4FH2A

Structure of s70c beta-lactamase bound to sulbactam
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
265
structure length
265
Chain Sequence
SPQPLEQIKLSESQLSGRVGMIEMDLASGRTLTAWRADERFPMMCTFKVVLCGAVLARVDAGDEQLERKIHYRQQDLVDYSPVSEKHLADGMTVGELCAAAITMSDNSAANLLLATVGGPAGLTAFLRQIGDNVTRLDRWETELNEALPGDARDTTTPASMAATLRKLLTSQRLSARSQRQLLQWMVDDRVAGPLIRSVLPAGWFIADKTGAGERGARGIVALLGPNNKAERIVVIYLRDTPASMAERNQQIAGIGAALIEHWQR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactamase SHV-1
publication title Crystal structure of a pre-acylation complex of the beta-lactamase inhibitor, sulbactam, bound to a sulfenamide bond containing thiol-beta-lactamase
pubmed doi rcsb
source organism Klebsiella pneumoniae
molecule tags Hydrolase/hydrolase inhibitor
total genus 96
structure length 265
sequence length 265
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2012-06-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 4fh2A00
3ZNYA 4CPKA 1L0EA 4M3KA 1KDWA 2Y59A 3P98A 3V3SA 1EWZA 2XEPA 1PWDA 2FFFB 2VGJA 3ZG8B 3HUOA 1QMFA 3HLFA 1YQSA 1S0WA 4KZ3A 3LEZA 4UA7A 5CERA 3GVBA 1XA7A 5CGXA 3UO9A 3PBQA 4JF6A 1W7FA 1WYBA 4KG2A 3C7UA 4KZ5A 4RX3A 1I2WA 2EFXA 4FH2A 4MNRA 4OOYA 3ZNTA 5FQMA 4QB8A 3SH7A 3ZG9B 3C4PA 5FSRA 1GCEA 3G4PA 4R1GA 3RXWA 2RCXA 3SOIA 3Q7VA 2XH9A 1I5QA 5HAIA 1L0GA 1H8YA 3HLWA 5GL9A 1J9MA 3WS4A 3BRMA 4R3JA 4F94A 3HLDA 4N92A 1NY0A 1BLHA 4WEJA 4JBFA 4A5RA 4E3MA 5HAPA 4ZDXA 2R9WA 5A93A 2WAFA 3A3FA 5HX9A 3M6BA 3OPLA 4QHCA 3WWXA 4EQIA 4MLLA 4QJGA 1W8QA 1CEFA 3O3VA 1MKIA 3MZFA 5CGSA 5CHMA 3HUMA 3B3XA 1SKFA 2XR0A 3PBSA 5FQKA 1BT5A 1DJBA 4GOGA 4IVIA 4X55A 4XUZA 3VP3A 2P9VB 1H5XA 5EUAA 4OQIA 5EPHA 5D3OA 5FASA 2WGWA 4BD0A 4IBXA 2XLNA 2X01A 4KENB 3ITAA 5AQ9A 3NI9A 1JWZA 3N6IA 3UNWA 1W79A 4BJPA 2Y2OA 2XFSA 3DW0A 4S2NC 2XK1A 5EVIB 2XFTA 3ZDJA 3QNBA 3VFFA 1VQQA 4DKIA 4JKTA 1OMEA 4DRTA 1HTZA 4HESA 4CJNA 3NY4A 1N9BA 3PBTA 4P0MA 3G35A 2HDSA 2ZJ9A 2C6WB 1HD8A 4OKPA 1O7EA 4WM9A 1AXBA 3BECA 2WZXA 5FAPA 3DTMA 3IHAA 3SS3A 1MXOA 3LO7A 3VSKA 3UE1A 5CECA 4KZAA 4ZTKA 5FATA 3VOZA 4GB7A 4GZBA 1IYOA 3FYZA 5CTNA 2OV5A 4X53A 1KE4A 3ZVWA 2A3UA 2Y4AA 4FD8A 4DE0A 1N4OA 1XGIA 4B4XA 3UPOA 1XA1A 3IWQA 4YINA 4JF4A 4U3TA 1Q2QA 1MWUA 2XD1A 1CI8A 3V39A 4OQHA 5DTKA 2WK0A 1ES2A 4WYYA 4EUZA 5EOOA 4DDSA 5DTTA 3UN7A 4OOMA 1PWGA 4GDBA 4OH0A 3LY4A 1NRFA 4EBPA 1YLZA 5J8XA 4KQOA 4E3IA 5GLCA 1GHIA 3NC8A 4IBRA 1YLTA 5FQJA 1ERMA 1XGJA 1KE0A 4KZ6A 5CHUA 5FI7A 2RL3A 1IYSA 4QU3A 1IEMA 1ALQA 3QNCA 4X69A 5G18A 2EXAA 2Y2KA 4MBKA 4HBUA 1NZOA 2JCHA 5F83A 2WADA 5CHJA 3FWLA 2EX8A 1YMSA 3OZHA 3NCKA 2HP5A 5EVID 4X56A 1ERQA 2Y2QA 2H5SA 5FI2A 1H8ZA 5F1FA 4KZ9A 3IXBA 4EWFA 4PM6A 4ZJ3A 4E3JA 3AGEA 1DY6A 5EVIA 1BLSA 1W5DA 3GR2A 1ZC2A 3VOYA 3DWZA 4K0WA 1YLPA 2G2UA 3D4FA 2E8IA 1IKGA 3MKEA 5HL1A 1XPBA 2EX6A 1JWPA 2ZQCA 4E3NA 1BSGA 3MXSA 2I72A 1IYPA 1L0FA 5E2EA 1BLPA 3MZEA 3IWOA 4JLFA 2DRWA 4BQMA 2WGVA 3IXGA 1YLJA 3BM6A 3Q7ZA 2QZ6A 4OPRA 5F82A 2G2WA 4YFMA 5CTMA 3G30A 4WELA 3G2ZA 1LLBA 2Y2HA 2Y2NA 1Q2PA 3IF6A 3M2JA 3N8LA 4OPQA 5DF9A 1ES3A 4U0TA 2OLVA 5E2GA 4ZJ1A 1L0DA 4D2OA 2Y55A 1K4EA 5E2FA 2FFYA 3LY3A 4N1HA 4BL2A 4HEFA 5E2HA 1PWCA 3FKVA 3G34A 2ZC7A 1FOFA 3M2KA 2C5WB 2H10A 1RP5A 3MBZA 4KZ7A 1U60A 4S2KA 5KSCA 1K56D 3PBOA 4EBNA 1Y54A 3Q1FA 1JWVA 3EQUA 4FH4A 4H8RA 1K54A 2EFUA 4R3BA 2IWBA 5EE8A 1JTDA 2IWCA 1K6SA 1K56A 2CC1A 1E25A 4U0XA 1FSYA 3V3RA 3OPPA 3G2YA 1YT4A 2XDMA 4JXWA 3ZHHA 4WBGA 4K0XA 1G6AA 3OPHA 5IHVA 3WS0A 4OPZA 2R9XA 2PU4A 3TG9A 4Y0UA 4C6YA 4E6WA 5FAOA 1ONHA 3IH8A 2V20A 4GN2A 1FCOA 4KQRA 4N9LA 3N8SA 4BD1A 4DE3A 3HBRA 4QY6A 4DE1A 4ID4A 3N7WA 4RYEA 2IWDA 4LV3A 5AQBA 3UPNA 3ZGAB 1M6KA 1O07A 5CXWA 1CI9A 3ITBA 3UE0A 4OONA 4X6TA 4X68A 3HVFA 3ZG7B 3IXDA 1YM1A 1PI5A 3OC2A 5HW3A 4WZ5C 3ZG5A 2DNSA 4S2MA 2XD5A 5GHXA 5L2FA 3P09A 1ES4A 2VGKA 4NK3A 1HZOA 4DXCA 5I94A 4EV4A 1L2SA 3UDFA 5HFOA 2EX2A 4OLDA 5A92A 2WZZA 3IXHA 1K57C 2Y2GA 4S2OA 3V5MA 3FZCA 2WKEA 2J9OA 4UAAA 3AGDA 3S22A 3GMWA 4KZBA 5GHZA 4Q8IA 3UPPA 1BLCA 1PZPA 3BEBA 4JXSA 4KG6A 4GD8A 4PM5A 2V2FF 4JXVA 4JXGA 3MXRA 3HREA 5FQQA 3HUNA 5TR7A 1S6RA 2V1ZA 3SS5A 1WYCA 1Z6FA 1FQGA 2J7VA 4P85A 1KGGA 3W8KA 4K91A 3ZCZA 2HPBA 2EX9A 2ZM8A 3N4IA 5M1AA 2WYXA 2Q9NA 3UDXA 1LL9A 2ZQDA 4S2NA 4LV1A 4OQ0A 2BG1A 2PBYA 3QHYA 4JF5A 4PPRA 1K4FA 4IEDA 1PZOA 2J8YA 5EOEA 3VP1A 1K6RA 2P9VA 3UDIA 4QY5A 1I2SA 1TDLA 3WRZA 2PU2A 4LCLA 5JYPA 1ESUA 4RA7A 2H0TA 4HBTA 1IYQA 1KE3A 2XGNA 3BFDA 4FSFA 1NZUA 3JYIA 1QMEA 1GA0A 4GD6A 4GKUA 4S2IA 4DDYA 4OPYA 5FI6A 2Z2LB 2ZC4B 4XUXA 2Y91A 3PAEA 3IF6C 3HLCA 3C7VA 3GQZA 4KZ8A 3AGFA 2X02A 4OLGA 2Y2MA 4S2PA 1E3UD 5FQ9A 2ZC5B 1ONGA 1PIOA 3C4OA 2Y2LA 4RX2A 3A3EA 2WGWB 2ZM0A 3M6HA 4QD4A 5DVAA 5E43A 4GNUA 3W4OA 1XKZA 3MZDA 4DE2A 2EXBA 2Z2MB 1K25A 1FR6A 3HLEA 3N8RA 3BFFA 2Y2PA 1LI9A 4MBFA 4KQQA 5TGFA 1IKIA 2BLSA 5DTSA 5U47A 1G68A 5FDHA 5JYOA 4PM9A 2ZC6B 1BUEA 3E2LA 2QPNA 1ZG6A 2H0YA 4E6XA 3PAGA 3ISGA 4EBLA 1YLYA 3SH8A 4UA6A 1IELA 2P74A 4DF6A 4MBHA 3RXXA 3DWKA 5FAQA 1TEMA 1PW8A 3BLSA 3E2KA 1LL5A 4UHUA 4LV0A 3SS4A 1K55A 2ZC3B 3LCEA 3PTEA 4S2LA 2HP6A 1PYYA 5FQIA 3O88A 4R4RA 1K38A 1VM1A 5EECA 4GDNA 5M19A 3HL9A 1MWRA 1YLWA 3IHBA 4UA9A 5KZHA 5HAQA 1JVJA 3VP4A 2ZD8A 3MKFA 1SHVA 4KZ4A 4OP5A 3C5AA 3TSGA 4R23A 4BENA 1ZG4A 3BLMA 2WUQA 1YMXA 4L0LA 2Q9MA 3HLBA 3SH9A 4E3OA 2XQZA 3RJUA 4LV2A 4R4SA 4OOLA 4BLMA 2UWXA 2JC7A 3A3JA 4WMCD 5F1GA 1GA9A 3CMZA 3WS1A 4E3KA 3BFEA 2ZQ8A 3IWIA 1FCMA 4Z9QA 3BYDA 3BFCA 1DJAA 4E3LA 3GV9A 5CEDA 3NDGA 2HDRA 1TDGA 5HARA 5BOHA 4WMCA 3VMAA 1XP4A 3S1YA 3W4PA 4C75A 1M40A 1RCJA 2WAEA 2ZLYA 3ZVTA 1CK3A 3W4QA 3PBNA 3IF5A 4JPMA 2J9PA 3CZDA 3G32A 5KSHA 1NXYA 3VP0A 4C3QA 1W8YA 3CJMA 4ZBEA 1HVBA 1FSWA 1PW1A 3GTCA 2ZQ7A 2OLUA 4N9KA 1WE4A 5GLDA 4WZ4A 1MWSA 4NETA 4ZJ2A 3TOIA 4B4ZA 1KGEA 4LENA 4BL3A 1SCWA 5KMWA 3NIAA 3IQAA 3UE3A 4RVAA 2WKIA 5CGWA 3NBLA 5CEBA 3A3DA 1MPLA 2QMIA 4LCMA 3OCNA 1BTLA 1ZKJA 1LI0A 2DCFA 4KG5A 5DF8A 4B88A 1BULA 1DJCA 3FV7A 1EI5A 3A3IA 4XXRA 1RGZA 3HLGA 4OVDA 3EQVA 4S2JA 1JTGA 2WGIA 3GRJA 3O86A 5EVIC 2ZMAA 1NYMA 5A91A 4O7DA 3O87A 3UY6A 4Y7PA 1NYYA 3IT9A 1KVLA 3ZFZA 4OP8A 1FR1A 3OPRA 5AQ7A 3FKWA 3Q82A 3WS5A 4PMAA 2B5RA 3CG5A 1MWTA 2HP9A 3IF6B 2ZQ9A 1E4DA 1KDSA 3Q7VB 1KVMA 3MFDA 3OCLA 1TVFA 3Q81A 4MEZA 2OSUA 4DXBA 4P6BA 1ESIA 1XX2A 4N1XA 3VSLA 2HDQA 4IVKA 5FA7A 3GSGA 4WZ5A 1XXMA 2JE5A 1MBLA 1KGFA 2HDUA 4WEKA 3VFHA 4OQGA 4ZAMA 3V50A 2Y2IA 2ZM2A 3WRTA 4R0QA 2X71A 2WKHA 3I7JA 1GHMA 2XF3A 2GDNA 1BZAA 1FCNA 1K57A 4PM8A 3S4XA 1RGYA 5A90A 3G31A 5CRFA 3BFGA 1SDNA 4P87A 4Y0TA 1CEGA 3ZG0A 5GLBA 1LHYA 2Y2JA 1SDEA 1K55C 3NDEA 1NJ4A 4PM7A 5AQAA 5DF7A 3Q07A 5EVLA 1C3BA 3IH9A 3VP2A 1EROA 5GLAA 1PI4A 1E3UA 1ES5A 1K54C 4Y0OA 1GHPA 5M18A 5GHYA 3PBRA 5TFQA 3WS2A 2JBFA 2ZQAA 1MY8A 4FCFA 2A49A
chains in the Genus database with same CATH superfamily
4CPKA 1L0EA 4M3KA 2Y59A 3V3SA 1EWZA 4O01A 3KYQA 2VK3A 4CLCE 1ACFA 5FDSA 3GVBA 2HZ5A 2W3DA 3ZNTA 5FQMA 1J3WA 4LRZE 1GCEA 3G4PA 3SOIA 5HL6A 2XH9A 5HAIA 2GX5A 2OAP1 3HLDA 3LR5A 1NY0A 4E3MA 1NLYA 1YSQA 3MZFA 5AVEA 3KYZA 1BT5A 4IVIA 2WKPA 4HQAA 1H5XA 4IBXA 2X01A 4KENB 5AQ9A 3C30A 4BJPA 4UQIS 3MQOA 3DW0A 1MZUA 2XK1A 2XA7S 5EVIB 3MJQA 5G4YA 1NWZA 4DKIA 3NY4A 3C8CA 2FZ0A 3PHYA 4P0MA 2ZJ9A 4LLOB 3BECA 2WZXA 5FAPA 4Y17A 4GJ4A 3T4SA 2A3UA 4DE0A 2NUPC 3LEQA 3T4KA 3UPOA 1XA1A 2Z6CA 3IWQA 4YINA 2D02A 2JKRI 1Q2QA 2W1RA 4OQHA 3A0RA 2WK0A 5DTKA 3EEAA 3E0YA 3UN7A 3EGDC 4EBPA 1IFQA 4KQOA 4PAUA 3NC8A 1YKDA 2PYPA 4WLAA 5FI7A 1V9ZA 1FIKA 3RTYA 1IYSA 3FPVA 5L10A 1P97A 2HP5A 2QWSA 3NCKA 4X56A 1ERQA 2H5SA 1OTBA 4KZ9A 3IXBA 4DJ2A 3UB6A 2MJ6A 3LI9A 2PRFA 4K0WA 4LFUA 5K5BA 1YLPA 1XPBA 2EX6A 2ZQCA 2B18A 3MXSA 4HOIA 1BLPA 5DFYA 3B42A 5F82A 2VA0A 2OAQ1 1N9NA 1FILA 3G30A 3IF6A 3NHQA 3EEHA 1L0DA 2Y55A 5E2FA 3LY3A 3T4TA 3B33A 2J3TD 1YAXA 3SZTA 3H82A 4S2KA 1U60A 3Q1FA 4H8RA 2L4RA 2EFUA 1JTDA 1K6SA 2CC1A 1FSYA 1XJ4A 1T1BA 1OTAA 5IHVA 1Z09A 4OPZA 4C6YA 3TG9A 4GN2A 1FCOA 1CF0A 3N8SA 4DE3A 3HBRA 4EXOA 2IWDA 5AQBA 3UPNA 1O07A 1DRMA 3NOUC 3ITBA 3BQ8A 4OONA 3HVFA 1YM1A 4WZ5C 3ZG5A 2GNXA 5HSQA 5GHXA 3MQQA 3VE3A 1ES4A 4GHIA 2KX6A 2NUTC 4EESA 5HPFA 1K57C 3R7WB 2Y2GA 3V5MA 3FZCA 4UAAA 3GMWA 4KG6A 4GD8A 4PM5A 2V2FF 4JXGA 3HREA 3B47A 3P7NA 1FQGA 4P85A 3T4QA 2ZM8A 5M1AA 2M1CA 3QHYA 4JF5A 5EOEA 2P9VA 4XT2B 4QY5A 4LCLA 1ESUA 4BBVA 3BFDA 4FSFA 3K2NA 1GA0A 3E4PA 4S2IA 4CLCD 4GS9A 4DMZA 3GQZA 4KZ8A 2Y2MA 3BY9A 1PIOA 2ZM0A 4KQDA 3MZDA 3BFFA 2W1TA 2Y2PA 5L07A 5TGFA 5DTSA 1PRQA 1BUEA 2QPNA 2W3FA 2VGLS 3SH8A 2P74A 4MBHA 3JVUA 3TW8A 4UHUA 4LV0A 3CLOA 1K55A 2ZC3B 2HP6A 5FQIA 4MN7A 4R4RA 1K38A 2ZOIA 4BWIA 1YLWA 4UA9A 4EEUA 2PAVP 4KZ4A 4OP5A 2YKFA 4R23A 1ZG4A 2PR5A 1YMXA 2E8JA 3HLBA 3SH9A 1L3LA 2XQZA 4BLMA 4OOLA 3A3JA 4WMCD 5F1GA 3WS1A 3EWKA 3KSFA 3D3OA 3IWIA 5CEDA 3F1PA 3VMAA 2K7SA 1CK3A 3FPWA 2KDKA 3VP0A 2VV6A 1HVBA 1PW1A 2Y79A 3GTCA 4HJ4A 5KIZA 2OLUA 4N9KA 3R4KA 4WZ4A 1MWSA 3CPTA 1P9RA 3NBLA 1MPLA 4LCMA 3OCNA 4KG5A 5DF8A 1DJCA 3A3IA 3EQVA 4Q0JA 2ZMAA 1NYMA 3ULFA 4B9OA 3UY6A 1KVLA 5AQ7A 4M4XA 3FC7A 3TRCA 3IF6B 2OWJA 2ZQ9A 3MMHA 1DP8A 3Q7VB 1KVMA 3MFDA 3OCLA 4II7A 2HDQA 5FA7A 3GSGA 4WZ5A 1MBLA 2HDUA 3U4LP 4OQGA 3V50A 1AWIA 4R0QA 2X71A 4Y2FA 1GHMA 2GJ3A 1BZAA 1K57A 5A90A 1F5MA 3BFGA 4Y0TA 1CEGA 4PM7A 2HJ9C 3W2ZA 1PFLA 5EVLA 2LB5A 1K54C 2J3TC 4NXFA 5TFQA 2A49A 4F3LA 3P98A 2XEPA 1PWDA 4GW9A 3LR4A 3ZG8B 1QMFA 4UA7A 5I5LA 3LIEA 4JGQA 3LIDA 4JF6A 1W7FA 4H6JB 4KG2A 3C7UA 2A24A 3SH7A 3UMEA 3RXWA 2RCXA 1L0GA 3LGOA 3F1OB 4JBFA 5HAPA 1GSWA 2D01A 3A3FA 1S1ZA 5F68A 5HX9A 3M6BA 4QHCA 4GCZA 4EQIA 4QJGA 1MKIA 3T1XA 2XR0A 1DJBA 2ACGA 4GOGA 4Q0HA 4X55A 4XUZA 2P9VB 5EPHA 5L09A 3HCYA 2WGWA 3N6IA 5EVEA 2XFSA 2PD7A 3ZDJA 2XFTA 3QNBA 1TS8A 3MXQA 1G5UA 4DRTA 4G3WA 4HESA 4LGWA 3CAXA 3G35A 2PHYA 2HDSA 3IX8A 2C6WB 1T1AA 1OPXA 1HD8A 1N9LA 5LBRA 3MQ0A 2B02A 3LO7A 5CECA 3UE1A 4KZAA 3IX4A 4ZTKA 3VOZA 4GB7A 3FYZA 5CTNA 4X53A 4L9EA 3ICYA 4CLCC 4EERA 2QHKA 3H7WB 4U3TA 4GLQA 1MWUA 1P9WA 4WYYA 1CJFA 4EUZA 1TS0A 1ZHHB 4OH0A 1YLZA 5J8XA 1TF1A 4FTXA 5GLCA 1GHIA 4I38A 5CHUA 3T4JA 4QU3A 1ALQA 5G18A 4MBKA 3FWLA 5EVID 3RFBA 4EWFA 4PM6A 4YWZA 3F1PB 1ZC2A 3VOYA 3D4FA 2E8IA 1IKGA 3D9YA 4FUWA 5HL1A 4EQ1A 2OOLA 4E3NA 1BSGA 3IS2A 2KLIA 1IYPA 5F5YA 3IWOA 4JLFA 3NJAA 4BQMA 3IXGA 1YLJA 3BW6A 3BM6A 2QZ6A 4OPRA 4YFMA 2Y2HA 5TJJA 1VHMA 2OLVA 3MR0A 2V0UA 4MN5A 1K4EA 4N1HA 5E2HA 1PWCA 3FKVA 3G34A 2ZC7A 1FOFA 4E04A 4NKPA 4EBNA 1JWVA 3EQUA 1K54A 3D72A 3EGXC 1E25A 3OBFA 1BYWA 4U0XA 3OPPA 3ZHHA 1G6AA 5F69A 2R9XA 2PU4A 4E6WA 4KUOA 5FAOA 1ONHA 3IH8A 4NXEA 3T50A 1G28A 4NEED 4N9LA 5DFXA 4KUKA 4DE1A 1F9IA 3UB9A 4RYEA 3ZGAB 5DKLA 2VZWA 4X68A 3ZG7B 3OC2A 3LIAA 2DNSA 4S2MA 2XD5A 3P09A 2VGKA 4NK3A 1VEUA 4DXCA 4EV4A 3UDFA 5HFOA 5A92A 4HI4A 4S2OA 3GDIA 2J9OA 3AGDA 3S22A 4KZBA 1BLCA 2V1BA 2P04A 2R78A 3HUNA 1D7EA 2V1ZA 5HD5A 1DP9A 1WYCA 3SS5A 2J7VA 2A24B 2W0NA 2EX9A 2WYXA 2HV1A 3UDXA 1LL9A 2ZQDA 2BG1A 4PPRA 1PZOA 1OJ5A 3QP8A 2ZL1A 4HY8A 3VV4A 4I3AA 4R38A 4ZRRA 5FI6A 5HDCA 2Y91A 3PAEA 4PKYA 2X02A 4CLCA 4L9GA 2ZC5B 1ONGA 3C4OA 4CQHA 4RX2A 3M6HA 2WGWB 4QD4A 5DVAA 1UGUA 1LT0A 3W4OA 1K25A 1FR6A 3LUQA 3N8RA 5DKKA 4MBFA 1IKIA 1XJ3A 4EW7A 1G68A 5HD3A 4B93A 4E6XA 1IELA 5FAQA 2GZAA 4JGOA 3LCEA 3UB5P 3O88A 2Z6DA 3HL9A 5HAQA 1JVJA 3VP4A 1STZA 3MKFA 1SHVA 3C5AA 3S7PA 2WUQA 4L0LA 2ZBBA 4O8GA 1MKMA 2M7UA 1VB6A 2HJEA 3CMZA 3GECA 4E3KA 3RH8B 2ZQ8A 4G3VA 3BYDA 2H28A 1TDGA 4WMCA 2W27A 3JVVA 4ARZA 2G7UA 3K3DA 3S1YA 4C75A 1RCJA 2WAEA 3QP4A 3ZVTA 3CZDA 1OTDA 3NOTC 4C3QA 4X1MA 4ETXA 5HZHA 2PYRA 1EW0A 2Q0OA 4NETA 3TOIA 4P6ZM 4LENA 4BL3A 5CGWA 5CEBA 3HJIA 4WUJA 2DCFA 3F1NA 3IS2B 4B88A 4WL9A 1IOUA 5EVIC 4Y7PA 3IT9A 5EM0A 2QJ7A 3OPRA 2HP9A 1KDSA 4LPZA 1SKOA 2KOIA 3MFXA 4P6BA 2XA7M 2XRNA 2V1AA 2JE5A 4NXBA 1S1YA 3VFHA 3WRTA 2V8CA 2XF3A 3S4XA 1W63M 3G31A 5CRFA 2OWHA 3ZG0A 2Y2JA 3HJKA 2VV8A 4X25A 3IH9A 5GLAA 1E3UA 1ES5A 4Y0OA 3P01A 2ZOHA 3LIFA 3S7QA 2FFFB 2VGJA 1H8MA 3CI6A 1OJGA 3UB7A 1S0WA 5IT5A 3LR0A 1XA7A 2HGVA 5CGXA 4HIAA 3UO9A 3PBQA 4I3IA 1I2WA 2EFXA 4MNRA 3LYXA 4QB8A 4HJ3A 2FH5A 2XROA 4R1GA 1NRJA 5GL9A 1J9MA 3SW1A 4N92A 4WEJA 1BLHA 4ZDXA 2R9WA 2WAFA 4MN6A 4MLLA 1W8QA 3O3VA 5CGSA 5CHMA 2O0YA 3VP3A 5EUAA 4OQIA 5FASA 2XLNA 3ITAA 3NI9A 1JWZA 3UNWA 1LSWA 3JPUA 5HWWA 3CHWP 4HP9A 1S4SA 4CJNA 3PBTA 5HPIA 3L9KA 1OTIA 4WM9A 1AXBA 1F2KA 1W63Q 3DTMA 3IHAA 4RQ9A 3SS3A 1MXOA 3VSKA 1IYOA 2OV5A 3ZVWA 1N4OA 1N9OA 5HWVA 4JF4A 2PD8A 4EU0A 3V39A 3UMDA 1ES2A 3QP2A 5EOOA 3H82B 4GDBA 3LY4A 1NRFA 1XJ6A 1G6OA 4BBTA 3T1SA 1YLTA 5FQJA 2JKGA 1XGJA 2JHEA 2HF6A 1KE0A 1P0ZA 4KZ6A 2RL3A 3O5YA 4EUVA 1IEMA 3QNCA 3UB8A 2Y2KA 1NZOA 2JCHA 2O99A 5CHJA 2EX8A 1YMSA 3OZHA 4L9FA 5FI2A 1H8ZA 4ZJ3A 4E3JA 5DJUA 1DY6A 5EVIA 3DWZA 2J80A 3PYPA 3K3CA 1JWPA 2M7VA 2I72A 1S67L 5E2EA 3MZEA 4GHIB 2DRWA 4HHDA 2WGVA 3G6OA 3A0SA 1NLZA 3G2ZA 1LLBA 1XJ2A 1Q2PA 3M2JA 3N8LA 3E4OA 3V67A 1ES3A 3OLOA 4D2OA 4BL2A 3M2KA 2H10A 3MBZA 4KZ7A 1K56D 4FH4A 4R3BA 5EE8A 4UEYA 4JXWA 4IUHA 4WBGA 4K0XA 3KYEA 2V20A 1LSXA 4GS9B 4ID4A 3N7WA 2W3GA 4LV3A 1CI9A 3S7OA 4X6TA 4QWOA 3MS6A 5L2FA 5EFWA 2V9AA 5A8BA 4PHTA 2W1TB 3IXHA 2INWA 4LRYC 5GHZA 2O9CA 1PZPA 2JN7A 4JXVA 3MXRA 3T12B 1GSXA 5TR7A 1S6RA 4DJ3A 1Z6FA 1KGGA 3W8KA 4K91A 2HPBA 3N4IA 5DJTA 2Q9NA 4OQ0A 2PBYA 4IEDA 2J8YA 3VP1A 3IBRA 3UDIA 4HP4A 4R70A 3WRZA 1TDLA 2J3WA 1VETA 2PU2A 5JYPA 3NOPC 2DMWA 1IYQA 2XGNA 3H9WA 1NZUA 3JYIA 4GD6A 4DDYA 2Z2LB 2ZC4B 4Y15A 3IF6C 2B95A 4OLGA 5FQ9A 3DTIA 2Y2LA 3CWFA 3QP1A 3ZYTA 5E43A 4GNUA 1D1JA 1XKZA 2VV7A 4DE2A 1T19A 3HLEA 2IA2A 3C2WA 1LI9A 4KQQA 3CPTB 3R7WA 3DBAA 5U47A 5FDHA 5JYOA 4PM9A 2H0YA 4EBLA 1YLYA 4UA6A 3FG8A 4IUKA 2I9VA 4DF6A 3RXXA 1TEMA 3BLSA 1LL5A 3SS4A 4NG2A 4YNRA 5CX7A 3PTEA 3C38A 1PYYA 1VM1A 5EECA 4GDNA 1MWRA 4Y5FA 5KZHA 2VKSA 2CMNA 4XT2A 1T18A 4BENA 4P6ZS 2WKRA 3BLMA 2EA9A 1K0KA 2Q9MA 4LV2A 3CITA 2V8FA 3BFEA 1FCMA 4Z9QA 4E3LA 3GV9A 3KSIA 3NDGA 2HDRA 5HDSA 2P08A 4QPRA 1LL8A 5J7EA 1TS6A 3W4PA 1M40A 2ZLYA 3IF5A 3G32A 5KSHA 1NXYA 1TD5A 1GSVA 2ZQ7A 3NECA 3QP6A 4B4ZA 1KGEA 3BQAA 1SCWA 1UWPX 3IQAA 3NIAA 5TBMA 3UE3A 4F3LB 1D06A 3A3DA 5AVFA 1ZKJA 1LI0A 5EV0A 5MC7A 3EOIA 3TJZC 1BULA 4XXRA 1RGZA 3HLGA 4IHQA 3O86A 2JKTI 4O7DA 1ZTUA 4OP8A 1FR1A 3FKWA 5G4ZA 3E4QA 3TE8A 4PMAA 2B5RA 1MWTA 1TVFA 3LICA 2OSUA 3VSLA 1XX2A 4ZAMA 2ZM2A 1H0MA 3I7JA 4LRXC 2GDNA 4PM8A 1MC0A 4P87A 5GLBA 1K55C 1NJ4A 3Q07A 1EROA 5GHYA 2JBFA 1MY8A 4FCFA 5J3WA 3ZNYA 1KDWA 5HDDA 1Y28A 3KSHA 4Y13A 2PDRA 3HUOA 3HLFA 1YQSA 4KZ3A 3LEZA 5CERA 5IU1A 1OTEA 1DP6A 1WYBA 4KZ5A 4RX3A 4OOYA 4FH2A 4ETZA 3ZG9B 3C4PA 5FSRA 1T1CA 1UWNX 3Q7VA 1I5QA 2QJ5A 1H8YA 3HLWA 3WS4A 3BRMA 4R3JA 4F94A 3KX0X 4A5RA 5A93A 4WN5A 3OPLA 3WWXA 1CEFA 3HUMA 3B3XA 1SKFA 3BY8A 3PBSA 5FQKA 4Z1WA 1S66L 1PNEA 2QYBA 1SZVA 1VETB 5D3OA 4BD0A 4HNBA 4K08A 1W79A 2Y2OA 2BASA 4S2NC 3PR6A 4JGPA 3VFFA 1XFNA 3BJNA 1VQQA 4R3AA 4JKTA 1OMEA 1HTZA 1N9BA 2L0WA 1CQAA 2ZMVA 4OKPA 3BWLA 1O7EA 4PKYG 4AFIA 4H6JA 5FATA 2K31A 4GZBA 1ODVA 3T1RA 1KE4A 3S7NA 2Y4AA 4FD8A 1A0KA 1XGIA 5FL3A 4B4XA 2EWWA 4D60A 4UQIM 2XD1A 5J4EA 1CI8A 2VX8A 3F1OA 2W3HA 4WF0A 5DTTA 4DDSA 4OOMA 1PWGA 2VJWA 4E3IA 4IBRA 1ERMA 1WA9A 2QKPA 2K2NA 4JGRA 4DN0A 4X69A 2JKFA 2EXAA 4HBUA 5F83A 2WADA 2A2LA 4EEPA 2Y2QA 5F1FA 4G3KA 2YKHA 3AGEA 1BLSA 1W5DA 3GR2A 2G2UA 3MKEA 1L0FA 3DAVA 1VEUB 3Q7ZA 4I3JA 3L7HA 2G2WA 4Y3IA 3UE6A 4MCWA 5CTMA 1OT6A 4WELA 5TBMB 2Y2NA 2JKTM 5DF9A 4OPQA 4U0TA 5E2GA 3H7WA 4ZJ1A 3CUEC 2FFYA 4HEFA 5F6AA 2JKRM 2C5WB 1RP5A 4X1LA 5KSCA 3PBOA 1Y54A 4EETB 2IWBA 1H3QA 3VE4A 2IWCA 2L1MA 1K56A 4HH2A 3V3RA 2ZL1B 1YT4A 2XDMA 3G2YA 2O9BA 3OPHA 3LR3A 3WS0A 3T1QB 4Y0UA 2VLGA 1JNUA 4KQRA 4BD1A 4QY6A 1YSPA 1M6KA 5CXWA 2ZMFA 4CLCB 3UE0A 3IXDA 1PI5A 5HW3A 1HZOA 5I94A 1L2SA 2EX2A 4OLDA 2WZZA 4BMWA 2WKEA 5HWTA 4Q8IA 3UPPA 3BEBA 4JXSA 1Y4OA 3VOLA 2AVXA 4Q0IA 5FQQA 4ME4A 2W3EA 3ZCZA 3LI8A 3OOVA 4S2NA 4LV1A 1K4FA 5FEGA 1K6RA 1I2SA 4O0PA 4RA7A 2H0TA 4HBTA 1KE3A 2PBDP 1QMEA 2EWVA 4R6LA 4GKUA 4OPYA 3MF0A 4XUXA 3HLCA 3C7VA 2BTFP 3AGFA 1LSVA 2V0WA 4ARZB 4S2PA 1E3UD 3DTKA 3A3EA 2EXBA 2Z2MB 2PT7A 1XFQA 2BLSA 4MMNA 1V9YA 2ZC6B 3E2LA 1ZG6A 3PAGA 3ISGA 3F1NB 3DWKA 1PW8A 3E2KA 3T4LA 4S2LA 5M19A 3IHBA 2P7JA 5EM1A 3IBJA 5FEFA 2ZD8A 1SKOB 3TSGA 4E3OA 3QP5A 1TS7A 3RJUA 4R4SA 4ESPA 3PXPA 2UWXA 2JC7A 4HH3A 1GA9A 1HLUP 4IJGA 5L8MA 4I39A 3MSHA 2VGLM 5IS1A 3BFCA 1DJAA 4HJ6A 5HARA 5BOHA 1XP4A 3W4QA 3PBNA 4JPMA 2J9PA 3CUEA 2XSSA 1W8YA 3CJMA 4ZBEA 2O9AA 1FSWA 1WE4A 1F98A 4FOFA 5GLDA 3LIBA 4I5SA 2LB9A 4ZJ2A 3T4OA 5KMWA 2VEAA 4RVAA 4NXGA 2WKIA 1KOUA 2QMIA 3DTEA 1BTLA 1S4RA 3FV7A 1EI5A 3U2AA 3KSGA 4OVDA 4S2JA 1JTGA 2WGIA 3GRJA 5A91A 1YPRA 3O87A 3E98A 1NYYA 3ZFZA 3Q82A 3WS5A 2PR6A 3CG5A 1E4DA 4BBUA 4MEZA 3Q81A 2WKQA 4DXBA 3ZQ5A 1ESIA 1OT9A 3LFVA 4N1XA 4IVKA 1XXMA 4WEKA 1KGFA 5AJGA 3NULA 2Y8HA 2Y2IA 3IX3A 3KO6A 2WKHA 1FCNA 4MDZA 1RGYA 2UV0E 1SDNA 1LHYA 4YOFA 1SDEA 3NDEA 5AQAA 5DF7A 1C3BA 3VP2A 5C5KA 1PI4A 1X0OA 1GHPA 5M18A 3PBRA 3WS2A 2ZQAA 3A0VA
chains in the Genus database with same CATH topology
3ZNYA 4CPKA 1L0EA 4M3KA 1KDWA 2Y59A 3P98A 3V3SA 1EWZA 2XEPA 1PWDA 2FFFB 2VGJA 3ZG8B 3HUOA 1QMFA 3HLFA 1YQSA 1S0WA 4KZ3A 3LEZA 4UA7A 5CERA 3GVBA 1XA7A 5CGXA 3UO9A 3PBQA 4JF6A 1W7FA 1WYBA 4KG2A 3C7UA 4KZ5A 4RX3A 1I2WA 2EFXA 4FH2A 4MNRA 4OOYA 3ZNTA 5FQMA 4QB8A 3SH7A 3ZG9B 3C4PA 5FSRA 1GCEA 3G4PA 4R1GA 3RXWA 2RCXA 3SOIA 3Q7VA 2XH9A 1I5QA 5HAIA 1L0GA 1H8YA 3HLWA 5GL9A 1J9MA 3WS4A 3BRMA 4R3JA 4F94A 3HLDA 4N92A 1NY0A 1BLHA 4WEJA 4JBFA 4A5RA 4E3MA 5HAPA 4ZDXA 2R9WA 5A93A 2WAFA 3A3FA 5HX9A 3M6BA 3OPLA 4QHCA 3WWXA 4EQIA 4MLLA 4QJGA 1W8QA 1CEFA 3O3VA 1MKIA 3MZFA 5CGSA 5CHMA 3HUMA 3B3XA 1SKFA 2XR0A 3PBSA 5FQKA 1BT5A 1DJBA 4GOGA 4IVIA 4X55A 4XUZA 3VP3A 2P9VB 1H5XA 5EUAA 4OQIA 5EPHA 5D3OA 5FASA 2WGWA 4BD0A 4IBXA 2XLNA 2X01A 4KENB 3ITAA 5AQ9A 3NI9A 1JWZA 3N6IA 3UNWA 1W79A 4BJPA 2Y2OA 2XFSA 3DW0A 4S2NC 2XK1A 5EVIB 2XFTA 3ZDJA 3QNBA 3VFFA 1VQQA 4DKIA 4JKTA 1OMEA 4DRTA 1HTZA 4HESA 4CJNA 3NY4A 1N9BA 3PBTA 4P0MA 3G35A 2HDSA 2ZJ9A 2C6WB 1HD8A 4OKPA 1O7EA 4WM9A 1AXBA 3BECA 2WZXA 5FAPA 3DTMA 3IHAA 3SS3A 1MXOA 3LO7A 3VSKA 3UE1A 5CECA 4KZAA 4ZTKA 5FATA 3VOZA 4GB7A 4GZBA 1IYOA 3FYZA 5CTNA 2OV5A 4X53A 1KE4A 3ZVWA 2A3UA 2Y4AA 4FD8A 4DE0A 1N4OA 1XGIA 4B4XA 3UPOA 1XA1A 3IWQA 4YINA 4JF4A 4U3TA 1Q2QA 1MWUA 2XD1A 1CI8A 3V39A 4OQHA 5DTKA 2WK0A 1ES2A 4WYYA 4EUZA 5EOOA 4DDSA 5DTTA 3UN7A 4OOMA 1PWGA 4GDBA 4OH0A 3LY4A 1NRFA 4EBPA 1YLZA 5J8XA 4KQOA 4E3IA 5GLCA 1GHIA 3NC8A 4IBRA 1YLTA 5FQJA 1ERMA 1XGJA 1KE0A 4KZ6A 5CHUA 5FI7A 2RL3A 1IYSA 4QU3A 1IEMA 1ALQA 3QNCA 4X69A 5G18A 2EXAA 2Y2KA 4MBKA 4HBUA 1NZOA 2JCHA 5F83A 2WADA 5CHJA 3FWLA 2EX8A 1YMSA 3OZHA 3NCKA 2HP5A 5EVID 4X56A 1ERQA 2Y2QA 2H5SA 5FI2A 1H8ZA 5F1FA 4KZ9A 3IXBA 4EWFA 4PM6A 4ZJ3A 4E3JA 3AGEA 1DY6A 5EVIA 1BLSA 1W5DA 3GR2A 1ZC2A 3VOYA 3DWZA 4K0WA 1YLPA 2G2UA 3D4FA 2E8IA 1IKGA 3MKEA 5HL1A 1XPBA 2EX6A 1JWPA 2ZQCA 4E3NA 1BSGA 3MXSA 2I72A 1IYPA 1L0FA 5E2EA 1BLPA 3MZEA 3IWOA 4JLFA 2DRWA 4BQMA 2WGVA 3IXGA 1YLJA 3BM6A 3Q7ZA 2QZ6A 4OPRA 5F82A 2G2WA 4YFMA 5CTMA 3G30A 4WELA 3G2ZA 1LLBA 2Y2HA 2Y2NA 1Q2PA 3IF6A 3M2JA 3N8LA 4OPQA 5DF9A 1ES3A 4U0TA 2OLVA 5E2GA 4ZJ1A 1L0DA 4D2OA 2Y55A 1K4EA 5E2FA 2FFYA 3LY3A 4N1HA 4BL2A 4HEFA 5E2HA 1PWCA 3FKVA 3G34A 2ZC7A 1FOFA 3M2KA 2C5WB 2H10A 1RP5A 3MBZA 4KZ7A 1U60A 4S2KA 5KSCA 1K56D 3PBOA 4EBNA 1Y54A 3Q1FA 1JWVA 3EQUA 4FH4A 4H8RA 1K54A 2EFUA 4R3BA 2IWBA 5EE8A 1JTDA 2IWCA 1K6SA 1K56A 2CC1A 1E25A 4U0XA 1FSYA 3V3RA 3OPPA 3G2YA 1YT4A 2XDMA 4JXWA 3ZHHA 4WBGA 4K0XA 1G6AA 3OPHA 5IHVA 3WS0A 4OPZA 2R9XA 2PU4A 3TG9A 4Y0UA 4C6YA 4E6WA 5FAOA 1ONHA 3IH8A 2V20A 4GN2A 1FCOA 4KQRA 4N9LA 3N8SA 4BD1A 4DE3A 3HBRA 4QY6A 4DE1A 4ID4A 3N7WA 4RYEA 2IWDA 4LV3A 5AQBA 3UPNA 3ZGAB 1M6KA 1O07A 5CXWA 1CI9A 3ITBA 3UE0A 4OONA 4X6TA 4X68A 3HVFA 3ZG7B 3IXDA 1YM1A 1PI5A 3OC2A 5HW3A 4WZ5C 3ZG5A 2DNSA 4S2MA 2XD5A 5GHXA 5L2FA 3P09A 1ES4A 2VGKA 4NK3A 1HZOA 4DXCA 5I94A 4EV4A 1L2SA 3UDFA 5HFOA 2EX2A 4OLDA 5A92A 2WZZA 3IXHA 1K57C 2Y2GA 4S2OA 3V5MA 3FZCA 2WKEA 2J9OA 4UAAA 3AGDA 3S22A 3GMWA 4KZBA 5GHZA 4Q8IA 3UPPA 1BLCA 1PZPA 3BEBA 4JXSA 4KG6A 4GD8A 4PM5A 2V2FF 4JXVA 4JXGA 3MXRA 3HREA 5FQQA 3HUNA 5TR7A 1S6RA 2V1ZA 3SS5A 1WYCA 1Z6FA 1FQGA 2J7VA 4P85A 1KGGA 3W8KA 4K91A 3ZCZA 2HPBA 2EX9A 2ZM8A 3N4IA 5M1AA 2WYXA 2Q9NA 3UDXA 1LL9A 2ZQDA 4S2NA 4LV1A 4OQ0A 2BG1A 2PBYA 3QHYA 4JF5A 4PPRA 1K4FA 4IEDA 1PZOA 2J8YA 5EOEA 3VP1A 1K6RA 2P9VA 3UDIA 4QY5A 1I2SA 1TDLA 3WRZA 2PU2A 4LCLA 5JYPA 1ESUA 4RA7A 2H0TA 4HBTA 1IYQA 1KE3A 2XGNA 3BFDA 4FSFA 1NZUA 3JYIA 1QMEA 1GA0A 4GD6A 4GKUA 4S2IA 4DDYA 4OPYA 5FI6A 2Z2LB 2ZC4B 4XUXA 2Y91A 3PAEA 3IF6C 3HLCA 3C7VA 3GQZA 4KZ8A 3AGFA 2X02A 4OLGA 2Y2MA 4S2PA 1E3UD 5FQ9A 2ZC5B 1ONGA 1PIOA 3C4OA 2Y2LA 4RX2A 3A3EA 2WGWB 2ZM0A 3M6HA 4QD4A 5DVAA 5E43A 4GNUA 3W4OA 1XKZA 3MZDA 4DE2A 2EXBA 2Z2MB 1K25A 1FR6A 3HLEA 3N8RA 3BFFA 2Y2PA 1LI9A 4MBFA 4KQQA 5TGFA 1IKIA 2BLSA 5DTSA 5U47A 1G68A 5FDHA 5JYOA 4PM9A 2ZC6B 1BUEA 3E2LA 2QPNA 1ZG6A 2H0YA 4E6XA 3PAGA 3ISGA 4EBLA 1YLYA 3SH8A 4UA6A 1IELA 2P74A 4DF6A 4MBHA 3RXXA 3DWKA 5FAQA 1TEMA 1PW8A 3BLSA 3E2KA 1LL5A 4UHUA 4LV0A 3SS4A 1K55A 2ZC3B 3LCEA 3PTEA 4S2LA 2HP6A 1PYYA 5FQIA 3O88A 4R4RA 1K38A 1VM1A 5EECA 4GDNA 5M19A 3HL9A 1MWRA 1YLWA 3IHBA 4UA9A 5KZHA 5HAQA 1JVJA 3VP4A 2ZD8A 3MKFA 1SHVA 4KZ4A 4OP5A 3C5AA 3TSGA 4R23A 4BENA 1ZG4A 3BLMA 2WUQA 1YMXA 4L0LA 2Q9MA 3HLBA 3SH9A 4E3OA 2XQZA 3RJUA 4LV2A 4R4SA 4OOLA 4BLMA 2UWXA 2JC7A 3A3JA 4WMCD 5F1GA 1GA9A 3CMZA 3WS1A 4E3KA 3BFEA 2ZQ8A 3IWIA 1FCMA 4Z9QA 3BYDA 3BFCA 1DJAA 4E3LA 3GV9A 5CEDA 3NDGA 2HDRA 1TDGA 5HARA 5BOHA 4WMCA 3VMAA 1XP4A 3S1YA 3W4PA 4C75A 1M40A 1RCJA 2WAEA 2ZLYA 3ZVTA 1CK3A 3W4QA 3PBNA 3IF5A 4JPMA 2J9PA 3CZDA 3G32A 5KSHA 1NXYA 3VP0A 4C3QA 1W8YA 3CJMA 4ZBEA 1HVBA 1FSWA 1PW1A 3GTCA 2ZQ7A 2OLUA 4N9KA 1WE4A 5GLDA 4WZ4A 1MWSA 4NETA 4ZJ2A 3TOIA 4B4ZA 1KGEA 4LENA 4BL3A 1SCWA 5KMWA 3NIAA 3IQAA 3UE3A 4RVAA 2WKIA 5CGWA 3NBLA 5CEBA 3A3DA 1MPLA 2QMIA 4LCMA 3OCNA 1BTLA 1ZKJA 1LI0A 2DCFA 4KG5A 5DF8A 4B88A 1BULA 1DJCA 3FV7A 1EI5A 3A3IA 4XXRA 1RGZA 3HLGA 4OVDA 3EQVA 4S2JA 1JTGA 2WGIA 3GRJA 3O86A 5EVIC 2ZMAA 1NYMA 5A91A 4O7DA 3O87A 3UY6A 4Y7PA 1NYYA 3IT9A 1KVLA 3ZFZA 4OP8A 1FR1A 3OPRA 5AQ7A 3FKWA 3Q82A 3WS5A 4PMAA 2B5RA 3CG5A 1MWTA 2HP9A 3IF6B 2ZQ9A 1E4DA 1KDSA 3Q7VB 1KVMA 3MFDA 3OCLA 1TVFA 3Q81A 4MEZA 2OSUA 4DXBA 4P6BA 1ESIA 1XX2A 4N1XA 3VSLA 2HDQA 4IVKA 5FA7A 3GSGA 4WZ5A 1XXMA 2JE5A 1MBLA 1KGFA 2HDUA 4WEKA 3VFHA 4OQGA 4ZAMA 3V50A 2Y2IA 2ZM2A 3WRTA 4R0QA 2X71A 2WKHA 3I7JA 1GHMA 2XF3A 2GDNA 1BZAA 1FCNA 1K57A 4PM8A 3S4XA 1RGYA 5A90A 3G31A 5CRFA 3BFGA 1SDNA 4P87A 4Y0TA 1CEGA 3ZG0A 5GLBA 1LHYA 2Y2JA 1SDEA 1K55C 3NDEA 1NJ4A 4PM7A 5AQAA 5DF7A 3Q07A 5EVLA 1C3BA 3IH9A 3VP2A 1EROA 5GLAA 1PI4A 1E3UA 1ES5A 1K54C 4Y0OA 1GHPA 5M18A 5GHYA 3PBRA 5TFQA 3WS2A 2JBFA 2ZQAA 1MY8A 4FCFA 2A49A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZNY A;  4CPK A;  1L0E A;  4M3K A;  1KDW A;  2Y59 A;  3P98 A;  3V3S A;  1EWZ A;  2XEP A;  1PWD A;  2FFF B;  2VGJ A;  3ZG8 B;  3HUO A;  1QMF A;  3HLF A;  1YQS A;  1S0W A;  4KZ3 A;  3LEZ A;  4UA7 A;  5CER A;  3GVB A;  1XA7 A;  5CGX A;  3UO9 A;  3PBQ A;  4JF6 A;  1W7F A;  1WYB A;  4KG2 A;  3C7U A;  4KZ5 A;  4RX3 A;  1I2W A;  2EFX A;  4FH2 A;  4MNR A;  4OOY A;  3ZNT A;  5FQM A;  4QB8 A;  3SH7 A;  3ZG9 B;  3C4P A;  5FSR A;  1GCE A;  3G4P A;  4R1G A;  3RXW A;  2RCX A;  3SOI A;  3Q7V A;  2XH9 A;  1I5Q A;  5HAI A;  1L0G A;  1H8Y A;  3HLW A;  5GL9 A;  1J9M A;  3WS4 A;  3BRM A;  4R3J A;  4F94 A;  3HLD A;  4N92 A;  1NY0 A;  1BLH A;  4WEJ A;  4JBF A;  4A5R A;  4E3M A;  5HAP A;  4ZDX A;  2R9W A;  5A93 A;  2WAF A;  3A3F A;  5HX9 A;  3M6B A;  3OPL A;  4QHC A;  3WWX A;  4EQI A;  4MLL A;  4QJG A;  1W8Q A;  1CEF A;  3O3V A;  1MKI A;  3MZF A;  5CGS A;  5CHM A;  3HUM A;  3B3X A;  1SKF A;  2XR0 A;  3PBS A;  5FQK A;  1BT5 A;  1DJB A;  4GOG A;  4IVI A;  4X55 A;  4XUZ A;  3VP3 A;  2P9V B;  1H5X A;  5EUA A;  4OQI A;  5EPH A;  5D3O A;  5FAS A;  2WGW A;  4BD0 A;  4IBX A;  2XLN A;  2X01 A;  4KEN B;  3ITA A;  5AQ9 A;  3NI9 A;  1JWZ A;  3N6I A;  3UNW A;  1W79 A;  4BJP A;  2Y2O A;  2XFS A;  3DW0 A;  4S2N C;  2XK1 A;  5EVI B;  2XFT A;  3ZDJ A;  3QNB A;  3VFF A;  1VQQ A;  4DKI A;  4JKT A;  1OME A;  4DRT A;  1HTZ A;  4HES A;  4CJN A;  3NY4 A;  1N9B A;  3PBT A;  4P0M A;  3G35 A;  2HDS A;  2ZJ9 A;  2C6W B;  1HD8 A;  4OKP A;  1O7E A;  4WM9 A;  1AXB A;  3BEC A;  2WZX A;  5FAP A;  3DTM A;  3IHA A;  3SS3 A;  1MXO A;  3LO7 A;  3VSK A;  3UE1 A;  5CEC A;  4KZA A;  4ZTK A;  5FAT A;  3VOZ A;  4GB7 A;  4GZB A;  1IYO A;  3FYZ A;  5CTN A;  2OV5 A;  4X53 A;  1KE4 A;  3ZVW A;  2A3U A;  2Y4A A;  4FD8 A;  4DE0 A;  1N4O A;  1XGI A;  4B4X A;  3UPO A;  1XA1 A;  3IWQ A;  4YIN A;  4JF4 A;  4U3T A;  1Q2Q A;  1MWU A;  2XD1 A;  1CI8 A;  3V39 A;  4OQH A;  5DTK A;  2WK0 A;  1ES2 A;  4WYY A;  4EUZ A;  5EOO A;  4DDS A;  5DTT A;  3UN7 A;  4OOM A;  1PWG A;  4GDB A;  4OH0 A;  3LY4 A;  1NRF A;  4EBP A;  1YLZ A;  5J8X A;  4KQO A;  4E3I A;  5GLC A;  1GHI A;  3NC8 A;  4IBR A;  1YLT A;  5FQJ A;  1ERM A;  1XGJ A;  1KE0 A;  4KZ6 A;  5CHU A;  5FI7 A;  2RL3 A;  1IYS A;  4QU3 A;  1IEM A;  1ALQ A;  3QNC A;  4X69 A;  5G18 A;  2EXA A;  2Y2K A;  4MBK A;  4HBU A;  1NZO A;  2JCH A;  5F83 A;  2WAD A;  5CHJ A;  3FWL A;  2EX8 A;  1YMS A;  3OZH A;  3NCK A;  2HP5 A;  5EVI D;  4X56 A;  1ERQ A;  2Y2Q A;  2H5S A;  5FI2 A;  1H8Z A;  5F1F A;  4KZ9 A;  3IXB A;  4EWF A;  4PM6 A;  4ZJ3 A;  4E3J A;  3AGE A;  1DY6 A;  5EVI A;  1BLS A;  1W5D A;  3GR2 A;  1ZC2 A;  3VOY A;  3DWZ A;  4K0W A;  1YLP A;  2G2U A;  3D4F A;  2E8I A;  1IKG A;  3MKE A;  5HL1 A;  1XPB A;  2EX6 A;  1JWP A;  2ZQC A;  4E3N A;  1BSG A;  3MXS A;  2I72 A;  1IYP A;  1L0F A;  5E2E A;  1BLP A;  3MZE A;  3IWO A;  4JLF A;  2DRW A;  4BQM A;  2WGV A;  3IXG A;  1YLJ A;  3BM6 A;  3Q7Z A;  2QZ6 A;  4OPR A;  5F82 A;  2G2W A;  4YFM A;  5CTM A;  3G30 A;  4WEL A;  3G2Z A;  1LLB A;  2Y2H A;  2Y2N A;  1Q2P A;  3IF6 A;  3M2J A;  3N8L A;  4OPQ A;  5DF9 A;  1ES3 A;  4U0T A;  2OLV A;  5E2G A;  4ZJ1 A;  1L0D A;  4D2O A;  2Y55 A;  1K4E A;  5E2F A;  2FFY A;  3LY3 A;  4N1H A;  4BL2 A;  4HEF A;  5E2H A;  1PWC A;  3FKV A;  3G34 A;  2ZC7 A;  1FOF A;  3M2K A;  2C5W B;  2H10 A;  1RP5 A;  3MBZ A;  4KZ7 A;  1U60 A;  4S2K A;  5KSC A;  1K56 D;  3PBO A;  4EBN A;  1Y54 A;  3Q1F A;  1JWV A;  3EQU A;  4FH4 A;  4H8R A;  1K54 A;  2EFU A;  4R3B A;  2IWB A;  5EE8 A;  1JTD A;  2IWC A;  1K6S A;  1K56 A;  2CC1 A;  1E25 A;  4U0X A;  1FSY A;  3V3R A;  3OPP A;  3G2Y A;  1YT4 A;  2XDM A;  4JXW A;  3ZHH A;  4WBG A;  4K0X A;  1G6A A;  3OPH A;  5IHV A;  3WS0 A;  4OPZ A;  2R9X A;  2PU4 A;  3TG9 A;  4Y0U A;  4C6Y A;  4E6W A;  5FAO A;  1ONH A;  3IH8 A;  2V20 A;  4GN2 A;  1FCO A;  4KQR A;  4N9L A;  3N8S A;  4BD1 A;  4DE3 A;  3HBR A;  4QY6 A;  4DE1 A;  4ID4 A;  3N7W A;  4RYE A;  2IWD A;  4LV3 A;  5AQB A;  3UPN A;  3ZGA B;  1M6K A;  1O07 A;  5CXW A;  1CI9 A;  3ITB A;  3UE0 A;  4OON A;  4X6T A;  4X68 A;  3HVF A;  3ZG7 B;  3IXD A;  1YM1 A;  1PI5 A;  3OC2 A;  5HW3 A;  4WZ5 C;  3ZG5 A;  2DNS A;  4S2M A;  2XD5 A;  5GHX A;  5L2F A;  3P09 A;  1ES4 A;  2VGK A;  4NK3 A;  1HZO A;  4DXC A;  5I94 A;  4EV4 A;  1L2S A;  3UDF A;  5HFO A;  2EX2 A;  4OLD A;  5A92 A;  2WZZ A;  3IXH A;  1K57 C;  2Y2G A;  4S2O A;  3V5M A;  3FZC A;  2WKE A;  2J9O A;  4UAA A;  3AGD A;  3S22 A;  3GMW A;  4KZB A;  5GHZ A;  4Q8I A;  3UPP A;  1BLC A;  1PZP A;  3BEB A;  4JXS A;  4KG6 A;  4GD8 A;  4PM5 A;  2V2F F;  4JXV A;  4JXG A;  3MXR A;  3HRE A;  5FQQ A;  3HUN A;  5TR7 A;  1S6R A;  2V1Z A;  3SS5 A;  1WYC A;  1Z6F A;  1FQG A;  2J7V A;  4P85 A;  1KGG A;  3W8K A;  4K91 A;  3ZCZ A;  2HPB A;  2EX9 A;  2ZM8 A;  3N4I A;  5M1A A;  2WYX A;  2Q9N A;  3UDX A;  1LL9 A;  2ZQD A;  4S2N A;  4LV1 A;  4OQ0 A;  2BG1 A;  2PBY A;  3QHY A;  4JF5 A;  4PPR A;  1K4F A;  4IED A;  1PZO A;  2J8Y A;  5EOE A;  3VP1 A;  1K6R A;  2P9V A;  3UDI A;  4QY5 A;  1I2S A;  1TDL A;  3WRZ A;  2PU2 A;  4LCL A;  5JYP A;  1ESU A;  4RA7 A;  2H0T A;  4HBT A;  1IYQ A;  1KE3 A;  2XGN A;  3BFD A;  4FSF A;  1NZU A;  3JYI A;  1QME A;  1GA0 A;  4GD6 A;  4GKU A;  4S2I A;  4DDY A;  4OPY A;  5FI6 A;  2Z2L B;  2ZC4 B;  4XUX A;  2Y91 A;  3PAE A;  3IF6 C;  3HLC A;  3C7V A;  3GQZ A;  4KZ8 A;  3AGF A;  2X02 A;  4OLG A;  2Y2M A;  4S2P A;  1E3U D;  5FQ9 A;  2ZC5 B;  1ONG A;  1PIO A;  3C4O A;  2Y2L A;  4RX2 A;  3A3E A;  2WGW B;  2ZM0 A;  3M6H A;  4QD4 A;  5DVA A;  5E43 A;  4GNU A;  3W4O A;  1XKZ A;  3MZD A;  4DE2 A;  2EXB A;  2Z2M B;  1K25 A;  1FR6 A;  3HLE A;  3N8R A;  3BFF A;  2Y2P A;  1LI9 A;  4MBF A;  4KQQ A;  5TGF A;  1IKI A;  2BLS A;  5DTS A;  5U47 A;  1G68 A;  5FDH A;  5JYO A;  4PM9 A;  2ZC6 B;  1BUE A;  3E2L A;  2QPN A;  1ZG6 A;  2H0Y A;  4E6X A;  3PAG A;  3ISG A;  4EBL A;  1YLY A;  3SH8 A;  4UA6 A;  1IEL A;  2P74 A;  4DF6 A;  4MBH A;  3RXX A;  3DWK A;  5FAQ A;  1TEM A;  1PW8 A;  3BLS A;  3E2K A;  1LL5 A;  4UHU A;  4LV0 A;  3SS4 A;  1K55 A;  2ZC3 B;  3LCE A;  3PTE A;  4S2L A;  2HP6 A;  1PYY A;  5FQI A;  3O88 A;  4R4R A;  1K38 A;  1VM1 A;  5EEC A;  4GDN A;  5M19 A;  3HL9 A;  1MWR A;  1YLW A;  3IHB A;  4UA9 A;  5KZH A;  5HAQ A;  1JVJ A;  3VP4 A;  2ZD8 A;  3MKF A;  1SHV A;  4KZ4 A;  4OP5 A;  3C5A A;  3TSG A;  4R23 A;  4BEN A;  1ZG4 A;  3BLM A;  2WUQ A;  1YMX A;  4L0L A;  2Q9M A;  3HLB A;  3SH9 A;  4E3O A;  2XQZ A;  3RJU A;  4LV2 A;  4R4S A;  4OOL A;  4BLM A;  2UWX A;  2JC7 A;  3A3J A;  4WMC D;  5F1G A;  1GA9 A;  3CMZ A;  3WS1 A;  4E3K A;  3BFE A;  2ZQ8 A;  3IWI A;  1FCM A;  4Z9Q A;  3BYD A;  3BFC A;  1DJA A;  4E3L A;  3GV9 A;  5CED A;  3NDG A;  2HDR A;  1TDG A;  5HAR A;  5BOH A;  4WMC A;  3VMA A;  1XP4 A;  3S1Y A;  3W4P A;  4C75 A;  1M40 A;  1RCJ A;  2WAE A;  2ZLY A;  3ZVT A;  1CK3 A;  3W4Q A;  3PBN A;  3IF5 A;  4JPM A;  2J9P A;  3CZD A;  3G32 A;  5KSH A;  1NXY A;  3VP0 A;  4C3Q A;  1W8Y A;  3CJM A;  4ZBE A;  1HVB A;  1FSW A;  1PW1 A;  3GTC A;  2ZQ7 A;  2OLU A;  4N9K A;  1WE4 A;  5GLD A;  4WZ4 A;  1MWS A;  4NET A;  4ZJ2 A;  3TOI A;  4B4Z A;  1KGE A;  4LEN A;  4BL3 A;  1SCW A;  5KMW A;  3NIA A;  3IQA A;  3UE3 A;  4RVA A;  2WKI A;  5CGW A;  3NBL A;  5CEB A;  3A3D A;  1MPL A;  2QMI A;  4LCM A;  3OCN A;  1BTL A;  1ZKJ A;  1LI0 A;  2DCF A;  4KG5 A;  5DF8 A;  4B88 A;  1BUL A;  1DJC A;  3FV7 A;  1EI5 A;  3A3I A;  4XXR A;  1RGZ A;  3HLG A;  4OVD A;  3EQV A;  4S2J A;  1JTG A;  2WGI A;  3GRJ A;  3O86 A;  5EVI C;  2ZMA A;  1NYM A;  5A91 A;  4O7D A;  3O87 A;  3UY6 A;  4Y7P A;  1NYY A;  3IT9 A;  1KVL A;  3ZFZ A;  4OP8 A;  1FR1 A;  3OPR A;  5AQ7 A;  3FKW A;  3Q82 A;  3WS5 A;  4PMA A;  2B5R A;  3CG5 A;  1MWT A;  2HP9 A;  3IF6 B;  2ZQ9 A;  1E4D A;  1KDS A;  3Q7V B;  1KVM A;  3MFD A;  3OCL A;  1TVF A;  3Q81 A;  4MEZ A;  2OSU A;  4DXB A;  4P6B A;  1ESI A;  1XX2 A;  4N1X A;  3VSL A;  2HDQ A;  4IVK A;  5FA7 A;  3GSG A;  4WZ5 A;  1XXM A;  2JE5 A;  1MBL A;  1KGF A;  2HDU A;  4WEK A;  3VFH A;  4OQG A;  4ZAM A;  3V50 A;  2Y2I A;  2ZM2 A;  3WRT A;  4R0Q A;  2X71 A;  2WKH A;  3I7J A;  1GHM A;  2XF3 A;  2GDN A;  1BZA A;  1FCN A;  1K57 A;  4PM8 A;  3S4X A;  1RGY A;  5A90 A;  3G31 A;  5CRF A;  3BFG A;  1SDN A;  4P87 A;  4Y0T A;  1CEG A;  3ZG0 A;  5GLB A;  1LHY A;  2Y2J A;  1SDE A;  1K55 C;  3NDE A;  1NJ4 A;  4PM7 A;  5AQA A;  5DF7 A;  3Q07 A;  5EVL A;  1C3B A;  3IH9 A;  3VP2 A;  1ERO A;  5GLA A;  1PI4 A;  1E3U A;  1ES5 A;  1K54 C;  4Y0O A;  1GHP A;  5M18 A;  5GHY A;  3PBR A;  5TFQ A;  3WS2 A;  2JBF A;  2ZQA A;  1MY8 A;  4FCF A;  2A49 A; 
#chains in the Genus database with same CATH topology
 4CPK A;  1L0E A;  4M3K A;  2Y59 A;  3V3S A;  1EWZ A;  4O01 A;  3KYQ A;  2VK3 A;  4CLC E;  1ACF A;  5FDS A;  3GVB A;  2HZ5 A;  2W3D A;  3ZNT A;  5FQM A;  1J3W A;  4LRZ E;  1GCE A;  3G4P A;  3SOI A;  5HL6 A;  2XH9 A;  5HAI A;  2GX5 A;  2OAP 1;  3HLD A;  3LR5 A;  1NY0 A;  4E3M A;  1NLY A;  1YSQ A;  3MZF A;  5AVE A;  3KYZ A;  1BT5 A;  4IVI A;  2WKP A;  4HQA A;  1H5X A;  4IBX A;  2X01 A;  4KEN B;  5AQ9 A;  3C30 A;  4BJP A;  4UQI S;  3MQO A;  3DW0 A;  1MZU A;  2XK1 A;  2XA7 S;  5EVI B;  3MJQ A;  5G4Y A;  1NWZ A;  4DKI A;  3NY4 A;  3C8C A;  2FZ0 A;  3PHY A;  4P0M A;  2ZJ9 A;  4LLO B;  3BEC A;  2WZX A;  5FAP A;  4Y17 A;  4GJ4 A;  3T4S A;  2A3U A;  4DE0 A;  2NUP C;  3LEQ A;  3T4K A;  3UPO A;  1XA1 A;  2Z6C A;  3IWQ A;  4YIN A;  2D02 A;  2JKR I;  1Q2Q A;  2W1R A;  4OQH A;  3A0R A;  2WK0 A;  5DTK A;  3EEA A;  3E0Y A;  3UN7 A;  3EGD C;  4EBP A;  1IFQ A;  4KQO A;  4PAU A;  3NC8 A;  1YKD A;  2PYP A;  4WLA A;  5FI7 A;  1V9Z A;  1FIK A;  3RTY A;  1IYS A;  3FPV A;  5L10 A;  1P97 A;  2HP5 A;  2QWS A;  3NCK A;  4X56 A;  1ERQ A;  2H5S A;  1OTB A;  4KZ9 A;  3IXB A;  4DJ2 A;  3UB6 A;  2MJ6 A;  3LI9 A;  2PRF A;  4K0W A;  4LFU A;  5K5B A;  1YLP A;  1XPB A;  2EX6 A;  2ZQC A;  2B18 A;  3MXS A;  4HOI A;  1BLP A;  5DFY A;  3B42 A;  5F82 A;  2VA0 A;  2OAQ 1;  1N9N A;  1FIL A;  3G30 A;  3IF6 A;  3NHQ A;  3EEH A;  1L0D A;  2Y55 A;  5E2F A;  3LY3 A;  3T4T A;  3B33 A;  2J3T D;  1YAX A;  3SZT A;  3H82 A;  4S2K A;  1U60 A;  3Q1F A;  4H8R A;  2L4R A;  2EFU A;  1JTD A;  1K6S A;  2CC1 A;  1FSY A;  1XJ4 A;  1T1B A;  1OTA A;  5IHV A;  1Z09 A;  4OPZ A;  4C6Y A;  3TG9 A;  4GN2 A;  1FCO A;  1CF0 A;  3N8S A;  4DE3 A;  3HBR A;  4EXO A;  2IWD A;  5AQB A;  3UPN A;  1O07 A;  1DRM A;  3NOU C;  3ITB A;  3BQ8 A;  4OON A;  3HVF A;  1YM1 A;  4WZ5 C;  3ZG5 A;  2GNX A;  5HSQ A;  5GHX A;  3MQQ A;  3VE3 A;  1ES4 A;  4GHI A;  2KX6 A;  2NUT C;  4EES A;  5HPF A;  1K57 C;  3R7W B;  2Y2G A;  3V5M A;  3FZC A;  4UAA A;  3GMW A;  4KG6 A;  4GD8 A;  4PM5 A;  2V2F F;  4JXG A;  3HRE A;  3B47 A;  3P7N A;  1FQG A;  4P85 A;  3T4Q A;  2ZM8 A;  5M1A A;  2M1C A;  3QHY A;  4JF5 A;  5EOE A;  2P9V A;  4XT2 B;  4QY5 A;  4LCL A;  1ESU A;  4BBV A;  3BFD A;  4FSF A;  3K2N A;  1GA0 A;  3E4P A;  4S2I A;  4CLC D;  4GS9 A;  4DMZ A;  3GQZ A;  4KZ8 A;  2Y2M A;  3BY9 A;  1PIO A;  2ZM0 A;  4KQD A;  3MZD A;  3BFF A;  2W1T A;  2Y2P A;  5L07 A;  5TGF A;  5DTS A;  1PRQ A;  1BUE A;  2QPN A;  2W3F A;  2VGL S;  3SH8 A;  2P74 A;  4MBH A;  3JVU A;  3TW8 A;  4UHU A;  4LV0 A;  3CLO A;  1K55 A;  2ZC3 B;  2HP6 A;  5FQI A;  4MN7 A;  4R4R A;  1K38 A;  2ZOI A;  4BWI A;  1YLW A;  4UA9 A;  4EEU A;  2PAV P;  4KZ4 A;  4OP5 A;  2YKF A;  4R23 A;  1ZG4 A;  2PR5 A;  1YMX A;  2E8J A;  3HLB A;  3SH9 A;  1L3L A;  2XQZ A;  4BLM A;  4OOL A;  3A3J A;  4WMC D;  5F1G A;  3WS1 A;  3EWK A;  3KSF A;  3D3O A;  3IWI A;  5CED A;  3F1P A;  3VMA A;  2K7S A;  1CK3 A;  3FPW A;  2KDK A;  3VP0 A;  2VV6 A;  1HVB A;  1PW1 A;  2Y79 A;  3GTC A;  4HJ4 A;  5KIZ A;  2OLU A;  4N9K A;  3R4K A;  4WZ4 A;  1MWS A;  3CPT A;  1P9R A;  3NBL A;  1MPL A;  4LCM A;  3OCN A;  4KG5 A;  5DF8 A;  1DJC A;  3A3I A;  3EQV A;  4Q0J A;  2ZMA A;  1NYM A;  3ULF A;  4B9O A;  3UY6 A;  1KVL A;  5AQ7 A;  4M4X A;  3FC7 A;  3TRC A;  3IF6 B;  2OWJ A;  2ZQ9 A;  3MMH A;  1DP8 A;  3Q7V B;  1KVM A;  3MFD A;  3OCL A;  4II7 A;  2HDQ A;  5FA7 A;  3GSG A;  4WZ5 A;  1MBL A;  2HDU A;  3U4L P;  4OQG A;  3V50 A;  1AWI A;  4R0Q A;  2X71 A;  4Y2F A;  1GHM A;  2GJ3 A;  1BZA A;  1K57 A;  5A90 A;  1F5M A;  3BFG A;  4Y0T A;  1CEG A;  4PM7 A;  2HJ9 C;  3W2Z A;  1PFL A;  5EVL A;  2LB5 A;  1K54 C;  2J3T C;  4NXF A;  5TFQ A;  2A49 A;  4F3L A;  3P98 A;  2XEP A;  1PWD A;  4GW9 A;  3LR4 A;  3ZG8 B;  1QMF A;  4UA7 A;  5I5L A;  3LIE A;  4JGQ A;  3LID A;  4JF6 A;  1W7F A;  4H6J B;  4KG2 A;  3C7U A;  2A24 A;  3SH7 A;  3UME A;  3RXW A;  2RCX A;  1L0G A;  3LGO A;  3F1O B;  4JBF A;  5HAP A;  1GSW A;  2D01 A;  3A3F A;  1S1Z A;  5F68 A;  5HX9 A;  3M6B A;  4QHC A;  4GCZ A;  4EQI A;  4QJG A;  1MKI A;  3T1X A;  2XR0 A;  1DJB A;  2ACG A;  4GOG A;  4Q0H A;  4X55 A;  4XUZ A;  2P9V B;  5EPH A;  5L09 A;  3HCY A;  2WGW A;  3N6I A;  5EVE A;  2XFS A;  2PD7 A;  3ZDJ A;  2XFT A;  3QNB A;  1TS8 A;  3MXQ A;  1G5U A;  4DRT A;  4G3W A;  4HES A;  4LGW A;  3CAX A;  3G35 A;  2PHY A;  2HDS A;  3IX8 A;  2C6W B;  1T1A A;  1OPX A;  1HD8 A;  1N9L A;  5LBR A;  3MQ0 A;  2B02 A;  3LO7 A;  5CEC A;  3UE1 A;  4KZA A;  3IX4 A;  4ZTK A;  3VOZ A;  4GB7 A;  3FYZ A;  5CTN A;  4X53 A;  4L9E A;  3ICY A;  4CLC C;  4EER A;  2QHK A;  3H7W B;  4U3T A;  4GLQ A;  1MWU A;  1P9W A;  4WYY A;  1CJF A;  4EUZ A;  1TS0 A;  1ZHH B;  4OH0 A;  1YLZ A;  5J8X A;  1TF1 A;  4FTX A;  5GLC A;  1GHI A;  4I38 A;  5CHU A;  3T4J A;  4QU3 A;  1ALQ A;  5G18 A;  4MBK A;  3FWL A;  5EVI D;  3RFB A;  4EWF A;  4PM6 A;  4YWZ A;  3F1P B;  1ZC2 A;  3VOY A;  3D4F A;  2E8I A;  1IKG A;  3D9Y A;  4FUW A;  5HL1 A;  4EQ1 A;  2OOL A;  4E3N A;  1BSG A;  3IS2 A;  2KLI A;  1IYP A;  5F5Y A;  3IWO A;  4JLF A;  3NJA A;  4BQM A;  3IXG A;  1YLJ A;  3BW6 A;  3BM6 A;  2QZ6 A;  4OPR A;  4YFM A;  2Y2H A;  5TJJ A;  1VHM A;  2OLV A;  3MR0 A;  2V0U A;  4MN5 A;  1K4E A;  4N1H A;  5E2H A;  1PWC A;  3FKV A;  3G34 A;  2ZC7 A;  1FOF A;  4E04 A;  4NKP A;  4EBN A;  1JWV A;  3EQU A;  1K54 A;  3D72 A;  3EGX C;  1E25 A;  3OBF A;  1BYW A;  4U0X A;  3OPP A;  3ZHH A;  1G6A A;  5F69 A;  2R9X A;  2PU4 A;  4E6W A;  4KUO A;  5FAO A;  1ONH A;  3IH8 A;  4NXE A;  3T50 A;  1G28 A;  4NEE D;  4N9L A;  5DFX A;  4KUK A;  4DE1 A;  1F9I A;  3UB9 A;  4RYE A;  3ZGA B;  5DKL A;  2VZW A;  4X68 A;  3ZG7 B;  3OC2 A;  3LIA A;  2DNS A;  4S2M A;  2XD5 A;  3P09 A;  2VGK A;  4NK3 A;  1VEU A;  4DXC A;  4EV4 A;  3UDF A;  5HFO A;  5A92 A;  4HI4 A;  4S2O A;  3GDI A;  2J9O A;  3AGD A;  3S22 A;  4KZB A;  1BLC A;  2V1B A;  2P04 A;  2R78 A;  3HUN A;  1D7E A;  2V1Z A;  5HD5 A;  1DP9 A;  1WYC A;  3SS5 A;  2J7V A;  2A24 B;  2W0N A;  2EX9 A;  2WYX A;  2HV1 A;  3UDX A;  1LL9 A;  2ZQD A;  2BG1 A;  4PPR A;  1PZO A;  1OJ5 A;  3QP8 A;  2ZL1 A;  4HY8 A;  3VV4 A;  4I3A A;  4R38 A;  4ZRR A;  5FI6 A;  5HDC A;  2Y91 A;  3PAE A;  4PKY A;  2X02 A;  4CLC A;  4L9G A;  2ZC5 B;  1ONG A;  3C4O A;  4CQH A;  4RX2 A;  3M6H A;  2WGW B;  4QD4 A;  5DVA A;  1UGU A;  1LT0 A;  3W4O A;  1K25 A;  1FR6 A;  3LUQ A;  3N8R A;  5DKK A;  4MBF A;  1IKI A;  1XJ3 A;  4EW7 A;  1G68 A;  5HD3 A;  4B93 A;  4E6X A;  1IEL A;  5FAQ A;  2GZA A;  4JGO A;  3LCE A;  3UB5 P;  3O88 A;  2Z6D A;  3HL9 A;  5HAQ A;  1JVJ A;  3VP4 A;  1STZ A;  3MKF A;  1SHV A;  3C5A A;  3S7P A;  2WUQ A;  4L0L A;  2ZBB A;  4O8G A;  1MKM A;  2M7U A;  1VB6 A;  2HJE A;  3CMZ A;  3GEC A;  4E3K A;  3RH8 B;  2ZQ8 A;  4G3V A;  3BYD A;  2H28 A;  1TDG A;  4WMC A;  2W27 A;  3JVV A;  4ARZ A;  2G7U A;  3K3D A;  3S1Y A;  4C75 A;  1RCJ A;  2WAE A;  3QP4 A;  3ZVT A;  3CZD A;  1OTD A;  3NOT C;  4C3Q A;  4X1M A;  4ETX A;  5HZH A;  2PYR A;  1EW0 A;  2Q0O A;  4NET A;  3TOI A;  4P6Z M;  4LEN A;  4BL3 A;  5CGW A;  5CEB A;  3HJI A;  4WUJ A;  2DCF A;  3F1N A;  3IS2 B;  4B88 A;  4WL9 A;  1IOU A;  5EVI C;  4Y7P A;  3IT9 A;  5EM0 A;  2QJ7 A;  3OPR A;  2HP9 A;  1KDS A;  4LPZ A;  1SKO A;  2KOI A;  3MFX A;  4P6B A;  2XA7 M;  2XRN A;  2V1A A;  2JE5 A;  4NXB A;  1S1Y A;  3VFH A;  3WRT A;  2V8C A;  2XF3 A;  3S4X A;  1W63 M;  3G31 A;  5CRF A;  2OWH A;  3ZG0 A;  2Y2J A;  3HJK A;  2VV8 A;  4X25 A;  3IH9 A;  5GLA A;  1E3U A;  1ES5 A;  4Y0O A;  3P01 A;  2ZOH A;  3LIF A;  3S7Q A;  2FFF B;  2VGJ A;  1H8M A;  3CI6 A;  1OJG A;  3UB7 A;  1S0W A;  5IT5 A;  3LR0 A;  1XA7 A;  2HGV A;  5CGX A;  4HIA A;  3UO9 A;  3PBQ A;  4I3I A;  1I2W A;  2EFX A;  4MNR A;  3LYX A;  4QB8 A;  4HJ3 A;  2FH5 A;  2XRO A;  4R1G A;  1NRJ A;  5GL9 A;  1J9M A;  3SW1 A;  4N92 A;  4WEJ A;  1BLH A;  4ZDX A;  2R9W A;  2WAF A;  4MN6 A;  4MLL A;  1W8Q A;  3O3V A;  5CGS A;  5CHM A;  2O0Y A;  3VP3 A;  5EUA A;  4OQI A;  5FAS A;  2XLN A;  3ITA A;  3NI9 A;  1JWZ A;  3UNW A;  1LSW A;  3JPU A;  5HWW A;  3CHW P;  4HP9 A;  1S4S A;  4CJN A;  3PBT A;  5HPI A;  3L9K A;  1OTI A;  4WM9 A;  1AXB A;  1F2K A;  1W63 Q;  3DTM A;  3IHA A;  4RQ9 A;  3SS3 A;  1MXO A;  3VSK A;  1IYO A;  2OV5 A;  3ZVW A;  1N4O A;  1N9O A;  5HWV A;  4JF4 A;  2PD8 A;  4EU0 A;  3V39 A;  3UMD A;  1ES2 A;  3QP2 A;  5EOO A;  3H82 B;  4GDB A;  3LY4 A;  1NRF A;  1XJ6 A;  1G6O A;  4BBT A;  3T1S A;  1YLT A;  5FQJ A;  2JKG A;  1XGJ A;  2JHE A;  2HF6 A;  1KE0 A;  1P0Z A;  4KZ6 A;  2RL3 A;  3O5Y A;  4EUV A;  1IEM A;  3QNC A;  3UB8 A;  2Y2K A;  1NZO A;  2JCH A;  2O99 A;  5CHJ A;  2EX8 A;  1YMS A;  3OZH A;  4L9F A;  5FI2 A;  1H8Z A;  4ZJ3 A;  4E3J A;  5DJU A;  1DY6 A;  5EVI A;  3DWZ A;  2J80 A;  3PYP A;  3K3C A;  1JWP A;  2M7V A;  2I72 A;  1S67 L;  5E2E A;  3MZE A;  4GHI B;  2DRW A;  4HHD A;  2WGV A;  3G6O A;  3A0S A;  1NLZ A;  3G2Z A;  1LLB A;  1XJ2 A;  1Q2P A;  3M2J A;  3N8L A;  3E4O A;  3V67 A;  1ES3 A;  3OLO A;  4D2O A;  4BL2 A;  3M2K A;  2H10 A;  3MBZ A;  4KZ7 A;  1K56 D;  4FH4 A;  4R3B A;  5EE8 A;  4UEY A;  4JXW A;  4IUH A;  4WBG A;  4K0X A;  3KYE A;  2V20 A;  1LSX A;  4GS9 B;  4ID4 A;  3N7W A;  2W3G A;  4LV3 A;  1CI9 A;  3S7O A;  4X6T A;  4QWO A;  3MS6 A;  5L2F A;  5EFW A;  2V9A A;  5A8B A;  4PHT A;  2W1T B;  3IXH A;  2INW A;  4LRY C;  5GHZ A;  2O9C A;  1PZP A;  2JN7 A;  4JXV A;  3MXR A;  3T12 B;  1GSX A;  5TR7 A;  1S6R A;  4DJ3 A;  1Z6F A;  1KGG A;  3W8K A;  4K91 A;  2HPB A;  3N4I A;  5DJT A;  2Q9N A;  4OQ0 A;  2PBY A;  4IED A;  2J8Y A;  3VP1 A;  3IBR A;  3UDI A;  4HP4 A;  4R70 A;  3WRZ A;  1TDL A;  2J3W A;  1VET A;  2PU2 A;  5JYP A;  3NOP C;  2DMW A;  1IYQ A;  2XGN A;  3H9W A;  1NZU A;  3JYI A;  4GD6 A;  4DDY A;  2Z2L B;  2ZC4 B;  4Y15 A;  3IF6 C;  2B95 A;  4OLG A;  5FQ9 A;  3DTI A;  2Y2L A;  3CWF A;  3QP1 A;  3ZYT A;  5E43 A;  4GNU A;  1D1J A;  1XKZ A;  2VV7 A;  4DE2 A;  1T19 A;  3HLE A;  2IA2 A;  3C2W A;  1LI9 A;  4KQQ A;  3CPT B;  3R7W A;  3DBA A;  5U47 A;  5FDH A;  5JYO A;  4PM9 A;  2H0Y A;  4EBL A;  1YLY A;  4UA6 A;  3FG8 A;  4IUK A;  2I9V A;  4DF6 A;  3RXX A;  1TEM A;  3BLS A;  1LL5 A;  3SS4 A;  4NG2 A;  4YNR A;  5CX7 A;  3PTE A;  3C38 A;  1PYY A;  1VM1 A;  5EEC A;  4GDN A;  1MWR A;  4Y5F A;  5KZH A;  2VKS A;  2CMN A;  4XT2 A;  1T18 A;  4BEN A;  4P6Z S;  2WKR A;  3BLM A;  2EA9 A;  1K0K A;  2Q9M A;  4LV2 A;  3CIT A;  2V8F A;  3BFE A;  1FCM A;  4Z9Q A;  4E3L A;  3GV9 A;  3KSI A;  3NDG A;  2HDR A;  5HDS A;  2P08 A;  4QPR A;  1LL8 A;  5J7E A;  1TS6 A;  3W4P A;  1M40 A;  2ZLY A;  3IF5 A;  3G32 A;  5KSH A;  1NXY A;  1TD5 A;  1GSV A;  2ZQ7 A;  3NEC A;  3QP6 A;  4B4Z A;  1KGE A;  3BQA A;  1SCW A;  1UWP X;  3IQA A;  3NIA A;  5TBM A;  3UE3 A;  4F3L B;  1D06 A;  3A3D A;  5AVF A;  1ZKJ A;  1LI0 A;  5EV0 A;  5MC7 A;  3EOI A;  3TJZ C;  1BUL A;  4XXR A;  1RGZ A;  3HLG A;  4IHQ A;  3O86 A;  2JKT I;  4O7D A;  1ZTU A;  4OP8 A;  1FR1 A;  3FKW A;  5G4Z A;  3E4Q A;  3TE8 A;  4PMA A;  2B5R A;  1MWT A;  1TVF A;  3LIC A;  2OSU A;  3VSL A;  1XX2 A;  4ZAM A;  2ZM2 A;  1H0M A;  3I7J A;  4LRX C;  2GDN A;  4PM8 A;  1MC0 A;  4P87 A;  5GLB A;  1K55 C;  1NJ4 A;  3Q07 A;  1ERO A;  5GHY A;  2JBF A;  1MY8 A;  4FCF A;  5J3W A;  3ZNY A;  1KDW A;  5HDD A;  1Y28 A;  3KSH A;  4Y13 A;  2PDR A;  3HUO A;  3HLF A;  1YQS A;  4KZ3 A;  3LEZ A;  5CER A;  5IU1 A;  1OTE A;  1DP6 A;  1WYB A;  4KZ5 A;  4RX3 A;  4OOY A;  4FH2 A;  4ETZ A;  3ZG9 B;  3C4P A;  5FSR A;  1T1C A;  1UWN X;  3Q7V A;  1I5Q A;  2QJ5 A;  1H8Y A;  3HLW A;  3WS4 A;  3BRM A;  4R3J A;  4F94 A;  3KX0 X;  4A5R A;  5A93 A;  4WN5 A;  3OPL A;  3WWX A;  1CEF A;  3HUM A;  3B3X A;  1SKF A;  3BY8 A;  3PBS A;  5FQK A;  4Z1W A;  1S66 L;  1PNE A;  2QYB A;  1SZV A;  1VET B;  5D3O A;  4BD0 A;  4HNB A;  4K08 A;  1W79 A;  2Y2O A;  2BAS A;  4S2N C;  3PR6 A;  4JGP A;  3VFF A;  1XFN A;  3BJN A;  1VQQ A;  4R3A A;  4JKT A;  1OME A;  1HTZ A;  1N9B A;  2L0W A;  1CQA A;  2ZMV A;  4OKP A;  3BWL A;  1O7E A;  4PKY G;  4AFI A;  4H6J A;  5FAT A;  2K31 A;  4GZB A;  1ODV A;  3T1R A;  1KE4 A;  3S7N A;  2Y4A A;  4FD8 A;  1A0K A;  1XGI A;  5FL3 A;  4B4X A;  2EWW A;  4D60 A;  4UQI M;  2XD1 A;  5J4E A;  1CI8 A;  2VX8 A;  3F1O A;  2W3H A;  4WF0 A;  5DTT A;  4DDS A;  4OOM A;  1PWG A;  2VJW A;  4E3I A;  4IBR A;  1ERM A;  1WA9 A;  2QKP A;  2K2N A;  4JGR A;  4DN0 A;  4X69 A;  2JKF A;  2EXA A;  4HBU A;  5F83 A;  2WAD A;  2A2L A;  4EEP A;  2Y2Q A;  5F1F A;  4G3K A;  2YKH A;  3AGE A;  1BLS A;  1W5D A;  3GR2 A;  2G2U A;  3MKE A;  1L0F A;  3DAV A;  1VEU B;  3Q7Z A;  4I3J A;  3L7H A;  2G2W A;  4Y3I A;  3UE6 A;  4MCW A;  5CTM A;  1OT6 A;  4WEL A;  5TBM B;  2Y2N A;  2JKT M;  5DF9 A;  4OPQ A;  4U0T A;  5E2G A;  3H7W A;  4ZJ1 A;  3CUE C;  2FFY A;  4HEF A;  5F6A A;  2JKR M;  2C5W B;  1RP5 A;  4X1L A;  5KSC A;  3PBO A;  1Y54 A;  4EET B;  2IWB A;  1H3Q A;  3VE4 A;  2IWC A;  2L1M A;  1K56 A;  4HH2 A;  3V3R A;  2ZL1 B;  1YT4 A;  2XDM A;  3G2Y A;  2O9B A;  3OPH A;  3LR3 A;  3WS0 A;  3T1Q B;  4Y0U A;  2VLG A;  1JNU A;  4KQR A;  4BD1 A;  4QY6 A;  1YSP A;  1M6K A;  5CXW A;  2ZMF A;  4CLC B;  3UE0 A;  3IXD A;  1PI5 A;  5HW3 A;  1HZO A;  5I94 A;  1L2S A;  2EX2 A;  4OLD A;  2WZZ A;  4BMW A;  2WKE A;  5HWT A;  4Q8I A;  3UPP A;  3BEB A;  4JXS A;  1Y4O A;  3VOL A;  2AVX A;  4Q0I A;  5FQQ A;  4ME4 A;  2W3E A;  3ZCZ A;  3LI8 A;  3OOV A;  4S2N A;  4LV1 A;  1K4F A;  5FEG A;  1K6R A;  1I2S A;  4O0P A;  4RA7 A;  2H0T A;  4HBT A;  1KE3 A;  2PBD P;  1QME A;  2EWV A;  4R6L A;  4GKU A;  4OPY A;  3MF0 A;  4XUX A;  3HLC A;  3C7V A;  2BTF P;  3AGF A;  1LSV A;  2V0W A;  4ARZ B;  4S2P A;  1E3U D;  3DTK A;  3A3E A;  2EXB A;  2Z2M B;  2PT7 A;  1XFQ A;  2BLS A;  4MMN A;  1V9Y A;  2ZC6 B;  3E2L A;  1ZG6 A;  3PAG A;  3ISG A;  3F1N B;  3DWK A;  1PW8 A;  3E2K A;  3T4L A;  4S2L A;  5M19 A;  3IHB A;  2P7J A;  5EM1 A;  3IBJ A;  5FEF A;  2ZD8 A;  1SKO B;  3TSG A;  4E3O A;  3QP5 A;  1TS7 A;  3RJU A;  4R4S A;  4ESP A;  3PXP A;  2UWX A;  2JC7 A;  4HH3 A;  1GA9 A;  1HLU P;  4IJG A;  5L8M A;  4I39 A;  3MSH A;  2VGL M;  5IS1 A;  3BFC A;  1DJA A;  4HJ6 A;  5HAR A;  5BOH A;  1XP4 A;  3W4Q A;  3PBN A;  4JPM A;  2J9P A;  3CUE A;  2XSS A;  1W8Y A;  3CJM A;  4ZBE A;  2O9A A;  1FSW A;  1WE4 A;  1F98 A;  4FOF A;  5GLD A;  3LIB A;  4I5S A;  2LB9 A;  4ZJ2 A;  3T4O A;  5KMW A;  2VEA A;  4RVA A;  4NXG A;  2WKI A;  1KOU A;  2QMI A;  3DTE A;  1BTL A;  1S4R A;  3FV7 A;  1EI5 A;  3U2A A;  3KSG A;  4OVD A;  4S2J A;  1JTG A;  2WGI A;  3GRJ A;  5A91 A;  1YPR A;  3O87 A;  3E98 A;  1NYY A;  3ZFZ A;  3Q82 A;  3WS5 A;  2PR6 A;  3CG5 A;  1E4D A;  4BBU A;  4MEZ A;  3Q81 A;  2WKQ A;  4DXB A;  3ZQ5 A;  1ESI A;  1OT9 A;  3LFV A;  4N1X A;  4IVK A;  1XXM A;  4WEK A;  1KGF A;  5AJG A;  3NUL A;  2Y8H A;  2Y2I A;  3IX3 A;  3KO6 A;  2WKH A;  1FCN A;  4MDZ A;  1RGY A;  2UV0 E;  1SDN A;  1LHY A;  4YOF A;  1SDE A;  3NDE A;  5AQA A;  5DF7 A;  1C3B A;  3VP2 A;  5C5K A;  1PI4 A;  1X0O A;  1GHP A;  5M18 A;  3PBR A;  3WS2 A;  2ZQA A;  3A0V A; 
#chains in the Genus database with same CATH homology
 3ZNY A;  4CPK A;  1L0E A;  4M3K A;  1KDW A;  2Y59 A;  3P98 A;  3V3S A;  1EWZ A;  2XEP A;  1PWD A;  2FFF B;  2VGJ A;  3ZG8 B;  3HUO A;  1QMF A;  3HLF A;  1YQS A;  1S0W A;  4KZ3 A;  3LEZ A;  4UA7 A;  5CER A;  3GVB A;  1XA7 A;  5CGX A;  3UO9 A;  3PBQ A;  4JF6 A;  1W7F A;  1WYB A;  4KG2 A;  3C7U A;  4KZ5 A;  4RX3 A;  1I2W A;  2EFX A;  4FH2 A;  4MNR A;  4OOY A;  3ZNT A;  5FQM A;  4QB8 A;  3SH7 A;  3ZG9 B;  3C4P A;  5FSR A;  1GCE A;  3G4P A;  4R1G A;  3RXW A;  2RCX A;  3SOI A;  3Q7V A;  2XH9 A;  1I5Q A;  5HAI A;  1L0G A;  1H8Y A;  3HLW A;  5GL9 A;  1J9M A;  3WS4 A;  3BRM A;  4R3J A;  4F94 A;  3HLD A;  4N92 A;  1NY0 A;  1BLH A;  4WEJ A;  4JBF A;  4A5R A;  4E3M A;  5HAP A;  4ZDX A;  2R9W A;  5A93 A;  2WAF A;  3A3F A;  5HX9 A;  3M6B A;  3OPL A;  4QHC A;  3WWX A;  4EQI A;  4MLL A;  4QJG A;  1W8Q A;  1CEF A;  3O3V A;  1MKI A;  3MZF A;  5CGS A;  5CHM A;  3HUM A;  3B3X A;  1SKF A;  2XR0 A;  3PBS A;  5FQK A;  1BT5 A;  1DJB A;  4GOG A;  4IVI A;  4X55 A;  4XUZ A;  3VP3 A;  2P9V B;  1H5X A;  5EUA A;  4OQI A;  5EPH A;  5D3O A;  5FAS A;  2WGW A;  4BD0 A;  4IBX A;  2XLN A;  2X01 A;  4KEN B;  3ITA A;  5AQ9 A;  3NI9 A;  1JWZ A;  3N6I A;  3UNW A;  1W79 A;  4BJP A;  2Y2O A;  2XFS A;  3DW0 A;  4S2N C;  2XK1 A;  5EVI B;  2XFT A;  3ZDJ A;  3QNB A;  3VFF A;  1VQQ A;  4DKI A;  4JKT A;  1OME A;  4DRT A;  1HTZ A;  4HES A;  4CJN A;  3NY4 A;  1N9B A;  3PBT A;  4P0M A;  3G35 A;  2HDS A;  2ZJ9 A;  2C6W B;  1HD8 A;  4OKP A;  1O7E A;  4WM9 A;  1AXB A;  3BEC A;  2WZX A;  5FAP A;  3DTM A;  3IHA A;  3SS3 A;  1MXO A;  3LO7 A;  3VSK A;  3UE1 A;  5CEC A;  4KZA A;  4ZTK A;  5FAT A;  3VOZ A;  4GB7 A;  4GZB A;  1IYO A;  3FYZ A;  5CTN A;  2OV5 A;  4X53 A;  1KE4 A;  3ZVW A;  2A3U A;  2Y4A A;  4FD8 A;  4DE0 A;  1N4O A;  1XGI A;  4B4X A;  3UPO A;  1XA1 A;  3IWQ A;  4YIN A;  4JF4 A;  4U3T A;  1Q2Q A;  1MWU A;  2XD1 A;  1CI8 A;  3V39 A;  4OQH A;  5DTK A;  2WK0 A;  1ES2 A;  4WYY A;  4EUZ A;  5EOO A;  4DDS A;  5DTT A;  3UN7 A;  4OOM A;  1PWG A;  4GDB A;  4OH0 A;  3LY4 A;  1NRF A;  4EBP A;  1YLZ A;  5J8X A;  4KQO A;  4E3I A;  5GLC A;  1GHI A;  3NC8 A;  4IBR A;  1YLT A;  5FQJ A;  1ERM A;  1XGJ A;  1KE0 A;  4KZ6 A;  5CHU A;  5FI7 A;  2RL3 A;  1IYS A;  4QU3 A;  1IEM A;  1ALQ A;  3QNC A;  4X69 A;  5G18 A;  2EXA A;  2Y2K A;  4MBK A;  4HBU A;  1NZO A;  2JCH A;  5F83 A;  2WAD A;  5CHJ A;  3FWL A;  2EX8 A;  1YMS A;  3OZH A;  3NCK A;  2HP5 A;  5EVI D;  4X56 A;  1ERQ A;  2Y2Q A;  2H5S A;  5FI2 A;  1H8Z A;  5F1F A;  4KZ9 A;  3IXB A;  4EWF A;  4PM6 A;  4ZJ3 A;  4E3J A;  3AGE A;  1DY6 A;  5EVI A;  1BLS A;  1W5D A;  3GR2 A;  1ZC2 A;  3VOY A;  3DWZ A;  4K0W A;  1YLP A;  2G2U A;  3D4F A;  2E8I A;  1IKG A;  3MKE A;  5HL1 A;  1XPB A;  2EX6 A;  1JWP A;  2ZQC A;  4E3N A;  1BSG A;  3MXS A;  2I72 A;  1IYP A;  1L0F A;  5E2E A;  1BLP A;  3MZE A;  3IWO A;  4JLF A;  2DRW A;  4BQM A;  2WGV A;  3IXG A;  1YLJ A;  3BM6 A;  3Q7Z A;  2QZ6 A;  4OPR A;  5F82 A;  2G2W A;  4YFM A;  5CTM A;  3G30 A;  4WEL A;  3G2Z A;  1LLB A;  2Y2H A;  2Y2N A;  1Q2P A;  3IF6 A;  3M2J A;  3N8L A;  4OPQ A;  5DF9 A;  1ES3 A;  4U0T A;  2OLV A;  5E2G A;  4ZJ1 A;  1L0D A;  4D2O A;  2Y55 A;  1K4E A;  5E2F A;  2FFY A;  3LY3 A;  4N1H A;  4BL2 A;  4HEF A;  5E2H A;  1PWC A;  3FKV A;  3G34 A;  2ZC7 A;  1FOF A;  3M2K A;  2C5W B;  2H10 A;  1RP5 A;  3MBZ A;  4KZ7 A;  1U60 A;  4S2K A;  5KSC A;  1K56 D;  3PBO A;  4EBN A;  1Y54 A;  3Q1F A;  1JWV A;  3EQU A;  4FH4 A;  4H8R A;  1K54 A;  2EFU A;  4R3B A;  2IWB A;  5EE8 A;  1JTD A;  2IWC A;  1K6S A;  1K56 A;  2CC1 A;  1E25 A;  4U0X A;  1FSY A;  3V3R A;  3OPP A;  3G2Y A;  1YT4 A;  2XDM A;  4JXW A;  3ZHH A;  4WBG A;  4K0X A;  1G6A A;  3OPH A;  5IHV A;  3WS0 A;  4OPZ A;  2R9X A;  2PU4 A;  3TG9 A;  4Y0U A;  4C6Y A;  4E6W A;  5FAO A;  1ONH A;  3IH8 A;  2V20 A;  4GN2 A;  1FCO A;  4KQR A;  4N9L A;  3N8S A;  4BD1 A;  4DE3 A;  3HBR A;  4QY6 A;  4DE1 A;  4ID4 A;  3N7W A;  4RYE A;  2IWD A;  4LV3 A;  5AQB A;  3UPN A;  3ZGA B;  1M6K A;  1O07 A;  5CXW A;  1CI9 A;  3ITB A;  3UE0 A;  4OON A;  4X6T A;  4X68 A;  3HVF A;  3ZG7 B;  3IXD A;  1YM1 A;  1PI5 A;  3OC2 A;  5HW3 A;  4WZ5 C;  3ZG5 A;  2DNS A;  4S2M A;  2XD5 A;  5GHX A;  5L2F A;  3P09 A;  1ES4 A;  2VGK A;  4NK3 A;  1HZO A;  4DXC A;  5I94 A;  4EV4 A;  1L2S A;  3UDF A;  5HFO A;  2EX2 A;  4OLD A;  5A92 A;  2WZZ A;  3IXH A;  1K57 C;  2Y2G A;  4S2O A;  3V5M A;  3FZC A;  2WKE A;  2J9O A;  4UAA A;  3AGD A;  3S22 A;  3GMW A;  4KZB A;  5GHZ A;  4Q8I A;  3UPP A;  1BLC A;  1PZP A;  3BEB A;  4JXS A;  4KG6 A;  4GD8 A;  4PM5 A;  2V2F F;  4JXV A;  4JXG A;  3MXR A;  3HRE A;  5FQQ A;  3HUN A;  5TR7 A;  1S6R A;  2V1Z A;  3SS5 A;  1WYC A;  1Z6F A;  1FQG A;  2J7V A;  4P85 A;  1KGG A;  3W8K A;  4K91 A;  3ZCZ A;  2HPB A;  2EX9 A;  2ZM8 A;  3N4I A;  5M1A A;  2WYX A;  2Q9N A;  3UDX A;  1LL9 A;  2ZQD A;  4S2N A;  4LV1 A;  4OQ0 A;  2BG1 A;  2PBY A;  3QHY A;  4JF5 A;  4PPR A;  1K4F A;  4IED A;  1PZO A;  2J8Y A;  5EOE A;  3VP1 A;  1K6R A;  2P9V A;  3UDI A;  4QY5 A;  1I2S A;  1TDL A;  3WRZ A;  2PU2 A;  4LCL A;  5JYP A;  1ESU A;  4RA7 A;  2H0T A;  4HBT A;  1IYQ A;  1KE3 A;  2XGN A;  3BFD A;  4FSF A;  1NZU A;  3JYI A;  1QME A;  1GA0 A;  4GD6 A;  4GKU A;  4S2I A;  4DDY A;  4OPY A;  5FI6 A;  2Z2L B;  2ZC4 B;  4XUX A;  2Y91 A;  3PAE A;  3IF6 C;  3HLC A;  3C7V A;  3GQZ A;  4KZ8 A;  3AGF A;  2X02 A;  4OLG A;  2Y2M A;  4S2P A;  1E3U D;  5FQ9 A;  2ZC5 B;  1ONG A;  1PIO A;  3C4O A;  2Y2L A;  4RX2 A;  3A3E A;  2WGW B;  2ZM0 A;  3M6H A;  4QD4 A;  5DVA A;  5E43 A;  4GNU A;  3W4O A;  1XKZ A;  3MZD A;  4DE2 A;  2EXB A;  2Z2M B;  1K25 A;  1FR6 A;  3HLE A;  3N8R A;  3BFF A;  2Y2P A;  1LI9 A;  4MBF A;  4KQQ A;  5TGF A;  1IKI A;  2BLS A;  5DTS A;  5U47 A;  1G68 A;  5FDH A;  5JYO A;  4PM9 A;  2ZC6 B;  1BUE A;  3E2L A;  2QPN A;  1ZG6 A;  2H0Y A;  4E6X A;  3PAG A;  3ISG A;  4EBL A;  1YLY A;  3SH8 A;  4UA6 A;  1IEL A;  2P74 A;  4DF6 A;  4MBH A;  3RXX A;  3DWK A;  5FAQ A;  1TEM A;  1PW8 A;  3BLS A;  3E2K A;  1LL5 A;  4UHU A;  4LV0 A;  3SS4 A;  1K55 A;  2ZC3 B;  3LCE A;  3PTE A;  4S2L A;  2HP6 A;  1PYY A;  5FQI A;  3O88 A;  4R4R A;  1K38 A;  1VM1 A;  5EEC A;  4GDN A;  5M19 A;  3HL9 A;  1MWR A;  1YLW A;  3IHB A;  4UA9 A;  5KZH A;  5HAQ A;  1JVJ A;  3VP4 A;  2ZD8 A;  3MKF A;  1SHV A;  4KZ4 A;  4OP5 A;  3C5A A;  3TSG A;  4R23 A;  4BEN A;  1ZG4 A;  3BLM A;  2WUQ A;  1YMX A;  4L0L A;  2Q9M A;  3HLB A;  3SH9 A;  4E3O A;  2XQZ A;  3RJU A;  4LV2 A;  4R4S A;  4OOL A;  4BLM A;  2UWX A;  2JC7 A;  3A3J A;  4WMC D;  5F1G A;  1GA9 A;  3CMZ A;  3WS1 A;  4E3K A;  3BFE A;  2ZQ8 A;  3IWI A;  1FCM A;  4Z9Q A;  3BYD A;  3BFC A;  1DJA A;  4E3L A;  3GV9 A;  5CED A;  3NDG A;  2HDR A;  1TDG A;  5HAR A;  5BOH A;  4WMC A;  3VMA A;  1XP4 A;  3S1Y A;  3W4P A;  4C75 A;  1M40 A;  1RCJ A;  2WAE A;  2ZLY A;  3ZVT A;  1CK3 A;  3W4Q A;  3PBN A;  3IF5 A;  4JPM A;  2J9P A;  3CZD A;  3G32 A;  5KSH A;  1NXY A;  3VP0 A;  4C3Q A;  1W8Y A;  3CJM A;  4ZBE A;  1HVB A;  1FSW A;  1PW1 A;  3GTC A;  2ZQ7 A;  2OLU A;  4N9K A;  1WE4 A;  5GLD A;  4WZ4 A;  1MWS A;  4NET A;  4ZJ2 A;  3TOI A;  4B4Z A;  1KGE A;  4LEN A;  4BL3 A;  1SCW A;  5KMW A;  3NIA A;  3IQA A;  3UE3 A;  4RVA A;  2WKI A;  5CGW A;  3NBL A;  5CEB A;  3A3D A;  1MPL A;  2QMI A;  4LCM A;  3OCN A;  1BTL A;  1ZKJ A;  1LI0 A;  2DCF A;  4KG5 A;  5DF8 A;  4B88 A;  1BUL A;  1DJC A;  3FV7 A;  1EI5 A;  3A3I A;  4XXR A;  1RGZ A;  3HLG A;  4OVD A;  3EQV A;  4S2J A;  1JTG A;  2WGI A;  3GRJ A;  3O86 A;  5EVI C;  2ZMA A;  1NYM A;  5A91 A;  4O7D A;  3O87 A;  3UY6 A;  4Y7P A;  1NYY A;  3IT9 A;  1KVL A;  3ZFZ A;  4OP8 A;  1FR1 A;  3OPR A;  5AQ7 A;  3FKW A;  3Q82 A;  3WS5 A;  4PMA A;  2B5R A;  3CG5 A;  1MWT A;  2HP9 A;  3IF6 B;  2ZQ9 A;  1E4D A;  1KDS A;  3Q7V B;  1KVM A;  3MFD A;  3OCL A;  1TVF A;  3Q81 A;  4MEZ A;  2OSU A;  4DXB A;  4P6B A;  1ESI A;  1XX2 A;  4N1X A;  3VSL A;  2HDQ A;  4IVK A;  5FA7 A;  3GSG A;  4WZ5 A;  1XXM A;  2JE5 A;  1MBL A;  1KGF A;  2HDU A;  4WEK A;  3VFH A;  4OQG A;  4ZAM A;  3V50 A;  2Y2I A;  2ZM2 A;  3WRT A;  4R0Q A;  2X71 A;  2WKH A;  3I7J A;  1GHM A;  2XF3 A;  2GDN A;  1BZA A;  1FCN A;  1K57 A;  4PM8 A;  3S4X A;  1RGY A;  5A90 A;  3G31 A;  5CRF A;  3BFG A;  1SDN A;  4P87 A;  4Y0T A;  1CEG A;  3ZG0 A;  5GLB A;  1LHY A;  2Y2J A;  1SDE A;  1K55 C;  3NDE A;  1NJ4 A;  4PM7 A;  5AQA A;  5DF7 A;  3Q07 A;  5EVL A;  1C3B A;  3IH9 A;  3VP2 A;  1ERO A;  5GLA A;  1PI4 A;  1E3U A;  1ES5 A;  1K54 C;  4Y0O A;  1GHP A;  5M18 A;  5GHY A;  3PBR A;  5TFQ A;  3WS2 A;  2JBF A;  2ZQA A;  1MY8 A;  4FCF A;  2A49 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...