3FPWA

Crystal structure of hbps with bound iron
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
140
structure length
140
Chain Sequence
b'PVAARGGELTQSTHLTLEAATKAARAAVEAAEKDGRHVSVAVVDRNGNTLVTLRGDGAGPQSYESAERKAFTAVSWNAPTSELAKRLAQAPTLKDIPGTLFLAGGTPVTAKGAPVAGIGVAGAPSGDLDEQYARAGAAVL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Extracellular haem-binding protein
publication title The oligomeric assembly of the novel haem-degrading protein HbpS is essential for interaction with its cognate two-component sensor kinase
pubmed doi rcsb
source organism Streptomyces reticuli
molecule tags Heme binding protein
total genus 43
structure length 140
sequence length 140
ec nomenclature
pdb deposition date 2009-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03928 Haem_degrading Haem-degrading
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.150 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3fpwA01
3FPVA 4CLCE 4CLCC 4CLCD 4CLCB 2A2LA 3FPWA 5CX7A 4NKPA 4CLCA 4BMWA
chains in the Genus database with same CATH superfamily
4QY5A 2HJ9C 4B9OA 3O88A 3QP1A 3D9YA 3BQ8A 3NIAA 3MKEA 2M7UA 1M6KA 5DJUA 4WUJA 5FEGA 1W79A 4GOGA 2BASA 3VV4A 3A3EA 4S2PA 2BTFP 2ZQ9A 3KSFA 3L9KA 4I3AA 3UB9A 1KE3A 5HPIA 3UNWA 1K55A 2PU2A 2PAVP 2VZWA 3UN7A 3UMDA 1L2SA 2K2NA 4G3VA 2Y2JA 4OQIA 4WMCD 3NOTC 2GNXA 5HD5A 1ALQA 5HWTA 3ZG9B 5FQ9A 5HX9A 4ZRRA 4R70A 4AFIA 1XKZA 1NJ4A 4JLFA 3I7JA 4YWZA 1IELA 4ZJ3A 4IVIA 2VV6A 1VQQA 4NXFA 3RH8B 2ZJ9A 4KZ9A 2K31A 1LSXA 5CGWA 2IWBA 4DDYA 4Y3IA 2P9VA 3EOIA 2QKPA 4DXCA 1OTDA 4DE0A 4EETB 1I2SA 3NOUC 1ERMA 1MWTA 1KOUA 2FFYA 4OONA 4QY6A 2GZAA 3MS6A 1K55C 1TS6A 1YQSA 5G4YA 4OH0A 3QNCA 4QWOA 1GA0A 3O5YA 4OOYA 4B88A 3NC8A 3MZFA 3V5MA 5KZHA 4FCFA 2ZOIA 4WMCA 1NXYA 4IBRA 4DF6A 4HIAA 3T4SA 2DMWA 2Z6CA 4U0TA 5A92A 1TD5A 4UA7A 1GSVA 5EFWA 4IBXA 4R3AA 4PM9A 4S2LA 4MMNA 2GJ3A 4GLQA 1MC0A 2ZQAA 1ZC2A 2ZOHA 1P9WA 3DW0A 1SKFA 2H0TA 2Z6DA 5DFYA 3SS4A 5DTTA 1XX2A 1GSXA 5M18A 3VP2A 2LB9A 2ZQ8A 2Z2LB 1D06A 4CPKA 3FC7A 2YKFA 4K0WA 1GCEA 5J8XA 2L1MA 2X01A 1SZVA 1QMFA 2EA9A 5DF8A 5F68A 4MBKA 3H7WB 2ZQDA 2Y2LA 2B18A 2J3WA 2XA7S 1HTZA 4OVDA 4KQQA 4QD4A 1QMEA 1F5MA 3MF0A 1VEUB 5DTSA 3EQUA 1T1AA 1LSWA 1W63M 4I39A 3GTCA 1X0OA 1XA7A 4Z1WA 2Z2MB 3BJNA 3W4OA 3IXGA 4LRYC 2J9OA 3ULFA 4K91A 4M3KA 1PI4A 1K54C 5HFOA 5HAQA 4EW7A 5EOEA 1VEUA 3FZCA 3IF6B 4HP9A 3PTEA 1F2KA 1PFLA 4BBUA 3U4LP 4LLOB 3T4JA 4NETA 2PU4A 3LIFA 4Y0TA 1U60A 3R7WB 3NY4A 3FKVA 2V0UA 4IJGA 2JHEA 2W1RA 4KZ4A 3HLCA 1T18A 3CWFA 5M1AA 2FZ0A 2PR5A 4XT2B 5FDSA 3LR4A 3NDEA 4P6BA 4JF6A 2V1BA 3UE3A 3P01A 3IF6A 1TEMA 4EUZA 2NUTC 1J9MA 4H8RA 3N8RA 2QWSA 5F1GA 1K57A 3R7WA 2WAEA 3U2AA 3ITBA 2V8CA 4MNRA 4RX2A 2Y91A 2WYXA 2P74A 1GA9A 4JGRA 1MWRA 4XT2A 3SH9A 5KIZA 4EV4A 2XD1A 4E6WA 3WS2A 1LL8A 4IHQA 4LPZA 3IXHA 1IYOA 4E6XA 5A8BA 1P97A 2PRFA 1N9NA 3E0YA 3S22A 1MPLA 2XR0A 1SDEA 1NLYA 1H8ZA 5HL6A 2Y2OA 3CHWP 2Y2HA 1BLHA 3IF5A 1NRJA 2ZQCA 3W4PA 2XFSA 3A3JA 1NLZA 4BMWA 3T12B 1TDGA 2V0WA 3T4LA 1ACFA 3BW6A 3QP2A 5FI7A 3PAEA 4KZ3A 4PM5A 4P6ZS 5I5LA 2KDKA 3GDIA 2OOLA 4R4RA 4OPRA 3DTKA 1L0FA 4WL9A 4MDZA 1K57C 3CPTB 3HCYA 4OQHA 1IYQA 2V9AA 3FPWA 5TFQA 2EWWA 3EGDC 2W3GA 4MCWA 3HUOA 4GCZA 3PBNA 3WS4A 4NXGA 3ZNTA 1Y54A 1YPRA 4M4XA 2HDRA 1NZOA 1CJFA 5F83A 2OWJA 3BFGA 3NBLA 3KSHA 1KGGA 4HY8A 2JE5A 1JTGA 1MKMA 3CPTA 2XQZA 2Q9NA 4WEJA 3WRTA 1ESIA 3VOYA 5J4EA 3VFHA 5AQAA 2Y2MA 4DE3A 2WGIA 3MMHA 2H0YA 4Y17A 4HBUA 4GDNA 4L9GA 3LR3A 3HL9A 1F9IA 1YM1A 2BLSA 3MZDA 4S2IA 3SZTA 4LV0A 5CHUA 2JKRM 4P87A 3IWIA 2C6WB 3LIBA 1YLYA 3UPOA 3CG5A 5EPHA 5CEBA 4LRZE 2D01A 5FA7A 1G6OA 3KX0X 5F6AA 3SH8A 3AGDA 2ZL1B 3S7NA 2OLUA 3GQZA 3NECA 3IBJA 2I9VA 5E2GA 4JGQA 1LLBA 1EROA 4PAUA 3JVUA 1LI9A 4JXGA 4E3IA 3BWLA 4HQAA 3V50A 3RJUA 1JWPA 4QB8A 1FCNA 4RQ9A 4ID4A 1W7FA 2ZL1A 4GDBA 4OPQA 5CEDA 4HNBA 3CUEC 3GR2A 1IYPA 3VP0A 3OBFA 1NWZA 2DRWA 1IOUA 1XP4A 2J9PA 3ZG0A 4KZAA 4EWFA 4X55A 4GW9A 3T50A 3LR5A 2JBFA 4R1GA 5JYOA 1GHMA 1TS7A 5EECA 2ZQ7A 3M6BA 3ZNYA 2VV8A 2FH5A 4Q0IA 2XF3A 3HLEA 1PWDA 3SS3A 1FCOA 3QP6A 4JBFA 3VSLA 4X56A 4OP8A 3UPNA 5FSRA 4D60A 4KUOA 4OOLA 5FAQA 3ISGA 3VP4A 5HWVA 2VV7A 4BL3A 5U47A 1BUEA 5CHJA 2P08A 1S67L 1OMEA 1XJ3A 3UPPA 1NRFA 4E04A 3N6IA 3V3RA 4EBLA 4NKPA 4L9EA 2ZC5B 3VSKA 5AQ7A 2ZMVA 4PKYA 2HDUA 2B95A 3AGEA 3TW8A 1OTEA 5E43A 3B47A 3MQ0A 3T1XA 4JPMA 2B02A 4FOFA 4YINA 1STZA 4WZ4A 1OTBA 2PYRA 2W3EA 3GVBA 4O0PA 1BZAA 3IHAA 4UA6A 1ZHHB 4X1LA 4G3WA 5CECA 1IKIA 1OTIA 2WKRA 4I3JA 4UEYA 4OPZA 1RCJA 3ZG7B 5A91A 1IKGA 4HH2A 1O07A 2P9VB 1DJBA 3HJIA 2JKTM 2HP5A 1YLZA 5GHYA 3VOZA 1W8QA 3L7HA 2L0WA 4GD8A 2A49A 4NEED 2V20A 4X1MA 4GZBA 1MBLA 4EXOA 4R4SA 4LCLA 1CEGA 3LICA 3WS5A 2R78A 4K0XA 3MFDA 4FSFA 4BJPA 3MSHA 2WADA 5FATA 5HAIA 2HZ5A 2QHKA 4NK3A 2INWA 1Z6FA 1UGUA 4YFMA 4Y15A 1WYBA 4KQOA 2EX6A 3LIEA 1BULA 4LV2A 4PM6A 5HZHA 2R9WA 3VFFA 2XRNA 4OKPA 5FQMA 4CQHA 2HF6A 4JGPA 5J3WA 4LRXC 5MC7A 2P7JA 2W0NA 1AWIA 1F98A 1ONHA 2EX8A 4KZ6A 5DKLA 3PAGA 3MJQA 1XGJA 3JVVA 5F5YA 4ZJ1A 2IA2A 2ZM0A 2QJ5A 4N1XA 1G68A 5FEFA 1ZTUA 2OLVA 3WWXA 5EOOA 3C8CA 2EFUA 3G35A 5M19A 1HD8A 1SHVA 4KQDA 2UWXA 5TGFA 1KGFA 3VP1A 1BLCA 1IEMA 2ZD8A 1GSWA 1DP9A 1S66L 1K54A 3O86A 2LB5A 3IT9A 3OPRA 3UDFA 2VKSA 4OLDA 1H5XA 2C5WB 5FDHA 1E3UD 1GHIA 3UB7A 3K3DA 4DN0A 2JN7A 3SOIA 3GSGA 4KG2A 3F1OB 3FPVA 2Y79A 1XFQA 4DKIA 4MLLA 2ZC3B 3A3DA 4OQGA 1BT5A 3V39A 3IQAA 5HL1A 3BYDA 4YNRA 1CQAA 4WBGA 2XA7M 1CI8A 5D3OA 2EFXA 2Y2GA 1V9YA 1ZG4A 3OPLA 1I5QA 4OLGA 5HWWA 1G6AA 1H8MA 3RXXA 5CXWA 2XLNA 4IEDA 3F1OA 1FCMA 3FKWA 4Y5FA 1YAXA 1EW0A 2A3UA 3MFXA 3LGOA 5A90A 2VK3A 4WELA 4B93A 3ZQ5A 1ES4A 4IUHA 3ZCZA 4DRTA 4N92A 4MN7A 3PBTA 2WZXA 2J7VA 4I38A 3MXSA 1JWVA 1OT9A 4P0MA 5FAPA 4F3LA 3NCKA 3DAVA 1E3UA 4C75A 1JWZA 1AXBA 3UB5P 3VP3A 3SS5A 2WKIA 2J8YA 4KG6A 3LO7A 3ZHHA 3M2KA 4QHCA 3PBRA 2PBYA 5CGSA 1OT6A 5FAOA 1YLWA 2G7UA 5IU1A 3S1YA 3F1NB 4OPYA 3MQOA 3DBAA 4LV1A 3ZDJA 1KE0A 1BTLA 2HPBA 2G2WA 5FQQA 4LCMA 4XUXA 5JYPA 3QNBA 3IWOA 1LHYA 4WZ5C 2PHYA 1S6RA 3KYZA 4IVKA 3JPUA 3IWQA 2HJEA 2ZM2A 3LI9A 2PD8A 4X6TA 4RYEA 3LYXA 5G4ZA 4NXBA 5E2HA 4R38A 2VLGA 5GLAA 3F1NA 3OZHA 1HZOA 3QHYA 1FIKA 5KSHA 2KOIA 5AQ9A 3DTIA 3VOLA 3PXPA 1W8YA 1N9LA 4DE2A 5AQBA 4Y0OA 3V3SA 1E25A 1PYYA 3KSGA 4R23A 2D02A 3UE1A 2O0YA 4WLAA 2JKFA 1H3QA 2WZZA 3G4PA 1KVLA 2WUQA 5EVLA 3KYQA 3IX8A 3MZEA 4BQMA 5HDCA 4LV3A 2VJWA 2B5RA 4P85A 2EXAA 4HJ3A 4BL2A 4P6ZM 4Q0JA 4B4ZA 2X71A 3F1PB 2Y2NA 4MN5A 3UDIA 5LBRA 4FTXA 3B33A 5DTKA 1K4FA 3HLFA 4BBVA 2PDRA 1XJ2A 4E3KA 2QYBA 1VB6A 2WKHA 4EEPA 3ICYA 3QP4A 4S2KA 1L3LA 1W63Q 3DWKA 4ARZB 3VE3A 2E8IA 3C7UA 3D3OA 5GLDA 1CF0A 2FFFB 3T1RA 4X69A 5DKKA 5HAPA 3F1PA 1P9RA 1GHPA 2JKGA 3BLMA 1YMSA 4KENB 3O87A 3P7NA 3CI6A 3G31A 2M1CA 3UO9A 4CLCE 4F94A 4LGWA 4G3KA 1IYSA 4ARZA 5L09A 3C4OA 4GD6A 2GX5A 4S2OA 4A5RA 2RL3A 4UQIS 3T4TA 2J3TD 5HDDA 2IWCA 2YKHA 3JYIA 5AVFA 2Y2IA 1PWCA 5EM0A 2L4RA 2OSUA 1NYMA 5TJJA 1TVFA 5IT5A 1G28A 3LIAA 2H28A 3CJMA 3CUEA 5TR7A 1C3BA 4ESPA 3W8KA 4Y0UA 1YMXA 1ODVA 5F69A 4DE1A 3IH9A 4PHTA 5FASA 3PYPA 1FSWA 2IWDA 4N9KA 2ZC4B 2W1TA 4HOIA 4E3LA 3NHQA 4ME4A 2Y2PA 2VEAA 4KZBA 1LT0A 4CLCD 3LEQA 2I72A 5C5KA 4KZ7A 5F82A 3NDGA 3NJAA 2PR6A 5CX7A 2ZC6B 5FQJA 1K25A 1JNUA 4JXWA 3RXWA 4ZDXA 3UDXA 1WE4A 3ZVTA 2WKPA 5FQKA 4I5SA 3FWLA 5KSCA 3UB6A 1OJ5A 3CAXA 1WA9A 3HVFA 3Q7VB 2PT7A 4YOFA 3ZFZA 4JXSA 1KDWA 2J80A 2XK1A 4DMZA 3BLSA 4RA7A 4PM7A 3TE8A 3N8LA 3A0RA 3N4IA 2XSSA 1TF1A 2ZLYA 1N4OA 1T1CA 3B3XA 5DF9A 2ZC7A 5DFXA 3ZYTA 4DJ2A 1H0MA 3Q7VA 3E2LA 4R3BA 2VGLS 3TOIA 4CLCA 4HHDA 4XUZA 3C4PA 3HBRA 2VGLM 4PPRA 1YSPA 1KGEA 5CERA 4GNUA 2JKRI 3OPPA 2XFTA 2OAQ1 3LCEA 2EWVA 3C30A 5J7EA 4EU0A 3TJZC 1SKOB 1E4DA 2EXBA 3KSIA 5GL9A 4Y7PA 4UAAA 1P0ZA 2J3TC 5A93A 4CJNA 5K5BA 1YKDA 4KUKA 2XROA 2EX2A 2ZMFA 3HLDA 2K7SA 3WS0A 4X25A 3MXRA 3MR0A 2NUPC 5TBMB 5EVID 3M2JA 4E3MA 1EWZA 4Y13A 3GRJA 2DCFA 3BRMA 1SKOA 3PBQA 5HDSA 3ZVWA 2W3HA 4BD0A 3PR6A 3T4KA 2H10A 3FV7A 4O01A 3VMAA 3S7QA 3V67A 3BFDA 1RGZA 4CLCC 4N9LA 2VGKA 5TBMA 3IS2B 1Q2PA 1YT4A 2M7VA 1W5DA 3G30A 5EVIB 4XXRA 3FG8A 1L0EA 2O9AA 1KVMA 3P98A 3S7PA 4BD1A 2KX6A 4WF0A 3A0VA 4MBHA 4UHUA 3WRZA 3QP5A 3LY3A 3P09A 4PKYG 4HH3A 3A3FA 1DP8A 2BG1A 3MBZA 3N7WA 4LENA 3C7VA 2O9BA 4S2NA 5EVEA 3IS2A 3D72A 4RX3A 2QMIA 4BWIA 4C3QA 2G2UA 4U3TA 1MY8A 1XFNA 3ZG5A 5EVIA 1UWPX 3C5AA 5G18A 4WYYA 3Q1FA 4WM9A 5AVEA 2AVXA 3H82B 1H8YA 5DVAA 4EERA 2WAFA 4JF4A 2HP6A 4EBPA 4HEFA 3IH8A 3W2ZA 3B42A 3MXQA 4R6LA 2OWHA 3UMEA 1G5UA 1Z09A 2VX8A 5E2EA 4HESA 3OC2A 1JTDA 3T1SA 4S2MA 1WYCA 4ZBEA 3BFFA 2XDMA 1FR6A 2HGVA 1BLPA 2JC7A 3H82A 3G2YA 3ZG8B 2E8JA 3OPHA 4NG2A 4ZAMA 3IX4A 1BLSA 3ITAA 1TS8A 3DTMA 2O99A 2Q9MA 3IXDA 3HLGA 3R4KA 5HPFA 3G6OA 2XGNA 2JKTI 4S2NC 3A0SA 4NXEA 2A24B 5EVIC 2PYPA 2WGVA 5IS1A 2ZMAA 1OJGA 5EV0A 4R0QA 4MN6A 1YSQA 2VGJA 1Q2QA 3LY4A 5GLBA 5CHMA 3DTEA 4FH2A 3C38A 2V1AA 1V9ZA 3MQQA 3CMZA 4EQIA 1NY0A 3WS1A 4IUKA 1S4RA 2A24A 2PBDP 3HLBA 4QPRA 4JF5A 4F3LB 4O7DA 3IHBA 5FQIA 3K3CA 1FOFA 1TDLA 4N1HA 4WZ5A 3TSGA 4DDSA 4EESA 2PD7A 4FD8A 5EUAA 3LI8A 3A3IA 3E4OA 4QU3A 2ZM8A 3CZDA 4GN2A 4E3NA 1OTAA 4GJ4A 4L9FA 5DF7A 3IX3A 2Y2QA 4JGOA 5CTNA 1FSYA 3PBOA 4O8GA 3H7WA 3LUQA 1S1ZA 3E4QA 1XXMA 1N9OA 1L0DA 3O3VA 3BEBA 2MJ6A 1SDNA 1L0GA 1PWGA 1FR1A 1LL9A 4LFUA 4ETXA 5DJTA 2XH9A 4DXBA 3UY6A 1MWUA 4OQ0A 5KMWA 2QZ6A 1K0KA 5L2FA 4ZJ2A 4GS9B 3W4QA 3GECA 3BY9A 4ZTKA 2H5SA 2Q0OA 2Y2KA 3BY8A 1D1JA 3G32A 2HDSA 2HP9A 5L10A 1I2WA 4PMAA 4BBTA 1VM1A 1N9BA 1D7EA 3KYEA 5CGXA 1ERQA 3IBRA 2RCXA 4GKUA 3EQVA 3S4XA 1S1YA 1J3WA 3E4PA 3HJKA 4K08A 1NZUA 3H9WA 4WEKA 3G2ZA 3G34A 4GS9A 1FILA 1K6SA 2OV5A 3UE0A 1T1BA 3RTYA 5EM1A 4BENA 2QPNA 4U0XA 3EEHA 3NOPC 1JVJA 5HW3A 1PW1A 4QJGA 2P04A 4KZ5A 3S7OA 3OLOA 1ES2A 1OPXA 3FYZA 3BECA 3OOVA 1RP5A 1XJ4A 3NI9A 4GB7A 1LL5A 4OP5A 4II7A 1S0WA 2QJ7A 1A0KA 4H6JB 2GDNA 1DJAA 1PZPA 1KE4A 3T4OA 1K56D 3E2KA 4R3JA 3T4QA 2V8FA 2R9XA 4Q0HA 1MZUA 3EGXC 1CI9A 2XEPA 1PNEA 3IF6C 5L8MA 4HJ4A 4X68A 3T1QB 2DNSA 4WN5A 1NYYA 4B4XA 3SH7A 2VA0A 3Q82A 1FQGA 4EUVA 2Y55A 1SCWA 4H6JA 2WGWB 2WK0A 2EX9A 3LR0A 4Z9QA 5FI2A 1HVBA 2A2LA 2XD5A 3LEZA 4X53A 4UA9A 3DWZA 4PM8A 4OOMA 3M6HA 1K4EA 4RVAA 1ES3A 3CLOA 1O7EA 3MKFA 1TS0A 1XA1A 2OAP1 4DJ3A 3QP8A 2Y59A 1ES5A 4E3JA 1BSGA 1M40A 4HP4A 3EWKA 4EQ1A 1VHMA 2W1TB 3PBSA 1YLJA 3PHYA 2WGWA 1XJ6A 4ETZA 3OCNA 1XGIA 1BYWA 3NULA 5AJGA 4EBNA 4UQIM 3UB8A 5CRFA 2W3FA 4D2OA 1VETB 3E98A 1K56A 1PIOA 5FL3A 4JXVA 4FH4A 3BQAA 3HUNA 4BLMA 1K6RA 4L0LA 2V2FF 4MBFA 3HLWA 2CMNA 1UWNX 3OCLA 4GHIB 3HREA 4HJ6A 2UV0E 1RGYA 3LIDA 3D4FA 1VETA 2CC1A 1CEFA 3CITA 2HDQA 2ACGA 2JCHA 3GMWA 4Q8IA 4KG5A 3UE6A 2WKEA 2Y4AA 1DP6A 1MWSA 5BOHA 4Y2FA 1YLPA 1T19A 1Y4OA 4S2JA 3Q07A 5HD3A 4GHIA 3GV9A 3AGFA 5HSQA 1PW8A 4I3IA 2W27A 4HBTA 1PI5A 4CLCB 3TRCA 1LI0A 2Y8HA 3TG9A 1XPBA 3ZGAB 1ONGA 3BFEA 1HLUP 3Q81A 1K38A 1ZG6A 3RFBA 1DY6A 2HV1A 5EE8A 2KLIA 1PZOA 5CTMA 3BM6A 2V1ZA 1S4SA 4JKTA 3IXBA 3Q7ZA 1ZKJA 4E3OA 1EI5A 2O9CA 1YLTA 2WKQA 3HUMA 1KDSA 5F1FA 5L07A 3N8SA 5I94A 3SW1A 5GHZA 1LSVA 3LFVA 2W3DA 1PRQA 1IFQA 2X02A 3EEAA 5GLCA 4MEZA 1Y28A 4KQRA 5HARA 2ZBBA 1DRMA 5IHVA 3VE4A 4C6YA 1ESUA 4HI4A 3BFCA 5GHXA 4EEUA 4FUWA 1CK3A 1DJCA 3KO6A 1MKIA 3K2NA 1MXOA 5FI6A 5E2FA 4KZ8A 3C2WA
chains in the Genus database with same CATH topology
3G6OA 2HJEA 2HJ9C 3LI9A 4B9OA 2PD8A 2JKTI 3BQ8A 3LYXA 5G4ZA 4NXBA 2M7UA 4R38A 3A0SA 2JKRM 2VLGA 4NXEA 2A24B 2PYPA 5DJUA 3F1NA 4WUJA 5IS1A 1OJGA 5KSHA 4MN6A 1YSQA 2BASA 2KOIA 3VV4A 3LIBA 3VOLA 3KSFA 3PXPA 1N9LA 4I3AA 3UB9A 3KSGA 5HPIA 2D02A 4LRZE 2O0YA 2D01A 3C38A 4WLAA 2VZWA 2V1AA 1H3QA 3UMDA 1G6OA 3KX0X 2K2NA 4G3VA 1V9ZA 3MQQA 5F6AA 3KYQA 3S7NA 3NOTC 2GNXA 4IUKA 1S4RA 2A24A 5HDCA 5HD5A 3IBJA 4QPRA 2I9VA 5HWTA 4JGQA 4F3LB 2VJWA 4PAUA 3JVUA 4ZRRA 4R70A 3K3CA 4AFIA 4EESA 4HJ3A 2PD7A 4YWZA 4P6ZM 4Q0JA 3F1PB 3LI8A 3BWLA 3E4OA 2VV6A 4MN5A 4HQAA 4NXFA 5LBRA 3RH8B 3B33A 1OTAA 2K31A 4BBVA 2PDRA 4GJ4A 4L9FA 1XJ2A 4RQ9A 2QYBA 1LSXA 1VB6A 4EEPA 3ICYA 4JGOA 4Y3IA 1W63Q 4HNBA 3CUEC 3PBOA 4ARZB 3EOIA 3VE3A 4O8GA 3H7WA 2QKPA 1OTDA 3OBFA 3LUQA 4EETB 1S1ZA 1NWZA 3D3OA 1IOUA 3E4QA 3NOUC 1N9OA 5DKKA 2MJ6A 3F1PA 1KOUA 4GW9A 3T50A 1P9RA 3LR5A 2GZAA 4ETXA 5DJTA 1TS6A 5G4YA 3P7NA 1TS7A 3CI6A 2VV8A 2FH5A 2M1CA 3O5YA 4Q0IA 4GS9B 4CLCE 3GECA 4G3KA 4ARZA 3BY9A 2ZOIA 2GX5A 3BY8A 4KUOA 4OOLA 4HIAA 4UQIS 3T4TA 2J3TD 5HDDA 2YKHA 3T4SA 2DMWA 2Z6CA 4BBTA 1TD5A 5AVFA 1GSVA 1D7EA 5EFWA 5HWVA 2VV7A 2L4RA 3IBRA 4R3AA 3EQVA 1S1YA 3E4PA 2P08A 3HJKA 5TJJA 5IT5A 4K08A 1G28A 3LIAA 1S67L 4MMNA 2H28A 3CUEA 1XJ3A 3H9WA 4WEKA 2GJ3A 4GLQA 1MC0A 4E04A 1ODVA 4GS9A 5F69A 4PHTA 4NKPA 1T1BA 2ZOHA 3RTYA 3PYPA 4L9EA 1P9WA 2ZMVA 4PKYA 3TW8A 3EEHA 2Z6DA 3NOPC 1OTEA 5DFYA 2W1TA 3B47A 3MQ0A 4HOIA 1GSXA 3NHQA 2B02A 4FOFA 2LB9A 4ME4A 1STZA 2P04A 1D06A 1OTBA 2PYRA 2VEAA 2W3EA 3S7OA 3OLOA 1LT0A 4O0PA 4CLCD 3FC7A 1OPXA 1ZHHB 2YKFA 4G3WA 1OTIA 2WKRA 4I3JA 4UEYA 5C5KA 3OOVA 1XJ4A 3NJAA 2L1MA 2PR6A 5CX7A 4HH2A 2EA9A 4II7A 5F68A 1JNUA 2QJ7A 3HJIA 2JKTM 3H7WB 2B18A 2J3WA 2XA7S 2WKPA 4H6JB 1F5MA 4I5SA 2L0WA 3UB6A 1OJ5A 3CAXA 1WA9A 3MF0A 3T4OA 4NEED 2PT7A 3EQUA 1T1AA 4YOFA 3T4QA 4Q0HA 1MZUA 4EXOA 1LSWA 1W63M 4I39A 3EGXC 1X0OA 3LICA 2J80A 4DMZA 4Z1WA 5L8MA 3BJNA 2R78A 4FSFA 4HJ4A 4LRYC 3TE8A 3ULFA 4BJPA 3A0RA 4WN5A 2XSSA 1TF1A 2VA0A 4EUVA 2QHKA 4H6JA 2INWA 1T1CA 1UGUA 5DF9A 3LR0A 4KQOA 5DFXA 3ZYTA 2A2LA 3LIEA 4DJ2A 4EW7A 5HZHA 4CQHA 2XRNA 4HP9A 4OOMA 2HF6A 4JGPA 5J3WA 4BBUA 3CLOA 2VGLS 4LLOB 4LRXC 3T4JA 5MC7A 2P7JA 1TS0A 2W0NA 3LIFA 4CLCA 4HHDA 1F98A 2OAP1 5DKLA 3R7WB 4DJ3A 2VGLM 3MJQA 2V0UA 1YSPA 4IJGA 2JHEA 3JVVA 2W1RA 5F5YA 4HP4A 3EWKA 4EQ1A 2JKRI 1VHMA 2IA2A 2W1TB 1T18A 2OAQ1 3CWFA 3PBSA 2EWVA 2QJ5A 3PHYA 3C30A 1XJ6A 4ETZA 3OCNA 2FZ0A 2PR5A 1ZTUA 5J7EA 4XT2B 3LR4A 1BYWA 5AJGA 4EU0A 3TJZC 3C8CA 2V1BA 4UQIM 3UE3A 3P01A 3UB8A 3KSIA 2W3FA 4KQDA 3E98A 5FL3A 2NUTC 1P0ZA 2J3TC 5K5BA 1YKDA 4KUKA 2XROA 2QWSA 1GSWA 3BQAA 1DP9A 2ZMFA 3R7WA 1S66L 2K7SA 3U2AA 2LB5A 3MR0A 2NUPC 4L0LA 5TBMB 2CMNA 1UWNX 4JGRA 3OCLA 4GHIB 2VKSA 4XT2A 5KIZA 4HJ6A 3PBQA 5HDSA 3LIDA 2W3HA 3PR6A 1LL8A 3T4KA 4IHQA 4LPZA 3CITA 3UB7A 3K3DA 4DN0A 2JN7A 5A8BA 1P97A 1N9NA 4O01A 3F1OB 3FPVA 3UE6A 3E0YA 3S7QA 2Y79A 3V67A 1DP6A 1XFQA 4CLCC 1NLYA 4Y2FA 5HL6A 5TBMA 1T19A 3IS2B 1NRJA 4YNRA 2M7VA 5HD3A 2XA7M 4GHIA 1NLZA 1V9YA 4BMWA 3FG8A 2O9AA 3S7PA 5HSQA 2V0WA 3T4LA 4I3IA 2KX6A 2W27A 5HWWA 4WF0A 3A0VA 3BW6A 1H8MA 4CLCB 4P6ZS 4PKYG 3TRCA 5I5LA 2KDKA 3F1OA 2Y8HA 3GDIA 2OOLA 4HH3A 4Y5FA 1YAXA 1DP8A 1EW0A 4WL9A 3MFXA 3HCYA 4MDZA 2O9BA 2V9AA 3RFBA 3IS2A 3D72A 4WELA 4B93A 3ZQ5A 2HV1A 4BWIA 3FPWA 4IUHA 1XFNA 2EWWA 3EGDC 4MN7A 3PBTA 2W3GA 2KLIA 1UWPX 4MCWA 4GCZA 3PBNA 1S4SA 4NXGA 4I38A 5AVEA 3H82B 1OT9A 4F3LA 4EERA 4M4XA 2O9CA 2OWJA 2WKQA 3W2ZA 3B42A 3KSHA 3MXQA 4R6LA 4HY8A 2OWHA 3UMEA 1MKMA 2VX8A 4WEJA 3SW1A 1LSVA 3LFVA 3OC2A 2W3DA 1IFQA 3PBRA 3EEAA 5J4EA 1Y28A 1OT6A 2G7UA 5IU1A 2ZBBA 2HGVA 1DRMA 3F1NB 3MMHA 3MQOA 3DBAA 3VE4A 3H82A 4HI4A 4EEUA 3KO6A 1TS8A 3LR3A 4L9GA 1F9IA 3K2NA 2O99A 2PHYA 3KYZA 3C2WA 3R4KA 5HPFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FPV A;  4CLC E;  4CLC C;  4CLC D;  4CLC B;  2A2L A;  3FPW A;  5CX7 A;  4NKP A;  4CLC A;  4BMW A; 
#chains in the Genus database with same CATH topology
 4QY5 A;  2HJ9 C;  4B9O A;  3O88 A;  3QP1 A;  3D9Y A;  3BQ8 A;  3NIA A;  3MKE A;  2M7U A;  1M6K A;  5DJU A;  4WUJ A;  5FEG A;  1W79 A;  4GOG A;  2BAS A;  3VV4 A;  3A3E A;  4S2P A;  2BTF P;  2ZQ9 A;  3KSF A;  3L9K A;  4I3A A;  3UB9 A;  1KE3 A;  5HPI A;  3UNW A;  1K55 A;  2PU2 A;  2PAV P;  2VZW A;  3UN7 A;  3UMD A;  1L2S A;  2K2N A;  4G3V A;  2Y2J A;  4OQI A;  4WMC D;  3NOT C;  2GNX A;  5HD5 A;  1ALQ A;  5HWT A;  3ZG9 B;  5FQ9 A;  5HX9 A;  4ZRR A;  4R70 A;  4AFI A;  1XKZ A;  1NJ4 A;  4JLF A;  3I7J A;  4YWZ A;  1IEL A;  4ZJ3 A;  4IVI A;  2VV6 A;  1VQQ A;  4NXF A;  3RH8 B;  2ZJ9 A;  4KZ9 A;  2K31 A;  1LSX A;  5CGW A;  2IWB A;  4DDY A;  4Y3I A;  2P9V A;  3EOI A;  2QKP A;  4DXC A;  1OTD A;  4DE0 A;  4EET B;  1I2S A;  3NOU C;  1ERM A;  1MWT A;  1KOU A;  2FFY A;  4OON A;  4QY6 A;  2GZA A;  3MS6 A;  1K55 C;  1TS6 A;  1YQS A;  5G4Y A;  4OH0 A;  3QNC A;  4QWO A;  1GA0 A;  3O5Y A;  4OOY A;  4B88 A;  3NC8 A;  3MZF A;  3V5M A;  5KZH A;  4FCF A;  2ZOI A;  4WMC A;  1NXY A;  4IBR A;  4DF6 A;  4HIA A;  3T4S A;  2DMW A;  2Z6C A;  4U0T A;  5A92 A;  1TD5 A;  4UA7 A;  1GSV A;  5EFW A;  4IBX A;  4R3A A;  4PM9 A;  4S2L A;  4MMN A;  2GJ3 A;  4GLQ A;  1MC0 A;  2ZQA A;  1ZC2 A;  2ZOH A;  1P9W A;  3DW0 A;  1SKF A;  2H0T A;  2Z6D A;  5DFY A;  3SS4 A;  5DTT A;  1XX2 A;  1GSX A;  5M18 A;  3VP2 A;  2LB9 A;  2ZQ8 A;  2Z2L B;  1D06 A;  4CPK A;  3FC7 A;  2YKF A;  4K0W A;  1GCE A;  5J8X A;  2L1M A;  2X01 A;  1SZV A;  1QMF A;  2EA9 A;  5DF8 A;  5F68 A;  4MBK A;  3H7W B;  2ZQD A;  2Y2L A;  2B18 A;  2J3W A;  2XA7 S;  1HTZ A;  4OVD A;  4KQQ A;  4QD4 A;  1QME A;  1F5M A;  3MF0 A;  1VEU B;  5DTS A;  3EQU A;  1T1A A;  1LSW A;  1W63 M;  4I39 A;  3GTC A;  1X0O A;  1XA7 A;  4Z1W A;  2Z2M B;  3BJN A;  3W4O A;  3IXG A;  4LRY C;  2J9O A;  3ULF A;  4K91 A;  4M3K A;  1PI4 A;  1K54 C;  5HFO A;  5HAQ A;  4EW7 A;  5EOE A;  1VEU A;  3FZC A;  3IF6 B;  4HP9 A;  3PTE A;  1F2K A;  1PFL A;  4BBU A;  3U4L P;  4LLO B;  3T4J A;  4NET A;  2PU4 A;  3LIF A;  4Y0T A;  1U60 A;  3R7W B;  3NY4 A;  3FKV A;  2V0U A;  4IJG A;  2JHE A;  2W1R A;  4KZ4 A;  3HLC A;  1T18 A;  3CWF A;  5M1A A;  2FZ0 A;  2PR5 A;  4XT2 B;  5FDS A;  3LR4 A;  3NDE A;  4P6B A;  4JF6 A;  2V1B A;  3UE3 A;  3P01 A;  3IF6 A;  1TEM A;  4EUZ A;  2NUT C;  1J9M A;  4H8R A;  3N8R A;  2QWS A;  5F1G A;  1K57 A;  3R7W A;  2WAE A;  3U2A A;  3ITB A;  2V8C A;  4MNR A;  4RX2 A;  2Y91 A;  2WYX A;  2P74 A;  1GA9 A;  4JGR A;  1MWR A;  4XT2 A;  3SH9 A;  5KIZ A;  4EV4 A;  2XD1 A;  4E6W A;  3WS2 A;  1LL8 A;  4IHQ A;  4LPZ A;  3IXH A;  1IYO A;  4E6X A;  5A8B A;  1P97 A;  2PRF A;  1N9N A;  3E0Y A;  3S22 A;  1MPL A;  2XR0 A;  1SDE A;  1NLY A;  1H8Z A;  5HL6 A;  2Y2O A;  3CHW P;  2Y2H A;  1BLH A;  3IF5 A;  1NRJ A;  2ZQC A;  3W4P A;  2XFS A;  3A3J A;  1NLZ A;  4BMW A;  3T12 B;  1TDG A;  2V0W A;  3T4L A;  1ACF A;  3BW6 A;  3QP2 A;  5FI7 A;  3PAE A;  4KZ3 A;  4PM5 A;  4P6Z S;  5I5L A;  2KDK A;  3GDI A;  2OOL A;  4R4R A;  4OPR A;  3DTK A;  1L0F A;  4WL9 A;  4MDZ A;  1K57 C;  3CPT B;  3HCY A;  4OQH A;  1IYQ A;  2V9A A;  3FPW A;  5TFQ A;  2EWW A;  3EGD C;  2W3G A;  4MCW A;  3HUO A;  4GCZ A;  3PBN A;  3WS4 A;  4NXG A;  3ZNT A;  1Y54 A;  1YPR A;  4M4X A;  2HDR A;  1NZO A;  1CJF A;  5F83 A;  2OWJ A;  3BFG A;  3NBL A;  3KSH A;  1KGG A;  4HY8 A;  2JE5 A;  1JTG A;  1MKM A;  3CPT A;  2XQZ A;  2Q9N A;  4WEJ A;  3WRT A;  1ESI A;  3VOY A;  5J4E A;  3VFH A;  5AQA A;  2Y2M A;  4DE3 A;  2WGI A;  3MMH A;  2H0Y A;  4Y17 A;  4HBU A;  4GDN A;  4L9G A;  3LR3 A;  3HL9 A;  1F9I A;  1YM1 A;  2BLS A;  3MZD A;  4S2I A;  3SZT A;  4LV0 A;  5CHU A;  2JKR M;  4P87 A;  3IWI A;  2C6W B;  3LIB A;  1YLY A;  3UPO A;  3CG5 A;  5EPH A;  5CEB A;  4LRZ E;  2D01 A;  5FA7 A;  1G6O A;  3KX0 X;  5F6A A;  3SH8 A;  3AGD A;  2ZL1 B;  3S7N A;  2OLU A;  3GQZ A;  3NEC A;  3IBJ A;  2I9V A;  5E2G A;  4JGQ A;  1LLB A;  1ERO A;  4PAU A;  3JVU A;  1LI9 A;  4JXG A;  4E3I A;  3BWL A;  4HQA A;  3V50 A;  3RJU A;  1JWP A;  4QB8 A;  1FCN A;  4RQ9 A;  4ID4 A;  1W7F A;  2ZL1 A;  4GDB A;  4OPQ A;  5CED A;  4HNB A;  3CUE C;  3GR2 A;  1IYP A;  3VP0 A;  3OBF A;  1NWZ A;  2DRW A;  1IOU A;  1XP4 A;  2J9P A;  3ZG0 A;  4KZA A;  4EWF A;  4X55 A;  4GW9 A;  3T50 A;  3LR5 A;  2JBF A;  4R1G A;  5JYO A;  1GHM A;  1TS7 A;  5EEC A;  2ZQ7 A;  3M6B A;  3ZNY A;  2VV8 A;  2FH5 A;  4Q0I A;  2XF3 A;  3HLE A;  1PWD A;  3SS3 A;  1FCO A;  3QP6 A;  4JBF A;  3VSL A;  4X56 A;  4OP8 A;  3UPN A;  5FSR A;  4D60 A;  4KUO A;  4OOL A;  5FAQ A;  3ISG A;  3VP4 A;  5HWV A;  2VV7 A;  4BL3 A;  5U47 A;  1BUE A;  5CHJ A;  2P08 A;  1S67 L;  1OME A;  1XJ3 A;  3UPP A;  1NRF A;  4E04 A;  3N6I A;  3V3R A;  4EBL A;  4NKP A;  4L9E A;  2ZC5 B;  3VSK A;  5AQ7 A;  2ZMV A;  4PKY A;  2HDU A;  2B95 A;  3AGE A;  3TW8 A;  1OTE A;  5E43 A;  3B47 A;  3MQ0 A;  3T1X A;  4JPM A;  2B02 A;  4FOF A;  4YIN A;  1STZ A;  4WZ4 A;  1OTB A;  2PYR A;  2W3E A;  3GVB A;  4O0P A;  1BZA A;  3IHA A;  4UA6 A;  1ZHH B;  4X1L A;  4G3W A;  5CEC A;  1IKI A;  1OTI A;  2WKR A;  4I3J A;  4UEY A;  4OPZ A;  1RCJ A;  3ZG7 B;  5A91 A;  1IKG A;  4HH2 A;  1O07 A;  2P9V B;  1DJB A;  3HJI A;  2JKT M;  2HP5 A;  1YLZ A;  5GHY A;  3VOZ A;  1W8Q A;  3L7H A;  2L0W A;  4GD8 A;  2A49 A;  4NEE D;  2V20 A;  4X1M A;  4GZB A;  1MBL A;  4EXO A;  4R4S A;  4LCL A;  1CEG A;  3LIC A;  3WS5 A;  2R78 A;  4K0X A;  3MFD A;  4FSF A;  4BJP A;  3MSH A;  2WAD A;  5FAT A;  5HAI A;  2HZ5 A;  2QHK A;  4NK3 A;  2INW A;  1Z6F A;  1UGU A;  4YFM A;  4Y15 A;  1WYB A;  4KQO A;  2EX6 A;  3LIE A;  1BUL A;  4LV2 A;  4PM6 A;  5HZH A;  2R9W A;  3VFF A;  2XRN A;  4OKP A;  5FQM A;  4CQH A;  2HF6 A;  4JGP A;  5J3W A;  4LRX C;  5MC7 A;  2P7J A;  2W0N A;  1AWI A;  1F98 A;  1ONH A;  2EX8 A;  4KZ6 A;  5DKL A;  3PAG A;  3MJQ A;  1XGJ A;  3JVV A;  5F5Y A;  4ZJ1 A;  2IA2 A;  2ZM0 A;  2QJ5 A;  4N1X A;  1G68 A;  5FEF A;  1ZTU A;  2OLV A;  3WWX A;  5EOO A;  3C8C A;  2EFU A;  3G35 A;  5M19 A;  1HD8 A;  1SHV A;  4KQD A;  2UWX A;  5TGF A;  1KGF A;  3VP1 A;  1BLC A;  1IEM A;  2ZD8 A;  1GSW A;  1DP9 A;  1S66 L;  1K54 A;  3O86 A;  2LB5 A;  3IT9 A;  3OPR A;  3UDF A;  2VKS A;  4OLD A;  1H5X A;  2C5W B;  5FDH A;  1E3U D;  1GHI A;  3UB7 A;  3K3D A;  4DN0 A;  2JN7 A;  3SOI A;  3GSG A;  4KG2 A;  3F1O B;  3FPV A;  2Y79 A;  1XFQ A;  4DKI A;  4MLL A;  2ZC3 B;  3A3D A;  4OQG A;  1BT5 A;  3V39 A;  3IQA A;  5HL1 A;  3BYD A;  4YNR A;  1CQA A;  4WBG A;  2XA7 M;  1CI8 A;  5D3O A;  2EFX A;  2Y2G A;  1V9Y A;  1ZG4 A;  3OPL A;  1I5Q A;  4OLG A;  5HWW A;  1G6A A;  1H8M A;  3RXX A;  5CXW A;  2XLN A;  4IED A;  3F1O A;  1FCM A;  3FKW A;  4Y5F A;  1YAX A;  1EW0 A;  2A3U A;  3MFX A;  3LGO A;  5A90 A;  2VK3 A;  4WEL A;  4B93 A;  3ZQ5 A;  1ES4 A;  4IUH A;  3ZCZ A;  4DRT A;  4N92 A;  4MN7 A;  3PBT A;  2WZX A;  2J7V A;  4I38 A;  3MXS A;  1JWV A;  1OT9 A;  4P0M A;  5FAP A;  4F3L A;  3NCK A;  3DAV A;  1E3U A;  4C75 A;  1JWZ A;  1AXB A;  3UB5 P;  3VP3 A;  3SS5 A;  2WKI A;  2J8Y A;  4KG6 A;  3LO7 A;  3ZHH A;  3M2K A;  4QHC A;  3PBR A;  2PBY A;  5CGS A;  1OT6 A;  5FAO A;  1YLW A;  2G7U A;  5IU1 A;  3S1Y A;  3F1N B;  4OPY A;  3MQO A;  3DBA A;  4LV1 A;  3ZDJ A;  1KE0 A;  1BTL A;  2HPB A;  2G2W A;  5FQQ A;  4LCM A;  4XUX A;  5JYP A;  3QNB A;  3IWO A;  1LHY A;  4WZ5 C;  2PHY A;  1S6R A;  3KYZ A;  4IVK A;  3JPU A;  3IWQ A;  2HJE A;  2ZM2 A;  3LI9 A;  2PD8 A;  4X6T A;  4RYE A;  3LYX A;  5G4Z A;  4NXB A;  5E2H A;  4R38 A;  2VLG A;  5GLA A;  3F1N A;  3OZH A;  1HZO A;  3QHY A;  1FIK A;  5KSH A;  2KOI A;  5AQ9 A;  3DTI A;  3VOL A;  3PXP A;  1W8Y A;  1N9L A;  4DE2 A;  5AQB A;  4Y0O A;  3V3S A;  1E25 A;  1PYY A;  3KSG A;  4R23 A;  2D02 A;  3UE1 A;  2O0Y A;  4WLA A;  2JKF A;  1H3Q A;  2WZZ A;  3G4P A;  1KVL A;  2WUQ A;  5EVL A;  3KYQ A;  3IX8 A;  3MZE A;  4BQM A;  5HDC A;  4LV3 A;  2VJW A;  2B5R A;  4P85 A;  2EXA A;  4HJ3 A;  4BL2 A;  4P6Z M;  4Q0J A;  4B4Z A;  2X71 A;  3F1P B;  2Y2N A;  4MN5 A;  3UDI A;  5LBR A;  4FTX A;  3B33 A;  5DTK A;  1K4F A;  3HLF A;  4BBV A;  2PDR A;  1XJ2 A;  4E3K A;  2QYB A;  1VB6 A;  2WKH A;  4EEP A;  3ICY A;  3QP4 A;  4S2K A;  1L3L A;  1W63 Q;  3DWK A;  4ARZ B;  3VE3 A;  2E8I A;  3C7U A;  3D3O A;  5GLD A;  1CF0 A;  2FFF B;  3T1R A;  4X69 A;  5DKK A;  5HAP A;  3F1P A;  1P9R A;  1GHP A;  2JKG A;  3BLM A;  1YMS A;  4KEN B;  3O87 A;  3P7N A;  3CI6 A;  3G31 A;  2M1C A;  3UO9 A;  4CLC E;  4F94 A;  4LGW A;  4G3K A;  1IYS A;  4ARZ A;  5L09 A;  3C4O A;  4GD6 A;  2GX5 A;  4S2O A;  4A5R A;  2RL3 A;  4UQI S;  3T4T A;  2J3T D;  5HDD A;  2IWC A;  2YKH A;  3JYI A;  5AVF A;  2Y2I A;  1PWC A;  5EM0 A;  2L4R A;  2OSU A;  1NYM A;  5TJJ A;  1TVF A;  5IT5 A;  1G28 A;  3LIA A;  2H28 A;  3CJM A;  3CUE A;  5TR7 A;  1C3B A;  4ESP A;  3W8K A;  4Y0U A;  1YMX A;  1ODV A;  5F69 A;  4DE1 A;  3IH9 A;  4PHT A;  5FAS A;  3PYP A;  1FSW A;  2IWD A;  4N9K A;  2ZC4 B;  2W1T A;  4HOI A;  4E3L A;  3NHQ A;  4ME4 A;  2Y2P A;  2VEA A;  4KZB A;  1LT0 A;  4CLC D;  3LEQ A;  2I72 A;  5C5K A;  4KZ7 A;  5F82 A;  3NDG A;  3NJA A;  2PR6 A;  5CX7 A;  2ZC6 B;  5FQJ A;  1K25 A;  1JNU A;  4JXW A;  3RXW A;  4ZDX A;  3UDX A;  1WE4 A;  3ZVT A;  2WKP A;  5FQK A;  4I5S A;  3FWL A;  5KSC A;  3UB6 A;  1OJ5 A;  3CAX A;  1WA9 A;  3HVF A;  3Q7V B;  2PT7 A;  4YOF A;  3ZFZ A;  4JXS A;  1KDW A;  2J80 A;  2XK1 A;  4DMZ A;  3BLS A;  4RA7 A;  4PM7 A;  3TE8 A;  3N8L A;  3A0R A;  3N4I A;  2XSS A;  1TF1 A;  2ZLY A;  1N4O A;  1T1C A;  3B3X A;  5DF9 A;  2ZC7 A;  5DFX A;  3ZYT A;  4DJ2 A;  1H0M A;  3Q7V A;  3E2L A;  4R3B A;  2VGL S;  3TOI A;  4CLC A;  4HHD A;  4XUZ A;  3C4P A;  3HBR A;  2VGL M;  4PPR A;  1YSP A;  1KGE A;  5CER A;  4GNU A;  2JKR I;  3OPP A;  2XFT A;  2OAQ 1;  3LCE A;  2EWV A;  3C30 A;  5J7E A;  4EU0 A;  3TJZ C;  1SKO B;  1E4D A;  2EXB A;  3KSI A;  5GL9 A;  4Y7P A;  4UAA A;  1P0Z A;  2J3T C;  5A93 A;  4CJN A;  5K5B A;  1YKD A;  4KUK A;  2XRO A;  2EX2 A;  2ZMF A;  3HLD A;  2K7S A;  3WS0 A;  4X25 A;  3MXR A;  3MR0 A;  2NUP C;  5TBM B;  5EVI D;  3M2J A;  4E3M A;  1EWZ A;  4Y13 A;  3GRJ A;  2DCF A;  3BRM A;  1SKO A;  3PBQ A;  5HDS A;  3ZVW A;  2W3H A;  4BD0 A;  3PR6 A;  3T4K A;  2H10 A;  3FV7 A;  4O01 A;  3VMA A;  3S7Q A;  3V67 A;  3BFD A;  1RGZ A;  4CLC C;  4N9L A;  2VGK A;  5TBM A;  3IS2 B;  1Q2P A;  1YT4 A;  2M7V A;  1W5D A;  3G30 A;  5EVI B;  4XXR A;  3FG8 A;  1L0E A;  2O9A A;  1KVM A;  3P98 A;  3S7P A;  4BD1 A;  2KX6 A;  4WF0 A;  3A0V A;  4MBH A;  4UHU A;  3WRZ A;  3QP5 A;  3LY3 A;  3P09 A;  4PKY G;  4HH3 A;  3A3F A;  1DP8 A;  2BG1 A;  3MBZ A;  3N7W A;  4LEN A;  3C7V A;  2O9B A;  4S2N A;  5EVE A;  3IS2 A;  3D72 A;  4RX3 A;  2QMI A;  4BWI A;  4C3Q A;  2G2U A;  4U3T A;  1MY8 A;  1XFN A;  3ZG5 A;  5EVI A;  1UWP X;  3C5A A;  5G18 A;  4WYY A;  3Q1F A;  4WM9 A;  5AVE A;  2AVX A;  3H82 B;  1H8Y A;  5DVA A;  4EER A;  2WAF A;  4JF4 A;  2HP6 A;  4EBP A;  4HEF A;  3IH8 A;  3W2Z A;  3B42 A;  3MXQ A;  4R6L A;  2OWH A;  3UME A;  1G5U A;  1Z09 A;  2VX8 A;  5E2E A;  4HES A;  3OC2 A;  1JTD A;  3T1S A;  4S2M A;  1WYC A;  4ZBE A;  3BFF A;  2XDM A;  1FR6 A;  2HGV A;  1BLP A;  2JC7 A;  3H82 A;  3G2Y A;  3ZG8 B;  2E8J A;  3OPH A;  4NG2 A;  4ZAM A;  3IX4 A;  1BLS A;  3ITA A;  1TS8 A;  3DTM A;  2O99 A;  2Q9M A;  3IXD A;  3HLG A;  3R4K A;  5HPF A;  3G6O A;  2XGN A;  2JKT I;  4S2N C;  3A0S A;  4NXE A;  2A24 B;  5EVI C;  2PYP A;  2WGV A;  5IS1 A;  2ZMA A;  1OJG A;  5EV0 A;  4R0Q A;  4MN6 A;  1YSQ A;  2VGJ A;  1Q2Q A;  3LY4 A;  5GLB A;  5CHM A;  3DTE A;  4FH2 A;  3C38 A;  2V1A A;  1V9Z A;  3MQQ A;  3CMZ A;  4EQI A;  1NY0 A;  3WS1 A;  4IUK A;  1S4R A;  2A24 A;  2PBD P;  3HLB A;  4QPR A;  4JF5 A;  4F3L B;  4O7D A;  3IHB A;  5FQI A;  3K3C A;  1FOF A;  1TDL A;  4N1H A;  4WZ5 A;  3TSG A;  4DDS A;  4EES A;  2PD7 A;  4FD8 A;  5EUA A;  3LI8 A;  3A3I A;  3E4O A;  4QU3 A;  2ZM8 A;  3CZD A;  4GN2 A;  4E3N A;  1OTA A;  4GJ4 A;  4L9F A;  5DF7 A;  3IX3 A;  2Y2Q A;  4JGO A;  5CTN A;  1FSY A;  3PBO A;  4O8G A;  3H7W A;  3LUQ A;  1S1Z A;  3E4Q A;  1XXM A;  1N9O A;  1L0D A;  3O3V A;  3BEB A;  2MJ6 A;  1SDN A;  1L0G A;  1PWG A;  1FR1 A;  1LL9 A;  4LFU A;  4ETX A;  5DJT A;  2XH9 A;  4DXB A;  3UY6 A;  1MWU A;  4OQ0 A;  5KMW A;  2QZ6 A;  1K0K A;  5L2F A;  4ZJ2 A;  4GS9 B;  3W4Q A;  3GEC A;  3BY9 A;  4ZTK A;  2H5S A;  2Q0O A;  2Y2K A;  3BY8 A;  1D1J A;  3G32 A;  2HDS A;  2HP9 A;  5L10 A;  1I2W A;  4PMA A;  4BBT A;  1VM1 A;  1N9B A;  1D7E A;  3KYE A;  5CGX A;  1ERQ A;  3IBR A;  2RCX A;  4GKU A;  3EQV A;  3S4X A;  1S1Y A;  1J3W A;  3E4P A;  3HJK A;  4K08 A;  1NZU A;  3H9W A;  4WEK A;  3G2Z A;  3G34 A;  4GS9 A;  1FIL A;  1K6S A;  2OV5 A;  3UE0 A;  1T1B A;  3RTY A;  5EM1 A;  4BEN A;  2QPN A;  4U0X A;  3EEH A;  3NOP C;  1JVJ A;  5HW3 A;  1PW1 A;  4QJG A;  2P04 A;  4KZ5 A;  3S7O A;  3OLO A;  1ES2 A;  1OPX A;  3FYZ A;  3BEC A;  3OOV A;  1RP5 A;  1XJ4 A;  3NI9 A;  4GB7 A;  1LL5 A;  4OP5 A;  4II7 A;  1S0W A;  2QJ7 A;  1A0K A;  4H6J B;  2GDN A;  1DJA A;  1PZP A;  1KE4 A;  3T4O A;  1K56 D;  3E2K A;  4R3J A;  3T4Q A;  2V8F A;  2R9X A;  4Q0H A;  1MZU A;  3EGX C;  1CI9 A;  2XEP A;  1PNE A;  3IF6 C;  5L8M A;  4HJ4 A;  4X68 A;  3T1Q B;  2DNS A;  4WN5 A;  1NYY A;  4B4X A;  3SH7 A;  2VA0 A;  3Q82 A;  1FQG A;  4EUV A;  2Y55 A;  1SCW A;  4H6J A;  2WGW B;  2WK0 A;  2EX9 A;  3LR0 A;  4Z9Q A;  5FI2 A;  1HVB A;  2A2L A;  2XD5 A;  3LEZ A;  4X53 A;  4UA9 A;  3DWZ A;  4PM8 A;  4OOM A;  3M6H A;  1K4E A;  4RVA A;  1ES3 A;  3CLO A;  1O7E A;  3MKF A;  1TS0 A;  1XA1 A;  2OAP 1;  4DJ3 A;  3QP8 A;  2Y59 A;  1ES5 A;  4E3J A;  1BSG A;  1M40 A;  4HP4 A;  3EWK A;  4EQ1 A;  1VHM A;  2W1T B;  3PBS A;  1YLJ A;  3PHY A;  2WGW A;  1XJ6 A;  4ETZ A;  3OCN A;  1XGI A;  1BYW A;  3NUL A;  5AJG A;  4EBN A;  4UQI M;  3UB8 A;  5CRF A;  2W3F A;  4D2O A;  1VET B;  3E98 A;  1K56 A;  1PIO A;  5FL3 A;  4JXV A;  4FH4 A;  3BQA A;  3HUN A;  4BLM A;  1K6R A;  4L0L A;  2V2F F;  4MBF A;  3HLW A;  2CMN A;  1UWN X;  3OCL A;  4GHI B;  3HRE A;  4HJ6 A;  2UV0 E;  1RGY A;  3LID A;  3D4F A;  1VET A;  2CC1 A;  1CEF A;  3CIT A;  2HDQ A;  2ACG A;  2JCH A;  3GMW A;  4Q8I A;  4KG5 A;  3UE6 A;  2WKE A;  2Y4A A;  1DP6 A;  1MWS A;  5BOH A;  4Y2F A;  1YLP A;  1T19 A;  1Y4O A;  4S2J A;  3Q07 A;  5HD3 A;  4GHI A;  3GV9 A;  3AGF A;  5HSQ A;  1PW8 A;  4I3I A;  2W27 A;  4HBT A;  1PI5 A;  4CLC B;  3TRC A;  1LI0 A;  2Y8H A;  3TG9 A;  1XPB A;  3ZGA B;  1ONG A;  3BFE A;  1HLU P;  3Q81 A;  1K38 A;  1ZG6 A;  3RFB A;  1DY6 A;  2HV1 A;  5EE8 A;  2KLI A;  1PZO A;  5CTM A;  3BM6 A;  2V1Z A;  1S4S A;  4JKT A;  3IXB A;  3Q7Z A;  1ZKJ A;  4E3O A;  1EI5 A;  2O9C A;  1YLT A;  2WKQ A;  3HUM A;  1KDS A;  5F1F A;  5L07 A;  3N8S A;  5I94 A;  3SW1 A;  5GHZ A;  1LSV A;  3LFV A;  2W3D A;  1PRQ A;  1IFQ A;  2X02 A;  3EEA A;  5GLC A;  4MEZ A;  1Y28 A;  4KQR A;  5HAR A;  2ZBB A;  1DRM A;  5IHV A;  3VE4 A;  4C6Y A;  1ESU A;  4HI4 A;  3BFC A;  5GHX A;  4EEU A;  4FUW A;  1CK3 A;  1DJC A;  3KO6 A;  1MKI A;  3K2N A;  1MXO A;  5FI6 A;  5E2F A;  4KZ8 A;  3C2W A; 
#chains in the Genus database with same CATH homology
 3G6O A;  2HJE A;  2HJ9 C;  3LI9 A;  4B9O A;  2PD8 A;  2JKT I;  3BQ8 A;  3LYX A;  5G4Z A;  4NXB A;  2M7U A;  4R38 A;  3A0S A;  2JKR M;  2VLG A;  4NXE A;  2A24 B;  2PYP A;  5DJU A;  3F1N A;  4WUJ A;  5IS1 A;  1OJG A;  5KSH A;  4MN6 A;  1YSQ A;  2BAS A;  2KOI A;  3VV4 A;  3LIB A;  3VOL A;  3KSF A;  3PXP A;  1N9L A;  4I3A A;  3UB9 A;  3KSG A;  5HPI A;  2D02 A;  4LRZ E;  2O0Y A;  2D01 A;  3C38 A;  4WLA A;  2VZW A;  2V1A A;  1H3Q A;  3UMD A;  1G6O A;  3KX0 X;  2K2N A;  4G3V A;  1V9Z A;  3MQQ A;  5F6A A;  3KYQ A;  3S7N A;  3NOT C;  2GNX A;  4IUK A;  1S4R A;  2A24 A;  5HDC A;  5HD5 A;  3IBJ A;  4QPR A;  2I9V A;  5HWT A;  4JGQ A;  4F3L B;  2VJW A;  4PAU A;  3JVU A;  4ZRR A;  4R70 A;  3K3C A;  4AFI A;  4EES A;  4HJ3 A;  2PD7 A;  4YWZ A;  4P6Z M;  4Q0J A;  3F1P B;  3LI8 A;  3BWL A;  3E4O A;  2VV6 A;  4MN5 A;  4HQA A;  4NXF A;  5LBR A;  3RH8 B;  3B33 A;  1OTA A;  2K31 A;  4BBV A;  2PDR A;  4GJ4 A;  4L9F A;  1XJ2 A;  4RQ9 A;  2QYB A;  1LSX A;  1VB6 A;  4EEP A;  3ICY A;  4JGO A;  4Y3I A;  1W63 Q;  4HNB A;  3CUE C;  3PBO A;  4ARZ B;  3EOI A;  3VE3 A;  4O8G A;  3H7W A;  2QKP A;  1OTD A;  3OBF A;  3LUQ A;  4EET B;  1S1Z A;  1NWZ A;  3D3O A;  1IOU A;  3E4Q A;  3NOU C;  1N9O A;  5DKK A;  2MJ6 A;  3F1P A;  1KOU A;  4GW9 A;  3T50 A;  1P9R A;  3LR5 A;  2GZA A;  4ETX A;  5DJT A;  1TS6 A;  5G4Y A;  3P7N A;  1TS7 A;  3CI6 A;  2VV8 A;  2FH5 A;  2M1C A;  3O5Y A;  4Q0I A;  4GS9 B;  4CLC E;  3GEC A;  4G3K A;  4ARZ A;  3BY9 A;  2ZOI A;  2GX5 A;  3BY8 A;  4KUO A;  4OOL A;  4HIA A;  4UQI S;  3T4T A;  2J3T D;  5HDD A;  2YKH A;  3T4S A;  2DMW A;  2Z6C A;  4BBT A;  1TD5 A;  5AVF A;  1GSV A;  1D7E A;  5EFW A;  5HWV A;  2VV7 A;  2L4R A;  3IBR A;  4R3A A;  3EQV A;  1S1Y A;  3E4P A;  2P08 A;  3HJK A;  5TJJ A;  5IT5 A;  4K08 A;  1G28 A;  3LIA A;  1S67 L;  4MMN A;  2H28 A;  3CUE A;  1XJ3 A;  3H9W A;  4WEK A;  2GJ3 A;  4GLQ A;  1MC0 A;  4E04 A;  1ODV A;  4GS9 A;  5F69 A;  4PHT A;  4NKP A;  1T1B A;  2ZOH A;  3RTY A;  3PYP A;  4L9E A;  1P9W A;  2ZMV A;  4PKY A;  3TW8 A;  3EEH A;  2Z6D A;  3NOP C;  1OTE A;  5DFY A;  2W1T A;  3B47 A;  3MQ0 A;  4HOI A;  1GSX A;  3NHQ A;  2B02 A;  4FOF A;  2LB9 A;  4ME4 A;  1STZ A;  2P04 A;  1D06 A;  1OTB A;  2PYR A;  2VEA A;  2W3E A;  3S7O A;  3OLO A;  1LT0 A;  4O0P A;  4CLC D;  3FC7 A;  1OPX A;  1ZHH B;  2YKF A;  4G3W A;  1OTI A;  2WKR A;  4I3J A;  4UEY A;  5C5K A;  3OOV A;  1XJ4 A;  3NJA A;  2L1M A;  2PR6 A;  5CX7 A;  4HH2 A;  2EA9 A;  4II7 A;  5F68 A;  1JNU A;  2QJ7 A;  3HJI A;  2JKT M;  3H7W B;  2B18 A;  2J3W A;  2XA7 S;  2WKP A;  4H6J B;  1F5M A;  4I5S A;  2L0W A;  3UB6 A;  1OJ5 A;  3CAX A;  1WA9 A;  3MF0 A;  3T4O A;  4NEE D;  2PT7 A;  3EQU A;  1T1A A;  4YOF A;  3T4Q A;  4Q0H A;  1MZU A;  4EXO A;  1LSW A;  1W63 M;  4I39 A;  3EGX C;  1X0O A;  3LIC A;  2J80 A;  4DMZ A;  4Z1W A;  5L8M A;  3BJN A;  2R78 A;  4FSF A;  4HJ4 A;  4LRY C;  3TE8 A;  3ULF A;  4BJP A;  3A0R A;  4WN5 A;  2XSS A;  1TF1 A;  2VA0 A;  4EUV A;  2QHK A;  4H6J A;  2INW A;  1T1C A;  1UGU A;  5DF9 A;  3LR0 A;  4KQO A;  5DFX A;  3ZYT A;  2A2L A;  3LIE A;  4DJ2 A;  4EW7 A;  5HZH A;  4CQH A;  2XRN A;  4HP9 A;  4OOM A;  2HF6 A;  4JGP A;  5J3W A;  4BBU A;  3CLO A;  2VGL S;  4LLO B;  4LRX C;  3T4J A;  5MC7 A;  2P7J A;  1TS0 A;  2W0N A;  3LIF A;  4CLC A;  4HHD A;  1F98 A;  2OAP 1;  5DKL A;  3R7W B;  4DJ3 A;  2VGL M;  3MJQ A;  2V0U A;  1YSP A;  4IJG A;  2JHE A;  3JVV A;  2W1R A;  5F5Y A;  4HP4 A;  3EWK A;  4EQ1 A;  2JKR I;  1VHM A;  2IA2 A;  2W1T B;  1T18 A;  2OAQ 1;  3CWF A;  3PBS A;  2EWV A;  2QJ5 A;  3PHY A;  3C30 A;  1XJ6 A;  4ETZ A;  3OCN A;  2FZ0 A;  2PR5 A;  1ZTU A;  5J7E A;  4XT2 B;  3LR4 A;  1BYW A;  5AJG A;  4EU0 A;  3TJZ C;  3C8C A;  2V1B A;  4UQI M;  3UE3 A;  3P01 A;  3UB8 A;  3KSI A;  2W3F A;  4KQD A;  3E98 A;  5FL3 A;  2NUT C;  1P0Z A;  2J3T C;  5K5B A;  1YKD A;  4KUK A;  2XRO A;  2QWS A;  1GSW A;  3BQA A;  1DP9 A;  2ZMF A;  3R7W A;  1S66 L;  2K7S A;  3U2A A;  2LB5 A;  3MR0 A;  2NUP C;  4L0L A;  5TBM B;  2CMN A;  1UWN X;  4JGR A;  3OCL A;  4GHI B;  2VKS A;  4XT2 A;  5KIZ A;  4HJ6 A;  3PBQ A;  5HDS A;  3LID A;  2W3H A;  3PR6 A;  1LL8 A;  3T4K A;  4IHQ A;  4LPZ A;  3CIT A;  3UB7 A;  3K3D A;  4DN0 A;  2JN7 A;  5A8B A;  1P97 A;  1N9N A;  4O01 A;  3F1O B;  3FPV A;  3UE6 A;  3E0Y A;  3S7Q A;  2Y79 A;  3V67 A;  1DP6 A;  1XFQ A;  4CLC C;  1NLY A;  4Y2F A;  5HL6 A;  5TBM A;  1T19 A;  3IS2 B;  1NRJ A;  4YNR A;  2M7V A;  5HD3 A;  2XA7 M;  4GHI A;  1NLZ A;  1V9Y A;  4BMW A;  3FG8 A;  2O9A A;  3S7P A;  5HSQ A;  2V0W A;  3T4L A;  4I3I A;  2KX6 A;  2W27 A;  5HWW A;  4WF0 A;  3A0V A;  3BW6 A;  1H8M A;  4CLC B;  4P6Z S;  4PKY G;  3TRC A;  5I5L A;  2KDK A;  3F1O A;  2Y8H A;  3GDI A;  2OOL A;  4HH3 A;  4Y5F A;  1YAX A;  1DP8 A;  1EW0 A;  4WL9 A;  3MFX A;  3HCY A;  4MDZ A;  2O9B A;  2V9A A;  3RFB A;  3IS2 A;  3D72 A;  4WEL A;  4B93 A;  3ZQ5 A;  2HV1 A;  4BWI A;  3FPW A;  4IUH A;  1XFN A;  2EWW A;  3EGD C;  4MN7 A;  3PBT A;  2W3G A;  2KLI A;  1UWP X;  4MCW A;  4GCZ A;  3PBN A;  1S4S A;  4NXG A;  4I38 A;  5AVE A;  3H82 B;  1OT9 A;  4F3L A;  4EER A;  4M4X A;  2O9C A;  2OWJ A;  2WKQ A;  3W2Z A;  3B42 A;  3KSH A;  3MXQ A;  4R6L A;  4HY8 A;  2OWH A;  3UME A;  1MKM A;  2VX8 A;  4WEJ A;  3SW1 A;  1LSV A;  3LFV A;  3OC2 A;  2W3D A;  1IFQ A;  3PBR A;  3EEA A;  5J4E A;  1Y28 A;  1OT6 A;  2G7U A;  5IU1 A;  2ZBB A;  2HGV A;  1DRM A;  3F1N B;  3MMH A;  3MQO A;  3DBA A;  3VE4 A;  3H82 A;  4HI4 A;  4EEU A;  3KO6 A;  1TS8 A;  3LR3 A;  4L9G A;  1F9I A;  3K2N A;  2O99 A;  2PHY A;  3KYZ A;  3C2W A;  3R4K A;  5HPF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...