E A;  5F68 A;  3MR0 A;  1EW0 A;  1XJ6 A;  1N9L A;  1P97 A;  1VB6 A;  5DJT A;  4R70 A;  2PYP A;  5KIZ A;  1GSX A;  1KOU A;  1T19 A;  4HY8 A;  3EEH A;  3GEC A;  2M1C A;  4HIA A;  4DJ3 A;  1DRM A;  3A0S A;  1T1A A;  4HJ4 A;  3LI9 A;  1LSV A;  3FG8 A;  1LSW A;  4PKY A;  4EW7 A;  4LRZ E;  2D02 A;  1OJ5 A;  1F98 A;  1NWZ A;  3NOP C;  4LPZ A;  1Y28 A;  1G28 A;  2WKR A;  4R38 A;  1TS0 A;  4B9O A;  4F3L A;  1XJ2 A;  1S1Y A;  5G4Z A;  2CMN A;  1BYW A;  1DP9 A;  2L0W A;  1GSW A;  2V1A A;  2QKP A;  2WKQ A;  3F1O B;  4K08 A;  3MJQ A;  3UB8 A;  4DJ2 A;  2D01 A;  1TS6 A;  1OTI A;  2V0W A;  5HDD A;  2H28 A;  4I5S A;  2KX6 A;  3K3D A;  4I39 A;  4M4X A;  1S67 L;  4HP9 A;  4PKY G;  2K7S A;  3E4O A;  5A8B A;  2YKF A;  4XT2 B;  3P7N A;  5HSQ A;  5F5Y A;  5I5L A;  3T50 A;  4HOI A;  4NXG A;  3A0V A;  3LIC A;  3IS2 A;  2V0U A;  3PHY A;  4WUJ A;  5HD3 A;  3HJI A;  4EQ1 A;  1D06 A;  3LIA A;  3IBR A;  5F6A A;  1UGU A;  2V1B A;  3H9W A;  4EXO A;  2ZOH A;  5HZH A;  4L9E A;  3GDI A;  4JGO A;  3C8C A;  5HWW A;  4EET B;  2I9V A;  1UWP X;  4YWZ A;  1GSV A;  3IS2 B;  1S66 L;  2ZOI A;  3LIB A;  2L4R A;  1OTE A;  4WF0 A;  3H82 B;  4GHI A;  1LT0 A;  1F9I A;  4NXF A;  5AVF A;  1OTA A;  3F1P B;  2OWH A;  3H7W B;  5HWT A;  1ODV A;  4EES A; 
#chains in the Genus database with same CATH topology
 4WEJ A;  3LYX A;  3ZDJ A;  4H6J A;  3DAV A;  3B47 A;  5GL9 A;  3G34 A;  5IU1 A;  2VV6 A;  5DKL A;  3O86 A;  4OH0 A;  2PBY A;  2HP6 A;  4OPY A;  5HAR A;  1OJG A;  4X25 A;  1TS8 A;  1QMF A;  3AGD A;  3JVV A;  3VSL A;  2B18 A;  3MXQ A;  3R7W B;  3FPW A;  5G4Y A;  2BLS A;  5CX7 A;  5FI2 A;  2JN7 A;  5F69 A;  2YKH A;  1IYQ A;  3WS2 A;  2JKF A;  2OLV A;  1YPR A;  4QU3 A;  2Y2O A;  3MS6 A;  2OAP 1;  1K55 A;  3KSH A;  3OPR A;  2PYP A;  3EEH A;  1FSY A;  1T1A A;  1Z6F A;  1IKG A;  5A8B A;  3FG8 A;  4M3K A;  3BJN A;  1TS0 A;  3QP8 A;  5K5B A;  4CLC C;  4ARZ A;  3UO9 A;  2KX6 A;  2FFF B;  4OVD A;  3BEC A;  2WAD A;  2VGL S;  4DN0 A;  1ZG4 A;  1IYS A;  2DNS A;  4FD8 A;  3C4O A;  3PHY A;  1G6O A;  5HD3 A;  3IXB A;  5HFO A;  1KVM A;  4EXO A;  1XPB A;  3QP1 A;  3IS2 B;  5FDS A;  2EX9 A;  4JXG A;  3IXH A;  3T4J A;  4O01 A;  3KYE A;  3ITB A;  2PR6 A;  3UPO A;  3LUQ A;  5A91 A;  5FI7 A;  2WGI A;  1ALQ A;  3HJK A;  3VE3 A;  2XQZ A;  4BD1 A;  3F1P A;  3Q7V B;  3UDI A;  2A24 A;  1YLW A;  4E3N A;  2PRF A;  1H8Z A;  4WZ5 C;  3UB7 A;  2G2U A;  1LI9 A;  5CHJ A;  2W1T A;  3ZG7 B;  1OME A;  3KSG A;  1L0F A;  5HD5 A;  3WS0 A;  1PWG A;  3MZF A;  1SZV A;  1YLT A;  1W5D A;  3NOU C;  1CEF A;  4HBU A;  4IED A;  3G32 A;  1YSQ A;  2V9A A;  2J80 A;  2JKR M;  3EGX C;  4YIN A;  3W2Z A;  1S4R A;  4C3Q A;  1H3Q A;  3CIT A;  3HRE A;  3U2A A;  2XRN A;  4Q0J A;  4ZAM A;  1P9W A;  3QP6 A;  1IKI A;  5F83 A;  1YSP A;  5MC7 A;  3PBO A;  1LSW A;  4AFI A;  3FV7 A;  3HUM A;  3OBF A;  3BQ8 A;  1PRQ A;  5FL3 A;  3JYI A;  2Y2G A;  2FH5 A;  4IUK A;  1F2K A;  1ES2 A;  2J8Y A;  5HSQ A;  5DTS A;  1GHM A;  1YAX A;  1ES3 A;  3WRT A;  4QY6 A;  3JVU A;  3HJI A;  2I72 A;  4NEE D;  1D06 A;  2ZC4 B;  3N8S A;  5HZH A;  4WYY A;  1XA7 A;  4YWZ A;  1S66 L;  1KDW A;  4JPM A;  3T1S A;  1LT0 A;  1K54 C;  2QMI A;  3OLO A;  4R70 A;  1W8Y A;  4PHT A;  4DKI A;  3BEB A;  3KSF A;  5E2G A;  4EER A;  3T4L A;  1ZTU A;  1BSG A;  1Z09 A;  3UME A;  4N1H A;  5EM0 A;  1CI9 A;  4H8R A;  4C75 A;  3PBQ A;  4EEP A;  3BFC A;  5AVE A;  2INW A;  2JE5 A;  4IHQ A;  2E8I A;  4EQI A;  1N9O A;  2P9V B;  3BWL A;  2XSS A;  5EOO A;  4JF6 A;  1T1B A;  3H82 A;  1NLY A;  1L0E A;  4WEL A;  3ZG0 A;  3S7N A;  1XA1 A;  2W1R A;  4FH2 A;  4GS9 A;  3QP5 A;  4LCM A;  1HTZ A;  5GLB A;  2Y2N A;  2Z2L B;  4P6B A;  4ZRR A;  3IF6 A;  2OLU A;  3LFV A;  3Q7V A;  1GA0 A;  2X01 A;  4RVA A;  5EFW A;  3WS5 A;  5EOE A;  4R4R A;  5TR7 A;  4P0M A;  5CTN A;  4HY8 A;  1KE3 A;  3MKF A;  3HUN A;  5GLD A;  3EOI A;  5CGW A;  1F98 A;  3IH9 A;  1BUE A;  1W7F A;  1XJ2 A;  4A5R A;  3A3J A;  2WKQ A;  2QKP A;  5HL6 A;  1JWZ A;  1J9M A;  5E2F A;  2B5R A;  1N4O A;  5F6A A;  3HL9 A;  1UGU A;  5FQM A;  4EET B;  3HLC A;  3T4O A;  1K0K A;  1GSV A;  4K0X A;  1TDL A;  3ZCZ A;  3VMA A;  2X71 A;  5A92 A;  2EX2 A;  4CLC D;  3ZG9 B;  2EX6 A;  3EWK A;  1E3U D;  2EFX A;  2A3U A;  3SH7 A;  4S2P A;  4MN5 A;  3HBR A;  4JXW A;  4UA6 A;  4GNU A;  2KOI A;  5AQB A;  1YLY A;  2W3H A;  4B4Z A;  2XA7 M;  2Y2K A;  4CQH A;  1C3B A;  3NHQ A;  4I3A A;  5CHM A;  4ETZ A;  4F3L A;  3M6B A;  2GNX A;  2Y91 A;  2A24 B;  2W3F A;  5HAP A;  3V50 A;  2ZQ9 A;  3DW0 A;  4I3J A;  3DTK A;  4KZ9 A;  1PWC A;  5FEF A;  2XLN A;  3O5Y A;  5J7E A;  3LI8 A;  3C2W A;  4E3O A;  3ZNY A;  2PR5 A;  4O8G A;  3VP0 A;  1YM1 A;  3E98 A;  1RP5 A;  1LL9 A;  1MY8 A;  4IVK A;  4PPR A;  4LV0 A;  3CPT B;  3BW6 A;  2PU2 A;  1NZO A;  3NC8 A;  5AJG A;  4ZJ2 A;  3PAG A;  3GEC A;  1CQA A;  4DJ3 A;  1KGF A;  4IUH A;  4HJ4 A;  4LRZ E;  4FCF A;  3S7Q A;  3IHA A;  3WRZ A;  5FQJ A;  1BYW A;  1VM1 A;  2K7S A;  2DCF A;  3MF0 A;  2Y2H A;  4GDB A;  2V0U A;  1G68 A;  3BQA A;  3GDI A;  4Y15 A;  5HWW A;  4E3M A;  3L9K A;  1JTG A;  4UQI S;  4JBF A;  5HWT A;  3UPP A;  3Q82 A;  1LSX A;  1J3W A;  4YOF A;  1WYC A;  3E0Y A;  4Y17 A;  3KO6 A;  2WGV A;  2ZL1 A;  1PI4 A;  3MKE A;  4GCZ A;  4R4S A;  5TBM B;  3O3V A;  5G18 A;  3RTY A;  5HPI A;  2Y2L A;  4DXC A;  5J3W A;  4DE3 A;  4WLA A;  4OOL A;  2WYX A;  3C30 A;  3VP2 A;  1TD5 A;  5HAI A;  5HDC A;  3U4L P;  1JTD A;  1D1J A;  1DY6 A;  4GDN A;  2BAS A;  1YLZ A;  2Y4A A;  5FQQ A;  2Y2M A;  3NY4 A;  5F82 A;  3G2Y A;  2HV1 A;  3NOT C;  5E2H A;  5EUA A;  2OOL A;  2ZC3 B;  4QHC A;  1CK3 A;  2IWD A;  1YKD A;  4KUK A;  4GJ4 A;  1ONH A;  3DTM A;  4PM6 A;  3IF6 B;  4MEZ A;  4R23 A;  1NRF A;  1M40 A;  3S1Y A;  3D4F A;  3ZHH A;  4B93 A;  2W3E A;  3LO7 A;  1W63 M;  2ZM2 A;  1NJ4 A;  1SDN A;  3TRC A;  1ZG6 A;  3M2J A;  4X68 A;  1OJ5 A;  1NWZ A;  3IXD A;  5IHV A;  1Y28 A;  3F1O B;  3MJQ A;  3NBL A;  3OCN A;  1TS6 A;  3TJZ C;  3CHW P;  4E3K A;  4XT2 B;  4NXG A;  5CED A;  1YLP A;  3S7O A;  3N7W A;  5CEB A;  2V1B A;  3RXX A;  5EE8 A;  3ITA A;  2W1T B;  4B88 A;  4JGO A;  5EVE A;  4CPK A;  3LIB A;  4ZJ3 A;  3HUO A;  3HLW A;  3MXR A;  3UNW A;  4G3K A;  1HZO A;  3FKV A;  3LIE A;  2HPB A;  1JNU A;  3BY9 A;  3QP2 A;  4HBT A;  4KZ5 A;  3L7H A;  2Y2I A;  3NI9 A;  4IJG A;  4ESP A;  4FUW A;  2ACG A;  2EWV A;  4O0P A;  3AGE A;  3KX0 X;  2HJ9 C;  3QNC A;  2P7J A;  1BT5 A;  3NDE A;  3VOL A;  2ZC6 B;  1IYO A;  3LID A;  5L07 A;  3QNB A;  3IF6 C;  5U47 A;  4QY5 A;  5HDS A;  4E6X A;  1XX2 A;  1KDS A;  1Q2P A;  1T18 A;  4WMC A;  5D3O A;  3V5M A;  3MQ0 A;  4XUZ A;  5EVI B;  1JWV A;  2Y2Q A;  3GRJ A;  1EWZ A;  4P6Z S;  2Q9M A;  2EWW A;  5KZH A;  2WGW A;  4PM9 A;  3HLD A;  2O0Y A;  2WKR A;  5G4Z A;  3UB6 A;  1GSW A;  2CC1 A;  3IT9 A;  2D01 A;  2H0T A;  4I5S A;  4KZ8 A;  5AQA A;  4LV3 A;  4M4X A;  3NCK A;  2P9V A;  4CLC B;  3UN7 A;  2ZQ7 A;  5JYO A;  1FR1 A;  1VET A;  3VSK A;  1OTE A;  4EBL A;  3OC2 A;  5GLC A;  3H82 B;  4NXF A;  1GCE A;  2WAF A;  2WZZ A;  3OPL A;  3BFG A;  2QWS A;  3F1N B;  3F1O A;  1K57 A;  2NUP C;  3CJM A;  3EQV A;  1XFQ A;  3IF5 A;  1IFQ A;  3EGD C;  3EQU A;  1SKF A;  3I7J A;  3ZYT A;  3UE6 A;  1V9Z A;  4N1X A;  3WS4 A;  3S7P A;  3B42 A;  4JGR A;  3V39 A;  2H10 A;  2GX5 A;  3CWF A;  3NEC A;  4WN5 A;  5FSR A;  2WK0 A;  2O9B A;  1WA9 A;  3DTI A;  2EFU A;  3IHB A;  1SHV A;  1Y4O A;  5M18 A;  4D60 A;  5DF9 A;  3SW1 A;  2JKR I;  4FOF A;  2VJW A;  3OOV A;  2PD8 A;  1K4F A;  3IX8 A;  4PAU A;  4R3J A;  2J3W A;  1F5M A;  3LY3 A;  4EU0 A;  4L9F A;  1MC0 A;  2R78 A;  2VLG A;  1WYB A;  1SKO A;  1VB6 A;  2Q0O A;  1QME A;  3WS1 A;  4BL3 A;  1I5Q A;  2E8J A;  3RFB A;  4B9O A;  1NLZ A;  2XA7 S;  3UB8 A;  4BEN A;  1PIO A;  3LEZ A;  5DFX A;  4GZB A;  1PNE A;  3P7N A;  5CER A;  1BLH A;  2ZMA A;  5HX9 A;  2ZQA A;  4LCL A;  2A2L A;  1BTL A;  2ZOH A;  4UHU A;  5JYP A;  2ZL1 B;  3IBJ A;  5AVF A;  3Q81 A;  4E3J A;  1ODV A;  5FQK A;  1E25 A;  1TS7 A;  3HVF A;  2OWJ A;  4E6W A;  4G3W A;  4NK3 A;  1XXM A;  5EVI D;  3K3C A;  4LRY C;  3CAX A;  5A90 A;  2J9P A;  4HQA A;  3CPT A;  2HZ5 A;  3VP4 A;  2HDQ A;  3SH8 A;  4KEN B;  4Y0O A;  2QJ7 A;  4MMN A;  4QB8 A;  3ULF A;  3DWK A;  2ZLY A;  4FTX A;  5CHU A;  1L0G A;  4S2N A;  4HEF A;  2J3T C;  3UB9 A;  4OQ0 A;  4DJ2 A;  1ERO A;  1K56 A;  1XGI A;  5TBM A;  5L09 A;  4KZ4 A;  4R3B A;  4QWO A;  4BJP A;  2WKI A;  2XFS A;  4R3A A;  2V8F A;  1CF0 A;  1UWN X;  4X6T A;  3HLF A;  2JKG A;  3BM6 A;  4X69 A;  4KZB A;  2UV0 E;  5CGS A;  1DJC A;  2PBD P;  4OKP A;  4KZ7 A;  4HP4 A;  3V3S A;  4OOY A;  4OPZ A;  1IYP A;  2LB5 A;  4O7D A;  2VA0 A;  5EVI A;  4N9L A;  2M7U A;  3JPU A;  3GV9 A;  3VFH A;  1BUL A;  1N9B A;  3HLG A;  3LY4 A;  4FH4 A;  2V0W A;  2XDM A;  2ZC7 A;  4GN2 A;  1FOF A;  4DDY A;  5I5L A;  3O87 A;  2WAE A;  4EQ1 A;  4LFU A;  2K2N A;  5DVA A;  5DTT A;  2Q9N A;  5BOH A;  4MBH A;  3S22 A;  3UE3 A;  1UWP X;  5HW3 A;  3MSH A;  2PU4 A;  3UB5 P;  4WF0 A;  4MBF A;  4BLM A;  1OTA A;  3H7W B;  3W8K A;  1TVF A;  4HH2 A;  3KYQ A;  1I2W A;  4KQQ A;  2Y8H A;  4Q0H A;  3T4T A;  4P87 A;  3BFD A;  3MFD A;  2MJ6 A;  3F1N A;  4Y7P A;  4KG6 A;  1YQS A;  3G31 A;  3T1X A;  1LL8 A;  2RL3 A;  2PYR A;  3PXP A;  1DP6 A;  5EM1 A;  3P01 A;  4OP8 A;  1FCO A;  1HLU P;  2OSU A;  4KG2 A;  3MBZ A;  4E3I A;  4RX2 A;  3T12 B;  3FC7 A;  3DBA A;  4S2L A;  5FI6 A;  2VV8 A;  4N92 A;  4LV1 A;  1OTD A;  3PBS A;  4BBU A;  2VK3 A;  4XT2 A;  1NZU A;  3MQQ A;  3CI6 A;  4R6L A;  2GZA A;  1S0W A;  3ISG A;  2JCH A;  3UDF A;  4KQD A;  2Y2P A;  4KQR A;  2ZD8 A;  3NJA A;  3VP1 A;  3CUE A;  2P74 A;  3PR6 A;  3MFX A;  4X55 A;  4NXB A;  5J4E A;  5L2F A;  2Y79 A;  3IXG A;  1N9L A;  2ZM0 A;  5DJT A;  4OON A;  4QD4 A;  1FCN A;  2V2F F;  2W3G A;  3A0S A;  1ACF A;  4PKY A;  2P08 A;  4LPZ A;  3SZT A;  5HPF A;  2Y59 A;  4RYE A;  3G30 A;  4DRT A;  5FDH A;  1K4E A;  3A0V A;  4PM8 A;  5J8X A;  3IS2 A;  5HL1 A;  3LIA A;  5KSC A;  2K31 A;  4P6Z M;  1G6A A;  3UDX A;  1K6R A;  4QPR A;  4GHI A;  4BL2 A;  4U0X A;  1H8M A;  2NUT C;  2OWH A;  1MKM A;  4S2J A;  2PHY A;  2AVX A;  2VGL M;  1O7E A;  3VOY A;  4HI4 A;  4S2M A;  3ZFZ A;  3LCE A;  2Y2J A;  2W27 A;  2P04 A;  4KQO A;  1PI5 A;  3N8R A;  3MMH A;  2Z6C A;  3FPV A;  1L3L A;  1ZHH B;  4MBK A;  4UA9 A;  3ZVW A;  4JXS A;  1FSW A;  5E43 A;  3TSG A;  5DJU A;  3CMZ A;  2KDK A;  1LHY A;  2ZQD A;  4EWF A;  1HVB A;  4MN6 A;  3CG5 A;  3P98 A;  3E2L A;  4EUZ A;  3C4P A;  4ZDX A;  4HES A;  4Y3I A;  3W4P A;  4X53 A;  3ZQ5 A;  4EBN A;  3UY6 A;  3B33 A;  1PFL A;  3IX3 A;  1SCW A;  3GQZ A;  4LV2 A;  4X1L A;  1PZP A;  4GB7 A;  4WZ4 A;  5FAT A;  5AQ7 A;  3C38 A;  1RGY A;  5F68 A;  2ZMV A;  3WWX A;  5C5K A;  1T19 A;  2EXA A;  4HIA A;  4ZBE A;  5FEG A;  1DRM A;  2C5W B;  2J9O A;  4Q0I A;  3LR0 A;  3NUL A;  1G28 A;  3IX4 A;  3IH8 A;  2WZX A;  4DF6 A;  5DTK A;  1HD8 A;  3T50 A;  4OPR A;  4BD0 A;  4JKT A;  5DFY A;  4X1M A;  2V20 A;  4L9E A;  3K2N A;  4UA7 A;  3V3R A;  4XUX A;  1U60 A;  3BLM A;  1FIL A;  3C7V A;  4LLO B;  2HDU A;  2ZBB A;  4GW9 A;  2B02 A;  2BTF P;  2HDR A;  3V67 A;  4EV4 A;  5HWV A;  5IS1 A;  3GMW A;  4R0Q A;  1NY0 A;  1IEM A;  4MDZ A;  3ZVT A;  5CEC A;  4JGQ A;  1ONG A;  4WZ5 A;  3A0R A;  3PBR A;  5GLA A;  3B3X A;  1S1Z A;  2HJE A;  1OTB A;  3DTE A;  5A93 A;  5FQ9 A;  4E04 A;  2HF6 A;  4JGP A;  2G7U A;  3UE0 A;  3LR5 A;  3T1R A;  4GOG A;  4MNR A;  3VV4 A;  5F1F A;  1ES4 A;  4CLC E;  4CJN A;  4BBT A;  1MWR A;  1NRJ A;  1V9Y A;  3MR0 A;  4UQI M;  2KLI A;  4DE2 A;  5FAS A;  1KGE A;  1GHI A;  1YT4 A;  4X56 A;  1S1Y A;  3VP3 A;  2EX8 A;  3NDG A;  2ZM8 A;  2H28 A;  2M7V A;  5IT5 A;  2O9C A;  3K3D A;  1ERQ A;  3C7U A;  4HP9 A;  4EBP A;  1VHM A;  3MZE A;  1MKI A;  3T4S A;  3IQA A;  2X02 A;  1XGJ A;  5TFQ A;  3C5A A;  5EVL A;  3T4K A;  1W79 A;  3IWO A;  5CXW A;  1YMX A;  5HAQ A;  1JWP A;  2XF3 A;  4DXB A;  4ZJ1 A;  1PYY A;  3CZD A;  4OPQ A;  3MZD A;  1TDG A;  5FQI A;  1K54 A;  3D72 A;  4JF5 A;  1GHP A;  2H0Y A;  3OPP A;  4DMZ A;  2WKP A;  2BG1 A;  4Y13 A;  4N9K A;  2PAV P;  4BBV A;  4B4X A;  4OQH A;  3D3O A;  4F3L B;  2QPN A;  5FAP A;  5M1A A;  3CLO A;  3A3D A;  1M6K A;  4NET A;  4NXE A;  5DKK A;  2JKT I;  3ICY A;  1MZU A;  2R9W A;  1MWT A;  1P0Z A;  4GD8 A;  2JC7 A;  4GKU A;  2FZ0 A;  4OQI A;  2JHE A;  4EEU A;  4HNB A;  4Z9Q A;  4K91 A;  3PTE A;  2O9A A;  4E3L A;  5F1G A;  1XJ4 A;  2FFY A;  1ZC2 A;  2HDS A;  1SDE A;  3TG9 A;  3PAE A;  2ZJ9 A;  4WEK A;  3W4Q A;  1GSX A;  2IA2 A;  2D02 A;  4G3V A;  1PW1 A;  4R38 A;  1W8Q A;  3LGO A;  4JF4 A;  1S67 L;  3SS4 A;  5F5Y A;  2ZC5 B;  3GVB A;  3BYD A;  1ZKJ A;  1MXO A;  1ES5 A;  4JXV A;  1EI5 A;  2L4R A;  1MPL A;  3E2K A;  1F9I A;  3RJU A;  2VKS A;  3AGF A;  4KZ3 A;  1STZ A;  4QJG A;  3PBT A;  4MCW A;  1CI8 A;  5AQ9 A;  5M19 A;  4ARZ B;  5EVI C;  2VEA A;  4I38 A;  2GJ3 A;  4WM9 A;  4EUV A;  1LLB A;  2VZW A;  2Z2M B;  3A3F A;  3MQO A;  2Z6D A;  1FCM A;  4KZA A;  1TF1 A;  2HGV A;  4L9G A;  1KE4 A;  1LL5 A;  1KGG A;  4LEN A;  1NXY A;  4CLC A;  4KG5 A;  4U3T A;  1DJB A;  4IBX A;  3IWI A;  3BRM A;  5L8M A;  1LI0 A;  4RQ9 A;  2W0N A;  3IWQ A;  4H6J B;  4Y2F A;  2B95 A;  2O99 A;  1KE0 A;  3A3E A;  3Q07 A;  1EW0 A;  1RCJ A;  5KIZ A;  4P85 A;  4JLF A;  1IOU A;  1TEM A;  3HLE A;  1E4D A;  5E2E A;  4ETX A;  1BLS A;  3MXS A;  1LSV A;  4EW7 A;  1O07 A;  2VX8 A;  4OQG A;  2OV5 A;  5GHY A;  1H5X A;  2L0W A;  2XGN A;  3SS5 A;  4GD6 A;  3RXW A;  3W4O A;  3LIC A;  4WUJ A;  3G35 A;  3TOI A;  1K25 A;  1L2S A;  3FKW A;  2GDN A;  1CJF A;  4IVI A;  4PMA A;  4OLG A;  4ME4 A;  1T1C A;  3EEA A;  5LBR A;  4OOM A;  5EV0 A;  1KVL A;  2EA9 A;  3D9Y A;  4R1G A;  1ESU A;  4DDS A;  3OPH A;  3ZGA B;  2OAQ 1;  5KSH A;  3LEQ A;  5L10 A;  3FZC A;  3M2K A;  1N9N A;  3PYP A;  4F94 A;  2IWC A;  3S4X A;  3BFE A;  3BFF A;  2EXB A;  3RH8 B;  3VOZ A;  1PW8 A;  1AXB A;  3E4P A;  1YMS A;  3M6H A;  4LRX C;  4FSF A;  3PBN A;  3R4K A;  5TGF A;  2QJ5 A;  1K38 A;  1K55 C;  2XR0 A;  4BWI A;  1VEU A;  4DE1 A;  4K0W A;  1XJ6 A;  4Q8I A;  1K57 C;  1XKZ A;  1WE4 A;  2V1Z A;  4D2O A;  4K08 A;  2QYB A;  2WGW B;  3N8L A;  3FWL A;  4I39 A;  3TE8 A;  1BLP A;  1L0D A;  5EEC A;  1FIK A;  4Y0U A;  2HP5 A;  3IBR A;  1K56 D;  3C8C A;  3KYZ A;  1MBL A;  3SOI A;  4NG2 A;  3F1P B;  5FAO A;  1VET B;  4KUO A;  2VGK A;  5DF7 A;  1W63 Q;  3G2Z A;  1XJ3 A;  5I94 A;  3HLB A;  4NKP A;  1S4S A;  1OT6 A;  1GA9 A;  3R7W A;  2VV7 A;  4WMC D;  2ZMF A;  1OPX A;  2QHK A;  3G4P A;  3TW8 A;  1VQQ A;  4WBG A;  4HHD A;  1K6S A;  3GTC A;  3UE1 A;  3ZG5 A;  5KMW A;  4UAA A;  1FR6 A;  3VE4 A;  3ZNT A;  3UMD A;  1ERM A;  3NIA A;  1H0M A;  3UPN A;  4KZ6 A;  2Y55 A;  4HJ3 A;  2QZ6 A;  3BY8 A;  4PM7 A;  1OT9 A;  2PD7 A;  3H7W A;  1X0O A;  1DP8 A;  5DF8 A;  2ZQC A;  1DJA A;  4RX3 A;  4BMW A;  4WL9 A;  4I3I A;  4IBR A;  3N4I A;  2W3D A;  2R9X A;  2XFT A;  3OZH A;  2V8C A;  1P97 A;  3VFF A;  1SKO B;  1BZA A;  4PM5 A;  5EPH A;  3KSI A;  3NOP C;  3OCL A;  2H5S A;  2ZQ8 A;  3ZG8 B;  2CMN A;  2JKT M;  1E3U A;  1DP9 A;  2RCX A;  5CTM A;  2XEP A;  1Y54 A;  2PT7 A;  1OTI A;  5HDD A;  2C6W B;  1RGZ A;  4PKY G;  1S6R A;  1CEG A;  4S2K A;  2YKF A;  5GHX A;  4S2N C;  4HOI A;  3A3I A;  2XK1 A;  2DMW A;  3BLS A;  1YLJ A;  3P09 A;  4RA7 A;  1NYM A;  4MLL A;  2DRW A;  2I9V A;  4Y0T A;  4ID4 A;  1BLC A;  5TJJ A;  3T4Q A;  4MN7 A;  1MWU A;  3HCY A;  5FAQ A;  3SH9 A;  2L1M A;  3LR4 A;  3Q7Z A;  1P9R A;  3N6I A;  3E4Q A;  3LR3 A;  4UEY A;  4HH3 A;  2XH9 A;  2JBF A;  4YNR A;  3LIF A;  4C6Y A;  4S2I A;  1PWD A;  1AWI A;  4GS9 B;  3O88 A;  1D7E A;  1G5U A;  2A49 A;  4HJ6 A;  1MWS A;  4Z1W A;  1XP4 A;  2J3T D;  2PDR A;  3G6O A;  2LB9 A;  1JVJ A;  5GHZ A;  3GR2 A;  4GLQ A;  3T1Q B;  4GHI B;  2WKE A;  1XFN A;  2XD1 A;  4S2O A;  3CUE C;  2IWB A;  3GSG A;  3QP4 A;  1H8Y A;  2UWX A;  3DWZ A;  3FYZ A;  1A0K A;  3SS3 A;  5CGX A;  4OLD A;  4LGW A;  5FA7 A;  4XXR A;  4L0L A;  4YFM A;  1KOU A;  1ESI A;  2VGJ A;  2M1C A;  3Q1F A;  4OP5 A;  4ZTK A;  1VEU B;  3LI9 A;  1Q2Q A;  2V1A A;  1IEL A;  4BQM A;  1PZO A;  2XRO A;  2XD5 A;  3E4O A;  2G2W A;  3QHY A;  2WUQ A;  2WKH A;  4DE0 A;  1FQG A;  3H9W A;  4Y5F A;  1I2S A;  5CRF A;  2J7V A;  2ZOI A;  2HP9 A;  4II7 A;  4U0T A;  4EES A;  1NYY A; 
#chains in the Genus database with same CATH homology
 1STZ A;  4WEJ A;  3LYX A;  4HH2 A;  3PBT A;  3KYQ A;  4H6J A;  1LSX A;  4MCW A;  4YOF A;  3E0Y A;  3B47 A;  2Y8H A;  4Q0H A;  4ARZ B;  3KO6 A;  5IU1 A;  3T4T A;  2VV6 A;  5DKL A;  2MJ6 A;  3F1N A;  2VEA A;  4GCZ A;  1LL8 A;  5TBM B;  2PYR A;  4I38 A;  3PXP A;  2GJ3 A;  1OJG A;  4EUV A;  3RTY A;  1DP6 A;  2VZW A;  5HPI A;  5J3W A;  3P01 A;  1TS8 A;  3JVV A;  4WLA A;  2B18 A;  2Z6D A;  3MQO A;  3MXQ A;  4OOL A;  3R7W B;  3FPW A;  3C30 A;  5G4Y A;  1TD5 A;  1TF1 A;  2HGV A;  4L9G A;  5CX7 A;  5HDC A;  2BAS A;  4CLC A;  2JN7 A;  3FC7 A;  3DBA A;  5F69 A;  2VV8 A;  2YKH A;  1OTD A;  3PBS A;  4BBU A;  5L8M A;  4RQ9 A;  4XT2 A;  2HV1 A;  3NOT C;  3MQQ A;  2W0N A;  3CI6 A;  4R6L A;  2GZA A;  2OOL A;  4H6J B;  1YKD A;  4KUK A;  4KQD A;  2OAP 1;  4Y2F A;  3NJA A;  3CUE A;  2O99 A;  4GJ4 A;  3KSH A;  3PR6 A;  3MFX A;  4NXB A;  5J4E A;  2Y79 A;  1EW0 A;  1N9L A;  5DJT A;  2PYP A;  5KIZ A;  4B93 A;  1IOU A;  3EEH A;  2W3E A;  1W63 M;  2W3G A;  3TRC A;  4ETX A;  3A0S A;  1T1A A;  1LSV A;  3FG8 A;  4PKY A;  2P08 A;  4EW7 A;  5A8B A;  1OJ5 A;  1NWZ A;  2VX8 A;  4LPZ A;  1Y28 A;  3BJN A;  1TS0 A;  3F1O B;  2L0W A;  5K5B A;  5HPF A;  3MJQ A;  3OCN A;  1TS6 A;  4CLC C;  3TJZ C;  4ARZ A;  2KX6 A;  4XT2 B;  2VGL S;  4DN0 A;  4NXG A;  3A0V A;  3LIC A;  3IS2 A;  3PHY A;  3S7O A;  1G6O A;  4WUJ A;  5HD3 A;  3LIA A;  2V1B A;  2K31 A;  4P6Z M;  4EXO A;  2W1T B;  4JGO A;  3IS2 B;  3LIB A;  4QPR A;  4GHI A;  4G3K A;  1H8M A;  2NUT C;  2OWH A;  1MKM A;  4ME4 A;  3LIE A;  1T1C A;  3T4J A;  4O01 A;  3EEA A;  2PHY A;  1JNU A;  3BY9 A;  5LBR A;  2PR6 A;  4OOM A;  4IJG A;  3LUQ A;  2EA9 A;  2VGL M;  3HJK A;  3VE3 A;  4HI4 A;  2OAQ 1;  2W27 A;  2P04 A;  3F1P A;  4KQO A;  5KSH A;  2EWV A;  2A24 A;  4O0P A;  3MMH A;  1N9N A;  2Z6C A;  3PYP A;  3FPV A;  1ZHH B;  3UB7 A;  3KX0 X;  2HJ9 C;  5DJU A;  2W1T A;  2KDK A;  2P7J A;  3RH8 B;  4MN6 A;  3VOL A;  3KSG A;  5HD5 A;  3LID A;  3E4P A;  3NOU C;  4Y3I A;  1YSQ A;  2V9A A;  4LRX C;  5HDS A;  4FSF A;  2J80 A;  2JKR M;  3ZQ5 A;  1T18 A;  3B33 A;  3PBN A;  3EGX C;  3R4K A;  3W2Z A;  3MQ0 A;  2QJ5 A;  1S4R A;  4BWI A;  3C38 A;  1H3Q A;  3CIT A;  5F68 A;  1XJ6 A;  3U2A A;  2ZMV A;  2XRN A;  4Q0J A;  1P9W A;  5C5K A;  1T19 A;  4P6Z S;  4HIA A;  2EWW A;  1DRM A;  1YSP A;  5MC7 A;  3PBO A;  1LSW A;  4AFI A;  4Q0I A;  2O0Y A;  3LR0 A;  3OBF A;  1G28 A;  2WKR A;  3BQ8 A;  5G4Z A;  3UB6 A;  5FL3 A;  1GSW A;  4K08 A;  2QYB A;  2D01 A;  2FH5 A;  4IUK A;  4I5S A;  4I39 A;  4M4X A;  5HSQ A;  3TE8 A;  1YAX A;  3T50 A;  3JVU A;  3HJI A;  4NEE D;  1D06 A;  3IBR A;  5DFY A;  4CLC B;  5HZH A;  4L9E A;  3C8C A;  4YWZ A;  1S66 L;  3KYZ A;  1OTE A;  3OC2 A;  3K2N A;  3H82 B;  1LT0 A;  4NXF A;  3F1P B;  2QWS A;  3OLO A;  4R70 A;  3F1N B;  4PHT A;  3F1O A;  2NUP C;  4KUO A;  3KSF A;  3EQV A;  4EER A;  1XFQ A;  3T4L A;  1ZTU A;  1W63 Q;  1IFQ A;  3EGD C;  3EQU A;  1XJ3 A;  4LLO B;  2ZBB A;  4GW9 A;  3ZYT A;  4NKP A;  2B02 A;  3UE6 A;  1V9Z A;  1S4S A;  3V67 A;  1OT6 A;  3S7P A;  3R7W A;  3UME A;  5HWV A;  2VV7 A;  3B42 A;  4JGR A;  2ZMF A;  5IS1 A;  1OPX A;  2GX5 A;  3CWF A;  3PBQ A;  2QHK A;  3TW8 A;  4WN5 A;  4EEP A;  4MDZ A;  2O9B A;  1WA9 A;  5AVE A;  2INW A;  4JGQ A;  4HHD A;  4IHQ A;  3A0R A;  3PBR A;  1N9O A;  3BWL A;  1S1Z A;  2HJE A;  2XSS A;  3VE4 A;  3UMD A;  1OTB A;  1T1B A;  3H82 A;  4HJ3 A;  5DF9 A;  3BY8 A;  1NLY A;  4WEL A;  1OT9 A;  2PD7 A;  3S7N A;  3H7W A;  3SW1 A;  2JKR I;  2W1R A;  1X0O A;  4FOF A;  4E04 A;  4GS9 A;  1DP8 A;  2VJW A;  3OOV A;  2HF6 A;  4JGP A;  2G7U A;  2PD8 A;  4ZRR A;  3LR5 A;  4PAU A;  4BMW A;  4WL9 A;  3VV4 A;  2J3W A;  4I3I A;  3LFV A;  1F5M A;  4EU0 A;  4L9F A;  1MC0 A;  2R78 A;  5EFW A;  4CLC E;  2W3D A;  4BBT A;  2VLG A;  1NRJ A;  1V9Y A;  3MR0 A;  4UQI M;  2KLI A;  1P97 A;  1VB6 A;  4HY8 A;  3EOI A;  3RFB A;  1F98 A;  3KSI A;  3NOP C;  3OCL A;  4B9O A;  1NLZ A;  1XJ2 A;  1S1Y A;  2XA7 S;  2CMN A;  2JKT M;  1DP9 A;  2WKQ A;  2QKP A;  3UB8 A;  5HL6 A;  2PT7 A;  1OTI A;  5HDD A;  2H28 A;  2M7V A;  5IT5 A;  2O9C A;  3K3D A;  4PKY G;  4HP9 A;  5DFX A;  2YKF A;  1VHM A;  3P7N A;  4HOI A;  3T4S A;  2DMW A;  5F6A A;  1UGU A;  2A2L A;  2ZOH A;  4EET B;  2I9V A;  3T4O A;  1GSV A;  3T4K A;  5TJJ A;  3T4Q A;  4MN7 A;  3IBJ A;  5AVF A;  1ODV A;  4CLC D;  3HCY A;  1TS7 A;  3EWK A;  2OWJ A;  2L1M A;  3LR4 A;  1P9R A;  4G3W A;  4MN5 A;  3E4Q A;  3LR3 A;  3D72 A;  3K3C A;  4UEY A;  4LRY C;  4DMZ A;  2WKP A;  4HH3 A;  3CAX A;  2KOI A;  4HQA A;  4BBV A;  2W3H A;  4F3L B;  3D3O A;  4YNR A;  3LIF A;  2XA7 M;  3CLO A;  4CQH A;  2QJ7 A;  4MMN A;  3ULF A;  3NHQ A;  4I3A A;  4ETZ A;  4GS9 B;  4F3L A;  2GNX A;  4NXE A;  1D7E A;  5DKK A;  4HJ6 A;  2JKT I;  2A24 B;  2J3T C;  2W3F A;  4Z1W A;  2J3T D;  3UB9 A;  3ICY A;  1MZU A;  4DJ2 A;  2PDR A;  3G6O A;  5TBM A;  4I3J A;  2LB9 A;  4GLQ A;  4BJP A;  1P0Z A;  4GHI B;  4R3A A;  3O5Y A;  2FZ0 A;  1XFN A;  1UWN X;  5J7E A;  3LI8 A;  3C2W A;  3CUE C;  2JHE A;  4EEU A;  2PR5 A;  4HNB A;  4O8G A;  3E98 A;  2O9A A;  4HP4 A;  1XJ4 A;  3BW6 A;  4WEK A;  5AJG A;  4L0L A;  2LB5 A;  1GSX A;  1KOU A;  3GEC A;  2M1C A;  2VA0 A;  4DJ3 A;  4IUH A;  4HJ4 A;  2IA2 A;  3LI9 A;  2M7U A;  4LRZ E;  2D02 A;  3S7Q A;  4G3V A;  4R38 A;  1BYW A;  2V1A A;  2V0W A;  1S67 L;  2XRO A;  2K7S A;  3E4O A;  3MF0 A;  5F5Y A;  5I5L A;  2V0U A;  4EQ1 A;  2K2N A;  3H9W A;  4Y5F A;  3BQA A;  3GDI A;  5HWW A;  3UE3 A;  1UWP X;  2ZOI A;  2L4R A;  4UQI S;  4WF0 A;  1F9I A;  1OTA A;  4II7 A;  3H7W B;  5HWT A;  4EES A;  2VKS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...