1D7EA

Crystal structure of the p65 crystal form of photoactive yellow protein
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
122
structure length
119
Chain Sequence
VAFGSEDIENTLAKMDDGQLDGLAFGAIQLDGDGNILQYNAAEGDITGRDPKQVIGKNFFKDVAPCTDSPEFYGKFKEGVASGNLNTMFEYTFDYQMTPTKVKVHMKKALSYWVFVKRV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Conformational substates in different crystal forms of the photoactive yellow protein--correlation with theoretical and experimental flexibility.
pubmed rcsb
source organism Halorhodospira halophila
molecule tags Photosynthesis
molecule keywords PHOTOACTIVE YELLOW PROTEIN
total genus 32
structure length 119
sequence length 122
ec nomenclature
pdb deposition date 1999-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00989 PAS PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 1d7eA00
5AVEA 5F6AA 3PHYA 2WKPA 1UWPX 3T50A 4HHDA 3UB6A 2VV7A 3LIDA 3BY8A 1TS8A 1OTDA 3KX0X 3MXQA 2D01A 3F1PB 1ODVA 4HP9A 2QWSA 2ZBBA 2QJ7A 3EEHA 5HWVA 2JHEA 1S66L 3SW1A 2JN7A 2VV8A 1OT9A 1P97A 4EESA 5HDCA 3MR0A 2Z6CA 2R78A 3LI8A 5F68A 1XJ3A 2PR6A 3F1PA 4R3AA 4NXBA 3LUQA 1XJ2A 4HI4A 1XFNA 5HDDA 3LIAA 3MJQA 2ZOIA 3LIFA 1OTIA 1T19A 4K08A 1S4RA 3GECA 1UWNX 2ZOHA 2VLGA 4HH2A 2K7SA 2PD8A 5HDSA 4HJ3A 5IS1A 2QHKA 2B02A 5TBMB 5HD5A 3NJAA 3LI9A 4MN6A 3ULFA 1D7EA 2V0WA 4JGQA 3RH8B 2QKPA 3GDIA 4WLAA 5TBMA 5F69A 4DJ2A 5HSQA 4BBTA 3MQQA 3A0VA 4XT2A 5KIZA 4WF0A 1D06A 2V0UA 3F1OA 3K3CA 1GSVA 1KOUA 1V9YA 3B33A 4HY8A 4RQ9A 1LT0A 3F1OB 3FG8A 3F1NA 1T1AA 2EA9A 4GHIB 4MN5A 3E4PA 4F3LA 5AVFA 5J3WA 5EFWA 3NHQA 4GHIA 4LRZE 4F3LB 5DKLA 3C8CA 4HJ4A 3VE4A 2WKQA 3HJIA 4EEPA 2M1CA 4R70A 4LRYC 4EETB 5HWWA 3IS2A 2OWJA 3BY9A 3OLOA 4HP4A 2P7JA 4L9GA 3A0RA 2QJ5A 3ZQ5A 4LLOB 3IS2B 1OT6A 4R38A 4BBUA 4XT2B 1UGUA 3PYPA 3G6OA 5DKKA 4I38A 1WA9A 1T18A 3IBRA 4HIAA 4WN5A 5HD3A 1OTAA 1XJ4A 5A8BA 1F9IA 4EW7A 4GCZA 4I3JA 5IU1A 3H82B 2HV1A 1BYWA 1DRMA 1F98A 2D02A 1LSXA 1LSVA 1OJ5A 1XFQA 1N9LA 3F1NB 2PDRA 3H7WB 4I3IA 4YWZA 4HNBA 2OOLA 4I3AA 1OJGA 2PYPA 2V1AA 4B9OA 3D72A 1V9ZA 3K3DA 4DJ3A 4JGOA 3UMDA 4HJ6A 1TS0A 3MFXA 3H7WA 1G28A 2INWA 2PYRA 5HZHA 5F5YA 3H9WA 1GSXA 4JGPA 3LIBA 4WL9A 2W27A 4EXOA 3NOPC 1DP6A 3BWLA 3E4OA 1T1BA 5J7EA 3H82A 4I5SA 3NOTC 3LICA 3CLOA 2W0NA 3C2WA 4EERA 4E04A 3UB7A 1N9OA 2L1MA 4M4XA 2GJ3A 1JNUA 2KX6A 4GW9A 2YKFA 4L9EA 4EQ1A 1DP9A 4NXEA 3A0SA 4LPZA 1MZUA 2A24A 2YKHA 4PKYA 3VOLA 1NWZA 4HOIA 2WKRA 1LL8A 2PD7A 3MQOA 3EWKA 2H28A 1OTBA 2OWHA 4HH3A 2V9AA 1OTEA 3FC7A 1N9NA 2I9VA 4PKYG 2BASA 1P0ZA 1S4SA 4JGRA 3VE3A 5DJTA 4BBVA 1EW0A 1S1ZA 2PR5A 2Z6DA 3CAXA 3CWFA 1VB6A 3NOUC 3E4QA 3P7NA 4KUOA 4LRXC 1LSWA 1TS6A 1S67L 4I39A 3LIEA 2J80A 1GSWA 1T1CA 5HWTA 4HQAA 1X0OA 2L0WA 4KUKA 4NXFA 5G4ZA 2VV6A 2A24B 3UMEA 1DP8A 2L4RA 4GS9A 5J4EA 3UE6A 4L9FA 4NXGA 2PHYA 3RTYA 3UB8A 3HJKA 4R6LA 2V1BA 5DJUA 5I5LA 2VEAA 2KDKA 4WUJA 4GS9B 1Y28A 3LYXA 4KQDA 1XJ6A 4H6JB 3UB9A 5G4YA 4EEUA 3ICYA 1S1YA 1TS7A 4H6JA 2CMNA
chains in the Genus database with same CATH superfamily
3T1XA 4QY5A 4WEJA 4RX2A 5CTNA 2EWVA 5FQMA 3A3JA 3QP2A 3LI8A 2BLSA 4PAUA 1XFNA 3QNCA 1IYQA 3LIAA 4XUXA 3LIFA 4S2IA 4ZJ2A 3OPRA 2Y2MA 2WGVA 4O7DA 4XT2A 5FQKA 4KZ4A 3FG8A 2H10A 4FCFA 4MN5A 4IBXA 1E4DA 3NCKA 4M3KA 3PBTA 3G6OA 3HREA 1F5MA 3H82B 2XA7S 4OQIA 4HNBA 4MNRA 3D72A 2VGJA 3PAGA 4RYEA 4ZTKA 1GHIA 1KGEA 3Q81A 4R1GA 3NI9A 2JKGA 5L2FA 3VP2A 4GD8A 3C2WA 3GQZA 4E04A 1W8YA 1Y4OA 3HLEA 1DY6A 2ZC5B 3V39A 4MBFA 3N7WA 3LEQA 3M6BA 2PD7A 3UY6A 1YMSA 4NETA 2Y59A 4C6YA 2BASA 1NZOA 2JE5A 1MPLA 3HLDA 4S2NC 1TS6A 2KLIA 5HWTA 1T1CA 4WMCA 1CQAA 1YLPA 2IWCA 3S7QA 2GX5A 2DRWA 4DXBA 1Y28A 3LYXA 4LGWA 3E98A 3UNWA 4PMAA 1HTZA 1MXOA 3DAVA 4X55A 5FEGA 1K25A 2JHEA 4P6ZM 1K56A 1NYYA 2DCFA 2IWDA 3R7WB 2W3EA 1OTIA 1EWZA 2WK0A 4HH2A 2K7SA 2ZD8A 4HEFA 4E3KA 5HSQA 1SKOA 4QHCA 3UDFA 3A0VA 5KIZA 3ZG5A 2VJWA 1GSVA 1LT0A 3IWIA 5FAQA 3NHQA 4GHIA 3BW6A 5KZHA 2RCXA 5HAIA 2P7JA 2FH5A 1NRJA 3KSHA 3IBRA 2O9AA 4KZ5A 3R4KA 3T4SA 4WMCD 1N9LA 4B9OA 3VP1A 2V1AA 4DRTA 5CGSA 2WAEA 2EX8A 3M2JA 4LV1A 5HZHA 3O87A 5EVIC 2W27A 3NOPC 3BECA 4I5SA 4EERA 3KYQA 3C7VA 1L2SA 3KYEA 5L10A 1SZVA 2A24A 1KVLA 2WKEA 3PBQA 1W63Q 3G35A 3SS3A 1IYSA 3WS1A 3P7NA 1YLTA 2XFSA 3PBOA 1K4EA 2VV6A 4WYYA 1K55A 5DTSA 5FSRA 1S1YA 1TS7A 3Q7VB 3ZG8B 2VKSA 1XGIA 1PW8A 4G3KA 2VV7A 3KX0X 3F1PB 5HWVA 3K2NA 2R78A 1K6RA 2G2WA 4NXBA 3IWQA 5EOEA 3T4KA 4EQIA 3GECA 1UWNX 2ZOHA 5BOHA 3SH7A 3D3OA 2WZXA 3NJAA 3LI9A 5GHXA 4Y15A 3GDIA 4DDYA 4OPYA 1L0GA 2WGWA 5AQ9A 4HJ4A 4CLCC 4BBUA 2Y4AA 4P0MA 1I2WA 5HFOA 5I94A 1LSVA 4OP8A 3RTYA 3MKEA 4GDBA 4CLCA 3A3EA 3LR4A 3S22A 4KQOA 2VGLS 3EQUA 4ZJ1A 2FZ0A 4EXOA 1MWTA 3LR3A 1H8YA 4RX3A 3IX4A 5FDSA 1LHYA 2WAFA 3ISGA 2XK1A 3BYDA 3EWKA 4FUWA 3BFFA 2V9AA 3VFHA 3C38A 4S2MA 5HL6A 2R9WA 4PM6A 1KVMA 3MFDA 2XSSA 1Z6FA 4ZAMA 4X1MA 2BG1A 4LFUA 3ZVWA 2H5SA 1GA0A 4R4RA 2VX8A 4ZRRA 2X01A 4S2JA 3IWOA 1AXBA 3SW1A 2QJ7A 1NZUA 2C5WB 5KSCA 1FSYA 3MR0A 2NUPC 5GLAA 3V3RA 1TF1A 3QNBA 4EU0A 4DN0A 2Q9NA 1MC0A 4QJGA 1BLPA 3B47A 5CGWA 3T4LA 3O86A 3FV7A 3LEZA 5FASA 1D06A 2Y79A 1HVBA 4F3LA 3GMWA 4LRZE 3WRTA 1G6OA 1LL9A 4WELA 4HP4A 5DFXA 5DF8A 3ZGAB 2ZC7A 4N1HA 1WA9A 4CPKA 4D2OA 1F98A 2LB9A 4X69A 4UQIM 4UA9A 3MXRA 3WS2A 2WUQA 1RGYA 2ZQ9A 3K3DA 5CERA 2HP5A 3A3FA 1PRQA 4F94A 4WL9A 3CLOA 5FI6A 3MZFA 1JTDA 5L8MA 4M4XA 1NLZA 4GW9A 2QZ6A 3JVVA 4X1LA 5F82A 2W1TB 4RA7A 4BMWA 2JKRI 4S2PA 3MQOA 1ESIA 5G18A 1SHVA 3EEAA 4BBVA 1CF0A 4JGRA 4RVAA 4KUOA 3NOUC 4OLDA 5EV0A 1LSWA 4IEDA 1YT4A 4L9FA 3HJKA 2JKRM 3UDIA 4Y0TA 2B95A 3EOIA 1N4OA 4BJPA 4ID4A 1J9MA 2WKPA 3OC2A 4P6ZS 1OTDA 2HDRA 4HP9A 3BQ8A 1RCJA 3MMHA 2Y2NA 5FA7A 2Z6CA 3BM6A 1IOUA 4OQGA 4E3NA 4KZ9A 1PWGA 4MN6A 4GZBA 2W3DA 5A91A 2QYBA 1RGZA 1WYBA 3EGXC 3KSGA 3N8LA 4RQ9A 4DMZA 1PNEA 1IEMA 1ALQA 3NULA 3HL9A 4LCMA 5J3WA 3VV4A 4F3LB 3P01A 3BLSA 4QY6A 3OLOA 5EVID 4LLOB 3PYPA 1T18A 4JBFA 5EVIA 4I3AA 1A0KA 1NYMA 4DJ3A 2M7UA 3MFXA 2H0TA 4P87A 3H7WA 4UA7A 2INWA 1VM1A 1SCWA 1BZAA 1F2KA 5CECA 2ZQAA 2WGIA 2XH9A 2YKFA 4S2NA 4GB7A 3S1YA 3LR0A 4PM7A 3Q1FA 2HP9A 1BT5A 5GLDA 1OTEA 1S4SA 2Z6DA 1W79A 4ME4A 3D4FA 4MBKA 3KSIA 1XX2A 5FQ9A 4Y0UA 1MBLA 1OPXA 3G4PA 1W5DA 4UHUA 3TW8A 1IYOA 2QPNA 5M1AA 2ZLYA 3HBRA 2PBYA 2O9CA 1UWPX 1G5UA 4JPMA 1DJCA 1XGJA 4E6XA 1MWUA 1S66L 3NDEA 3N8SA 1OT9A 2J9OA 3M6HA 1NLYA 1VEUA 2Z2MB 5EE8A 3N6IA 2DNSA 1G6AA 5GLCA 3JVUA 4DE3A 4XXRA 3HUMA 3MF0A 4MEZA 1CEGA 3FWLA 1EI5A 4MBHA 1YKDA 1VHMA 4JLFA 3BEBA 3BQAA 4BLMA 3B33A 4UA6A 2P08A 2EA9A 4MMNA 2EWWA 3UE3A 3HCYA 4HESA 3N4IA 3IS2A 5FATA 2W3HA 4I38A 4Q0IA 3VSLA 2HV1A 1BYWA 2ZQ7A 3F1NB 4X56A 4GNUA 4K0WA 3S7NA 3IF6A 2VGLM 3BFDA 3NC8A 3W4OA 2ZM2A 3O88A 2ZJ9A 3OOVA 1Z09A 3V5MA 5AJGA 3AGDA 4DF6A 3G30A 2JKTM 3UO9A 2W3GA 2EX2A 4DDSA 3N8RA 2K2NA 1Q2PA 1YAXA 1N9NA 4PM8A 3DTIA 3KO6A 2PR5A 4OP5A 5DFYA 4G3WA 4OONA 2MJ6A 4OH0A 3NECA 4GS9A 3V3SA 4MCWA 2W3FA 4GS9B 4Q0JA 2ZM0A 1ESUA 4OPZA 4DKIA 1MWSA 5FAPA 1VETB 4P85A 4BWIA 3ZVTA 1TS8A 3ZNTA 3B42A 4YNRA 2H0YA 5LBRA 4Z1WA 2XRNA 4EESA 1QMFA 3AGFA 5HDCA 5F68A 3F1PA 4R3AA 5HDDA 2LB5A 3GRJA 3CI6A 3HLFA 1S4RA 1YSQA 2KOIA 2B02A 4FD8A 1FR1A 2O9BA 3G31A 2ZMVA 4JF5A 3R7WA 1I5QA 4GHIB 1PZOA 4II7A 1QMEA 4EETB 1TVFA 1DJBA 2QJ5A 2XEPA 3IF6C 5GLBA 3CHWP 3ZG9B 1DRMA 4PPRA 2D02A 5U47A 4YWZA 2OLUA 1ONHA 2Q0OA 4XUZA 2HZ5A 1WE4A 5EM0A 2BTFP 1VQQA 1BLCA 2J8YA 5J7EA 1MKMA 4FH2A 3C4OA 5DVAA 2O0YA 4KG5A 3C7UA 1FSWA 2A2LA 1J3WA 1ZC2A 1HZOA 3ITBA 3CUEA 2EFUA 5CHUA 4GD6A 3FPWA 3E2KA 5FAOA 1FILA 2A24B 1YSPA 4Q0HA 3G32A 2B18A 1E25A 1O07A 3BFGA 4ARZB 4FTXA 5E2GA 2OSUA 3T50A 1KDWA 2J9PA 2JN7A 1P97A 4Y0OA 3WWXA 3LUQA 3ZHHA 1T19A 1ONGA 4EBNA 1IELA 3RFBA 1KDSA 5EOOA 3JPUA 5HD5A 1H0MA 2GNXA 4WLAA 1KGGA 2XFTA 2JC7A 4Q8IA 2JKFA 4BD1A 4H8RA 2OAQ1 5HWWA 1YMXA 3ZQ5A 1OT6A 1PWCA 1UGUA 1I2SA 2GDNA 2OLVA 3IXGA 1E3UD 3NBLA 1GCEA 5DTKA 5CHMA 3VSKA 5FI2A 1V9ZA 3V67A 3UMDA 1ES2A 2V20A 4D60A 5MC7A 2ZM8A 2UWXA 3OPPA 1P9RA 2HP6A 5K5BA 5C5KA 2W0NA 3HVFA 3FKWA 2PU2A 4KZ6A 3JYIA 4QWOA 2ZQDA 3KSFA 5HAPA 4JXVA 2PU4A 4WZ4A 1VB6A 1K55C 4I39A 3TSGA 1Q2QA 2E8JA 4HQAA 1LL5A 1XPBA 3GVBA 4E6WA 3UB8A 2XF3A 4OVDA 2KDKA 1YLYA 4KQDA 3HLBA 4Y5FA 4X6TA 5AVEA 3T4OA 3IHAA 3LIDA 3MXQA 4X68A 2V1ZA 1PI5A 1XJ3A 4HI4A 2OAP1 2ZMAA 3MJQA 2ZMFA 4N92A 4ZJ3A 5TBMB 1FCNA 2QKPA 2WGWB 4DJ2A 2EX6A 4BL2A 3F1OA 3IXHA 1H8MA 4KQRA 3BLMA 1YM1A 5A90A 5CHJA 4ETXA 3HJIA 1YLWA 1FIKA 1PYYA 3QP4A 5JYOA 1ES3A 1OJ5A 2OOLA 5IT5A 2HGVA 2PYRA 3W4PA 2V2FF 4EBPA 4MDZA 3W4QA 4IUKA 1L3LA 2Y2HA 4C75A 1JNUA 4JXGA 4NKPA 1SDEA 3A0SA 5EVIB 4HOIA 2Y2OA 2WKRA 3LO7A 4WZ5C 1OTBA 1TD5A 3AGEA 2I9VA 4NG2A 3CAXA 4N1XA 1CEFA 1S67L 2J80A 2X71A 1H3QA 2L4RA 4NXGA 2PHYA 2P9VB 3T1QB 4PM5A 4KQQA 2R9XA 4OOLA 2HJ9C 4H6JA 3PBNA 5F1GA 3BRMA 5CTMA 3BY8A 5FL3A 3GSGA 3P09A 2G2UA 2VK3A 2ZBBA 4JKTA 3SH8A 3ZCZA 3S7PA 1L0FA 3VMAA 3L9KA 4X53A 3QP8A 3HLGA 3T1RA 1ZG6A 4BBTA 4QPRA 3G34A 5EECA 4AFIA 1K38A 3F1OB 5JYPA 1IKGA 5HPIA 3MKFA 3MS6A 1N9BA 5A93A 4ZDXA 4XT2B 3UB5P 3ZG7B 2XD5A 3A3DA 4EW7A 3L7HA 3NY4A 4I3IA 1OJGA 2B5RA 2VZWA 2XA7M 1TS0A 4CLCB 4E3IA 1YLJA 4QB8A 3UN7A 3LIBA 5E2HA 3QP1A 3C5AA 1TDGA 1JWZA 2J3TC 2K31A 4JF4A 4LENA 3U2AA 4DE2A 2ZQCA 4EUVA 2W1TA 4EQ1A 2KX6A 3ITAA 4L9EA 5L07A 2Y2IA 1MZUA 3RJUA 2P9VA 4GLQA 1XA7A 3VE3A 4NEED 4ESPA 1FOFA 4R6LA 4DXCA 1ACFA 2VA0A 4GDNA 3MZEA 4G3VA 1X0OA 2L0WA 2XLNA 2Y2GA 4ARZA 4Z9QA 1K57A 3UB9A 1E3UA 4KG2A 5F6AA 3BFCA 3E0YA 2D01A 3SS5A 2Y2LA 4QU3A 1IKIA 3CMZA 1FCOA 3E2LA 1K56D 4K08A 2QHKA 4PHTA 5TR7A 3ULFA 4Y13A 1CK3A 4S2KA 2C6WB 3OCLA 3NDGA 2A3UA 1S6RA 2ZC4B 2XGNA 1KE3A 4IVKA 4CLCD 4EEPA 4R70A 2A49A 5EVEA 1ERMA 4L9GA 2I72A 1SKFA 2XDMA 4N9LA 4WN5A 2WADA 4UQIS 1OTAA 5HD3A 1FCMA 4GCZA 2NUTC 2EXBA 2IWBA 1BULA 3KYZA 3H7WB 3TG9A 1DJAA 1P9WA 2HDUA 3FYZA 1G28A 1PW1A 3H9WA 4B93A 3CJMA 3PBSA 3NOTC 4LV2A 1NJ4A 1L0DA 1N9OA 3DTKA 5J8XA 2YKHA 3A3IA 4DE1A 4IVIA 1LL8A 3WS0A 2H28A 4WM9A 3IT9A 3C4PA 1GSWA 5TGFA 1DP8A 4X25A 3S7OA 5I5LA 4EBLA 2WKIA 1ZHHB 3ZNYA 1BLSA 4C3QA 4IUHA 4K0XA 5AQAA 4YOFA 4K91A 4R3BA 4HBUA 1JTGA 3CPTB 1VEUB 1BUEA 3CZDA 4O8GA 3CPTA 2PR6A 5E43A 4MLLA 5IS1A 2EFXA 4UEYA 3MSHA 3K3CA 1KOUA 1BSGA 2M7VA 1SKOB 2ZC3B 5AVFA 3Q07A 5EFWA 4FSFA 3O3VA 1IYPA 5CXWA 5AQ7A 3BY9A 1PI4A 2ZC6B 5KMWA 5CRFA 5IU1A 4I3JA 3VOZA 1LSXA 2Z2LB 1U60A 5FQJA 2PYPA 2E8IA 3IXBA 3RXXA 3VOYA 2X02A 3PBRA 1NRFA 3E4OA 3BWLA 1T1BA 3GV9A 5FEFA 2OV5A 3SZTA 3GR2A 4LPZA 4N9KA 1O7EA 4HBTA 5TJJA 1NWZA 4B4XA 3U4LP 3FZCA 2WZZA 2PRFA 4DE0A 1KE4A 3LFVA 1ERQA 3E4QA 3LIEA 4JF6A 1AWIA 1S0WA 4KENB 1D1JA 3UE6A 4GKUA 4E3JA 2HDQA 2PBDP 2VEAA 4H6JB 2ACGA 3ICYA 2JKTI 2EXAA 4A5RA 4Y3IA 4HHDA 3UB6A 3Q7VA 1GHMA 5E2FA 1LLBA 4GJ4A 4JXSA 2JCHA 3UDXA 5HARA 1XJ2A 3LY3A 3VP4A 1NXYA 5EUAA 3RH8B 3UE0A 4CQHA 3TJZC 4R3JA 1LI9A 4HY8A 3F1NA 1T1AA 4E3LA 4OQ0A 2G7UA 4L0LA 4KZAA 3BJNA 2M1CA 4GN2A 5HAQA 1K4FA 3UPOA 3IS2B 3PAEA 4NK3A 4MN7A 4LV3A 3T1SA 3DWZA 5DTTA 3VFFA 5E2EA 1LI0A 2XQZA 3OPLA 1FR6A 1W63M 2L1MA 1H5XA 4BD0A 5F1FA 1DP9A 3IX3A 3ZFZA 5A92A 3B3XA 5HX9A 2CC1A 5GHYA 4LCLA 3SH9A 3IF5A 1P0ZA 5DJTA 4BENA 2ZL1A 3PR6A 3HLWA 3CUEC 4R23A 3IHBA 5J4EA 1EROA 5M19A 3M2KA 4KG6A 1TEMA 2V1BA 3SS4A 3RXWA 3T4JA 4B4ZA 3DBAA 1MWRA 1BTLA 3PHYA 3SOIA 1ODVA 2HJEA 3EEHA 1RP5A 1C3BA 2VV8A 3NIAA 4KZ7A 4Y7PA 5CGXA 3UPNA 3DTEA 3O5YA 5HL1A 2VLGA 2PD8A 4HJ3A 3HLCA 2V0WA 5CEBA 5KSHA 1GA9A 5F69A 3MQQA 2RL3A 3ZDJA 1K0KA 2V0UA 2V8CA 1V9YA 4R0QA 5FI7A 2IA2A 5IHVA 2Y55A 4EWFA 1JVJA 4B88A 4UAAA 3C8CA 1KGFA 2WKQA 3MBZA 2PAVP 4LRYC 1YPRA 1XJ4A 3S4XA 4P6BA 1ES5A 3LY4A 2PDRA 4OKPA 4HJ6A 3HUNA 4OOMA 2Y2JA 5FQIA 2V8FA 1K54A 4YINA 5EVLA 5HW3A 1FQGA 3CG5A 2J3TD 2PT7A 5L09A 1CJFA 1ES4A 1PFLA 3IH9A 1K54C 3G2YA 4OLGA 4U0XA 5EM1A 3IXDA 1OMEA 2WYXA 4U3TA 5GL9A 5EPHA 3FC7A 3MZDA 2P74A 1EW0A 4E3OA 4NXFA 1XA1A 1HLUP 1YLZA 3OZHA 1ZTUA 3OBFA 1XJ6A 1GHPA 1Y54A 2Y8HA 1MKIA 1HD8A 4OPRA 1CI9A 5TFQA 1BLHA 2QWSA 2ZQ8A 3W2ZA 3GTCA 3UE1A 1TDLA 2ZOIA 2UV0E 1D7EA 4JGQA 1ZKJA 3IH8A 3CITA 1CI8A 1STZA 4JXWA 3TE8A 3V50A 2Y2PA 1PIOA 2XD1A 3A0RA 2Y2KA 3UPPA 3EQVA 5CX7A 5DKKA 3IQAA 2FFFB 1F9IA 3D9YA 1XFQA 4ZBEA 2HPBA 3QP5A 4EUZA 1YQSA 2XR0A 3WS5A 4CLCE 3WRZA 3DW0A 3LR5A 4OPQA 2DMWA 2GZAA 4WBGA 3VP3A 2J3WA 2HF6A 5AQBA 4YFMA 3LICA 1M40A 5M18A 4U0TA 1G68A 1XKZA 4NXEA 1W8QA 4PKYA 3VOLA 3OCNA 4OQHA 4S2OA 5CEDA 3G2ZA 2ZL1B 3I7JA 3WS4A 2OWHA 1M6KA 2HDSA 4JGOA 1S1ZA 4LRXC 1W7FA 4KZ8A 2AVXA 4FH4A 1JWVA 3UMEA 4WZ5A 3MQ0A 3DTMA 5DJUA 1PWDA 1XXMA 1VETA 5G4YA 3EGDC 2VGKA 2CMNA 5DF7A 2W1RA 4R4SA 3LCEA 4KZ3A 3P98A 4Y2FA 4S2LA 4GOGA 2Y2QA 5GHZA 3C30A 3BFEA 2QMIA 5FQQA 1KE0A 4E3MA 5HDSA 1WYCA 2WKHA 3MXSA 2J7VA 3W8KA 1PZPA 5TBMA 5HPFA 4PM9A 3PXPA 4WF0A 3T12B 3IF6B 4KZBA 3VP0A 3DWKA 3IBJA 1MY8A 3E4PA 1K6SA 4QD4A 5DKLA 1IFQA 4IHQA 2OWJA 4BL3A 3FKVA 4R38A 3HUOA 4HIAA 2Y91A 3ZYTA 5A8BA 2JBFA 4WEKA 4O01A 4IJGA 4HH3A 3QP6A 3QHYA 3VE4A 2FFYA 3ZG0A 1NY0A 4CJNA 3LGOA 3OPHA 3TOIA 4O0PA 5F5YA 1GSXA 4ETZA 5DF9A 4JGPA 1DP6A 3H82A 2EX9A 3T4QA 3UB7A 4EV4A 4OOYA 3Q82A 2GJ3A 3T4TA 2XROA 3TRCA 5F83A 3PTEA 4LV0A 1ZG4A 3FPVA 1H8ZA 2P04A 4PKYG 3IX8A 3CWFA 1K57C 5FDHA 4IBRA 5G4ZA 1SDNA 4KUKA 5D3OA 4FOFA 1XP4A 4WUJA 2O99A 4EEUA 1JWPA 4Y17A 2Q9MA 1L0EA 4BQMA 3Q7ZA
chains in the Genus database with same CATH topology
5AVEA 3T4OA 2WKPA 4Y3IA 4HHDA 3UB6A 3OC2A 4P6ZS 3LIDA 1OTDA 3MXQA 4HP9A 3BQ8A 4WEJA 4GJ4A 3MMHA 2EWVA 2Z6CA 3LI8A 1XJ3A 1XJ2A 4PAUA 4HI4A 1XFNA 2OAP1 3LIAA 3MJQA 1IOUA 3LIFA 2ZMFA 5TBMB 4MN6A 3RH8B 2QKPA 4DJ2A 4CQHA 3TJZC 4XT2A 2W3DA 2QYBA 3F1OA 3EGXC 3KSGA 4HY8A 4RQ9A 4DMZA 1H8MA 3FG8A 3F1NA 1T1AA 4MN5A 5J3WA 3VV4A 2G7UA 4L0LA 4F3LB 4ETXA 3BJNA 3HJIA 2M1CA 3P01A 3OLOA 4LLOB 3IS2B 3PBTA 3PYPA 3G6OA 1T18A 1F5MA 4MN7A 3H82B 1OJ5A 2XA7S 4HNBA 2OOLA 4I3AA 5IT5A 3D72A 4DJ3A 2M7UA 3MFXA 2HGVA 3H7WA 2INWA 2PYRA 4MDZA 1W63M 3C2WA 4E04A 4IUKA 2L1MA 1JNUA 2YKFA 1DP9A 4NKPA 3A0SA 3LR0A 4HOIA 2WKRA 2PD7A 1OTBA 1TD5A 1OTEA 2I9VA 2BASA 1P0ZA 1S4SA 5DJTA 2Z6DA 3CAXA 4ME4A 3PR6A 1TS6A 1S67L 2KLIA 3CUEC 2J80A 5HWTA 1T1CA 1H3QA 5J4EA 2L4RA 3KSIA 4NXGA 2PHYA 3S7QA 2GX5A 2V1BA 1OPXA 3TW8A 1Y28A 3T4JA 3LYXA 4OOLA 3DBAA 3E98A 2HJ9C 4H6JA 2O9CA 3PBNA 3PHYA 1UWPX 3BY8A 5FL3A 1ODVA 2HJEA 3EEHA 2ZBBA 2JHEA 1S66L 2VV8A 4P6ZM 1OT9A 1NLYA 3S7PA 3R7WB 3O5YA 2W3EA 1OTIA 2VLGA 4HH2A 2K7SA 2PD8A 3JVUA 4HJ3A 3MF0A 2V0WA 5KSHA 5F69A 5HSQA 4BBTA 3MQQA 4QPRA 3A0VA 5KIZA 1YKDA 4AFIA 1VHMA 2VJWA 2V0UA 3BQAA 1GSVA 1V9YA 3B33A 2P08A 2IA2A 1LT0A 3F1OB 2EA9A 4MMNA 2EWWA 3UE3A 3HCYA 3NHQA 4GHIA 3BW6A 3C8CA 2WKQA 5HPIA 4LRYC 3IS2A 2P7JA 2FH5A 2W3HA 1NRJA 4XT2B 3KSHA 4I38A 3IBRA 4Q0IA 1XJ4A 2O9AA 3R4KA 4EW7A 3T4SA 2HV1A 1BYWA 3F1NB 1N9LA 2PDRA 4I3IA 4B9OA 1OJGA 2V1AA 2VZWA 2XA7M 3S7NA 2VGLM 1TS0A 4HJ6A 4OOMA 4CLCB 5HZHA 3LIBA 3OOVA 2J3TD 2W27A 3NOPC 2PT7A 4I5SA 5AJGA 4EERA 2J3TC 3KYQA 2K31A 3U2AA 4EUVA 2W1TA 4EQ1A 2KX6A 4L9EA 2JKTM 1MZUA 2A24A 2W3GA 3PBQA 4GLQA 2K2NA 1W63Q 1YAXA 3FC7A 1N9NA 3KO6A 3VE3A 4NEED 1EW0A 2PR5A 4R6LA 3P7NA 5DFYA 2VA0A 4G3WA 3PBOA 4G3VA 4NXFA 1X0OA 2L0WA 2MJ6A 2VV6A 4GS9A 4ARZA 4MCWA 2W3FA 4GS9B 1ZTUA 3OBFA 4Q0JA 1XJ6A 3UB9A 2Y8HA 1S1YA 1TS7A 2VKSA 5F6AA 4BWIA 4G3KA 2VV7A 1TS8A 3E0YA 3B42A 3KX0X 2D01A 3F1PB 4YNRA 5HWVA 2QWSA 5LBRA 4Z1WA 2XRNA 4EESA 3K2NA 5HDCA 2R78A 5F68A 3W2ZA 3F1PA 4R3AA 4NXBA 5HDDA 2LB5A 2ZOIA 3CI6A 3T4KA 4K08A 1S4RA 3GECA 1YSQA 1UWNX 2ZOHA 2KOIA 2QHKA 2B02A 3D3OA 4PHTA 3NJAA 3LI9A 3ULFA 1D7EA 4JGQA 3GDIA 2O9BA 3OCLA 2ZMVA 3CITA 3R7WA 4GHIB 1STZA 3TE8A 4II7A 4CLCD 4HJ4A 4EEPA 4EETB 4R70A 4L9GA 4CLCC 3A0RA 2QJ5A 4BBUA 3EQVA 5CX7A 5DKKA 4WN5A 5HD3A 4UQIS 1OTAA 1F9IA 4GCZA 2NUTC 1DRMA 1LSVA 1XFQA 3RTYA 2D02A 3KYZA 3H7WB 4YWZA 1P9WA 4CLCA 4CLCE 3LR5A 2DMWA 2GZAA 3LR4A 1G28A 4KQOA 2VGLS 3EQUA 3H9WA 2J3WA 2FZ0A 2HF6A 4B93A 4EXOA 5J7EA 3PBSA 1MKMA 3NOTC 3LICA 1N9OA 3LR3A 2O0YA 4NXEA 2A2LA 2YKHA 3CUEA 4PKYA 3VOLA 3OCNA 1LL8A 3EWKA 2H28A 2OWHA 2V9AA 3FPWA 4JGOA 1S1ZA 3C38A 4LRXC 5HL6A 1GSWA 2A24B 1YSPA 1DP8A 2XSSA 4Q0HA 3UMEA 2B18A 3MQ0A 3S7OA 5DJUA 5I5LA 4ARZB 1ZHHB 2VX8A 4ZRRA 4IUHA 5G4YA 4YOFA 3EGDC 2CMNA 2W1RA 3T50A 4Y2FA 3SW1A 2QJ7A 2JN7A 1P97A 3C30A 3MR0A 4O8GA 2NUPC 2PR6A 3LUQA 1T19A 1TF1A 4EU0A 5HDSA 4DN0A 3RFBA 5IS1A 1MC0A 5HD5A 2GNXA 3B47A 4WLAA 5TBMA 5HPFA 3T4LA 3PXPA 4WF0A 1D06A 4UEYA 2Y79A 3K3CA 1KOUA 2M7VA 3IBJA 4F3LA 2OAQ1 3E4PA 5AVFA 5EFWA 4FSFA 4LRZE 1G6OA 5DKLA 5HWWA 1IFQA 4IHQA 2OWJA 3BY9A 4HP4A 4WELA 5DFXA 3ZQ5A 4R38A 1OT6A 1UGUA 1WA9A 4HIAA 3ZYTA 5A8BA 4WEKA 4I3JA 4O01A 5IU1A 4IJGA 1F98A 2LB9A 1LSXA 4HH3A 4UQIM 3VE4A 2PYPA 3K3DA 1V9ZA 3V67A 3UMDA 4O0PA 5F5YA 5MC7A 1GSXA 4ETZA 3PBRA 5DF9A 4JGPA 1P9RA 4WL9A 1DP6A 3BWLA 3E4OA 1T1BA 5K5BA 3H82A 5C5KA 3CLOA 2W0NA 3T4QA 3UB7A 5L8MA 4M4XA 1NLZA 2GJ3A 3T4TA 2XROA 4GW9A 3TRCA 3JVVA 4LPZA 3KSFA 5TJJA 1NWZA 2W1TB 4BMWA 3FPVA 2JKRI 3MQOA 3EEAA 2P04A 4PKYG 4BBVA 4JGRA 4KUOA 3CWFA 1VB6A 3LFVA 3E4QA 3NOUC 1LSWA 4I39A 3LIEA 4HQAA 5G4ZA 4KUKA 4FOFA 3UE6A 4L9FA 3UB8A 3HJKA 2JKRM 2VEAA 2KDKA 4WUJA 2O99A 4KQDA 3EOIA 4BJPA 4H6JB 4EEUA 3ICYA 2JKTI 4Y5FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AVE A;  5F6A A;  3PHY A;  2WKP A;  1UWP X;  3T50 A;  4HHD A;  3UB6 A;  2VV7 A;  3LID A;  3BY8 A;  1TS8 A;  1OTD A;  3KX0 X;  3MXQ A;  2D01 A;  3F1P B;  1ODV A;  4HP9 A;  2QWS A;  2ZBB A;  2QJ7 A;  3EEH A;  5HWV A;  2JHE A;  1S66 L;  3SW1 A;  2JN7 A;  2VV8 A;  1OT9 A;  1P97 A;  4EES A;  5HDC A;  3MR0 A;  2Z6C A;  2R78 A;  3LI8 A;  5F68 A;  1XJ3 A;  2PR6 A;  3F1P A;  4R3A A;  4NXB A;  3LUQ A;  1XJ2 A;  4HI4 A;  1XFN A;  5HDD A;  3LIA A;  3MJQ A;  2ZOI A;  3LIF A;  1OTI A;  1T19 A;  4K08 A;  1S4R A;  3GEC A;  1UWN X;  2ZOH A;  2VLG A;  4HH2 A;  2K7S A;  2PD8 A;  5HDS A;  4HJ3 A;  5IS1 A;  2QHK A;  2B02 A;  5TBM B;  5HD5 A;  3NJA A;  3LI9 A;  4MN6 A;  3ULF A;  1D7E A;  2V0W A;  4JGQ A;  3RH8 B;  2QKP A;  3GDI A;  4WLA A;  5TBM A;  5F69 A;  4DJ2 A;  5HSQ A;  4BBT A;  3MQQ A;  3A0V A;  4XT2 A;  5KIZ A;  4WF0 A;  1D06 A;  2V0U A;  3F1O A;  3K3C A;  1GSV A;  1KOU A;  1V9Y A;  3B33 A;  4HY8 A;  4RQ9 A;  1LT0 A;  3F1O B;  3FG8 A;  3F1N A;  1T1A A;  2EA9 A;  4GHI B;  4MN5 A;  3E4P A;  4F3L A;  5AVF A;  5J3W A;  5EFW A;  3NHQ A;  4GHI A;  4LRZ E;  4F3L B;  5DKL A;  3C8C A;  4HJ4 A;  3VE4 A;  2WKQ A;  3HJI A;  4EEP A;  2M1C A;  4R70 A;  4LRY C;  4EET B;  5HWW A;  3IS2 A;  2OWJ A;  3BY9 A;  3OLO A;  4HP4 A;  2P7J A;  4L9G A;  3A0R A;  2QJ5 A;  3ZQ5 A;  4LLO B;  3IS2 B;  1OT6 A;  4R38 A;  4BBU A;  4XT2 B;  1UGU A;  3PYP A;  3G6O A;  5DKK A;  4I38 A;  1WA9 A;  1T18 A;  3IBR A;  4HIA A;  4WN5 A;  5HD3 A;  1OTA A;  1XJ4 A;  5A8B A;  1F9I A;  4EW7 A;  4GCZ A;  4I3J A;  5IU1 A;  3H82 B;  2HV1 A;  1BYW A;  1DRM A;  1F98 A;  2D02 A;  1LSX A;  1LSV A;  1OJ5 A;  1XFQ A;  1N9L A;  3F1N B;  2PDR A;  3H7W B;  4I3I A;  4YWZ A;  4HNB A;  2OOL A;  4I3A A;  1OJG A;  2PYP A;  2V1A A;  4B9O A;  3D72 A;  1V9Z A;  3K3D A;  4DJ3 A;  4JGO A;  3UMD A;  4HJ6 A;  1TS0 A;  3MFX A;  3H7W A;  1G28 A;  2INW A;  2PYR A;  5HZH A;  5F5Y A;  3H9W A;  1GSX A;  4JGP A;  3LIB A;  4WL9 A;  2W27 A;  4EXO A;  3NOP C;  1DP6 A;  3BWL A;  3E4O A;  1T1B A;  5J7E A;  3H82 A;  4I5S A;  3NOT C;  3LIC A;  3CLO A;  2W0N A;  3C2W A;  4EER A;  4E04 A;  3UB7 A;  1N9O A;  2L1M A;  4M4X A;  2GJ3 A;  1JNU A;  2KX6 A;  4GW9 A;  2YKF A;  4L9E A;  4EQ1 A;  1DP9 A;  4NXE A;  3A0S A;  4LPZ A;  1MZU A;  2A24 A;  2YKH A;  4PKY A;  3VOL A;  1NWZ A;  4HOI A;  2WKR A;  1LL8 A;  2PD7 A;  3MQO A;  3EWK A;  2H28 A;  1OTB A;  2OWH A;  4HH3 A;  2V9A A;  1OTE A;  3FC7 A;  1N9N A;  2I9V A;  4PKY G;  2BAS A;  1P0Z A;  1S4S A;  4JGR A;  3VE3 A;  5DJT A;  4BBV A;  1EW0 A;  1S1Z A;  2PR5 A;  2Z6D A;  3CAX A;  3CWF A;  1VB6 A;  3NOU C;  3E4Q A;  3P7N A;  4KUO A;  4LRX C;  1LSW A;  1TS6 A;  1S67 L;  4I39 A;  3LIE A;  2J80 A;  1GSW A;  1T1C A;  5HWT A;  4HQA A;  1X0O A;  2L0W A;  4KUK A;  4NXF A;  5G4Z A;  2VV6 A;  2A24 B;  3UME A;  1DP8 A;  2L4R A;  4GS9 A;  5J4E A;  3UE6 A;  4L9F A;  4NXG A;  2PHY A;  3RTY A;  3UB8 A;  3HJK A;  4R6L A;  2V1B A;  5DJU A;  5I5L A;  2VEA A;  2KDK A;  4WUJ A;  4GS9 B;  1Y28 A;  3LYX A;  4KQD A;  1XJ6 A;  4H6J B;  3UB9 A;  5G4Y A;  4EEU A;  3ICY A;  1S1Y A;  1TS7 A;  4H6J A;  2CMN A; 
#chains in the Genus database with same CATH topology
 3T1X A;  4QY5 A;  4WEJ A;  4RX2 A;  5CTN A;  2EWV A;  5FQM A;  3A3J A;  3QP2 A;  3LI8 A;  2BLS A;  4PAU A;  1XFN A;  3QNC A;  1IYQ A;  3LIA A;  4XUX A;  3LIF A;  4S2I A;  4ZJ2 A;  3OPR A;  2Y2M A;  2WGV A;  4O7D A;  4XT2 A;  5FQK A;  4KZ4 A;  3FG8 A;  2H10 A;  4FCF A;  4MN5 A;  4IBX A;  1E4D A;  3NCK A;  4M3K A;  3PBT A;  3G6O A;  3HRE A;  1F5M A;  3H82 B;  2XA7 S;  4OQI A;  4HNB A;  4MNR A;  3D72 A;  2VGJ A;  3PAG A;  4RYE A;  4ZTK A;  1GHI A;  1KGE A;  3Q81 A;  4R1G A;  3NI9 A;  2JKG A;  5L2F A;  3VP2 A;  4GD8 A;  3C2W A;  3GQZ A;  4E04 A;  1W8Y A;  1Y4O A;  3HLE A;  1DY6 A;  2ZC5 B;  3V39 A;  4MBF A;  3N7W A;  3LEQ A;  3M6B A;  2PD7 A;  3UY6 A;  1YMS A;  4NET A;  2Y59 A;  4C6Y A;  2BAS A;  1NZO A;  2JE5 A;  1MPL A;  3HLD A;  4S2N C;  1TS6 A;  2KLI A;  5HWT A;  1T1C A;  4WMC A;  1CQA A;  1YLP A;  2IWC A;  3S7Q A;  2GX5 A;  2DRW A;  4DXB A;  1Y28 A;  3LYX A;  4LGW A;  3E98 A;  3UNW A;  4PMA A;  1HTZ A;  1MXO A;  3DAV A;  4X55 A;  5FEG A;  1K25 A;  2JHE A;  4P6Z M;  1K56 A;  1NYY A;  2DCF A;  2IWD A;  3R7W B;  2W3E A;  1OTI A;  1EWZ A;  2WK0 A;  4HH2 A;  2K7S A;  2ZD8 A;  4HEF A;  4E3K A;  5HSQ A;  1SKO A;  4QHC A;  3UDF A;  3A0V A;  5KIZ A;  3ZG5 A;  2VJW A;  1GSV A;  1LT0 A;  3IWI A;  5FAQ A;  3NHQ A;  4GHI A;  3BW6 A;  5KZH A;  2RCX A;  5HAI A;  2P7J A;  2FH5 A;  1NRJ A;  3KSH A;  3IBR A;  2O9A A;  4KZ5 A;  3R4K A;  3T4S A;  4WMC D;  1N9L A;  4B9O A;  3VP1 A;  2V1A A;  4DRT A;  5CGS A;  2WAE A;  2EX8 A;  3M2J A;  4LV1 A;  5HZH A;  3O87 A;  5EVI C;  2W27 A;  3NOP C;  3BEC A;  4I5S A;  4EER A;  3KYQ A;  3C7V A;  1L2S A;  3KYE A;  5L10 A;  1SZV A;  2A24 A;  1KVL A;  2WKE A;  3PBQ A;  1W63 Q;  3G35 A;  3SS3 A;  1IYS A;  3WS1 A;  3P7N A;  1YLT A;  2XFS A;  3PBO A;  1K4E A;  2VV6 A;  4WYY A;  1K55 A;  5DTS A;  5FSR A;  1S1Y A;  1TS7 A;  3Q7V B;  3ZG8 B;  2VKS A;  1XGI A;  1PW8 A;  4G3K A;  2VV7 A;  3KX0 X;  3F1P B;  5HWV A;  3K2N A;  2R78 A;  1K6R A;  2G2W A;  4NXB A;  3IWQ A;  5EOE A;  3T4K A;  4EQI A;  3GEC A;  1UWN X;  2ZOH A;  5BOH A;  3SH7 A;  3D3O A;  2WZX A;  3NJA A;  3LI9 A;  5GHX A;  4Y15 A;  3GDI A;  4DDY A;  4OPY A;  1L0G A;  2WGW A;  5AQ9 A;  4HJ4 A;  4CLC C;  4BBU A;  2Y4A A;  4P0M A;  1I2W A;  5HFO A;  5I94 A;  1LSV A;  4OP8 A;  3RTY A;  3MKE A;  4GDB A;  4CLC A;  3A3E A;  3LR4 A;  3S22 A;  4KQO A;  2VGL S;  3EQU A;  4ZJ1 A;  2FZ0 A;  4EXO A;  1MWT A;  3LR3 A;  1H8Y A;  4RX3 A;  3IX4 A;  5FDS A;  1LHY A;  2WAF A;  3ISG A;  2XK1 A;  3BYD A;  3EWK A;  4FUW A;  3BFF A;  2V9A A;  3VFH A;  3C38 A;  4S2M A;  5HL6 A;  2R9W A;  4PM6 A;  1KVM A;  3MFD A;  2XSS A;  1Z6F A;  4ZAM A;  4X1M A;  2BG1 A;  4LFU A;  3ZVW A;  2H5S A;  1GA0 A;  4R4R A;  2VX8 A;  4ZRR A;  2X01 A;  4S2J A;  3IWO A;  1AXB A;  3SW1 A;  2QJ7 A;  1NZU A;  2C5W B;  5KSC A;  1FSY A;  3MR0 A;  2NUP C;  5GLA A;  3V3R A;  1TF1 A;  3QNB A;  4EU0 A;  4DN0 A;  2Q9N A;  1MC0 A;  4QJG A;  1BLP A;  3B47 A;  5CGW A;  3T4L A;  3O86 A;  3FV7 A;  3LEZ A;  5FAS A;  1D06 A;  2Y79 A;  1HVB A;  4F3L A;  3GMW A;  4LRZ E;  3WRT A;  1G6O A;  1LL9 A;  4WEL A;  4HP4 A;  5DFX A;  5DF8 A;  3ZGA B;  2ZC7 A;  4N1H A;  1WA9 A;  4CPK A;  4D2O A;  1F98 A;  2LB9 A;  4X69 A;  4UQI M;  4UA9 A;  3MXR A;  3WS2 A;  2WUQ A;  1RGY A;  2ZQ9 A;  3K3D A;  5CER A;  2HP5 A;  3A3F A;  1PRQ A;  4F94 A;  4WL9 A;  3CLO A;  5FI6 A;  3MZF A;  1JTD A;  5L8M A;  4M4X A;  1NLZ A;  4GW9 A;  2QZ6 A;  3JVV A;  4X1L A;  5F82 A;  2W1T B;  4RA7 A;  4BMW A;  2JKR I;  4S2P A;  3MQO A;  1ESI A;  5G18 A;  1SHV A;  3EEA A;  4BBV A;  1CF0 A;  4JGR A;  4RVA A;  4KUO A;  3NOU C;  4OLD A;  5EV0 A;  1LSW A;  4IED A;  1YT4 A;  4L9F A;  3HJK A;  2JKR M;  3UDI A;  4Y0T A;  2B95 A;  3EOI A;  1N4O A;  4BJP A;  4ID4 A;  1J9M A;  2WKP A;  3OC2 A;  4P6Z S;  1OTD A;  2HDR A;  4HP9 A;  3BQ8 A;  1RCJ A;  3MMH A;  2Y2N A;  5FA7 A;  2Z6C A;  3BM6 A;  1IOU A;  4OQG A;  4E3N A;  4KZ9 A;  1PWG A;  4MN6 A;  4GZB A;  2W3D A;  5A91 A;  2QYB A;  1RGZ A;  1WYB A;  3EGX C;  3KSG A;  3N8L A;  4RQ9 A;  4DMZ A;  1PNE A;  1IEM A;  1ALQ A;  3NUL A;  3HL9 A;  4LCM A;  5J3W A;  3VV4 A;  4F3L B;  3P01 A;  3BLS A;  4QY6 A;  3OLO A;  5EVI D;  4LLO B;  3PYP A;  1T18 A;  4JBF A;  5EVI A;  4I3A A;  1A0K A;  1NYM A;  4DJ3 A;  2M7U A;  3MFX A;  2H0T A;  4P87 A;  3H7W A;  4UA7 A;  2INW A;  1VM1 A;  1SCW A;  1BZA A;  1F2K A;  5CEC A;  2ZQA A;  2WGI A;  2XH9 A;  2YKF A;  4S2N A;  4GB7 A;  3S1Y A;  3LR0 A;  4PM7 A;  3Q1F A;  2HP9 A;  1BT5 A;  5GLD A;  1OTE A;  1S4S A;  2Z6D A;  1W79 A;  4ME4 A;  3D4F A;  4MBK A;  3KSI A;  1XX2 A;  5FQ9 A;  4Y0U A;  1MBL A;  1OPX A;  3G4P A;  1W5D A;  4UHU A;  3TW8 A;  1IYO A;  2QPN A;  5M1A A;  2ZLY A;  3HBR A;  2PBY A;  2O9C A;  1UWP X;  1G5U A;  4JPM A;  1DJC A;  1XGJ A;  4E6X A;  1MWU A;  1S66 L;  3NDE A;  3N8S A;  1OT9 A;  2J9O A;  3M6H A;  1NLY A;  1VEU A;  2Z2M B;  5EE8 A;  3N6I A;  2DNS A;  1G6A A;  5GLC A;  3JVU A;  4DE3 A;  4XXR A;  3HUM A;  3MF0 A;  4MEZ A;  1CEG A;  3FWL A;  1EI5 A;  4MBH A;  1YKD A;  1VHM A;  4JLF A;  3BEB A;  3BQA A;  4BLM A;  3B33 A;  4UA6 A;  2P08 A;  2EA9 A;  4MMN A;  2EWW A;  3UE3 A;  3HCY A;  4HES A;  3N4I A;  3IS2 A;  5FAT A;  2W3H A;  4I38 A;  4Q0I A;  3VSL A;  2HV1 A;  1BYW A;  2ZQ7 A;  3F1N B;  4X56 A;  4GNU A;  4K0W A;  3S7N A;  3IF6 A;  2VGL M;  3BFD A;  3NC8 A;  3W4O A;  2ZM2 A;  3O88 A;  2ZJ9 A;  3OOV A;  1Z09 A;  3V5M A;  5AJG A;  3AGD A;  4DF6 A;  3G30 A;  2JKT M;  3UO9 A;  2W3G A;  2EX2 A;  4DDS A;  3N8R A;  2K2N A;  1Q2P A;  1YAX A;  1N9N A;  4PM8 A;  3DTI A;  3KO6 A;  2PR5 A;  4OP5 A;  5DFY A;  4G3W A;  4OON A;  2MJ6 A;  4OH0 A;  3NEC A;  4GS9 A;  3V3S A;  4MCW A;  2W3F A;  4GS9 B;  4Q0J A;  2ZM0 A;  1ESU A;  4OPZ A;  4DKI A;  1MWS A;  5FAP A;  1VET B;  4P85 A;  4BWI A;  3ZVT A;  1TS8 A;  3ZNT A;  3B42 A;  4YNR A;  2H0Y A;  5LBR A;  4Z1W A;  2XRN A;  4EES A;  1QMF A;  3AGF A;  5HDC A;  5F68 A;  3F1P A;  4R3A A;  5HDD A;  2LB5 A;  3GRJ A;  3CI6 A;  3HLF A;  1S4R A;  1YSQ A;  2KOI A;  2B02 A;  4FD8 A;  1FR1 A;  2O9B A;  3G31 A;  2ZMV A;  4JF5 A;  3R7W A;  1I5Q A;  4GHI B;  1PZO A;  4II7 A;  1QME A;  4EET B;  1TVF A;  1DJB A;  2QJ5 A;  2XEP A;  3IF6 C;  5GLB A;  3CHW P;  3ZG9 B;  1DRM A;  4PPR A;  2D02 A;  5U47 A;  4YWZ A;  2OLU A;  1ONH A;  2Q0O A;  4XUZ A;  2HZ5 A;  1WE4 A;  5EM0 A;  2BTF P;  1VQQ A;  1BLC A;  2J8Y A;  5J7E A;  1MKM A;  4FH2 A;  3C4O A;  5DVA A;  2O0Y A;  4KG5 A;  3C7U A;  1FSW A;  2A2L A;  1J3W A;  1ZC2 A;  1HZO A;  3ITB A;  3CUE A;  2EFU A;  5CHU A;  4GD6 A;  3FPW A;  3E2K A;  5FAO A;  1FIL A;  2A24 B;  1YSP A;  4Q0H A;  3G32 A;  2B18 A;  1E25 A;  1O07 A;  3BFG A;  4ARZ B;  4FTX A;  5E2G A;  2OSU A;  3T50 A;  1KDW A;  2J9P A;  2JN7 A;  1P97 A;  4Y0O A;  3WWX A;  3LUQ A;  3ZHH A;  1T19 A;  1ONG A;  4EBN A;  1IEL A;  3RFB A;  1KDS A;  5EOO A;  3JPU A;  5HD5 A;  1H0M A;  2GNX A;  4WLA A;  1KGG A;  2XFT A;  2JC7 A;  4Q8I A;  2JKF A;  4BD1 A;  4H8R A;  2OAQ 1;  5HWW A;  1YMX A;  3ZQ5 A;  1OT6 A;  1PWC A;  1UGU A;  1I2S A;  2GDN A;  2OLV A;  3IXG A;  1E3U D;  3NBL A;  1GCE A;  5DTK A;  5CHM A;  3VSK A;  5FI2 A;  1V9Z A;  3V67 A;  3UMD A;  1ES2 A;  2V20 A;  4D60 A;  5MC7 A;  2ZM8 A;  2UWX A;  3OPP A;  1P9R A;  2HP6 A;  5K5B A;  5C5K A;  2W0N A;  3HVF A;  3FKW A;  2PU2 A;  4KZ6 A;  3JYI A;  4QWO A;  2ZQD A;  3KSF A;  5HAP A;  4JXV A;  2PU4 A;  4WZ4 A;  1VB6 A;  1K55 C;  4I39 A;  3TSG A;  1Q2Q A;  2E8J A;  4HQA A;  1LL5 A;  1XPB A;  3GVB A;  4E6W A;  3UB8 A;  2XF3 A;  4OVD A;  2KDK A;  1YLY A;  4KQD A;  3HLB A;  4Y5F A;  4X6T A;  5AVE A;  3T4O A;  3IHA A;  3LID A;  3MXQ A;  4X68 A;  2V1Z A;  1PI5 A;  1XJ3 A;  4HI4 A;  2OAP 1;  2ZMA A;  3MJQ A;  2ZMF A;  4N92 A;  4ZJ3 A;  5TBM B;  1FCN A;  2QKP A;  2WGW B;  4DJ2 A;  2EX6 A;  4BL2 A;  3F1O A;  3IXH A;  1H8M A;  4KQR A;  3BLM A;  1YM1 A;  5A90 A;  5CHJ A;  4ETX A;  3HJI A;  1YLW A;  1FIK A;  1PYY A;  3QP4 A;  5JYO A;  1ES3 A;  1OJ5 A;  2OOL A;  5IT5 A;  2HGV A;  2PYR A;  3W4P A;  2V2F F;  4EBP A;  4MDZ A;  3W4Q A;  4IUK A;  1L3L A;  2Y2H A;  4C75 A;  1JNU A;  4JXG A;  4NKP A;  1SDE A;  3A0S A;  5EVI B;  4HOI A;  2Y2O A;  2WKR A;  3LO7 A;  4WZ5 C;  1OTB A;  1TD5 A;  3AGE A;  2I9V A;  4NG2 A;  3CAX A;  4N1X A;  1CEF A;  1S67 L;  2J80 A;  2X71 A;  1H3Q A;  2L4R A;  4NXG A;  2PHY A;  2P9V B;  3T1Q B;  4PM5 A;  4KQQ A;  2R9X A;  4OOL A;  2HJ9 C;  4H6J A;  3PBN A;  5F1G A;  3BRM A;  5CTM A;  3BY8 A;  5FL3 A;  3GSG A;  3P09 A;  2G2U A;  2VK3 A;  2ZBB A;  4JKT A;  3SH8 A;  3ZCZ A;  3S7P A;  1L0F A;  3VMA A;  3L9K A;  4X53 A;  3QP8 A;  3HLG A;  3T1R A;  1ZG6 A;  4BBT A;  4QPR A;  3G34 A;  5EEC A;  4AFI A;  1K38 A;  3F1O B;  5JYP A;  1IKG A;  5HPI A;  3MKF A;  3MS6 A;  1N9B A;  5A93 A;  4ZDX A;  4XT2 B;  3UB5 P;  3ZG7 B;  2XD5 A;  3A3D A;  4EW7 A;  3L7H A;  3NY4 A;  4I3I A;  1OJG A;  2B5R A;  2VZW A;  2XA7 M;  1TS0 A;  4CLC B;  4E3I A;  1YLJ A;  4QB8 A;  3UN7 A;  3LIB A;  5E2H A;  3QP1 A;  3C5A A;  1TDG A;  1JWZ A;  2J3T C;  2K31 A;  4JF4 A;  4LEN A;  3U2A A;  4DE2 A;  2ZQC A;  4EUV A;  2W1T A;  4EQ1 A;  2KX6 A;  3ITA A;  4L9E A;  5L07 A;  2Y2I A;  1MZU A;  3RJU A;  2P9V A;  4GLQ A;  1XA7 A;  3VE3 A;  4NEE D;  4ESP A;  1FOF A;  4R6L A;  4DXC A;  1ACF A;  2VA0 A;  4GDN A;  3MZE A;  4G3V A;  1X0O A;  2L0W A;  2XLN A;  2Y2G A;  4ARZ A;  4Z9Q A;  1K57 A;  3UB9 A;  1E3U A;  4KG2 A;  5F6A A;  3BFC A;  3E0Y A;  2D01 A;  3SS5 A;  2Y2L A;  4QU3 A;  1IKI A;  3CMZ A;  1FCO A;  3E2L A;  1K56 D;  4K08 A;  2QHK A;  4PHT A;  5TR7 A;  3ULF A;  4Y13 A;  1CK3 A;  4S2K A;  2C6W B;  3OCL A;  3NDG A;  2A3U A;  1S6R A;  2ZC4 B;  2XGN A;  1KE3 A;  4IVK A;  4CLC D;  4EEP A;  4R70 A;  2A49 A;  5EVE A;  1ERM A;  4L9G A;  2I72 A;  1SKF A;  2XDM A;  4N9L A;  4WN5 A;  2WAD A;  4UQI S;  1OTA A;  5HD3 A;  1FCM A;  4GCZ A;  2NUT C;  2EXB A;  2IWB A;  1BUL A;  3KYZ A;  3H7W B;  3TG9 A;  1DJA A;  1P9W A;  2HDU A;  3FYZ A;  1G28 A;  1PW1 A;  3H9W A;  4B93 A;  3CJM A;  3PBS A;  3NOT C;  4LV2 A;  1NJ4 A;  1L0D A;  1N9O A;  3DTK A;  5J8X A;  2YKH A;  3A3I A;  4DE1 A;  4IVI A;  1LL8 A;  3WS0 A;  2H28 A;  4WM9 A;  3IT9 A;  3C4P A;  1GSW A;  5TGF A;  1DP8 A;  4X25 A;  3S7O A;  5I5L A;  4EBL A;  2WKI A;  1ZHH B;  3ZNY A;  1BLS A;  4C3Q A;  4IUH A;  4K0X A;  5AQA A;  4YOF A;  4K91 A;  4R3B A;  4HBU A;  1JTG A;  3CPT B;  1VEU B;  1BUE A;  3CZD A;  4O8G A;  3CPT A;  2PR6 A;  5E43 A;  4MLL A;  5IS1 A;  2EFX A;  4UEY A;  3MSH A;  3K3C A;  1KOU A;  1BSG A;  2M7V A;  1SKO B;  2ZC3 B;  5AVF A;  3Q07 A;  5EFW A;  4FSF A;  3O3V A;  1IYP A;  5CXW A;  5AQ7 A;  3BY9 A;  1PI4 A;  2ZC6 B;  5KMW A;  5CRF A;  5IU1 A;  4I3J A;  3VOZ A;  1LSX A;  2Z2L B;  1U60 A;  5FQJ A;  2PYP A;  2E8I A;  3IXB A;  3RXX A;  3VOY A;  2X02 A;  3PBR A;  1NRF A;  3E4O A;  3BWL A;  1T1B A;  3GV9 A;  5FEF A;  2OV5 A;  3SZT A;  3GR2 A;  4LPZ A;  4N9K A;  1O7E A;  4HBT A;  5TJJ A;  1NWZ A;  4B4X A;  3U4L P;  3FZC A;  2WZZ A;  2PRF A;  4DE0 A;  1KE4 A;  3LFV A;  1ERQ A;  3E4Q A;  3LIE A;  4JF6 A;  1AWI A;  1S0W A;  4KEN B;  1D1J A;  3UE6 A;  4GKU A;  4E3J A;  2HDQ A;  2PBD P;  2VEA A;  4H6J B;  2ACG A;  3ICY A;  2JKT I;  2EXA A;  4A5R A;  4Y3I A;  4HHD A;  3UB6 A;  3Q7V A;  1GHM A;  5E2F A;  1LLB A;  4GJ4 A;  4JXS A;  2JCH A;  3UDX A;  5HAR A;  1XJ2 A;  3LY3 A;  3VP4 A;  1NXY A;  5EUA A;  3RH8 B;  3UE0 A;  4CQH A;  3TJZ C;  4R3J A;  1LI9 A;  4HY8 A;  3F1N A;  1T1A A;  4E3L A;  4OQ0 A;  2G7U A;  4L0L A;  4KZA A;  3BJN A;  2M1C A;  4GN2 A;  5HAQ A;  1K4F A;  3UPO A;  3IS2 B;  3PAE A;  4NK3 A;  4MN7 A;  4LV3 A;  3T1S A;  3DWZ A;  5DTT A;  3VFF A;  5E2E A;  1LI0 A;  2XQZ A;  3OPL A;  1FR6 A;  1W63 M;  2L1M A;  1H5X A;  4BD0 A;  5F1F A;  1DP9 A;  3IX3 A;  3ZFZ A;  5A92 A;  3B3X A;  5HX9 A;  2CC1 A;  5GHY A;  4LCL A;  3SH9 A;  3IF5 A;  1P0Z A;  5DJT A;  4BEN A;  2ZL1 A;  3PR6 A;  3HLW A;  3CUE C;  4R23 A;  3IHB A;  5J4E A;  1ERO A;  5M19 A;  3M2K A;  4KG6 A;  1TEM A;  2V1B A;  3SS4 A;  3RXW A;  3T4J A;  4B4Z A;  3DBA A;  1MWR A;  1BTL A;  3PHY A;  3SOI A;  1ODV A;  2HJE A;  3EEH A;  1RP5 A;  1C3B A;  2VV8 A;  3NIA A;  4KZ7 A;  4Y7P A;  5CGX A;  3UPN A;  3DTE A;  3O5Y A;  5HL1 A;  2VLG A;  2PD8 A;  4HJ3 A;  3HLC A;  2V0W A;  5CEB A;  5KSH A;  1GA9 A;  5F69 A;  3MQQ A;  2RL3 A;  3ZDJ A;  1K0K A;  2V0U A;  2V8C A;  1V9Y A;  4R0Q A;  5FI7 A;  2IA2 A;  5IHV A;  2Y55 A;  4EWF A;  1JVJ A;  4B88 A;  4UAA A;  3C8C A;  1KGF A;  2WKQ A;  3MBZ A;  2PAV P;  4LRY C;  1YPR A;  1XJ4 A;  3S4X A;  4P6B A;  1ES5 A;  3LY4 A;  2PDR A;  4OKP A;  4HJ6 A;  3HUN A;  4OOM A;  2Y2J A;  5FQI A;  2V8F A;  1K54 A;  4YIN A;  5EVL A;  5HW3 A;  1FQG A;  3CG5 A;  2J3T D;  2PT7 A;  5L09 A;  1CJF A;  1ES4 A;  1PFL A;  3IH9 A;  1K54 C;  3G2Y A;  4OLG A;  4U0X A;  5EM1 A;  3IXD A;  1OME A;  2WYX A;  4U3T A;  5GL9 A;  5EPH A;  3FC7 A;  3MZD A;  2P74 A;  1EW0 A;  4E3O A;  4NXF A;  1XA1 A;  1HLU P;  1YLZ A;  3OZH A;  1ZTU A;  3OBF A;  1XJ6 A;  1GHP A;  1Y54 A;  2Y8H A;  1MKI A;  1HD8 A;  4OPR A;  1CI9 A;  5TFQ A;  1BLH A;  2QWS A;  2ZQ8 A;  3W2Z A;  3GTC A;  3UE1 A;  1TDL A;  2ZOI A;  2UV0 E;  1D7E A;  4JGQ A;  1ZKJ A;  3IH8 A;  3CIT A;  1CI8 A;  1STZ A;  4JXW A;  3TE8 A;  3V50 A;  2Y2P A;  1PIO A;  2XD1 A;  3A0R A;  2Y2K A;  3UPP A;  3EQV A;  5CX7 A;  5DKK A;  3IQA A;  2FFF B;  1F9I A;  3D9Y A;  1XFQ A;  4ZBE A;  2HPB A;  3QP5 A;  4EUZ A;  1YQS A;  2XR0 A;  3WS5 A;  4CLC E;  3WRZ A;  3DW0 A;  3LR5 A;  4OPQ A;  2DMW A;  2GZA A;  4WBG A;  3VP3 A;  2J3W A;  2HF6 A;  5AQB A;  4YFM A;  3LIC A;  1M40 A;  5M18 A;  4U0T A;  1G68 A;  1XKZ A;  4NXE A;  1W8Q A;  4PKY A;  3VOL A;  3OCN A;  4OQH A;  4S2O A;  5CED A;  3G2Z A;  2ZL1 B;  3I7J A;  3WS4 A;  2OWH A;  1M6K A;  2HDS A;  4JGO A;  1S1Z A;  4LRX C;  1W7F A;  4KZ8 A;  2AVX A;  4FH4 A;  1JWV A;  3UME A;  4WZ5 A;  3MQ0 A;  3DTM A;  5DJU A;  1PWD A;  1XXM A;  1VET A;  5G4Y A;  3EGD C;  2VGK A;  2CMN A;  5DF7 A;  2W1R A;  4R4S A;  3LCE A;  4KZ3 A;  3P98 A;  4Y2F A;  4S2L A;  4GOG A;  2Y2Q A;  5GHZ A;  3C30 A;  3BFE A;  2QMI A;  5FQQ A;  1KE0 A;  4E3M A;  5HDS A;  1WYC A;  2WKH A;  3MXS A;  2J7V A;  3W8K A;  1PZP A;  5TBM A;  5HPF A;  4PM9 A;  3PXP A;  4WF0 A;  3T12 B;  3IF6 B;  4KZB A;  3VP0 A;  3DWK A;  3IBJ A;  1MY8 A;  3E4P A;  1K6S A;  4QD4 A;  5DKL A;  1IFQ A;  4IHQ A;  2OWJ A;  4BL3 A;  3FKV A;  4R38 A;  3HUO A;  4HIA A;  2Y91 A;  3ZYT A;  5A8B A;  2JBF A;  4WEK A;  4O01 A;  4IJG A;  4HH3 A;  3QP6 A;  3QHY A;  3VE4 A;  2FFY A;  3ZG0 A;  1NY0 A;  4CJN A;  3LGO A;  3OPH A;  3TOI A;  4O0P A;  5F5Y A;  1GSX A;  4ETZ A;  5DF9 A;  4JGP A;  1DP6 A;  3H82 A;  2EX9 A;  3T4Q A;  3UB7 A;  4EV4 A;  4OOY A;  3Q82 A;  2GJ3 A;  3T4T A;  2XRO A;  3TRC A;  5F83 A;  3PTE A;  4LV0 A;  1ZG4 A;  3FPV A;  1H8Z A;  2P04 A;  4PKY G;  3IX8 A;  3CWF A;  1K57 C;  5FDH A;  4IBR A;  5G4Z A;  1SDN A;  4KUK A;  5D3O A;  4FOF A;  1XP4 A;  4WUJ A;  2O99 A;  4EEU A;  1JWP A;  4Y17 A;  2Q9M A;  1L0E A;  4BQM A;  3Q7Z A; 
#chains in the Genus database with same CATH homology
 5AVE A;  3T4O A;  2WKP A;  4Y3I A;  4HHD A;  3UB6 A;  3OC2 A;  4P6Z S;  3LID A;  1OTD A;  3MXQ A;  4HP9 A;  3BQ8 A;  4WEJ A;  4GJ4 A;  3MMH A;  2EWV A;  2Z6C A;  3LI8 A;  1XJ3 A;  1XJ2 A;  4PAU A;  4HI4 A;  1XFN A;  2OAP 1;  3LIA A;  3MJQ A;  1IOU A;  3LIF A;  2ZMF A;  5TBM B;  4MN6 A;  3RH8 B;  2QKP A;  4DJ2 A;  4CQH A;  3TJZ C;  4XT2 A;  2W3D A;  2QYB A;  3F1O A;  3EGX C;  3KSG A;  4HY8 A;  4RQ9 A;  4DMZ A;  1H8M A;  3FG8 A;  3F1N A;  1T1A A;  4MN5 A;  5J3W A;  3VV4 A;  2G7U A;  4L0L A;  4F3L B;  4ETX A;  3BJN A;  3HJI A;  2M1C A;  3P01 A;  3OLO A;  4LLO B;  3IS2 B;  3PBT A;  3PYP A;  3G6O A;  1T18 A;  1F5M A;  4MN7 A;  3H82 B;  1OJ5 A;  2XA7 S;  4HNB A;  2OOL A;  4I3A A;  5IT5 A;  3D72 A;  4DJ3 A;  2M7U A;  3MFX A;  2HGV A;  3H7W A;  2INW A;  2PYR A;  4MDZ A;  1W63 M;  3C2W A;  4E04 A;  4IUK A;  2L1M A;  1JNU A;  2YKF A;  1DP9 A;  4NKP A;  3A0S A;  3LR0 A;  4HOI A;  2WKR A;  2PD7 A;  1OTB A;  1TD5 A;  1OTE A;  2I9V A;  2BAS A;  1P0Z A;  1S4S A;  5DJT A;  2Z6D A;  3CAX A;  4ME4 A;  3PR6 A;  1TS6 A;  1S67 L;  2KLI A;  3CUE C;  2J80 A;  5HWT A;  1T1C A;  1H3Q A;  5J4E A;  2L4R A;  3KSI A;  4NXG A;  2PHY A;  3S7Q A;  2GX5 A;  2V1B A;  1OPX A;  3TW8 A;  1Y28 A;  3T4J A;  3LYX A;  4OOL A;  3DBA A;  3E98 A;  2HJ9 C;  4H6J A;  2O9C A;  3PBN A;  3PHY A;  1UWP X;  3BY8 A;  5FL3 A;  1ODV A;  2HJE A;  3EEH A;  2ZBB A;  2JHE A;  1S66 L;  2VV8 A;  4P6Z M;  1OT9 A;  1NLY A;  3S7P A;  3R7W B;  3O5Y A;  2W3E A;  1OTI A;  2VLG A;  4HH2 A;  2K7S A;  2PD8 A;  3JVU A;  4HJ3 A;  3MF0 A;  2V0W A;  5KSH A;  5F69 A;  5HSQ A;  4BBT A;  3MQQ A;  4QPR A;  3A0V A;  5KIZ A;  1YKD A;  4AFI A;  1VHM A;  2VJW A;  2V0U A;  3BQA A;  1GSV A;  1V9Y A;  3B33 A;  2P08 A;  2IA2 A;  1LT0 A;  3F1O B;  2EA9 A;  4MMN A;  2EWW A;  3UE3 A;  3HCY A;  3NHQ A;  4GHI A;  3BW6 A;  3C8C A;  2WKQ A;  5HPI A;  4LRY C;  3IS2 A;  2P7J A;  2FH5 A;  2W3H A;  1NRJ A;  4XT2 B;  3KSH A;  4I38 A;  3IBR A;  4Q0I A;  1XJ4 A;  2O9A A;  3R4K A;  4EW7 A;  3T4S A;  2HV1 A;  1BYW A;  3F1N B;  1N9L A;  2PDR A;  4I3I A;  4B9O A;  1OJG A;  2V1A A;  2VZW A;  2XA7 M;  3S7N A;  2VGL M;  1TS0 A;  4HJ6 A;  4OOM A;  4CLC B;  5HZH A;  3LIB A;  3OOV A;  2J3T D;  2W27 A;  3NOP C;  2PT7 A;  4I5S A;  5AJG A;  4EER A;  2J3T C;  3KYQ A;  2K31 A;  3U2A A;  4EUV A;  2W1T A;  4EQ1 A;  2KX6 A;  4L9E A;  2JKT M;  1MZU A;  2A24 A;  2W3G A;  3PBQ A;  4GLQ A;  2K2N A;  1W63 Q;  1YAX A;  3FC7 A;  1N9N A;  3KO6 A;  3VE3 A;  4NEE D;  1EW0 A;  2PR5 A;  4R6L A;  3P7N A;  5DFY A;  2VA0 A;  4G3W A;  3PBO A;  4G3V A;  4NXF A;  1X0O A;  2L0W A;  2MJ6 A;  2VV6 A;  4GS9 A;  4ARZ A;  4MCW A;  2W3F A;  4GS9 B;  1ZTU A;  3OBF A;  4Q0J A;  1XJ6 A;  3UB9 A;  2Y8H A;  1S1Y A;  1TS7 A;  2VKS A;  5F6A A;  4BWI A;  4G3K A;  2VV7 A;  1TS8 A;  3E0Y A;  3B42 A;  3KX0 X;  2D01 A;  3F1P B;  4YNR A;  5HWV A;  2QWS A;  5LBR A;  4Z1W A;  2XRN A;  4EES A;  3K2N A;  5HDC A;  2R78 A;  5F68 A;  3W2Z A;  3F1P A;  4R3A A;  4NXB A;  5HDD A;  2LB5 A;  2ZOI A;  3CI6 A;  3T4K A;  4K08 A;  1S4R A;  3GEC A;  1YSQ A;  1UWN X;  2ZOH A;  2KOI A;  2QHK A;  2B02 A;  3D3O A;  4PHT A;  3NJA A;  3LI9 A;  3ULF A;  1D7E A;  4JGQ A;  3GDI A;  2O9B A;  3OCL A;  2ZMV A;  3CIT A;  3R7W A;  4GHI B;  1STZ A;  3TE8 A;  4II7 A;  4CLC D;  4HJ4 A;  4EEP A;  4EET B;  4R70 A;  4L9G A;  4CLC C;  3A0R A;  2QJ5 A;  4BBU A;  3EQV A;  5CX7 A;  5DKK A;  4WN5 A;  5HD3 A;  4UQI S;  1OTA A;  1F9I A;  4GCZ A;  2NUT C;  1DRM A;  1LSV A;  1XFQ A;  3RTY A;  2D02 A;  3KYZ A;  3H7W B;  4YWZ A;  1P9W A;  4CLC A;  4CLC E;  3LR5 A;  2DMW A;  2GZA A;  3LR4 A;  1G28 A;  4KQO A;  2VGL S;  3EQU A;  3H9W A;  2J3W A;  2FZ0 A;  2HF6 A;  4B93 A;  4EXO A;  5J7E A;  3PBS A;  1MKM A;  3NOT C;  3LIC A;  1N9O A;  3LR3 A;  2O0Y A;  4NXE A;  2A2L A;  2YKH A;  3CUE A;  4PKY A;  3VOL A;  3OCN A;  1LL8 A;  3EWK A;  2H28 A;  2OWH A;  2V9A A;  3FPW A;  4JGO A;  1S1Z A;  3C38 A;  4LRX C;  5HL6 A;  1GSW A;  2A24 B;  1YSP A;  1DP8 A;  2XSS A;  4Q0H A;  3UME A;  2B18 A;  3MQ0 A;  3S7O A;  5DJU A;  5I5L A;  4ARZ B;  1ZHH B;  2VX8 A;  4ZRR A;  4IUH A;  5G4Y A;  4YOF A;  3EGD C;  2CMN A;  2W1R A;  3T50 A;  4Y2F A;  3SW1 A;  2QJ7 A;  2JN7 A;  1P97 A;  3C30 A;  3MR0 A;  4O8G A;  2NUP C;  2PR6 A;  3LUQ A;  1T19 A;  1TF1 A;  4EU0 A;  5HDS A;  4DN0 A;  3RFB A;  5IS1 A;  1MC0 A;  5HD5 A;  2GNX A;  3B47 A;  4WLA A;  5TBM A;  5HPF A;  3T4L A;  3PXP A;  4WF0 A;  1D06 A;  4UEY A;  2Y79 A;  3K3C A;  1KOU A;  2M7V A;  3IBJ A;  4F3L A;  2OAQ 1;  3E4P A;  5AVF A;  5EFW A;  4FSF A;  4LRZ E;  1G6O A;  5DKL A;  5HWW A;  1IFQ A;  4IHQ A;  2OWJ A;  3BY9 A;  4HP4 A;  4WEL A;  5DFX A;  3ZQ5 A;  4R38 A;  1OT6 A;  1UGU A;  1WA9 A;  4HIA A;  3ZYT A;  5A8B A;  4WEK A;  4I3J A;  4O01 A;  5IU1 A;  4IJG A;  1F98 A;  2LB9 A;  1LSX A;  4HH3 A;  4UQI M;  3VE4 A;  2PYP A;  3K3D A;  1V9Z A;  3V67 A;  3UMD A;  4O0P A;  5F5Y A;  5MC7 A;  1GSX A;  4ETZ A;  3PBR A;  5DF9 A;  4JGP A;  1P9R A;  4WL9 A;  1DP6 A;  3BWL A;  3E4O A;  1T1B A;  5K5B A;  3H82 A;  5C5K A;  3CLO A;  2W0N A;  3T4Q A;  3UB7 A;  5L8M A;  4M4X A;  1NLZ A;  2GJ3 A;  3T4T A;  2XRO A;  4GW9 A;  3TRC A;  3JVV A;  4LPZ A;  3KSF A;  5TJJ A;  1NWZ A;  2W1T B;  4BMW A;  3FPV A;  2JKR I;  3MQO A;  3EEA A;  2P04 A;  4PKY G;  4BBV A;  4JGR A;  4KUO A;  3CWF A;  1VB6 A;  3LFV A;  3E4Q A;  3NOU C;  1LSW A;  4I39 A;  3LIE A;  4HQA A;  5G4Z A;  4KUK A;  4FOF A;  3UE6 A;  4L9F A;  3UB8 A;  3HJK A;  2JKR M;  2VEA A;  2KDK A;  4WUJ A;  2O99 A;  4KQD A;  3EOI A;  4BJP A;  4H6J B;  4EEU A;  3ICY A;  2JKT I;  4Y5F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...