3FPWA

Crystal structure of hbps with bound iron
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
140
structure length
140
Chain Sequence
PVAARGGELTQSTHLTLEAATKAARAAVEAAEKDGRHVSVAVVDRNGNTLVTLRGDGAGPQSYESAERKAFTAVSWNAPTSELAKRLAQAPTLKDIPGTLFLAGGTPVTAKGAPVAGIGVAGAPSGDLDEQYARAGAAVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Extracellular haem-binding protein
publication title The oligomeric assembly of the novel haem-degrading protein HbpS is essential for interaction with its cognate two-component sensor kinase
pubmed doi rcsb
source organism Streptomyces reticuli
molecule tags Heme binding protein
total genus 43
structure length 140
sequence length 140
ec nomenclature
pdb deposition date 2009-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03928 Haem_degrading Haem-degrading
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.150 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3fpwA01
4CLCA 4CLCD 4BMWA 3FPWA 4CLCB 4CLCE 5CX7A 4NKPA 4CLCC 2A2LA 3FPVA
chains in the Genus database with same CATH superfamily
5J4EA 1YLTA 3IXDA 3MXSA 1OMEA 2E8IA 1I2WA 3MBZA 4GZBA 3MSHA 1MY8A 3OPPA 3HBRA 3BJNA 1K25A 2JN7A 2WK0A 4WN5A 4EQIA 1ESIA 2B5RA 5AJGA 1BLHA 3BFDA 3MQOA 3WS4A 5JYOA 3O88A 1I2SA 3HUNA 5DKKA 2MJ6A 5F83A 1FSWA 2ZC5B 4XT2B 2GX5A 3VFHA 4YNRA 3AGDA 4Y0UA 3T12B 3LCEA 5CECA 1P9WA 4QJGA 4BLMA 1Y28A 3UPNA 3VP2A 5EOEA 3HL9A 4I39A 3C4OA 1K4EA 1XGJA 2Q9NA 2OOLA 2Q0OA 1NZUA 5FAOA 1EW0A 2PBDP 4S2LA 3CAXA 3ZG5A 3BLSA 3PYPA 3GECA 3D72A 4K91A 5GLDA 5I5LA 1YSPA 4DMZA 4O0PA 3GTCA 3KX0X 3V5MA 4EBNA 4LRZE 3OBFA 1XX2A 3F1NB 4R38A 1EWZA 3HLWA 5FDSA 2FFYA 3SZTA 4WZ4A 1Z09A 5IU1A 3HLBA 3ZFZA 1J3WA 2H28A 4KZAA 2OWJA 4KENB 3FPVA 4LGWA 3RFBA 3C30A 5AQ7A 1ZKJA 4GS9B 3EWKA 3Q7VA 3IXGA 3CHWP 2DRWA 1ACFA 4PHTA 1MKIA 5DFYA 2Y2HA 2WKIA 3DWZA 2V0WA 2I72A 1BYWA 1NLYA 3WS2A 5GLBA 1XA1A 1ES5A 1PFLA 4R3BA 3QP8A 1L2SA 3GRJA 2JHEA 1BT5A 4O8GA 3MQ0A 3ZG7B 2ZMVA 4MBKA 1OJGA 1M6KA 1CF0A 1Y4OA 5EPHA 3D4FA 2XA7M 1JVJA 2PU4A 3CG5A 4X69A 5M1AA 1FCMA 1NWZA 3BEBA 1STZA 5DKLA 3VE4A 2ZC6B 2J80A 5AQBA 4OPZA 4OQHA 5EM1A 3ZDJA 1UWPX 2HDQA 3GQZA 3DWKA 4UEYA 4F3LA 2P7JA 3F1PA 4DXBA 3KSIA 3T4OA 3FZCA 2RL3A 3CPTB 2HDUA 1E3UD 3C38A 4LRXC 1OT6A 4MEZA 5EV0A 1E4DA 4R1GA 2HZ5A 3QP2A 3IF6A 3PHYA 2K2NA 1L3LA 2DNSA 1DP6A 4KQQA 3U4LP 4I38A 1GA0A 3MMHA 3W8KA 2QZ6A 2W3FA 5CXWA 3ZCZA 1N9NA 1T1BA 3P01A 1TS0A 3OZHA 5CHJA 1IYOA 2WYXA 1EROA 2K31A 2Y2JA 2BG1A 3SH9A 1DJCA 4HESA 3FKWA 4N92A 3T4LA 1S0WA 4DXCA 1HVBA 4DE3A 4Q8IA 1KE3A 4Y3IA 1PZOA 4QD4A 3HLCA 2FH5A 3P7NA 3KYQA 4O01A 5DJTA 1TVFA 3VFFA 3U2AA 3ZNYA 3W4OA 4E3JA 4E3MA 2VJWA 2FFFB 4LCMA 2V9AA 2NUTC 4OPYA 3ITBA 2VV8A 1JTDA 3KO6A 4N9LA 4H8RA 2ZOHA 1LL8A 3PAGA 2Z6DA 5AVFA 4LCLA 5TBMB 5IS1A 2XGNA 4L9FA 4HNBA 3GSGA 2HP9A 2W3EA 3R4KA 2IWCA 3FYZA 1FOFA 5EUAA 1FCNA 3O86A 3QP5A 4KZ9A 3ICYA 3ZGAB 4KUOA 4FCFA 3FC7A 1VEUA 4MLLA 3NY4A 1L0DA 1SKOA 3OLOA 4QU3A 2W3HA 5F68A 4Q0HA 2M1CA 3CZDA 4DE0A 2XRNA 4JLFA 3T50A 3SOIA 3N6IA 2EWWA 3BY9A 3LGOA 3O5YA 3H82B 4OOYA 1NLZA 2H5SA 4HH2A 2W1TB 1S6RA 3HLEA 2ACGA 3HCYA 4E6XA 1YLYA 2B95A 4X6TA 2P9VB 1W63Q 3ZVWA 2VKSA 1XJ4A 5CTNA 2H0YA 3RXWA 2INWA 4KZ3A 4D60A 4C6YA 1F9IA 1VB6A 1ERMA 4EU0A 3NULA 2ZQ7A 4HP4A 1OTBA 1PZPA 2WADA 4FOFA 3IWQA 3GDIA 3VSKA 1ES3A 5E2FA 4S2IA 2W3DA 2L0WA 4WMCA 4HQAA 1S1ZA 1K56D 5G4ZA 3BY8A 4JGRA 1YLPA 4JXWA 3NECA 3HUMA 3EEAA 3S7QA 1Q2PA 4IVIA 1ZG4A 4L9EA 2Z6CA 1YPRA 4HEFA 4R3AA 4BENA 2OWHA 3IXBA 4N9KA 4DF6A 3GV9A 4HIAA 1YT4A 2PBYA 5D3OA 3UNWA 3PTEA 4IUHA 1IEMA 3NOTC 4Q0JA 5HWVA 1MWRA 1CI9A 2VGLS 4C3QA 3IS2A 1BUEA 4ZDXA 5K5BA 4HY8A 1GSWA 4NG2A 1HZOA 1MC0A 3IX8A 3JVUA 3N4IA 3WS5A 1FR1A 4EXOA 3IF5A 3MR0A 1DY6A 2PDRA 2WGWB 1W63M 5HFOA 3LR5A 1KGFA 3UY6A 2WKRA 3M2KA 4UHUA 2ZQDA 4ARZB 2Y2MA 4X53A 2YKFA 3SS3A 4N1HA 1K6RA 2JKTI 1S4SA 3T4JA 1S1YA 4EEUA 3VOYA 2Y4AA 3RH8B 3CUEA 2XROA 2X71A 1S4RA 3PBNA 2JE5A 3C7UA 2V0UA 4OOLA 1YSQA 4MN7A 2HJ9C 3PBQA 3ZHHA 4P85A 2V1ZA 5E2GA 1T1CA 1HTZA 5EVIB 4K0WA 3G32A 4P6ZS 3DTMA 1NXYA 4DDYA 1NJ4A 3A3DA 1DJBA 3NOPC 1JWPA 1P0ZA 1ODVA 4KUKA 4OP5A 2HF6A 2XFSA 4EV4A 3FWLA 2X01A 4Q0IA 2J7VA 2HP5A 2ZL1B 4ZJ3A 3H9WA 4NKPA 1AWIA 4KG2A 4E6WA 4HOIA 3MFDA 3BFCA 4DJ3A 1LHYA 2QYBA 3V3RA 2G2UA 3MKFA 1T18A 1OTDA 1HLUP 3BWLA 2JC7A 5J3WA 1C3BA 4QHCA 2WAEA 3DBAA 1MKMA 2XA7S 3BW6A 4QPRA 4PM7A 5GL9A 4Y7PA 4DKIA 3WS0A 2QJ7A 2ZQAA 2VGLM 4BL2A 5HPFA 2XEPA 3A0VA 1TDLA 2QWSA 3UPOA 3F1OA 4JGPA 2G7UA 4WBGA 3QP4A 3H7WA 3VOLA 2B18A 4MDZA 2A24B 3CWFA 1TS7A 1VM1A 5TR7A 1PW8A 3L9KA 5G4YA 4HBTA 1V9ZA 5DTSA 4HHDA 2M7VA 2ZOIA 2V1AA 2R78A 1IYSA 4ZBEA 4JGOA 4E3IA 5FQKA 5FQ9A 2UWXA 4GHIB 3Q1FA 3P09A 2GJ3A 1GHIA 2ZJ9A 3S7NA 1G6OA 3G30A 4Z9QA 3UDFA 3UB9A 5F1FA 4NK3A 3HJIA 4R0QA 2J3TC 3V50A 2QKPA 1BLCA 1ZTUA 4FTXA 4H6JA 4HP9A 4X1MA 5HAPA 3NDGA 4GLQA 1G68A 1LSXA 3SH8A 4ESPA 4WYYA 5FDHA 5DTKA 3MS6A 4QWOA 2XQZA 4P6ZM 3MKEA 3QHYA 1FQGA 2WAFA 1YAXA 1K55A 2CC1A 2Y2GA 4ZJ1A 1WE4A 3EEHA 1CEFA 3PR6A 3CJMA 3GVBA 5L09A 4A5RA 4MN6A 4GW9A 2J9PA 4X56A 3V67A 3IWOA 3PBRA 3UDIA 4IVKA 2OLVA 2OLUA 4PM9A 1KGGA 5EM0A 3VE3A 3OCNA 2M7UA 3BRMA 2XF3A 4BL3A 1N9BA 3R7WB 5AQAA 2Y8HA 3VOZA 4WZ5A 2PHYA 1RP5A 3W4PA 3E4QA 1L0GA 4OQGA 2VZWA 3T4TA 4MNRA 4WUJA 3HUOA 1XPBA 3IQAA 4KQDA 2J3TD 3IH8A 4Z1WA 4B93A 4AFIA 3VSLA 1GHMA 4DE1A 2Y2NA 5HD5A 3IHBA 4YWZA 4CPKA 4KG6A 3LYXA 2VV7A 3CUEC 4CLCA 4CJNA 3HJKA 1M40A 5A92A 4NXGA 4BD0A 4B9OA 4LV1A 4EETB 4E04A 2EXBA 1YKDA 4UA6A 2ZD8A 2O9CA 2H0TA 1SHVA 5F1GA 2G2WA 2W3GA 1XGIA 4LV3A 1SKFA 2XD5A 2Z2LB 3IX4A 1MPLA 1CQAA 2QJ5A 5DVAA 4U3TA 3TRCA 3LIAA 5HL6A 4RX2A 1K6SA 2ZMAA 2A49A 1XKZA 3B47A 3FV7A 1LT0A 4Y17A 2ZQCA 4IUKA 2C5WB 4RVAA 5FI7A 5FQIA 4HI4A 2VK3A 1GA9A 1RGZA 2B02A 1XJ6A 1IOUA 5CX7A 1OJ5A 4I3JA 1JTGA 1HD8A 1W7FA 1O07A 2EX6A 2HP6A 4X68A 1J9MA 4WM9A 1VETB 2O9AA 2XH9A 3N8RA 2J3WA 5HDDA 5GLCA 2OAP1 3UB7A 1NYYA 3LEZA 3C4PA 1KE0A 1F5MA 4EQ1A 5CEDA 3Q07A 1KDWA 2ZC4B 5E2EA 1PWDA 3T1RA 5FL3A 1NY0A 5FASA 5EECA 4DE2A 2V8CA 3G35A 3P98A 4N1XA 4BMWA 3OPLA 5EE8A 1YMXA 5C5KA 2ZC7A 5M18A 3LIFA 3E2KA 4IBXA 1LI0A 3UPPA 1TS6A 1N9LA 1TDGA 5FAPA 5IT5A 4DDSA 3I7JA 4QB8A 1IELA 4LENA 4LRYC 1FCOA 4DN0A 4BBVA 3UMDA 5HPIA 3BM6A 2P08A 2W1RA 2PT7A 4OPQA 1D7EA 4R6LA 3E4PA 1P97A 1V9YA 2Y2PA 3D9YA 2KOIA 4XT2A 3QNCA 4B88A 4ZTKA 4MMNA 5FATA 2D01A 4C75A 3UE6A 4RQ9A 2OSUA 1U60A 1GSXA 3LR0A 1PNEA 4GB7A 1LSWA 3RJUA 4K08A 3BFGA 4KZ8A 2E8JA 2V1BA 5GHXA 3HLFA 4JKTA 5HSQA 5E43A 4HJ4A 1IYPA 2Y2QA 4HJ6A 5E2HA 4UQIS 1IYQA 1PRQA 1RGYA 1L0FA 4G3WA 1K57A 2A3UA 2V8FA 5GHZA 1NRFA 3TG9A 4WZ5C 3ZYTA 5L07A 4JBFA 2DCFA 4GD6A 5U47A 4MCWA 3PBTA 2KDKA 3UO9A 3UDXA 1H5XA 5CGXA 4GNUA 3UE0A 4II7A 3F1NA 3OPHA 3IH9A 3Q7VB 2LB5A 1KVLA 2Y2LA 3IBRA 4BD1A 1K4FA 4CLCC 1GHPA 5HWTA 3EQUA 2P04A 4PKYA 3KSHA 4BQMA 3ITAA 1ZHHB 1LSVA 3DTEA 2LB9A 4ZAMA 4GS9A 5DF9A 2WKQA 3EQVA 1ZC2A 1YLZA 4I5SA 4FH4A 5G18A 1Y54A 5FSRA 4ETZA 2ZLYA 4OH0A 4S2OA 3SW1A 4JF5A 1FIKA 3GR2A 4EUZA 3IT9A 1PI5A 2J8YA 1PWCA 5KIZA 3IF6C 4OLDA 1YLJA 4EBPA 3N8LA 2Y2IA 4P0MA 2OV5A 3G31A 1KDSA 1EI5A 1SCWA 3L7HA 4FSFA 4NXEA 1KOUA 1D06A 3S7PA 2J9OA 4Y2FA 3LY4A 1DP9A 4JXSA 1WA9A 1LI9A 3NDEA 1KGEA 2ZQ8A 3BQAA 2XR0A 5CHUA 5DFXA 5F6AA 3B42A 4CLCD 3G4PA 1K0KA 2L1MA 4F3LB 5EVEA 3DAVA 3F1PB 1D1JA 3LFVA 3TOIA 4BBUA 2FZ0A 3A3EA 3FG8A 3A3JA 3GMWA 1SZVA 4O7DA 4S2JA 2EX8A 1YM1A 3IF6B 1FR6A 4Y13A 2VGKA 2EXAA 2HDSA 3M2JA 3PAEA 2I9VA 2WZZA 4JGQA 3WWXA 4Y15A 3K2NA 1IFQA 4UQIM 3CPTA 2Y2OA 4GDBA 2PAVP 4S2PA 3LR3A 2Y59A 3C8CA 2CMNA 3HREA 1XP4A 4PM5A 5TGFA 4OOMA 2C6WB 1WYCA 3E4OA 5A91A 5FQQA 1W5DA 2AVXA 2PU2A 3C7VA 5MC7A 2BLSA 1PWGA 5EOOA 4E3NA 2XD1A 5DF8A 3ULFA 5A90A 2GNXA 1CI8A 1QMFA 2EFUA 3BECA 2JBFA 4OKPA 3T4SA 3UE3A 2YKHA 5CGSA 4GCZA 5A93A 5HAIA 4P87A 1BTLA 1NZOA 1FSYA 1OTAA 1K54A 2V20A 5DF7A 3UB8A 3CMZA 3FKVA 3VP4A 1N4OA 3IBJA 2WGIA 4R4RA 1CK3A 1TF1A 3VV4A 3NOUC 5CRFA 1MBLA 4IHQA 4KZ5A 1QMEA 1XXMA 4LV0A 1VQQA 1K57C 4PPRA 4FH2A 3E2LA 2UV0E 2EA9A 3IXHA 2QMIA 5TBMA 5A8BA 3M6HA 1KE4A 4LLOB 2P74A 1VEUB 3G34A 5CEBA 4JF6A 3JVVA 1SKOB 1TS8A 2KX6A 3VMAA 5JYPA 2A2LA 2VX8A 1ERQA 4G3VA 3K3DA 3OPRA 1LLBA 1ESUA 1XFNA 1PW1A 2GDNA 3T4QA 4LPZA 3S4XA 2WKEA 1LL9A 2WZXA 5HAQA 1Q2QA 4KZ4A 2HPBA 3PBOA 1MXOA 2K7SA 4YINA 2Y2KA 3MFXA 5L10A 2OAQ1 3H82A 3ZQ5A 5LBRA 1SDEA 1X0OA 5HDSA 4WLAA 3RXXA 2W1TA 4LFUA 4NEED 2P9VA 5F5YA 4GKUA 3TSGA 3JYIA 3PXPA 4S2MA 4F94A 1H8MA 2ZM0A 2IA2A 1BLPA 1ES2A 4HJ3A 3T1XA 4BJPA 5HW3A 3NCKA 3DTKA 2XK1A 3BFEA 3A3FA 3CI6A 4JXGA 4GOGA 5HWWA 3UE1A 4IJGA 1JWVA 1H8ZA 2O0YA 1F2KA 1OTIA 2VGJA 4U0TA 4KZ6A 1K56A 2EFXA 4EEPA 4WMCD 4YFMA 5L8MA 1BULA 5DJUA 5HARA 3LI8A 5L2FA 4HBUA 4OVDA 3KYEA 3OC2A 3M6BA 4JPMA 3NIAA 4QY6A 3B3XA 3LUQA 1GCEA 5TFQA 2EWVA 1W8QA 4CLCE 2XSSA 3WS1A 3T1QB 3N7WA 5J7EA 3T4KA 3IS2B 3UB5P 1CEGA 4EERA 5CHMA 4Y5FA 3S7OA 1UWNX 2EX9A 1RCJA 4RA7A 3AGFA 3ZG9B 2VEAA 4WL9A 5HX9A 3E98A 3LI9A 4X25A 2VV6A 3ZNTA 5TJJA 3SH7A 2XDMA 2D02A 1YLWA 2PYPA 2HGVA 1PIOA 4ZJ2A 1TEMA 4WEJA 1OPXA 5IHVA 1DJAA 3HVFA 2WGWA 4HH3A 1AXBA 4WF0A 1K54C 2PR5A 3HLGA 3V39A 2XFTA 5I94A 4ARZA 3MXQA 3EGXC 1OT9A 4KQRA 3W2ZA 1MZUA 4OLGA 2RCXA 4S2NA 1I5QA 3KYZA 1TD5A 1CJFA 2O9BA 4MN5A 5F82A 3SS5A 4B4XA 1S67L 3LY3A 2ZM2A 5M19A 3A3IA 4BBTA 2NUPC 2WGVA 5EVIA 2H10A 2JCHA 2WKHA 1ONGA 4PMAA 3JPUA 1G28A 3C5AA 1K38A 3Q81A 1G6AA 3N8SA 4IBRA 4K0XA 4OP8A 2ZL1A 2DMWA 3Q82A 5FI2A 2PR6A 4IEDA 4PKYG 4L9GA 3Q7ZA 4DJ2A 2BASA 4KQOA 4ME4A 3MQQA 3BFFA 3WRTA 4WEKA 4EBLA 4UA9A 1GSVA 1P9RA 3B33A 5FI6A 4NXBA 1H8YA 1MWUA 2ZBBA 2Y55A 3S22A 3LR4A 4L0LA 3F1OB 3G2ZA 3H7WB 2Y91A 1PYYA 1T19A 3EOIA 3O3VA 4GDNA 4S2KA 5EFWA 3DTIA 3UB6A 4FUWA 2ZM8A 2IWDA 3CLOA 4BWIA 3VP3A 3ZVTA 4QY5A 1JWZA 2ZQ9A 4R3JA 5GLAA 4UA7A 4NETA 3MXRA 1K55C 4GD8A 1BZAA 2V2FF 2A24A 5HD3A 3FPWA 3HLDA 2O99A 4PM8A 4ZRRA 5KSHA 4MBFA 3ZG0A 2X02A 1XJ2A 3O87A 3MF0A 3OCLA 1N9OA 4UAAA 2L4RA 1XJ3A 2PYRA 1G5UA 3LICA 3MZEA 5GHYA 3LEQA 3KSFA 3QP1A 1LL5A 4R23A 5FQMA 1L0EA 4GHIA 1ES4A 4G3KA 4MBHA 4EW7A 4KZBA 4H6JB 5HDCA 2Z2MB 3LIBA 4PM6A 4CQHA 4D2OA 3LIDA 3NBLA 3QP6A 4OQ0A 2VA0A 4JXVA 4RX3A 5FQJA 1KVMA 3MZDA 1PI4A 1NYMA 3VP0A 1VHMA 2HDRA 3LO7A 3UN7A 1DP8A 3BLMA 4U0XA 2HJEA 2R9XA 3UMEA 3V3SA 4OONA 2JKRI 5KSCA 3NJAA 2PD7A 3LIEA 5HL1A 2XLNA 4E3OA 4OQIA 5HZHA 2PRFA 1W79A 2JKFA 3C2WA 3MJQA 4LV2A 3EGDC 5AQ9A 4NXFA 4FD8A 3W4QA 2W0NA 4Y0OA 1W8YA 3OOVA 1UGUA 3R7WA 2GZAA 1F98A 2PD8A 3SS4A 4GJ4A 4I3AA 4CLCB 3QNBA 4EWFA 4GN2A 2WKPA 2JKRM 1ONHA 4YOFA 1NRJA 2WUQA 2Q9MA 4Y0TA 1DRMA 4S2NC 3TJZC 4XUXA 3KSGA 5CGWA 1XFQA 1IKGA 1OTEA 1E25A 3DW0A 4PAUA 2QPNA 5F69A 4M4XA 1JNUA 3G2YA 4E3KA 4B4ZA 5FEGA 1T1AA 1MWTA 2JKGA 4ID4A 3RTYA 2EX2A 2R9WA 3D3OA 4ETXA 2ZC3B 3TW8A 1A0KA 2Y79A 3BYDA 1H0MA 1YQSA 1WYBA 1ALQA 4KZ7A 3VP1A 1BLSA 4XXRA 5EVIC 5BOHA 1E3UA 3G6OA 4R4SA 1Z6FA 3ZG8B 3A0RA 3ISGA 3PBSA 1YMSA 2BTFP 5CTMA 1XA7A 3BQ8A 3E0YA 3WRZA 2HV1A 2W27A 4X55A 5EVLA 5KMWA 4XUZA 4P6BA 4E3LA 3AGEA 1SDNA 3A0SA 1IKIA 4RYEA 1H3QA 1MWSA 3TE8A 3IWIA 2QHKA 1S66L 2ZMFA 4M3KA 4OPRA 3T1SA 3MZFA 1ZG6A 2VLGA 4I3IA 3K3CA 4JF4A 5FEFA 5FAQA 4X1LA 1VETA 5FA7A 2KLIA 1BSGA 4R70A 3IHAA 1O7EA 5DTTA 4DRTA 5AVEA 3NI9A 4EESA 4EUVA 5EVID 4WELA 3NHQA 2JKTM 2IWBA 3NC8A 3S1YA 4KG5A 3CITA 5CERA 1FILA 3IX3A 5J8XA 5KZHA
chains in the Genus database with same CATH topology
5C5KA 4L9EA 3LUQA 5J4EA 2Z6CA 3LIFA 2EWVA 4R3AA 4CLCE 2OWHA 2XSSA 1TS6A 1N9LA 3BJNA 4HIAA 2JN7A 4WN5A 4IUHA 5AJGA 5IT5A 3T4KA 5J7EA 3IS2B 3NOTC 3MQOA 4Q0JA 5HWVA 4LRYC 5DKKA 4DN0A 4EERA 2MJ6A 4Y5FA 3S7OA 4BBVA 1UWNX 2VGLS 3UMDA 5HPIA 3IS2A 2P08A 2W1RA 4XT2B 2GX5A 2PT7A 1D7EA 4R6LA 3E4PA 5K5BA 1P97A 4YNRA 1V9YA 2VEAA 4HY8A 4WL9A 3E98A 1GSWA 3LI9A 2KOIA 2VV6A 1P9WA 4XT2A 1Y28A 4MMNA 2D01A 1MC0A 5TJJA 3UE6A 4RQ9A 3JVUA 4I39A 2D02A 1GSXA 3LR0A 2PYPA 4EXOA 1LSWA 2HGVA 3MR0A 2OOLA 2PDRA 1W63M 4K08A 4WEJA 1OPXA 3LR5A 2V1BA 1EW0A 5HSQA 2WKRA 4HJ4A 4ARZB 4HH3A 4HJ6A 3CAXA 4WF0A 4UQIS 3PYPA 3GECA 3D72A 5I5LA 2PR5A 2YKFA 1YSPA 4G3WA 4DMZA 2JKTI 1S4SA 4ARZA 3T4JA 4O0PA 3MXQA 3KX0X 3EGXC 1OT9A 1S1YA 3W2ZA 1MZUA 4LRZE 4EEUA 3OBFA 3RH8B 3ZYTA 3CUEA 2XROA 3KYZA 1S4RA 1TD5A 3F1NB 4MCWA 3PBNA 3PBTA 4R38A 2KDKA 2V0UA 4OOLA 1YSQA 4MN7A 2HJ9C 2O9BA 3PBQA 4MN5A 5IU1A 4II7A 3F1NA 1T1CA 2H28A 2OWJA 3FPVA 2LB5A 1S67L 4P6ZS 3IBRA 3NOPC 3RFBA 3C30A 4CLCC 4BBTA 1P0ZA 5HWTA 2NUPC 1ODVA 3EQUA 2P04A 4KUKA 4GS9B 4PKYA 3EWKA 3KSHA 2HF6A 1ZHHB 4Q0IA 1LSVA 4PHTA 2LB9A 5DFYA 1G28A 4GS9A 3H9WA 5DF9A 2WKQA 3EQVA 2V0WA 1BYWA 4NKPA 4I5SA 1NLYA 4ETZA 4HOIA 2DMWA 2PR6A 4DJ3A 4PKYG 3SW1A 2QYBA 4L9GA 4DJ2A 2JHEA 4O8GA 2BASA 3MQ0A 5KIZA 1T18A 1OTDA 4KQOA 4ME4A 3MQQA 2ZMVA 3BWLA 5J3WA 4WEKA 3DBAA 1MKMA 1OJGA 2XA7S 3BW6A 1GSVA 4QPRA 1P9RA 3B33A 4FSFA 4NXEA 1KOUA 1D06A 4NXBA 3S7PA 2ZBBA 2XA7M 4Y2FA 2QJ7A 3LR4A 1DP9A 3F1OB 4L0LA 1WA9A 3H7WB 2VGLM 1T19A 3BQAA 3EOIA 1NWZA 5HPFA 3A0VA 3UB6A 1STZA 5EFWA 5DKLA 3CLOA 2QWSA 5DFXA 5F6AA 3VE4A 3F1OA 4BWIA 4JGPA 2G7UA 2J80A 3B42A 4CLCD 3H7WA 3VOLA 2B18A 4MDZA 2A24B 2L1MA 3CWFA 4F3LB 1TS7A 3F1PB 3LFVA 5G4YA 4BBUA 2FZ0A 1UWPX 1V9ZA 3FG8A 2A24A 4HHDA 2M7VA 5HD3A 3FPWA 4UEYA 2ZOIA 4F3LA 2V1AA 2P7JA 3F1PA 2R78A 2O99A 4ZRRA 5KSHA 3KSIA 4JGOA 3T4OA 1XJ2A 3MF0A 3OCLA 1N9OA 3C38A 4GHIB 2L4RA 1XJ3A 2PYRA 3LICA 4LRXC 2I9VA 1OT6A 2GJ3A 4JGQA 3K2NA 3KSFA 1IFQA 4UQIM 3PHYA 3S7NA 2K2NA 1G6OA 4GHIA 3LR3A 1DP6A 4G3KA 4EW7A 3C8CA 4I38A 2CMNA 3UB9A 4H6JB 5HDCA 3MMHA 3HJIA 4OOMA 3LIBA 2J3TC 2QKPA 2W3FA 4CQHA 1ZTUA 3E4OA 3LIDA 1N9NA 1T1BA 4H6JA 4HP9A 2VA0A 3P01A 1TS0A 5MC7A 4GLQA 1LSXA 2K31A 1VHMA 4P6ZM 3ULFA 1DP8A 2GNXA 1YAXA 2HJEA 3T4LA 3UMEA 3T4SA 3UE3A 2YKHA 3EEHA 4GCZA 3PR6A 2JKRI 4Y3IA 4MN6A 4GW9A 3NJAA 2PD7A 3LIEA 3V67A 2FH5A 3P7NA 3KYQA 4O01A 3PBRA 1OTAA 5DJTA 3U2AA 3VE3A 5HZHA 3OCNA 3UB8A 2VJWA 2M7UA 3C2WA 3IBJA 3MJQA 3EGDC 1TF1A 3R7WB 4NXFA 3NOUC 2V9AA 2Y8HA 3VV4A 2NUTC 2PHYA 2VV8A 2W0NA 3KO6A 4IHQA 3E4QA 2VZWA 3OOVA 1UGUA 2ZOHA 1LL8A 3R7WA 3T4TA 4WUJA 2GZAA 1F98A 4KQDA 2PD8A 2J3TD 4Z1WA 4B93A 2Z6DA 4AFIA 5AVFA 4GJ4A 5TBMB 4I3AA 4CLCB 5IS1A 4L9FA 5HD5A 4YWZA 4HNBA 2EA9A 2WKPA 2JKRM 4YOFA 1NRJA 3LYXA 2VV7A 1DRMA 2W3EA 3CUEC 5TBMA 3R4KA 3TJZC 4CLCA 5A8BA 3KSGA 1XFQA 4LLOB 1OTEA 3HJKA 4PAUA 5F69A 4NXGA 4M4XA 1JNUA 4B9OA 3ICYA 4EETB 3JVVA 1T1AA 4KUOA 4E04A 1YKDA 3RTYA 1TS8A 2KX6A 3D3OA 3FC7A 3TW8A 4ETXA 2A2LA 2Y79A 2VX8A 2O9CA 4G3VA 3K3DA 1XFNA 3OLOA 2W3GA 3G6OA 2W3HA 5F68A 4Q0HA 2M1CA 3A0RA 2QJ5A 2XRNA 3PBSA 3T4QA 3T50A 4LPZA 3TRCA 3LIAA 5HL6A 2EWWA 3BY9A 3B47A 3BQ8A 3E0YA 3PBOA 2HV1A 3O5YA 1LT0A 2K7SA 3H82B 4IUKA 1NLZA 2W27A 3MFXA 2OAQ1 4HI4A 4HH2A 2W1TB 3A0SA 2B02A 3HCYA 1XJ6A 3H82A 3ZQ5A 5LBRA 1IOUA 5CX7A 1OJ5A 1X0OA 5HDSA 1H3QA 4I3JA 1W63Q 4WLAA 3TE8A 2W1TA 2QHKA 2VKSA 1S66L 2ZMFA 1XJ4A 2O9AA 4NEED 2J3WA 5F5YA 2INWA 5HDDA 2VLGA 4I3IA 3PXPA 3K3CA 1H8MA 2OAP1 2IA2A 3UB7A 1F9IA 1VB6A 4HJ3A 4EU0A 2KLIA 4BJPA 1F5MA 4EQ1A 4R70A 4HP4A 1OTBA 4FOFA 3CI6A 3GDIA 5HWWA 4IJGA 5AVEA 2O0YA 4EESA 2W3DA 5FL3A 4EUVA 1OTIA 4WELA 3NHQA 2JKTM 2L0WA 4HQAA 4EEPA 1S1ZA 3CITA 5G4ZA 5L8MA 3BY8A 5DJUA 4JGRA 3LI8A 4BMWA 3EEAA 3S7QA 3OC2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CLC A;  4CLC D;  4BMW A;  3FPW A;  4CLC B;  4CLC E;  5CX7 A;  4NKP A;  4CLC C;  2A2L A;  3FPV A; 
#chains in the Genus database with same CATH topology
 5J4E A;  1YLT A;  3IXD A;  3MXS A;  1OME A;  2E8I A;  1I2W A;  3MBZ A;  4GZB A;  3MSH A;  1MY8 A;  3OPP A;  3HBR A;  3BJN A;  1K25 A;  2JN7 A;  2WK0 A;  4WN5 A;  4EQI A;  1ESI A;  2B5R A;  5AJG A;  1BLH A;  3BFD A;  3MQO A;  3WS4 A;  5JYO A;  3O88 A;  1I2S A;  3HUN A;  5DKK A;  2MJ6 A;  5F83 A;  1FSW A;  2ZC5 B;  4XT2 B;  2GX5 A;  3VFH A;  4YNR A;  3AGD A;  4Y0U A;  3T12 B;  3LCE A;  5CEC A;  1P9W A;  4QJG A;  4BLM A;  1Y28 A;  3UPN A;  3VP2 A;  5EOE A;  3HL9 A;  4I39 A;  3C4O A;  1K4E A;  1XGJ A;  2Q9N A;  2OOL A;  2Q0O A;  1NZU A;  5FAO A;  1EW0 A;  2PBD P;  4S2L A;  3CAX A;  3ZG5 A;  3BLS A;  3PYP A;  3GEC A;  3D72 A;  4K91 A;  5GLD A;  5I5L A;  1YSP A;  4DMZ A;  4O0P A;  3GTC A;  3KX0 X;  3V5M A;  4EBN A;  4LRZ E;  3OBF A;  1XX2 A;  3F1N B;  4R38 A;  1EWZ A;  3HLW A;  5FDS A;  2FFY A;  3SZT A;  4WZ4 A;  1Z09 A;  5IU1 A;  3HLB A;  3ZFZ A;  1J3W A;  2H28 A;  4KZA A;  2OWJ A;  4KEN B;  3FPV A;  4LGW A;  3RFB A;  3C30 A;  5AQ7 A;  1ZKJ A;  4GS9 B;  3EWK A;  3Q7V A;  3IXG A;  3CHW P;  2DRW A;  1ACF A;  4PHT A;  1MKI A;  5DFY A;  2Y2H A;  2WKI A;  3DWZ A;  2V0W A;  2I72 A;  1BYW A;  1NLY A;  3WS2 A;  5GLB A;  1XA1 A;  1ES5 A;  1PFL A;  4R3B A;  3QP8 A;  1L2S A;  3GRJ A;  2JHE A;  1BT5 A;  4O8G A;  3MQ0 A;  3ZG7 B;  2ZMV A;  4MBK A;  1OJG A;  1M6K A;  1CF0 A;  1Y4O A;  5EPH A;  3D4F A;  2XA7 M;  1JVJ A;  2PU4 A;  3CG5 A;  4X69 A;  5M1A A;  1FCM A;  1NWZ A;  3BEB A;  1STZ A;  5DKL A;  3VE4 A;  2ZC6 B;  2J80 A;  5AQB A;  4OPZ A;  4OQH A;  5EM1 A;  3ZDJ A;  1UWP X;  2HDQ A;  3GQZ A;  3DWK A;  4UEY A;  4F3L A;  2P7J A;  3F1P A;  4DXB A;  3KSI A;  3T4O A;  3FZC A;  2RL3 A;  3CPT B;  2HDU A;  1E3U D;  3C38 A;  4LRX C;  1OT6 A;  4MEZ A;  5EV0 A;  1E4D A;  4R1G A;  2HZ5 A;  3QP2 A;  3IF6 A;  3PHY A;  2K2N A;  1L3L A;  2DNS A;  1DP6 A;  4KQQ A;  3U4L P;  4I38 A;  1GA0 A;  3MMH A;  3W8K A;  2QZ6 A;  2W3F A;  5CXW A;  3ZCZ A;  1N9N A;  1T1B A;  3P01 A;  1TS0 A;  3OZH A;  5CHJ A;  1IYO A;  2WYX A;  1ERO A;  2K31 A;  2Y2J A;  2BG1 A;  3SH9 A;  1DJC A;  4HES A;  3FKW A;  4N92 A;  3T4L A;  1S0W A;  4DXC A;  1HVB A;  4DE3 A;  4Q8I A;  1KE3 A;  4Y3I A;  1PZO A;  4QD4 A;  3HLC A;  2FH5 A;  3P7N A;  3KYQ A;  4O01 A;  5DJT A;  1TVF A;  3VFF A;  3U2A A;  3ZNY A;  3W4O A;  4E3J A;  4E3M A;  2VJW A;  2FFF B;  4LCM A;  2V9A A;  2NUT C;  4OPY A;  3ITB A;  2VV8 A;  1JTD A;  3KO6 A;  4N9L A;  4H8R A;  2ZOH A;  1LL8 A;  3PAG A;  2Z6D A;  5AVF A;  4LCL A;  5TBM B;  5IS1 A;  2XGN A;  4L9F A;  4HNB A;  3GSG A;  2HP9 A;  2W3E A;  3R4K A;  2IWC A;  3FYZ A;  1FOF A;  5EUA A;  1FCN A;  3O86 A;  3QP5 A;  4KZ9 A;  3ICY A;  3ZGA B;  4KUO A;  4FCF A;  3FC7 A;  1VEU A;  4MLL A;  3NY4 A;  1L0D A;  1SKO A;  3OLO A;  4QU3 A;  2W3H A;  5F68 A;  4Q0H A;  2M1C A;  3CZD A;  4DE0 A;  2XRN A;  4JLF A;  3T50 A;  3SOI A;  3N6I A;  2EWW A;  3BY9 A;  3LGO A;  3O5Y A;  3H82 B;  4OOY A;  1NLZ A;  2H5S A;  4HH2 A;  2W1T B;  1S6R A;  3HLE A;  2ACG A;  3HCY A;  4E6X A;  1YLY A;  2B95 A;  4X6T A;  2P9V B;  1W63 Q;  3ZVW A;  2VKS A;  1XJ4 A;  5CTN A;  2H0Y A;  3RXW A;  2INW A;  4KZ3 A;  4D60 A;  4C6Y A;  1F9I A;  1VB6 A;  1ERM A;  4EU0 A;  3NUL A;  2ZQ7 A;  4HP4 A;  1OTB A;  1PZP A;  2WAD A;  4FOF A;  3IWQ A;  3GDI A;  3VSK A;  1ES3 A;  5E2F A;  4S2I A;  2W3D A;  2L0W A;  4WMC A;  4HQA A;  1S1Z A;  1K56 D;  5G4Z A;  3BY8 A;  4JGR A;  1YLP A;  4JXW A;  3NEC A;  3HUM A;  3EEA A;  3S7Q A;  1Q2P A;  4IVI A;  1ZG4 A;  4L9E A;  2Z6C A;  1YPR A;  4HEF A;  4R3A A;  4BEN A;  2OWH A;  3IXB A;  4N9K A;  4DF6 A;  3GV9 A;  4HIA A;  1YT4 A;  2PBY A;  5D3O A;  3UNW A;  3PTE A;  4IUH A;  1IEM A;  3NOT C;  4Q0J A;  5HWV A;  1MWR A;  1CI9 A;  2VGL S;  4C3Q A;  3IS2 A;  1BUE A;  4ZDX A;  5K5B A;  4HY8 A;  1GSW A;  4NG2 A;  1HZO A;  1MC0 A;  3IX8 A;  3JVU A;  3N4I A;  3WS5 A;  1FR1 A;  4EXO A;  3IF5 A;  3MR0 A;  1DY6 A;  2PDR A;  2WGW B;  1W63 M;  5HFO A;  3LR5 A;  1KGF A;  3UY6 A;  2WKR A;  3M2K A;  4UHU A;  2ZQD A;  4ARZ B;  2Y2M A;  4X53 A;  2YKF A;  3SS3 A;  4N1H A;  1K6R A;  2JKT I;  1S4S A;  3T4J A;  1S1Y A;  4EEU A;  3VOY A;  2Y4A A;  3RH8 B;  3CUE A;  2XRO A;  2X71 A;  1S4R A;  3PBN A;  2JE5 A;  3C7U A;  2V0U A;  4OOL A;  1YSQ A;  4MN7 A;  2HJ9 C;  3PBQ A;  3ZHH A;  4P85 A;  2V1Z A;  5E2G A;  1T1C A;  1HTZ A;  5EVI B;  4K0W A;  3G32 A;  4P6Z S;  3DTM A;  1NXY A;  4DDY A;  1NJ4 A;  3A3D A;  1DJB A;  3NOP C;  1JWP A;  1P0Z A;  1ODV A;  4KUK A;  4OP5 A;  2HF6 A;  2XFS A;  4EV4 A;  3FWL A;  2X01 A;  4Q0I A;  2J7V A;  2HP5 A;  2ZL1 B;  4ZJ3 A;  3H9W A;  4NKP A;  1AWI A;  4KG2 A;  4E6W A;  4HOI A;  3MFD A;  3BFC A;  4DJ3 A;  1LHY A;  2QYB A;  3V3R A;  2G2U A;  3MKF A;  1T18 A;  1OTD A;  1HLU P;  3BWL A;  2JC7 A;  5J3W A;  1C3B A;  4QHC A;  2WAE A;  3DBA A;  1MKM A;  2XA7 S;  3BW6 A;  4QPR A;  4PM7 A;  5GL9 A;  4Y7P A;  4DKI A;  3WS0 A;  2QJ7 A;  2ZQA A;  2VGL M;  4BL2 A;  5HPF A;  2XEP A;  3A0V A;  1TDL A;  2QWS A;  3UPO A;  3F1O A;  4JGP A;  2G7U A;  4WBG A;  3QP4 A;  3H7W A;  3VOL A;  2B18 A;  4MDZ A;  2A24 B;  3CWF A;  1TS7 A;  1VM1 A;  5TR7 A;  1PW8 A;  3L9K A;  5G4Y A;  4HBT A;  1V9Z A;  5DTS A;  4HHD A;  2M7V A;  2ZOI A;  2V1A A;  2R78 A;  1IYS A;  4ZBE A;  4JGO A;  4E3I A;  5FQK A;  5FQ9 A;  2UWX A;  4GHI B;  3Q1F A;  3P09 A;  2GJ3 A;  1GHI A;  2ZJ9 A;  3S7N A;  1G6O A;  3G30 A;  4Z9Q A;  3UDF A;  3UB9 A;  5F1F A;  4NK3 A;  3HJI A;  4R0Q A;  2J3T C;  3V50 A;  2QKP A;  1BLC A;  1ZTU A;  4FTX A;  4H6J A;  4HP9 A;  4X1M A;  5HAP A;  3NDG A;  4GLQ A;  1G68 A;  1LSX A;  3SH8 A;  4ESP A;  4WYY A;  5FDH A;  5DTK A;  3MS6 A;  4QWO A;  2XQZ A;  4P6Z M;  3MKE A;  3QHY A;  1FQG A;  2WAF A;  1YAX A;  1K55 A;  2CC1 A;  2Y2G A;  4ZJ1 A;  1WE4 A;  3EEH A;  1CEF A;  3PR6 A;  3CJM A;  3GVB A;  5L09 A;  4A5R A;  4MN6 A;  4GW9 A;  2J9P A;  4X56 A;  3V67 A;  3IWO A;  3PBR A;  3UDI A;  4IVK A;  2OLV A;  2OLU A;  4PM9 A;  1KGG A;  5EM0 A;  3VE3 A;  3OCN A;  2M7U A;  3BRM A;  2XF3 A;  4BL3 A;  1N9B A;  3R7W B;  5AQA A;  2Y8H A;  3VOZ A;  4WZ5 A;  2PHY A;  1RP5 A;  3W4P A;  3E4Q A;  1L0G A;  4OQG A;  2VZW A;  3T4T A;  4MNR A;  4WUJ A;  3HUO A;  1XPB A;  3IQA A;  4KQD A;  2J3T D;  3IH8 A;  4Z1W A;  4B93 A;  4AFI A;  3VSL A;  1GHM A;  4DE1 A;  2Y2N A;  5HD5 A;  3IHB A;  4YWZ A;  4CPK A;  4KG6 A;  3LYX A;  2VV7 A;  3CUE C;  4CLC A;  4CJN A;  3HJK A;  1M40 A;  5A92 A;  4NXG A;  4BD0 A;  4B9O A;  4LV1 A;  4EET B;  4E04 A;  2EXB A;  1YKD A;  4UA6 A;  2ZD8 A;  2O9C A;  2H0T A;  1SHV A;  5F1G A;  2G2W A;  2W3G A;  1XGI A;  4LV3 A;  1SKF A;  2XD5 A;  2Z2L B;  3IX4 A;  1MPL A;  1CQA A;  2QJ5 A;  5DVA A;  4U3T A;  3TRC A;  3LIA A;  5HL6 A;  4RX2 A;  1K6S A;  2ZMA A;  2A49 A;  1XKZ A;  3B47 A;  3FV7 A;  1LT0 A;  4Y17 A;  2ZQC A;  4IUK A;  2C5W B;  4RVA A;  5FI7 A;  5FQI A;  4HI4 A;  2VK3 A;  1GA9 A;  1RGZ A;  2B02 A;  1XJ6 A;  1IOU A;  5CX7 A;  1OJ5 A;  4I3J A;  1JTG A;  1HD8 A;  1W7F A;  1O07 A;  2EX6 A;  2HP6 A;  4X68 A;  1J9M A;  4WM9 A;  1VET B;  2O9A A;  2XH9 A;  3N8R A;  2J3W A;  5HDD A;  5GLC A;  2OAP 1;  3UB7 A;  1NYY A;  3LEZ A;  3C4P A;  1KE0 A;  1F5M A;  4EQ1 A;  5CED A;  3Q07 A;  1KDW A;  2ZC4 B;  5E2E A;  1PWD A;  3T1R A;  5FL3 A;  1NY0 A;  5FAS A;  5EEC A;  4DE2 A;  2V8C A;  3G35 A;  3P98 A;  4N1X A;  4BMW A;  3OPL A;  5EE8 A;  1YMX A;  5C5K A;  2ZC7 A;  5M18 A;  3LIF A;  3E2K A;  4IBX A;  1LI0 A;  3UPP A;  1TS6 A;  1N9L A;  1TDG A;  5FAP A;  5IT5 A;  4DDS A;  3I7J A;  4QB8 A;  1IEL A;  4LEN A;  4LRY C;  1FCO A;  4DN0 A;  4BBV A;  3UMD A;  5HPI A;  3BM6 A;  2P08 A;  2W1R A;  2PT7 A;  4OPQ A;  1D7E A;  4R6L A;  3E4P A;  1P97 A;  1V9Y A;  2Y2P A;  3D9Y A;  2KOI A;  4XT2 A;  3QNC A;  4B88 A;  4ZTK A;  4MMN A;  5FAT A;  2D01 A;  4C75 A;  3UE6 A;  4RQ9 A;  2OSU A;  1U60 A;  1GSX A;  3LR0 A;  1PNE A;  4GB7 A;  1LSW A;  3RJU A;  4K08 A;  3BFG A;  4KZ8 A;  2E8J A;  2V1B A;  5GHX A;  3HLF A;  4JKT A;  5HSQ A;  5E43 A;  4HJ4 A;  1IYP A;  2Y2Q A;  4HJ6 A;  5E2H A;  4UQI S;  1IYQ A;  1PRQ A;  1RGY A;  1L0F A;  4G3W A;  1K57 A;  2A3U A;  2V8F A;  5GHZ A;  1NRF A;  3TG9 A;  4WZ5 C;  3ZYT A;  5L07 A;  4JBF A;  2DCF A;  4GD6 A;  5U47 A;  4MCW A;  3PBT A;  2KDK A;  3UO9 A;  3UDX A;  1H5X A;  5CGX A;  4GNU A;  3UE0 A;  4II7 A;  3F1N A;  3OPH A;  3IH9 A;  3Q7V B;  2LB5 A;  1KVL A;  2Y2L A;  3IBR A;  4BD1 A;  1K4F A;  4CLC C;  1GHP A;  5HWT A;  3EQU A;  2P04 A;  4PKY A;  3KSH A;  4BQM A;  3ITA A;  1ZHH B;  1LSV A;  3DTE A;  2LB9 A;  4ZAM A;  4GS9 A;  5DF9 A;  2WKQ A;  3EQV A;  1ZC2 A;  1YLZ A;  4I5S A;  4FH4 A;  5G18 A;  1Y54 A;  5FSR A;  4ETZ A;  2ZLY A;  4OH0 A;  4S2O A;  3SW1 A;  4JF5 A;  1FIK A;  3GR2 A;  4EUZ A;  3IT9 A;  1PI5 A;  2J8Y A;  1PWC A;  5KIZ A;  3IF6 C;  4OLD A;  1YLJ A;  4EBP A;  3N8L A;  2Y2I A;  4P0M A;  2OV5 A;  3G31 A;  1KDS A;  1EI5 A;  1SCW A;  3L7H A;  4FSF A;  4NXE A;  1KOU A;  1D06 A;  3S7P A;  2J9O A;  4Y2F A;  3LY4 A;  1DP9 A;  4JXS A;  1WA9 A;  1LI9 A;  3NDE A;  1KGE A;  2ZQ8 A;  3BQA A;  2XR0 A;  5CHU A;  5DFX A;  5F6A A;  3B42 A;  4CLC D;  3G4P A;  1K0K A;  2L1M A;  4F3L B;  5EVE A;  3DAV A;  3F1P B;  1D1J A;  3LFV A;  3TOI A;  4BBU A;  2FZ0 A;  3A3E A;  3FG8 A;  3A3J A;  3GMW A;  1SZV A;  4O7D A;  4S2J A;  2EX8 A;  1YM1 A;  3IF6 B;  1FR6 A;  4Y13 A;  2VGK A;  2EXA A;  2HDS A;  3M2J A;  3PAE A;  2I9V A;  2WZZ A;  4JGQ A;  3WWX A;  4Y15 A;  3K2N A;  1IFQ A;  4UQI M;  3CPT A;  2Y2O A;  4GDB A;  2PAV P;  4S2P A;  3LR3 A;  2Y59 A;  3C8C A;  2CMN A;  3HRE A;  1XP4 A;  4PM5 A;  5TGF A;  4OOM A;  2C6W B;  1WYC A;  3E4O A;  5A91 A;  5FQQ A;  1W5D A;  2AVX A;  2PU2 A;  3C7V A;  5MC7 A;  2BLS A;  1PWG A;  5EOO A;  4E3N A;  2XD1 A;  5DF8 A;  3ULF A;  5A90 A;  2GNX A;  1CI8 A;  1QMF A;  2EFU A;  3BEC A;  2JBF A;  4OKP A;  3T4S A;  3UE3 A;  2YKH A;  5CGS A;  4GCZ A;  5A93 A;  5HAI A;  4P87 A;  1BTL A;  1NZO A;  1FSY A;  1OTA A;  1K54 A;  2V20 A;  5DF7 A;  3UB8 A;  3CMZ A;  3FKV A;  3VP4 A;  1N4O A;  3IBJ A;  2WGI A;  4R4R A;  1CK3 A;  1TF1 A;  3VV4 A;  3NOU C;  5CRF A;  1MBL A;  4IHQ A;  4KZ5 A;  1QME A;  1XXM A;  4LV0 A;  1VQQ A;  1K57 C;  4PPR A;  4FH2 A;  3E2L A;  2UV0 E;  2EA9 A;  3IXH A;  2QMI A;  5TBM A;  5A8B A;  3M6H A;  1KE4 A;  4LLO B;  2P74 A;  1VEU B;  3G34 A;  5CEB A;  4JF6 A;  3JVV A;  1SKO B;  1TS8 A;  2KX6 A;  3VMA A;  5JYP A;  2A2L A;  2VX8 A;  1ERQ A;  4G3V A;  3K3D A;  3OPR A;  1LLB A;  1ESU A;  1XFN A;  1PW1 A;  2GDN A;  3T4Q A;  4LPZ A;  3S4X A;  2WKE A;  1LL9 A;  2WZX A;  5HAQ A;  1Q2Q A;  4KZ4 A;  2HPB A;  3PBO A;  1MXO A;  2K7S A;  4YIN A;  2Y2K A;  3MFX A;  5L10 A;  2OAQ 1;  3H82 A;  3ZQ5 A;  5LBR A;  1SDE A;  1X0O A;  5HDS A;  4WLA A;  3RXX A;  2W1T A;  4LFU A;  4NEE D;  2P9V A;  5F5Y A;  4GKU A;  3TSG A;  3JYI A;  3PXP A;  4S2M A;  4F94 A;  1H8M A;  2ZM0 A;  2IA2 A;  1BLP A;  1ES2 A;  4HJ3 A;  3T1X A;  4BJP A;  5HW3 A;  3NCK A;  3DTK A;  2XK1 A;  3BFE A;  3A3F A;  3CI6 A;  4JXG A;  4GOG A;  5HWW A;  3UE1 A;  4IJG A;  1JWV A;  1H8Z A;  2O0Y A;  1F2K A;  1OTI A;  2VGJ A;  4U0T A;  4KZ6 A;  1K56 A;  2EFX A;  4EEP A;  4WMC D;  4YFM A;  5L8M A;  1BUL A;  5DJU A;  5HAR A;  3LI8 A;  5L2F A;  4HBU A;  4OVD A;  3KYE A;  3OC2 A;  3M6B A;  4JPM A;  3NIA A;  4QY6 A;  3B3X A;  3LUQ A;  1GCE A;  5TFQ A;  2EWV A;  1W8Q A;  4CLC E;  2XSS A;  3WS1 A;  3T1Q B;  3N7W A;  5J7E A;  3T4K A;  3IS2 B;  3UB5 P;  1CEG A;  4EER A;  5CHM A;  4Y5F A;  3S7O A;  1UWN X;  2EX9 A;  1RCJ A;  4RA7 A;  3AGF A;  3ZG9 B;  2VEA A;  4WL9 A;  5HX9 A;  3E98 A;  3LI9 A;  4X25 A;  2VV6 A;  3ZNT A;  5TJJ A;  3SH7 A;  2XDM A;  2D02 A;  1YLW A;  2PYP A;  2HGV A;  1PIO A;  4ZJ2 A;  1TEM A;  4WEJ A;  1OPX A;  5IHV A;  1DJA A;  3HVF A;  2WGW A;  4HH3 A;  1AXB A;  4WF0 A;  1K54 C;  2PR5 A;  3HLG A;  3V39 A;  2XFT A;  5I94 A;  4ARZ A;  3MXQ A;  3EGX C;  1OT9 A;  4KQR A;  3W2Z A;  1MZU A;  4OLG A;  2RCX A;  4S2N A;  1I5Q A;  3KYZ A;  1TD5 A;  1CJF A;  2O9B A;  4MN5 A;  5F82 A;  3SS5 A;  4B4X A;  1S67 L;  3LY3 A;  2ZM2 A;  5M19 A;  3A3I A;  4BBT A;  2NUP C;  2WGV A;  5EVI A;  2H10 A;  2JCH A;  2WKH A;  1ONG A;  4PMA A;  3JPU A;  1G28 A;  3C5A A;  1K38 A;  3Q81 A;  1G6A A;  3N8S A;  4IBR A;  4K0X A;  4OP8 A;  2ZL1 A;  2DMW A;  3Q82 A;  5FI2 A;  2PR6 A;  4IED A;  4PKY G;  4L9G A;  3Q7Z A;  4DJ2 A;  2BAS A;  4KQO A;  4ME4 A;  3MQQ A;  3BFF A;  3WRT A;  4WEK A;  4EBL A;  4UA9 A;  1GSV A;  1P9R A;  3B33 A;  5FI6 A;  4NXB A;  1H8Y A;  1MWU A;  2ZBB A;  2Y55 A;  3S22 A;  3LR4 A;  4L0L A;  3F1O B;  3G2Z A;  3H7W B;  2Y91 A;  1PYY A;  1T19 A;  3EOI A;  3O3V A;  4GDN A;  4S2K A;  5EFW A;  3DTI A;  3UB6 A;  4FUW A;  2ZM8 A;  2IWD A;  3CLO A;  4BWI A;  3VP3 A;  3ZVT A;  4QY5 A;  1JWZ A;  2ZQ9 A;  4R3J A;  5GLA A;  4UA7 A;  4NET A;  3MXR A;  1K55 C;  4GD8 A;  1BZA A;  2V2F F;  2A24 A;  5HD3 A;  3FPW A;  3HLD A;  2O99 A;  4PM8 A;  4ZRR A;  5KSH A;  4MBF A;  3ZG0 A;  2X02 A;  1XJ2 A;  3O87 A;  3MF0 A;  3OCL A;  1N9O A;  4UAA A;  2L4R A;  1XJ3 A;  2PYR A;  1G5U A;  3LIC A;  3MZE A;  5GHY A;  3LEQ A;  3KSF A;  3QP1 A;  1LL5 A;  4R23 A;  5FQM A;  1L0E A;  4GHI A;  1ES4 A;  4G3K A;  4MBH A;  4EW7 A;  4KZB A;  4H6J B;  5HDC A;  2Z2M B;  3LIB A;  4PM6 A;  4CQH A;  4D2O A;  3LID A;  3NBL A;  3QP6 A;  4OQ0 A;  2VA0 A;  4JXV A;  4RX3 A;  5FQJ A;  1KVM A;  3MZD A;  1PI4 A;  1NYM A;  3VP0 A;  1VHM A;  2HDR A;  3LO7 A;  3UN7 A;  1DP8 A;  3BLM A;  4U0X A;  2HJE A;  2R9X A;  3UME A;  3V3S A;  4OON A;  2JKR I;  5KSC A;  3NJA A;  2PD7 A;  3LIE A;  5HL1 A;  2XLN A;  4E3O A;  4OQI A;  5HZH A;  2PRF A;  1W79 A;  2JKF A;  3C2W A;  3MJQ A;  4LV2 A;  3EGD C;  5AQ9 A;  4NXF A;  4FD8 A;  3W4Q A;  2W0N A;  4Y0O A;  1W8Y A;  3OOV A;  1UGU A;  3R7W A;  2GZA A;  1F98 A;  2PD8 A;  3SS4 A;  4GJ4 A;  4I3A A;  4CLC B;  3QNB A;  4EWF A;  4GN2 A;  2WKP A;  2JKR M;  1ONH A;  4YOF A;  1NRJ A;  2WUQ A;  2Q9M A;  4Y0T A;  1DRM A;  4S2N C;  3TJZ C;  4XUX A;  3KSG A;  5CGW A;  1XFQ A;  1IKG A;  1OTE A;  1E25 A;  3DW0 A;  4PAU A;  2QPN A;  5F69 A;  4M4X A;  1JNU A;  3G2Y A;  4E3K A;  4B4Z A;  5FEG A;  1T1A A;  1MWT A;  2JKG A;  4ID4 A;  3RTY A;  2EX2 A;  2R9W A;  3D3O A;  4ETX A;  2ZC3 B;  3TW8 A;  1A0K A;  2Y79 A;  3BYD A;  1H0M A;  1YQS A;  1WYB A;  1ALQ A;  4KZ7 A;  3VP1 A;  1BLS A;  4XXR A;  5EVI C;  5BOH A;  1E3U A;  3G6O A;  4R4S A;  1Z6F A;  3ZG8 B;  3A0R A;  3ISG A;  3PBS A;  1YMS A;  2BTF P;  5CTM A;  1XA7 A;  3BQ8 A;  3E0Y A;  3WRZ A;  2HV1 A;  2W27 A;  4X55 A;  5EVL A;  5KMW A;  4XUZ A;  4P6B A;  4E3L A;  3AGE A;  1SDN A;  3A0S A;  1IKI A;  4RYE A;  1H3Q A;  1MWS A;  3TE8 A;  3IWI A;  2QHK A;  1S66 L;  2ZMF A;  4M3K A;  4OPR A;  3T1S A;  3MZF A;  1ZG6 A;  2VLG A;  4I3I A;  3K3C A;  4JF4 A;  5FEF A;  5FAQ A;  4X1L A;  1VET A;  5FA7 A;  2KLI A;  1BSG A;  4R70 A;  3IHA A;  1O7E A;  5DTT A;  4DRT A;  5AVE A;  3NI9 A;  4EES A;  4EUV A;  5EVI D;  4WEL A;  3NHQ A;  2JKT M;  2IWB A;  3NC8 A;  3S1Y A;  4KG5 A;  3CIT A;  5CER A;  1FIL A;  3IX3 A;  5J8X A;  5KZH A; 
#chains in the Genus database with same CATH homology
 5C5K A;  4L9E A;  3LUQ A;  5J4E A;  2Z6C A;  3LIF A;  2EWV A;  4R3A A;  4CLC E;  2OWH A;  2XSS A;  1TS6 A;  1N9L A;  3BJN A;  4HIA A;  2JN7 A;  4WN5 A;  4IUH A;  5AJG A;  5IT5 A;  3T4K A;  5J7E A;  3IS2 B;  3NOT C;  3MQO A;  4Q0J A;  5HWV A;  4LRY C;  5DKK A;  4DN0 A;  4EER A;  2MJ6 A;  4Y5F A;  3S7O A;  4BBV A;  1UWN X;  2VGL S;  3UMD A;  5HPI A;  3IS2 A;  2P08 A;  2W1R A;  4XT2 B;  2GX5 A;  2PT7 A;  1D7E A;  4R6L A;  3E4P A;  5K5B A;  1P97 A;  4YNR A;  1V9Y A;  2VEA A;  4HY8 A;  4WL9 A;  3E98 A;  1GSW A;  3LI9 A;  2KOI A;  2VV6 A;  1P9W A;  4XT2 A;  1Y28 A;  4MMN A;  2D01 A;  1MC0 A;  5TJJ A;  3UE6 A;  4RQ9 A;  3JVU A;  4I39 A;  2D02 A;  1GSX A;  3LR0 A;  2PYP A;  4EXO A;  1LSW A;  2HGV A;  3MR0 A;  2OOL A;  2PDR A;  1W63 M;  4K08 A;  4WEJ A;  1OPX A;  3LR5 A;  2V1B A;  1EW0 A;  5HSQ A;  2WKR A;  4HJ4 A;  4ARZ B;  4HH3 A;  4HJ6 A;  3CAX A;  4WF0 A;  4UQI S;  3PYP A;  3GEC A;  3D72 A;  5I5L A;  2PR5 A;  2YKF A;  1YSP A;  4G3W A;  4DMZ A;  2JKT I;  1S4S A;  4ARZ A;  3T4J A;  4O0P A;  3MXQ A;  3KX0 X;  3EGX C;  1OT9 A;  1S1Y A;  3W2Z A;  1MZU A;  4LRZ E;  4EEU A;  3OBF A;  3RH8 B;  3ZYT A;  3CUE A;  2XRO A;  3KYZ A;  1S4R A;  1TD5 A;  3F1N B;  4MCW A;  3PBN A;  3PBT A;  4R38 A;  2KDK A;  2V0U A;  4OOL A;  1YSQ A;  4MN7 A;  2HJ9 C;  2O9B A;  3PBQ A;  4MN5 A;  5IU1 A;  4II7 A;  3F1N A;  1T1C A;  2H28 A;  2OWJ A;  3FPV A;  2LB5 A;  1S67 L;  4P6Z S;  3IBR A;  3NOP C;  3RFB A;  3C30 A;  4CLC C;  4BBT A;  1P0Z A;  5HWT A;  2NUP C;  1ODV A;  3EQU A;  2P04 A;  4KUK A;  4GS9 B;  4PKY A;  3EWK A;  3KSH A;  2HF6 A;  1ZHH B;  4Q0I A;  1LSV A;  4PHT A;  2LB9 A;  5DFY A;  1G28 A;  4GS9 A;  3H9W A;  5DF9 A;  2WKQ A;  3EQV A;  2V0W A;  1BYW A;  4NKP A;  4I5S A;  1NLY A;  4ETZ A;  4HOI A;  2DMW A;  2PR6 A;  4DJ3 A;  4PKY G;  3SW1 A;  2QYB A;  4L9G A;  4DJ2 A;  2JHE A;  4O8G A;  2BAS A;  3MQ0 A;  5KIZ A;  1T18 A;  1OTD A;  4KQO A;  4ME4 A;  3MQQ A;  2ZMV A;  3BWL A;  5J3W A;  4WEK A;  3DBA A;  1MKM A;  1OJG A;  2XA7 S;  3BW6 A;  1GSV A;  4QPR A;  1P9R A;  3B33 A;  4FSF A;  4NXE A;  1KOU A;  1D06 A;  4NXB A;  3S7P A;  2ZBB A;  2XA7 M;  4Y2F A;  2QJ7 A;  3LR4 A;  1DP9 A;  3F1O B;  4L0L A;  1WA9 A;  3H7W B;  2VGL M;  1T19 A;  3BQA A;  3EOI A;  1NWZ A;  5HPF A;  3A0V A;  3UB6 A;  1STZ A;  5EFW A;  5DKL A;  3CLO A;  2QWS A;  5DFX A;  5F6A A;  3VE4 A;  3F1O A;  4BWI A;  4JGP A;  2G7U A;  2J80 A;  3B42 A;  4CLC D;  3H7W A;  3VOL A;  2B18 A;  4MDZ A;  2A24 B;  2L1M A;  3CWF A;  4F3L B;  1TS7 A;  3F1P B;  3LFV A;  5G4Y A;  4BBU A;  2FZ0 A;  1UWP X;  1V9Z A;  3FG8 A;  2A24 A;  4HHD A;  2M7V A;  5HD3 A;  3FPW A;  4UEY A;  2ZOI A;  4F3L A;  2V1A A;  2P7J A;  3F1P A;  2R78 A;  2O99 A;  4ZRR A;  5KSH A;  3KSI A;  4JGO A;  3T4O A;  1XJ2 A;  3MF0 A;  3OCL A;  1N9O A;  3C38 A;  4GHI B;  2L4R A;  1XJ3 A;  2PYR A;  3LIC A;  4LRX C;  2I9V A;  1OT6 A;  2GJ3 A;  4JGQ A;  3K2N A;  3KSF A;  1IFQ A;  4UQI M;  3PHY A;  3S7N A;  2K2N A;  1G6O A;  4GHI A;  3LR3 A;  1DP6 A;  4G3K A;  4EW7 A;  3C8C A;  4I38 A;  2CMN A;  3UB9 A;  4H6J B;  5HDC A;  3MMH A;  3HJI A;  4OOM A;  3LIB A;  2J3T C;  2QKP A;  2W3F A;  4CQH A;  1ZTU A;  3E4O A;  3LID A;  1N9N A;  1T1B A;  4H6J A;  4HP9 A;  2VA0 A;  3P01 A;  1TS0 A;  5MC7 A;  4GLQ A;  1LSX A;  2K31 A;  1VHM A;  4P6Z M;  3ULF A;  1DP8 A;  2GNX A;  1YAX A;  2HJE A;  3T4L A;  3UME A;  3T4S A;  3UE3 A;  2YKH A;  3EEH A;  4GCZ A;  3PR6 A;  2JKR I;  4Y3I A;  4MN6 A;  4GW9 A;  3NJA A;  2PD7 A;  3LIE A;  3V67 A;  2FH5 A;  3P7N A;  3KYQ A;  4O01 A;  3PBR A;  1OTA A;  5DJT A;  3U2A A;  3VE3 A;  5HZH A;  3OCN A;  3UB8 A;  2VJW A;  2M7U A;  3C2W A;  3IBJ A;  3MJQ A;  3EGD C;  1TF1 A;  3R7W B;  4NXF A;  3NOU C;  2V9A A;  2Y8H A;  3VV4 A;  2NUT C;  2PHY A;  2VV8 A;  2W0N A;  3KO6 A;  4IHQ A;  3E4Q A;  2VZW A;  3OOV A;  1UGU A;  2ZOH A;  1LL8 A;  3R7W A;  3T4T A;  4WUJ A;  2GZA A;  1F98 A;  4KQD A;  2PD8 A;  2J3T D;  4Z1W A;  4B93 A;  2Z6D A;  4AFI A;  5AVF A;  4GJ4 A;  5TBM B;  4I3A A;  4CLC B;  5IS1 A;  4L9F A;  5HD5 A;  4YWZ A;  4HNB A;  2EA9 A;  2WKP A;  2JKR M;  4YOF A;  1NRJ A;  3LYX A;  2VV7 A;  1DRM A;  2W3E A;  3CUE C;  5TBM A;  3R4K A;  3TJZ C;  4CLC A;  5A8B A;  3KSG A;  1XFQ A;  4LLO B;  1OTE A;  3HJK A;  4PAU A;  5F69 A;  4NXG A;  4M4X A;  1JNU A;  4B9O A;  3ICY A;  4EET B;  3JVV A;  1T1A A;  4KUO A;  4E04 A;  1YKD A;  3RTY A;  1TS8 A;  2KX6 A;  3D3O A;  3FC7 A;  3TW8 A;  4ETX A;  2A2L A;  2Y79 A;  2VX8 A;  2O9C A;  4G3V A;  3K3D A;  1XFN A;  3OLO A;  2W3G A;  3G6O A;  2W3H A;  5F68 A;  4Q0H A;  2M1C A;  3A0R A;  2QJ5 A;  2XRN A;  3PBS A;  3T4Q A;  3T50 A;  4LPZ A;  3TRC A;  3LIA A;  5HL6 A;  2EWW A;  3BY9 A;  3B47 A;  3BQ8 A;  3E0Y A;  3PBO A;  2HV1 A;  3O5Y A;  1LT0 A;  2K7S A;  3H82 B;  4IUK A;  1NLZ A;  2W27 A;  3MFX A;  2OAQ 1;  4HI4 A;  4HH2 A;  2W1T B;  3A0S A;  2B02 A;  3HCY A;  1XJ6 A;  3H82 A;  3ZQ5 A;  5LBR A;  1IOU A;  5CX7 A;  1OJ5 A;  1X0O A;  5HDS A;  1H3Q A;  4I3J A;  1W63 Q;  4WLA A;  3TE8 A;  2W1T A;  2QHK A;  2VKS A;  1S66 L;  2ZMF A;  1XJ4 A;  2O9A A;  4NEE D;  2J3W A;  5F5Y A;  2INW A;  5HDD A;  2VLG A;  4I3I A;  3PXP A;  3K3C A;  1H8M A;  2OAP 1;  2IA2 A;  3UB7 A;  1F9I A;  1VB6 A;  4HJ3 A;  4EU0 A;  2KLI A;  4BJP A;  1F5M A;  4EQ1 A;  4R70 A;  4HP4 A;  1OTB A;  4FOF A;  3CI6 A;  3GDI A;  5HWW A;  4IJG A;  5AVE A;  2O0Y A;  4EES A;  2W3D A;  5FL3 A;  4EUV A;  1OTI A;  4WEL A;  3NHQ A;  2JKT M;  2L0W A;  4HQA A;  4EEP A;  1S1Z A;  3CIT A;  5G4Z A;  5L8M A;  3BY8 A;  5DJU A;  4JGR A;  3LI8 A;  4BMW A;  3EEA A;  3S7Q A;  3OC2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...