1D7EA

Crystal structure of the p65 crystal form of photoactive yellow protein
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
122
structure length
119
Chain Sequence
VAFGSEDIENTLAKMDDGQLDGLAFGAIQLDGDGNILQYNAAEGDITGRDPKQVIGKNFFKDVAPCTDSPEFYGKFKEGVASGNLNTMFEYTFDYQMTPTKVKVHMKKALSYWVFVKRV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PHOTOACTIVE YELLOW PROTEIN
publication title Conformational substates in different crystal forms of the photoactive yellow protein--correlation with theoretical and experimental flexibility.
pubmed rcsb
source organism Halorhodospira halophila
molecule tags Photosynthesis
total genus 32
structure length 119
sequence length 122
ec nomenclature
pdb deposition date 1999-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00989 PAS PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 1d7eA00
3F1OB 2V0WA 1D06A 4HI4A 5F6AA 2OWJA 3E4QA 4I39A 1TS6A 4EXOA 4EEUA 3GECA 1NWZA 5TBMB 1OTEA 2PR5A 1LSVA 2I9VA 2V9AA 1P0ZA 3BY9A 1XJ2A 1OJGA 1OTDA 4DJ2A 2D01A 2W0NA 3H9WA 3NOTC 4HJ4A 1TS8A 3H7WA 1XJ4A 1LSXA 5HSQA 3LIEA 3ULFA 3LI8A 2M1CA 4BBTA 4WF0A 2Z6DA 3F1NB 4L9FA 4I38A 3IS2B 4EERA 4HQAA 4I5SA 4KUOA 1BYWA 3F1PA 1UGUA 3NOUC 2VV8A 4HY8A 3BY8A 5A8BA 3PYPA 4L9GA 1DRMA 2HV1A 1S1ZA 2J80A 2YKFA 2EA9A 5I5LA 4WN5A 1XJ3A 1V9YA 1Y28A 4HNBA 3ZQ5A 4YWZA 3CWFA 4H6JA 4EW7A 4XT2B 4NXEA 5DJUA 4JGOA 1G28A 1T19A 2PDRA 3MR0A 2WKQA 2H28A 4PKYA 3OLOA 4WLAA 3UB8A 3ICYA 3C8CA 5AVEA 5F69A 5HWTA 4BBVA 4HH3A 5KIZA 4MN6A 4F3LB 4WL9A 3H82A 4GHIB 5G4YA 4HJ6A 4GS9A 1P97A 5DKKA 2JHEA 3K3DA 5IU1A 2ZBBA 2V1AA 4EEPA 3SW1A 2QJ7A 3D72A 1JNUA 3VE3A 3MJQA 4LLOB 1S67L 1S66L 5HWVA 4I3JA 5HD3A 5F5YA 5DJTA 3P7NA 4HIAA 1N9NA 2PHYA 4GCZA 2JN7A 4L9EA 4KUKA 3H7WB 5HZHA 5DKLA 2PYRA 2WKPA 3A0RA 1XFNA 3EWKA 4JGQA 3MQOA 3UMDA 3MQQA 2VV6A 3F1PB 5G4ZA 3UE6A 2K7SA 1OTAA 2A24A 2PD7A 4DJ3A 4R38A 1OT6A 1X0OA 1VB6A 4H6JB 2KX6A 1LL8A 5HDSA 1OT9A 1DP8A 3E4PA 2R78A 1TS0A 3LUQA 4BBUA 4NXBA 1UWNX 4NXGA 1OTIA 3LIFA 1OJ5A 4I3AA 1T1BA 3FG8A 2D02A 3HJKA 1T1AA 3MFXA 2YKHA 1F9IA 3RTYA 2L4RA 3VE4A 2ZOIA 3H82B 2WKRA 5HDCA 3PHYA 3NOPC 4GS9B 2PD8A 4LPZA 5F68A 3LIDA 3A0VA 4HP4A 3GDIA 4LRXC 3HJIA 1N9OA 4HHDA 4LRYC 2Z6CA 3T50A 2L1MA 1DP6A 4GW9A 5J7EA 3UB9A 2L0WA 4EESA 3LICA 1GSWA 4I3IA 1UWPX 5HDDA 4LRZE 2P7JA 5IS1A 5EFWA 3B33A 3F1OA 2BASA 1GSVA 2QHKA 4KQDA 2QKPA 1LT0A 1OTBA 3K3CA 5TBMA 1V9ZA 1DP9A 1WA9A 5HWWA 3VOLA 1D7EA 4JGRA 2A24B 5J4EA 3LIAA 1TS7A 3UB6A 3NHQA 3C2WA 4HJ3A 2ZOHA 3UB7A 4EETB 3F1NA 2PR6A 3IS2A 4E04A 2VV7A 3MXQA 4R6LA 1XJ6A 3G6OA 4M4XA 1S1YA 3CAXA 3FC7A 5AVFA 2V1BA 3LYXA 1LSWA 1MZUA 2OWHA 1S4RA 1N9LA 2VEAA 3RH8B 2QJ5A 2B02A 5J3WA 3A0SA 4HH2A 1F98A 4WUJA 1ODVA 3EEHA 3E4OA 4B9OA 3LI9A 1KOUA 4HOIA 2W27A 1XFQA 3NJAA 4MN5A 2GJ3A 1GSXA 1T1CA 2INWA 4XT2A 3CLOA 3IBRA 2CMNA 1S4SA 2QWSA 2V0UA 3LIBA 4JGPA 2KDKA 4PKYG 2OOLA 2VLGA 2PYPA 1T18A 4F3LA 5HD5A 4GHIA 4R3AA 4K08A 1EW0A 3KX0X 4R70A 4EQ1A 4RQ9A 4HP9A 3UMEA 3BWLA 4NXFA
chains in the Genus database with same CATH superfamily
3F1OB 2WADA 1L0EA 3S7NA 1CI9A 5EVIA 3G4PA 4WZ5A 5TGFA 1OTEA 2V9AA 2I9VA 2WGWA 1P0ZA 1YMXA 4S2PA 3OPRA 3TW8A 5KSCA 3H9WA 4Y2FA 1PNEA 1YT4A 4G3VA 3O86A 2V8FA 5HPFA 3UDIA 2JKTM 4KQRA 1H0MA 1DJAA 5HAPA 4EERA 3Q81A 4HQAA 5FDHA 2CC1A 1G6OA 1BYWA 4NK3A 5L2FA 3BQAA 1PZOA 2VV8A 4KZAA 2RL3A 3G30A 4DN0A 1BTLA 4L9GA 1DRMA 3PBOA 5JYPA 3A3FA 2YKFA 4WZ5C 2Y79A 4ZDXA 1YMSA 2H0TA 1K56A 4B4ZA 3ZQ5A 4DDYA 1M40A 5F83A 1FOFA 3CWFA 4OOLA 2ZL1B 4NXEA 5DJUA 3OZHA 5TFQA 2H0YA 3LEZA 1GA0A 1KGFA 1M6KA 4GDNA 3WRZA 4CLCE 1IFQA 3GR2A 1GA9A 4UA7A 3UB8A 3IHBA 3C8CA 3D3OA 5AVEA 5F69A 5KIZA 4MN6A 1CJFA 3H82A 4GHIB 3CITA 1YLJA 4GS9A 5DKKA 3DTKA 4Y0OA 5FI7A 5FASA 2ZBBA 3IXBA 3EQUA 3SW1A 1OPXA 3TG9A 5F1FA 2Y2NA 4KG6A 1LI0A 4U0XA 2QJ7A 5AJGA 3D72A 1Y54A 2J3TD 4S2NA 2EXBA 2DCFA 2EFUA 5CHUA 4LLOB 2M7UA 1S67L 5HWVA 2IWDA 4EUZA 2GZAA 2ZMAA 1SCWA 2EWWA 1N9NA 3LCEA 2LB9A 2PHYA 2K31A 1K4EA 5EM0A 2XFSA 3ZVTA 3TJZC 1JWVA 2ZC7A 1TF1A 2C5WB 3EWKA 4B93A 2K7SA 5A91A 3UPNA 1P9WA 1NXYA 3HUNA 3RXXA 1YSPA 2W1TB 2XRNA 3C7VA 2V2FF 2EFXA 5DTKA 2PD7A 3IXHA 1MBLA 3KSHA 3IH8A 4KENB 4S2NC 2Z2MB 4BWIA 4DJ3A 3QP1A 5FA7A 1K57A 3S7QA 4X68A 5LBRA 2KX6A 3NC8A 3PBSA 2Q0OA 1DP8A 3MXRA 1TS0A 1K4FA 3LUQA 4BBUA 1S6RA 1PWDA 4E3JA 3HUOA 4NXGA 3IWQA 3LIFA 1W8YA 1OJ5A 4I3AA 1T1BA 1E25A 2W3EA 3GMWA 3T1QB 1SHVA 3KYEA 2LB5A 3GTCA 4E3IA 1SDEA 2HP5A 3DTEA 4OPRA 4HP4A 1PWCA 1IYPA 4HHDA 2EX9A 4Z9QA 3CPTA 3KSGA 3T50A 2L1MA 5GLCA 1K57C 1TD5A 2Y2GA 1MWSA 3G35A 3HLBA 3RJUA 1U60A 1F5MA 1IYOA 2JKGA 2H5SA 4JPMA 2OLVA 1GSWA 4LRZE 1YLYA 4L0LA 5CGXA 4Q8IA 2P7JA 3B33A 2XD5A 5CRFA 1CEFA 4G3WA 3AGFA 2W3FA 4EQIA 4QWOA 1LT0A 4QY6A 3K3CA 5E2EA 5GHXA 2JKRI 1E3UA 3ZG0A 4RX3A 3Q07A 2HP9A 2VJWA 3OPPA 4Y17A 1XA7A 1BSGA 1DY6A 4X69A 4XXRA 2PBYA 3O5YA 4HBUA 4RX2A 5FQMA 4QY5A 1ZTUA 3FZCA 1CI8A 3C2WA 3NHQA 3QP5A 2XDMA 4HJ3A 2OAQ1 4C6YA 2KOIA 2ZOHA 3BJNA 3IS2A 4KZ6A 1LLBA 5FQKA 2BLSA 4CLCD 2Z2LB 3G6OA 5IHVA 3IF5A 3EOIA 2XSSA 4IEDA 4FH4A 1S4RA 2IWBA 3TE8A 4N92A 2ZC6B 3CHWP 4M3KA 4NEED 3NCKA 4WUJA 1NRFA 4B9OA 3LR4A 5A92A 3HLWA 5E2GA 3N8RA 5M1AA 4RVAA 1XFQA 3SS4A 1YLWA 2GJ3A 3MF0A 3PBTA 2NUTC 1KDWA 2INWA 2ZQ7A 1DJCA 4DKIA 3PTEA 4X1MA 1Y4OA 2QWSA 1GCEA 3VP1A 3V3SA 5AQ9A 1FSWA 2H10A 4WBGA 1T18A 5DTSA 3IWOA 1IYSA 1NLZA 2QPNA 4IUHA 4R3BA 4F3LA 1A0KA 3LR5A 4K08A 2WKEA 4Z1WA 3UE0A 4LV3A 4EQ1A 4HP9A 1D06A 4XUZA 5E2HA 1QMEA 4NKPA 5HL6A 4KQOA 4ME4A 2ACGA 4EEUA 4GD8A 4MDZA 1NWZA 2P04A 1MY8A 3NDEA 3QP2A 2UV0E 4BJPA 3N7WA 3ZVWA 3B42A 2WK0A 4ZTKA 3DTIA 3BLSA 3DWKA 4DE1A 2W0NA 5DFYA 3SH7A 4GJ4A 3G34A 4EBPA 3DBAA 4CJNA 4X56A 5MC7A 5TR7A 5IT5A 1G68A 3HCYA 1LSXA 3LIEA 3ULFA 4S2KA 3IX3A 4X55A 3QP6A 4BBTA 4WF0A 1GHIA 2Z6DA 4L9FA 4I38A 4ARZB 4I5SA 4BMWA 4KUOA 1EWZA 3F1PA 2WAFA 1UGUA 2XA7M 1W8QA 4O8GA 4KZ3A 4HY8A 4ID4A 3BYDA 3Q7VB 5GLBA 2OV5A 3N4IA 2O0YA 2QYBA 4N1XA 4H8RA 2FH5A 2J80A 5KMWA 2EA9A 4E3MA 5I5LA 4WMCD 3CJMA 3ZCZA 1V9YA 5HARA 2P9VA 3E2LA 4WZ4A 2JC7A 4S2IA 5E43A 4C75A 4UQIM 4YWZA 4WYYA 4H6JA 3ZG7B 4EW7A 4XT2B 3VSLA 4WM9A 3WS4A 4MNRA 4UA6A 4JGOA 4K0WA 4MMNA 2JKRM 2DMWA 2PDRA 5M18A 1OMEA 4OONA 5FQIA 2Y2LA 4K91A 3SH9A 3OLOA 3ZFZA 4PHTA 3ZYTA 4UAAA 4BBVA 4OQIA 2V20A 4WL9A 4F94A 4OVDA 2JHEA 4E3KA 4JXGA 4GLQA 5CHJA 4QB8A 3VSKA 5K5BA 5F1GA 3C38A 5EVIB 1MC0A 4RYEA 3T4JA 3V5MA 3VE3A 1H8YA 1KDSA 2A2LA 2ZM2A 2HJEA 2XK1A 5HD3A 3FKVA 3P7NA 4R0QA 1E4DA 2DNSA 4L9EA 3CUEA 5DF9A 2PYRA 3N8LA 2WKPA 1ACFA 3PBRA 3A0RA 5HFOA 3UMDA 4GDBA 2Y2IA 3D4FA 4DF6A 5FEFA 1VHMA 3LGOA 4PM6A 3UE6A 4UEYA 2HF6A 5FI6A 1OTAA 2G7UA 1VETA 2E8JA 3GSGA 2A24A 4JF6A 1AWIA 5EVIC 3C4OA 4OKPA 5U47A 3UB5P 4BQMA 2VZWA 2NUPC 5L09A 4KZ8A 1OT6A 2A49A 4E3NA 2KLIA 1X0OA 4CQHA 5A90A 3IHAA 3IF6A 2VX8A 5G18A 4OLGA 5HDSA 3E4PA 3Q7ZA 1J9MA 4K0XA 3CUEC 2XROA 4NXBA 3CG5A 1L0GA 1ONGA 1OTIA 4DE0A 4D2OA 1SKFA 2XEPA 2JCHA 2J3WA 2ZC4B 3M6BA 2D02A 4YOFA 3HJKA 3MQ0A 3VMAA 1PIOA 2YKHA 2L4RA 3TRCA 2XH9A 3VE4A 4JXVA 2HZ5A 4OP5A 3DAVA 3P01A 2V1ZA 3H82B 1HD8A 4KG5A 4GS9B 1O7EA 5FSRA 4LPZA 2B95A 4U3TA 5F68A 4PM8A 3FWLA 4GN2A 4LRXC 1ES3A 2O9BA 1XGJA 1YLPA 3HJIA 3A3JA 1TDGA 5GHZA 3UNWA 3PAGA 3M2JA 3SS3A 4BL2A 1MWTA 2BTFP 1NY0A 3IF6C 4FUWA 4EU0A 4E6XA 3MKFA 1FCNA 4EESA 3LICA 1XKZA 2IA2A 4LV0A 3SOIA 3NI9A 1UWPX 2B5RA 5CX7A 4MN7A 1L2SA 3HL9A 4DE2A 5IS1A 2A3UA 3ZNTA 1HLUP 2BASA 1GSVA 4KQDA 2M7VA 4E3OA 2W1RA 2Y59A 5TBMA 1RP5A 1DP9A 1WA9A 3PAEA 3MFDA 1QMFA 3ISGA 1ES2A 2Q9MA 4OP8A 5J4EA 3FPVA 1TS7A 2J7VA 3BFCA 4OOYA 2JBFA 5HAIA 1PWGA 3MBZA 2ZMFA 4Q0HA 4EETB 3F1NA 4S2OA 2XQZA 2VV7A 4JBFA 4R6LA 3WS0A 4II7A 4M4XA 1K25A 4LGWA 3C7UA 3UPOA 4HBTA 1MZUA 2ZM8A 2WGVA 3T4LA 3AGDA 3VP2A 2ZQ8A 4HH2A 2PU2A 3IBJA 1K6SA 3EEHA 3CMZA 1PYYA 3E0YA 1MPLA 3LI9A 4HOIA 1KGGA 2W27A 3NJAA 1GSXA 4HESA 1XXMA 1ZG4A 4N9KA 5FAQA 2W3HA 1I5QA 3CPTB 2HDRA 4PMAA 3GRJA 3EQVA 3LIBA 4B88A 4PKYG 1W7FA 3BECA 3NECA 5FL3A 2VLGA 2PYPA 3KSIA 4QU3A 3BM6A 4WEKA 1EW0A 4EUVA 4R70A 1YLZA 4GNUA 3V67A 4EBNA 2IWCA 2V0WA 4HI4A 3M6HA 3QP4A 4CPKA 1YKDA 4JF4A 2VGLS 5F6AA 3E4QA 1TS6A 4EXOA 3SZTA 4JXSA 3VFFA 3MZFA 3GVBA 4PM5A 2PR5A 1LSVA 5HAQA 4BD1A 4BD0A 1BUEA 2HDSA 1OTDA 2XFTA 3QP8A 3VFHA 4PPRA 3R7WA 1I2SA 3VV4A 3S4XA 5A93A 4QJGA 1AXBA 2MJ6A 5L8MA 1TS8A 3H7WA 1XJ4A 5L10A 5HSQA 3N6IA 4OPZA 1MXOA 3A3IA 4KZ5A 5C5KA 3T1SA 2X02A 3IS2B 2EX2A 2E8IA 5D3OA 4X1LA 3UPPA 4MBHA 1NJ4A 3T4SA 2XA7S 3BY8A 3O87A 5A8BA 4PAUA 2ZLYA 4Q0IA 1Q2QA 1ZKJA 1DJBA 3DTMA 5DF7A 1HZOA 2VGKA 1XJ3A 3FV7A 1Y28A 1W79A 4NETA 1SKOA 1XGIA 3IXGA 2Y2KA 3MZEA 4XUXA 1BT5A 2ZQDA 4R23A 3BFGA 1SZVA 5DF8A 1G6AA 1G28A 1LHYA 3G2YA 3MR0A 1KE3A 3T4KA 3BFFA 3MZDA 2H28A 1KVMA 1K0KA 2V8CA 2Y2HA 1Z09A 4JLFA 5HWTA 4F3LB 5F82A 4ZJ2A 1S0WA 5G4YA 5CEDA 4OLDA 1P97A 4ZRRA 3K3DA 5J8XA 5IU1A 4P87A 2V1AA 4GKUA 5FAOA 4O0PA 2EWVA 3AGEA 3PBQA 2R9WA 5EOOA 4CLCA 3DWZA 1ALQA 3K2NA 4YINA 4ZBEA 1KGEA 3S22A 3U2AA 1JNUA 2GX5A 1VM1A 2WGIA 2X01A 5CXWA 4LCLA 4I3JA 1VEUA 5EV0A 3JVUA 5F5YA 3S1YA 1W5DA 2HPBA 4DRTA 3CZDA 4O7DA 1FCOA 4P6BA 1K6RA 4S2LA 5HX9A 5HZHA 1O07A 3BQ8A 4WEJA 3T12B 3MMHA 3D9YA 4UHUA 4JGQA 3MQOA 3B3XA 1ZHHB 2VV6A 3MQQA 1IOUA 1EI5A 3F1PB 5AQ7A 5G4ZA 2VA0A 3MKEA 4P6ZM 1TVFA 1LL5A 1PZPA 3IT9A 4E6WA 1BLSA 1WE4A 3OOVA 4OQ0A 5GL9A 3KYZA 1ESUA 1W63Q 3LFVA 2P9VB 4R38A 3HLEA 2OAP1 3BLMA 4R1GA 3WRTA 5CHMA 5EVID 4R3JA 4H6JB 3CI6A 3HLFA 3IH9A 1JTDA 4G3KA 5EE8A 2ZM0A 1IKIA 4YFMA 3E2KA 1HTZA 1LI9A 5TJJA 1NLYA 3MFXA 1F9IA 3RTYA 3NY4A 2ZOIA 3S7OA 3G2ZA 2XGNA 3ZHHA 3NOPC 4EWFA 2EX8A 3A0VA 3LIDA 4ZJ3A 4KZ7A 4ETZA 1GHPA 4ZJ1A 3GDIA 3NBLA 4X6TA 5CGSA 1BLHA 1YPRA 4LRYC 1MKIA 2Z6CA 3JYIA 5FQJA 4PM9A 2XD1A 4NG2A 2JE5A 5GLAA 1XX2A 4GW9A 3RXWA 2EXAA 3IX8A 4OOMA 1PW8A 2WGWB 3UB9A 2L0WA 4U0TA 1KE4A 1K56D 4FOFA 1TEMA 5HDDA 4LCMA 2J9OA 1K54A 3JVVA 2WZZA 2G2WA 3ZG5A 1STZA 5EFWA 1KE0A 1BLCA 3F1OA 1FR6A 2HP6A 2QHKA 3QHYA 4BLMA 5HPIA 1NZOA 2QKPA 1OTBA 3UO9A 4UA9A 3W4OA 1C3BA 2P74A 3NIAA 5HWWA 2O9AA 3Q1FA 4FTXA 1VETB 1D7EA 1KVLA 4JGRA 2Y4AA 4ETXA 3LR0A 2A24B 2Q9NA 5M19A 3ITBA 3UB6A 4Y15A 1XP4A 5FATA 1N4OA 5AQBA 3UB7A 3LR3A 5FQ9A 1NYYA 4LENA 2PR6A 3W4PA 1YAXA 4KQQA 3IF6B 3MXQA 1K54C 1W63M 3CAXA 3FC7A 5AVFA 3LYXA 4C3QA 3O88A 4LFUA 4ZAMA 2OWHA 3IXDA 3FYZA 3RH8B 2QJ5A 2Y2OA 2B02A 5J3WA 4B4XA 3SS5A 2Y55A 3A0SA 1XPBA 1F98A 3VOZA 1ERQA 3KSFA 3UE3A 1KOUA 3LEQA 5CTMA 4OQHA 3HVFA 4MLLA 1D1JA 4MN5A 4JXWA 5DFXA 1T1CA 2ZL1A 3DW0A 4OPQA 3GV9A 3OCNA 1S4SA 1RGYA 2V0UA 1G5UA 5CECA 1YQSA 3VP4A 2Y2MA 4OPYA 1YM1A 3C4PA 2K2NA 2OOLA 3MS6A 1HVBA 4EV4A 1BLPA 5HD5A 4GHIA 4R3AA 3EEAA 4Y13A 2Y2QA 3KX0X 3IQAA 3UMEA 1NRJA 2P08A 2GNXA 3O3VA 1ERMA 3BWLA 3T1XA 4NXFA 3HLCA 4IJGA 3TSGA 2OWJA 4I39A 1J3WA 4P85A 1YSQA 1PRQA 3N8SA 3GECA 4GD6A 5TBMB 3E98A 2C6WB 3BY9A 2PAVP 3JPUA 1XJ2A 1OJGA 2J9PA 3EGXC 3V3RA 3BRMA 4GOGA 1K55A 4DJ2A 1JVJA 2QZ6A 5DTTA 2D01A 1P9RA 3LY3A 3NOTC 4HJ4A 4X25A 2XR0A 5GLDA 1Z6FA 1FIKA 3IWIA 5KSHA 4Y0UA 4WELA 3LI8A 2M1CA 1F2KA 1MWUA 1IEMA 1FSYA 3F1NB 4O01A 2QMIA 1L0DA 3NOUC 2UWXA 2ZQCA 5HL1A 3ZGAB 3PYPA 2W1TA 3V50A 3ZG8B 3ITAA 3OC2A 3VOYA 1EROA 3P98A 3OBFA 4MCWA 1K38A 2HV1A 1CF0A 1S1ZA 5DVAA 3NDGA 4OQGA 1LL9A 4WN5A 5GHYA 1CEGA 4A5RA 4HNBA 1ESIA 2OSUA 1Q2PA 1K55C 1CK3A 3A3DA 4DXCA 2VK3A 3HBRA 1T19A 1E3UD 3LO7A 3UN7A 4BENA 3OPLA 4PM7A 3W8KA 2WKQA 1ES5A 4MBFA 2O99A 4PKYA 4E3LA 4WLAA 3L9KA 3T4OA 3UY6A 3ICYA 1SDNA 1ONHA 4HH3A 4HJ6A 1FCMA 1L0FA 5FDSA 2PU4A 3WS2A 2Y2PA 4HEFA 4ESPA 2WAEA 2J3TC 4EEPA 1GHMA 3UDXA 2ZC5B 3A3EA 1RCJA 3UDFA 3BW6A 1ES4A 1I2WA 2O9CA 4JF5A 1JWPA 4P0MA 4R4SA 4S2JA 4QD4A 3BEBA 3MJQA 1H8MA 4RA7A 1S66L 5FAPA 3MSHA 5DJTA 4IHQA 3R7WB 4HIAA 2WZXA 3SH8A 4GCZA 2JN7A 2X71A 4KUKA 3H7WB 1XA1A 4IUKA 5DKLA 4D60A 3KO6A 4IVIA 5JYOA 4LV2A 3T4TA 2FFYA 1XFNA 4FD8A 2Y91A 5EECA 2W3GA 3ZG9B 2WUQA 4KZ4A 5FQQA 3Q82A 3G32A 4QHCA 3R4KA 5CERA 4P6ZS 3UE1A 2FFFB 4DDSA 1JTGA 3BFDA 1IYQA 4X53A 3FKWA 2ZD8A 1PFLA 2G2UA 3BFEA 4Q0JA 1SKOB 4FH2A 3C5AA 2DRWA 3IX4A 3ZDJA 1VB6A 3LY4A 1LL8A 5FI2A 1OT9A 5I94A 2R78A 4UQIS 3RFBA 1UWNX 1L3LA 3P09A 3W2ZA 1NYMA 5E2FA 3FG8A 1T1AA 4FSFA 3VP3A 3EGDC 2AVXA 4FCFA 3I7JA 2J8YA 2Y2JA 2ZJ9A 1H5XA 3S7PA 2WKRA 5HDCA 3PHYA 4KZBA 4OH0A 3G31A 2PD8A 3C30A 3T1RA 1PW1A 5FEGA 2JKTI 2HGVA 1N9OA 3PR6A 4GB7A 2HDQA 4CLCB 2ZQAA 2XF3A 5HW3A 1DP6A 5EOEA 5CGWA 2WKHA 4R4RA 3OPHA 2Y8HA 5J7EA 1MKMA 3PBNA 1VEUB 2B18A 3WS1A 3HREA 4I3IA 1FQGA 3HLDA 3MXSA 4S2MA 2VGLM 1IKGA 1YLTA 5AQAA 4Y0TA 1H8ZA 2PT7A 1JWZA 3ZNYA 4N9LA 1TDLA 2RCXA 5EM1A 2XLNA 3W4QA 1V9ZA 2FZ0A 4Y5FA 4AFIA 4MEZA 4N1HA 1BULA 1PI4A 5BOHA 4DXBA 2PRFA 3VOLA 4IBXA 4Y7PA 4YNRA 3LIAA 3NULA 5KZHA 2ZC3B 4MBKA 4CLCC 3HUMA 4DE3A 3OCLA 2ZMVA 2HJ9C 1RGZA 3FPWA 2VGJA 5EPHA 4BL3A 2R9XA 2OLUA 4ARZA 1NZUA 4E04A 4Y3IA 2GDNA 3KYQA 1XJ6A 3U4LP 1S1YA 2V1BA 4GZBA 4KZ9A 1LSWA 3GQZA 3QNBA 3HLGA 4KG2A 4IVKA 1N9LA 3Q7VA 2VEAA 1CQAA 1PI5A 1BZAA 2EX6A 1ODVA 2VKSA 2PBDP 4EBLA 3E4OA 2I72A 1WYCA 2W3DA 5EVEA 1VQQA 4XT2A 2JKFA 1MWRA 2WYXA 3WS5A 4DMZA 2WKIA 3CLOA 2ZQ9A 3PXPA 5EUAA 5CEBA 5CTNA 1ZG6A 3IBRA 3TOIA 2CMNA 4LV1A 3V39A 3B47A 1H3QA 3QNCA 3M2KA 4JGPA 2HDUA 2KDKA 1FR1A 1WYBA 1ZC2A 3WWXA 1FILA 4JKTA 1N9BA 4QPRA 4IBRA 3L7HA 1IELA 4RQ9A 5L07A 3T4QA 5EVLA 4WMCA 3VP0A 2BG1A
chains in the Genus database with same CATH topology
3F1OB 4IJGA 2V0WA 1D06A 4HI4A 1YKDA 4NKPA 2VGLS 5F6AA 2OWJA 3E4QA 4I39A 5HL6A 3S7NA 1TS6A 4EXOA 1YSQA 4KQOA 4ME4A 4EEUA 4MDZA 3GECA 1NWZA 2P04A 5TBMB 1OTEA 2PR5A 1LSVA 2I9VA 2V9AA 1P0ZA 3E98A 4BJPA 3BY9A 1XJ2A 1OJGA 1OTDA 3EGXC 3B42A 4DJ2A 3R7WA 2D01A 3VV4A 2W0NA 3TW8A 5DFYA 4GJ4A 3H9WA 1P9RA 4Y2FA 3DBAA 3NOTC 2MJ6A 4HJ4A 5L8MA 4G3VA 1TS8A 3H7WA 5MC7A 1XJ4A 5HPFA 5IT5A 3HCYA 1LSXA 5HSQA 2JKTM 3LIEA 3ULFA 5KSHA 4WELA 3LI8A 2M1CA 4BBTA 5C5KA 4WF0A 2Z6DA 3F1NB 4L9FA 4I38A 4O01A 3IS2B 4ARZB 4EERA 4HQAA 4I5SA 4BMWA 4KUOA 1G6OA 1BYWA 3BQAA 3F1PA 1UGUA 3NOUC 2XA7M 3T4SA 4O8GA 2VV8A 2XA7S 4HY8A 3BY8A 5A8BA 3PYPA 4PAUA 2W1TA 4Q0IA 3OC2A 4DN0A 4L9GA 2O0YA 3OBFA 4MCWA 1DRMA 2HV1A 2QYBA 3PBOA 2FH5A 1S1ZA 2J80A 2YKFA 2EA9A 5I5LA 2Y79A 4WN5A 1XJ3A 1V9YA 1Y28A 4HNBA 3ZQ5A 4UQIM 4YWZA 3CWFA 4H6JA 4OOLA 4EW7A 4XT2B 4NXEA 5DJUA 4JGOA 4MMNA 1G28A 2JKRM 1T19A 2DMWA 2PDRA 3MR0A 3T4KA 2WKQA 4CLCE 1IFQA 2H28A 2O99A 4PKYA 3OLOA 4WLAA 4PHTA 3T4OA 3ZYTA 3UB8A 3ICYA 3C8CA 3D3OA 5AVEA 5F69A 5HWTA 4BBVA 4HH3A 5KIZA 4MN6A 4F3LB 4WL9A 3H82A 4GHIB 5G4YA 3CITA 4HJ6A 4GS9A 1P97A 5DKKA 2JHEA 4ZRRA 3K3DA 5IU1A 4GLQA 2ZBBA 2V1AA 2J3TC 3EQUA 4EEPA 3SW1A 5K5BA 1OPXA 4O0PA 2EWVA 3PBQA 3C38A 1MC0A 4CLCA 3BW6A 2QJ7A 3T4JA 5AJGA 3K2NA 3D72A 2O9CA 2J3TD 3U2AA 1JNUA 3VE3A 2A2LA 3MJQA 2GX5A 4LLOB 2HJEA 1H8MA 1S67L 1S66L 2M7UA 5HWVA 4I3JA 5HD3A 3JVUA 5F5YA 5DJTA 4IHQA 2GZAA 3P7NA 2EWWA 3R7WB 4HIAA 1N9NA 2LB9A 2PHYA 4GCZA 2JN7A 2K31A 4L9EA 4KUKA 3CUEA 3H7WB 4IUKA 5DF9A 5HZHA 5DKLA 3TJZC 3KO6A 2PYRA 3BQ8A 2WKPA 3PBRA 3A0RA 4WEJA 3T4TA 1TF1A 1XFNA 3MMHA 2W3GA 3EWKA 4JGQA 3MQOA 3UMDA 1ZHHB 2VV6A 3MQQA 1IOUA 3F1PB 1VHMA 4B93A 5G4ZA 3UE6A 2K7SA 2VA0A 4UEYA 1P9WA 2HF6A 3R4KA 4P6ZM 1OTAA 2G7UA 1YSPA 2W1TB 4P6ZS 2XRNA 3OOVA 2A24A 2PD7A 3KYZA 3KSHA 1W63Q 3LFVA 2VZWA 4BWIA 4DJ3A 2NUPC 4R38A 1OT6A 4Q0JA 3S7QA 2OAP1 2KLIA 1X0OA 4CQHA 1VB6A 4H6JB 2KX6A 1LL8A 2VX8A 5LBRA 3PBSA 5HDSA 1OT9A 1DP8A 3E4PA 2R78A 1TS0A 3CI6A 3LUQA 4UQIS 3RFBA 3CUEC 4BBUA 2XROA 4G3KA 4NXBA 1UWNX 4NXGA 3W2ZA 1OTIA 3LIFA 1OJ5A 2J3WA 4I3AA 1T1BA 3FG8A 2D02A 4YOFA 3HJKA 1T1AA 4FSFA 5TJJA 3MQ0A 1NLYA 3EGDC 3MFXA 2YKHA 2W3EA 1F9IA 3RTYA 2L4RA 3TRCA 3VE4A 2ZOIA 3S7OA 3P01A 3H82B 3S7PA 2LB5A 2WKRA 5HDCA 3PHYA 3NOPC 4GS9B 2PD8A 4LPZA 3C30A 5F68A 3LIDA 3A0VA 4HP4A 4ETZA 2JKTI 3GDIA 4LRXC 2O9BA 3HJIA 2HGVA 1N9OA 4HHDA 3PR6A 3KSGA 4LRYC 2Z6CA 3T50A 2L1MA 4CLCB 1TD5A 1DP6A 4GW9A 4EU0A 1F5MA 2Y8HA 4OOMA 5J7EA 1MKMA 3PBNA 3UB9A 2L0WA 2B18A 4EESA 3LICA 2IA2A 1GSWA 4I3IA 4FOFA 1UWPX 5HDDA 4LRZE 3JVVA 2VGLM 4L0LA 5CX7A 4MN7A 2P7JA 5IS1A 1STZA 5EFWA 3B33A 3F1OA 2PT7A 4G3WA 2BASA 2W3FA 1GSVA 2QHKA 4KQDA 2M7VA 5HPIA 2QKPA 1LT0A 1OTBA 3K3CA 2W1RA 5TBMA 1V9ZA 2FZ0A 4Y5FA 4AFIA 2JKRI 1DP9A 1WA9A 5HWWA 2VJWA 2O9AA 3O5YA 3VOLA 1D7EA 4JGRA 4ETXA 3LR0A 2A24B 4YNRA 5J4EA 3LIAA 3FPVA 1ZTUA 1TS7A 3UB6A 4CLCC 3NHQA 3C2WA 3OCLA 2ZMVA 2HJ9C 4HJ3A 3FPWA 2OAQ1 2KOIA 2ZOHA 2ZMFA 3LR3A 4Q0HA 3UB7A 3BJNA 3F1NA 4EETB 2PR6A 4ARZA 3IS2A 1YAXA 4E04A 4Y3IA 2VV7A 4CLCD 3MXQA 3KYQA 4R6LA 1XJ6A 3G6OA 1W63M 4II7A 4M4XA 1S1YA 3CAXA 3FC7A 5AVFA 2V1BA 3LYXA 1LSWA 3EOIA 2XSSA 1MZUA 2OWHA 1S4RA 3T4LA 3TE8A 1N9LA 2VEAA 3RH8B 2QJ5A 4NEED 2B02A 5J3WA 3A0SA 4HH2A 1F98A 3IBJA 4WUJA 1ODVA 2VKSA 3EEHA 3E4OA 4B9OA 2W3DA 3LR4A 3E0YA 3KSFA 3UE3A 3LI9A 1KOUA 4HOIA 2W27A 1XFQA 3NJAA 4MN5A 2GJ3A 1GSXA 3MF0A 1T1CA 2NUTC 2INWA 3PBTA 5DFXA 4XT2A 4DMZA 3CLOA 3PXPA 2W3HA 3IBRA 2CMNA 3OCNA 1S4SA 2QWSA 3B47A 2V0UA 3EQVA 1H3QA 3LIBA 4JGPA 2KDKA 4PKYG 2K2NA 2OOLA 5FL3A 2VLGA 2PYPA 1T18A 3KSIA 1NLZA 4IUHA 4QPRA 4F3LA 5HD5A 3LR5A 4GHIA 4R3AA 4WEKA 3EEAA 4K08A 1EW0A 4EUVA 4Z1WA 3KX0X 4R70A 4EQ1A 4RQ9A 4HP9A 3UMEA 1NRJA 2P08A 3T4QA 2GNXA 3V67A 3BWLA 4NXFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3F1O B;  2V0W A;  1D06 A;  4HI4 A;  5F6A A;  2OWJ A;  3E4Q A;  4I39 A;  1TS6 A;  4EXO A;  4EEU A;  3GEC A;  1NWZ A;  5TBM B;  1OTE A;  2PR5 A;  1LSV A;  2I9V A;  2V9A A;  1P0Z A;  3BY9 A;  1XJ2 A;  1OJG A;  1OTD A;  4DJ2 A;  2D01 A;  2W0N A;  3H9W A;  3NOT C;  4HJ4 A;  1TS8 A;  3H7W A;  1XJ4 A;  1LSX A;  5HSQ A;  3LIE A;  3ULF A;  3LI8 A;  2M1C A;  4BBT A;  4WF0 A;  2Z6D A;  3F1N B;  4L9F A;  4I38 A;  3IS2 B;  4EER A;  4HQA A;  4I5S A;  4KUO A;  1BYW A;  3F1P A;  1UGU A;  3NOU C;  2VV8 A;  4HY8 A;  3BY8 A;  5A8B A;  3PYP A;  4L9G A;  1DRM A;  2HV1 A;  1S1Z A;  2J80 A;  2YKF A;  2EA9 A;  5I5L A;  4WN5 A;  1XJ3 A;  1V9Y A;  1Y28 A;  4HNB A;  3ZQ5 A;  4YWZ A;  3CWF A;  4H6J A;  4EW7 A;  4XT2 B;  4NXE A;  5DJU A;  4JGO A;  1G28 A;  1T19 A;  2PDR A;  3MR0 A;  2WKQ A;  2H28 A;  4PKY A;  3OLO A;  4WLA A;  3UB8 A;  3ICY A;  3C8C A;  5AVE A;  5F69 A;  5HWT A;  4BBV A;  4HH3 A;  5KIZ A;  4MN6 A;  4F3L B;  4WL9 A;  3H82 A;  4GHI B;  5G4Y A;  4HJ6 A;  4GS9 A;  1P97 A;  5DKK A;  2JHE A;  3K3D A;  5IU1 A;  2ZBB A;  2V1A A;  4EEP A;  3SW1 A;  2QJ7 A;  3D72 A;  1JNU A;  3VE3 A;  3MJQ A;  4LLO B;  1S67 L;  1S66 L;  5HWV A;  4I3J A;  5HD3 A;  5F5Y A;  5DJT A;  3P7N A;  4HIA A;  1N9N A;  2PHY A;  4GCZ A;  2JN7 A;  4L9E A;  4KUK A;  3H7W B;  5HZH A;  5DKL A;  2PYR A;  2WKP A;  3A0R A;  1XFN A;  3EWK A;  4JGQ A;  3MQO A;  3UMD A;  3MQQ A;  2VV6 A;  3F1P B;  5G4Z A;  3UE6 A;  2K7S A;  1OTA A;  2A24 A;  2PD7 A;  4DJ3 A;  4R38 A;  1OT6 A;  1X0O A;  1VB6 A;  4H6J B;  2KX6 A;  1LL8 A;  5HDS A;  1OT9 A;  1DP8 A;  3E4P A;  2R78 A;  1TS0 A;  3LUQ A;  4BBU A;  4NXB A;  1UWN X;  4NXG A;  1OTI A;  3LIF A;  1OJ5 A;  4I3A A;  1T1B A;  3FG8 A;  2D02 A;  3HJK A;  1T1A A;  3MFX A;  2YKH A;  1F9I A;  3RTY A;  2L4R A;  3VE4 A;  2ZOI A;  3H82 B;  2WKR A;  5HDC A;  3PHY A;  3NOP C;  4GS9 B;  2PD8 A;  4LPZ A;  5F68 A;  3LID A;  3A0V A;  4HP4 A;  3GDI A;  4LRX C;  3HJI A;  1N9O A;  4HHD A;  4LRY C;  2Z6C A;  3T50 A;  2L1M A;  1DP6 A;  4GW9 A;  5J7E A;  3UB9 A;  2L0W A;  4EES A;  3LIC A;  1GSW A;  4I3I A;  1UWP X;  5HDD A;  4LRZ E;  2P7J A;  5IS1 A;  5EFW A;  3B33 A;  3F1O A;  2BAS A;  1GSV A;  2QHK A;  4KQD A;  2QKP A;  1LT0 A;  1OTB A;  3K3C A;  5TBM A;  1V9Z A;  1DP9 A;  1WA9 A;  5HWW A;  3VOL A;  1D7E A;  4JGR A;  2A24 B;  5J4E A;  3LIA A;  1TS7 A;  3UB6 A;  3NHQ A;  3C2W A;  4HJ3 A;  2ZOH A;  3UB7 A;  4EET B;  3F1N A;  2PR6 A;  3IS2 A;  4E04 A;  2VV7 A;  3MXQ A;  4R6L A;  1XJ6 A;  3G6O A;  4M4X A;  1S1Y A;  3CAX A;  3FC7 A;  5AVF A;  2V1B A;  3LYX A;  1LSW A;  1MZU A;  2OWH A;  1S4R A;  1N9L A;  2VEA A;  3RH8 B;  2QJ5 A;  2B02 A;  5J3W A;  3A0S A;  4HH2 A;  1F98 A;  4WUJ A;  1ODV A;  3EEH A;  3E4O A;  4B9O A;  3LI9 A;  1KOU A;  4HOI A;  2W27 A;  1XFQ A;  3NJA A;  4MN5 A;  2GJ3 A;  1GSX A;  1T1C A;  2INW A;  4XT2 A;  3CLO A;  3IBR A;  2CMN A;  1S4S A;  2QWS A;  2V0U A;  3LIB A;  4JGP A;  2KDK A;  4PKY G;  2OOL A;  2VLG A;  2PYP A;  1T18 A;  4F3L A;  5HD5 A;  4GHI A;  4R3A A;  4K08 A;  1EW0 A;  3KX0 X;  4R70 A;  4EQ1 A;  4RQ9 A;  4HP9 A;  3UME A;  3BWL A;  4NXF A; 
#chains in the Genus database with same CATH topology
 3F1O B;  2WAD A;  1L0E A;  3S7N A;  1CI9 A;  5EVI A;  3G4P A;  4WZ5 A;  5TGF A;  1OTE A;  2V9A A;  2I9V A;  2WGW A;  1P0Z A;  1YMX A;  4S2P A;  3OPR A;  3TW8 A;  5KSC A;  3H9W A;  4Y2F A;  1PNE A;  1YT4 A;  4G3V A;  3O86 A;  2V8F A;  5HPF A;  3UDI A;  2JKT M;  4KQR A;  1H0M A;  1DJA A;  5HAP A;  4EER A;  3Q81 A;  4HQA A;  5FDH A;  2CC1 A;  1G6O A;  1BYW A;  4NK3 A;  5L2F A;  3BQA A;  1PZO A;  2VV8 A;  4KZA A;  2RL3 A;  3G30 A;  4DN0 A;  1BTL A;  4L9G A;  1DRM A;  3PBO A;  5JYP A;  3A3F A;  2YKF A;  4WZ5 C;  2Y79 A;  4ZDX A;  1YMS A;  2H0T A;  1K56 A;  4B4Z A;  3ZQ5 A;  4DDY A;  1M40 A;  5F83 A;  1FOF A;  3CWF A;  4OOL A;  2ZL1 B;  4NXE A;  5DJU A;  3OZH A;  5TFQ A;  2H0Y A;  3LEZ A;  1GA0 A;  1KGF A;  1M6K A;  4GDN A;  3WRZ A;  4CLC E;  1IFQ A;  3GR2 A;  1GA9 A;  4UA7 A;  3UB8 A;  3IHB A;  3C8C A;  3D3O A;  5AVE A;  5F69 A;  5KIZ A;  4MN6 A;  1CJF A;  3H82 A;  4GHI B;  3CIT A;  1YLJ A;  4GS9 A;  5DKK A;  3DTK A;  4Y0O A;  5FI7 A;  5FAS A;  2ZBB A;  3IXB A;  3EQU A;  3SW1 A;  1OPX A;  3TG9 A;  5F1F A;  2Y2N A;  4KG6 A;  1LI0 A;  4U0X A;  2QJ7 A;  5AJG A;  3D72 A;  1Y54 A;  2J3T D;  4S2N A;  2EXB A;  2DCF A;  2EFU A;  5CHU A;  4LLO B;  2M7U A;  1S67 L;  5HWV A;  2IWD A;  4EUZ A;  2GZA A;  2ZMA A;  1SCW A;  2EWW A;  1N9N A;  3LCE A;  2LB9 A;  2PHY A;  2K31 A;  1K4E A;  5EM0 A;  2XFS A;  3ZVT A;  3TJZ C;  1JWV A;  2ZC7 A;  1TF1 A;  2C5W B;  3EWK A;  4B93 A;  2K7S A;  5A91 A;  3UPN A;  1P9W A;  1NXY A;  3HUN A;  3RXX A;  1YSP A;  2W1T B;  2XRN A;  3C7V A;  2V2F F;  2EFX A;  5DTK A;  2PD7 A;  3IXH A;  1MBL A;  3KSH A;  3IH8 A;  4KEN B;  4S2N C;  2Z2M B;  4BWI A;  4DJ3 A;  3QP1 A;  5FA7 A;  1K57 A;  3S7Q A;  4X68 A;  5LBR A;  2KX6 A;  3NC8 A;  3PBS A;  2Q0O A;  1DP8 A;  3MXR A;  1TS0 A;  1K4F A;  3LUQ A;  4BBU A;  1S6R A;  1PWD A;  4E3J A;  3HUO A;  4NXG A;  3IWQ A;  3LIF A;  1W8Y A;  1OJ5 A;  4I3A A;  1T1B A;  1E25 A;  2W3E A;  3GMW A;  3T1Q B;  1SHV A;  3KYE A;  2LB5 A;  3GTC A;  4E3I A;  1SDE A;  2HP5 A;  3DTE A;  4OPR A;  4HP4 A;  1PWC A;  1IYP A;  4HHD A;  2EX9 A;  4Z9Q A;  3CPT A;  3KSG A;  3T50 A;  2L1M A;  5GLC A;  1K57 C;  1TD5 A;  2Y2G A;  1MWS A;  3G35 A;  3HLB A;  3RJU A;  1U60 A;  1F5M A;  1IYO A;  2JKG A;  2H5S A;  4JPM A;  2OLV A;  1GSW A;  4LRZ E;  1YLY A;  4L0L A;  5CGX A;  4Q8I A;  2P7J A;  3B33 A;  2XD5 A;  5CRF A;  1CEF A;  4G3W A;  3AGF A;  2W3F A;  4EQI A;  4QWO A;  1LT0 A;  4QY6 A;  3K3C A;  5E2E A;  5GHX A;  2JKR I;  1E3U A;  3ZG0 A;  4RX3 A;  3Q07 A;  2HP9 A;  2VJW A;  3OPP A;  4Y17 A;  1XA7 A;  1BSG A;  1DY6 A;  4X69 A;  4XXR A;  2PBY A;  3O5Y A;  4HBU A;  4RX2 A;  5FQM A;  4QY5 A;  1ZTU A;  3FZC A;  1CI8 A;  3C2W A;  3NHQ A;  3QP5 A;  2XDM A;  4HJ3 A;  2OAQ 1;  4C6Y A;  2KOI A;  2ZOH A;  3BJN A;  3IS2 A;  4KZ6 A;  1LLB A;  5FQK A;  2BLS A;  4CLC D;  2Z2L B;  3G6O A;  5IHV A;  3IF5 A;  3EOI A;  2XSS A;  4IED A;  4FH4 A;  1S4R A;  2IWB A;  3TE8 A;  4N92 A;  2ZC6 B;  3CHW P;  4M3K A;  4NEE D;  3NCK A;  4WUJ A;  1NRF A;  4B9O A;  3LR4 A;  5A92 A;  3HLW A;  5E2G A;  3N8R A;  5M1A A;  4RVA A;  1XFQ A;  3SS4 A;  1YLW A;  2GJ3 A;  3MF0 A;  3PBT A;  2NUT C;  1KDW A;  2INW A;  2ZQ7 A;  1DJC A;  4DKI A;  3PTE A;  4X1M A;  1Y4O A;  2QWS A;  1GCE A;  3VP1 A;  3V3S A;  5AQ9 A;  1FSW A;  2H10 A;  4WBG A;  1T18 A;  5DTS A;  3IWO A;  1IYS A;  1NLZ A;  2QPN A;  4IUH A;  4R3B A;  4F3L A;  1A0K A;  3LR5 A;  4K08 A;  2WKE A;  4Z1W A;  3UE0 A;  4LV3 A;  4EQ1 A;  4HP9 A;  1D06 A;  4XUZ A;  5E2H A;  1QME A;  4NKP A;  5HL6 A;  4KQO A;  4ME4 A;  2ACG A;  4EEU A;  4GD8 A;  4MDZ A;  1NWZ A;  2P04 A;  1MY8 A;  3NDE A;  3QP2 A;  2UV0 E;  4BJP A;  3N7W A;  3ZVW A;  3B42 A;  2WK0 A;  4ZTK A;  3DTI A;  3BLS A;  3DWK A;  4DE1 A;  2W0N A;  5DFY A;  3SH7 A;  4GJ4 A;  3G34 A;  4EBP A;  3DBA A;  4CJN A;  4X56 A;  5MC7 A;  5TR7 A;  5IT5 A;  1G68 A;  3HCY A;  1LSX A;  3LIE A;  3ULF A;  4S2K A;  3IX3 A;  4X55 A;  3QP6 A;  4BBT A;  4WF0 A;  1GHI A;  2Z6D A;  4L9F A;  4I38 A;  4ARZ B;  4I5S A;  4BMW A;  4KUO A;  1EWZ A;  3F1P A;  2WAF A;  1UGU A;  2XA7 M;  1W8Q A;  4O8G A;  4KZ3 A;  4HY8 A;  4ID4 A;  3BYD A;  3Q7V B;  5GLB A;  2OV5 A;  3N4I A;  2O0Y A;  2QYB A;  4N1X A;  4H8R A;  2FH5 A;  2J80 A;  5KMW A;  2EA9 A;  4E3M A;  5I5L A;  4WMC D;  3CJM A;  3ZCZ A;  1V9Y A;  5HAR A;  2P9V A;  3E2L A;  4WZ4 A;  2JC7 A;  4S2I A;  5E43 A;  4C75 A;  4UQI M;  4YWZ A;  4WYY A;  4H6J A;  3ZG7 B;  4EW7 A;  4XT2 B;  3VSL A;  4WM9 A;  3WS4 A;  4MNR A;  4UA6 A;  4JGO A;  4K0W A;  4MMN A;  2JKR M;  2DMW A;  2PDR A;  5M18 A;  1OME A;  4OON A;  5FQI A;  2Y2L A;  4K91 A;  3SH9 A;  3OLO A;  3ZFZ A;  4PHT A;  3ZYT A;  4UAA A;  4BBV A;  4OQI A;  2V20 A;  4WL9 A;  4F94 A;  4OVD A;  2JHE A;  4E3K A;  4JXG A;  4GLQ A;  5CHJ A;  4QB8 A;  3VSK A;  5K5B A;  5F1G A;  3C38 A;  5EVI B;  1MC0 A;  4RYE A;  3T4J A;  3V5M A;  3VE3 A;  1H8Y A;  1KDS A;  2A2L A;  2ZM2 A;  2HJE A;  2XK1 A;  5HD3 A;  3FKV A;  3P7N A;  4R0Q A;  1E4D A;  2DNS A;  4L9E A;  3CUE A;  5DF9 A;  2PYR A;  3N8L A;  2WKP A;  1ACF A;  3PBR A;  3A0R A;  5HFO A;  3UMD A;  4GDB A;  2Y2I A;  3D4F A;  4DF6 A;  5FEF A;  1VHM A;  3LGO A;  4PM6 A;  3UE6 A;  4UEY A;  2HF6 A;  5FI6 A;  1OTA A;  2G7U A;  1VET A;  2E8J A;  3GSG A;  2A24 A;  4JF6 A;  1AWI A;  5EVI C;  3C4O A;  4OKP A;  5U47 A;  3UB5 P;  4BQM A;  2VZW A;  2NUP C;  5L09 A;  4KZ8 A;  1OT6 A;  2A49 A;  4E3N A;  2KLI A;  1X0O A;  4CQH A;  5A90 A;  3IHA A;  3IF6 A;  2VX8 A;  5G18 A;  4OLG A;  5HDS A;  3E4P A;  3Q7Z A;  1J9M A;  4K0X A;  3CUE C;  2XRO A;  4NXB A;  3CG5 A;  1L0G A;  1ONG A;  1OTI A;  4DE0 A;  4D2O A;  1SKF A;  2XEP A;  2JCH A;  2J3W A;  2ZC4 B;  3M6B A;  2D02 A;  4YOF A;  3HJK A;  3MQ0 A;  3VMA A;  1PIO A;  2YKH A;  2L4R A;  3TRC A;  2XH9 A;  3VE4 A;  4JXV A;  2HZ5 A;  4OP5 A;  3DAV A;  3P01 A;  2V1Z A;  3H82 B;  1HD8 A;  4KG5 A;  4GS9 B;  1O7E A;  5FSR A;  4LPZ A;  2B95 A;  4U3T A;  5F68 A;  4PM8 A;  3FWL A;  4GN2 A;  4LRX C;  1ES3 A;  2O9B A;  1XGJ A;  1YLP A;  3HJI A;  3A3J A;  1TDG A;  5GHZ A;  3UNW A;  3PAG A;  3M2J A;  3SS3 A;  4BL2 A;  1MWT A;  2BTF P;  1NY0 A;  3IF6 C;  4FUW A;  4EU0 A;  4E6X A;  3MKF A;  1FCN A;  4EES A;  3LIC A;  1XKZ A;  2IA2 A;  4LV0 A;  3SOI A;  3NI9 A;  1UWP X;  2B5R A;  5CX7 A;  4MN7 A;  1L2S A;  3HL9 A;  4DE2 A;  5IS1 A;  2A3U A;  3ZNT A;  1HLU P;  2BAS A;  1GSV A;  4KQD A;  2M7V A;  4E3O A;  2W1R A;  2Y59 A;  5TBM A;  1RP5 A;  1DP9 A;  1WA9 A;  3PAE A;  3MFD A;  1QMF A;  3ISG A;  1ES2 A;  2Q9M A;  4OP8 A;  5J4E A;  3FPV A;  1TS7 A;  2J7V A;  3BFC A;  4OOY A;  2JBF A;  5HAI A;  1PWG A;  3MBZ A;  2ZMF A;  4Q0H A;  4EET B;  3F1N A;  4S2O A;  2XQZ A;  2VV7 A;  4JBF A;  4R6L A;  3WS0 A;  4II7 A;  4M4X A;  1K25 A;  4LGW A;  3C7U A;  3UPO A;  4HBT A;  1MZU A;  2ZM8 A;  2WGV A;  3T4L A;  3AGD A;  3VP2 A;  2ZQ8 A;  4HH2 A;  2PU2 A;  3IBJ A;  1K6S A;  3EEH A;  3CMZ A;  1PYY A;  3E0Y A;  1MPL A;  3LI9 A;  4HOI A;  1KGG A;  2W27 A;  3NJA A;  1GSX A;  4HES A;  1XXM A;  1ZG4 A;  4N9K A;  5FAQ A;  2W3H A;  1I5Q A;  3CPT B;  2HDR A;  4PMA A;  3GRJ A;  3EQV A;  3LIB A;  4B88 A;  4PKY G;  1W7F A;  3BEC A;  3NEC A;  5FL3 A;  2VLG A;  2PYP A;  3KSI A;  4QU3 A;  3BM6 A;  4WEK A;  1EW0 A;  4EUV A;  4R70 A;  1YLZ A;  4GNU A;  3V67 A;  4EBN A;  2IWC A;  2V0W A;  4HI4 A;  3M6H A;  3QP4 A;  4CPK A;  1YKD A;  4JF4 A;  2VGL S;  5F6A A;  3E4Q A;  1TS6 A;  4EXO A;  3SZT A;  4JXS A;  3VFF A;  3MZF A;  3GVB A;  4PM5 A;  2PR5 A;  1LSV A;  5HAQ A;  4BD1 A;  4BD0 A;  1BUE A;  2HDS A;  1OTD A;  2XFT A;  3QP8 A;  3VFH A;  4PPR A;  3R7W A;  1I2S A;  3VV4 A;  3S4X A;  5A93 A;  4QJG A;  1AXB A;  2MJ6 A;  5L8M A;  1TS8 A;  3H7W A;  1XJ4 A;  5L10 A;  5HSQ A;  3N6I A;  4OPZ A;  1MXO A;  3A3I A;  4KZ5 A;  5C5K A;  3T1S A;  2X02 A;  3IS2 B;  2EX2 A;  2E8I A;  5D3O A;  4X1L A;  3UPP A;  4MBH A;  1NJ4 A;  3T4S A;  2XA7 S;  3BY8 A;  3O87 A;  5A8B A;  4PAU A;  2ZLY A;  4Q0I A;  1Q2Q A;  1ZKJ A;  1DJB A;  3DTM A;  5DF7 A;  1HZO A;  2VGK A;  1XJ3 A;  3FV7 A;  1Y28 A;  1W79 A;  4NET A;  1SKO A;  1XGI A;  3IXG A;  2Y2K A;  3MZE A;  4XUX A;  1BT5 A;  2ZQD A;  4R23 A;  3BFG A;  1SZV A;  5DF8 A;  1G6A A;  1G28 A;  1LHY A;  3G2Y A;  3MR0 A;  1KE3 A;  3T4K A;  3BFF A;  3MZD A;  2H28 A;  1KVM A;  1K0K A;  2V8C A;  2Y2H A;  1Z09 A;  4JLF A;  5HWT A;  4F3L B;  5F82 A;  4ZJ2 A;  1S0W A;  5G4Y A;  5CED A;  4OLD A;  1P97 A;  4ZRR A;  3K3D A;  5J8X A;  5IU1 A;  4P87 A;  2V1A A;  4GKU A;  5FAO A;  4O0P A;  2EWV A;  3AGE A;  3PBQ A;  2R9W A;  5EOO A;  4CLC A;  3DWZ A;  1ALQ A;  3K2N A;  4YIN A;  4ZBE A;  1KGE A;  3S22 A;  3U2A A;  1JNU A;  2GX5 A;  1VM1 A;  2WGI A;  2X01 A;  5CXW A;  4LCL A;  4I3J A;  1VEU A;  5EV0 A;  3JVU A;  5F5Y A;  3S1Y A;  1W5D A;  2HPB A;  4DRT A;  3CZD A;  4O7D A;  1FCO A;  4P6B A;  1K6R A;  4S2L A;  5HX9 A;  5HZH A;  1O07 A;  3BQ8 A;  4WEJ A;  3T12 B;  3MMH A;  3D9Y A;  4UHU A;  4JGQ A;  3MQO A;  3B3X A;  1ZHH B;  2VV6 A;  3MQQ A;  1IOU A;  1EI5 A;  3F1P B;  5AQ7 A;  5G4Z A;  2VA0 A;  3MKE A;  4P6Z M;  1TVF A;  1LL5 A;  1PZP A;  3IT9 A;  4E6W A;  1BLS A;  1WE4 A;  3OOV A;  4OQ0 A;  5GL9 A;  3KYZ A;  1ESU A;  1W63 Q;  3LFV A;  2P9V B;  4R38 A;  3HLE A;  2OAP 1;  3BLM A;  4R1G A;  3WRT A;  5CHM A;  5EVI D;  4R3J A;  4H6J B;  3CI6 A;  3HLF A;  3IH9 A;  1JTD A;  4G3K A;  5EE8 A;  2ZM0 A;  1IKI A;  4YFM A;  3E2K A;  1HTZ A;  1LI9 A;  5TJJ A;  1NLY A;  3MFX A;  1F9I A;  3RTY A;  3NY4 A;  2ZOI A;  3S7O A;  3G2Z A;  2XGN A;  3ZHH A;  3NOP C;  4EWF A;  2EX8 A;  3A0V A;  3LID A;  4ZJ3 A;  4KZ7 A;  4ETZ A;  1GHP A;  4ZJ1 A;  3GDI A;  3NBL A;  4X6T A;  5CGS A;  1BLH A;  1YPR A;  4LRY C;  1MKI A;  2Z6C A;  3JYI A;  5FQJ A;  4PM9 A;  2XD1 A;  4NG2 A;  2JE5 A;  5GLA A;  1XX2 A;  4GW9 A;  3RXW A;  2EXA A;  3IX8 A;  4OOM A;  1PW8 A;  2WGW B;  3UB9 A;  2L0W A;  4U0T A;  1KE4 A;  1K56 D;  4FOF A;  1TEM A;  5HDD A;  4LCM A;  2J9O A;  1K54 A;  3JVV A;  2WZZ A;  2G2W A;  3ZG5 A;  1STZ A;  5EFW A;  1KE0 A;  1BLC A;  3F1O A;  1FR6 A;  2HP6 A;  2QHK A;  3QHY A;  4BLM A;  5HPI A;  1NZO A;  2QKP A;  1OTB A;  3UO9 A;  4UA9 A;  3W4O A;  1C3B A;  2P74 A;  3NIA A;  5HWW A;  2O9A A;  3Q1F A;  4FTX A;  1VET B;  1D7E A;  1KVL A;  4JGR A;  2Y4A A;  4ETX A;  3LR0 A;  2A24 B;  2Q9N A;  5M19 A;  3ITB A;  3UB6 A;  4Y15 A;  1XP4 A;  5FAT A;  1N4O A;  5AQB A;  3UB7 A;  3LR3 A;  5FQ9 A;  1NYY A;  4LEN A;  2PR6 A;  3W4P A;  1YAX A;  4KQQ A;  3IF6 B;  3MXQ A;  1K54 C;  1W63 M;  3CAX A;  3FC7 A;  5AVF A;  3LYX A;  4C3Q A;  3O88 A;  4LFU A;  4ZAM A;  2OWH A;  3IXD A;  3FYZ A;  3RH8 B;  2QJ5 A;  2Y2O A;  2B02 A;  5J3W A;  4B4X A;  3SS5 A;  2Y55 A;  3A0S A;  1XPB A;  1F98 A;  3VOZ A;  1ERQ A;  3KSF A;  3UE3 A;  1KOU A;  3LEQ A;  5CTM A;  4OQH A;  3HVF A;  4MLL A;  1D1J A;  4MN5 A;  4JXW A;  5DFX A;  1T1C A;  2ZL1 A;  3DW0 A;  4OPQ A;  3GV9 A;  3OCN A;  1S4S A;  1RGY A;  2V0U A;  1G5U A;  5CEC A;  1YQS A;  3VP4 A;  2Y2M A;  4OPY A;  1YM1 A;  3C4P A;  2K2N A;  2OOL A;  3MS6 A;  1HVB A;  4EV4 A;  1BLP A;  5HD5 A;  4GHI A;  4R3A A;  3EEA A;  4Y13 A;  2Y2Q A;  3KX0 X;  3IQA A;  3UME A;  1NRJ A;  2P08 A;  2GNX A;  3O3V A;  1ERM A;  3BWL A;  3T1X A;  4NXF A;  3HLC A;  4IJG A;  3TSG A;  2OWJ A;  4I39 A;  1J3W A;  4P85 A;  1YSQ A;  1PRQ A;  3N8S A;  3GEC A;  4GD6 A;  5TBM B;  3E98 A;  2C6W B;  3BY9 A;  2PAV P;  3JPU A;  1XJ2 A;  1OJG A;  2J9P A;  3EGX C;  3V3R A;  3BRM A;  4GOG A;  1K55 A;  4DJ2 A;  1JVJ A;  2QZ6 A;  5DTT A;  2D01 A;  1P9R A;  3LY3 A;  3NOT C;  4HJ4 A;  4X25 A;  2XR0 A;  5GLD A;  1Z6F A;  1FIK A;  3IWI A;  5KSH A;  4Y0U A;  4WEL A;  3LI8 A;  2M1C A;  1F2K A;  1MWU A;  1IEM A;  1FSY A;  3F1N B;  4O01 A;  2QMI A;  1L0D A;  3NOU C;  2UWX A;  2ZQC A;  5HL1 A;  3ZGA B;  3PYP A;  2W1T A;  3V50 A;  3ZG8 B;  3ITA A;  3OC2 A;  3VOY A;  1ERO A;  3P98 A;  3OBF A;  4MCW A;  1K38 A;  2HV1 A;  1CF0 A;  1S1Z A;  5DVA A;  3NDG A;  4OQG A;  1LL9 A;  4WN5 A;  5GHY A;  1CEG A;  4A5R A;  4HNB A;  1ESI A;  2OSU A;  1Q2P A;  1K55 C;  1CK3 A;  3A3D A;  4DXC A;  2VK3 A;  3HBR A;  1T19 A;  1E3U D;  3LO7 A;  3UN7 A;  4BEN A;  3OPL A;  4PM7 A;  3W8K A;  2WKQ A;  1ES5 A;  4MBF A;  2O99 A;  4PKY A;  4E3L A;  4WLA A;  3L9K A;  3T4O A;  3UY6 A;  3ICY A;  1SDN A;  1ONH A;  4HH3 A;  4HJ6 A;  1FCM A;  1L0F A;  5FDS A;  2PU4 A;  3WS2 A;  2Y2P A;  4HEF A;  4ESP A;  2WAE A;  2J3T C;  4EEP A;  1GHM A;  3UDX A;  2ZC5 B;  3A3E A;  1RCJ A;  3UDF A;  3BW6 A;  1ES4 A;  1I2W A;  2O9C A;  4JF5 A;  1JWP A;  4P0M A;  4R4S A;  4S2J A;  4QD4 A;  3BEB A;  3MJQ A;  1H8M A;  4RA7 A;  1S66 L;  5FAP A;  3MSH A;  5DJT A;  4IHQ A;  3R7W B;  4HIA A;  2WZX A;  3SH8 A;  4GCZ A;  2JN7 A;  2X71 A;  4KUK A;  3H7W B;  1XA1 A;  4IUK A;  5DKL A;  4D60 A;  3KO6 A;  4IVI A;  5JYO A;  4LV2 A;  3T4T A;  2FFY A;  1XFN A;  4FD8 A;  2Y91 A;  5EEC A;  2W3G A;  3ZG9 B;  2WUQ A;  4KZ4 A;  5FQQ A;  3Q82 A;  3G32 A;  4QHC A;  3R4K A;  5CER A;  4P6Z S;  3UE1 A;  2FFF B;  4DDS A;  1JTG A;  3BFD A;  1IYQ A;  4X53 A;  3FKW A;  2ZD8 A;  1PFL A;  2G2U A;  3BFE A;  4Q0J A;  1SKO B;  4FH2 A;  3C5A A;  2DRW A;  3IX4 A;  3ZDJ A;  1VB6 A;  3LY4 A;  1LL8 A;  5FI2 A;  1OT9 A;  5I94 A;  2R78 A;  4UQI S;  3RFB A;  1UWN X;  1L3L A;  3P09 A;  3W2Z A;  1NYM A;  5E2F A;  3FG8 A;  1T1A A;  4FSF A;  3VP3 A;  3EGD C;  2AVX A;  4FCF A;  3I7J A;  2J8Y A;  2Y2J A;  2ZJ9 A;  1H5X A;  3S7P A;  2WKR A;  5HDC A;  3PHY A;  4KZB A;  4OH0 A;  3G31 A;  2PD8 A;  3C30 A;  3T1R A;  1PW1 A;  5FEG A;  2JKT I;  2HGV A;  1N9O A;  3PR6 A;  4GB7 A;  2HDQ A;  4CLC B;  2ZQA A;  2XF3 A;  5HW3 A;  1DP6 A;  5EOE A;  5CGW A;  2WKH A;  4R4R A;  3OPH A;  2Y8H A;  5J7E A;  1MKM A;  3PBN A;  1VEU B;  2B18 A;  3WS1 A;  3HRE A;  4I3I A;  1FQG A;  3HLD A;  3MXS A;  4S2M A;  2VGL M;  1IKG A;  1YLT A;  5AQA A;  4Y0T A;  1H8Z A;  2PT7 A;  1JWZ A;  3ZNY A;  4N9L A;  1TDL A;  2RCX A;  5EM1 A;  2XLN A;  3W4Q A;  1V9Z A;  2FZ0 A;  4Y5F A;  4AFI A;  4MEZ A;  4N1H A;  1BUL A;  1PI4 A;  5BOH A;  4DXB A;  2PRF A;  3VOL A;  4IBX A;  4Y7P A;  4YNR A;  3LIA A;  3NUL A;  5KZH A;  2ZC3 B;  4MBK A;  4CLC C;  3HUM A;  4DE3 A;  3OCL A;  2ZMV A;  2HJ9 C;  1RGZ A;  3FPW A;  2VGJ A;  5EPH A;  4BL3 A;  2R9X A;  2OLU A;  4ARZ A;  1NZU A;  4E04 A;  4Y3I A;  2GDN A;  3KYQ A;  1XJ6 A;  3U4L P;  1S1Y A;  2V1B A;  4GZB A;  4KZ9 A;  1LSW A;  3GQZ A;  3QNB A;  3HLG A;  4KG2 A;  4IVK A;  1N9L A;  3Q7V A;  2VEA A;  1CQA A;  1PI5 A;  1BZA A;  2EX6 A;  1ODV A;  2VKS A;  2PBD P;  4EBL A;  3E4O A;  2I72 A;  1WYC A;  2W3D A;  5EVE A;  1VQQ A;  4XT2 A;  2JKF A;  1MWR A;  2WYX A;  3WS5 A;  4DMZ A;  2WKI A;  3CLO A;  2ZQ9 A;  3PXP A;  5EUA A;  5CEB A;  5CTN A;  1ZG6 A;  3IBR A;  3TOI A;  2CMN A;  4LV1 A;  3V39 A;  3B47 A;  1H3Q A;  3QNC A;  3M2K A;  4JGP A;  2HDU A;  2KDK A;  1FR1 A;  1WYB A;  1ZC2 A;  3WWX A;  1FIL A;  4JKT A;  1N9B A;  4QPR A;  4IBR A;  3L7H A;  1IEL A;  4RQ9 A;  5L07 A;  3T4Q A;  5EVL A;  4WMC A;  3VP0 A;  2BG1 A; 
#chains in the Genus database with same CATH homology
 3F1O B;  4IJG A;  2V0W A;  1D06 A;  4HI4 A;  1YKD A;  4NKP A;  2VGL S;  5F6A A;  2OWJ A;  3E4Q A;  4I39 A;  5HL6 A;  3S7N A;  1TS6 A;  4EXO A;  1YSQ A;  4KQO A;  4ME4 A;  4EEU A;  4MDZ A;  3GEC A;  1NWZ A;  2P04 A;  5TBM B;  1OTE A;  2PR5 A;  1LSV A;  2I9V A;  2V9A A;  1P0Z A;  3E98 A;  4BJP A;  3BY9 A;  1XJ2 A;  1OJG A;  1OTD A;  3EGX C;  3B42 A;  4DJ2 A;  3R7W A;  2D01 A;  3VV4 A;  2W0N A;  3TW8 A;  5DFY A;  4GJ4 A;  3H9W A;  1P9R A;  4Y2F A;  3DBA A;  3NOT C;  2MJ6 A;  4HJ4 A;  5L8M A;  4G3V A;  1TS8 A;  3H7W A;  5MC7 A;  1XJ4 A;  5HPF A;  5IT5 A;  3HCY A;  1LSX A;  5HSQ A;  2JKT M;  3LIE A;  3ULF A;  5KSH A;  4WEL A;  3LI8 A;  2M1C A;  4BBT A;  5C5K A;  4WF0 A;  2Z6D A;  3F1N B;  4L9F A;  4I38 A;  4O01 A;  3IS2 B;  4ARZ B;  4EER A;  4HQA A;  4I5S A;  4BMW A;  4KUO A;  1G6O A;  1BYW A;  3BQA A;  3F1P A;  1UGU A;  3NOU C;  2XA7 M;  3T4S A;  4O8G A;  2VV8 A;  2XA7 S;  4HY8 A;  3BY8 A;  5A8B A;  3PYP A;  4PAU A;  2W1T A;  4Q0I A;  3OC2 A;  4DN0 A;  4L9G A;  2O0Y A;  3OBF A;  4MCW A;  1DRM A;  2HV1 A;  2QYB A;  3PBO A;  2FH5 A;  1S1Z A;  2J80 A;  2YKF A;  2EA9 A;  5I5L A;  2Y79 A;  4WN5 A;  1XJ3 A;  1V9Y A;  1Y28 A;  4HNB A;  3ZQ5 A;  4UQI M;  4YWZ A;  3CWF A;  4H6J A;  4OOL A;  4EW7 A;  4XT2 B;  4NXE A;  5DJU A;  4JGO A;  4MMN A;  1G28 A;  2JKR M;  1T19 A;  2DMW A;  2PDR A;  3MR0 A;  3T4K A;  2WKQ A;  4CLC E;  1IFQ A;  2H28 A;  2O99 A;  4PKY A;  3OLO A;  4WLA A;  4PHT A;  3T4O A;  3ZYT A;  3UB8 A;  3ICY A;  3C8C A;  3D3O A;  5AVE A;  5F69 A;  5HWT A;  4BBV A;  4HH3 A;  5KIZ A;  4MN6 A;  4F3L B;  4WL9 A;  3H82 A;  4GHI B;  5G4Y A;  3CIT A;  4HJ6 A;  4GS9 A;  1P97 A;  5DKK A;  2JHE A;  4ZRR A;  3K3D A;  5IU1 A;  4GLQ A;  2ZBB A;  2V1A A;  2J3T C;  3EQU A;  4EEP A;  3SW1 A;  5K5B A;  1OPX A;  4O0P A;  2EWV A;  3PBQ A;  3C38 A;  1MC0 A;  4CLC A;  3BW6 A;  2QJ7 A;  3T4J A;  5AJG A;  3K2N A;  3D72 A;  2O9C A;  2J3T D;  3U2A A;  1JNU A;  3VE3 A;  2A2L A;  3MJQ A;  2GX5 A;  4LLO B;  2HJE A;  1H8M A;  1S67 L;  1S66 L;  2M7U A;  5HWV A;  4I3J A;  5HD3 A;  3JVU A;  5F5Y A;  5DJT A;  4IHQ A;  2GZA A;  3P7N A;  2EWW A;  3R7W B;  4HIA A;  1N9N A;  2LB9 A;  2PHY A;  4GCZ A;  2JN7 A;  2K31 A;  4L9E A;  4KUK A;  3CUE A;  3H7W B;  4IUK A;  5DF9 A;  5HZH A;  5DKL A;  3TJZ C;  3KO6 A;  2PYR A;  3BQ8 A;  2WKP A;  3PBR A;  3A0R A;  4WEJ A;  3T4T A;  1TF1 A;  1XFN A;  3MMH A;  2W3G A;  3EWK A;  4JGQ A;  3MQO A;  3UMD A;  1ZHH B;  2VV6 A;  3MQQ A;  1IOU A;  3F1P B;  1VHM A;  4B93 A;  5G4Z A;  3UE6 A;  2K7S A;  2VA0 A;  4UEY A;  1P9W A;  2HF6 A;  3R4K A;  4P6Z M;  1OTA A;  2G7U A;  1YSP A;  2W1T B;  4P6Z S;  2XRN A;  3OOV A;  2A24 A;  2PD7 A;  3KYZ A;  3KSH A;  1W63 Q;  3LFV A;  2VZW A;  4BWI A;  4DJ3 A;  2NUP C;  4R38 A;  1OT6 A;  4Q0J A;  3S7Q A;  2OAP 1;  2KLI A;  1X0O A;  4CQH A;  1VB6 A;  4H6J B;  2KX6 A;  1LL8 A;  2VX8 A;  5LBR A;  3PBS A;  5HDS A;  1OT9 A;  1DP8 A;  3E4P A;  2R78 A;  1TS0 A;  3CI6 A;  3LUQ A;  4UQI S;  3RFB A;  3CUE C;  4BBU A;  2XRO A;  4G3K A;  4NXB A;  1UWN X;  4NXG A;  3W2Z A;  1OTI A;  3LIF A;  1OJ5 A;  2J3W A;  4I3A A;  1T1B A;  3FG8 A;  2D02 A;  4YOF A;  3HJK A;  1T1A A;  4FSF A;  5TJJ A;  3MQ0 A;  1NLY A;  3EGD C;  3MFX A;  2YKH A;  2W3E A;  1F9I A;  3RTY A;  2L4R A;  3TRC A;  3VE4 A;  2ZOI A;  3S7O A;  3P01 A;  3H82 B;  3S7P A;  2LB5 A;  2WKR A;  5HDC A;  3PHY A;  3NOP C;  4GS9 B;  2PD8 A;  4LPZ A;  3C30 A;  5F68 A;  3LID A;  3A0V A;  4HP4 A;  4ETZ A;  2JKT I;  3GDI A;  4LRX C;  2O9B A;  3HJI A;  2HGV A;  1N9O A;  4HHD A;  3PR6 A;  3KSG A;  4LRY C;  2Z6C A;  3T50 A;  2L1M A;  4CLC B;  1TD5 A;  1DP6 A;  4GW9 A;  4EU0 A;  1F5M A;  2Y8H A;  4OOM A;  5J7E A;  1MKM A;  3PBN A;  3UB9 A;  2L0W A;  2B18 A;  4EES A;  3LIC A;  2IA2 A;  1GSW A;  4I3I A;  4FOF A;  1UWP X;  5HDD A;  4LRZ E;  3JVV A;  2VGL M;  4L0L A;  5CX7 A;  4MN7 A;  2P7J A;  5IS1 A;  1STZ A;  5EFW A;  3B33 A;  3F1O A;  2PT7 A;  4G3W A;  2BAS A;  2W3F A;  1GSV A;  2QHK A;  4KQD A;  2M7V A;  5HPI A;  2QKP A;  1LT0 A;  1OTB A;  3K3C A;  2W1R A;  5TBM A;  1V9Z A;  2FZ0 A;  4Y5F A;  4AFI A;  2JKR I;  1DP9 A;  1WA9 A;  5HWW A;  2VJW A;  2O9A A;  3O5Y A;  3VOL A;  1D7E A;  4JGR A;  4ETX A;  3LR0 A;  2A24 B;  4YNR A;  5J4E A;  3LIA A;  3FPV A;  1ZTU A;  1TS7 A;  3UB6 A;  4CLC C;  3NHQ A;  3C2W A;  3OCL A;  2ZMV A;  2HJ9 C;  4HJ3 A;  3FPW A;  2OAQ 1;  2KOI A;  2ZOH A;  2ZMF A;  3LR3 A;  4Q0H A;  3UB7 A;  3BJN A;  3F1N A;  4EET B;  2PR6 A;  4ARZ A;  3IS2 A;  1YAX A;  4E04 A;  4Y3I A;  2VV7 A;  4CLC D;  3MXQ A;  3KYQ A;  4R6L A;  1XJ6 A;  3G6O A;  1W63 M;  4II7 A;  4M4X A;  1S1Y A;  3CAX A;  3FC7 A;  5AVF A;  2V1B A;  3LYX A;  1LSW A;  3EOI A;  2XSS A;  1MZU A;  2OWH A;  1S4R A;  3T4L A;  3TE8 A;  1N9L A;  2VEA A;  3RH8 B;  2QJ5 A;  4NEE D;  2B02 A;  5J3W A;  3A0S A;  4HH2 A;  1F98 A;  3IBJ A;  4WUJ A;  1ODV A;  2VKS A;  3EEH A;  3E4O A;  4B9O A;  2W3D A;  3LR4 A;  3E0Y A;  3KSF A;  3UE3 A;  3LI9 A;  1KOU A;  4HOI A;  2W27 A;  1XFQ A;  3NJA A;  4MN5 A;  2GJ3 A;  1GSX A;  3MF0 A;  1T1C A;  2NUT C;  2INW A;  3PBT A;  5DFX A;  4XT2 A;  4DMZ A;  3CLO A;  3PXP A;  2W3H A;  3IBR A;  2CMN A;  3OCN A;  1S4S A;  2QWS A;  3B47 A;  2V0U A;  3EQV A;  1H3Q A;  3LIB A;  4JGP A;  2KDK A;  4PKY G;  2K2N A;  2OOL A;  5FL3 A;  2VLG A;  2PYP A;  1T18 A;  3KSI A;  1NLZ A;  4IUH A;  4QPR A;  4F3L A;  5HD5 A;  3LR5 A;  4GHI A;  4R3A A;  4WEK A;  3EEA A;  4K08 A;  1EW0 A;  4EUV A;  4Z1W A;  3KX0 X;  4R70 A;  4EQ1 A;  4RQ9 A;  4HP9 A;  3UME A;  1NRJ A;  2P08 A;  3T4Q A;  2GNX A;  3V67 A;  3BWL A;  4NXF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...