3FPWA

Crystal structure of hbps with bound iron
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
140
structure length
140
Chain Sequence
b'PVAARGGELTQSTHLTLEAATKAARAAVEAAEKDGRHVSVAVVDRNGNTLVTLRGDGAGPQSYESAERKAFTAVSWNAPTSELAKRLAQAPTLKDIPGTLFLAGGTPVTAKGAPVAGIGVAGAPSGDLDEQYARAGAAVL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Extracellular haem-binding protein
molecule tags Heme binding protein
source organism Streptomyces reticuli
publication title The oligomeric assembly of the novel haem-degrading protein HbpS is essential for interaction with its cognate two-component sensor kinase
pubmed doi rcsb
total genus 43
structure length 140
sequence length 140
ec nomenclature
pdb deposition date 2009-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03928 Haem_degrading Haem-degrading
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.150 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3fpwA01
3FPVA 2A2LA 3FPWA 4BMWA 4CLCE 4CLCC 5CX7A 4CLCB 4CLCA 4CLCD 4NKPA
chains in the Genus database with same CATH superfamily
2OV5A 5J7EA 1DJBA 1DP9A 5L8MA 1YT4A 5FAOA 3VFHA 3MXQA 5A91A 4DDYA 4KQRA 4ZBEA 4UA7A 2ZMFA 3MXSA 3MZDA 1T1AA 3QP4A 2Y2GA 3CJMA 2PU2A 3LR3A 2P04A 4HEFA 3VSKA 1TDGA 3DWZA 3RXWA 1KDWA 4KZ6A 3TOIA 3UNWA 4ZTKA 5G4YA 1RP5A 3PBNA 4DXCA 1D06A 4NEED 1GHMA 3HREA 5DTTA 2DMWA 2ZQAA 3C7UA 3O88A 4RVAA 2XH9A 3KX0X 5DVAA 2EFXA 3HLBA 3LI9A 2OWJA 2L4RA 3IBJA 1CF0A 1MBLA 2EX9A 5HDCA 4E3IA 2EX6A 1L3LA 4GJ4A 1LT0A 5LBRA 5GLCA 4II7A 1P0ZA 4Q0IA 2UV0E 4PAUA 2INWA 2JCHA 5CHUA 2WK0A 2ZM0A 3IWQA 1XKZA 2WGIA 5GHXA 1FSWA 1GHIA 3IF5A 4RYEA 2H28A 5FEGA 1M6KA 3UPPA 2A2LA 2O9BA 2QMIA 3UB5P 4QB8A 1OJ5A 2ACGA 4GZBA 3NOPC 1CQAA 3VP2A 3BEBA 4PM8A 3A0VA 4FOFA 4L9GA 3UDXA 2V1ZA 4P6BA 4JXGA 4F94A 1VHMA 1YM1A 4H6JA 2PAVP 1IELA 3PXPA 3G6OA 1LSXA 1IYSA 2WGWA 4ARZA 4PKYA 4DJ3A 2W1TA 2M7UA 5KSCA 2IWBA 2ZL1B 3Q07A 4LV0A 2ZQCA 1N9NA 4ZJ3A 1ES3A 3LR5A 4O0PA 1VQQA 1XJ2A 5F1GA 2WKQA 4BBVA 1ESUA 2Y2IA 2Y2JA 5DTKA 2ZLYA 1C3BA 3MFXA 3BRMA 3NI9A 4I38A 2WYXA 3MSHA 4OOLA 4S2OA 4GS9B 5FASA 3BY8A 1PWDA 1K55C 3P01A 4KUKA 5IU1A 3ZG0A 3VV4A 3MS6A 5DJTA 5M1AA 3IQAA 5I94A 4N92A 4G3WA 3S1YA 2QYBA 1AWIA 1PW8A 2FH5A 1BSGA 4Q0HA 1MWSA 4UEYA 1DJAA 1FCNA 5TBMB 3DTKA 1ES5A 5EOOA 3A3FA 2J3TC 4GB7A 4K0WA 3C2WA 3IH8A 3LI8A 3UPNA 3HLEA 3CLOA 3JYIA 5DFXA 1KE4A 3BECA 4B4ZA 2V2FF 4Y0UA 5DF9A 1SKFA 1NZUA 1ACFA 3IWOA 1EW0A 1TS7A 1CK3A 1X0OA 1VEUB 3GTCA 2J7VA 3K3DA 3PBSA 2PBYA 1S1ZA 2K2NA 2P9VA 5J3WA 4JXWA 2WKEA 1GSVA 1GA0A 1YLPA 1MWRA 1ES4A 2PT7A 3C7VA 4X56A 3VP3A 2A3UA 4Y15A 3G2YA 4MNRA 3LGOA 4GD6A 4EETB 3DTIA 5HW3A 4MBFA 4M3KA 2B02A 1OTBA 2XQZA 3S7NA 3NHQA 5IS1A 2D02A 3ZG8B 5F1FA 3CUEA 1G5UA 2VGJA 4DE1A 1PWGA 5EM1A 3W8KA 3IH9A 1S4RA 3HVFA 5HDDA 4EUVA 5FATA 1LSWA 4G3VA 4EQ1A 2VK3A 1XGIA 5F69A 1LI9A 2Y2NA 2RCXA 1TS0A 4OH0A 1ERMA 1JTGA 3ZGAB 3NDEA 3UE3A 1QMFA 4BQMA 2W1TB 2EFUA 3QP2A 4X1MA 5HAPA 3WRZA 3OLOA 4GW9A 3WS4A 5GHYA 4E3LA 2W3HA 1V9YA 4R0QA 3BQAA 4PM6A 2WUQA 4R3JA 3T4OA 4LRZE 5GL9A 2Z2LB 4S2LA 1O7EA 3HLGA 5A8BA 4OQHA 4E3MA 3V39A 4HBTA 5DKLA 1BLPA 4BD0A 4RX3A 3FWLA 2XDMA 4C75A 3G30A 3BWLA 3LR0A 1XA1A 3WRTA 1IYPA 1G6AA 3LIEA 2JKFA 4WLAA 2H5SA 4OPRA 5FQIA 1VEUA 1W8YA 4GN2A 2ZD8A 4P6ZS 1J9MA 1MWTA 2V0WA 5F6AA 3E2KA 3HLCA 5A92A 3KSHA 4Y7PA 5DFYA 2Z6CA 3NOTC 1HZOA 5FI2A 3H7WA 1JWPA 1P97A 3LIDA 3BQ8A 5FQJA 1NYYA 2PU4A 3W2ZA 1FCOA 5GLBA 5HPFA 3A0SA 2VGLS 1MZUA 2JKTM 3PTEA 4S2NC 3LIFA 5AVEA 4MBKA 4FH2A 5HX9A 2E8JA 5CEBA 4GHIA 2P9VB 3G31A 4KZ5A 2XROA 3P7NA 5TFQA 5DKKA 2EWWA 3KYZA 4K08A 1IKGA 4IUHA 4DKIA 5E2EA 3AGEA 3EWKA 2HPBA 4MEZA 4BJPA 2OAQ1 4QHCA 1Y4OA 3SH8A 2ZOIA 5TR7A 3UMDA 4N1XA 1IOUA 3O3VA 5E2HA 1SKOA 2ZQ8A 4DMZA 2QJ7A 2ZMVA 2GJ3A 3BYDA 4WZ5A 1UWNX 3R7WA 1H3QA 3FPWA 5L10A 1YMSA 1LI0A 2GZAA 1LL9A 2HJ9C 2LB9A 3TW8A 3H82B 3IBRA 1DP8A 1XGJA 1Y54A 1YQSA 1GHPA 1KE3A 3ULFA 4X53A 4S2IA 2AVXA 1V9ZA 2WGWB 4ARZB 1BUEA 3LFVA 3KSIA 3T1SA 2EA9A 2BASA 4QY5A 2W3EA 4O8GA 3MQQA 2P7JA 4CLCE 3T4TA 4QJGA 1H8MA 1TS6A 2PDRA 4PMAA 1F2KA 4HJ6A 3H82A 4JGPA 1JWZA 2PBDP 2ZC6B 4RA7A 4EEUA 1PZOA 4BBUA 1LHYA 1I5QA 4MN6A 2ZC7A 1SZVA 1UGUA 2L0WA 2ZM8A 5KIZA 1KVMA 2IWCA 4JXSA 4YFMA 5CTNA 5AQ9A 3M2JA 5D3OA 3TE8A 4WF0A 3JVUA 3UE6A 4MN5A 1K4EA 2NUPC 2B95A 1YLWA 3ZFZA 5F68A 3Q81A 5E2FA 2JC7A 3SW1A 3C5AA 3R4KA 4NXFA 2Y79A 3BFEA 5E43A 3OC2A 3OOVA 1PZPA 3IXDA 2OLUA 5FEFA 2HV1A 2FFYA 3HUMA 4EW7A 1H5XA 3WS5A 5DTSA 4CLCA 1N9OA 3HLDA 4I39A 4XXRA 3GV9A 3U2AA 3MKEA 3A3IA 2CC1A 1WE4A 1A0KA 2W3DA 4WMCD 4HP4A 5GLDA 4ETZA 5CECA 2A24A 4S2MA 2PR5A 3SZTA 5HD5A 3Q7ZA 2VEAA 2UWXA 2Y2PA 4MCWA 3ZG5A 3EEAA 4DF6A 2J80A 2KLIA 1CI8A 1BLCA 1K6SA 1CEGA 3VFFA 3EQUA 2V1BA 2JN7A 1OMEA 3ZVTA 4EESA 4FD8A 4LCLA 2VA0A 3GVBA 4OOMA 2WZXA 4S2PA 3G34A 4PHTA 5EVIA 2ZM2A 2BG1A 5G18A 3ZNYA 4WELA 3DW0A 4LV1A 2WGVA 4Y2FA 4IBRA 3LICA 3ISGA 4XUZA 4L9FA 4JKTA 3LR4A 2VZWA 4EBNA 3QNBA 4ETXA 3TG9A 1JVJA 4QPRA 3G32A 3M6HA 3DTMA 1K54C 3NIAA 4DE3A 3VE4A 5GLAA 3E4PA 4IVIA 3MJQA 2HGVA 5CHMA 4Q8IA 1PI4A 2VGKA 4E3NA 3LIAA 3MMHA 2H10A 3G4PA 4BL2A 4R6LA 1J3WA 4LFUA 1K6RA 2KOIA 4EU0A 4JF6A 1MXOA 4UQIM 5HL1A 4M4XA 5EUAA 4LCMA 3B47A 2VLGA 1TVFA 4S2NA 5HSQA 1HTZA 4KZ8A 1SDEA 4FUWA 2H0YA 1YLTA 4EQIA 3RTYA 3HLWA 1FR1A 3ZDJA 1W7FA 1YSPA 3IF6A 2V8FA 4KQDA 2J8YA 1PWCA 2C6WB 2G2WA 5EVEA 4MBHA 3BFDA 2Y59A 5CEDA 3ZVWA 1E4DA 1JNUA 1Q2QA 1S67L 2JKGA 1YPRA 3PYPA 3ZHHA 3CITA 4ESPA 3E4QA 4JXVA 4UQIS 3FG8A 3C38A 5FAPA 2V20A 3GSGA 1K0KA 4QU3A 4LRXC 1DJCA 4GCZA 1K56A 1FCMA 3AGFA 3KSFA 4EUZA 2J3WA 1K57A 1E3UA 1SCWA 1G68A 2QKPA 4LGWA 2PYPA 3HUOA 4HI4A 1G6OA 2J3TD 4HOIA 2P74A 3HBRA 4YOFA 1PI5A 3SS5A 1YLJA 3O87A 3CMZA 2WKRA 3CZDA 5HDSA 3PBQA 4N9KA 2QJ5A 1H0MA 2HP6A 1EI5A 3OCLA 5K5BA 1OTIA 4JGRA 5CTMA 1WYBA 1XPBA 2QWSA 4CLCB 3QP1A 3HL9A 3MBZA 3N8SA 4HH3A 2OSUA 2I72A 1F5MA 3HUNA 1GSWA 2IWDA 2ZQDA 3BFGA 5AJGA 1SHVA 3TRCA 2WAEA 1CI9A 4MLLA 4GDBA 4GD8A 2VV6A 1YMXA 3HCYA 5AQAA 1CJFA 5EPHA 4OONA 1MY8A 4LRYC 1O07A 1ZG6A 1DP6A 1D7EA 4NXEA 1MWUA 3ICYA 4DE0A 1LSVA 1KVLA 2WZZA 4YINA 4JLFA 1YAXA 3UMEA 2MJ6A 2HDRA 2R9XA 4S2KA 1LLBA 4K91A 5CGWA 4R1GA 4ZJ1A 1ZC2A 5HFOA 1W63Q 1L0GA 3F1PA 3LY4A 3OCNA 2O99A 5F5YA 2W3GA 3NC8A 2OLVA 4KZ9A 1XJ4A 3PAGA 2HDUA 4OKPA 4OVDA 2ZMAA 3O86A 3D72A 1OTEA 5FAQA 3NBLA 4NK3A 3DBAA 1Z6FA 3VOYA 3IHBA 1XA7A 4NETA 1H8YA 4U3TA 3PR6A 1ONGA 5FL3A 2WADA 1G28A 3PBOA 4E3KA 3F1NA 3RFBA 5CERA 3Q82A 1SKOB 2VKSA 3A3DA 5EVIC 3IX4A 4QWOA 1ESIA 4IJGA 4KZBA 1L2SA 1MKIA 2OWHA 1YSQA 4O7DA 4EBPA 4OLDA 1NLYA 5CXWA 1K55A 3WS0A 5IT5A 4Z1WA 1MPLA 3T1QB 4CJNA 1GCEA 3I7JA 2Y91A 3IT9A 5FQMA 1S6RA 5GHZA 3CI6A 3ITAA 3NULA 5HAQA 4F3LA 3N6IA 4WM9A 4HY8A 4L0LA 2Y2LA 4C3QA 1HVBA 3VP1A 5L09A 1FOFA 5FI6A 2QZ6A 4OP5A 3MQ0A 3HLFA 4OQGA 3G35A 4ZDXA 1PYYA 4JBFA 3NECA 3EGXC 1BT5A 1Q2PA 1JWVA 2IA2A 3MR0A 4R4RA 3OPHA 1U60A 3T4LA 1KGGA 1MC0A 1XFQA 1OPXA 3UY6A 4QY6A 1BLSA 3IX3A 4JPMA 2X71A 4I3JA 3VE3A 2GNXA 4EV4A 2G7UA 2Q9NA 1WYCA 3OPRA 1FILA 1L0EA 1WA9A 3IXGA 2Y8HA 5JYOA 5HAIA 3NDGA 4B88A 3QHYA 1BTLA 3MZEA 4H6JB 3CG5A 3LY3A 3P98A 4KG6A 2XGNA 3C4OA 2PD8A 1TF1A 3IX8A 3PBTA 3IXHA 2ZOHA 2A49A 4WMCA 4JF4A 3IS2B 4I5SA 4X55A 2VV8A 4U0XA 1BYWA 3FZCA 4YWZA 4X6TA 2PR6A 5EFWA 4PM9A 1W63M 3UPOA 4KZ7A 5CRFA 4MMNA 2VX8A 2JHEA 4Y0TA 4R4SA 4Y0OA 5CGSA 1PFLA 1OTDA 4R38A 4GHIB 2O9CA 1ZHHB 2X02A 3F1OA 4IEDA 3NCKA 3VMAA 1IKIA 4KQQA 4BD1A 1NXYA 3RXXA 1S66L 4X68A 4U0TA 4EEPA 1EROA 1I2SA 3B42A 3LCEA 3BJNA 3GECA 1PIOA 4BBTA 5EM0A 1T19A 5EECA 4L9EA 2OOLA 3UDIA 1ERQA 2W3FA 3UB8A 2ZBBA 3T4KA 3IXBA 3S22A 1W79A 4UAAA 5EOEA 1K38A 1PRQA 1E25A 2XLNA 3IHAA 3C30A 3E2LA 1YKDA 4OQIA 3PBRA 2Y2HA 3SH9A 3V3SA 1NRJA 2GDNA 3GDIA 3UO9A 2L1MA 4K0XA 1IYQA 1OJGA 3QP5A 4HNBA 4XUXA 4E3JA 2E8IA 4D2OA 1N9LA 4FCFA 4RX2A 1L0FA 1GA9A 4E3OA 4HHDA 5HZHA 4CLCC 3E98A 3B33A 1RGYA 4IVKA 2W1RA 4DJ2A 3WS2A 3F1NB 5HWWA 2D01A 3ZG7B 3F1OB 1EWZA 1M40A 2RL3A 5E2GA 2DCFA 2V9AA 3MFDA 1NYMA 3T4SA 2EXBA 1T1BA 4CPKA 3A0RA 2Y2MA 2B5RA 3Q7VA 3P09A 5J8XA 1NJ4A 1W5DA 1XFNA 3IF6C 1MKMA 1KDSA 5G4ZA 4LENA 4UA6A 3B3XA 3W4QA 2JE5A 2O9AA 1STZA 4FSFA 1XJ3A 4MN7A 5IHVA 1XXMA 4XT2B 1K57C 3D4FA 5HARA 4KENB 3U4LP 2M1CA 2VJWA 3DAVA 4CLCD 4P6ZM 3GR2A 3UB6A 3NY4A 5JYPA 3CPTA 2ZC3B 5FA7A 3V67A 3K2NA 4GNUA 3V5MA 3NJAA 5C5KA 1P9RA 3JPUA 4OOYA 4E6WA 1K54A 3T1XA 4EWFA 2XSSA 3BW6A 3ZYTA 1I2WA 1YLZA 3V3RA 4WEJA 3VOLA 4EERA 4FTXA 1TEMA 3ZNTA 2NUTC 4Y5FA 2JKTI 2XR0A 2EX8A 2V1AA 3FYZA 4AFIA 3A3EA 2R9WA 3FC7A 3E4OA 1PW1A 4IUKA 3KSGA 1PNEA 3HJIA 3GMWA 3WS1A 1ALQA 1OTAA 1F98A 3LIBA 5TBMA 3S7QA 4EXOA 4Y3IA 3S7OA 3SS3A 4BENA 3UN7A 2V8CA 4XT2A 1VB6A 2YKHA 3H7WB 4OPZA 1DRMA 1L0DA 3BLSA 4KG5A 1RGZA 2PRFA 5M19A 3OZHA 4DN0A 2PD7A 3S7PA 4GS9A 4HJ4A 3ZQ5A 4MDZA 4RQ9A 4HP9A 4R23A 2DRWA 1P9WA 3KO6A 5FI7A 3BY9A 4OQ0A 3MF0A 4I3IA 2WKHA 4PM7A 2Y2KA 2XFSA 4WBGA 4P87A 4OPYA 1IFQA 2DNSA 2Z6DA 3KYEA 4B93A 2YKFA 2J9PA 3OPLA 1GSXA 4BLMA 1FR6A 1ONHA 3W4OA 3TJZC 2C5WB 2XRNA 1Z09A 2J9OA 1LL8A 1S1YA 4E04A 4LLOB 2I9VA 1N9BA 3WWXA 3F1PB 2XD5A 3L7HA 4ZAMA 3OPPA 2Y4AA 3EOIA 3UE1A 2M7VA 1ODVA 2JKRM 3QNCA 5FQ9A 1KGFA 4PKYG 3PHYA 1IEMA 4ZJ2A 1K4FA 3QP8A 4UA9A 4LV3A 4S2JA 2GX5A 1BULA 2FFFB 4JF5A 1TD5A 2JKRI 3HJKA 3G2ZA 3LUQA 5KSHA 2B18A 5KZHA 4DDSA 4B4XA 2A24B 2ZQ9A 4HH2A 2Q9MA 2HDSA 3V50A 5CX7A 5HD3A 1IYOA 1RCJA 1VETA 1JTDA 3RH8B 3LO7A 4WEKA 4H8RA 2HP9A 5EV0A 3PAEA 3NOUC 3C8CA 4BWIA 1HD8A 2ZC4B 4F3LB 3E0YA 3CUEC 3CAXA 4GLQA 5AQBA 4BL3A 2ZC5B 2K31A 5FDHA 2KDKA 1AXBA 4ID4A 4WZ5C 1QMEA 3SOIA 3Q1FA 1E3UD 2X01A 4DRTA 2XF3A 1FIKA 5DJUA 2EX2A 5CHJA 3VP4A 1XP4A 4N1HA 2W0NA 3FPVA 4WL9A 3BM6A 3M6BA 3ITBA 2CMNA 1NZOA 3T4JA 2XD1A 2JBFA 3FKWA 5EVID 3BFCA 4NG2A 2BLSA 3QP6A 3T50A 3VSLA 2KX6A 4YNRA 5FSRA 4D60A 3JVVA 1T18A 4WN5A 2XFTA 4P0MA 4B9OA 3VP0A 4GKUA 5AVFA 3CPTB 5CGXA 4NKPA 4NXBA 2QPNA 1D1JA 3DTEA 1K56D 4O01A 1KE0A 4HBUA 2V0UA 3AGDA 2Y2OA 3FV7A 5TJJA 3IS2A 5FQQA 3A3JA 1OT6A 3UE0A 3SS4A 4PM5A 1W8QA 3MXRA 4Z9QA 4OP8A 2Y2QA 5HPIA 2WKPA 1HLUP 3C4PA 5BOHA 5EVLA 3K3CA 1UWPX 5I5LA 3KYQA 2PHYA 4KG2A 4OLGA 5DF7A 4QD4A 2G2UA 2ZQ7A 3R7WB 2R78A 3DWKA 4A5RA 5A93A 4KZ3A 1KGEA 3LYXA 2O0YA 4FH4A 5HWTA 2W27A 5EVIB 5F82A 1H8ZA 1NRFA 1CEFA 5L2FA 1S0WA 2VGLM 2HDQA 2PYRA 4DXBA 3H9WA 5FDSA 3D3OA 4BMWA 5J4EA 2Q0OA 3EQVA 4E6XA 3MZFA 4KZAA 5FQKA 1BLHA 1DY6A 3GRJA 1YLYA 1NLZA 2WAFA 4HIAA 5EE8A 1Y28A 3EEHA 4X69A 3L9KA 2FZ0A 3N8RA 3FKVA 2XA7S 4UHUA 4JGQA 4IBXA 4ZRRA 2HF6A 2XA7M 4WYYA 1OT9A 1NY0A 5F83A 5HL6A 1FQGA 1KOUA 1VM1A 2HJEA 5A90A 3IF6B 3LEQA 3O5YA 3ZG9B 1FSYA 5KMWA 2EWVA 4HJ3A 5HWVA 1XX2A 4DE2A 1ZKJA 4NXGA 4Y17A 4HESA 5M18A 1TDLA 4PPRA 3CWFA 4R70A 1TS8A 1K25A 4KQOA 2XK1A 3TSGA 4OPQA 5U47A 1S4SA 3OBFA 2QHKA 1ZG4A 4Q0JA 1LL5A 3LEZA 4KZ4A 4C6YA 2H0TA 2OAP1 2P08A 4P85A 3T12B 3T1RA 1ES2A 3BLMA 1SDNA 5L07A 3GQZA 3ZCZA 3SH7A 5TGFA 3UB7A 3MQOA 4CQHA 5DF8A 3N7WA 4JGOA 1VETB 1ZTUA 4ME4A 4LPZA 4GOGA 3N4IA 4R3AA 2LB5A 2Z2MB 1BZAA 4N9LA 4WZ4A 2EXAA 2WKIA 3UDFA 4IHQA 2Y55A 4G3KA 2BTFP 3UB9A 4X1LA 4WUJA 1XJ6A 4Y13A 3T4QA 5MC7A 4I3AA 1NWZA 4R3BA 4X25A 4HQAA 5AQ7A 1F9IA 2ZJ9A 4KUOA 4EBLA 3VOZA 3EGDC 3MKFA 3RJUA 3BFFA 3N8LA 4GDNA 3S4XA 3D9YA 3Q7VB 3M2KA 2K7SA 2HZ5A 1T1CA 2ZL1A 3CHWP 2HP5A 4LV2A 2VV7A 3IWIA 1N4OA 3W4PA 2XEPA
chains in the Genus database with same CATH topology
5J7EA 4K08A 4IUHA 4XT2A 1VB6A 1DP9A 2YKHA 3H7WB 5L8MA 3EWKA 1DRMA 3MXQA 4BJPA 2OAQ1 1W63Q 4DN0A 3F1PA 2PD7A 3S7PA 2ZMFA 4GS9A 2ZOIA 3OCNA 1T1AA 4HJ4A 3ZQ5A 2O99A 4MDZA 4RQ9A 5F5YA 3UMDA 4HP9A 2W3GA 1IOUA 1P9WA 1XJ4A 3KO6A 3LR3A 2QJ7A 4DMZA 2ZMVA 2GJ3A 2P04A 1UWNX 3BY9A 3R7WA 1H3QA 3MF0A 3FPWA 4I3IA 3D72A 1OTEA 2GZAA 3DBAA 5G4YA 2HJ9C 3PBNA 2LB9A 1D06A 1IFQA 4NEED 3TW8A 2Z6DA 2DMWA 3PR6A 3H82B 4B93A 3IBRA 5FL3A 1DP8A 2YKFA 1GSXA 1G28A 3KX0X 3PBOA 3F1NA 3RFBA 3LI9A 3ULFA 2OWJA 2L4RA 2VKSA 1V9ZA 4ARZB 3TJZC 3IBJA 2XRNA 5HDCA 3LFVA 1LL8A 3KSIA 1S1YA 2EA9A 2BASA 4LLOB 4E04A 2I9VA 4GJ4A 1LT0A 2W3EA 5LBRA 4O8GA 4II7A 3MQQA 1P0ZA 3F1PB 4IJGA 2P7JA 4CLCE 3T4TA 2OWHA 4Q0IA 1H8MA 1TS6A 1YSQA 2PDRA 3EOIA 4PAUA 4HJ6A 2M7VA 2INWA 1ODVA 3H82A 1NLYA 2JKRM 4JGPA 5IT5A 4PKYG 4Z1WA 4EEUA 3PHYA 4BBUA 2GX5A 4MN6A 1TD5A 1UGUA 2L0WA 2JKRI 3HJKA 3LUQA 5KIZA 2H28A 5KSHA 2B18A 3CI6A 4F3LA 4HY8A 2A2LA 2O9BA 4L0LA 3TE8A 2A24B 1OJ5A 3JVUA 4WF0A 3UE6A 4MN5A 4HH2A 2NUPC 3NOPC 5F68A 5CX7A 5HD3A 3A0VA 3SW1A 3R4KA 4FOFA 3MQ0A 4NXFA 4L9GA 2Y79A 3RH8B 3OC2A 3OOVA 4WEKA 3EGXC 1VHMA 4H6JA 2IA2A 3MR0A 3PXPA 3G6OA 1LSXA 3NOUC 2HV1A 3C8CA 4ARZA 4BWIA 3T4LA 4PKYA 4EW7A 4DJ3A 4F3LB 1MC0A 1XFQA 1OPXA 2W1TA 2M7UA 3E0YA 3CUEC 3CAXA 4GLQA 1N9OA 4CLCA 2K31A 4I39A 2KDKA 4I3JA 3VE3A 2GNXA 2G7UA 1N9NA 3U2AA 3LR5A 4O0PA 1XJ2A 2W3DA 4HP4A 4ETZA 1WA9A 2WKQA 5DJUA 4BBVA 2Y8HA 2A24A 3MFXA 2W0NA 3FPVA 2PR5A 4WL9A 5HD5A 4H6JB 4I38A 2VEAA 4MCWA 3EEAA 2CMNA 2J80A 2KLIA 4OOLA 2PD8A 1TF1A 3T4JA 4GS9B 3PBTA 2ZOHA 3BY8A 3EQUA 2V1BA 2JN7A 3IS2B 3P01A 4I5SA 4KUKA 5IU1A 2VV8A 1BYWA 3VV4A 5DJTA 4EESA 3T50A 4YWZA 2VA0A 2KX6A 2PR6A 4YNRA 5EFWA 4OOMA 1W63M 3JVVA 4G3WA 1T18A 2QYBA 4PHTA 4WN5A 4MMNA 4B9OA 2VX8A 2FH5A 2JHEA 4Q0HA 4WELA 4UEYA 5AVFA 1OTDA 4Y2FA 3LICA 4R38A 4GHIB 5TBMB 2O9CA 1ZHHB 3F1OA 4NKPA 4NXBA 4L9FA 2J3TC 4O01A 3LR4A 2VZWA 2V0UA 3C2WA 3LI8A 4ETXA 1S66L 3IS2A 5TJJA 4EEPA 3CLOA 1OT6A 5DFXA 3B42A 4QPRA 3BJNA 3GECA 4BBTA 1T19A 4L9EA 2OOLA 3VE4A 5DF9A 5HPIA 3E4PA 2WKPA 3MJQA 2HGVA 2W3FA 3UB8A 1EW0A 2ZBBA 1TS7A 3K3CA 1UWPX 3T4KA 1X0OA 5I5LA 3PBSA 3K3DA 3LIAA 3MMHA 3KYQA 2PHYA 1S1ZA 2K2NA 4R6LA 5J3WA 3C30A 1GSVA 2KOIA 2PT7A 1YKDA 3PBRA 4EU0A 3R7WB 2R78A 4UQIM 1NRJA 3LYXA 2O0YA 4M4XA 3GDIA 3B47A 2VLGA 4EETB 5HWTA 2W27A 2L1MA 5HSQA 1OJGA 4HNBA 2B02A 1OTBA 3RTYA 1N9LA 3S7NA 2VGLM 3NHQA 2PYRA 2D02A 5IS1A 4HHDA 1YSPA 5HZHA 3CUEA 4CLCC 3E98A 3B33A 3H9WA 2W1RA 4DJ2A 3D3OA 4BMWA 5J4EA 3F1NB 4KQDA 5HWWA 3EQVA 1S4RA 2D01A 5HDDA 3F1OB 4EUVA 2V9AA 1LSWA 4G3VA 4EQ1A 1NLZA 4HIAA 5F69A 1Y28A 3EEHA 3T4SA 1JNUA 1TS0A 2FZ0A 1S67L 1T1BA 3A0RA 3PYPA 2XA7S 4JGQA 3CITA 3UE3A 3E4QA 4ZRRA 1XFNA 3FG8A 4UQIS 2HF6A 2XA7M 2W1TB 1MKMA 1OT9A 3C38A 5G4ZA 5HL6A 4LRXC 1KOUA 3OLOA 4GW9A 4GCZA 2W3HA 2HJEA 3KSFA 1V9YA 3BQAA 3O5YA 2J3WA 2O9AA 1STZA 2EWVA 4FSFA 4HJ3A 5HWVA 1XJ3A 3T4OA 2QKPA 4MN7A 4LRZE 2PYPA 4HI4A 1G6OA 4NXGA 4XT2B 2J3TD 5A8BA 4HOIA 3CWFA 4R70A 1TS8A 4YOFA 2M1CA 4KQOA 2VJWA 4CLCD 4P6ZM 3UB6A 1S4SA 3OBFA 2QHKA 5DKLA 4Q0JA 2WKRA 5HDSA 3PBQA 2QJ5A 3V67A 3K2NA 3OCLA 2OAP1 1OTIA 2P08A 5K5BA 4JGRA 3BWLA 3NJAA 5C5KA 1P9RA 2QWSA 3LR0A 4CLCB 4HH3A 3LIEA 3UB7A 1F5MA 4WLAA 3MQOA 2XSSA 4CQHA 3BW6A 1GSWA 3ZYTA 4P6ZS 4JGOA 1ZTUA 4ME4A 4LPZA 4R3AA 2LB5A 2V0WA 5AJGA 5F6AA 3TRCA 4WEJA 3VOLA 4EERA 3KSHA 5DFYA 2Z6CA 3NOTC 4IHQA 3H7WA 2NUTC 4G3KA 3UB9A 4WUJA 4Y5FA 1XJ6A 2JKTI 1P97A 3LIDA 3T4QA 2V1AA 5MC7A 2VV6A 4I3AA 4AFIA 1NWZA 3BQ8A 3E4OA 3FC7A 3HCYA 3W2ZA 4IUKA 3KSGA 4HQAA 5HPFA 3A0SA 1F9IA 2VGLS 4KUOA 1MZUA 2JKTM 4LRYC 3EGDC 3HJIA 1DP6A 3LIFA 1D7EA 5AVEA 4NXEA 3ICYA 1LSVA 2K7SA 1OTAA 1F98A 1T1CA 1YAXA 3LIBA 4GHIA 5TBMA 3UMEA 3S7QA 2XROA 4EXOA 4Y3IA 2VV7A 3P7NA 2MJ6A 5DKKA 2EWWA 3KYZA 3S7OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FPV A;  2A2L A;  3FPW A;  4BMW A;  4CLC E;  4CLC C;  5CX7 A;  4CLC B;  4CLC A;  4CLC D;  4NKP A; 
#chains in the Genus database with same CATH topology
 2OV5 A;  5J7E A;  1DJB A;  1DP9 A;  5L8M A;  1YT4 A;  5FAO A;  3VFH A;  3MXQ A;  5A91 A;  4DDY A;  4KQR A;  4ZBE A;  4UA7 A;  2ZMF A;  3MXS A;  3MZD A;  1T1A A;  3QP4 A;  2Y2G A;  3CJM A;  2PU2 A;  3LR3 A;  2P04 A;  4HEF A;  3VSK A;  1TDG A;  3DWZ A;  3RXW A;  1KDW A;  4KZ6 A;  3TOI A;  3UNW A;  4ZTK A;  5G4Y A;  1RP5 A;  3PBN A;  4DXC A;  1D06 A;  4NEE D;  1GHM A;  3HRE A;  5DTT A;  2DMW A;  2ZQA A;  3C7U A;  3O88 A;  4RVA A;  2XH9 A;  3KX0 X;  5DVA A;  2EFX A;  3HLB A;  3LI9 A;  2OWJ A;  2L4R A;  3IBJ A;  1CF0 A;  1MBL A;  2EX9 A;  5HDC A;  4E3I A;  2EX6 A;  1L3L A;  4GJ4 A;  1LT0 A;  5LBR A;  5GLC A;  4II7 A;  1P0Z A;  4Q0I A;  2UV0 E;  4PAU A;  2INW A;  2JCH A;  5CHU A;  2WK0 A;  2ZM0 A;  3IWQ A;  1XKZ A;  2WGI A;  5GHX A;  1FSW A;  1GHI A;  3IF5 A;  4RYE A;  2H28 A;  5FEG A;  1M6K A;  3UPP A;  2A2L A;  2O9B A;  2QMI A;  3UB5 P;  4QB8 A;  1OJ5 A;  2ACG A;  4GZB A;  3NOP C;  1CQA A;  3VP2 A;  3BEB A;  4PM8 A;  3A0V A;  4FOF A;  4L9G A;  3UDX A;  2V1Z A;  4P6B A;  4JXG A;  4F94 A;  1VHM A;  1YM1 A;  4H6J A;  2PAV P;  1IEL A;  3PXP A;  3G6O A;  1LSX A;  1IYS A;  2WGW A;  4ARZ A;  4PKY A;  4DJ3 A;  2W1T A;  2M7U A;  5KSC A;  2IWB A;  2ZL1 B;  3Q07 A;  4LV0 A;  2ZQC A;  1N9N A;  4ZJ3 A;  1ES3 A;  3LR5 A;  4O0P A;  1VQQ A;  1XJ2 A;  5F1G A;  2WKQ A;  4BBV A;  1ESU A;  2Y2I A;  2Y2J A;  5DTK A;  2ZLY A;  1C3B A;  3MFX A;  3BRM A;  3NI9 A;  4I38 A;  2WYX A;  3MSH A;  4OOL A;  4S2O A;  4GS9 B;  5FAS A;  3BY8 A;  1PWD A;  1K55 C;  3P01 A;  4KUK A;  5IU1 A;  3ZG0 A;  3VV4 A;  3MS6 A;  5DJT A;  5M1A A;  3IQA A;  5I94 A;  4N92 A;  4G3W A;  3S1Y A;  2QYB A;  1AWI A;  1PW8 A;  2FH5 A;  1BSG A;  4Q0H A;  1MWS A;  4UEY A;  1DJA A;  1FCN A;  5TBM B;  3DTK A;  1ES5 A;  5EOO A;  3A3F A;  2J3T C;  4GB7 A;  4K0W A;  3C2W A;  3IH8 A;  3LI8 A;  3UPN A;  3HLE A;  3CLO A;  3JYI A;  5DFX A;  1KE4 A;  3BEC A;  4B4Z A;  2V2F F;  4Y0U A;  5DF9 A;  1SKF A;  1NZU A;  1ACF A;  3IWO A;  1EW0 A;  1TS7 A;  1CK3 A;  1X0O A;  1VEU B;  3GTC A;  2J7V A;  3K3D A;  3PBS A;  2PBY A;  1S1Z A;  2K2N A;  2P9V A;  5J3W A;  4JXW A;  2WKE A;  1GSV A;  1GA0 A;  1YLP A;  1MWR A;  1ES4 A;  2PT7 A;  3C7V A;  4X56 A;  3VP3 A;  2A3U A;  4Y15 A;  3G2Y A;  4MNR A;  3LGO A;  4GD6 A;  4EET B;  3DTI A;  5HW3 A;  4MBF A;  4M3K A;  2B02 A;  1OTB A;  2XQZ A;  3S7N A;  3NHQ A;  5IS1 A;  2D02 A;  3ZG8 B;  5F1F A;  3CUE A;  1G5U A;  2VGJ A;  4DE1 A;  1PWG A;  5EM1 A;  3W8K A;  3IH9 A;  1S4R A;  3HVF A;  5HDD A;  4EUV A;  5FAT A;  1LSW A;  4G3V A;  4EQ1 A;  2VK3 A;  1XGI A;  5F69 A;  1LI9 A;  2Y2N A;  2RCX A;  1TS0 A;  4OH0 A;  1ERM A;  1JTG A;  3ZGA B;  3NDE A;  3UE3 A;  1QMF A;  4BQM A;  2W1T B;  2EFU A;  3QP2 A;  4X1M A;  5HAP A;  3WRZ A;  3OLO A;  4GW9 A;  3WS4 A;  5GHY A;  4E3L A;  2W3H A;  1V9Y A;  4R0Q A;  3BQA A;  4PM6 A;  2WUQ A;  4R3J A;  3T4O A;  4LRZ E;  5GL9 A;  2Z2L B;  4S2L A;  1O7E A;  3HLG A;  5A8B A;  4OQH A;  4E3M A;  3V39 A;  4HBT A;  5DKL A;  1BLP A;  4BD0 A;  4RX3 A;  3FWL A;  2XDM A;  4C75 A;  3G30 A;  3BWL A;  3LR0 A;  1XA1 A;  3WRT A;  1IYP A;  1G6A A;  3LIE A;  2JKF A;  4WLA A;  2H5S A;  4OPR A;  5FQI A;  1VEU A;  1W8Y A;  4GN2 A;  2ZD8 A;  4P6Z S;  1J9M A;  1MWT A;  2V0W A;  5F6A A;  3E2K A;  3HLC A;  5A92 A;  3KSH A;  4Y7P A;  5DFY A;  2Z6C A;  3NOT C;  1HZO A;  5FI2 A;  3H7W A;  1JWP A;  1P97 A;  3LID A;  3BQ8 A;  5FQJ A;  1NYY A;  2PU4 A;  3W2Z A;  1FCO A;  5GLB A;  5HPF A;  3A0S A;  2VGL S;  1MZU A;  2JKT M;  3PTE A;  4S2N C;  3LIF A;  5AVE A;  4MBK A;  4FH2 A;  5HX9 A;  2E8J A;  5CEB A;  4GHI A;  2P9V B;  3G31 A;  4KZ5 A;  2XRO A;  3P7N A;  5TFQ A;  5DKK A;  2EWW A;  3KYZ A;  4K08 A;  1IKG A;  4IUH A;  4DKI A;  5E2E A;  3AGE A;  3EWK A;  2HPB A;  4MEZ A;  4BJP A;  2OAQ 1;  4QHC A;  1Y4O A;  3SH8 A;  2ZOI A;  5TR7 A;  3UMD A;  4N1X A;  1IOU A;  3O3V A;  5E2H A;  1SKO A;  2ZQ8 A;  4DMZ A;  2QJ7 A;  2ZMV A;  2GJ3 A;  3BYD A;  4WZ5 A;  1UWN X;  3R7W A;  1H3Q A;  3FPW A;  5L10 A;  1YMS A;  1LI0 A;  2GZA A;  1LL9 A;  2HJ9 C;  2LB9 A;  3TW8 A;  3H82 B;  3IBR A;  1DP8 A;  1XGJ A;  1Y54 A;  1YQS A;  1GHP A;  1KE3 A;  3ULF A;  4X53 A;  4S2I A;  2AVX A;  1V9Z A;  2WGW B;  4ARZ B;  1BUE A;  3LFV A;  3KSI A;  3T1S A;  2EA9 A;  2BAS A;  4QY5 A;  2W3E A;  4O8G A;  3MQQ A;  2P7J A;  4CLC E;  3T4T A;  4QJG A;  1H8M A;  1TS6 A;  2PDR A;  4PMA A;  1F2K A;  4HJ6 A;  3H82 A;  4JGP A;  1JWZ A;  2PBD P;  2ZC6 B;  4RA7 A;  4EEU A;  1PZO A;  4BBU A;  1LHY A;  1I5Q A;  4MN6 A;  2ZC7 A;  1SZV A;  1UGU A;  2L0W A;  2ZM8 A;  5KIZ A;  1KVM A;  2IWC A;  4JXS A;  4YFM A;  5CTN A;  5AQ9 A;  3M2J A;  5D3O A;  3TE8 A;  4WF0 A;  3JVU A;  3UE6 A;  4MN5 A;  1K4E A;  2NUP C;  2B95 A;  1YLW A;  3ZFZ A;  5F68 A;  3Q81 A;  5E2F A;  2JC7 A;  3SW1 A;  3C5A A;  3R4K A;  4NXF A;  2Y79 A;  3BFE A;  5E43 A;  3OC2 A;  3OOV A;  1PZP A;  3IXD A;  2OLU A;  5FEF A;  2HV1 A;  2FFY A;  3HUM A;  4EW7 A;  1H5X A;  3WS5 A;  5DTS A;  4CLC A;  1N9O A;  3HLD A;  4I39 A;  4XXR A;  3GV9 A;  3U2A A;  3MKE A;  3A3I A;  2CC1 A;  1WE4 A;  1A0K A;  2W3D A;  4WMC D;  4HP4 A;  5GLD A;  4ETZ A;  5CEC A;  2A24 A;  4S2M A;  2PR5 A;  3SZT A;  5HD5 A;  3Q7Z A;  2VEA A;  2UWX A;  2Y2P A;  4MCW A;  3ZG5 A;  3EEA A;  4DF6 A;  2J80 A;  2KLI A;  1CI8 A;  1BLC A;  1K6S A;  1CEG A;  3VFF A;  3EQU A;  2V1B A;  2JN7 A;  1OME A;  3ZVT A;  4EES A;  4FD8 A;  4LCL A;  2VA0 A;  3GVB A;  4OOM A;  2WZX A;  4S2P A;  3G34 A;  4PHT A;  5EVI A;  2ZM2 A;  2BG1 A;  5G18 A;  3ZNY A;  4WEL A;  3DW0 A;  4LV1 A;  2WGV A;  4Y2F A;  4IBR A;  3LIC A;  3ISG A;  4XUZ A;  4L9F A;  4JKT A;  3LR4 A;  2VZW A;  4EBN A;  3QNB A;  4ETX A;  3TG9 A;  1JVJ A;  4QPR A;  3G32 A;  3M6H A;  3DTM A;  1K54 C;  3NIA A;  4DE3 A;  3VE4 A;  5GLA A;  3E4P A;  4IVI A;  3MJQ A;  2HGV A;  5CHM A;  4Q8I A;  1PI4 A;  2VGK A;  4E3N A;  3LIA A;  3MMH A;  2H10 A;  3G4P A;  4BL2 A;  4R6L A;  1J3W A;  4LFU A;  1K6R A;  2KOI A;  4EU0 A;  4JF6 A;  1MXO A;  4UQI M;  5HL1 A;  4M4X A;  5EUA A;  4LCM A;  3B47 A;  2VLG A;  1TVF A;  4S2N A;  5HSQ A;  1HTZ A;  4KZ8 A;  1SDE A;  4FUW A;  2H0Y A;  1YLT A;  4EQI A;  3RTY A;  3HLW A;  1FR1 A;  3ZDJ A;  1W7F A;  1YSP A;  3IF6 A;  2V8F A;  4KQD A;  2J8Y A;  1PWC A;  2C6W B;  2G2W A;  5EVE A;  4MBH A;  3BFD A;  2Y59 A;  5CED A;  3ZVW A;  1E4D A;  1JNU A;  1Q2Q A;  1S67 L;  2JKG A;  1YPR A;  3PYP A;  3ZHH A;  3CIT A;  4ESP A;  3E4Q A;  4JXV A;  4UQI S;  3FG8 A;  3C38 A;  5FAP A;  2V20 A;  3GSG A;  1K0K A;  4QU3 A;  4LRX C;  1DJC A;  4GCZ A;  1K56 A;  1FCM A;  3AGF A;  3KSF A;  4EUZ A;  2J3W A;  1K57 A;  1E3U A;  1SCW A;  1G68 A;  2QKP A;  4LGW A;  2PYP A;  3HUO A;  4HI4 A;  1G6O A;  2J3T D;  4HOI A;  2P74 A;  3HBR A;  4YOF A;  1PI5 A;  3SS5 A;  1YLJ A;  3O87 A;  3CMZ A;  2WKR A;  3CZD A;  5HDS A;  3PBQ A;  4N9K A;  2QJ5 A;  1H0M A;  2HP6 A;  1EI5 A;  3OCL A;  5K5B A;  1OTI A;  4JGR A;  5CTM A;  1WYB A;  1XPB A;  2QWS A;  4CLC B;  3QP1 A;  3HL9 A;  3MBZ A;  3N8S A;  4HH3 A;  2OSU A;  2I72 A;  1F5M A;  3HUN A;  1GSW A;  2IWD A;  2ZQD A;  3BFG A;  5AJG A;  1SHV A;  3TRC A;  2WAE A;  1CI9 A;  4MLL A;  4GDB A;  4GD8 A;  2VV6 A;  1YMX A;  3HCY A;  5AQA A;  1CJF A;  5EPH A;  4OON A;  1MY8 A;  4LRY C;  1O07 A;  1ZG6 A;  1DP6 A;  1D7E A;  4NXE A;  1MWU A;  3ICY A;  4DE0 A;  1LSV A;  1KVL A;  2WZZ A;  4YIN A;  4JLF A;  1YAX A;  3UME A;  2MJ6 A;  2HDR A;  2R9X A;  4S2K A;  1LLB A;  4K91 A;  5CGW A;  4R1G A;  4ZJ1 A;  1ZC2 A;  5HFO A;  1W63 Q;  1L0G A;  3F1P A;  3LY4 A;  3OCN A;  2O99 A;  5F5Y A;  2W3G A;  3NC8 A;  2OLV A;  4KZ9 A;  1XJ4 A;  3PAG A;  2HDU A;  4OKP A;  4OVD A;  2ZMA A;  3O86 A;  3D72 A;  1OTE A;  5FAQ A;  3NBL A;  4NK3 A;  3DBA A;  1Z6F A;  3VOY A;  3IHB A;  1XA7 A;  4NET A;  1H8Y A;  4U3T A;  3PR6 A;  1ONG A;  5FL3 A;  2WAD A;  1G28 A;  3PBO A;  4E3K A;  3F1N A;  3RFB A;  5CER A;  3Q82 A;  1SKO B;  2VKS A;  3A3D A;  5EVI C;  3IX4 A;  4QWO A;  1ESI A;  4IJG A;  4KZB A;  1L2S A;  1MKI A;  2OWH A;  1YSQ A;  4O7D A;  4EBP A;  4OLD A;  1NLY A;  5CXW A;  1K55 A;  3WS0 A;  5IT5 A;  4Z1W A;  1MPL A;  3T1Q B;  4CJN A;  1GCE A;  3I7J A;  2Y91 A;  3IT9 A;  5FQM A;  1S6R A;  5GHZ A;  3CI6 A;  3ITA A;  3NUL A;  5HAQ A;  4F3L A;  3N6I A;  4WM9 A;  4HY8 A;  4L0L A;  2Y2L A;  4C3Q A;  1HVB A;  3VP1 A;  5L09 A;  1FOF A;  5FI6 A;  2QZ6 A;  4OP5 A;  3MQ0 A;  3HLF A;  4OQG A;  3G35 A;  4ZDX A;  1PYY A;  4JBF A;  3NEC A;  3EGX C;  1BT5 A;  1Q2P A;  1JWV A;  2IA2 A;  3MR0 A;  4R4R A;  3OPH A;  1U60 A;  3T4L A;  1KGG A;  1MC0 A;  1XFQ A;  1OPX A;  3UY6 A;  4QY6 A;  1BLS A;  3IX3 A;  4JPM A;  2X71 A;  4I3J A;  3VE3 A;  2GNX A;  4EV4 A;  2G7U A;  2Q9N A;  1WYC A;  3OPR A;  1FIL A;  1L0E A;  1WA9 A;  3IXG A;  2Y8H A;  5JYO A;  5HAI A;  3NDG A;  4B88 A;  3QHY A;  1BTL A;  3MZE A;  4H6J B;  3CG5 A;  3LY3 A;  3P98 A;  4KG6 A;  2XGN A;  3C4O A;  2PD8 A;  1TF1 A;  3IX8 A;  3PBT A;  3IXH A;  2ZOH A;  2A49 A;  4WMC A;  4JF4 A;  3IS2 B;  4I5S A;  4X55 A;  2VV8 A;  4U0X A;  1BYW A;  3FZC A;  4YWZ A;  4X6T A;  2PR6 A;  5EFW A;  4PM9 A;  1W63 M;  3UPO A;  4KZ7 A;  5CRF A;  4MMN A;  2VX8 A;  2JHE A;  4Y0T A;  4R4S A;  4Y0O A;  5CGS A;  1PFL A;  1OTD A;  4R38 A;  4GHI B;  2O9C A;  1ZHH B;  2X02 A;  3F1O A;  4IED A;  3NCK A;  3VMA A;  1IKI A;  4KQQ A;  4BD1 A;  1NXY A;  3RXX A;  1S66 L;  4X68 A;  4U0T A;  4EEP A;  1ERO A;  1I2S A;  3B42 A;  3LCE A;  3BJN A;  3GEC A;  1PIO A;  4BBT A;  5EM0 A;  1T19 A;  5EEC A;  4L9E A;  2OOL A;  3UDI A;  1ERQ A;  2W3F A;  3UB8 A;  2ZBB A;  3T4K A;  3IXB A;  3S22 A;  1W79 A;  4UAA A;  5EOE A;  1K38 A;  1PRQ A;  1E25 A;  2XLN A;  3IHA A;  3C30 A;  3E2L A;  1YKD A;  4OQI A;  3PBR A;  2Y2H A;  3SH9 A;  3V3S A;  1NRJ A;  2GDN A;  3GDI A;  3UO9 A;  2L1M A;  4K0X A;  1IYQ A;  1OJG A;  3QP5 A;  4HNB A;  4XUX A;  4E3J A;  2E8I A;  4D2O A;  1N9L A;  4FCF A;  4RX2 A;  1L0F A;  1GA9 A;  4E3O A;  4HHD A;  5HZH A;  4CLC C;  3E98 A;  3B33 A;  1RGY A;  4IVK A;  2W1R A;  4DJ2 A;  3WS2 A;  3F1N B;  5HWW A;  2D01 A;  3ZG7 B;  3F1O B;  1EWZ A;  1M40 A;  2RL3 A;  5E2G A;  2DCF A;  2V9A A;  3MFD A;  1NYM A;  3T4S A;  2EXB A;  1T1B A;  4CPK A;  3A0R A;  2Y2M A;  2B5R A;  3Q7V A;  3P09 A;  5J8X A;  1NJ4 A;  1W5D A;  1XFN A;  3IF6 C;  1MKM A;  1KDS A;  5G4Z A;  4LEN A;  4UA6 A;  3B3X A;  3W4Q A;  2JE5 A;  2O9A A;  1STZ A;  4FSF A;  1XJ3 A;  4MN7 A;  5IHV A;  1XXM A;  4XT2 B;  1K57 C;  3D4F A;  5HAR A;  4KEN B;  3U4L P;  2M1C A;  2VJW A;  3DAV A;  4CLC D;  4P6Z M;  3GR2 A;  3UB6 A;  3NY4 A;  5JYP A;  3CPT A;  2ZC3 B;  5FA7 A;  3V67 A;  3K2N A;  4GNU A;  3V5M A;  3NJA A;  5C5K A;  1P9R A;  3JPU A;  4OOY A;  4E6W A;  1K54 A;  3T1X A;  4EWF A;  2XSS A;  3BW6 A;  3ZYT A;  1I2W A;  1YLZ A;  3V3R A;  4WEJ A;  3VOL A;  4EER A;  4FTX A;  1TEM A;  3ZNT A;  2NUT C;  4Y5F A;  2JKT I;  2XR0 A;  2EX8 A;  2V1A A;  3FYZ A;  4AFI A;  3A3E A;  2R9W A;  3FC7 A;  3E4O A;  1PW1 A;  4IUK A;  3KSG A;  1PNE A;  3HJI A;  3GMW A;  3WS1 A;  1ALQ A;  1OTA A;  1F98 A;  3LIB A;  5TBM A;  3S7Q A;  4EXO A;  4Y3I A;  3S7O A;  3SS3 A;  4BEN A;  3UN7 A;  2V8C A;  4XT2 A;  1VB6 A;  2YKH A;  3H7W B;  4OPZ A;  1DRM A;  1L0D A;  3BLS A;  4KG5 A;  1RGZ A;  2PRF A;  5M19 A;  3OZH A;  4DN0 A;  2PD7 A;  3S7P A;  4GS9 A;  4HJ4 A;  3ZQ5 A;  4MDZ A;  4RQ9 A;  4HP9 A;  4R23 A;  2DRW A;  1P9W A;  3KO6 A;  5FI7 A;  3BY9 A;  4OQ0 A;  3MF0 A;  4I3I A;  2WKH A;  4PM7 A;  2Y2K A;  2XFS A;  4WBG A;  4P87 A;  4OPY A;  1IFQ A;  2DNS A;  2Z6D A;  3KYE A;  4B93 A;  2YKF A;  2J9P A;  3OPL A;  1GSX A;  4BLM A;  1FR6 A;  1ONH A;  3W4O A;  3TJZ C;  2C5W B;  2XRN A;  1Z09 A;  2J9O A;  1LL8 A;  1S1Y A;  4E04 A;  4LLO B;  2I9V A;  1N9B A;  3WWX A;  3F1P B;  2XD5 A;  3L7H A;  4ZAM A;  3OPP A;  2Y4A A;  3EOI A;  3UE1 A;  2M7V A;  1ODV A;  2JKR M;  3QNC A;  5FQ9 A;  1KGF A;  4PKY G;  3PHY A;  1IEM A;  4ZJ2 A;  1K4F A;  3QP8 A;  4UA9 A;  4LV3 A;  4S2J A;  2GX5 A;  1BUL A;  2FFF B;  4JF5 A;  1TD5 A;  2JKR I;  3HJK A;  3G2Z A;  3LUQ A;  5KSH A;  2B18 A;  5KZH A;  4DDS A;  4B4X A;  2A24 B;  2ZQ9 A;  4HH2 A;  2Q9M A;  2HDS A;  3V50 A;  5CX7 A;  5HD3 A;  1IYO A;  1RCJ A;  1VET A;  1JTD A;  3RH8 B;  3LO7 A;  4WEK A;  4H8R A;  2HP9 A;  5EV0 A;  3PAE A;  3NOU C;  3C8C A;  4BWI A;  1HD8 A;  2ZC4 B;  4F3L B;  3E0Y A;  3CUE C;  3CAX A;  4GLQ A;  5AQB A;  4BL3 A;  2ZC5 B;  2K31 A;  5FDH A;  2KDK A;  1AXB A;  4ID4 A;  4WZ5 C;  1QME A;  3SOI A;  3Q1F A;  1E3U D;  2X01 A;  4DRT A;  2XF3 A;  1FIK A;  5DJU A;  2EX2 A;  5CHJ A;  3VP4 A;  1XP4 A;  4N1H A;  2W0N A;  3FPV A;  4WL9 A;  3BM6 A;  3M6B A;  3ITB A;  2CMN A;  1NZO A;  3T4J A;  2XD1 A;  2JBF A;  3FKW A;  5EVI D;  3BFC A;  4NG2 A;  2BLS A;  3QP6 A;  3T50 A;  3VSL A;  2KX6 A;  4YNR A;  5FSR A;  4D60 A;  3JVV A;  1T18 A;  4WN5 A;  2XFT A;  4P0M A;  4B9O A;  3VP0 A;  4GKU A;  5AVF A;  3CPT B;  5CGX A;  4NKP A;  4NXB A;  2QPN A;  1D1J A;  3DTE A;  1K56 D;  4O01 A;  1KE0 A;  4HBU A;  2V0U A;  3AGD A;  2Y2O A;  3FV7 A;  5TJJ A;  3IS2 A;  5FQQ A;  3A3J A;  1OT6 A;  3UE0 A;  3SS4 A;  4PM5 A;  1W8Q A;  3MXR A;  4Z9Q A;  4OP8 A;  2Y2Q A;  5HPI A;  2WKP A;  1HLU P;  3C4P A;  5BOH A;  5EVL A;  3K3C A;  1UWP X;  5I5L A;  3KYQ A;  2PHY A;  4KG2 A;  4OLG A;  5DF7 A;  4QD4 A;  2G2U A;  2ZQ7 A;  3R7W B;  2R78 A;  3DWK A;  4A5R A;  5A93 A;  4KZ3 A;  1KGE A;  3LYX A;  2O0Y A;  4FH4 A;  5HWT A;  2W27 A;  5EVI B;  5F82 A;  1H8Z A;  1NRF A;  1CEF A;  5L2F A;  1S0W A;  2VGL M;  2HDQ A;  2PYR A;  4DXB A;  3H9W A;  5FDS A;  3D3O A;  4BMW A;  5J4E A;  2Q0O A;  3EQV A;  4E6X A;  3MZF A;  4KZA A;  5FQK A;  1BLH A;  1DY6 A;  3GRJ A;  1YLY A;  1NLZ A;  2WAF A;  4HIA A;  5EE8 A;  1Y28 A;  3EEH A;  4X69 A;  3L9K A;  2FZ0 A;  3N8R A;  3FKV A;  2XA7 S;  4UHU A;  4JGQ A;  4IBX A;  4ZRR A;  2HF6 A;  2XA7 M;  4WYY A;  1OT9 A;  1NY0 A;  5F83 A;  5HL6 A;  1FQG A;  1KOU A;  1VM1 A;  2HJE A;  5A90 A;  3IF6 B;  3LEQ A;  3O5Y A;  3ZG9 B;  1FSY A;  5KMW A;  2EWV A;  4HJ3 A;  5HWV A;  1XX2 A;  4DE2 A;  1ZKJ A;  4NXG A;  4Y17 A;  4HES A;  5M18 A;  1TDL A;  4PPR A;  3CWF A;  4R70 A;  1TS8 A;  1K25 A;  4KQO A;  2XK1 A;  3TSG A;  4OPQ A;  5U47 A;  1S4S A;  3OBF A;  2QHK A;  1ZG4 A;  4Q0J A;  1LL5 A;  3LEZ A;  4KZ4 A;  4C6Y A;  2H0T A;  2OAP 1;  2P08 A;  4P85 A;  3T12 B;  3T1R A;  1ES2 A;  3BLM A;  1SDN A;  5L07 A;  3GQZ A;  3ZCZ A;  3SH7 A;  5TGF A;  3UB7 A;  3MQO A;  4CQH A;  5DF8 A;  3N7W A;  4JGO A;  1VET B;  1ZTU A;  4ME4 A;  4LPZ A;  4GOG A;  3N4I A;  4R3A A;  2LB5 A;  2Z2M B;  1BZA A;  4N9L A;  4WZ4 A;  2EXA A;  2WKI A;  3UDF A;  4IHQ A;  2Y55 A;  4G3K A;  2BTF P;  3UB9 A;  4X1L A;  4WUJ A;  1XJ6 A;  4Y13 A;  3T4Q A;  5MC7 A;  4I3A A;  1NWZ A;  4R3B A;  4X25 A;  4HQA A;  5AQ7 A;  1F9I A;  2ZJ9 A;  4KUO A;  4EBL A;  3VOZ A;  3EGD C;  3MKF A;  3RJU A;  3BFF A;  3N8L A;  4GDN A;  3S4X A;  3D9Y A;  3Q7V B;  3M2K A;  2K7S A;  2HZ5 A;  1T1C A;  2ZL1 A;  3CHW P;  2HP5 A;  4LV2 A;  2VV7 A;  3IWI A;  1N4O A;  3W4P A;  2XEP A; 
#chains in the Genus database with same CATH homology
 5J7E A;  4K08 A;  4IUH A;  4XT2 A;  1VB6 A;  1DP9 A;  2YKH A;  3H7W B;  5L8M A;  3EWK A;  1DRM A;  3MXQ A;  4BJP A;  2OAQ 1;  1W63 Q;  4DN0 A;  3F1P A;  2PD7 A;  3S7P A;  2ZMF A;  4GS9 A;  2ZOI A;  3OCN A;  1T1A A;  4HJ4 A;  3ZQ5 A;  2O99 A;  4MDZ A;  4RQ9 A;  5F5Y A;  3UMD A;  4HP9 A;  2W3G A;  1IOU A;  1P9W A;  1XJ4 A;  3KO6 A;  3LR3 A;  2QJ7 A;  4DMZ A;  2ZMV A;  2GJ3 A;  2P04 A;  1UWN X;  3BY9 A;  3R7W A;  1H3Q A;  3MF0 A;  3FPW A;  4I3I A;  3D72 A;  1OTE A;  2GZA A;  3DBA A;  5G4Y A;  2HJ9 C;  3PBN A;  2LB9 A;  1D06 A;  1IFQ A;  4NEE D;  3TW8 A;  2Z6D A;  2DMW A;  3PR6 A;  3H82 B;  4B93 A;  3IBR A;  5FL3 A;  1DP8 A;  2YKF A;  1GSX A;  1G28 A;  3KX0 X;  3PBO A;  3F1N A;  3RFB A;  3LI9 A;  3ULF A;  2OWJ A;  2L4R A;  2VKS A;  1V9Z A;  4ARZ B;  3TJZ C;  3IBJ A;  2XRN A;  5HDC A;  3LFV A;  1LL8 A;  3KSI A;  1S1Y A;  2EA9 A;  2BAS A;  4LLO B;  4E04 A;  2I9V A;  4GJ4 A;  1LT0 A;  2W3E A;  5LBR A;  4O8G A;  4II7 A;  3MQQ A;  1P0Z A;  3F1P B;  4IJG A;  2P7J A;  4CLC E;  3T4T A;  2OWH A;  4Q0I A;  1H8M A;  1TS6 A;  1YSQ A;  2PDR A;  3EOI A;  4PAU A;  4HJ6 A;  2M7V A;  2INW A;  1ODV A;  3H82 A;  1NLY A;  2JKR M;  4JGP A;  5IT5 A;  4PKY G;  4Z1W A;  4EEU A;  3PHY A;  4BBU A;  2GX5 A;  4MN6 A;  1TD5 A;  1UGU A;  2L0W A;  2JKR I;  3HJK A;  3LUQ A;  5KIZ A;  2H28 A;  5KSH A;  2B18 A;  3CI6 A;  4F3L A;  4HY8 A;  2A2L A;  2O9B A;  4L0L A;  3TE8 A;  2A24 B;  1OJ5 A;  3JVU A;  4WF0 A;  3UE6 A;  4MN5 A;  4HH2 A;  2NUP C;  3NOP C;  5F68 A;  5CX7 A;  5HD3 A;  3A0V A;  3SW1 A;  3R4K A;  4FOF A;  3MQ0 A;  4NXF A;  4L9G A;  2Y79 A;  3RH8 B;  3OC2 A;  3OOV A;  4WEK A;  3EGX C;  1VHM A;  4H6J A;  2IA2 A;  3MR0 A;  3PXP A;  3G6O A;  1LSX A;  3NOU C;  2HV1 A;  3C8C A;  4ARZ A;  4BWI A;  3T4L A;  4PKY A;  4EW7 A;  4DJ3 A;  4F3L B;  1MC0 A;  1XFQ A;  1OPX A;  2W1T A;  2M7U A;  3E0Y A;  3CUE C;  3CAX A;  4GLQ A;  1N9O A;  4CLC A;  2K31 A;  4I39 A;  2KDK A;  4I3J A;  3VE3 A;  2GNX A;  2G7U A;  1N9N A;  3U2A A;  3LR5 A;  4O0P A;  1XJ2 A;  2W3D A;  4HP4 A;  4ETZ A;  1WA9 A;  2WKQ A;  5DJU A;  4BBV A;  2Y8H A;  2A24 A;  3MFX A;  2W0N A;  3FPV A;  2PR5 A;  4WL9 A;  5HD5 A;  4H6J B;  4I38 A;  2VEA A;  4MCW A;  3EEA A;  2CMN A;  2J80 A;  2KLI A;  4OOL A;  2PD8 A;  1TF1 A;  3T4J A;  4GS9 B;  3PBT A;  2ZOH A;  3BY8 A;  3EQU A;  2V1B A;  2JN7 A;  3IS2 B;  3P01 A;  4I5S A;  4KUK A;  5IU1 A;  2VV8 A;  1BYW A;  3VV4 A;  5DJT A;  4EES A;  3T50 A;  4YWZ A;  2VA0 A;  2KX6 A;  2PR6 A;  4YNR A;  5EFW A;  4OOM A;  1W63 M;  3JVV A;  4G3W A;  1T18 A;  2QYB A;  4PHT A;  4WN5 A;  4MMN A;  4B9O A;  2VX8 A;  2FH5 A;  2JHE A;  4Q0H A;  4WEL A;  4UEY A;  5AVF A;  1OTD A;  4Y2F A;  3LIC A;  4R38 A;  4GHI B;  5TBM B;  2O9C A;  1ZHH B;  3F1O A;  4NKP A;  4NXB A;  4L9F A;  2J3T C;  4O01 A;  3LR4 A;  2VZW A;  2V0U A;  3C2W A;  3LI8 A;  4ETX A;  1S66 L;  3IS2 A;  5TJJ A;  4EEP A;  3CLO A;  1OT6 A;  5DFX A;  3B42 A;  4QPR A;  3BJN A;  3GEC A;  4BBT A;  1T19 A;  4L9E A;  2OOL A;  3VE4 A;  5DF9 A;  5HPI A;  3E4P A;  2WKP A;  3MJQ A;  2HGV A;  2W3F A;  3UB8 A;  1EW0 A;  2ZBB A;  1TS7 A;  3K3C A;  1UWP X;  3T4K A;  1X0O A;  5I5L A;  3PBS A;  3K3D A;  3LIA A;  3MMH A;  3KYQ A;  2PHY A;  1S1Z A;  2K2N A;  4R6L A;  5J3W A;  3C30 A;  1GSV A;  2KOI A;  2PT7 A;  1YKD A;  3PBR A;  4EU0 A;  3R7W B;  2R78 A;  4UQI M;  1NRJ A;  3LYX A;  2O0Y A;  4M4X A;  3GDI A;  3B47 A;  2VLG A;  4EET B;  5HWT A;  2W27 A;  2L1M A;  5HSQ A;  1OJG A;  4HNB A;  2B02 A;  1OTB A;  3RTY A;  1N9L A;  3S7N A;  2VGL M;  3NHQ A;  2PYR A;  2D02 A;  5IS1 A;  4HHD A;  1YSP A;  5HZH A;  3CUE A;  4CLC C;  3E98 A;  3B33 A;  3H9W A;  2W1R A;  4DJ2 A;  3D3O A;  4BMW A;  5J4E A;  3F1N B;  4KQD A;  5HWW A;  3EQV A;  1S4R A;  2D01 A;  5HDD A;  3F1O B;  4EUV A;  2V9A A;  1LSW A;  4G3V A;  4EQ1 A;  1NLZ A;  4HIA A;  5F69 A;  1Y28 A;  3EEH A;  3T4S A;  1JNU A;  1TS0 A;  2FZ0 A;  1S67 L;  1T1B A;  3A0R A;  3PYP A;  2XA7 S;  4JGQ A;  3CIT A;  3UE3 A;  3E4Q A;  4ZRR A;  1XFN A;  3FG8 A;  4UQI S;  2HF6 A;  2XA7 M;  2W1T B;  1MKM A;  1OT9 A;  3C38 A;  5G4Z A;  5HL6 A;  4LRX C;  1KOU A;  3OLO A;  4GW9 A;  4GCZ A;  2W3H A;  2HJE A;  3KSF A;  1V9Y A;  3BQA A;  3O5Y A;  2J3W A;  2O9A A;  1STZ A;  2EWV A;  4FSF A;  4HJ3 A;  5HWV A;  1XJ3 A;  3T4O A;  2QKP A;  4MN7 A;  4LRZ E;  2PYP A;  4HI4 A;  1G6O A;  4NXG A;  4XT2 B;  2J3T D;  5A8B A;  4HOI A;  3CWF A;  4R70 A;  1TS8 A;  4YOF A;  2M1C A;  4KQO A;  2VJW A;  4CLC D;  4P6Z M;  3UB6 A;  1S4S A;  3OBF A;  2QHK A;  5DKL A;  4Q0J A;  2WKR A;  5HDS A;  3PBQ A;  2QJ5 A;  3V67 A;  3K2N A;  3OCL A;  2OAP 1;  1OTI A;  2P08 A;  5K5B A;  4JGR A;  3BWL A;  3NJA A;  5C5K A;  1P9R A;  2QWS A;  3LR0 A;  4CLC B;  4HH3 A;  3LIE A;  3UB7 A;  1F5M A;  4WLA A;  3MQO A;  2XSS A;  4CQH A;  3BW6 A;  1GSW A;  3ZYT A;  4P6Z S;  4JGO A;  1ZTU A;  4ME4 A;  4LPZ A;  4R3A A;  2LB5 A;  2V0W A;  5AJG A;  5F6A A;  3TRC A;  4WEJ A;  3VOL A;  4EER A;  3KSH A;  5DFY A;  2Z6C A;  3NOT C;  4IHQ A;  3H7W A;  2NUT C;  4G3K A;  3UB9 A;  4WUJ A;  4Y5F A;  1XJ6 A;  2JKT I;  1P97 A;  3LID A;  3T4Q A;  2V1A A;  5MC7 A;  2VV6 A;  4I3A A;  4AFI A;  1NWZ A;  3BQ8 A;  3E4O A;  3FC7 A;  3HCY A;  3W2Z A;  4IUK A;  3KSG A;  4HQA A;  5HPF A;  3A0S A;  1F9I A;  2VGL S;  4KUO A;  1MZU A;  2JKT M;  4LRY C;  3EGD C;  3HJI A;  1DP6 A;  3LIF A;  1D7E A;  5AVE A;  4NXE A;  3ICY A;  1LSV A;  2K7S A;  1OTA A;  1F98 A;  1T1C A;  1YAX A;  3LIB A;  4GHI A;  5TBM A;  3UME A;  3S7Q A;  2XRO A;  4EXO A;  4Y3I A;  2VV7 A;  3P7N A;  2MJ6 A;  5DKK A;  2EWW A;  3KYZ A;  3S7O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...