4FH2A

Structure of s70c beta-lactamase bound to sulbactam
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
265
structure length
265
Chain Sequence
SPQPLEQIKLSESQLSGRVGMIEMDLASGRTLTAWRADERFPMMCTFKVVLCGAVLARVDAGDEQLERKIHYRQQDLVDYSPVSEKHLADGMTVGELCAAAITMSDNSAANLLLATVGGPAGLTAFLRQIGDNVTRLDRWETELNEALPGDARDTTTPASMAATLRKLLTSQRLSARSQRQLLQWMVDDRVAGPLIRSVLPAGWFIADKTGAGERGARGIVALLGPNNKAERIVVIYLRDTPASMAERNQQIAGIGAALIEHWQR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Beta-lactamase SHV-1
publication title Crystal structure of a pre-acylation complex of the beta-lactamase inhibitor, sulbactam, bound to a sulfenamide bond containing thiol-beta-lactamase
pubmed doi rcsb
source organism Klebsiella pneumoniae
total genus 96
structure length 265
sequence length 265
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2012-06-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 4fh2A00
5GLAA 3OPLA 4UAAA 1GCEA 2X01A 1K4EA 4K91A 5FAQA 4S2NC 1NRFA 3UPPA 4N1HA 4KZ8A 1L0DA 5GHXA 4RA7A 4X55A 3WS5A 5DF8A 4PPRA 2WGWB 2WZXA 1FOFA 4XUZA 4BL2A 1KE0A 1G6AA 2VGJA 3N7WA 1AXBA 3GQZA 1FCOA 3HUMA 5EPHA 3E2KA 1ESIA 1SDEA 4RX3A 1FQGA 2EX6A 1H8ZA 1CI8A 3P09A 4PM9A 3ZHHA 4JXSA 2WAFA 3VMAA 2XFSA 4NK3A 1K57C 3IH9A 1BLSA 4LCLA 2HPBA 3M6HA 4MBFA 4E6WA 3BFGA 5FI2A 5I94A 1YMSA 3TOIA 5DTTA 1MPLA 2WADA 4KG6A 1XXMA 2Z2LB 5CGWA 1XPBA 1Y54A 1VQQA 2XR0A 4IVIA 4S2LA 2WGWA 4WZ5A 3S22A 3O87A 3ZCZA 1IYSA 4S2MA 1KVLA 2OSUA 4Y0TA 1K25A 2Y2PA 2R9XA 3IXBA 3A3IA 4OLDA 3IF6A 3M2KA 4JF6A 4ZAMA 2BLSA 4N9LA 3ZGAB 5FAOA 2B5RA 1NJ4A 1NYYA 3ZDJA 1H5XA 3OPPA 1KGEA 3ISGA 2H0TA 3VFFA 5CEBA 2PBYA 2WK0A 3MBZA 3NDGA 3PBSA 3VP4A 1FCMA 5AQ9A 5FQJA 1HZOA 1YT4A 1ERQA 5AQAA 5DF7A 1O7EA 3C7UA 4R3JA 2EFUA 3HBRA 2EFXA 1K54A 2OLUA 3PBNA 1RP5A 3DTMA 1K6SA 5EUAA 4BLMA 3HUOA 4B88A 3IQAA 3BM6A 4E3OA 4GD8A 3GSGA 1YLZA 1ZG4A 1BLCA 4FD8A 3SH8A 3FKVA 4GN2A 2XEPA 1BLPA 3LY3A 3WS4A 5E2FA 5EVIA 1E3UA 3MFDA 1XGJA 1EWZA 1KVMA 3UE1A 4E3LA 3WS2A 4BENA 2XK1A 4P0MA 3Q82A 3UNWA 2J9OA 3OZHA 1FSYA 4MLLA 4EBLA 3ZFZA 3IF5A 4N9KA 4PM8A 3LY4A 3N8SA 1H8YA 4XUXA 5GLBA 4B4XA 2EX9A 3V39A 1ES2A 5TR7A 4A5RA 4LENA 2XF3A 4P85A 3WWXA 2OLVA 4EUZA 4K0WA 3RXXA 4CJNA 3HLGA 4OPRA 3Q7VB 3DW0A 1ALQA 3G32A 4OOMA 4QB8A 5TFQA 2C6WB 1PI4A 4R1GA 2ZC6B 4IEDA 3NI9A 1PIOA 5FQ9A 3G30A 3N8LA 2HDUA 2VGKA 2ZM2A 4GZBA 1MBLA 4DDYA 4JBFA 3E2LA 5CECA 3VP3A 2Y2JA 3MKFA 3RXWA 5KZHA 4D2OA 2WKIA 3IXGA 1E3UD 4Y7PA 4HBTA 3ZVTA 2JC7A 5CHJA 4KZ4A 3LCEA 5IHVA 4S2IA 4DXCA 2IWDA 1LL9A 4OP5A 2EXAA 5CEDA 4NETA 3FYZA 5CXWA 2EX2A 5FQKA 3O86A 4FH2A 5DVAA 3S4XA 2ZC3B 3HLDA 1NZOA 1MWSA 2ZQ8A 4OPYA 5M1AA 3IF6C 3C4OA 3HLCA 4R4SA 1YLTA 3W8KA 4RYEA 1YMXA 1U60A 3C5AA 4BL3A 3SOIA 1S6RA 4QD4A 4JXWA 3CJMA 5A92A 1ERMA 1HTZA 1G68A 1M6KA 3WRTA 1W79A 1HVBA 2H0YA 1PW8A 4GDNA 1Q2PA 2WGVA 1VM1A 1XX2A 4N1XA 1BT5A 1NY0A 5GL9A 3UE3A 3PTEA 4IVKA 3WS1A 1BUEA 3ITAA 4DE2A 3OC2A 1NYMA 2G2WA 4OOYA 4GB7A 1LI9A 4QJGA 3ZG7B 2ZMAA 4JF4A 2ZQAA 3NC8A 5CTNA 4EQIA 3MZFA 1W8YA 2QPNA 3UPOA 3IWQA 2Y2IA 1DY6A 1PYYA 2CC1A 2XQZA 5AQ7A 3G2YA 4E3MA 4X53A 5U47A 4XXRA 3UDFA 4ZJ3A 5EVIC 4H8RA 1RGYA 3IHAA 4UHUA 3D4FA 1JWZA 2J8YA 2ZC5B 5TGFA 4Y0UA 1L0FA 2X02A 4F94A 1LLBA 1NXYA 1ESUA 4X6TA 4K0XA 3GV9A 2Y2HA 3DWKA 3IH8A 3IXHA 1IEMA 4IBXA 4WYYA 1CK3A 1BSGA 1EROA 4RX2A 1ES3A 1TVFA 1Z6FA 3O3VA 3PBRA 1TDGA 1FR1A 2IWCA 1ZG6A 5CRFA 3CG5A 4UA9A 3WS0A 4ZDXA 4OONA 5E43A 4KZBA 3WRZA 4E6XA 5G18A 3UY6A 1C3BA 4X69A 3C4PA 2EX8A 3N8RA 1K56A 4OKPA 3EQVA 1MKIA 1Q2QA 2WYXA 5EOEA 1K55C 2Y2OA 4BQMA 4OQGA 3A3JA 4ZJ2A 1MY8A 5D3OA 2FFFB 1XKZA 4X56A 1LHYA 4GOGA 4KENB 3NIAA 1IKIA 5CGXA 3ZVWA 1IKGA 4UA6A 1PWGA 1EI5A 2J9PA 4E3KA 3V3SA 5DF9A 3LO7A 3N6IA 2Y55A 3BECA 2Q9MA 4GDBA 1W5DA 2XGNA 1K57A 3IT9A 3MXSA 3BFFA 3MZDA 4JKTA 4S2OA 1HD8A 4HBUA 2ZQ9A 1L0GA 4QY5A 1QMFA 1SCWA 3BLMA 3PAGA 4GNUA 5J8XA 4PM6A 2WGIA 4PMAA 3G4PA 5EVLA 1K56D 4B4ZA 3BEBA 5HAIA 3UPNA 5FI7A 3P98A 2H10A 1I2WA 4EV4A 4DE1A 4EBPA 3NBLA 2HDRA 1FCNA 2Y4AA 2IWBA 3NCKA 3BLSA 3UN7A 1K38A 2PU4A 4S2PA 3AGDA 3HUNA 3SS3A 1PZOA 1JTDA 2JBFA 2XD1A 3ZG0A 1PWDA 2E8IA 2R9WA 2XLNA 2ZQ7A 3G2ZA 3HREA 3FWLA 3Q1FA 3Q7VA 4DF6A 4CPKA 5EOOA 2BG1A 5AQBA 4Z9QA 3VP1A 5DTSA 4O7DA 1XA7A 4ZTKA 1YQSA 3SS5A 3SH9A 4P87A 1ONGA 1E25A 1E4DA 1N4OA 4U3TA 3EQUA 1W8QA 5CHMA 5E2EA 3ZG5A 3V5MA 4WZ5C 5FQMA 4GD6A 4E3NA 2ZLYA 2FFYA 3MZEA 4KG5A 4KQRA 3BFDA 1KE3A 4QU3A 5EECA 3G31A 4HEFA 2UWXA 3HLFA 5HARA 5HAPA 4LCMA 4LV0A 3W4OA 4C75A 2DNSA 3UE0A 4YINA 4FH4A 2ZJ9A 5M19A 4OQ0A 3Q81A 5F82A 2Y59A 3HLWA 4ID4A 4BD1A 5KSHA 1O07A 1SDNA 1BZAA 4MBHA 3BRMA 5GHYA 1OMEA 5GLCA 2ZQDA 4JF5A 3V3RA 1SHVA 1YLJA 3VP0A 4C6YA 3V50A 3W4QA 4LV3A 3LEZA 1CEFA 4KG2A 2ZQCA 3OCLA 4OVDA 3VOZA 3OCNA 3MXRA 4LV1A 3GMWA 3ZG8B 4EWFA 2XDMA 3OPRA 1K54C 2DCFA 5F1GA 2C5WB 1BTLA 1TDLA 5KSCA 2ZM0A 3VSLA 1ZKJA 3BYDA 4OLGA 4JLFA 4MNRA 1KGGA 2Y2KA 4DE3A 3GR2A 3ITBA 1L2SA 3QNCA 2JCHA 1IYPA 1NZUA 2G2UA 4WEJA 5EE8A 2XD5A 1BULA 2XH9A 1XGIA 1L0EA 1KE4A 1WYCA 3NDEA 4IBRA 4WEKA 5FDHA 4ZBEA 4DDSA 2X71A 5DTKA 1M40A 5HL1A 1S0WA 5GHZA 2WUQA 5F83A 2I72A 2Y2GA 1GHPA 1PW1A 2OV5A 3S1YA 3ZNYA 1ZC2A 2Y2LA 2Y2MA 5FI6A 2Z2MB 3IF6B 1RCJA 4UA7A 1KDSA 1IYOA 4WELA 1XP4A 1YLPA 3W4PA 3HLBA 1WYBA 3SH7A 3A3DA 3UDIA 3RJUA 4R23A 5CGSA 3BFCA 4KZAA 4R0QA 4C3QA 4MBKA 3CZDA 2P9VB 3G34A 2WKHA 5BOHA 1PWCA 3VOYA 4R4RA 1JWPA 3FZCA 4E3JA 3A3FA 4QHCA 3IHBA 4WM9A 1GA9A 2GDNA 1IYQA 5KMWA 2WZZA 3HLEA 2QZ6A 4BJPA 1JTGA 5FQIA 2RL3A 3VSKA 2HP6A 2ZC4B 3AGEA 4M3KA 3TSGA 4E3IA 3IWIA 4OOLA 3M2JA 3QHYA 5FQQA 3GRJA 1BLHA 4OPZA 2Y2QA 1ES5A 5E2GA 2P9VA 1QMEA 5JYOA 4KQOA 4S2NA 3VFHA 1JWVA 2WAEA 3M6BA 2EXBA 5HX9A 3UO9A 1I2SA 5HW3A 5EVIB 3AGFA 4HESA 5FSRA 4N92A 1DJCA 3O88A 5L2FA 4PM7A 1W7FA 1FR6A 4JXVA 5FAPA 2ZD8A 4DRTA 5M18A 4U0TA 4KZ5A 4ZJ1A 3JYIA 5F1FA 3Q7ZA 3GTCA 4OP8A 4PM5A 4S2KA 3NY4A 1CI9A 4P6BA 3TG9A 2V20A 4KZ6A 1DJAA 4YFMA 4L0LA 4JPMA 2A3UA 4OPQA 3DWZA 4OQHA 3CMZA 2RCXA 3B3XA 5A90A 1DJBA 5GLDA 4WMCA 2PU2A 4GKUA 2A49A 3SS4A 5FA7A 4FSFA 1MWRA 4OH0A 1LL5A 1KDWA 1IELA 5CHUA 1WE4A 3GVBA 5FASA 1J9MA 4FCFA 4Y0OA 2XFTA 3OPHA 2Y2NA 3ZG9B 1KGFA 3MKEA 3HL9A 1I5QA 2ZM8A 4JXGA 2P74A 1YLWA 1LI0A 2WKEA 2HDQA 1N9BA 4WBGA 5HFOA 1PI5A 3ZNTA 3QNBA 2HP5A 3FKWA 1TEMA 3UDXA 1MWTA 2DRWA 1RGZA 3VP2A 2H5SA 3PBOA 4OQIA 5E2HA 1GA0A 1FSWA 3HVFA 4U0XA 4KQQA 2JE5A 3A3EA 1JVJA 5EVID 1SKFA 4WMCD 4DXBA 1CEGA 4LV2A 3Q07A 4S2JA 1K55A 4BD0A 1GHMA 5HAQA 4X68A 2Q9NA 5CTMA 2QMIA 4DKIA 1YLYA 4QY6A 3N4IA 1K4FA 2V2FF 4RVAA 1XA1A 4EBNA 1GHIA 5A91A 2ZC7A 2V1ZA 2HP9A 5FATA 2J7VA 4Q8IA 3PAEA 3PBTA 3IWOA 4R3BA 3C7VA 3I7JA 3G35A 1ES4A 2Y91A 3PBQA 4WZ4A 1MXOA 5CERA 4KZ7A 1ONHA 3BFEA 3IXDA 1MWUA 1YM1A 5A93A 4MEZA 4DE0A 5JYPA 2HDSA 4KZ3A 3FV7A 1PZPA 1K6RA 4KZ9A
chains in the Genus database with same CATH superfamily
4UAAA 1GCEA 4S2NC 1NRFA 3UPPA 1OPXA 4X55A 3WS5A 5EM0A 4PPRA 2WZXA 4IHQA 5K5BA 1KE0A 1G6AA 2VGJA 1AWIA 3E0YA 1FCOA 3GQZA 3KSHA 1PRQA 3MQ0A 3JPUA 1CI8A 5HDCA 2VGLM 5J4EA 4PM9A 3ZHHA 3VMAA 2XFSA 3BFGA 2VV7A 1YMSA 3L9KA 4MDZA 4KG6A 1K0KA 3LICA 4H6JA 3IBRA 4S2MA 3QP8A 4Y0TA 2Y2PA 4BWIA 3M2KA 4JF6A 2MJ6A 4ZAMA 3K3CA 4YOFA 4HJ4A 2D02A 1NYYA 3CUEA 1H5XA 3ISGA 2H0TA 3VFFA 3U2AA 5CEBA 3MBZA 3PBSA 4I38A 5FQJA 1O7EA 4R3JA 2VZWA 2OLUA 3PBNA 1K6SA 3HUOA 4B88A 3BM6A 1UWNX 3FC7A 3K3DA 3MR0A 4FD8A 4GN2A 2G7UA 5HSQA 1E3UA 3MFDA 1EWZA 3UE1A 5HD3A 3WS2A 4ARZA 1TS8A 3N8SA 2EX9A 4P85A 2OLVA 4EUZA 1NWZA 3LFVA 3DW0A 4OOMA 1OTIA 1N9OA 5TFQA 2C6WB 4R1GA 3G30A 3SZTA 2HDUA 4HH3A 5CECA 4DMZA 5KZHA 4D2OA 4WF0A 3IXGA 1H8MA 3IS2A 5EV0A 5TBMA 4WN5A 2EA9A 5J3WA 2Q0OA 4EEUA 1A0KA 1ZTUA 5DVAA 3S4XA 1ODVA 5LBRA 1MWSA 5M1AA 4R4SA 1XJ3A 1YMXA 5J7EA 3SOIA 4JXWA 5A92A 3WRTA 1W79A 1OJGA 4GDNA 1Q2PA 1XJ2A 4UEYA 3UE3A 3VV4A 3OC2A 1NYMA 2G2WA 5F6AA 4WL9A 4GB7A 4GS9B 4JF4A 4EQIA 2QPNA 3IWQA 3S7PA 1DY6A 1UGUA 2CC1A 3G2YA 3ZYTA 3MS6A 5EVIC 2FH5A 5IT5A 4FOFA 1YSQA 3IHAA 4UHUA 5L07A 3D4FA 2HV1A 4KUOA 1L0FA 2ZL1A 4X6TA 4K0XA 3DWKA 1F2KA 1SKOB 4IBXA 1BSGA 1EROA 5FDSA 4UA9A 4ZDXA 3T12B 3UY6A 3P7NA 3C4PA 4G3VA 1ZHHB 3A0VA 4OKPA 4HP4A 1MKIA 1Q2QA 1NLZA 5EOEA 4NXEA 2Y2OA 3E4OA 3A3JA 2DMWA 4ZJ2A 2FFFB 4X56A 3NIAA 3LGOA 1IKIA 3NECA 2O99A 3LO7A 1LL8A 2Y55A 1XFQA 2Q9MA 3BECA 3PXPA 4DN0A 2XGNA 5EVEA 4Q0HA 4BBUA 4QY5A 1P97A 4QWOA 5J8XA 4GNUA 4PM6A 3G4PA 4B4ZA 1K56D 3BEBA 3T1XA 5FI7A 2H10A 4DE1A 2XSSA 3NCKA 3UN7A 3U4LP 4S2PA 3AGDA 3HUNA 2YKHA 3ZG0A 2XLNA 2ZQ7A 3Q7VA 3BW6A 5EOOA 2J3WA 5DTSA 4O7DA 4Y5FA 1XA7A 2M7UA 4ZTKA 4P87A 4X25A 1E4DA 1N4OA 3V5MA 4WZ5C 4NXGA 4GD6A 4GCZA 2O9BA 2R78A 3ZQ5A 3G31A 5HAPA 2QHKA 1D06A 2DNSA 3UE0A 2ZMVA 2ZJ9A 2Y59A 2V9AA 3BQ8A 5GHYA 3FPWA 3V3RA 4JF5A 3W4QA 4HQAA 3BQAA 5TJJA 3VOZA 4HJ6A 4LV1A 2W3HA 1K54C 2C5WB 5KSCA 4DE3A 2HJEA 1NLYA 1NRJA 4CLCE 3NDEA 3D9YA 4IBRA 5HL1A 3DAVA 5DTKA 1S0WA 3EGXC 4R6LA 2JKRI 2Y2MA 1RCJA 3CPTA 1KDSA 3F1PB 3H7WB 1XFNA 4KZAA 1H0MA 4KQDA 3CZDA 4P6ZM 1GA9A 2GDNA 1IYQA 3T4TA 5FQIA 3VSKA 3TSGA 3E98A 3M2JA 1Y4OA 4OPZA 2Y2QA 5FL3A 4KQOA 1VEUA 4Y15A 5HWWA 2GJ3A 5L2FA 4ARZB 1KOUA 1W7FA 4I39A 4ZJ1A 5F1FA 4HP9A 4FTXA 4S2KA 1CI9A 4P6BA 2WKQA 4YFMA 2A3UA 2KDKA 3CMZA 1D1JA 5A90A 1DJBA 5GLDA 4GKUA 4FSFA 4OH0A 3A0RA 1KDWA 5CHUA 3GVBA 1J9MA 4FCFA 2XFTA 4JGRA 3HL9A 1I5QA 1XJ4A 3OLOA 3IS2B 3GDIA 2HDQA 4F3LA 3TRCA 2WKRA 2L1MA 1TF1A 3VP2A 5E2HA 1GA0A 1FSWA 3HVFA 4KQQA 3A3EA 1JVJA 4DXBA 1S4SA 1CEGA 3KSIA 3S7OA 4X68A 4LRZE 2FZ0A 4RVAA 3NOTC 5HDDA 2P08A 2J7VA 4EESA 2HZ5A 4Y13A 3G35A 2Y91A 1ONHA 3BFEA 4QPRA 2YKFA 4MEZA 4KZ3A 4AFIA 3LR3A 1K6RA 1K4EA 4K91A 5FAQA 4KZ8A 1L0DA 5GHXA 4RA7A 2WGWB 3IBJA 3LR5A 5EPHA 3NOPC 2ZL1B 4Q0IA 1K57C 1DP6A 4LCLA 3M6HA 3ULFA 4GHIA 1VQQA 4IVIA 5DJTA 3EOIA 4S2LA 2GX5A 4WZ5A 3S22A 1KVLA 3A3IA 3IF6A 4R70A 2BLSA 2O9AA 2PR5A 3ZDJA 1SZVA 3NDGA 3VP4A 1FCMA 1ERQA 5AQAA 5DF7A 2QYBA 1S4RA 2EFXA 1K54A 5EUAA 3IQAA 4E3OA 1GSXA 4GD8A 1ZG4A 4WLAA 3H82A 2K2NA 3LY3A 3WS4A 5E2FA 5AVFA 4BENA 2XK1A 2W3EA 4MLLA 3R7WA 3IF5A 4PM8A 3LY4A 4XUXA 3V39A 3UB5P 4A5RA 4LENA 3WWXA 4K0WA 3RXXA 1DP8A 3Q7VB 3W2ZA 2ZC6B 3NI9A 3F1NA 2ZM2A 1MBLA 4DDYA 3VP3A 2Y2JA 3MKFA 2JHEA 4CQHA 3LIBA 3T1QB 4B9OA 4S2IA 4KUKA 2QKPA 4E04A 2EX2A 5FQKA 3T4LA 1FILA 2XA7S 1YLTA 4PKYA 3CHWP 2P04A 2QJ5A 4QD4A 3CJMA 1HTZA 1G68A 1M6KA 3MJQA 2PD8A 2V8FA 1PW8A 2JKTI 2PHYA 3NHQA 4IVKA 3LIDA 3WS1A 4EQ1A 4R38A 3ITAA 3UB7A 4QJGA 2ZMAA 2ZQAA 4IJGA 3MZFA 2Y2IA 2VEAA 1IOUA 5AQ7A 2XQZA 4X53A 3UDFA 3NULA 1L3LA 5A8BA 1OTAA 1JWZA 2VV8A 3NOUC 4Y0UA 2X02A 3G6OA 1LLBA 4II7A 4WYYA 1CK3A 1H3QA 4CLCB 1TVFA 3PBRA 1FR1A 2IWCA 5F5YA 1VEUB 3LIEA 4KZBA 5E43A 1OTDA 4PAUA 4X69A 2EX8A 1K56A 3EQVA 2H28A 2KOIA 2HF6A 1K55C 1T18A 4BQMA 4OQGA 1W63M 3MMHA 1LHYA 3D3OA 5CGXA 1PWGA 1EI5A 1K57A 2ZQ9A 3O5YA 3PAGA 2WGIA 4F3LB 5HAIA 3UPNA 1I2WA 4RQ9A 3NBLA 4EBPA 1FCNA 2Y4AA 2IWBA 4ESPA 2PU4A 5MC7A 2XD1A 2E8IA 2R9WA 4Q0JA 3FWLA 3Q1FA 3VP1A 2VGLS 4JGPA 1DP9A 3SS5A 3SH9A 2V0UA 1E25A 5E2EA 3ZG5A 5FQMA 3LR0A 2FFYA 4KG5A 3GECA 1LSXA 2UWXA 3HLFA 5HARA 4LV0A 4YINA 4FH4A 4OQ0A 2A24A 4BD1A 1BZAA 3C30A 5GLCA 4C6YA 1SHVA 4Y17A 4LV3A 3LEZA 4KG2A 2ZQCA 2DCFA 5F1GA 3CITA 3ICYA 3BYDA 4MNRA 2Y2KA 3GR2A 3ITBA 2JCHA 1NZUA 4WEJA 1XGIA 4PHTA 2XH9A 1L0EA 5FDHA 3T50A 2X71A 5I5LA 5F83A 3ZNYA 2Y2GA 1N9LA 3S1YA 1TD5A 3IF6B 3CI6A 3A3DA 3UDIA 4R0QA 4C3QA 1HLUP 2KLIA 3MXQA 2P9VB 3T1SA 4UQIM 1JWPA 3FZCA 3A3FA 4QHCA 5IU1A 2QZ6A 1JTGA 1P9WA 1V9YA 3QHYA 5FQQA 3FPVA 1BLHA 3UE6A 3MQOA 3H82B 4S2NA 2PT7A 2CMNA 3M6BA 2OOLA 5HW3A 3AGFA 4GW9A 3O88A 5FAPA 1F5MA 5DFYA 3VE4A 3JVVA 4OP8A 4PM5A 5FEFA 3KYZA 4X1MA 3TG9A 2V20A 4OPQA 2EWWA 3DWZA 4OQHA 4I3JA 3B3XA 3P01A 5C5KA 2ZMFA 3UB9A 3BWLA 2Y2NA 1KGFA 5L10A 2ZM8A 1J3WA 4JXGA 2NUTC 1LI0A 4YWZA 1N9BA 4WBGA 3ZNTA 2HP5A 3EEAA 1TEMA 3RFBA 1RGZA 2H5SA 1X0OA 4LPZA 2INWA 2J3TD 3Q07A 4S2JA 1K55A 4BD0A 1GHMA 3C8CA 4WUJA 4QY6A 3N4IA 4EBNA 2ZC7A 5EM1A 2V1ZA 5FATA 1YSPA 2B18A 2W3DA 1P9RA 3PBTA 2OWJA 4R3BA 3C7VA 3PBQA 1DRMA 1MXOA 3UMEA 4DE0A 1EW0A 3UB8A 3OPLA 2EWVA 4H6JB 4XUZA 4BL2A 4EERA 3N7WA 1AXBA 1ESIA 1TS0A 1SDEA 4RX3A 1FQGA 1H8ZA 3P09A 4JXSA 2WAFA 5HD5A 4NK3A 3IH9A 2HPBA 2VK3A 4ME4A 4HHDA 4NXBA 5I94A 2WADA 1XXMA 4NKPA 4O0PA 1Y54A 2XR0A 2L0WA 1OT9A 1S66L 3O87A 3ZCZA 1IYSA 4EU0A 1K25A 5HPIA 2R9XA 2HJ9C 4OLDA 4EETB 3KX0X 3ZGAB 2B5RA 3LR4A 1NJ4A 3CAXA 2M1CA 2PBYA 4L9FA 1YT4A 3C7UA 3HBRA 3KYEA 4BLMA 1RP5A 3OBFA 3GSGA 1YLZA 1BLCA 3SH8A 1S1YA 3FKVA 2XEPA 5EVIA 1XGJA 4K08A 5L8MA 4P0MA 3Q82A 3OZHA 1FSYA 4EBLA 4L9EA 3VE3A 5GLBA 3LUQA 1ES2A 5TR7A 4OPRA 3UMDA 1S67L 5TBMB 1PI4A 4IEDA 2O9CA 5FQ9A 3N8LA 2JKFA 3RXWA 2OAP1 2WKIA 3LIAA 3ZVTA 5IHVA 2OAQ1 4DXCA 2IWDA 1STZA 2LB9A 5CEDA 4NETA 5CXWA 3OOVA 1YAXA 3HLDA 1NZOA 4OPYA 2ZQ8A 3HLCA 3W8KA 4P6ZS 4RYEA 1T1CA 4M4XA 1ERMA 3CUEC 1HVBA 2H0YA 1VM1A 4N1XA 5GL9A 1NY0A 3B47A 3PTEA 3B42A 1BUEA 4DE2A 3LYXA 4MMNA 4EEPA 3HJKA 3ZG7B 5CTNA 2PYPA 3NC8A 1W8YA 3KO6A 2A2LA 1PYYA 4E3MA 4MN7A 4XXRA 4ZJ3A 1CF0A 1RGYA 2J3TC 3T4KA 1PFLA 5TGFA 2W1TA 1VETA 4GS9A 1NXYA 2W3GA 1ESUA 2Y2HA 3IH8A 3IXHA 2W27A 4RX2A 3O3VA 1Z6FA 1ZG6A 5CRFA 3CG5A 3HCYA 4BBVA 4OONA 5F69A 3WRZA 3RH8B 1G5UA 2BTFP 2WYXA 3H9WA 1MY8A 5D3OA 2JKRM 4GOGA 4KENB 3ZVWA 4UA6A 2J9PA 4LFUA 3V3SA 5DF9A 4GDBA 3B33A 3C2WA 4Z1WA 1HD8A 1FIKA 5DJUA 2GNXA 4PKYG 3P98A 2OWHA 2VJWA 4CLCD 3BLSA 3HREA 4DF6A 3V67A 3QP5A 4Z9QA 1YQSA 2VKSA 4NEED 4U3TA 3EQUA 3LEQA 2ZLYA 1D7EA 4KQRA 3BFDA 4QU3A 3KYQA 5DFXA 4HEFA 2PD7A 4LCMA 4C75A 5KSHA 1O07A 4MBHA 3BRMA 1OMEA 2ZQDA 5HWVA 2PR6A 3V50A 1CEFA 3OCLA 1TS7A 3OCNA 3MXRA 3BY8A 3GMWA 3ZG8B 4EWFA 2XDMA 3OPRA 3CPTB 1TDLA 4HY8A 4I3AA 2ZM0A 1KGGA 1L2SA 4MN5A 3QNCA 5CX7A 4G3KA 5F68A 1IYPA 2ACGA 1KE4A 1WYCA 2LB5A 4ZBEA 3A0SA 2PRFA 3QP2A 5GHZA 1GHPA 2OV5A 4EUVA 3DTKA 4UA7A 1IYOA 4WELA 2P7JA 1XP4A 1YLPA 3W4PA 3HLBA 4XT2A 2L4RA 3RJUA 4R23A 3UB6A 4MBKA 2BASA 3G34A 5G4YA 4YNRA 5BOHA 3VOYA 4R4RA 3KSFA 4GLQA 3IHBA 4WM9A 5KMWA 3HLEA 4X1LA 3F1PA 4BJPA 2RL3A 3H7WA 2HP6A 2ZC4B 4JGOA 4E3IA 3IWIA 1MC0A 2IA2A 5E2GA 5HDSA 3VFHA 2WAEA 1LT0A 3UO9A 1I2SA 1YKDA 5EVIB 5FSRA 1DJCA 1S1ZA 1FR6A 4JXVA 5M18A 4U0TA 4KZ5A 3JYIA 2XROA 3GTCA 4L0LA 4JPMA 3PR6A 3E4QA 1ACFA 2RCXA 5DKKA 2PU2A 4Y3IA 3SS4A 5FA7A 1MWRA 5AJGA 1IELA 1WE4A 5FASA 1G6OA 3MKEA 4B93A 4HOIA 2P74A 4LLOB 1YLWA 4HIAA 3QNBA 3FKWA 3UDXA 2DRWA 4OQIA 4U0XA 3NJAA 4R3AA 1SKFA 4WMCD 1F98A 4LV2A 2PAVP 5CTMA 1YLYA 3TW8A 2UV0E 2V2FF 1UWPX 3DTEA 2WKPA 2HP9A 4Q8IA 3PAEA 3F1OA 3EEHA 2ZBBA 2NUPC 1LSVA 4WZ4A 3T4SA 4BBTA 4KZ7A 1MWUA 5JYPA 3FV7A 4CLCC 2KX6A 4KZ9A 5GLAA 2X01A 2V0WA 4GHIB 4N1HA 2J80A 2V1AA 2B02A 5DF8A 2JKGA 1FOFA 3HUMA 3E2KA 2EX6A 2E8JA 2W1TB 1VETB 2V1BA 3PHYA 4NXFA 1VHMA 1BLSA 2GZAA 4MBFA 1OTEA 4E6WA 5FI2A 1OT6A 3TOIA 5DTTA 1MPLA 2Z2LB 3EGDC 5CGWA 1XPBA 3IX8A 2WGWA 2OSUA 3IXBA 3IX4A 1XJ6A 4N9LA 2VA0A 5FAOA 3L7HA 4D60A 2JKTM 3OPPA 1KGEA 3QP1A 3BJNA 1BYWA 2WK0A 2W1RA 4HI4A 5AQ9A 1OTBA 1HZOA 3LIFA 2EFUA 3R7WB 3DTMA 3R4KA 2QWSA 1G28A 1BLPA 1KVMA 4E3LA 3F1NB 3UNWA 2J9OA 3T1RA 3ZFZA 5EFWA 4HNBA 4N9KA 1H8YA 4B4XA 3MSHA 2XF3A 4CJNA 3HLGA 4I5SA 1T19A 1ALQA 3G32A 4QB8A 1MZUA 5HPFA 5FEGA 2W3FA 3PYPA 1PIOA 2VGKA 4GZBA 2W0NA 4JBFA 3E2LA 1V9ZA 3MQQA 1E3UD 2VLGA 4Y7PA 4HBTA 2JC7A 5CHJA 4KZ4A 3LCEA 3TJZC 1LL9A 3TE8A 4OP5A 2EXAA 1T1AA 4LRYC 4IUHA 3FYZA 3IX3A 3O86A 4FH2A 1W63Q 2ZC3B 3JVUA 1MKMA 3IF6C 4UQIS 3C4OA 4GJ4A 1U60A 3C5AA 4BL3A 1S6RA 2WGVA 1F9IA 1XX2A 1BT5A 4DJ2A 1T1BA 3T4JA 4OOYA 1IFQA 1LI9A 3UPOA 3MFXA 4XT2B 4NG2A 5U47A 2I9VA 4DJ3A 4H8RA 2K7SA 2J8YA 2ZC5B 4F94A 3GV9A 1IEMA 2VV6A 1PNEA 1ES3A 1TDGA 3WS0A 3RTYA 4E6XA 5G18A 4LRXC 1C3BA 3E4PA 3D72A 4LGWA 3N8RA 4O01A 4CLCA 4JGQA 1N9NA 1XKZA 2XRNA 3EWKA 3LI9A 5HZHA 1IKGA 4E3KA 1WA9A 3N6IA 4HH2A 1W5DA 3MXSA 3IT9A 1GSVA 3BFFA 3MZDA 4JKTA 4S2OA 3K2NA 4HBUA 1L0GA 2K31A 1QMFA 1SCWA 3BLMA 5DKLA 4PMAA 5EVLA 3QP6A 2PBDP 4EV4A 4O8GA 2HDRA 2Y8HA 2D01A 1K38A 3LI8A 1PZOA 1JTDA 2JBFA 3SS3A 5L09A 1PWDA 3G2ZA 2JN7A 3CWFA 4CPKA 2BG1A 5AQBA 2A24B 5HL6A 3S7NA 1ONGA 4I3IA 2PDRA 1W8QA 5CHMA 4L9GA 4E3NA 3MZEA 3F1OB 1KE3A 5EECA 3W4OA 5KIZA 4MN6A 5M19A 5F82A 3Q81A 3HLWA 4ID4A 1SDNA 2V8CA 3VP0A 1YLJA 3FG8A 1CQAA 4OVDA 1OJ5A 5IS1A 5G4ZA 1BTLA 3DTIA 4ETXA 3VSLA 1YPRA 1ZKJA 4OLGA 4JLFA 2G2UA 5EE8A 2XD5A 1BULA 4DDSA 4WEKA 1P0ZA 1M40A 2WUQA 2I72A 1PW1A 1TS6A 4ETZA 1ZC2A 2Y2LA 5FI6A 3VOLA 2Z2MB 1CJFA 1WYBA 3SH7A 5CGSA 3BFCA 1Y28A 2VX8A 2WKHA 3T4QA 3HJIA 1PWCA 2XA7M 4E3JA 4EW7A 2B95A 3SW1A 4Y2FA 3CLOA 2Z6CA 2WZZA 1SKOA 3AGEA 4M3KA 2M7VA 4OOLA 3GRJA 1ES5A 2HGVA 2P9VA 1QMEA 5JYOA 1JWVA 2EXBA 5HX9A 4HESA 3DBAA 1JNUA 4N92A 3T4OA 4PM7A 2ZD8A 4DRTA 4HJ3A 2PYRA 3Q7ZA 3NY4A 2QJ7A 1DJAA 4KZ6A 3S7QA 4WMCA 2A49A 2ZOHA 1LL5A 4Y0OA 3OPHA 3ZG9B 4G3WA 3QP4A 2O0YA 1VB6A 5HWTA 2WKEA 5HFOA 1PI5A 1LSWA 3MF0A 5AVEA 1MWTA 3BY9A 3PBOA 4IUKA 2JE5A 5EVID 2Z6DA 3KSGA 4MCWA 4BMWA 5HAQA 2Q9NA 2QMIA 4DKIA 3C38A 1K4FA 1XA1A 1GHIA 5A91A 4ZRRA 4FUWA 1GSWA 3IWOA 3I7JA 2AVXA 1ES4A 5CERA 2Y79A 3IXDA 2ZOIA 1YM1A 4EXOA 5A93A 2HDSA 1Z09A 1PZPA
chains in the Genus database with same CATH topology
5GLAA 3OPLA 4UAAA 1GCEA 2X01A 1K4EA 4K91A 5FAQA 4S2NC 1NRFA 3UPPA 4N1HA 4KZ8A 1L0DA 5GHXA 4RA7A 4X55A 3WS5A 5DF8A 4PPRA 2WGWB 2WZXA 1FOFA 4XUZA 4BL2A 1KE0A 1G6AA 2VGJA 3N7WA 1AXBA 3GQZA 1FCOA 3HUMA 5EPHA 3E2KA 1ESIA 1SDEA 4RX3A 1FQGA 2EX6A 1H8ZA 1CI8A 3P09A 4PM9A 3ZHHA 4JXSA 2WAFA 3VMAA 2XFSA 4NK3A 1K57C 3IH9A 1BLSA 4LCLA 2HPBA 3M6HA 4MBFA 4E6WA 3BFGA 5FI2A 5I94A 1YMSA 3TOIA 5DTTA 1MPLA 2WADA 4KG6A 1XXMA 2Z2LB 5CGWA 1XPBA 1Y54A 1VQQA 2XR0A 4IVIA 4S2LA 2WGWA 4WZ5A 3S22A 3O87A 3ZCZA 1IYSA 4S2MA 1KVLA 2OSUA 4Y0TA 1K25A 2Y2PA 2R9XA 3IXBA 3A3IA 4OLDA 3IF6A 3M2KA 4JF6A 4ZAMA 2BLSA 4N9LA 3ZGAB 5FAOA 2B5RA 1NJ4A 1NYYA 3ZDJA 1H5XA 3OPPA 1KGEA 3ISGA 2H0TA 3VFFA 5CEBA 2PBYA 2WK0A 3MBZA 3NDGA 3PBSA 3VP4A 1FCMA 5AQ9A 5FQJA 1HZOA 1YT4A 1ERQA 5AQAA 5DF7A 1O7EA 3C7UA 4R3JA 2EFUA 3HBRA 2EFXA 1K54A 2OLUA 3PBNA 1RP5A 3DTMA 1K6SA 5EUAA 4BLMA 3HUOA 4B88A 3IQAA 3BM6A 4E3OA 4GD8A 3GSGA 1YLZA 1ZG4A 1BLCA 4FD8A 3SH8A 3FKVA 4GN2A 2XEPA 1BLPA 3LY3A 3WS4A 5E2FA 5EVIA 1E3UA 3MFDA 1XGJA 1EWZA 1KVMA 3UE1A 4E3LA 3WS2A 4BENA 2XK1A 4P0MA 3Q82A 3UNWA 2J9OA 3OZHA 1FSYA 4MLLA 4EBLA 3ZFZA 3IF5A 4N9KA 4PM8A 3LY4A 3N8SA 1H8YA 4XUXA 5GLBA 4B4XA 2EX9A 3V39A 1ES2A 5TR7A 4A5RA 4LENA 2XF3A 4P85A 3WWXA 2OLVA 4EUZA 4K0WA 3RXXA 4CJNA 3HLGA 4OPRA 3Q7VB 3DW0A 1ALQA 3G32A 4OOMA 4QB8A 5TFQA 2C6WB 1PI4A 4R1GA 2ZC6B 4IEDA 3NI9A 1PIOA 5FQ9A 3G30A 3N8LA 2HDUA 2VGKA 2ZM2A 4GZBA 1MBLA 4DDYA 4JBFA 3E2LA 5CECA 3VP3A 2Y2JA 3MKFA 3RXWA 5KZHA 4D2OA 2WKIA 3IXGA 1E3UD 4Y7PA 4HBTA 3ZVTA 2JC7A 5CHJA 4KZ4A 3LCEA 5IHVA 4S2IA 4DXCA 2IWDA 1LL9A 4OP5A 2EXAA 5CEDA 4NETA 3FYZA 5CXWA 2EX2A 5FQKA 3O86A 4FH2A 5DVAA 3S4XA 2ZC3B 3HLDA 1NZOA 1MWSA 2ZQ8A 4OPYA 5M1AA 3IF6C 3C4OA 3HLCA 4R4SA 1YLTA 3W8KA 4RYEA 1YMXA 1U60A 3C5AA 4BL3A 3SOIA 1S6RA 4QD4A 4JXWA 3CJMA 5A92A 1ERMA 1HTZA 1G68A 1M6KA 3WRTA 1W79A 1HVBA 2H0YA 1PW8A 4GDNA 1Q2PA 2WGVA 1VM1A 1XX2A 4N1XA 1BT5A 1NY0A 5GL9A 3UE3A 3PTEA 4IVKA 3WS1A 1BUEA 3ITAA 4DE2A 3OC2A 1NYMA 2G2WA 4OOYA 4GB7A 1LI9A 4QJGA 3ZG7B 2ZMAA 4JF4A 2ZQAA 3NC8A 5CTNA 4EQIA 3MZFA 1W8YA 2QPNA 3UPOA 3IWQA 2Y2IA 1DY6A 1PYYA 2CC1A 2XQZA 5AQ7A 3G2YA 4E3MA 4X53A 5U47A 4XXRA 3UDFA 4ZJ3A 5EVIC 4H8RA 1RGYA 3IHAA 4UHUA 3D4FA 1JWZA 2J8YA 2ZC5B 5TGFA 4Y0UA 1L0FA 2X02A 4F94A 1LLBA 1NXYA 1ESUA 4X6TA 4K0XA 3GV9A 2Y2HA 3DWKA 3IH8A 3IXHA 1IEMA 4IBXA 4WYYA 1CK3A 1BSGA 1EROA 4RX2A 1ES3A 1TVFA 1Z6FA 3O3VA 3PBRA 1TDGA 1FR1A 2IWCA 1ZG6A 5CRFA 3CG5A 4UA9A 3WS0A 4ZDXA 4OONA 5E43A 4KZBA 3WRZA 4E6XA 5G18A 3UY6A 1C3BA 4X69A 3C4PA 2EX8A 3N8RA 1K56A 4OKPA 3EQVA 1MKIA 1Q2QA 2WYXA 5EOEA 1K55C 2Y2OA 4BQMA 4OQGA 3A3JA 4ZJ2A 1MY8A 5D3OA 2FFFB 1XKZA 4X56A 1LHYA 4GOGA 4KENB 3NIAA 1IKIA 5CGXA 3ZVWA 1IKGA 4UA6A 1PWGA 1EI5A 2J9PA 4E3KA 3V3SA 5DF9A 3LO7A 3N6IA 2Y55A 3BECA 2Q9MA 4GDBA 1W5DA 2XGNA 1K57A 3IT9A 3MXSA 3BFFA 3MZDA 4JKTA 4S2OA 1HD8A 4HBUA 2ZQ9A 1L0GA 4QY5A 1QMFA 1SCWA 3BLMA 3PAGA 4GNUA 5J8XA 4PM6A 2WGIA 4PMAA 3G4PA 5EVLA 1K56D 4B4ZA 3BEBA 5HAIA 3UPNA 5FI7A 3P98A 2H10A 1I2WA 4EV4A 4DE1A 4EBPA 3NBLA 2HDRA 1FCNA 2Y4AA 2IWBA 3NCKA 3BLSA 3UN7A 1K38A 2PU4A 4S2PA 3AGDA 3HUNA 3SS3A 1PZOA 1JTDA 2JBFA 2XD1A 3ZG0A 1PWDA 2E8IA 2R9WA 2XLNA 2ZQ7A 3G2ZA 3HREA 3FWLA 3Q1FA 3Q7VA 4DF6A 4CPKA 5EOOA 2BG1A 5AQBA 4Z9QA 3VP1A 5DTSA 4O7DA 1XA7A 4ZTKA 1YQSA 3SS5A 3SH9A 4P87A 1ONGA 1E25A 1E4DA 1N4OA 4U3TA 3EQUA 1W8QA 5CHMA 5E2EA 3ZG5A 3V5MA 4WZ5C 5FQMA 4GD6A 4E3NA 2ZLYA 2FFYA 3MZEA 4KG5A 4KQRA 3BFDA 1KE3A 4QU3A 5EECA 3G31A 4HEFA 2UWXA 3HLFA 5HARA 5HAPA 4LCMA 4LV0A 3W4OA 4C75A 2DNSA 3UE0A 4YINA 4FH4A 2ZJ9A 5M19A 4OQ0A 3Q81A 5F82A 2Y59A 3HLWA 4ID4A 4BD1A 5KSHA 1O07A 1SDNA 1BZAA 4MBHA 3BRMA 5GHYA 1OMEA 5GLCA 2ZQDA 4JF5A 3V3RA 1SHVA 1YLJA 3VP0A 4C6YA 3V50A 3W4QA 4LV3A 3LEZA 1CEFA 4KG2A 2ZQCA 3OCLA 4OVDA 3VOZA 3OCNA 3MXRA 4LV1A 3GMWA 3ZG8B 4EWFA 2XDMA 3OPRA 1K54C 2DCFA 5F1GA 2C5WB 1BTLA 1TDLA 5KSCA 2ZM0A 3VSLA 1ZKJA 3BYDA 4OLGA 4JLFA 4MNRA 1KGGA 2Y2KA 4DE3A 3GR2A 3ITBA 1L2SA 3QNCA 2JCHA 1IYPA 1NZUA 2G2UA 4WEJA 5EE8A 2XD5A 1BULA 2XH9A 1XGIA 1L0EA 1KE4A 1WYCA 3NDEA 4IBRA 4WEKA 5FDHA 4ZBEA 4DDSA 2X71A 5DTKA 1M40A 5HL1A 1S0WA 5GHZA 2WUQA 5F83A 2I72A 2Y2GA 1GHPA 1PW1A 2OV5A 3S1YA 3ZNYA 1ZC2A 2Y2LA 2Y2MA 5FI6A 2Z2MB 3IF6B 1RCJA 4UA7A 1KDSA 1IYOA 4WELA 1XP4A 1YLPA 3W4PA 3HLBA 1WYBA 3SH7A 3A3DA 3UDIA 3RJUA 4R23A 5CGSA 3BFCA 4KZAA 4R0QA 4C3QA 4MBKA 3CZDA 2P9VB 3G34A 2WKHA 5BOHA 1PWCA 3VOYA 4R4RA 1JWPA 3FZCA 4E3JA 3A3FA 4QHCA 3IHBA 4WM9A 1GA9A 2GDNA 1IYQA 5KMWA 2WZZA 3HLEA 2QZ6A 4BJPA 1JTGA 5FQIA 2RL3A 3VSKA 2HP6A 2ZC4B 3AGEA 4M3KA 3TSGA 4E3IA 3IWIA 4OOLA 3M2JA 3QHYA 5FQQA 3GRJA 1BLHA 4OPZA 2Y2QA 1ES5A 5E2GA 2P9VA 1QMEA 5JYOA 4KQOA 4S2NA 3VFHA 1JWVA 2WAEA 3M6BA 2EXBA 5HX9A 3UO9A 1I2SA 5HW3A 5EVIB 3AGFA 4HESA 5FSRA 4N92A 1DJCA 3O88A 5L2FA 4PM7A 1W7FA 1FR6A 4JXVA 5FAPA 2ZD8A 4DRTA 5M18A 4U0TA 4KZ5A 4ZJ1A 3JYIA 5F1FA 3Q7ZA 3GTCA 4OP8A 4PM5A 4S2KA 3NY4A 1CI9A 4P6BA 3TG9A 2V20A 4KZ6A 1DJAA 4YFMA 4L0LA 4JPMA 2A3UA 4OPQA 3DWZA 4OQHA 3CMZA 2RCXA 3B3XA 5A90A 1DJBA 5GLDA 4WMCA 2PU2A 4GKUA 2A49A 3SS4A 5FA7A 4FSFA 1MWRA 4OH0A 1LL5A 1KDWA 1IELA 5CHUA 1WE4A 3GVBA 5FASA 1J9MA 4FCFA 4Y0OA 2XFTA 3OPHA 2Y2NA 3ZG9B 1KGFA 3MKEA 3HL9A 1I5QA 2ZM8A 4JXGA 2P74A 1YLWA 1LI0A 2WKEA 2HDQA 1N9BA 4WBGA 5HFOA 1PI5A 3ZNTA 3QNBA 2HP5A 3FKWA 1TEMA 3UDXA 1MWTA 2DRWA 1RGZA 3VP2A 2H5SA 3PBOA 4OQIA 5E2HA 1GA0A 1FSWA 3HVFA 4U0XA 4KQQA 2JE5A 3A3EA 1JVJA 5EVID 1SKFA 4WMCD 4DXBA 1CEGA 4LV2A 3Q07A 4S2JA 1K55A 4BD0A 1GHMA 5HAQA 4X68A 2Q9NA 5CTMA 2QMIA 4DKIA 1YLYA 4QY6A 3N4IA 1K4FA 2V2FF 4RVAA 1XA1A 4EBNA 1GHIA 5A91A 2ZC7A 2V1ZA 2HP9A 5FATA 2J7VA 4Q8IA 3PAEA 3PBTA 3IWOA 4R3BA 3C7VA 3I7JA 3G35A 1ES4A 2Y91A 3PBQA 4WZ4A 1MXOA 5CERA 4KZ7A 1ONHA 3BFEA 3IXDA 1MWUA 1YM1A 5A93A 4MEZA 4DE0A 5JYPA 2HDSA 4KZ3A 3FV7A 1PZPA 1K6RA 4KZ9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5GLA A;  3OPL A;  4UAA A;  1GCE A;  2X01 A;  1K4E A;  4K91 A;  5FAQ A;  4S2N C;  1NRF A;  3UPP A;  4N1H A;  4KZ8 A;  1L0D A;  5GHX A;  4RA7 A;  4X55 A;  3WS5 A;  5DF8 A;  4PPR A;  2WGW B;  2WZX A;  1FOF A;  4XUZ A;  4BL2 A;  1KE0 A;  1G6A A;  2VGJ A;  3N7W A;  1AXB A;  3GQZ A;  1FCO A;  3HUM A;  5EPH A;  3E2K A;  1ESI A;  1SDE A;  4RX3 A;  1FQG A;  2EX6 A;  1H8Z A;  1CI8 A;  3P09 A;  4PM9 A;  3ZHH A;  4JXS A;  2WAF A;  3VMA A;  2XFS A;  4NK3 A;  1K57 C;  3IH9 A;  1BLS A;  4LCL A;  2HPB A;  3M6H A;  4MBF A;  4E6W A;  3BFG A;  5FI2 A;  5I94 A;  1YMS A;  3TOI A;  5DTT A;  1MPL A;  2WAD A;  4KG6 A;  1XXM A;  2Z2L B;  5CGW A;  1XPB A;  1Y54 A;  1VQQ A;  2XR0 A;  4IVI A;  4S2L A;  2WGW A;  4WZ5 A;  3S22 A;  3O87 A;  3ZCZ A;  1IYS A;  4S2M A;  1KVL A;  2OSU A;  4Y0T A;  1K25 A;  2Y2P A;  2R9X A;  3IXB A;  3A3I A;  4OLD A;  3IF6 A;  3M2K A;  4JF6 A;  4ZAM A;  2BLS A;  4N9L A;  3ZGA B;  5FAO A;  2B5R A;  1NJ4 A;  1NYY A;  3ZDJ A;  1H5X A;  3OPP A;  1KGE A;  3ISG A;  2H0T A;  3VFF A;  5CEB A;  2PBY A;  2WK0 A;  3MBZ A;  3NDG A;  3PBS A;  3VP4 A;  1FCM A;  5AQ9 A;  5FQJ A;  1HZO A;  1YT4 A;  1ERQ A;  5AQA A;  5DF7 A;  1O7E A;  3C7U A;  4R3J A;  2EFU A;  3HBR A;  2EFX A;  1K54 A;  2OLU A;  3PBN A;  1RP5 A;  3DTM A;  1K6S A;  5EUA A;  4BLM A;  3HUO A;  4B88 A;  3IQA A;  3BM6 A;  4E3O A;  4GD8 A;  3GSG A;  1YLZ A;  1ZG4 A;  1BLC A;  4FD8 A;  3SH8 A;  3FKV A;  4GN2 A;  2XEP A;  1BLP A;  3LY3 A;  3WS4 A;  5E2F A;  5EVI A;  1E3U A;  3MFD A;  1XGJ A;  1EWZ A;  1KVM A;  3UE1 A;  4E3L A;  3WS2 A;  4BEN A;  2XK1 A;  4P0M A;  3Q82 A;  3UNW A;  2J9O A;  3OZH A;  1FSY A;  4MLL A;  4EBL A;  3ZFZ A;  3IF5 A;  4N9K A;  4PM8 A;  3LY4 A;  3N8S A;  1H8Y A;  4XUX A;  5GLB A;  4B4X A;  2EX9 A;  3V39 A;  1ES2 A;  5TR7 A;  4A5R A;  4LEN A;  2XF3 A;  4P85 A;  3WWX A;  2OLV A;  4EUZ A;  4K0W A;  3RXX A;  4CJN A;  3HLG A;  4OPR A;  3Q7V B;  3DW0 A;  1ALQ A;  3G32 A;  4OOM A;  4QB8 A;  5TFQ A;  2C6W B;  1PI4 A;  4R1G A;  2ZC6 B;  4IED A;  3NI9 A;  1PIO A;  5FQ9 A;  3G30 A;  3N8L A;  2HDU A;  2VGK A;  2ZM2 A;  4GZB A;  1MBL A;  4DDY A;  4JBF A;  3E2L A;  5CEC A;  3VP3 A;  2Y2J A;  3MKF A;  3RXW A;  5KZH A;  4D2O A;  2WKI A;  3IXG A;  1E3U D;  4Y7P A;  4HBT A;  3ZVT A;  2JC7 A;  5CHJ A;  4KZ4 A;  3LCE A;  5IHV A;  4S2I A;  4DXC A;  2IWD A;  1LL9 A;  4OP5 A;  2EXA A;  5CED A;  4NET A;  3FYZ A;  5CXW A;  2EX2 A;  5FQK A;  3O86 A;  4FH2 A;  5DVA A;  3S4X A;  2ZC3 B;  3HLD A;  1NZO A;  1MWS A;  2ZQ8 A;  4OPY A;  5M1A A;  3IF6 C;  3C4O A;  3HLC A;  4R4S A;  1YLT A;  3W8K A;  4RYE A;  1YMX A;  1U60 A;  3C5A A;  4BL3 A;  3SOI A;  1S6R A;  4QD4 A;  4JXW A;  3CJM A;  5A92 A;  1ERM A;  1HTZ A;  1G68 A;  1M6K A;  3WRT A;  1W79 A;  1HVB A;  2H0Y A;  1PW8 A;  4GDN A;  1Q2P A;  2WGV A;  1VM1 A;  1XX2 A;  4N1X A;  1BT5 A;  1NY0 A;  5GL9 A;  3UE3 A;  3PTE A;  4IVK A;  3WS1 A;  1BUE A;  3ITA A;  4DE2 A;  3OC2 A;  1NYM A;  2G2W A;  4OOY A;  4GB7 A;  1LI9 A;  4QJG A;  3ZG7 B;  2ZMA A;  4JF4 A;  2ZQA A;  3NC8 A;  5CTN A;  4EQI A;  3MZF A;  1W8Y A;  2QPN A;  3UPO A;  3IWQ A;  2Y2I A;  1DY6 A;  1PYY A;  2CC1 A;  2XQZ A;  5AQ7 A;  3G2Y A;  4E3M A;  4X53 A;  5U47 A;  4XXR A;  3UDF A;  4ZJ3 A;  5EVI C;  4H8R A;  1RGY A;  3IHA A;  4UHU A;  3D4F A;  1JWZ A;  2J8Y A;  2ZC5 B;  5TGF A;  4Y0U A;  1L0F A;  2X02 A;  4F94 A;  1LLB A;  1NXY A;  1ESU A;  4X6T A;  4K0X A;  3GV9 A;  2Y2H A;  3DWK A;  3IH8 A;  3IXH A;  1IEM A;  4IBX A;  4WYY A;  1CK3 A;  1BSG A;  1ERO A;  4RX2 A;  1ES3 A;  1TVF A;  1Z6F A;  3O3V A;  3PBR A;  1TDG A;  1FR1 A;  2IWC A;  1ZG6 A;  5CRF A;  3CG5 A;  4UA9 A;  3WS0 A;  4ZDX A;  4OON A;  5E43 A;  4KZB A;  3WRZ A;  4E6X A;  5G18 A;  3UY6 A;  1C3B A;  4X69 A;  3C4P A;  2EX8 A;  3N8R A;  1K56 A;  4OKP A;  3EQV A;  1MKI A;  1Q2Q A;  2WYX A;  5EOE A;  1K55 C;  2Y2O A;  4BQM A;  4OQG A;  3A3J A;  4ZJ2 A;  1MY8 A;  5D3O A;  2FFF B;  1XKZ A;  4X56 A;  1LHY A;  4GOG A;  4KEN B;  3NIA A;  1IKI A;  5CGX A;  3ZVW A;  1IKG A;  4UA6 A;  1PWG A;  1EI5 A;  2J9P A;  4E3K A;  3V3S A;  5DF9 A;  3LO7 A;  3N6I A;  2Y55 A;  3BEC A;  2Q9M A;  4GDB A;  1W5D A;  2XGN A;  1K57 A;  3IT9 A;  3MXS A;  3BFF A;  3MZD A;  4JKT A;  4S2O A;  1HD8 A;  4HBU A;  2ZQ9 A;  1L0G A;  4QY5 A;  1QMF A;  1SCW A;  3BLM A;  3PAG A;  4GNU A;  5J8X A;  4PM6 A;  2WGI A;  4PMA A;  3G4P A;  5EVL A;  1K56 D;  4B4Z A;  3BEB A;  5HAI A;  3UPN A;  5FI7 A;  3P98 A;  2H10 A;  1I2W A;  4EV4 A;  4DE1 A;  4EBP A;  3NBL A;  2HDR A;  1FCN A;  2Y4A A;  2IWB A;  3NCK A;  3BLS A;  3UN7 A;  1K38 A;  2PU4 A;  4S2P A;  3AGD A;  3HUN A;  3SS3 A;  1PZO A;  1JTD A;  2JBF A;  2XD1 A;  3ZG0 A;  1PWD A;  2E8I A;  2R9W A;  2XLN A;  2ZQ7 A;  3G2Z A;  3HRE A;  3FWL A;  3Q1F A;  3Q7V A;  4DF6 A;  4CPK A;  5EOO A;  2BG1 A;  5AQB A;  4Z9Q A;  3VP1 A;  5DTS A;  4O7D A;  1XA7 A;  4ZTK A;  1YQS A;  3SS5 A;  3SH9 A;  4P87 A;  1ONG A;  1E25 A;  1E4D A;  1N4O A;  4U3T A;  3EQU A;  1W8Q A;  5CHM A;  5E2E A;  3ZG5 A;  3V5M A;  4WZ5 C;  5FQM A;  4GD6 A;  4E3N A;  2ZLY A;  2FFY A;  3MZE A;  4KG5 A;  4KQR A;  3BFD A;  1KE3 A;  4QU3 A;  5EEC A;  3G31 A;  4HEF A;  2UWX A;  3HLF A;  5HAR A;  5HAP A;  4LCM A;  4LV0 A;  3W4O A;  4C75 A;  2DNS A;  3UE0 A;  4YIN A;  4FH4 A;  2ZJ9 A;  5M19 A;  4OQ0 A;  3Q81 A;  5F82 A;  2Y59 A;  3HLW A;  4ID4 A;  4BD1 A;  5KSH A;  1O07 A;  1SDN A;  1BZA A;  4MBH A;  3BRM A;  5GHY A;  1OME A;  5GLC A;  2ZQD A;  4JF5 A;  3V3R A;  1SHV A;  1YLJ A;  3VP0 A;  4C6Y A;  3V50 A;  3W4Q A;  4LV3 A;  3LEZ A;  1CEF A;  4KG2 A;  2ZQC A;  3OCL A;  4OVD A;  3VOZ A;  3OCN A;  3MXR A;  4LV1 A;  3GMW A;  3ZG8 B;  4EWF A;  2XDM A;  3OPR A;  1K54 C;  2DCF A;  5F1G A;  2C5W B;  1BTL A;  1TDL A;  5KSC A;  2ZM0 A;  3VSL A;  1ZKJ A;  3BYD A;  4OLG A;  4JLF A;  4MNR A;  1KGG A;  2Y2K A;  4DE3 A;  3GR2 A;  3ITB A;  1L2S A;  3QNC A;  2JCH A;  1IYP A;  1NZU A;  2G2U A;  4WEJ A;  5EE8 A;  2XD5 A;  1BUL A;  2XH9 A;  1XGI A;  1L0E A;  1KE4 A;  1WYC A;  3NDE A;  4IBR A;  4WEK A;  5FDH A;  4ZBE A;  4DDS A;  2X71 A;  5DTK A;  1M40 A;  5HL1 A;  1S0W A;  5GHZ A;  2WUQ A;  5F83 A;  2I72 A;  2Y2G A;  1GHP A;  1PW1 A;  2OV5 A;  3S1Y A;  3ZNY A;  1ZC2 A;  2Y2L A;  2Y2M A;  5FI6 A;  2Z2M B;  3IF6 B;  1RCJ A;  4UA7 A;  1KDS A;  1IYO A;  4WEL A;  1XP4 A;  1YLP A;  3W4P A;  3HLB A;  1WYB A;  3SH7 A;  3A3D A;  3UDI A;  3RJU A;  4R23 A;  5CGS A;  3BFC A;  4KZA A;  4R0Q A;  4C3Q A;  4MBK A;  3CZD A;  2P9V B;  3G34 A;  2WKH A;  5BOH A;  1PWC A;  3VOY A;  4R4R A;  1JWP A;  3FZC A;  4E3J A;  3A3F A;  4QHC A;  3IHB A;  4WM9 A;  1GA9 A;  2GDN A;  1IYQ A;  5KMW A;  2WZZ A;  3HLE A;  2QZ6 A;  4BJP A;  1JTG A;  5FQI A;  2RL3 A;  3VSK A;  2HP6 A;  2ZC4 B;  3AGE A;  4M3K A;  3TSG A;  4E3I A;  3IWI A;  4OOL A;  3M2J A;  3QHY A;  5FQQ A;  3GRJ A;  1BLH A;  4OPZ A;  2Y2Q A;  1ES5 A;  5E2G A;  2P9V A;  1QME A;  5JYO A;  4KQO A;  4S2N A;  3VFH A;  1JWV A;  2WAE A;  3M6B A;  2EXB A;  5HX9 A;  3UO9 A;  1I2S A;  5HW3 A;  5EVI B;  3AGF A;  4HES A;  5FSR A;  4N92 A;  1DJC A;  3O88 A;  5L2F A;  4PM7 A;  1W7F A;  1FR6 A;  4JXV A;  5FAP A;  2ZD8 A;  4DRT A;  5M18 A;  4U0T A;  4KZ5 A;  4ZJ1 A;  3JYI A;  5F1F A;  3Q7Z A;  3GTC A;  4OP8 A;  4PM5 A;  4S2K A;  3NY4 A;  1CI9 A;  4P6B A;  3TG9 A;  2V20 A;  4KZ6 A;  1DJA A;  4YFM A;  4L0L A;  4JPM A;  2A3U A;  4OPQ A;  3DWZ A;  4OQH A;  3CMZ A;  2RCX A;  3B3X A;  5A90 A;  1DJB A;  5GLD A;  4WMC A;  2PU2 A;  4GKU A;  2A49 A;  3SS4 A;  5FA7 A;  4FSF A;  1MWR A;  4OH0 A;  1LL5 A;  1KDW A;  1IEL A;  5CHU A;  1WE4 A;  3GVB A;  5FAS A;  1J9M A;  4FCF A;  4Y0O A;  2XFT A;  3OPH A;  2Y2N A;  3ZG9 B;  1KGF A;  3MKE A;  3HL9 A;  1I5Q A;  2ZM8 A;  4JXG A;  2P74 A;  1YLW A;  1LI0 A;  2WKE A;  2HDQ A;  1N9B A;  4WBG A;  5HFO A;  1PI5 A;  3ZNT A;  3QNB A;  2HP5 A;  3FKW A;  1TEM A;  3UDX A;  1MWT A;  2DRW A;  1RGZ A;  3VP2 A;  2H5S A;  3PBO A;  4OQI A;  5E2H A;  1GA0 A;  1FSW A;  3HVF A;  4U0X A;  4KQQ A;  2JE5 A;  3A3E A;  1JVJ A;  5EVI D;  1SKF A;  4WMC D;  4DXB A;  1CEG A;  4LV2 A;  3Q07 A;  4S2J A;  1K55 A;  4BD0 A;  1GHM A;  5HAQ A;  4X68 A;  2Q9N A;  5CTM A;  2QMI A;  4DKI A;  1YLY A;  4QY6 A;  3N4I A;  1K4F A;  2V2F F;  4RVA A;  1XA1 A;  4EBN A;  1GHI A;  5A91 A;  2ZC7 A;  2V1Z A;  2HP9 A;  5FAT A;  2J7V A;  4Q8I A;  3PAE A;  3PBT A;  3IWO A;  4R3B A;  3C7V A;  3I7J A;  3G35 A;  1ES4 A;  2Y91 A;  3PBQ A;  4WZ4 A;  1MXO A;  5CER A;  4KZ7 A;  1ONH A;  3BFE A;  3IXD A;  1MWU A;  1YM1 A;  5A93 A;  4MEZ A;  4DE0 A;  5JYP A;  2HDS A;  4KZ3 A;  3FV7 A;  1PZP A;  1K6R A;  4KZ9 A; 
#chains in the Genus database with same CATH topology
 4UAA A;  1GCE A;  4S2N C;  1NRF A;  3UPP A;  1OPX A;  4X55 A;  3WS5 A;  5EM0 A;  4PPR A;  2WZX A;  4IHQ A;  5K5B A;  1KE0 A;  1G6A A;  2VGJ A;  1AWI A;  3E0Y A;  1FCO A;  3GQZ A;  3KSH A;  1PRQ A;  3MQ0 A;  3JPU A;  1CI8 A;  5HDC A;  2VGL M;  5J4E A;  4PM9 A;  3ZHH A;  3VMA A;  2XFS A;  3BFG A;  2VV7 A;  1YMS A;  3L9K A;  4MDZ A;  4KG6 A;  1K0K A;  3LIC A;  4H6J A;  3IBR A;  4S2M A;  3QP8 A;  4Y0T A;  2Y2P A;  4BWI A;  3M2K A;  4JF6 A;  2MJ6 A;  4ZAM A;  3K3C A;  4YOF A;  4HJ4 A;  2D02 A;  1NYY A;  3CUE A;  1H5X A;  3ISG A;  2H0T A;  3VFF A;  3U2A A;  5CEB A;  3MBZ A;  3PBS A;  4I38 A;  5FQJ A;  1O7E A;  4R3J A;  2VZW A;  2OLU A;  3PBN A;  1K6S A;  3HUO A;  4B88 A;  3BM6 A;  1UWN X;  3FC7 A;  3K3D A;  3MR0 A;  4FD8 A;  4GN2 A;  2G7U A;  5HSQ A;  1E3U A;  3MFD A;  1EWZ A;  3UE1 A;  5HD3 A;  3WS2 A;  4ARZ A;  1TS8 A;  3N8S A;  2EX9 A;  4P85 A;  2OLV A;  4EUZ A;  1NWZ A;  3LFV A;  3DW0 A;  4OOM A;  1OTI A;  1N9O A;  5TFQ A;  2C6W B;  4R1G A;  3G30 A;  3SZT A;  2HDU A;  4HH3 A;  5CEC A;  4DMZ A;  5KZH A;  4D2O A;  4WF0 A;  3IXG A;  1H8M A;  3IS2 A;  5EV0 A;  5TBM A;  4WN5 A;  2EA9 A;  5J3W A;  2Q0O A;  4EEU A;  1A0K A;  1ZTU A;  5DVA A;  3S4X A;  1ODV A;  5LBR A;  1MWS A;  5M1A A;  4R4S A;  1XJ3 A;  1YMX A;  5J7E A;  3SOI A;  4JXW A;  5A92 A;  3WRT A;  1W79 A;  1OJG A;  4GDN A;  1Q2P A;  1XJ2 A;  4UEY A;  3UE3 A;  3VV4 A;  3OC2 A;  1NYM A;  2G2W A;  5F6A A;  4WL9 A;  4GB7 A;  4GS9 B;  4JF4 A;  4EQI A;  2QPN A;  3IWQ A;  3S7P A;  1DY6 A;  1UGU A;  2CC1 A;  3G2Y A;  3ZYT A;  3MS6 A;  5EVI C;  2FH5 A;  5IT5 A;  4FOF A;  1YSQ A;  3IHA A;  4UHU A;  5L07 A;  3D4F A;  2HV1 A;  4KUO A;  1L0F A;  2ZL1 A;  4X6T A;  4K0X A;  3DWK A;  1F2K A;  1SKO B;  4IBX A;  1BSG A;  1ERO A;  5FDS A;  4UA9 A;  4ZDX A;  3T12 B;  3UY6 A;  3P7N A;  3C4P A;  4G3V A;  1ZHH B;  3A0V A;  4OKP A;  4HP4 A;  1MKI A;  1Q2Q A;  1NLZ A;  5EOE A;  4NXE A;  2Y2O A;  3E4O A;  3A3J A;  2DMW A;  4ZJ2 A;  2FFF B;  4X56 A;  3NIA A;  3LGO A;  1IKI A;  3NEC A;  2O99 A;  3LO7 A;  1LL8 A;  2Y55 A;  1XFQ A;  2Q9M A;  3BEC A;  3PXP A;  4DN0 A;  2XGN A;  5EVE A;  4Q0H A;  4BBU A;  4QY5 A;  1P97 A;  4QWO A;  5J8X A;  4GNU A;  4PM6 A;  3G4P A;  4B4Z A;  1K56 D;  3BEB A;  3T1X A;  5FI7 A;  2H10 A;  4DE1 A;  2XSS A;  3NCK A;  3UN7 A;  3U4L P;  4S2P A;  3AGD A;  3HUN A;  2YKH A;  3ZG0 A;  2XLN A;  2ZQ7 A;  3Q7V A;  3BW6 A;  5EOO A;  2J3W A;  5DTS A;  4O7D A;  4Y5F A;  1XA7 A;  2M7U A;  4ZTK A;  4P87 A;  4X25 A;  1E4D A;  1N4O A;  3V5M A;  4WZ5 C;  4NXG A;  4GD6 A;  4GCZ A;  2O9B A;  2R78 A;  3ZQ5 A;  3G31 A;  5HAP A;  2QHK A;  1D06 A;  2DNS A;  3UE0 A;  2ZMV A;  2ZJ9 A;  2Y59 A;  2V9A A;  3BQ8 A;  5GHY A;  3FPW A;  3V3R A;  4JF5 A;  3W4Q A;  4HQA A;  3BQA A;  5TJJ A;  3VOZ A;  4HJ6 A;  4LV1 A;  2W3H A;  1K54 C;  2C5W B;  5KSC A;  4DE3 A;  2HJE A;  1NLY A;  1NRJ A;  4CLC E;  3NDE A;  3D9Y A;  4IBR A;  5HL1 A;  3DAV A;  5DTK A;  1S0W A;  3EGX C;  4R6L A;  2JKR I;  2Y2M A;  1RCJ A;  3CPT A;  1KDS A;  3F1P B;  3H7W B;  1XFN A;  4KZA A;  1H0M A;  4KQD A;  3CZD A;  4P6Z M;  1GA9 A;  2GDN A;  1IYQ A;  3T4T A;  5FQI A;  3VSK A;  3TSG A;  3E98 A;  3M2J A;  1Y4O A;  4OPZ A;  2Y2Q A;  5FL3 A;  4KQO A;  1VEU A;  4Y15 A;  5HWW A;  2GJ3 A;  5L2F A;  4ARZ B;  1KOU A;  1W7F A;  4I39 A;  4ZJ1 A;  5F1F A;  4HP9 A;  4FTX A;  4S2K A;  1CI9 A;  4P6B A;  2WKQ A;  4YFM A;  2A3U A;  2KDK A;  3CMZ A;  1D1J A;  5A90 A;  1DJB A;  5GLD A;  4GKU A;  4FSF A;  4OH0 A;  3A0R A;  1KDW A;  5CHU A;  3GVB A;  1J9M A;  4FCF A;  2XFT A;  4JGR A;  3HL9 A;  1I5Q A;  1XJ4 A;  3OLO A;  3IS2 B;  3GDI A;  2HDQ A;  4F3L A;  3TRC A;  2WKR A;  2L1M A;  1TF1 A;  3VP2 A;  5E2H A;  1GA0 A;  1FSW A;  3HVF A;  4KQQ A;  3A3E A;  1JVJ A;  4DXB A;  1S4S A;  1CEG A;  3KSI A;  3S7O A;  4X68 A;  4LRZ E;  2FZ0 A;  4RVA A;  3NOT C;  5HDD A;  2P08 A;  2J7V A;  4EES A;  2HZ5 A;  4Y13 A;  3G35 A;  2Y91 A;  1ONH A;  3BFE A;  4QPR A;  2YKF A;  4MEZ A;  4KZ3 A;  4AFI A;  3LR3 A;  1K6R A;  1K4E A;  4K91 A;  5FAQ A;  4KZ8 A;  1L0D A;  5GHX A;  4RA7 A;  2WGW B;  3IBJ A;  3LR5 A;  5EPH A;  3NOP C;  2ZL1 B;  4Q0I A;  1K57 C;  1DP6 A;  4LCL A;  3M6H A;  3ULF A;  4GHI A;  1VQQ A;  4IVI A;  5DJT A;  3EOI A;  4S2L A;  2GX5 A;  4WZ5 A;  3S22 A;  1KVL A;  3A3I A;  3IF6 A;  4R70 A;  2BLS A;  2O9A A;  2PR5 A;  3ZDJ A;  1SZV A;  3NDG A;  3VP4 A;  1FCM A;  1ERQ A;  5AQA A;  5DF7 A;  2QYB A;  1S4R A;  2EFX A;  1K54 A;  5EUA A;  3IQA A;  4E3O A;  1GSX A;  4GD8 A;  1ZG4 A;  4WLA A;  3H82 A;  2K2N A;  3LY3 A;  3WS4 A;  5E2F A;  5AVF A;  4BEN A;  2XK1 A;  2W3E A;  4MLL A;  3R7W A;  3IF5 A;  4PM8 A;  3LY4 A;  4XUX A;  3V39 A;  3UB5 P;  4A5R A;  4LEN A;  3WWX A;  4K0W A;  3RXX A;  1DP8 A;  3Q7V B;  3W2Z A;  2ZC6 B;  3NI9 A;  3F1N A;  2ZM2 A;  1MBL A;  4DDY A;  3VP3 A;  2Y2J A;  3MKF A;  2JHE A;  4CQH A;  3LIB A;  3T1Q B;  4B9O A;  4S2I A;  4KUK A;  2QKP A;  4E04 A;  2EX2 A;  5FQK A;  3T4L A;  1FIL A;  2XA7 S;  1YLT A;  4PKY A;  3CHW P;  2P04 A;  2QJ5 A;  4QD4 A;  3CJM A;  1HTZ A;  1G68 A;  1M6K A;  3MJQ A;  2PD8 A;  2V8F A;  1PW8 A;  2JKT I;  2PHY A;  3NHQ A;  4IVK A;  3LID A;  3WS1 A;  4EQ1 A;  4R38 A;  3ITA A;  3UB7 A;  4QJG A;  2ZMA A;  2ZQA A;  4IJG A;  3MZF A;  2Y2I A;  2VEA A;  1IOU A;  5AQ7 A;  2XQZ A;  4X53 A;  3UDF A;  3NUL A;  1L3L A;  5A8B A;  1OTA A;  1JWZ A;  2VV8 A;  3NOU C;  4Y0U A;  2X02 A;  3G6O A;  1LLB A;  4II7 A;  4WYY A;  1CK3 A;  1H3Q A;  4CLC B;  1TVF A;  3PBR A;  1FR1 A;  2IWC A;  5F5Y A;  1VEU B;  3LIE A;  4KZB A;  5E43 A;  1OTD A;  4PAU A;  4X69 A;  2EX8 A;  1K56 A;  3EQV A;  2H28 A;  2KOI A;  2HF6 A;  1K55 C;  1T18 A;  4BQM A;  4OQG A;  1W63 M;  3MMH A;  1LHY A;  3D3O A;  5CGX A;  1PWG A;  1EI5 A;  1K57 A;  2ZQ9 A;  3O5Y A;  3PAG A;  2WGI A;  4F3L B;  5HAI A;  3UPN A;  1I2W A;  4RQ9 A;  3NBL A;  4EBP A;  1FCN A;  2Y4A A;  2IWB A;  4ESP A;  2PU4 A;  5MC7 A;  2XD1 A;  2E8I A;  2R9W A;  4Q0J A;  3FWL A;  3Q1F A;  3VP1 A;  2VGL S;  4JGP A;  1DP9 A;  3SS5 A;  3SH9 A;  2V0U A;  1E25 A;  5E2E A;  3ZG5 A;  5FQM A;  3LR0 A;  2FFY A;  4KG5 A;  3GEC A;  1LSX A;  2UWX A;  3HLF A;  5HAR A;  4LV0 A;  4YIN A;  4FH4 A;  4OQ0 A;  2A24 A;  4BD1 A;  1BZA A;  3C30 A;  5GLC A;  4C6Y A;  1SHV A;  4Y17 A;  4LV3 A;  3LEZ A;  4KG2 A;  2ZQC A;  2DCF A;  5F1G A;  3CIT A;  3ICY A;  3BYD A;  4MNR A;  2Y2K A;  3GR2 A;  3ITB A;  2JCH A;  1NZU A;  4WEJ A;  1XGI A;  4PHT A;  2XH9 A;  1L0E A;  5FDH A;  3T50 A;  2X71 A;  5I5L A;  5F83 A;  3ZNY A;  2Y2G A;  1N9L A;  3S1Y A;  1TD5 A;  3IF6 B;  3CI6 A;  3A3D A;  3UDI A;  4R0Q A;  4C3Q A;  1HLU P;  2KLI A;  3MXQ A;  2P9V B;  3T1S A;  4UQI M;  1JWP A;  3FZC A;  3A3F A;  4QHC A;  5IU1 A;  2QZ6 A;  1JTG A;  1P9W A;  1V9Y A;  3QHY A;  5FQQ A;  3FPV A;  1BLH A;  3UE6 A;  3MQO A;  3H82 B;  4S2N A;  2PT7 A;  2CMN A;  3M6B A;  2OOL A;  5HW3 A;  3AGF A;  4GW9 A;  3O88 A;  5FAP A;  1F5M A;  5DFY A;  3VE4 A;  3JVV A;  4OP8 A;  4PM5 A;  5FEF A;  3KYZ A;  4X1M A;  3TG9 A;  2V20 A;  4OPQ A;  2EWW A;  3DWZ A;  4OQH A;  4I3J A;  3B3X A;  3P01 A;  5C5K A;  2ZMF A;  3UB9 A;  3BWL A;  2Y2N A;  1KGF A;  5L10 A;  2ZM8 A;  1J3W A;  4JXG A;  2NUT C;  1LI0 A;  4YWZ A;  1N9B A;  4WBG A;  3ZNT A;  2HP5 A;  3EEA A;  1TEM A;  3RFB A;  1RGZ A;  2H5S A;  1X0O A;  4LPZ A;  2INW A;  2J3T D;  3Q07 A;  4S2J A;  1K55 A;  4BD0 A;  1GHM A;  3C8C A;  4WUJ A;  4QY6 A;  3N4I A;  4EBN A;  2ZC7 A;  5EM1 A;  2V1Z A;  5FAT A;  1YSP A;  2B18 A;  2W3D A;  1P9R A;  3PBT A;  2OWJ A;  4R3B A;  3C7V A;  3PBQ A;  1DRM A;  1MXO A;  3UME A;  4DE0 A;  1EW0 A;  3UB8 A;  3OPL A;  2EWV A;  4H6J B;  4XUZ A;  4BL2 A;  4EER A;  3N7W A;  1AXB A;  1ESI A;  1TS0 A;  1SDE A;  4RX3 A;  1FQG A;  1H8Z A;  3P09 A;  4JXS A;  2WAF A;  5HD5 A;  4NK3 A;  3IH9 A;  2HPB A;  2VK3 A;  4ME4 A;  4HHD A;  4NXB A;  5I94 A;  2WAD A;  1XXM A;  4NKP A;  4O0P A;  1Y54 A;  2XR0 A;  2L0W A;  1OT9 A;  1S66 L;  3O87 A;  3ZCZ A;  1IYS A;  4EU0 A;  1K25 A;  5HPI A;  2R9X A;  2HJ9 C;  4OLD A;  4EET B;  3KX0 X;  3ZGA B;  2B5R A;  3LR4 A;  1NJ4 A;  3CAX A;  2M1C A;  2PBY A;  4L9F A;  1YT4 A;  3C7U A;  3HBR A;  3KYE A;  4BLM A;  1RP5 A;  3OBF A;  3GSG A;  1YLZ A;  1BLC A;  3SH8 A;  1S1Y A;  3FKV A;  2XEP A;  5EVI A;  1XGJ A;  4K08 A;  5L8M A;  4P0M A;  3Q82 A;  3OZH A;  1FSY A;  4EBL A;  4L9E A;  3VE3 A;  5GLB A;  3LUQ A;  1ES2 A;  5TR7 A;  4OPR A;  3UMD A;  1S67 L;  5TBM B;  1PI4 A;  4IED A;  2O9C A;  5FQ9 A;  3N8L A;  2JKF A;  3RXW A;  2OAP 1;  2WKI A;  3LIA A;  3ZVT A;  5IHV A;  2OAQ 1;  4DXC A;  2IWD A;  1STZ A;  2LB9 A;  5CED A;  4NET A;  5CXW A;  3OOV A;  1YAX A;  3HLD A;  1NZO A;  4OPY A;  2ZQ8 A;  3HLC A;  3W8K A;  4P6Z S;  4RYE A;  1T1C A;  4M4X A;  1ERM A;  3CUE C;  1HVB A;  2H0Y A;  1VM1 A;  4N1X A;  5GL9 A;  1NY0 A;  3B47 A;  3PTE A;  3B42 A;  1BUE A;  4DE2 A;  3LYX A;  4MMN A;  4EEP A;  3HJK A;  3ZG7 B;  5CTN A;  2PYP A;  3NC8 A;  1W8Y A;  3KO6 A;  2A2L A;  1PYY A;  4E3M A;  4MN7 A;  4XXR A;  4ZJ3 A;  1CF0 A;  1RGY A;  2J3T C;  3T4K A;  1PFL A;  5TGF A;  2W1T A;  1VET A;  4GS9 A;  1NXY A;  2W3G A;  1ESU A;  2Y2H A;  3IH8 A;  3IXH A;  2W27 A;  4RX2 A;  3O3V A;  1Z6F A;  1ZG6 A;  5CRF A;  3CG5 A;  3HCY A;  4BBV A;  4OON A;  5F69 A;  3WRZ A;  3RH8 B;  1G5U A;  2BTF P;  2WYX A;  3H9W A;  1MY8 A;  5D3O A;  2JKR M;  4GOG A;  4KEN B;  3ZVW A;  4UA6 A;  2J9P A;  4LFU A;  3V3S A;  5DF9 A;  4GDB A;  3B33 A;  3C2W A;  4Z1W A;  1HD8 A;  1FIK A;  5DJU A;  2GNX A;  4PKY G;  3P98 A;  2OWH A;  2VJW A;  4CLC D;  3BLS A;  3HRE A;  4DF6 A;  3V67 A;  3QP5 A;  4Z9Q A;  1YQS A;  2VKS A;  4NEE D;  4U3T A;  3EQU A;  3LEQ A;  2ZLY A;  1D7E A;  4KQR A;  3BFD A;  4QU3 A;  3KYQ A;  5DFX A;  4HEF A;  2PD7 A;  4LCM A;  4C75 A;  5KSH A;  1O07 A;  4MBH A;  3BRM A;  1OME A;  2ZQD A;  5HWV A;  2PR6 A;  3V50 A;  1CEF A;  3OCL A;  1TS7 A;  3OCN A;  3MXR A;  3BY8 A;  3GMW A;  3ZG8 B;  4EWF A;  2XDM A;  3OPR A;  3CPT B;  1TDL A;  4HY8 A;  4I3A A;  2ZM0 A;  1KGG A;  1L2S A;  4MN5 A;  3QNC A;  5CX7 A;  4G3K A;  5F68 A;  1IYP A;  2ACG A;  1KE4 A;  1WYC A;  2LB5 A;  4ZBE A;  3A0S A;  2PRF A;  3QP2 A;  5GHZ A;  1GHP A;  2OV5 A;  4EUV A;  3DTK A;  4UA7 A;  1IYO A;  4WEL A;  2P7J A;  1XP4 A;  1YLP A;  3W4P A;  3HLB A;  4XT2 A;  2L4R A;  3RJU A;  4R23 A;  3UB6 A;  4MBK A;  2BAS A;  3G34 A;  5G4Y A;  4YNR A;  5BOH A;  3VOY A;  4R4R A;  3KSF A;  4GLQ A;  3IHB A;  4WM9 A;  5KMW A;  3HLE A;  4X1L A;  3F1P A;  4BJP A;  2RL3 A;  3H7W A;  2HP6 A;  2ZC4 B;  4JGO A;  4E3I A;  3IWI A;  1MC0 A;  2IA2 A;  5E2G A;  5HDS A;  3VFH A;  2WAE A;  1LT0 A;  3UO9 A;  1I2S A;  1YKD A;  5EVI B;  5FSR A;  1DJC A;  1S1Z A;  1FR6 A;  4JXV A;  5M18 A;  4U0T A;  4KZ5 A;  3JYI A;  2XRO A;  3GTC A;  4L0L A;  4JPM A;  3PR6 A;  3E4Q A;  1ACF A;  2RCX A;  5DKK A;  2PU2 A;  4Y3I A;  3SS4 A;  5FA7 A;  1MWR A;  5AJG A;  1IEL A;  1WE4 A;  5FAS A;  1G6O A;  3MKE A;  4B93 A;  4HOI A;  2P74 A;  4LLO B;  1YLW A;  4HIA A;  3QNB A;  3FKW A;  3UDX A;  2DRW A;  4OQI A;  4U0X A;  3NJA A;  4R3A A;  1SKF A;  4WMC D;  1F98 A;  4LV2 A;  2PAV P;  5CTM A;  1YLY A;  3TW8 A;  2UV0 E;  2V2F F;  1UWP X;  3DTE A;  2WKP A;  2HP9 A;  4Q8I A;  3PAE A;  3F1O A;  3EEH A;  2ZBB A;  2NUP C;  1LSV A;  4WZ4 A;  3T4S A;  4BBT A;  4KZ7 A;  1MWU A;  5JYP A;  3FV7 A;  4CLC C;  2KX6 A;  4KZ9 A;  5GLA A;  2X01 A;  2V0W A;  4GHI B;  4N1H A;  2J80 A;  2V1A A;  2B02 A;  5DF8 A;  2JKG A;  1FOF A;  3HUM A;  3E2K A;  2EX6 A;  2E8J A;  2W1T B;  1VET B;  2V1B A;  3PHY A;  4NXF A;  1VHM A;  1BLS A;  2GZA A;  4MBF A;  1OTE A;  4E6W A;  5FI2 A;  1OT6 A;  3TOI A;  5DTT A;  1MPL A;  2Z2L B;  3EGD C;  5CGW A;  1XPB A;  3IX8 A;  2WGW A;  2OSU A;  3IXB A;  3IX4 A;  1XJ6 A;  4N9L A;  2VA0 A;  5FAO A;  3L7H A;  4D60 A;  2JKT M;  3OPP A;  1KGE A;  3QP1 A;  3BJN A;  1BYW A;  2WK0 A;  2W1R A;  4HI4 A;  5AQ9 A;  1OTB A;  1HZO A;  3LIF A;  2EFU A;  3R7W B;  3DTM A;  3R4K A;  2QWS A;  1G28 A;  1BLP A;  1KVM A;  4E3L A;  3F1N B;  3UNW A;  2J9O A;  3T1R A;  3ZFZ A;  5EFW A;  4HNB A;  4N9K A;  1H8Y A;  4B4X A;  3MSH A;  2XF3 A;  4CJN A;  3HLG A;  4I5S A;  1T19 A;  1ALQ A;  3G32 A;  4QB8 A;  1MZU A;  5HPF A;  5FEG A;  2W3F A;  3PYP A;  1PIO A;  2VGK A;  4GZB A;  2W0N A;  4JBF A;  3E2L A;  1V9Z A;  3MQQ A;  1E3U D;  2VLG A;  4Y7P A;  4HBT A;  2JC7 A;  5CHJ A;  4KZ4 A;  3LCE A;  3TJZ C;  1LL9 A;  3TE8 A;  4OP5 A;  2EXA A;  1T1A A;  4LRY C;  4IUH A;  3FYZ A;  3IX3 A;  3O86 A;  4FH2 A;  1W63 Q;  2ZC3 B;  3JVU A;  1MKM A;  3IF6 C;  4UQI S;  3C4O A;  4GJ4 A;  1U60 A;  3C5A A;  4BL3 A;  1S6R A;  2WGV A;  1F9I A;  1XX2 A;  1BT5 A;  4DJ2 A;  1T1B A;  3T4J A;  4OOY A;  1IFQ A;  1LI9 A;  3UPO A;  3MFX A;  4XT2 B;  4NG2 A;  5U47 A;  2I9V A;  4DJ3 A;  4H8R A;  2K7S A;  2J8Y A;  2ZC5 B;  4F94 A;  3GV9 A;  1IEM A;  2VV6 A;  1PNE A;  1ES3 A;  1TDG A;  3WS0 A;  3RTY A;  4E6X A;  5G18 A;  4LRX C;  1C3B A;  3E4P A;  3D72 A;  4LGW A;  3N8R A;  4O01 A;  4CLC A;  4JGQ A;  1N9N A;  1XKZ A;  2XRN A;  3EWK A;  3LI9 A;  5HZH A;  1IKG A;  4E3K A;  1WA9 A;  3N6I A;  4HH2 A;  1W5D A;  3MXS A;  3IT9 A;  1GSV A;  3BFF A;  3MZD A;  4JKT A;  4S2O A;  3K2N A;  4HBU A;  1L0G A;  2K31 A;  1QMF A;  1SCW A;  3BLM A;  5DKL A;  4PMA A;  5EVL A;  3QP6 A;  2PBD P;  4EV4 A;  4O8G A;  2HDR A;  2Y8H A;  2D01 A;  1K38 A;  3LI8 A;  1PZO A;  1JTD A;  2JBF A;  3SS3 A;  5L09 A;  1PWD A;  3G2Z A;  2JN7 A;  3CWF A;  4CPK A;  2BG1 A;  5AQB A;  2A24 B;  5HL6 A;  3S7N A;  1ONG A;  4I3I A;  2PDR A;  1W8Q A;  5CHM A;  4L9G A;  4E3N A;  3MZE A;  3F1O B;  1KE3 A;  5EEC A;  3W4O A;  5KIZ A;  4MN6 A;  5M19 A;  5F82 A;  3Q81 A;  3HLW A;  4ID4 A;  1SDN A;  2V8C A;  3VP0 A;  1YLJ A;  3FG8 A;  1CQA A;  4OVD A;  1OJ5 A;  5IS1 A;  5G4Z A;  1BTL A;  3DTI A;  4ETX A;  3VSL A;  1YPR A;  1ZKJ A;  4OLG A;  4JLF A;  2G2U A;  5EE8 A;  2XD5 A;  1BUL A;  4DDS A;  4WEK A;  1P0Z A;  1M40 A;  2WUQ A;  2I72 A;  1PW1 A;  1TS6 A;  4ETZ A;  1ZC2 A;  2Y2L A;  5FI6 A;  3VOL A;  2Z2M B;  1CJF A;  1WYB A;  3SH7 A;  5CGS A;  3BFC A;  1Y28 A;  2VX8 A;  2WKH A;  3T4Q A;  3HJI A;  1PWC A;  2XA7 M;  4E3J A;  4EW7 A;  2B95 A;  3SW1 A;  4Y2F A;  3CLO A;  2Z6C A;  2WZZ A;  1SKO A;  3AGE A;  4M3K A;  2M7V A;  4OOL A;  3GRJ A;  1ES5 A;  2HGV A;  2P9V A;  1QME A;  5JYO A;  1JWV A;  2EXB A;  5HX9 A;  4HES A;  3DBA A;  1JNU A;  4N92 A;  3T4O A;  4PM7 A;  2ZD8 A;  4DRT A;  4HJ3 A;  2PYR A;  3Q7Z A;  3NY4 A;  2QJ7 A;  1DJA A;  4KZ6 A;  3S7Q A;  4WMC A;  2A49 A;  2ZOH A;  1LL5 A;  4Y0O A;  3OPH A;  3ZG9 B;  4G3W A;  3QP4 A;  2O0Y A;  1VB6 A;  5HWT A;  2WKE A;  5HFO A;  1PI5 A;  1LSW A;  3MF0 A;  5AVE A;  1MWT A;  3BY9 A;  3PBO A;  4IUK A;  2JE5 A;  5EVI D;  2Z6D A;  3KSG A;  4MCW A;  4BMW A;  5HAQ A;  2Q9N A;  2QMI A;  4DKI A;  3C38 A;  1K4F A;  1XA1 A;  1GHI A;  5A91 A;  4ZRR A;  4FUW A;  1GSW A;  3IWO A;  3I7J A;  2AVX A;  1ES4 A;  5CER A;  2Y79 A;  3IXD A;  2ZOI A;  1YM1 A;  4EXO A;  5A93 A;  2HDS A;  1Z09 A;  1PZP A; 
#chains in the Genus database with same CATH homology
 5GLA A;  3OPL A;  4UAA A;  1GCE A;  2X01 A;  1K4E A;  4K91 A;  5FAQ A;  4S2N C;  1NRF A;  3UPP A;  4N1H A;  4KZ8 A;  1L0D A;  5GHX A;  4RA7 A;  4X55 A;  3WS5 A;  5DF8 A;  4PPR A;  2WGW B;  2WZX A;  1FOF A;  4XUZ A;  4BL2 A;  1KE0 A;  1G6A A;  2VGJ A;  3N7W A;  1AXB A;  3GQZ A;  1FCO A;  3HUM A;  5EPH A;  3E2K A;  1ESI A;  1SDE A;  4RX3 A;  1FQG A;  2EX6 A;  1H8Z A;  1CI8 A;  3P09 A;  4PM9 A;  3ZHH A;  4JXS A;  2WAF A;  3VMA A;  2XFS A;  4NK3 A;  1K57 C;  3IH9 A;  1BLS A;  4LCL A;  2HPB A;  3M6H A;  4MBF A;  4E6W A;  3BFG A;  5FI2 A;  5I94 A;  1YMS A;  3TOI A;  5DTT A;  1MPL A;  2WAD A;  4KG6 A;  1XXM A;  2Z2L B;  5CGW A;  1XPB A;  1Y54 A;  1VQQ A;  2XR0 A;  4IVI A;  4S2L A;  2WGW A;  4WZ5 A;  3S22 A;  3O87 A;  3ZCZ A;  1IYS A;  4S2M A;  1KVL A;  2OSU A;  4Y0T A;  1K25 A;  2Y2P A;  2R9X A;  3IXB A;  3A3I A;  4OLD A;  3IF6 A;  3M2K A;  4JF6 A;  4ZAM A;  2BLS A;  4N9L A;  3ZGA B;  5FAO A;  2B5R A;  1NJ4 A;  1NYY A;  3ZDJ A;  1H5X A;  3OPP A;  1KGE A;  3ISG A;  2H0T A;  3VFF A;  5CEB A;  2PBY A;  2WK0 A;  3MBZ A;  3NDG A;  3PBS A;  3VP4 A;  1FCM A;  5AQ9 A;  5FQJ A;  1HZO A;  1YT4 A;  1ERQ A;  5AQA A;  5DF7 A;  1O7E A;  3C7U A;  4R3J A;  2EFU A;  3HBR A;  2EFX A;  1K54 A;  2OLU A;  3PBN A;  1RP5 A;  3DTM A;  1K6S A;  5EUA A;  4BLM A;  3HUO A;  4B88 A;  3IQA A;  3BM6 A;  4E3O A;  4GD8 A;  3GSG A;  1YLZ A;  1ZG4 A;  1BLC A;  4FD8 A;  3SH8 A;  3FKV A;  4GN2 A;  2XEP A;  1BLP A;  3LY3 A;  3WS4 A;  5E2F A;  5EVI A;  1E3U A;  3MFD A;  1XGJ A;  1EWZ A;  1KVM A;  3UE1 A;  4E3L A;  3WS2 A;  4BEN A;  2XK1 A;  4P0M A;  3Q82 A;  3UNW A;  2J9O A;  3OZH A;  1FSY A;  4MLL A;  4EBL A;  3ZFZ A;  3IF5 A;  4N9K A;  4PM8 A;  3LY4 A;  3N8S A;  1H8Y A;  4XUX A;  5GLB A;  4B4X A;  2EX9 A;  3V39 A;  1ES2 A;  5TR7 A;  4A5R A;  4LEN A;  2XF3 A;  4P85 A;  3WWX A;  2OLV A;  4EUZ A;  4K0W A;  3RXX A;  4CJN A;  3HLG A;  4OPR A;  3Q7V B;  3DW0 A;  1ALQ A;  3G32 A;  4OOM A;  4QB8 A;  5TFQ A;  2C6W B;  1PI4 A;  4R1G A;  2ZC6 B;  4IED A;  3NI9 A;  1PIO A;  5FQ9 A;  3G30 A;  3N8L A;  2HDU A;  2VGK A;  2ZM2 A;  4GZB A;  1MBL A;  4DDY A;  4JBF A;  3E2L A;  5CEC A;  3VP3 A;  2Y2J A;  3MKF A;  3RXW A;  5KZH A;  4D2O A;  2WKI A;  3IXG A;  1E3U D;  4Y7P A;  4HBT A;  3ZVT A;  2JC7 A;  5CHJ A;  4KZ4 A;  3LCE A;  5IHV A;  4S2I A;  4DXC A;  2IWD A;  1LL9 A;  4OP5 A;  2EXA A;  5CED A;  4NET A;  3FYZ A;  5CXW A;  2EX2 A;  5FQK A;  3O86 A;  4FH2 A;  5DVA A;  3S4X A;  2ZC3 B;  3HLD A;  1NZO A;  1MWS A;  2ZQ8 A;  4OPY A;  5M1A A;  3IF6 C;  3C4O A;  3HLC A;  4R4S A;  1YLT A;  3W8K A;  4RYE A;  1YMX A;  1U60 A;  3C5A A;  4BL3 A;  3SOI A;  1S6R A;  4QD4 A;  4JXW A;  3CJM A;  5A92 A;  1ERM A;  1HTZ A;  1G68 A;  1M6K A;  3WRT A;  1W79 A;  1HVB A;  2H0Y A;  1PW8 A;  4GDN A;  1Q2P A;  2WGV A;  1VM1 A;  1XX2 A;  4N1X A;  1BT5 A;  1NY0 A;  5GL9 A;  3UE3 A;  3PTE A;  4IVK A;  3WS1 A;  1BUE A;  3ITA A;  4DE2 A;  3OC2 A;  1NYM A;  2G2W A;  4OOY A;  4GB7 A;  1LI9 A;  4QJG A;  3ZG7 B;  2ZMA A;  4JF4 A;  2ZQA A;  3NC8 A;  5CTN A;  4EQI A;  3MZF A;  1W8Y A;  2QPN A;  3UPO A;  3IWQ A;  2Y2I A;  1DY6 A;  1PYY A;  2CC1 A;  2XQZ A;  5AQ7 A;  3G2Y A;  4E3M A;  4X53 A;  5U47 A;  4XXR A;  3UDF A;  4ZJ3 A;  5EVI C;  4H8R A;  1RGY A;  3IHA A;  4UHU A;  3D4F A;  1JWZ A;  2J8Y A;  2ZC5 B;  5TGF A;  4Y0U A;  1L0F A;  2X02 A;  4F94 A;  1LLB A;  1NXY A;  1ESU A;  4X6T A;  4K0X A;  3GV9 A;  2Y2H A;  3DWK A;  3IH8 A;  3IXH A;  1IEM A;  4IBX A;  4WYY A;  1CK3 A;  1BSG A;  1ERO A;  4RX2 A;  1ES3 A;  1TVF A;  1Z6F A;  3O3V A;  3PBR A;  1TDG A;  1FR1 A;  2IWC A;  1ZG6 A;  5CRF A;  3CG5 A;  4UA9 A;  3WS0 A;  4ZDX A;  4OON A;  5E43 A;  4KZB A;  3WRZ A;  4E6X A;  5G18 A;  3UY6 A;  1C3B A;  4X69 A;  3C4P A;  2EX8 A;  3N8R A;  1K56 A;  4OKP A;  3EQV A;  1MKI A;  1Q2Q A;  2WYX A;  5EOE A;  1K55 C;  2Y2O A;  4BQM A;  4OQG A;  3A3J A;  4ZJ2 A;  1MY8 A;  5D3O A;  2FFF B;  1XKZ A;  4X56 A;  1LHY A;  4GOG A;  4KEN B;  3NIA A;  1IKI A;  5CGX A;  3ZVW A;  1IKG A;  4UA6 A;  1PWG A;  1EI5 A;  2J9P A;  4E3K A;  3V3S A;  5DF9 A;  3LO7 A;  3N6I A;  2Y55 A;  3BEC A;  2Q9M A;  4GDB A;  1W5D A;  2XGN A;  1K57 A;  3IT9 A;  3MXS A;  3BFF A;  3MZD A;  4JKT A;  4S2O A;  1HD8 A;  4HBU A;  2ZQ9 A;  1L0G A;  4QY5 A;  1QMF A;  1SCW A;  3BLM A;  3PAG A;  4GNU A;  5J8X A;  4PM6 A;  2WGI A;  4PMA A;  3G4P A;  5EVL A;  1K56 D;  4B4Z A;  3BEB A;  5HAI A;  3UPN A;  5FI7 A;  3P98 A;  2H10 A;  1I2W A;  4EV4 A;  4DE1 A;  4EBP A;  3NBL A;  2HDR A;  1FCN A;  2Y4A A;  2IWB A;  3NCK A;  3BLS A;  3UN7 A;  1K38 A;  2PU4 A;  4S2P A;  3AGD A;  3HUN A;  3SS3 A;  1PZO A;  1JTD A;  2JBF A;  2XD1 A;  3ZG0 A;  1PWD A;  2E8I A;  2R9W A;  2XLN A;  2ZQ7 A;  3G2Z A;  3HRE A;  3FWL A;  3Q1F A;  3Q7V A;  4DF6 A;  4CPK A;  5EOO A;  2BG1 A;  5AQB A;  4Z9Q A;  3VP1 A;  5DTS A;  4O7D A;  1XA7 A;  4ZTK A;  1YQS A;  3SS5 A;  3SH9 A;  4P87 A;  1ONG A;  1E25 A;  1E4D A;  1N4O A;  4U3T A;  3EQU A;  1W8Q A;  5CHM A;  5E2E A;  3ZG5 A;  3V5M A;  4WZ5 C;  5FQM A;  4GD6 A;  4E3N A;  2ZLY A;  2FFY A;  3MZE A;  4KG5 A;  4KQR A;  3BFD A;  1KE3 A;  4QU3 A;  5EEC A;  3G31 A;  4HEF A;  2UWX A;  3HLF A;  5HAR A;  5HAP A;  4LCM A;  4LV0 A;  3W4O A;  4C75 A;  2DNS A;  3UE0 A;  4YIN A;  4FH4 A;  2ZJ9 A;  5M19 A;  4OQ0 A;  3Q81 A;  5F82 A;  2Y59 A;  3HLW A;  4ID4 A;  4BD1 A;  5KSH A;  1O07 A;  1SDN A;  1BZA A;  4MBH A;  3BRM A;  5GHY A;  1OME A;  5GLC A;  2ZQD A;  4JF5 A;  3V3R A;  1SHV A;  1YLJ A;  3VP0 A;  4C6Y A;  3V50 A;  3W4Q A;  4LV3 A;  3LEZ A;  1CEF A;  4KG2 A;  2ZQC A;  3OCL A;  4OVD A;  3VOZ A;  3OCN A;  3MXR A;  4LV1 A;  3GMW A;  3ZG8 B;  4EWF A;  2XDM A;  3OPR A;  1K54 C;  2DCF A;  5F1G A;  2C5W B;  1BTL A;  1TDL A;  5KSC A;  2ZM0 A;  3VSL A;  1ZKJ A;  3BYD A;  4OLG A;  4JLF A;  4MNR A;  1KGG A;  2Y2K A;  4DE3 A;  3GR2 A;  3ITB A;  1L2S A;  3QNC A;  2JCH A;  1IYP A;  1NZU A;  2G2U A;  4WEJ A;  5EE8 A;  2XD5 A;  1BUL A;  2XH9 A;  1XGI A;  1L0E A;  1KE4 A;  1WYC A;  3NDE A;  4IBR A;  4WEK A;  5FDH A;  4ZBE A;  4DDS A;  2X71 A;  5DTK A;  1M40 A;  5HL1 A;  1S0W A;  5GHZ A;  2WUQ A;  5F83 A;  2I72 A;  2Y2G A;  1GHP A;  1PW1 A;  2OV5 A;  3S1Y A;  3ZNY A;  1ZC2 A;  2Y2L A;  2Y2M A;  5FI6 A;  2Z2M B;  3IF6 B;  1RCJ A;  4UA7 A;  1KDS A;  1IYO A;  4WEL A;  1XP4 A;  1YLP A;  3W4P A;  3HLB A;  1WYB A;  3SH7 A;  3A3D A;  3UDI A;  3RJU A;  4R23 A;  5CGS A;  3BFC A;  4KZA A;  4R0Q A;  4C3Q A;  4MBK A;  3CZD A;  2P9V B;  3G34 A;  2WKH A;  5BOH A;  1PWC A;  3VOY A;  4R4R A;  1JWP A;  3FZC A;  4E3J A;  3A3F A;  4QHC A;  3IHB A;  4WM9 A;  1GA9 A;  2GDN A;  1IYQ A;  5KMW A;  2WZZ A;  3HLE A;  2QZ6 A;  4BJP A;  1JTG A;  5FQI A;  2RL3 A;  3VSK A;  2HP6 A;  2ZC4 B;  3AGE A;  4M3K A;  3TSG A;  4E3I A;  3IWI A;  4OOL A;  3M2J A;  3QHY A;  5FQQ A;  3GRJ A;  1BLH A;  4OPZ A;  2Y2Q A;  1ES5 A;  5E2G A;  2P9V A;  1QME A;  5JYO A;  4KQO A;  4S2N A;  3VFH A;  1JWV A;  2WAE A;  3M6B A;  2EXB A;  5HX9 A;  3UO9 A;  1I2S A;  5HW3 A;  5EVI B;  3AGF A;  4HES A;  5FSR A;  4N92 A;  1DJC A;  3O88 A;  5L2F A;  4PM7 A;  1W7F A;  1FR6 A;  4JXV A;  5FAP A;  2ZD8 A;  4DRT A;  5M18 A;  4U0T A;  4KZ5 A;  4ZJ1 A;  3JYI A;  5F1F A;  3Q7Z A;  3GTC A;  4OP8 A;  4PM5 A;  4S2K A;  3NY4 A;  1CI9 A;  4P6B A;  3TG9 A;  2V20 A;  4KZ6 A;  1DJA A;  4YFM A;  4L0L A;  4JPM A;  2A3U A;  4OPQ A;  3DWZ A;  4OQH A;  3CMZ A;  2RCX A;  3B3X A;  5A90 A;  1DJB A;  5GLD A;  4WMC A;  2PU2 A;  4GKU A;  2A49 A;  3SS4 A;  5FA7 A;  4FSF A;  1MWR A;  4OH0 A;  1LL5 A;  1KDW A;  1IEL A;  5CHU A;  1WE4 A;  3GVB A;  5FAS A;  1J9M A;  4FCF A;  4Y0O A;  2XFT A;  3OPH A;  2Y2N A;  3ZG9 B;  1KGF A;  3MKE A;  3HL9 A;  1I5Q A;  2ZM8 A;  4JXG A;  2P74 A;  1YLW A;  1LI0 A;  2WKE A;  2HDQ A;  1N9B A;  4WBG A;  5HFO A;  1PI5 A;  3ZNT A;  3QNB A;  2HP5 A;  3FKW A;  1TEM A;  3UDX A;  1MWT A;  2DRW A;  1RGZ A;  3VP2 A;  2H5S A;  3PBO A;  4OQI A;  5E2H A;  1GA0 A;  1FSW A;  3HVF A;  4U0X A;  4KQQ A;  2JE5 A;  3A3E A;  1JVJ A;  5EVI D;  1SKF A;  4WMC D;  4DXB A;  1CEG A;  4LV2 A;  3Q07 A;  4S2J A;  1K55 A;  4BD0 A;  1GHM A;  5HAQ A;  4X68 A;  2Q9N A;  5CTM A;  2QMI A;  4DKI A;  1YLY A;  4QY6 A;  3N4I A;  1K4F A;  2V2F F;  4RVA A;  1XA1 A;  4EBN A;  1GHI A;  5A91 A;  2ZC7 A;  2V1Z A;  2HP9 A;  5FAT A;  2J7V A;  4Q8I A;  3PAE A;  3PBT A;  3IWO A;  4R3B A;  3C7V A;  3I7J A;  3G35 A;  1ES4 A;  2Y91 A;  3PBQ A;  4WZ4 A;  1MXO A;  5CER A;  4KZ7 A;  1ONH A;  3BFE A;  3IXD A;  1MWU A;  1YM1 A;  5A93 A;  4MEZ A;  4DE0 A;  5JYP A;  2HDS A;  4KZ3 A;  3FV7 A;  1PZP A;  1K6R A;  4KZ9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...