3FPWA

Crystal structure of hbps with bound iron
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
140
structure length
140
Chain Sequence
PVAARGGELTQSTHLTLEAATKAARAAVEAAEKDGRHVSVAVVDRNGNTLVTLRGDGAGPQSYESAERKAFTAVSWNAPTSELAKRLAQAPTLKDIPGTLFLAGGTPVTAKGAPVAGIGVAGAPSGDLDEQYARAGAAVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Heme binding protein
molecule keywords Extracellular haem-binding protein
publication title The oligomeric assembly of the novel haem-degrading protein HbpS is essential for interaction with its cognate two-component sensor kinase
pubmed doi rcsb
source organism Streptomyces reticuli
total genus 43
structure length 140
sequence length 140
ec nomenclature
pdb deposition date 2009-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03928 Haem_degrading Haem-degrading
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.150 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3fpwA01
4CLCB 5CX7A 4CLCE 4CLCC 3FPWA 4NKPA 4CLCA 3FPVA 4CLCD 4BMWA 2A2LA
chains in the Genus database with same CATH superfamily
4KZ9A 2DNSA 3NOUC 4Y0OA 3MS6A 1K4EA 1LL5A 3S7NA 4O01A 4S2NC 5EVID 3BECA 1LI9A 5GLAA 1GSVA 2VGJA 3G2YA 5HWTA 4K91A 1PI4A 3IT9A 1LSWA 1BSGA 4IHQA 1CK3A 2WGWB 1SKOA 1TF1A 5E2EA 2D02A 4HESA 4WZ5C 1BT5A 1ERQA 2Z6DA 2PRFA 5F69A 4P6ZS 3SH9A 2PDRA 3LI8A 4FUWA 4LCLA 3ZG9B 4MNRA 1K25A 2XROA 5HW3A 5CHMA 2W27A 5HDSA 3RJUA 4YOFA 2XFSA 4PM5A 3CJMA 2BLSA 2G7UA 1K6SA 5EM0A 1XA7A 3ZFZA 3MJQA 3HUNA 3UB9A 3G35A 4K0WA 4QPRA 1FCNA 2XA7S 1TS7A 2B95A 4DJ3A 4KQOA 3ZG5A 5L10A 2Y2KA 3CLOA 2GX5A 2JC7A 3JYIA 3C7UA 2A24A 5TGFA 3IX3A 1YT4A 2QPNA 3VP0A 1K55C 5A8BA 3NULA 2V8CA 1MZUA 2QKPA 1D7EA 3MF0A 3VFHA 4GCZA 2P08A 1GCEA 3G32A 1Z09A 4MDZA 1N9OA 2VGLS 1K57C 3VOYA 4GLQA 3S1YA 4OP8A 3E4QA 5EVEA 2EX9A 5IS1A 3M6BA 3BRMA 3NECA 3WWXA 3C4OA 2OWJA 1ONGA 2XGNA 3C30A 3GVBA 4R3BA 3WS4A 4AFIA 4CLCC 3BEBA 3IBRA 4PM6A 2PT7A 3EQVA 3GQZA 3OZHA 3VMAA 3BFCA 2V8FA 1Q2QA 5FI6A 1ESIA 4E3OA 5MC7A 1FIKA 2JCHA 5CTNA 4HH3A 5BOHA 1SKOB 3A0VA 4JLFA 3C38A 2V0UA 3CUEC 4UEYA 1PNEA 2Y2NA 4KG5A 3WS0A 3ITBA 4S2MA 4R70A 1G6OA 4IVKA 2H0TA 3HLBA 4JXVA 2B18A 3GDIA 4FTXA 4GZBA 2OLVA 4ZJ3A 4N1HA 2DRWA 1LT0A 2FFYA 1NZUA 3PAGA 4GKUA 4II7A 2A24B 5AJGA 3HVFA 3F1NA 1NLYA 1T1BA 3VP4A 4NEED 1GHIA 1LI0A 4E6WA 1BLSA 1NY0A 2VA0A 4I5SA 2J9PA 3EEHA 3T1XA 1SHVA 3UB5P 4B93A 5AVEA 4DE2A 1S4SA 5EFWA 3O5YA 1OJGA 2EWVA 2JE5A 1D1JA 5HPIA 5HSQA 3UB6A 3FPWA 3RH8B 5EPHA 4S2PA 1N9BA 5F82A 4GS9A 1OTBA 1S1ZA 1SDNA 2V9AA 2H28A 4OQGA 2XR0A 1ES4A 4WEJA 1SZVA 5AQAA 3ZQ5A 4MBFA 3UDXA 2Y59A 5M18A 1F5MA 5FQKA 3G6OA 4RX3A 3TE8A 3LUQA 3UE0A 1DJAA 1PWGA 1XGIA 3LY4A 2J3TC 4YINA 4L9EA 1G5UA 2W0NA 4BBTA 4DE0A 5KSHA 4LCMA 4P6ZM 2W3HA 3G30A 3L7HA 5IU1A 2J8YA 5J8XA 4EW7A 2M7VA 3MZFA 3OC2A 4C6YA 2O9AA 3PBRA 1ZKJA 3F1OA 5FAOA 1VM1A 2ZOIA 4QB8A 5FL3A 3MQQA 1IFQA 2QZ6A 3IHAA 3IQAA 3BFDA 4FSFA 2XA7M 4OPZA 3VOZA 1Y4OA 1K54C 3IWIA 1WYBA 3BQ8A 2FH5A 2ZQDA 1MWTA 3SS5A 3N8RA 4OLDA 4RQ9A 4WELA 4GOGA 4O8GA 4S2NA 1HLUP 1OTEA 2RCXA 5HL6A 4R1GA 4UA6A 4LV1A 4UHUA 3F1NB 2Y2PA 1O7EA 2B5RA 4NKPA 3Q7VA 3ZG8B 2Y8HA 5FQIA 3UNWA 3OCNA 3LIEA 4EBPA 1KOUA 4PM9A 3HLFA 1F98A 3IWOA 2VGLM 3C8CA 3PAEA 2JBFA 4P0MA 3HREA 4HOIA 5J7EA 2XDMA 4DN0A 4NXFA 2V1ZA 5KZHA 1TS8A 4PPRA 3HLGA 3DTIA 4UQIS 4R6LA 3LEQA 3FKWA 2ZC7A 3DTEA 4LFUA 1S6RA 3ZNYA 1PWDA 5FATA 5FI7A 1YLZA 3VFFA 2W1RA 3A3EA 3KSGA 4H8RA 2KLIA 3CPTA 4R4SA 1E3UA 2WAEA 1K55A 3MZDA 3VP2A 1MWSA 1SCWA 2WGVA 3LICA 5F5YA 2V0WA 4LRZE 4XT2B 1VEUA 2WZZA 3D3OA 4EV4A 5G18A 3T4KA 3HLWA 3ICYA 1JNUA 4R0QA 2VV8A 4DXCA 5FSRA 1I5QA 3RXWA 3W2ZA 1XJ4A 1K57A 2BG1A 3UO9A 5CGXA 2O99A 2ZJ9A 4ZRRA 3IF6B 4CQHA 4KQQA 2EFXA 3F1OB 4EEPA 4ESPA 4OKPA 3PBSA 3QP5A 5HAQA 2WGIA 2YKFA 1W79A 1C3BA 4PM8A 1PW8A 1LSXA 1NRJA 4GN2A 4EUVA 4HJ6A 1NWZA 3T4LA 4CLCA 4QD4A 3SH7A 3IWQA 1LLBA 2ZOHA 1E25A 5DTSA 2J9OA 4GB7A 4LENA 2O0YA 1T1CA 1JWPA 2YKHA 4CPKA 4O0PA 1WA9A 2Y2QA 4M3KA 2ZBBA 3Q7VB 4C75A 4H6JB 1XJ2A 2WKEA 4LRYC 3CUEA 3E4OA 3Q07A 4OPRA 4X56A 5A93A 3H82B 3SW1A 3MZEA 4RYEA 1EI5A 5DTKA 3HJIA 4JGOA 1NRFA 1FR1A 3UMDA 1CJFA 3CI6A 3PHYA 1K56A 4MBHA 3HUOA 2L0WA 2I72A 3FV7A 4HI4A 2EX2A 3FKVA 1J3WA 2W1TB 4X1MA 3L9KA 2PD8A 1XP4A 1Y54A 4KZ7A 4UA9A 3U2AA 2UV0E 2V20A 3U4LP 4OVDA 3QP8A 2Y91A 3LFVA 5CECA 3WRZA 3N8LA 4E6XA 3PBTA 3CMZA 1N9NA 5FDHA 3DW0A 4BMWA 1SDEA 3SH8A 1ZHHB 3M2JA 4EQIA 2Y2HA 2Q9MA 5FDSA 3Q81A 5FAQA 4OONA 4U0XA 3VSKA 3B33A 3IHBA 3IH9A 3NBLA 1GSXA 1VEUB 4OOMA 5EVIC 2IWDA 4DE3A 4X6TA 4D60A 3S7QA 4R3AA 1VETB 5HX9A 1A0KA 3ZHHA 2K7SA 4Y5FA 1L0GA 4F94A 1G28A 1O07A 1KVLA 1OTIA 3NOTC 3RXXA 3R7WB 3O87A 3V50A 1T18A 2ZMVA 2ZMFA 4HH2A 1BTLA 4ZJ2A 5HAPA 2ZMAA 5HDDA 1RGYA 5F83A 4CLCB 4MMNA 3C4PA 4F3LA 1BULA 4NG2A 2WKRA 1I2SA 3LIAA 1YLJA 4JXSA 2VX8A 5AQ7A 4EESA 3NJAA 2VV6A 2PU4A 1VHMA 4MLLA 4X68A 4KQDA 3D9YA 3PBOA 4BD1A 3OPLA 1YSPA 1JWZA 1IYSA 2OOLA 3CHWP 1OT9A 4BD0A 4YWZA 3ISGA 3I7JA 4UQIM 5F1GA 1V9ZA 1D06A 1H8ZA 2OAQ1 3IXGA 4KZAA 5EVLA 3S4XA 2FZ0A 2BTFP 3UE3A 4Q0HA 4E3KA 3OBFA 2A49A 3MR0A 4KZ3A 4OPQA 4IUKA 1QMEA 2JKTI 3N8SA 4DKIA 3KYZA 1IEMA 3G34A 5FQ9A 1TVFA 3E2KA 4LV3A 1OJ5A 4WEKA 4GD6A 2PBDP 3UN7A 3OPHA 3TW8A 4S2IA 4E3NA 3IX8A 1JTDA 3A0SA 1YLTA 4Y0TA 2LB9A 4E3IA 4EWFA 2H0YA 3ZG7B 3TOIA 2WK0A 1ZG6A 4OQ0A 3JVVA 5EV0A 1DJCA 3S7OA 1L0EA 4EEUA 1ERMA 3Q1FA 3IS2A 2ZC4B 4BBVA 1KGEA 3NHQA 3H7WB 1AXBA 1E3UD 4X25A 4DRTA 1ODVA 2ACGA 2H10A 1FCMA 3T1RA 2HGVA 3LIFA 4IEDA 4OOYA 1NYMA 4IVIA 3G2ZA 2L1MA 3QP6A 1GA0A 3T12B 4BL3A 1YLPA 4F3LB 2EA9A 4NETA 1YQSA 3EOIA 4Q8IA 4MN5A 2WUQA 1ESUA 1MXOA 2ZM0A 3MXQA 4R38A 4CLCE 1W8YA 3G4PA 3ZGAB 1G6AA 1XJ3A 4HP9A 3GECA 2WKQA 4X53A 1BLHA 2QJ5A 2Y2GA 3NCKA 4CLCD 4WBGA 1YM1A 3V67A 1MKMA 3LIDA 3BYDA 1I2WA 1HD8A 5CHUA 1PFLA 3NDEA 5L8MA 1XGJA 2Y2IA 4KZ6A 4A5RA 2V2FF 3RTYA 4UAAA 1OT6A 3MFXA 3QP4A 2GZAA 5CEBA 3WS2A 1ES2A 3W4QA 3M2KA 3W4PA 1XJ6A 1K56D 1FOFA 3VE3A 2ZQ7A 2VEAA 1ALQA 1MKIA 3MKFA 4Y0UA 3DTMA 4B4XA 3NIAA 5K5BA 1ZTUA 1YLYA 2UWXA 2P9VA 2V1AA 4FH4A 4OP5A 3P98A 1UWPX 3IS2B 5HD3A 1TDLA 2XRNA 3DAVA 3C2WA 3DTKA 4I38A 5GHXA 2ZQ8A 1YPRA 5AVFA 1K4FA 1PIOA 4EU0A 4M4XA 1OTDA 1FILA 5CRFA 3ZVTA 2GNXA 1LHYA 1K6RA 3BW6A 1DRMA 4KG6A 3A3FA 4XT2A 3SS4A 3LR3A 3FC7A 4EETB 3BFFA 2GDNA 3IXDA 5JYPA 4WYYA 2CMNA 2Y2OA 5L2FA 1PZPA 1JWVA 4ZAMA 4GHIA 3B47A 1LL9A 3BY8A 2X71A 3IF6A 5IHVA 1PWCA 4K08A 1YMXA 2Q9NA 4ID4A 3PR6A 4WLAA 4JGPA 3K2NA 3PTEA 2M1CA 1L0DA 5JYOA 1IKIA 4PKYA 1K38A 1KE4A 4E04A 1PRQA 1H0MA 5CTMA 3T4SA 4Z1WA 3MXSA 1FSWA 1IKGA 3UDIA 5DTTA 1QMFA 2JKRM 3T50A 2WADA 2MJ6A 2J3TD 2Y55A 1LSVA 3T1SA 4DJ2A 4H6JA 1BYWA 3HLCA 1XPBA 2VV7A 3DWKA 5C5KA 1XFQA 3IX4A 4WZ5A 3H82A 4Q0IA 3FWLA 3W8KA 1RCJA 2KOIA 4X55A 2JKRI 4NXGA 2W3EA 3EEAA 3T1QB 3GMWA 2P04A 4BLMA 4Z9QA 3Q7ZA 5A91A 3VP3A 1W7FA 2HDRA 2XEPA 3BJNA 2QHKA 2W1TA 4DMZA 2ZC3B 4P87A 4Y13A 1W63M 3S7PA 2HP5A 3ZYTA 3ZNTA 3G31A 2OWHA 2P9VB 4U0TA 4N92A 2VZWA 5U47A 1XKZA 2E8IA 3N6IA 4LV0A 2XLNA 2K2NA 1JVJA 4ETXA 2A3UA 1BLPA 2AVXA 3DWZA 4EERA 3C5AA 1BUEA 3VP1A 1CEFA 4FCFA 1VQQA 3MQ0A 3CWFA 3FYZA 3VSLA 1MWUA 1VETA 3HCYA 3NC8A 5GLDA 5M1AA 2QJ7A 1FQGA 4GHIB 2Z2LB 4JXWA 2EX8A 2VLGA 4L9GA 3R7WA 4DE1A 3CITA 5DFYA 3C7VA 3LR0A 2J7VA 4ARZA 4X1LA 4EBNA 3T4TA 4KZ4A 5CEDA 4OOLA 1RP5A 1H3QA 1F9IA 4JGQA 1W8QA 5FASA 1L2SA 3NOPC 3P7NA 1YSQA 5CGWA 5FAPA 3BLMA 4P85A 5FQJA 3PYPA 1MY8A 2HDQA 1IYPA 2NUPC 2PD7A 1DY6A 2PU2A 3BQAA 4N1XA 3ZDJA 1E4DA 3B3XA 4LLOB 3NI9A 3SS3A 5TR7A 4IUHA 4Y2FA 4PKYG 3ULFA 5F1FA 2HPBA 4HJ4A 4CJNA 1OTAA 5E2FA 1DJBA 2BASA 4FH2A 4Q0JA 3KYEA 3CAXA 3EGXC 5EOEA 4BENA 2PYRA 5HZHA 2D01A 4OPYA 2Y2MA 1H8YA 5KSCA 3D72A 4HQAA 5FQMA 5CX7A 1DP8A 3TG9A 1S67L 4HHDA 2W3GA 3UMEA 1DP6A 1FSYA 2HF6A 5KMWA 4QWOA 1P9WA 4G3WA 1YKDA 3MQOA 2P7JA 1KVMA 3O86A 2G2WA 4P6BA 2JN7A 4LPZA 4S2KA 5G4ZA 2ZLYA 2W3DA 1Z6FA 4KENB 1ES3A 2XH9A 4HP4A 3V39A 3OCLA 5DF9A 2XK1A 5KIZA 2XSSA 3VOLA 2ZL1A 3HUMA 3H7WA 1GSWA 4LV2A 3MSHA 4HNBA 3T4QA 5HWVA 1X0OA 3OOVA 1NLZA 4ARZB 1W63Q 3LYXA 2W3FA 4ZTKA 5DF8A 4GD8A 4RA7A 2G2UA 2B02A 4PAUA 1Q2PA 2OLUA 2ZC6B 4KUKA 2X01A 3UPOA 1HZOA 1IYQA 4B9OA 1VB6A 2IA2A 2PR6A 4BJPA 4WN5A 2ZQCA 3TSGA 2XF3A 4C3QA 2Y79A 2O9CA 4R4RA 1N4OA 1MBLA 5HL1A 4IBRA 1L0FA 2JKTM 1OMEA 1KE3A 2KX6A 2ZQAA 3MBZA 1K54A 4XUXA 2PR5A 2R9XA 1MPLA 1TDGA 3GSGA 4G3KA 3OLOA 4KUOA 4GDBA 4DDSA 4S2OA 1UGUA 2HJ9C 4RX2A 3P01A 2A2LA 3O88A 1P9RA 1KGGA 4Y17A 4QHCA 1GA9A 5TBMB 3A0RA 3EWKA 1EWZA 1Y28A 4PHTA 3ZG0A 1TS6A 4KZBA 5FQQA 2EXAA 1SKFA 4JF4A 4GNUA 1GHPA 1ACFA 1ZC2A 4JPMA 5AQBA 3UDFA 2GJ3A 2PAVP 3KSFA 1NZOA 1OPXA 2ZL1B 2Y2JA 5DKLA 5EOOA 4JGRA 4UA7A 3GRJA 4JF6A 3JPUA 3F1PA 5HAIA 1HTZA 4EUZA 3AGFA 4I3AA 5HPFA 3E2LA 4X69A 2Y2LA 1NYYA 5GLBA 2R78A 4EQ1A 4E3LA 2VGKA 2R9WA 3GR2A 2QYBA 1H8MA 1STZA 2ZM8A 5CXWA 2EXBA 2JHEA 1G68A 1YLWA 4IBXA 4Y7PA 5F6AA 3FZCA 5EE8A 3KSIA 3IBJA 4WMCA 2H5SA 3QNCA 4XXRA 3LIBA 4BWIA 3V3SA 3ITAA 2E8JA 2HJEA 5G4YA 4Y15A 1AWIA 2Q0OA 1TEMA 3UE1A 5FI2A 4NXEA 2IWBA 3WRTA 4D2OA 4G3VA 1N9LA 3A3DA 3N7WA 4OLGA 3UE6A 5L07A 1S66L 4EXOA 4WZ4A 3E98A 2Y4AA 2EFUA 2VJWA 2DCFA 5IT5A 3NDGA 4MN6A 3P09A 5A92A 4KZ5A 3AGDA 1BLCA 3FPVA 3QHYA 5DJTA 3UPNA 1KDSA 1K0KA 1T19A 1HVBA 3KX0X 4MN7A 3UB8A 2HDSA 3OPRA 5HD5A 4OH0A 5M19A 4S2LA 2XD5A 3KO6A 1WYCA 4WF0A 3F1PB 2WAFA 3MMHA 5GHYA 3HBRA 3LO7A 4XUZA 4QU3A 3EGDC 1M6KA 5I5LA 3LR4A 2VK3A 5A90A 3QNBA 1FCOA 3OPPA 3T4OA 4I3JA 2WKHA 2ZD8A 5EVIA 1DP9A 1MWRA 1PYYA 5LBRA 5E43A 2P74A 4NXBA 2WKIA 2PHYA 1L3LA 1XA1A 3QP1A 5AQ9A 3TJZC 1YAXA 5F68A 5HDCA 3GV9A 2V1BA 1MC0A 1TS0A 3SOIA 4OQIA 2XFTA 4BQMA 1H5XA 4ME4A 2QMIA 4E3MA 4Y3IA 1KGFA 2OV5A 1BZAA 4I3IA 3NY4A 4ZJ1A 1S4RA 5I94A 1ES5A 3GTCA 4GW9A 2ZC5B 3LGOA 2EWWA 2ZQ9A 4HBTA 3BM6A 4U3TA 3PBQA 2RL3A 2FFFB 1PZOA 2VKSA 3IXBA 4N9LA 4EBLA 4B88A 4QY6A 2OSUA 4HJ3A 2KDKA 2OAP1 3H9WA 5DVAA 1U60A 1EROA 5CERA 5DKKA 1PW1A 3KSHA 3MFDA 4LRXC 2HV1A 5CHJA 2Z2MB 4GDNA 2K31A 2HP9A 3DBAA 5CGSA 4MEZA 4MBKA 1LL8A 2EX6A 3ZVWA 1YMSA 3LY3A 4DXBA 3IXHA 4WL9A 5J4EA 5TJJA 1CQAA 2HDUA 3IH8A 1KDWA 2IWCA 1KE0A 3HL9A 4L9FA 4KZ8A 4HY8A 4OQHA 3AGEA 2J3WA 5EUAA 5TFQA 5GHZA 3HLDA 3O3VA 1CEGA 3HLEA 4E3JA 4I39A 3WS1A 3UB7A 4GS9B 5EECA 4BBUA 4PM7A 3TRCA 2HP6A 1T1AA 3IF5A 2XQZA 2C6WB 3R4KA 1M40A 1P0ZA 3D4FA 3MXRA 2PBYA 4BL2A 3KYQA 4IJGA 3N4IA 4QJGA 5GL9A 2LB5A 3VV4A 5DF7A 5EM1A 5EVIB 3E0YA 3UPPA 4KG2A 3M6HA 5J3WA 4JBFA 3W4OA 4JXGA 4ZDXA 3EQUA 1WE4A 3HJKA 3PXPA 1P97A 4N9KA 4HBUA 2JKFA 1NJ4A 3VE4A 3Q82A 1ONHA 3SZTA 1CF0A 2ZM2A 3BFEA 2WYXA 3V5MA 4R23A 4JKTA 4PMAA 4GJ4A 5HFOA 1S0WA 5E2GA 4ZBEA 3CZDA 4WMCD 1ZG4A 1CI9A 2WGWA 5D3OA 3LCEA 3BLSA 3V3RA 2INWA 1EW0A 2I9VA 3A3JA 1XFNA 4KQRA 2QWSA 1IYOA 4LGWA 1XX2A 5FEFA 2NUTC 3WS5A 1NXYA 4DDYA 3LR5A 4FD8A 2J80A 2M7UA 1FR6A 2WZXA 3K3DA 4FOFA 2HZ5A 3LEZA 3BFGA 1PI5A 4R3JA 1CI8A 4JF5A 2DMWA 4L0LA 2X02A 2C5WB 4WUJA 3UY6A 4NK3A 3B42A 1W5DA 3A3IA 3CG5A 2XD1A 1GHMA 4B4ZA 4MCWA 1RGZA 4ETZA 5TBMA 2WKPA 4O7DA 2L4RA 5HWWA 5GLCA 3MKEA 1JTGA 1J9MA 4DF6A 2CC1A 2O9BA 1IELA 4YFMA 4QY5A 3ZCZA 3CPTB 4YNRA 4S2JA 3FG8A 4RVAA 4WM9A 3PBNA 2JKGA 2PYPA 1XXMA 1IOUA 3RFBA 3JVUA 4HEFA 3IF6C 3T4JA 1F2KA 4HIAA 5FA7A 3BWLA 5E2HA 1TD5A 5L09A 1UWNX 3E4PA 4K0XA 3BY9A 1V9YA 3K3CA 5HARA 3S22A 5FEGA 3QP2A 5DFXA 3LI9A 1S1YA 5DJUA 2Z6CA
chains in the Genus database with same CATH topology
4ZRRA 3BY8A 4CQHA 3F1OB 2QYBA 3NOUC 4EEPA 1H8MA 1STZA 3PBSA 2JHEA 4K08A 3S7NA 4O01A 2YKFA 3PR6A 4WLAA 1LSXA 1GSVA 3K2NA 1NRJA 4JGPA 2M1CA 5F6AA 4EUVA 4HJ6A 1NWZA 3T4LA 4CLCA 5HWTA 4PKYA 3KSIA 3IBJA 4E04A 3LIBA 1LSWA 2ZOHA 4BWIA 4IHQA 3T4SA 4Z1WA 2HJEA 5G4YA 1TF1A 2D02A 2O0YA 1T1CA 2Z6DA 2YKHA 5F69A 4P6ZS 4O0PA 2PDRA 1WA9A 3LI8A 2JKRM 3T50A 2MJ6A 2J3TD 2ZBBA 4NXEA 2XROA 4H6JB 1XJ2A 1LSVA 2W27A 5HDSA 4DJ2A 4H6JA 1BYWA 3CUEA 3E4OA 4LRYC 4YOFA 2VV7A 5C5KA 3H82B 4G3VA 3SW1A 1N9LA 2G7UA 1XFQA 3H82A 3HJIA 4JGOA 3UE6A 4Q0IA 3MJQA 2KOIA 3UB9A 3UMDA 3CI6A 4QPRA 2JKRI 4NXGA 2XA7S 2W3EA 1TS7A 3EEAA 1S66L 3PHYA 4DJ3A 4KQOA 2L0WA 4HI4A 3CLOA 4EXOA 2GX5A 2P04A 2W1TB 2A24A 3E98A 2PD8A 2VJWA 3BJNA 2QHKA 3U2AA 5IT5A 2W1TA 4DMZA 4MN6A 1W63M 3S7PA 5A8BA 3ZYTA 3FPVA 5DJTA 1MZUA 2QKPA 1D7EA 3LFVA 2OWHA 3MF0A 1T19A 3PBTA 1N9NA 4BMWA 2VZWA 1ZHHB 4GCZA 3KX0X 4MN7A 3UB8A 2P08A 2K2NA 4ETXA 5HD5A 3KO6A 3B33A 4MDZA 1N9OA 2VGLS 1GSXA 4EERA 4WF0A 3F1PB 4GLQA 4OOMA 3MMHA 3E4QA 3MQ0A 3S7QA 3CWFA 5IS1A 4R3AA 3EGDC 5I5LA 2K7SA 3HCYA 3LR4A 2QJ7A 4Y5FA 2OWJA 1G28A 1OTIA 3C30A 4AFIA 4GHIB 4CLCC 3IBRA 3T4OA 3NOTC 4I3JA 2PT7A 3R7WB 3EQVA 1T18A 2ZMVA 1DP9A 2ZMFA 2VLGA 4HH2A 4L9GA 5LBRA 3R7WA 3CITA 4NXBA 5DFYA 3LR0A 5HDDA 4ARZA 2PHYA 4CLCB 3T4TA 3TJZC 4MMNA 1YAXA 5F68A 5HDCA 4OOLA 2V1BA 5MC7A 1MC0A 4F3LA 4HH3A 1H3QA 1TS0A 2WKRA 3LIAA 4ME4A 3A0VA 1F9IA 2V0UA 3C38A 3CUEC 4JGQA 4Y3IA 4UEYA 4I3IA 3NOPC 2VX8A 4EESA 3P7NA 3NJAA 4R70A 2VV6A 1YSQA 1G6OA 1S4RA 1VHMA 3PYPA 4GW9A 2NUPC 2PD7A 2B18A 3GDIA 4KQDA 3BQAA 3PBOA 2EWWA 4LLOB 3PBQA 1YSPA 4IUHA 2VKSA 4Y2FA 4HJ3A 4PKYG 3ULFA 2OOLA 1OT9A 2KDKA 2OAP1 3H9WA 1LT0A 4HJ4A 5DKKA 4YWZA 3KSHA 1OTAA 4II7A 4UQIM 1V9ZA 2BASA 4LRXC 1D06A 2HV1A 4Q0JA 2A24B 2OAQ1 3CAXA 3EGXC 5AJGA 2K31A 2PYRA 3DBAA 3F1NA 5HZHA 1NLYA 1T1BA 2D01A 2FZ0A 3UE3A 4Q0HA 4NEED 1LL8A 3D72A 4HQAA 5CX7A 1DP8A 2VA0A 4I5SA 1S67L 3OBFA 4WL9A 5J4EA 5TJJA 3MR0A 4HHDA 3EEHA 2W3GA 3UMEA 1DP6A 4IUKA 2HF6A 4L9FA 2JKTI 4B93A 4HY8A 5AVEA 3KYZA 1S4SA 5EFWA 2J3WA 1P9WA 3O5YA 1OJ5A 1OJGA 4G3WA 2EWVA 1YKDA 4WEKA 3MQOA 2P7JA 5HPIA 5HSQA 3UB6A 3FPWA 3TW8A 4I39A 3RH8B 3UB7A 4GS9B 3A0SA 4BBUA 2LB9A 2JN7A 4LPZA 3TRCA 4GS9A 1OTBA 1T1AA 1S1ZA 2V9AA 2H28A 5G4ZA 3JVVA 3R4KA 1P0ZA 2W3DA 4WEJA 3KYQA 3S7OA 4IJGA 4EEUA 4HP4A 3ZQ5A 3OCLA 5DF9A 3IS2A 2LB5A 4BBVA 5KIZA 3VV4A 3NHQA 3H7WB 1F5MA 2XSSA 3E0YA 3VOLA 1ODVA 3G6OA 3H7WA 1GSWA 5J3WA 3TE8A 3LUQA 2HGVA 3LIFA 5HWVA 4HNBA 3T4QA 1X0OA 3OOVA 1NLZA 4ARZB 1W63Q 2J3TC 3LYXA 2W3FA 4L9EA 2L1MA 2W0NA 4BBTA 5KSHA 4P6ZM 2W3HA 4F3LB 3EQUA 3HJKA 5IU1A 4EW7A 3PXPA 1P97A 2B02A 2EA9A 2M7VA 3EOIA 3VE4A 4PAUA 3OC2A 4KUKA 4MN5A 2O9AA 3PBRA 3F1OA 2ZOIA 4R38A 3MXQA 4CLCE 5FL3A 3MQQA 1IFQA 1XJ3A 4B9OA 4HP9A 1VB6A 2IA2A 4FSFA 2XA7M 2PR6A 4BJPA 4WN5A 3GECA 2WKQA 2QJ5A 3BQ8A 2FH5A 4GJ4A 4CLCD 4RQ9A 4WELA 4O8GA 2Y79A 2O9CA 3V67A 1MKMA 1OTEA 3LIDA 5HL6A 2INWA 1EW0A 2I9VA 2JKTM 2KX6A 1XFNA 3F1NB 4NKPA 5L8MA 2QWSA 2Y8HA 2PR5A 3OCNA 2NUTC 3LIEA 3LR5A 3RTYA 2J80A 2M7UA 4G3KA 3OLOA 1KOUA 4KUOA 1OT6A 3K3DA 4FOFA 1UGUA 2HJ9C 1F98A 3MFXA 2GZAA 3P01A 2VGLM 3C8CA 2DMWA 4L0LA 2A2LA 1P9RA 4WUJA 4HOIA 1XJ6A 3VE3A 5TBMB 3B42A 5J7EA 2VEAA 4DN0A 4MCWA 4ETZA 4NXFA 5TBMA 2WKPA 3A0RA 2L4RA 1TS8A 3EWKA 4UQIS 5HWWA 4R6LA 5K5BA 1Y28A 4PHTA 1ZTUA 1TS6A 2W1RA 2O9BA 2V1AA 3KSGA 4YNRA 2GJ3A 1UWPX 3IS2B 3FG8A 5HD3A 2KLIA 3KSFA 2XRNA 1OPXA 3C2WA 3PBNA 3LICA 4I38A 5F5YA 5DKLA 5AVFA 2V0WA 4LRZE 4EU0A 4M4XA 1OTDA 4JGRA 2GNXA 2PYPA 3F1PA 1IOUA 4XT2B 3RFBA 3BW6A 3JVUA 1DRMA 3T4JA 4HIAA 3D3OA 4XT2A 3T4KA 3BWLA 3ICYA 1JNUA 1TD5A 2VV8A 3FC7A 3LR3A 4I3AA 4EETB 5HPFA 1UWNX 3E4PA 3BY9A 1V9YA 3K3CA 2CMNA 3W2ZA 5DFXA 2R78A 4EQ1A 1XJ4A 3LI9A 1S1YA 2O99A 4GHIA 3B47A 5DJUA 2Z6CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CLC B;  5CX7 A;  4CLC E;  4CLC C;  3FPW A;  4NKP A;  4CLC A;  3FPV A;  4CLC D;  4BMW A;  2A2L A; 
#chains in the Genus database with same CATH topology
 4KZ9 A;  2DNS A;  3NOU C;  4Y0O A;  3MS6 A;  1K4E A;  1LL5 A;  3S7N A;  4O01 A;  4S2N C;  5EVI D;  3BEC A;  1LI9 A;  5GLA A;  1GSV A;  2VGJ A;  3G2Y A;  5HWT A;  4K91 A;  1PI4 A;  3IT9 A;  1LSW A;  1BSG A;  4IHQ A;  1CK3 A;  2WGW B;  1SKO A;  1TF1 A;  5E2E A;  2D02 A;  4HES A;  4WZ5 C;  1BT5 A;  1ERQ A;  2Z6D A;  2PRF A;  5F69 A;  4P6Z S;  3SH9 A;  2PDR A;  3LI8 A;  4FUW A;  4LCL A;  3ZG9 B;  4MNR A;  1K25 A;  2XRO A;  5HW3 A;  5CHM A;  2W27 A;  5HDS A;  3RJU A;  4YOF A;  2XFS A;  4PM5 A;  3CJM A;  2BLS A;  2G7U A;  1K6S A;  5EM0 A;  1XA7 A;  3ZFZ A;  3MJQ A;  3HUN A;  3UB9 A;  3G35 A;  4K0W A;  4QPR A;  1FCN A;  2XA7 S;  1TS7 A;  2B95 A;  4DJ3 A;  4KQO A;  3ZG5 A;  5L10 A;  2Y2K A;  3CLO A;  2GX5 A;  2JC7 A;  3JYI A;  3C7U A;  2A24 A;  5TGF A;  3IX3 A;  1YT4 A;  2QPN A;  3VP0 A;  1K55 C;  5A8B A;  3NUL A;  2V8C A;  1MZU A;  2QKP A;  1D7E A;  3MF0 A;  3VFH A;  4GCZ A;  2P08 A;  1GCE A;  3G32 A;  1Z09 A;  4MDZ A;  1N9O A;  2VGL S;  1K57 C;  3VOY A;  4GLQ A;  3S1Y A;  4OP8 A;  3E4Q A;  5EVE A;  2EX9 A;  5IS1 A;  3M6B A;  3BRM A;  3NEC A;  3WWX A;  3C4O A;  2OWJ A;  1ONG A;  2XGN A;  3C30 A;  3GVB A;  4R3B A;  3WS4 A;  4AFI A;  4CLC C;  3BEB A;  3IBR A;  4PM6 A;  2PT7 A;  3EQV A;  3GQZ A;  3OZH A;  3VMA A;  3BFC A;  2V8F A;  1Q2Q A;  5FI6 A;  1ESI A;  4E3O A;  5MC7 A;  1FIK A;  2JCH A;  5CTN A;  4HH3 A;  5BOH A;  1SKO B;  3A0V A;  4JLF A;  3C38 A;  2V0U A;  3CUE C;  4UEY A;  1PNE A;  2Y2N A;  4KG5 A;  3WS0 A;  3ITB A;  4S2M A;  4R70 A;  1G6O A;  4IVK A;  2H0T A;  3HLB A;  4JXV A;  2B18 A;  3GDI A;  4FTX A;  4GZB A;  2OLV A;  4ZJ3 A;  4N1H A;  2DRW A;  1LT0 A;  2FFY A;  1NZU A;  3PAG A;  4GKU A;  4II7 A;  2A24 B;  5AJG A;  3HVF A;  3F1N A;  1NLY A;  1T1B A;  3VP4 A;  4NEE D;  1GHI A;  1LI0 A;  4E6W A;  1BLS A;  1NY0 A;  2VA0 A;  4I5S A;  2J9P A;  3EEH A;  3T1X A;  1SHV A;  3UB5 P;  4B93 A;  5AVE A;  4DE2 A;  1S4S A;  5EFW A;  3O5Y A;  1OJG A;  2EWV A;  2JE5 A;  1D1J A;  5HPI A;  5HSQ A;  3UB6 A;  3FPW A;  3RH8 B;  5EPH A;  4S2P A;  1N9B A;  5F82 A;  4GS9 A;  1OTB A;  1S1Z A;  1SDN A;  2V9A A;  2H28 A;  4OQG A;  2XR0 A;  1ES4 A;  4WEJ A;  1SZV A;  5AQA A;  3ZQ5 A;  4MBF A;  3UDX A;  2Y59 A;  5M18 A;  1F5M A;  5FQK A;  3G6O A;  4RX3 A;  3TE8 A;  3LUQ A;  3UE0 A;  1DJA A;  1PWG A;  1XGI A;  3LY4 A;  2J3T C;  4YIN A;  4L9E A;  1G5U A;  2W0N A;  4BBT A;  4DE0 A;  5KSH A;  4LCM A;  4P6Z M;  2W3H A;  3G30 A;  3L7H A;  5IU1 A;  2J8Y A;  5J8X A;  4EW7 A;  2M7V A;  3MZF A;  3OC2 A;  4C6Y A;  2O9A A;  3PBR A;  1ZKJ A;  3F1O A;  5FAO A;  1VM1 A;  2ZOI A;  4QB8 A;  5FL3 A;  3MQQ A;  1IFQ A;  2QZ6 A;  3IHA A;  3IQA A;  3BFD A;  4FSF A;  2XA7 M;  4OPZ A;  3VOZ A;  1Y4O A;  1K54 C;  3IWI A;  1WYB A;  3BQ8 A;  2FH5 A;  2ZQD A;  1MWT A;  3SS5 A;  3N8R A;  4OLD A;  4RQ9 A;  4WEL A;  4GOG A;  4O8G A;  4S2N A;  1HLU P;  1OTE A;  2RCX A;  5HL6 A;  4R1G A;  4UA6 A;  4LV1 A;  4UHU A;  3F1N B;  2Y2P A;  1O7E A;  2B5R A;  4NKP A;  3Q7V A;  3ZG8 B;  2Y8H A;  5FQI A;  3UNW A;  3OCN A;  3LIE A;  4EBP A;  1KOU A;  4PM9 A;  3HLF A;  1F98 A;  3IWO A;  2VGL M;  3C8C A;  3PAE A;  2JBF A;  4P0M A;  3HRE A;  4HOI A;  5J7E A;  2XDM A;  4DN0 A;  4NXF A;  2V1Z A;  5KZH A;  1TS8 A;  4PPR A;  3HLG A;  3DTI A;  4UQI S;  4R6L A;  3LEQ A;  3FKW A;  2ZC7 A;  3DTE A;  4LFU A;  1S6R A;  3ZNY A;  1PWD A;  5FAT A;  5FI7 A;  1YLZ A;  3VFF A;  2W1R A;  3A3E A;  3KSG A;  4H8R A;  2KLI A;  3CPT A;  4R4S A;  1E3U A;  2WAE A;  1K55 A;  3MZD A;  3VP2 A;  1MWS A;  1SCW A;  2WGV A;  3LIC A;  5F5Y A;  2V0W A;  4LRZ E;  4XT2 B;  1VEU A;  2WZZ A;  3D3O A;  4EV4 A;  5G18 A;  3T4K A;  3HLW A;  3ICY A;  1JNU A;  4R0Q A;  2VV8 A;  4DXC A;  5FSR A;  1I5Q A;  3RXW A;  3W2Z A;  1XJ4 A;  1K57 A;  2BG1 A;  3UO9 A;  5CGX A;  2O99 A;  2ZJ9 A;  4ZRR A;  3IF6 B;  4CQH A;  4KQQ A;  2EFX A;  3F1O B;  4EEP A;  4ESP A;  4OKP A;  3PBS A;  3QP5 A;  5HAQ A;  2WGI A;  2YKF A;  1W79 A;  1C3B A;  4PM8 A;  1PW8 A;  1LSX A;  1NRJ A;  4GN2 A;  4EUV A;  4HJ6 A;  1NWZ A;  3T4L A;  4CLC A;  4QD4 A;  3SH7 A;  3IWQ A;  1LLB A;  2ZOH A;  1E25 A;  5DTS A;  2J9O A;  4GB7 A;  4LEN A;  2O0Y A;  1T1C A;  1JWP A;  2YKH A;  4CPK A;  4O0P A;  1WA9 A;  2Y2Q A;  4M3K A;  2ZBB A;  3Q7V B;  4C75 A;  4H6J B;  1XJ2 A;  2WKE A;  4LRY C;  3CUE A;  3E4O A;  3Q07 A;  4OPR A;  4X56 A;  5A93 A;  3H82 B;  3SW1 A;  3MZE A;  4RYE A;  1EI5 A;  5DTK A;  3HJI A;  4JGO A;  1NRF A;  1FR1 A;  3UMD A;  1CJF A;  3CI6 A;  3PHY A;  1K56 A;  4MBH A;  3HUO A;  2L0W A;  2I72 A;  3FV7 A;  4HI4 A;  2EX2 A;  3FKV A;  1J3W A;  2W1T B;  4X1M A;  3L9K A;  2PD8 A;  1XP4 A;  1Y54 A;  4KZ7 A;  4UA9 A;  3U2A A;  2UV0 E;  2V20 A;  3U4L P;  4OVD A;  3QP8 A;  2Y91 A;  3LFV A;  5CEC A;  3WRZ A;  3N8L A;  4E6X A;  3PBT A;  3CMZ A;  1N9N A;  5FDH A;  3DW0 A;  4BMW A;  1SDE A;  3SH8 A;  1ZHH B;  3M2J A;  4EQI A;  2Y2H A;  2Q9M A;  5FDS A;  3Q81 A;  5FAQ A;  4OON A;  4U0X A;  3VSK A;  3B33 A;  3IHB A;  3IH9 A;  3NBL A;  1GSX A;  1VEU B;  4OOM A;  5EVI C;  2IWD A;  4DE3 A;  4X6T A;  4D60 A;  3S7Q A;  4R3A A;  1VET B;  5HX9 A;  1A0K A;  3ZHH A;  2K7S A;  4Y5F A;  1L0G A;  4F94 A;  1G28 A;  1O07 A;  1KVL A;  1OTI A;  3NOT C;  3RXX A;  3R7W B;  3O87 A;  3V50 A;  1T18 A;  2ZMV A;  2ZMF A;  4HH2 A;  1BTL A;  4ZJ2 A;  5HAP A;  2ZMA A;  5HDD A;  1RGY A;  5F83 A;  4CLC B;  4MMN A;  3C4P A;  4F3L A;  1BUL A;  4NG2 A;  2WKR A;  1I2S A;  3LIA A;  1YLJ A;  4JXS A;  2VX8 A;  5AQ7 A;  4EES A;  3NJA A;  2VV6 A;  2PU4 A;  1VHM A;  4MLL A;  4X68 A;  4KQD A;  3D9Y A;  3PBO A;  4BD1 A;  3OPL A;  1YSP A;  1JWZ A;  1IYS A;  2OOL A;  3CHW P;  1OT9 A;  4BD0 A;  4YWZ A;  3ISG A;  3I7J A;  4UQI M;  5F1G A;  1V9Z A;  1D06 A;  1H8Z A;  2OAQ 1;  3IXG A;  4KZA A;  5EVL A;  3S4X A;  2FZ0 A;  2BTF P;  3UE3 A;  4Q0H A;  4E3K A;  3OBF A;  2A49 A;  3MR0 A;  4KZ3 A;  4OPQ A;  4IUK A;  1QME A;  2JKT I;  3N8S A;  4DKI A;  3KYZ A;  1IEM A;  3G34 A;  5FQ9 A;  1TVF A;  3E2K A;  4LV3 A;  1OJ5 A;  4WEK A;  4GD6 A;  2PBD P;  3UN7 A;  3OPH A;  3TW8 A;  4S2I A;  4E3N A;  3IX8 A;  1JTD A;  3A0S A;  1YLT A;  4Y0T A;  2LB9 A;  4E3I A;  4EWF A;  2H0Y A;  3ZG7 B;  3TOI A;  2WK0 A;  1ZG6 A;  4OQ0 A;  3JVV A;  5EV0 A;  1DJC A;  3S7O A;  1L0E A;  4EEU A;  1ERM A;  3Q1F A;  3IS2 A;  2ZC4 B;  4BBV A;  1KGE A;  3NHQ A;  3H7W B;  1AXB A;  1E3U D;  4X25 A;  4DRT A;  1ODV A;  2ACG A;  2H10 A;  1FCM A;  3T1R A;  2HGV A;  3LIF A;  4IED A;  4OOY A;  1NYM A;  4IVI A;  3G2Z A;  2L1M A;  3QP6 A;  1GA0 A;  3T12 B;  4BL3 A;  1YLP A;  4F3L B;  2EA9 A;  4NET A;  1YQS A;  3EOI A;  4Q8I A;  4MN5 A;  2WUQ A;  1ESU A;  1MXO A;  2ZM0 A;  3MXQ A;  4R38 A;  4CLC E;  1W8Y A;  3G4P A;  3ZGA B;  1G6A A;  1XJ3 A;  4HP9 A;  3GEC A;  2WKQ A;  4X53 A;  1BLH A;  2QJ5 A;  2Y2G A;  3NCK A;  4CLC D;  4WBG A;  1YM1 A;  3V67 A;  1MKM A;  3LID A;  3BYD A;  1I2W A;  1HD8 A;  5CHU A;  1PFL A;  3NDE A;  5L8M A;  1XGJ A;  2Y2I A;  4KZ6 A;  4A5R A;  2V2F F;  3RTY A;  4UAA A;  1OT6 A;  3MFX A;  3QP4 A;  2GZA A;  5CEB A;  3WS2 A;  1ES2 A;  3W4Q A;  3M2K A;  3W4P A;  1XJ6 A;  1K56 D;  1FOF A;  3VE3 A;  2ZQ7 A;  2VEA A;  1ALQ A;  1MKI A;  3MKF A;  4Y0U A;  3DTM A;  4B4X A;  3NIA A;  5K5B A;  1ZTU A;  1YLY A;  2UWX A;  2P9V A;  2V1A A;  4FH4 A;  4OP5 A;  3P98 A;  1UWP X;  3IS2 B;  5HD3 A;  1TDL A;  2XRN A;  3DAV A;  3C2W A;  3DTK A;  4I38 A;  5GHX A;  2ZQ8 A;  1YPR A;  5AVF A;  1K4F A;  1PIO A;  4EU0 A;  4M4X A;  1OTD A;  1FIL A;  5CRF A;  3ZVT A;  2GNX A;  1LHY A;  1K6R A;  3BW6 A;  1DRM A;  4KG6 A;  3A3F A;  4XT2 A;  3SS4 A;  3LR3 A;  3FC7 A;  4EET B;  3BFF A;  2GDN A;  3IXD A;  5JYP A;  4WYY A;  2CMN A;  2Y2O A;  5L2F A;  1PZP A;  1JWV A;  4ZAM A;  4GHI A;  3B47 A;  1LL9 A;  3BY8 A;  2X71 A;  3IF6 A;  5IHV A;  1PWC A;  4K08 A;  1YMX A;  2Q9N A;  4ID4 A;  3PR6 A;  4WLA A;  4JGP A;  3K2N A;  3PTE A;  2M1C A;  1L0D A;  5JYO A;  1IKI A;  4PKY A;  1K38 A;  1KE4 A;  4E04 A;  1PRQ A;  1H0M A;  5CTM A;  3T4S A;  4Z1W A;  3MXS A;  1FSW A;  1IKG A;  3UDI A;  5DTT A;  1QMF A;  2JKR M;  3T50 A;  2WAD A;  2MJ6 A;  2J3T D;  2Y55 A;  1LSV A;  3T1S A;  4DJ2 A;  4H6J A;  1BYW A;  3HLC A;  1XPB A;  2VV7 A;  3DWK A;  5C5K A;  1XFQ A;  3IX4 A;  4WZ5 A;  3H82 A;  4Q0I A;  3FWL A;  3W8K A;  1RCJ A;  2KOI A;  4X55 A;  2JKR I;  4NXG A;  2W3E A;  3EEA A;  3T1Q B;  3GMW A;  2P04 A;  4BLM A;  4Z9Q A;  3Q7Z A;  5A91 A;  3VP3 A;  1W7F A;  2HDR A;  2XEP A;  3BJN A;  2QHK A;  2W1T A;  4DMZ A;  2ZC3 B;  4P87 A;  4Y13 A;  1W63 M;  3S7P A;  2HP5 A;  3ZYT A;  3ZNT A;  3G31 A;  2OWH A;  2P9V B;  4U0T A;  4N92 A;  2VZW A;  5U47 A;  1XKZ A;  2E8I A;  3N6I A;  4LV0 A;  2XLN A;  2K2N A;  1JVJ A;  4ETX A;  2A3U A;  1BLP A;  2AVX A;  3DWZ A;  4EER A;  3C5A A;  1BUE A;  3VP1 A;  1CEF A;  4FCF A;  1VQQ A;  3MQ0 A;  3CWF A;  3FYZ A;  3VSL A;  1MWU A;  1VET A;  3HCY A;  3NC8 A;  5GLD A;  5M1A A;  2QJ7 A;  1FQG A;  4GHI B;  2Z2L B;  4JXW A;  2EX8 A;  2VLG A;  4L9G A;  3R7W A;  4DE1 A;  3CIT A;  5DFY A;  3C7V A;  3LR0 A;  2J7V A;  4ARZ A;  4X1L A;  4EBN A;  3T4T A;  4KZ4 A;  5CED A;  4OOL A;  1RP5 A;  1H3Q A;  1F9I A;  4JGQ A;  1W8Q A;  5FAS A;  1L2S A;  3NOP C;  3P7N A;  1YSQ A;  5CGW A;  5FAP A;  3BLM A;  4P85 A;  5FQJ A;  3PYP A;  1MY8 A;  2HDQ A;  1IYP A;  2NUP C;  2PD7 A;  1DY6 A;  2PU2 A;  3BQA A;  4N1X A;  3ZDJ A;  1E4D A;  3B3X A;  4LLO B;  3NI9 A;  3SS3 A;  5TR7 A;  4IUH A;  4Y2F A;  4PKY G;  3ULF A;  5F1F A;  2HPB A;  4HJ4 A;  4CJN A;  1OTA A;  5E2F A;  1DJB A;  2BAS A;  4FH2 A;  4Q0J A;  3KYE A;  3CAX A;  3EGX C;  5EOE A;  4BEN A;  2PYR A;  5HZH A;  2D01 A;  4OPY A;  2Y2M A;  1H8Y A;  5KSC A;  3D72 A;  4HQA A;  5FQM A;  5CX7 A;  1DP8 A;  3TG9 A;  1S67 L;  4HHD A;  2W3G A;  3UME A;  1DP6 A;  1FSY A;  2HF6 A;  5KMW A;  4QWO A;  1P9W A;  4G3W A;  1YKD A;  3MQO A;  2P7J A;  1KVM A;  3O86 A;  2G2W A;  4P6B A;  2JN7 A;  4LPZ A;  4S2K A;  5G4Z A;  2ZLY A;  2W3D A;  1Z6F A;  4KEN B;  1ES3 A;  2XH9 A;  4HP4 A;  3V39 A;  3OCL A;  5DF9 A;  2XK1 A;  5KIZ A;  2XSS A;  3VOL A;  2ZL1 A;  3HUM A;  3H7W A;  1GSW A;  4LV2 A;  3MSH A;  4HNB A;  3T4Q A;  5HWV A;  1X0O A;  3OOV A;  1NLZ A;  4ARZ B;  1W63 Q;  3LYX A;  2W3F A;  4ZTK A;  5DF8 A;  4GD8 A;  4RA7 A;  2G2U A;  2B02 A;  4PAU A;  1Q2P A;  2OLU A;  2ZC6 B;  4KUK A;  2X01 A;  3UPO A;  1HZO A;  1IYQ A;  4B9O A;  1VB6 A;  2IA2 A;  2PR6 A;  4BJP A;  4WN5 A;  2ZQC A;  3TSG A;  2XF3 A;  4C3Q A;  2Y79 A;  2O9C A;  4R4R A;  1N4O A;  1MBL A;  5HL1 A;  4IBR A;  1L0F A;  2JKT M;  1OME A;  1KE3 A;  2KX6 A;  2ZQA A;  3MBZ A;  1K54 A;  4XUX A;  2PR5 A;  2R9X A;  1MPL A;  1TDG A;  3GSG A;  4G3K A;  3OLO A;  4KUO A;  4GDB A;  4DDS A;  4S2O A;  1UGU A;  2HJ9 C;  4RX2 A;  3P01 A;  2A2L A;  3O88 A;  1P9R A;  1KGG A;  4Y17 A;  4QHC A;  1GA9 A;  5TBM B;  3A0R A;  3EWK A;  1EWZ A;  1Y28 A;  4PHT A;  3ZG0 A;  1TS6 A;  4KZB A;  5FQQ A;  2EXA A;  1SKF A;  4JF4 A;  4GNU A;  1GHP A;  1ACF A;  1ZC2 A;  4JPM A;  5AQB A;  3UDF A;  2GJ3 A;  2PAV P;  3KSF A;  1NZO A;  1OPX A;  2ZL1 B;  2Y2J A;  5DKL A;  5EOO A;  4JGR A;  4UA7 A;  3GRJ A;  4JF6 A;  3JPU A;  3F1P A;  5HAI A;  1HTZ A;  4EUZ A;  3AGF A;  4I3A A;  5HPF A;  3E2L A;  4X69 A;  2Y2L A;  1NYY A;  5GLB A;  2R78 A;  4EQ1 A;  4E3L A;  2VGK A;  2R9W A;  3GR2 A;  2QYB A;  1H8M A;  1STZ A;  2ZM8 A;  5CXW A;  2EXB A;  2JHE A;  1G68 A;  1YLW A;  4IBX A;  4Y7P A;  5F6A A;  3FZC A;  5EE8 A;  3KSI A;  3IBJ A;  4WMC A;  2H5S A;  3QNC A;  4XXR A;  3LIB A;  4BWI A;  3V3S A;  3ITA A;  2E8J A;  2HJE A;  5G4Y A;  4Y15 A;  1AWI A;  2Q0O A;  1TEM A;  3UE1 A;  5FI2 A;  4NXE A;  2IWB A;  3WRT A;  4D2O A;  4G3V A;  1N9L A;  3A3D A;  3N7W A;  4OLG A;  3UE6 A;  5L07 A;  1S66 L;  4EXO A;  4WZ4 A;  3E98 A;  2Y4A A;  2EFU A;  2VJW A;  2DCF A;  5IT5 A;  3NDG A;  4MN6 A;  3P09 A;  5A92 A;  4KZ5 A;  3AGD A;  1BLC A;  3FPV A;  3QHY A;  5DJT A;  3UPN A;  1KDS A;  1K0K A;  1T19 A;  1HVB A;  3KX0 X;  4MN7 A;  3UB8 A;  2HDS A;  3OPR A;  5HD5 A;  4OH0 A;  5M19 A;  4S2L A;  2XD5 A;  3KO6 A;  1WYC A;  4WF0 A;  3F1P B;  2WAF A;  3MMH A;  5GHY A;  3HBR A;  3LO7 A;  4XUZ A;  4QU3 A;  3EGD C;  1M6K A;  5I5L A;  3LR4 A;  2VK3 A;  5A90 A;  3QNB A;  1FCO A;  3OPP A;  3T4O A;  4I3J A;  2WKH A;  2ZD8 A;  5EVI A;  1DP9 A;  1MWR A;  1PYY A;  5LBR A;  5E43 A;  2P74 A;  4NXB A;  2WKI A;  2PHY A;  1L3L A;  1XA1 A;  3QP1 A;  5AQ9 A;  3TJZ C;  1YAX A;  5F68 A;  5HDC A;  3GV9 A;  2V1B A;  1MC0 A;  1TS0 A;  3SOI A;  4OQI A;  2XFT A;  4BQM A;  1H5X A;  4ME4 A;  2QMI A;  4E3M A;  4Y3I A;  1KGF A;  2OV5 A;  1BZA A;  4I3I A;  3NY4 A;  4ZJ1 A;  1S4R A;  5I94 A;  1ES5 A;  3GTC A;  4GW9 A;  2ZC5 B;  3LGO A;  2EWW A;  2ZQ9 A;  4HBT A;  3BM6 A;  4U3T A;  3PBQ A;  2RL3 A;  2FFF B;  1PZO A;  2VKS A;  3IXB A;  4N9L A;  4EBL A;  4B88 A;  4QY6 A;  2OSU A;  4HJ3 A;  2KDK A;  2OAP 1;  3H9W A;  5DVA A;  1U60 A;  1ERO A;  5CER A;  5DKK A;  1PW1 A;  3KSH A;  3MFD A;  4LRX C;  2HV1 A;  5CHJ A;  2Z2M B;  4GDN A;  2K31 A;  2HP9 A;  3DBA A;  5CGS A;  4MEZ A;  4MBK A;  1LL8 A;  2EX6 A;  3ZVW A;  1YMS A;  3LY3 A;  4DXB A;  3IXH A;  4WL9 A;  5J4E A;  5TJJ A;  1CQA A;  2HDU A;  3IH8 A;  1KDW A;  2IWC A;  1KE0 A;  3HL9 A;  4L9F A;  4KZ8 A;  4HY8 A;  4OQH A;  3AGE A;  2J3W A;  5EUA A;  5TFQ A;  5GHZ A;  3HLD A;  3O3V A;  1CEG A;  3HLE A;  4E3J A;  4I39 A;  3WS1 A;  3UB7 A;  4GS9 B;  5EEC A;  4BBU A;  4PM7 A;  3TRC A;  2HP6 A;  1T1A A;  3IF5 A;  2XQZ A;  2C6W B;  3R4K A;  1M40 A;  1P0Z A;  3D4F A;  3MXR A;  2PBY A;  4BL2 A;  3KYQ A;  4IJG A;  3N4I A;  4QJG A;  5GL9 A;  2LB5 A;  3VV4 A;  5DF7 A;  5EM1 A;  5EVI B;  3E0Y A;  3UPP A;  4KG2 A;  3M6H A;  5J3W A;  4JBF A;  3W4O A;  4JXG A;  4ZDX A;  3EQU A;  1WE4 A;  3HJK A;  3PXP A;  1P97 A;  4N9K A;  4HBU A;  2JKF A;  1NJ4 A;  3VE4 A;  3Q82 A;  1ONH A;  3SZT A;  1CF0 A;  2ZM2 A;  3BFE A;  2WYX A;  3V5M A;  4R23 A;  4JKT A;  4PMA A;  4GJ4 A;  5HFO A;  1S0W A;  5E2G A;  4ZBE A;  3CZD A;  4WMC D;  1ZG4 A;  1CI9 A;  2WGW A;  5D3O A;  3LCE A;  3BLS A;  3V3R A;  2INW A;  1EW0 A;  2I9V A;  3A3J A;  1XFN A;  4KQR A;  2QWS A;  1IYO A;  4LGW A;  1XX2 A;  5FEF A;  2NUT C;  3WS5 A;  1NXY A;  4DDY A;  3LR5 A;  4FD8 A;  2J80 A;  2M7U A;  1FR6 A;  2WZX A;  3K3D A;  4FOF A;  2HZ5 A;  3LEZ A;  3BFG A;  1PI5 A;  4R3J A;  1CI8 A;  4JF5 A;  2DMW A;  4L0L A;  2X02 A;  2C5W B;  4WUJ A;  3UY6 A;  4NK3 A;  3B42 A;  1W5D A;  3A3I A;  3CG5 A;  2XD1 A;  1GHM A;  4B4Z A;  4MCW A;  1RGZ A;  4ETZ A;  5TBM A;  2WKP A;  4O7D A;  2L4R A;  5HWW A;  5GLC A;  3MKE A;  1JTG A;  1J9M A;  4DF6 A;  2CC1 A;  2O9B A;  1IEL A;  4YFM A;  4QY5 A;  3ZCZ A;  3CPT B;  4YNR A;  4S2J A;  3FG8 A;  4RVA A;  4WM9 A;  3PBN A;  2JKG A;  2PYP A;  1XXM A;  1IOU A;  3RFB A;  3JVU A;  4HEF A;  3IF6 C;  3T4J A;  1F2K A;  4HIA A;  5FA7 A;  3BWL A;  5E2H A;  1TD5 A;  5L09 A;  1UWN X;  3E4P A;  4K0X A;  3BY9 A;  1V9Y A;  3K3C A;  5HAR A;  3S22 A;  5FEG A;  3QP2 A;  5DFX A;  3LI9 A;  1S1Y A;  5DJU A;  2Z6C A; 
#chains in the Genus database with same CATH homology
 4ZRR A;  3BY8 A;  4CQH A;  3F1O B;  2QYB A;  3NOU C;  4EEP A;  1H8M A;  1STZ A;  3PBS A;  2JHE A;  4K08 A;  3S7N A;  4O01 A;  2YKF A;  3PR6 A;  4WLA A;  1LSX A;  1GSV A;  3K2N A;  1NRJ A;  4JGP A;  2M1C A;  5F6A A;  4EUV A;  4HJ6 A;  1NWZ A;  3T4L A;  4CLC A;  5HWT A;  4PKY A;  3KSI A;  3IBJ A;  4E04 A;  3LIB A;  1LSW A;  2ZOH A;  4BWI A;  4IHQ A;  3T4S A;  4Z1W A;  2HJE A;  5G4Y A;  1TF1 A;  2D02 A;  2O0Y A;  1T1C A;  2Z6D A;  2YKH A;  5F69 A;  4P6Z S;  4O0P A;  2PDR A;  1WA9 A;  3LI8 A;  2JKR M;  3T50 A;  2MJ6 A;  2J3T D;  2ZBB A;  4NXE A;  2XRO A;  4H6J B;  1XJ2 A;  1LSV A;  2W27 A;  5HDS A;  4DJ2 A;  4H6J A;  1BYW A;  3CUE A;  3E4O A;  4LRY C;  4YOF A;  2VV7 A;  5C5K A;  3H82 B;  4G3V A;  3SW1 A;  1N9L A;  2G7U A;  1XFQ A;  3H82 A;  3HJI A;  4JGO A;  3UE6 A;  4Q0I A;  3MJQ A;  2KOI A;  3UB9 A;  3UMD A;  3CI6 A;  4QPR A;  2JKR I;  4NXG A;  2XA7 S;  2W3E A;  1TS7 A;  3EEA A;  1S66 L;  3PHY A;  4DJ3 A;  4KQO A;  2L0W A;  4HI4 A;  3CLO A;  4EXO A;  2GX5 A;  2P04 A;  2W1T B;  2A24 A;  3E98 A;  2PD8 A;  2VJW A;  3BJN A;  2QHK A;  3U2A A;  5IT5 A;  2W1T A;  4DMZ A;  4MN6 A;  1W63 M;  3S7P A;  5A8B A;  3ZYT A;  3FPV A;  5DJT A;  1MZU A;  2QKP A;  1D7E A;  3LFV A;  2OWH A;  3MF0 A;  1T19 A;  3PBT A;  1N9N A;  4BMW A;  2VZW A;  1ZHH B;  4GCZ A;  3KX0 X;  4MN7 A;  3UB8 A;  2P08 A;  2K2N A;  4ETX A;  5HD5 A;  3KO6 A;  3B33 A;  4MDZ A;  1N9O A;  2VGL S;  1GSX A;  4EER A;  4WF0 A;  3F1P B;  4GLQ A;  4OOM A;  3MMH A;  3E4Q A;  3MQ0 A;  3S7Q A;  3CWF A;  5IS1 A;  4R3A A;  3EGD C;  5I5L A;  2K7S A;  3HCY A;  3LR4 A;  2QJ7 A;  4Y5F A;  2OWJ A;  1G28 A;  1OTI A;  3C30 A;  4AFI A;  4GHI B;  4CLC C;  3IBR A;  3T4O A;  3NOT C;  4I3J A;  2PT7 A;  3R7W B;  3EQV A;  1T18 A;  2ZMV A;  1DP9 A;  2ZMF A;  2VLG A;  4HH2 A;  4L9G A;  5LBR A;  3R7W A;  3CIT A;  4NXB A;  5DFY A;  3LR0 A;  5HDD A;  4ARZ A;  2PHY A;  4CLC B;  3T4T A;  3TJZ C;  4MMN A;  1YAX A;  5F68 A;  5HDC A;  4OOL A;  2V1B A;  5MC7 A;  1MC0 A;  4F3L A;  4HH3 A;  1H3Q A;  1TS0 A;  2WKR A;  3LIA A;  4ME4 A;  3A0V A;  1F9I A;  2V0U A;  3C38 A;  3CUE C;  4JGQ A;  4Y3I A;  4UEY A;  4I3I A;  3NOP C;  2VX8 A;  4EES A;  3P7N A;  3NJA A;  4R70 A;  2VV6 A;  1YSQ A;  1G6O A;  1S4R A;  1VHM A;  3PYP A;  4GW9 A;  2NUP C;  2PD7 A;  2B18 A;  3GDI A;  4KQD A;  3BQA A;  3PBO A;  2EWW A;  4LLO B;  3PBQ A;  1YSP A;  4IUH A;  2VKS A;  4Y2F A;  4HJ3 A;  4PKY G;  3ULF A;  2OOL A;  1OT9 A;  2KDK A;  2OAP 1;  3H9W A;  1LT0 A;  4HJ4 A;  5DKK A;  4YWZ A;  3KSH A;  1OTA A;  4II7 A;  4UQI M;  1V9Z A;  2BAS A;  4LRX C;  1D06 A;  2HV1 A;  4Q0J A;  2A24 B;  2OAQ 1;  3CAX A;  3EGX C;  5AJG A;  2K31 A;  2PYR A;  3DBA A;  3F1N A;  5HZH A;  1NLY A;  1T1B A;  2D01 A;  2FZ0 A;  3UE3 A;  4Q0H A;  4NEE D;  1LL8 A;  3D72 A;  4HQA A;  5CX7 A;  1DP8 A;  2VA0 A;  4I5S A;  1S67 L;  3OBF A;  4WL9 A;  5J4E A;  5TJJ A;  3MR0 A;  4HHD A;  3EEH A;  2W3G A;  3UME A;  1DP6 A;  4IUK A;  2HF6 A;  4L9F A;  2JKT I;  4B93 A;  4HY8 A;  5AVE A;  3KYZ A;  1S4S A;  5EFW A;  2J3W A;  1P9W A;  3O5Y A;  1OJ5 A;  1OJG A;  4G3W A;  2EWV A;  1YKD A;  4WEK A;  3MQO A;  2P7J A;  5HPI A;  5HSQ A;  3UB6 A;  3FPW A;  3TW8 A;  4I39 A;  3RH8 B;  3UB7 A;  4GS9 B;  3A0S A;  4BBU A;  2LB9 A;  2JN7 A;  4LPZ A;  3TRC A;  4GS9 A;  1OTB A;  1T1A A;  1S1Z A;  2V9A A;  2H28 A;  5G4Z A;  3JVV A;  3R4K A;  1P0Z A;  2W3D A;  4WEJ A;  3KYQ A;  3S7O A;  4IJG A;  4EEU A;  4HP4 A;  3ZQ5 A;  3OCL A;  5DF9 A;  3IS2 A;  2LB5 A;  4BBV A;  5KIZ A;  3VV4 A;  3NHQ A;  3H7W B;  1F5M A;  2XSS A;  3E0Y A;  3VOL A;  1ODV A;  3G6O A;  3H7W A;  1GSW A;  5J3W A;  3TE8 A;  3LUQ A;  2HGV A;  3LIF A;  5HWV A;  4HNB A;  3T4Q A;  1X0O A;  3OOV A;  1NLZ A;  4ARZ B;  1W63 Q;  2J3T C;  3LYX A;  2W3F A;  4L9E A;  2L1M A;  2W0N A;  4BBT A;  5KSH A;  4P6Z M;  2W3H A;  4F3L B;  3EQU A;  3HJK A;  5IU1 A;  4EW7 A;  3PXP A;  1P97 A;  2B02 A;  2EA9 A;  2M7V A;  3EOI A;  3VE4 A;  4PAU A;  3OC2 A;  4KUK A;  4MN5 A;  2O9A A;  3PBR A;  3F1O A;  2ZOI A;  4R38 A;  3MXQ A;  4CLC E;  5FL3 A;  3MQQ A;  1IFQ A;  1XJ3 A;  4B9O A;  4HP9 A;  1VB6 A;  2IA2 A;  4FSF A;  2XA7 M;  2PR6 A;  4BJP A;  4WN5 A;  3GEC A;  2WKQ A;  2QJ5 A;  3BQ8 A;  2FH5 A;  4GJ4 A;  4CLC D;  4RQ9 A;  4WEL A;  4O8G A;  2Y79 A;  2O9C A;  3V67 A;  1MKM A;  1OTE A;  3LID A;  5HL6 A;  2INW A;  1EW0 A;  2I9V A;  2JKT M;  2KX6 A;  1XFN A;  3F1N B;  4NKP A;  5L8M A;  2QWS A;  2Y8H A;  2PR5 A;  3OCN A;  2NUT C;  3LIE A;  3LR5 A;  3RTY A;  2J80 A;  2M7U A;  4G3K A;  3OLO A;  1KOU A;  4KUO A;  1OT6 A;  3K3D A;  4FOF A;  1UGU A;  2HJ9 C;  1F98 A;  3MFX A;  2GZA A;  3P01 A;  2VGL M;  3C8C A;  2DMW A;  4L0L A;  2A2L A;  1P9R A;  4WUJ A;  4HOI A;  1XJ6 A;  3VE3 A;  5TBM B;  3B42 A;  5J7E A;  2VEA A;  4DN0 A;  4MCW A;  4ETZ A;  4NXF A;  5TBM A;  2WKP A;  3A0R A;  2L4R A;  1TS8 A;  3EWK A;  4UQI S;  5HWW A;  4R6L A;  5K5B A;  1Y28 A;  4PHT A;  1ZTU A;  1TS6 A;  2W1R A;  2O9B A;  2V1A A;  3KSG A;  4YNR A;  2GJ3 A;  1UWP X;  3IS2 B;  3FG8 A;  5HD3 A;  2KLI A;  3KSF A;  2XRN A;  1OPX A;  3C2W A;  3PBN A;  3LIC A;  4I38 A;  5F5Y A;  5DKL A;  5AVF A;  2V0W A;  4LRZ E;  4EU0 A;  4M4X A;  1OTD A;  4JGR A;  2GNX A;  2PYP A;  3F1P A;  1IOU A;  4XT2 B;  3RFB A;  3BW6 A;  3JVU A;  1DRM A;  3T4J A;  4HIA A;  3D3O A;  4XT2 A;  3T4K A;  3BWL A;  3ICY A;  1JNU A;  1TD5 A;  2VV8 A;  3FC7 A;  3LR3 A;  4I3A A;  4EET B;  5HPF A;  1UWN X;  3E4P A;  3BY9 A;  1V9Y A;  3K3C A;  2CMN A;  3W2Z A;  5DFX A;  2R78 A;  4EQ1 A;  1XJ4 A;  3LI9 A;  1S1Y A;  2O99 A;  4GHI A;  3B47 A;  5DJU A;  2Z6C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...