4FH2A

Structure of s70c beta-lactamase bound to sulbactam
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
265
structure length
265
Chain Sequence
b'SPQPLEQIKLSESQLSGRVGMIEMDLASGRTLTAWRADERFPMMCTFKVVLCGAVLARVDAGDEQLERKIHYRQQDLVDYSPVSEKHLADGMTVGELCAAAITMSDNSAANLLLATVGGPAGLTAFLRQIGDNVTRLDRWETELNEALPGDARDTTTPASMAATLRKLLTSQRLSARSQRQLLQWMVDDRVAGPLIRSVLPAGWFIADKTGAGERGARGIVALLGPNNKAERIVVIYLRDTPASMAERNQQIAGIGAALIEHWQR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactamase SHV-1
molecule tags Hydrolase/hydrolase inhibitor
source organism Klebsiella pneumoniae
publication title Crystal structure of a pre-acylation complex of the beta-lactamase inhibitor, sulbactam, bound to a sulfenamide bond containing thiol-beta-lactamase
pubmed doi rcsb
total genus 96
structure length 265
sequence length 265
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2012-06-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 4fh2A00
1PW8A 5EOOA 4OVDA 1ESIA 1FCOA 2RCXA 3PAEA 2WK0A 3HUOA 3Q7VB 4K91A 4B4XA 4B4ZA 2Y2LA 1PW1A 4S2KA 4U0TA 2J9PA 3N7WA 3GR2A 1GA0A 1XP4A 2ZQDA 3CJMA 1ERQA 3LCEA 4Q8IA 1IKGA 4KZ8A 4QB8A 4Y0UA 3W8KA 3ZHHA 3G2ZA 2G2WA 4LCMA 4ZAMA 1KVMA 2XD5A 1GHMA 1HTZA 3ZFZA 2Y2PA 1GHPA 3IF6C 5FQMA 4JXGA 3VP2A 4C75A 3LY3A 4P0MA 3VFHA 5DF8A 3HLDA 1ES4A 5L2FA 1YLZA 5HAQA 2EX2A 4JXVA 1KE3A 3BFGA 1GCEA 3NY4A 4UAAA 4UA9A 5FSRA 2WKEA 4ZTKA 1I2WA 3HUMA 2WGWB 4PM9A 3FZCA 5TGFA 4LV0A 4OPZA 4U3TA 3G34A 1LHYA 1FSWA 3QNCA 2P9VA 4DE0A 4EQIA 1K4EA 5FA7A 1BSGA 2WGIA 3VP1A 4R3JA 5E2EA 1IYOA 4OOLA 5HARA 4NETA 1AXBA 2PBYA 4BENA 4EBPA 4OKPA 1RCJA 5DVAA 2ZQ7A 2HPBA 1NZOA 4KQOA 3ITAA 4OLDA 3ZNYA 2P74A 4E3KA 1DY6A 4DDSA 1U60A 2XR0A 3NIAA 5F82A 1O07A 3ZG9B 2Y2QA 4F94A 1YLYA 3BRMA 1FQGA 3UY6A 5KZHA 3OZHA 4R23A 1K54A 5FQIA 1FR1A 3S4XA 4LV3A 4H8RA 3UE0A 1K57C 1H8ZA 3I7JA 1S0WA 4KZ9A 4ZJ2A 3VP0A 1VQQA 3IHAA 4EV4A 1K4FA 2J9OA 3O3VA 1H5XA 1YLTA 5A92A 4FH4A 1FSYA 2FFFB 5HW3A 1LL5A 2WGWA 4LENA 1L0FA 1ERMA 3G32A 2Q9NA 1E3UD 1W5DA 4N92A 1EROA 2CC1A 4IVKA 1E3UA 2XEPA 1H8YA 3IF6B 2Y2IA 2DCFA 1XGJA 3G4PA 4FD8A 2IWCA 5CGSA 2WKHA 3MKEA 5CECA 4QJGA 4KG5A 4X6TA 3DTMA 3EQVA 2Q9MA 5IHVA 1IEMA 4RX3A 1I2SA 2Y2NA 2EX6A 2A3UA 2XQZA 2XLNA 4P6BA 1OMEA 1JWVA 4PM7A 4GDBA 4N9KA 4JF4A 3UDXA 4JF5A 4KZ5A 2BLSA 4RX2A 2ZC4B 1PZPA 3C4OA 3A3EA 2HDUA 3W4QA 5EOEA 4DXBA 4KZ6A 3VSKA 1PWCA 4OPQA 1KE0A 2Y2MA 3OC2A 4DKIA 3MFDA 4NK3A 1SHVA 3N8RA 2HP5A 4X69A 3A3FA 1Z6FA 1KDWA 5DTSA 2OSUA 3UE3A 1ONGA 5GHYA 1O7EA 5I94A 1EI5A 1KGEA 2IWDA 1YMSA 3GQZA 4MBHA 4MNRA 4IBXA 1Q2QA 2Y2GA 1SDEA 1KVLA 3UE1A 1E4DA 4MLLA 3S22A 4PPRA 1K56D 2XF3A 3IWQA 2WZZA 1RGZA 1NYYA 2EXBA 3Q82A 5FQJA 1BULA 1CEFA 1PYYA 5E2FA 2ZJ9A 1VM1A 3UN7A 3OPPA 4OPRA 3HUNA 1K38A 4GN2A 5GLDA 1JTGA 4ZDXA 1IYSA 4KG6A 2R9WA 1PI5A 1M40A 1NRFA 4HBUA 2WZXA 4OQIA 1ES3A 4QY5A 4S2IA 1J9MA 4BD0A 5F1GA 5FQQA 2WAEA 5FASA 3PBRA 1SCWA 3PAGA 4GOGA 5FI6A 3WS0A 1WYBA 3VMAA 3IT9A 5GHZA 2H10A 1YLJA 3PBSA 3P09A 2V20A 1K6SA 3HLFA 3TG9A 3D4FA 1W8QA 5FDHA 3V3RA 5JYOA 1GA9A 1BLPA 3HL9A 1BTLA 4BLMA 3ZNTA 3Q81A 3NC8A 2E8IA 4OQGA 5DF9A 1M6KA 4N1HA 4ZBEA 3UDIA 3NBLA 5FAQA 3N8LA 3O88A 1RP5A 4P85A 3ZVWA 2B5RA 4PM8A 1HVBA 1MXOA 1IKIA 3NI9A 2C5WB 3P98A 5FATA 2XK1A 4PMAA 1JWPA 4KENB 4X56A 1FCMA 5EUAA 2ZMAA 1IYPA 5CERA 3OPRA 2X71A 3SH7A 5AQAA 1PWDA 1CI8A 3IXBA 1K57A 4S2MA 4JKTA 5CHJA 5HFOA 3SS5A 1Y54A 1QMFA 2JE5A 3WS4A 4PM5A 1LL9A 2EX8A 3AGFA 4R1GA 1K6RA 2WKIA 5CTMA 2WAFA 3FV7A 3V50A 4D2OA 4Y0TA 4FSFA 1JVJA 1NYMA 3Q7ZA 1FR6A 1L2SA 1BUEA 2WGVA 4QU3A 5HL1A 1XA1A 5A90A 2XDMA 4S2LA 3UPPA 4WZ5A 2P9VB 3DW0A 3PTEA 3BYDA 4N9LA 3C7UA 4CJNA 4OQHA 4DF6A 5F1FA 4KZAA 4DE1A 3ZG5A 3G30A 5E2GA 5CTNA 4N1XA 1EWZA 2X01A 4EBLA 4LCLA 2HDSA 1L0EA 2Y2OA 1PIOA 1HD8A 4BD1A 4GKUA 1YLWA 1BLSA 2Y4AA 3SH9A 3UPNA 3IF6A 3NCKA 3OCLA 3Q07A 3IXDA 4C3QA 3LEZA 2GDNA 3WS1A 4EWFA 3OPHA 1MWRA 1BLHA 3ZG0A 3HLGA 3IWIA 4EBNA 2Y91A 3BECA 3BFFA 4JPMA 3UNWA 2PU2A 5M19A 4FCFA 4PM6A 1XA7A 2FFYA 3MZFA 3RJUA 1K56A 5HX9A 2DNSA 4IVIA 1JWZA 3HLBA 1I5QA 4Z9QA 4OPYA 1YMXA 1ZG4A 4R4SA 5A91A 2JCHA 3CG5A 5GHXA 1TDLA 4U0XA 4KZ4A 4S2PA 3UDFA 2QPNA 5M1AA 3HLEA 3GMWA 3ZG7B 5F83A 2EFXA 4LV1A 1KE4A 2Y59A 3E2KA 2EX9A 3BLMA 3LO7A 1K54C 1YQSA 4WMCD 3M2KA 2RL3A 1G6AA 3VSLA 3BFDA 4X53A 4JXSA 5EE8A 4E3MA 4E3OA 5GLBA 2X02A 3IH8A 2ZM8A 3IQAA 4WYYA 4WM9A 3ZCZA 4OQ0A 1G68A 1ESUA 2VGKA 5M18A 3BEBA 4E6WA 1YLPA 5CEDA 4IEDA 3AGEA 2C6WB 3RXXA 4A5RA 4E3IA 3WWXA 5FAPA 3GTCA 3M6BA 3VFFA 2ZD8A 4E3NA 5EVIA 1ALQA 4WMCA 3WS2A 3IXHA 1IELA 5EVID 3IXGA 4WELA 1MWSA 1TVFA 3AGDA 5EECA 4ZJ1A 1KGGA 2J7VA 4XUXA 4OP5A 1MPLA 3VP3A 3ZDJA 4RVAA 5FAOA 3A3JA 1FOFA 3VOZA 3Q1FA 1K55A 4K0WA 3W4OA 4B88A 3M6HA 3QHYA 4BQMA 1MWUA 2I72A 1XXMA 4S2NC 5CXWA 4JF6A 1YT4A 4RYEA 2ZLYA 3NDEA 4DRTA 3SH8A 4UHUA 2QZ6A 4MEZA 3IF5A 5CHMA 5DTKA 5FI2A 5DF7A 1XKZA 5AQ9A 1N9BA 5TFQA 4KG2A 3SS4A 4DDYA 4GD8A 1N4OA 4IBRA 1CK3A 1ZG6A 1FCNA 5G18A 1W7FA 4YFMA 5U47A 2OLVA 2UWXA 2ZC3B 3IWOA 3LY4A 1K55C 2XGNA 3G2YA 1ZKJA 3GSGA 3GRJA 3FKWA 2IWBA 3G35A 1DJAA 2ZQ8A 3MKFA 3MXSA 3MZEA 4O7DA 4R0QA 4S2OA 3A3DA 1JTDA 4QD4A 4QY6A 1L0GA 3V5MA 1TDGA 4OH0A 3WS5A 4YINA 1NY0A 5CGWA 1C3BA 1PWGA 3VP4A 2A49A 3UO9A 5CRFA 4XXRA 1WE4A 1W8YA 3M2JA 1YM1A 1K25A 4Y7PA 3SS3A 5KSHA 4DE2A 4E3JA 4ZJ3A 1TEMA 4BL3A 3BFEA 5BOHA 4R4RA 2V1ZA 3Q7VA 3RXWA 1CEGA 1XX2A 2JBFA 4JBFA 3A3IA 4R3BA 2XH9A 2PU4A 5FI7A 1L0DA 2Y2JA 4X68A 5AQ7A 1ONHA 1W79A 3ZVTA 1MBLA 1PZOA 4GB7A 3MZDA 3OPLA 4CPKA 1LI9A 4C6YA 2QMIA 3N8SA 4OOMA 3PBTA 4OOYA 5GLAA 3EQUA 3MXRA 2XFSA 1XPBA 5HAPA 2V2FF 3DWZA 3HREA 2ZM0A 4GD6A 1Q2PA 3IHBA 2Y2HA 3N4IA 3B3XA 5D3OA 3V3SA 2ZQ9A 3MBZA 3PBNA 3W4PA 3VOYA 1LLBA 3ZG8B 5EPHA 5HAIA 3N6IA 1GHIA 2OV5A 1NXYA 1BZAA 2ZM2A 1DJBA 4OLGA 4S2JA 5CHUA 1PI4A 4JLFA 3O86A 3SOIA 3HLWA 4LV2A 2J8YA 5FQ9A 2WYXA 3HBRA 2H0YA 4JXWA 5FQKA 5GLCA 3JYIA 5AQBA 2H5SA 5A93A 4KZ7A 5E43A 1XGIA 3C7VA 5KSCA 2JC7A 2Y2KA 3ZGAB 1QMEA 3FKVA 1SKFA 4WEKA 5KMWA 4L0LA 3HLCA 3CMZA 4UA6A 1BT5A 4WEJA 2HP6A 1ES2A 4MBKA 5EVIB 4X55A 2OLUA 4UA7A 1KDSA 3TOIA 4WZ4A 3GV9A 3PBOA 4DE3A 1WYCA 4EUZA 4BL2A 5EVIC 2H0TA 4KQQA 2R9XA 4HEFA 1MWTA 2XFTA 3E2LA 5JYPA 1RGYA 5TR7A 4KZBA 3OCNA 3V39A 1SDNA 3CZDA 4KZ3A 4WBGA 4BJPA 1DJCA 2WADA 4ID4A 2DRWA 5J8XA 4MBFA 1MY8A 4P87A 4WZ5C 1CI9A 3FWLA 2ZQAA 1LI0A 3PBQA 3C5AA 3BFCA 5GL9A 2HP9A 4GNUA 4DXCA 1NZUA 3QNBA 4GZBA 2XD1A 2BG1A 4QHCA 1NJ4A 5CEBA 3UPOA 3ITBA 3NDGA 2Y55A 3HVFA 2WUQA 4Y0OA 2ZC5B 1ZC2A 4E6XA 1S6RA 3IH9A 4XUZA 3O87A 5CGXA 2ZC6B 3C4PA 3ISGA 1ES5A 2ZQCA 3WRTA 4E3LA 3DWKA 1BLCA 2EXAA 5EVLA 1MKIA 2HDRA 2Z2LB 1IYQA 5E2HA 2Z2MB 5DTTA 2EFUA 4OP8A 2VGJA 3GVBA 3WRZA 1E25A 3TSGA 4K0XA 2ZC7A 1KGFA 4FH2A 4HBTA 3BLSA 3G31A 2HDQA 4GDNA 1HZOA 3S1YA 3FYZA 2G2UA 4RA7A 3BM6A 4S2NA 4OONA 4M3KA 4KQRA 4HESA
chains in the Genus database with same CATH superfamily
4OVDA 2OWJA 3HUOA 2V0WA 4S2KA 3T4OA 4HH2A 4U0TA 4I3AA 3NOPC 1GA0A 3T4JA 1ERQA 3LCEA 4L9GA 4QB8A 5FEGA 4Y17A 2JN7A 1KVMA 5FQMA 3FG8A 3C8CA 3VP2A 2VV6A 1KE3A 5K5BA 4UAAA 1I2WA 2WGWB 4OPZA 2W3FA 3G34A 1DP9A 2KOIA 4NETA 4HJ6A 4EBPA 2ZQ7A 3T50A 2XROA 3CLOA 1DY6A 5CX7A 2PR5A 3NIAA 4KUKA 4LPZA 3DTKA 3OZHA 5FQIA 1FR1A 3VP0A 4RQ9A 4EV4A 1K4FA 3DTIA 3F1OA 3G32A 1A0KA 4WN5A 4N92A 3T1SA 2CC1A 1E3UA 5HDSA 3IF6B 4I38A 4ETZA 3CAXA 4FD8A 5CECA 4X6TA 3VE3A 5IHVA 1IEMA 1D06A 1I2SA 2Y2NA 2EX6A 1DP6A 2A3UA 2XQZA 3K2NA 4GDBA 4RX2A 3A0VA 4QWOA 4DXBA 1K0KA 3OC2A 2BASA 3MFDA 4NK3A 1SHVA 2HP5A 2QHKA 3A3FA 3CPTA 1Z6FA 3UE3A 1O7EA 1Q2QA 1KVLA 1E4DA 5F69A 1K56D 2XF3A 3IWQA 1NYYA 2HJ9C 1UGUA 4GN2A 5IT5A 1NLYA 1W63M 3CUEC 1YKDA 1PI5A 1NRFA 3NECA 5FEFA 4QY5A 1J9MA 4BD0A 4CLCA 2WAEA 1MZUA 1SCWA 3PAGA 4GOGA 3CWFA 4CQHA 3KSHA 1YSPA 2H10A 3PBSA 5EM1A 2ZL1A 3TG9A 1GSVA 1BLPA 4BLMA 4OQGA 4ESPA 1M6KA 2HV1A 1MXOA 2C5WB 4PMAA 4KENB 1FCMA 3SH7A 2HJEA 3OPRA 5CERA 1T1AA 3IXBA 4S2MA 2JKTI 4JKTA 4EERA 1Y54A 1QMFA 4PM5A 1LL9A 2WKIA 4Y13A 4FSFA 2JKGA 5MC7A 4H6JA 4QU3A 3KO6A 2VGLM 2W3HA 2XDMA 4S2LA 2P9VB 4N9LA 3DW0A 2PHYA 4LRZE 4FTXA 1OPXA 3LR3A 4L9EA 3BY9A 4KZAA 3MJQA 3ZG5A 2W27A 3LR5A 4EBLA 2Y2OA 4DJ2A 1BLSA 2Y4AA 1FIKA 3MF0A 3OCLA 1VEUB 4X1MA 3OPHA 3ZG0A 3D9YA 2L4RA 5FDSA 2Y91A 2PU2A 1T1CA 4FCFA 1PNEA 1XA7A 2FFYA 4PM6A 2Q0OA 1JWZA 3HLBA 2INWA 2KLIA 1OTDA 3EOIA 3PXPA 4U0XA 4KZ4A 5M1AA 3GMWA 3E2KA 3BLMA 3LO7A 1K54C 3O5YA 3M2KA 3BJNA 2NUPC 3BFDA 4GJ4A 2O0YA 4WYYA 5M18A 2YKHA 4E6WA 1YLPA 4CLCB 4IEDA 3VE4A 2C6WB 4A5RA 4WL9A 2XA7S 4E3NA 5EVID 5EECA 2FH5A 4XUXA 4OP5A 2W1RA 5AVEA 3VP3A 2UV0E 3VOZA 4K0WA 4B88A 2O9BA 4JF6A 3ZQ5A 3H82A 4RYEA 2ZLYA 3SH8A 4GS9B 3R7WB 3LR0A 3IF5A 5CHMA 5DTKA 5TFQA 3SS4A 3KYEA 1FCNA 3G2YA 3GRJA 3FKWA 4WF0A 4G3WA 3G35A 3MKFA 3MZEA 5FASA 1L0GA 1LSXA 4HI4A 2WKQA 1W8YA 1YM1A 4Y7PA 4B93A 4ZJ3A 4G3KA 1TEMA 4I39A 3BFEA 5BOHA 4H6JB 4EW7A 3A3IA 2XH9A 2Y2JA 3KSGA 2A2LA 3ZVTA 1MBLA 1LI9A 4OOMA 2HZ5A 3MR0A 5TJJA 5F5YA 3IBJA 3PBNA 3ZYTA 3W4PA 1LLBA 5EPHA 2OV5A 3UB6A 1DJBA 4OLGA 4S2JA 1PI4A 3SOIA 1GSXA 4LV2A 5GLCA 3L7HA 5A93A 3FC7A 3D3OA 4KZ7A 4HJ3A 5G4YA 2Y2KA 4WEKA 3KSFA 5KMWA 3HLCA 2LB5A 3CMZA 4R3AA 4WEJA 4MN6A 4JGRA 2Z6CA 3PBOA 2H0TA 4HEFA 1PRQA 3OCNA 4WBGA 1DJCA 2DRWA 2ZQAA 1LI0A 3C5AA 1S1ZA 3T12B 4DXCA 4Z1WA 1NZUA 3QNBA 3DTEA 4QHCA 1NJ4A 5L8MA 4R6LA 3ITBA 1S6RA 4GLQA 3IH9A 4I5SA 4HOIA 4O01A 3K3DA 3DWKA 1BLCA 1MKIA 1IYQA 2EFUA 2VGJA 3GVBA 3JVUA 1E25A 2JKRM 1KGFA 2D01A 4HBTA 4ZRRA 3BLSA 3G31A 1HZOA 4RA7A 3BM6A 2PD8A 5L10A 3PHYA 1PW8A 3IS2B 1ESIA 1S66L 1FCOA 3Q7VB 2Y2LA 2V8CA 3N7WA 4DN0A 1XP4A 3OBFA 2ZQDA 1IKGA 3ZHHA 2WKPA 5DKKA 1HTZA 1GHPA 4BWIA 4JXGA 5DF8A 2JHEA 4JXVA 3NY4A 4UA9A 1IFQA 3FZCA 4LV0A 4YNRA 3G6OA 2KDKA 4EQIA 3VP1A 2OAP1 5E2EA 2V0UA 2PBYA 3QP8A 4BENA 3MXQA 5DVAA 2HPBA 1NZOA 5L07A 2XR0A 1VHMA 5F82A 3E4OA 2EWVA 1IOUA 3BRMA 1FQGA 1V9YA 5KZHA 4R23A 2A24A 3S4XA 4LV3A 4H8RA 4KZ9A 3GDIA 4JGQA 1P9RA 2J9OA 3T4KA 3C30A 2VZWA 3MSHA 5A92A 4FH4A 1FSYA 1LL5A 1ERMA 4IVKA 4XT2A 4IUHA 3LEQA 2Y2IA 1XGJA 3T1RA 3ICYA 5KIZA 2E8JA 2IWCA 2WKHA 2CMNA 4NXEA 4RX3A 5I5LA 2XLNA 4P6BA 1OMEA 5F68A 5AVFA 1LT0A 3C4OA 3A3EA 3W4QA 4DKIA 3FPWA 3D72A 5DTSA 3B33A 1XJ6A 3IX4A 3SZTA 3GQZA 1T18A 3UE1A 4HH3A 4Y2FA 2J3TD 3VOLA 1CEFA 1VM1A 2W1TB 3UN7A 4OPRA 1K38A 2O9CA 1JTGA 5A8BA 1S67L 4KG6A 2R9WA 4S2IA 5FQQA 3PBRA 4JGOA 4GW9A 3IT9A 5GHZA 3P09A 1GSWA 5FDHA 3V3RA 1BTLA 5DF9A 5FAQA 1RP5A 2B5RA 1IKIA 1JWPA 1EW0A 5EUAA 5AQAA 3E4QA 1UWNX 4R1GA 4Y0TA 2WAFA 4D2OA 1NYMA 1L2SA 4AFIA 2AVXA 5HL1A 1XA1A 3DAVA 2M1CA 1TD5A 4HQAA 4WZ5A 4OQHA 1G6OA 2B02A 5E2GA 3F1PB 2X01A 5J4EA 1L0EA 1PIOA 1HD8A 4GKUA 3UPNA 4NXFA 2VV7A 3IF6A 3CUEA 3EEAA 2GDNA 1MWRA 3QP4A 3MFXA 3BFFA 3RFBA 2H28A 2PR6A 2VA0A 4IVIA 1I5QA 4Z9QA 1D7EA 1W63Q 2V1BA 1YMXA 2PYRA 1G5UA 3GECA 5A91A 3TJZC 3BQAA 1VB6A 1TDLA 4S2PA 3UDFA 4I3IA 2QPNA 3HLEA 3ZG7B 2EX9A 1G6AA 4MCWA 4E3OA 3NOTC 5GLBA 1OTIA 4HHDA 3IQAA 4WM9A 1VETB 4OQ0A 2VGKA 1ESUA 1P0ZA 3BEBA 5CEDA 4Q0HA 3M6BA 3VFFA 2ZD8A 3WS2A 1IELA 3IXGA 2ZOIA 1TVFA 1F5MA 1KGGA 1N9LA 2J7VA 3DBAA 4EXOA 5FAOA 3T4TA 3LI8A 3LI9A 1FOFA 2VJWA 3B47A 2I72A 5CXWA 4R38A 1YT4A 2YKFA 3NDEA 4DRTA 2QZ6A 4MEZA 5DF7A 1XKZA 2L0WA 4K08A 3LIAA 3CITA 1CK3A 2OLVA 2ZC3B 3IWOA 1TS7A 3LY4A 3PYPA 1K55C 1DJAA 4R0QA 4S2OA 4QY6A 1TDGA 4OH0A 3VP4A 3UO9A 2Y79A 1WE4A 3M2JA 2MJ6A 3SS3A 4E3JA 3LICA 2V1ZA 2ACGA 4R4RA 3Q7VA 2ZBBA 4JBFA 4HIAA 4UQIM 4X68A 1ONHA 2VEAA 4EU0A 3PR6A 4HY8A 4CPKA 2JKTM 1H0MA 3KSIA 4OOYA 5GLAA 2XFSA 2ZM0A 3IHBA 2PAVP 4FOFA 3N4IA 3S7PA 5D3OA 3V3SA 3EEHA 5HAIA 3N6IA 2QJ7A 1BZAA 2ZM2A 4IJGA 4DMZA 5HWWA 3O86A 3K3CA 5HSQA 4BBTA 4JXWA 5FQKA 3JYIA 3MQQA 3MQOA 2JC7A 3TE8A 3ZGAB 3FKVA 1SKFA 4Y15A 4ME4A 4UA6A 4HP4A 2OLUA 4P6ZM 1KDSA 4WZ4A 4DE3A 1WYCA 4BL2A 1P9WA 1Y28A 1MWTA 2XFTA 3E2LA 4KZBA 3V39A 4KZ3A 2WADA 4ID4A 4MBFA 1CI9A 1H8MA 3PBQA 4GS9A 2QWSA 4GNUA 5EM0A 5HDDA 3NDGA 4D60A 3E0YA 2K7SA 3RH8B 4GHIB 3ISGA 2ZQCA 3WRTA 4E3LA 5E2HA 2Z2MB 4EUVA 4FUWA 4GDNA 3FYZA 2L1MA 1AWIA 2G2UA 4M3KA 4KQRA 4HESA 2GJ3A 2RCXA 4K91A 4B4ZA 2WK0A 1PW1A 2GNXA 3A0RA 3CJMA 4Q0JA 4HNBA 4KZ8A 4Y0UA 1FILA 4C6YA 3G2ZA 2G2WA 4LCMA 5FL3A 2Y2PA 5C5KA 3IF6C 3H7WA 4C75A 3LY3A 3VFHA 3BW6A 3HLDA 3F1NA 1YLZA 5HAQA 2EX2A 3CI6A 3BFGA 1GCEA 5FSRA 5HL6A 2WKEA 4ZTKA 3A0SA 4PM9A 4M4XA 3R7WA 1FSWA 4DE0A 1K4EA 5FA7A 1BSGA 2WGIA 4II7A 4R3JA 3H9WA 1IYOA 4OOLA 5HARA 5IU1A 1AXBA 1T1BA 2OAQ1 3BWLA 5LBRA 3ITAA 2PDRA 4E3KA 1U60A 1TS0A 1O07A 2Y2QA 4EETB 1YLYA 3UY6A 1K54A 4BBVA 3UE0A 1H8ZA 3I7JA 1S0WA 4ZJ2A 3L9KA 3O3VA 1H5XA 1YLTA 1F98A 3S7NA 2QJ5A 1L0FA 2Q9NA 2XEPA 1CQAA 5CGSA 3MKEA 4QJGA 3EQVA 4ARZA 3NULA 4KZ5A 3B42A 2ZC4B 1PZPA 5EOEA 1ZTUA 2FZ0A 1ACFA 4OPQA 1KE0A 1XJ4A 2EWWA 1S4RA 4O8GA 3BY8A 1N9NA 3HJKA 1KDWA 2OSUA 5GHYA 3UB5P 4LRYC 1KGEA 4LFUA 1YMSA 2W3GA 4MBHA 4MNRA 2Y2GA 2PT7A 4MLLA 3S22A 4PPRA 2EXBA 3Q82A 5FQJA 1BULA 1PYYA 3HUNA 5F6AA 3P01A 2VX8A 1M40A 4HBUA 4QPRA 2WZXA 4OQIA 4X1LA 2W0NA 5F1GA 5FI6A 3WS0A 4O0PA 1WYBA 4GHIA 4PKYA 3VMAA 1DRMA 1K6SA 2V20A 5JYOA 4BBUA 1GA9A 3HL9A 1N9OA 3Q81A 3NC8A 4MMNA 3UDIA 5TBMA 4PAUA 5DJUA 3O88A 3ZVWA 4PM8A 1HVBA 3NI9A 5FATA 4NKPA 2ZMAA 1IYPA 2X71A 1CI8A 1K57A 3IS2A 5CHJA 3NJAA 5HFOA 1SKOA 2JE5A 3WS4A 2EX8A 3AGFA 3FV7A 1JVJA 3Q7ZA 1MKMA 1FR6A 2XA7M 1BUEA 4KQDA 4ETXA 3UPPA 3EGDC 1LSWA 3C7UA 4CJNA 1SZVA 2J3TC 5F1FA 4DE1A 3G30A 4N1XA 4Q0IA 4LCLA 2HDSA 4BD1A 2P08A 3MMHA 3NCKA 1J3WA 3Q07A 3IXDA 4C3QA 3WS1A 4EWFA 1BLHA 3HLGA 4EBNA 3UNWA 1D1JA 3RJUA 1K56A 3IBRA 5DJTA 4R4SA 3CG5A 5GHXA 4BMWA 3JPUA 3VV4A 2EFXA 3OOVA 2Z6DA 1YQSA 2RL3A 1KOUA 2B95A 4X53A 2PYPA 4JXSA 4WLAA 5EE8A 2X02A 3IH8A 2ZM8A 1G68A 3AGEA 4E3IA 3WWXA 5FAPA 3GTCA 1ALQA 4WMCA 3IXHA 5HPFA 3CPTB 1SKOB 4ZJ1A 3OLOA 3AGDA 3BQ8A 1MPLA 3HCYA 4RVAA 4PKYG 3A3JA 3T4LA 1K55A 3W4OA 2JKFA 1XXMA 4S2NC 3SW1A 2XSSA 1BYWA 1H3QA 4UHUA 4KG2A 1L3LA 4IBRA 1VETA 1CJFA 3CHWP 4YFMA 2KX6A 2XGNA 1ZKJA 2PD7A 2IWBA 2ZQ8A 4O7DA 3A3DA 1JTDA 4QD4A 3WS5A 3H82B 4YINA 1NY0A 5CGWA 1C3BA 1PWGA 2A49A 2BTFP 4XXRA 5HD3A 5KSHA 4DE2A 5DKLA 4BL3A 2VKSA 1XX2A 2JBFA 4R3BA 1T19A 2PU4A 4CLCD 1L0DA 1W79A 4GB7A 5EVEA 2OWHA 3MZDA 3UE6A 4MN7A 3N8SA 4G3VA 3PBTA 3EQUA 2B18A 2QKPA 2V2FF 3DWZA 4GD6A 1OJ5A 1Q2PA 2Y2HA 3B3XA 1NRJA 3MBZA 3EWKA 3VOYA 3ZG8B 4LGWA 3LR4A 3HLWA 3UB9A 5FQ9A 2WYXA 3HBRA 4HJ4A 5AQBA 5E43A 1XGIA 5KSCA 1BT5A 1S4SA 1CF0A 4UA7A 2HF6A 4I3JA 3GV9A 1UWPX 4F3LA 4EUZA 5EVIC 4KQQA 5J3WA 2R9XA 4EQ1A 1YAXA 1SDNA 3CZDA 1VEUA 4P87A 2OOLA 5GL9A 2HP9A 2W3EA 4GZBA 2ZC5B 1ZC2A 4DJ3A 4E6XA 5CGXA 2ZC6B 2R78A 3C4PA 4EEPA 5TBMB 2EXAA 5EVLA 3U4LP 2O9AA 4OP8A 4UQIS 3WRZA 4F3LB 2ZC7A 2HDQA 2VV8A 4HP9A 3S1YA 4Y3IA 3NHQA 4S2NA 2A24B 5EOOA 3PAEA 4B4XA 2O99A 2J9PA 3GR2A 4LLOB 2GX5A 4Q8IA 3W8KA 3HJIA 3ZFZA 4ZAMA 2XD5A 1GHMA 3U2AA 3S7OA 4P0MA 1ES4A 2J80A 5L2FA 1S1YA 4GCZA 3HUMA 5TGFA 1DP8A 4U3TA 1LHYA 4EESA 3QNCA 2P9VA 3NOUC 3QP1A 4Y5FA 4OKPA 1RCJA 4KQOA 2I9VA 4OLDA 3ZNYA 2P74A 4DDSA 3ZG9B 2VLGA 4F94A 1WA9A 2GZAA 1K57C 1VQQA 3LUQA 3F1NB 3IHAA 1MC0A 2DMWA 3UB7A 2FFFB 5HW3A 2WGWA 4LENA 1JNUA 1E3UD 1W5DA 1EROA 5AJGA 3V67A 1H8YA 2DCFA 3G4PA 4KG5A 3DTMA 2Q9MA 1F2KA 1JWVA 4N9KA 4PM7A 4JF4A 3UDXA 4JF5A 2BLSA 4CLCC 3F1OB 2HDUA 4KZ6A 3VSKA 4P6ZS 1PWCA 2Y2MA 2NUTC 3T1XA 3N8RA 4X69A 4L9FA 1OJGA 1ONGA 5EV0A 5I94A 5EFWA 1EI5A 2IWDA 5DFYA 5G4ZA 1XFQA 3QP5A 4IBXA 1SDEA 2J3WA 4MN5A 2WZZA 1RGZA 1OT9A 5E2FA 2ZJ9A 3OPPA 5GLDA 4ZDXA 1IYSA 2V9AA 3R4KA 1ES3A 4CLCE 1YLJA 3HLFA 4NEED 3D4FA 1XJ2A 1W8QA 1OTEA 1G28A 3QP2A 5HPIA 3ZNTA 2E8IA 2V1AA 4WUJA 4ZBEA 4N1HA 3NBLA 3N8LA 4P85A 3LGOA 3P98A 3TRCA 2XK1A 4X56A 4E04A 1PWDA 1ZHHB 3SS5A 1F9IA 1K6RA 2LB9A 5CTMA 3V50A 2G7UA 2EA9A 2WGVA 1OT6A 2PRFA 5A90A 3PTEA 3BYDA 2WKRA 2M7UA 1XJ3A 3TW8A 3UB8A 4DF6A 3MS6A 5CTNA 1EWZA 4JGPA 4PHTA 5IS1A 3LIBA 1YLWA 3C38A 5HZHA 3SH9A 3LEZA 3IWIA 3BECA 4JPMA 1ODVA 5M19A 3IX3A 3MZFA 3QP6A 5HX9A 2DNSA 4EEUA 1LL8A 4YOFA 4IUKA 3LYXA 4OPYA 2QYBA 1ZG4A 2JCHA 1HLUP 4MDZA 5F83A 1LSVA 4LV1A 1KE4A 2Y59A 4YWZA 4WMCD 3F1PA 3VSLA 4E3MA 4UEYA 3E98A 3RTYA 2ZMFA 3LFVA 3ZCZA 3EGXC 4NXGA 3RXXA 2W3DA 2M7VA 5EVIA 3UMEA 4R70A 4WELA 1MWSA 3H7WB 3ZDJA 1P97A 5L09A 2P04A 3Q1FA 2XRNA 3M6HA 3P7NA 3QHYA 4BQMA 1MWUA 3E4PA 5J7EA 1NWZA 5FI2A 5AQ9A 2ZMVA 1N9BA 5HD5A 4DDYA 4GD8A 1N4OA 4B9OA 1ZG6A 5G18A 5U47A 1W7FA 2UWXA 3GSGA 3MXSA 3V5MA 3FPVA 2IA2A 2V8FA 5CRFA 3LIFA 3W2ZA 4NG2A 1K25A 3RXWA 3S7QA 2JKRI 1CEGA 1YSQA 4NXBA 2W1TA 5FI7A 3T4SA 5AQ7A 2ZOHA 1PZOA 1OTBA 2PBDP 2K2NA 3JVVA 3OPLA 2QMIA 3KX0X 3MXRA 1XPBA 5HAPA 1PFLA 2VGLS 3HREA 3LIEA 1NLZA 4LRXC 2ZL1B 2VK3A 2ZQ9A 5DFXA 1GHIA 1NXYA 5HDCA 2K31A 5CHUA 4JLFA 2Y8HA 2J8YA 2H0YA 2HGVA 5HWTA 2H5SA 3C7VA 1STZA 1QMEA 1X0OA 3T4QA 3ULFA 1Z09A 4L0LA 2HP6A 5EVIB 1ES2A 4KUOA 4MBKA 4X55A 3TOIA 1TF1A 3LIDA 4XT2B 5JYPA 1RGYA 5TR7A 1V9ZA 4BJPA 4X25A 5J8XA 4WZ5C 1MY8A 3FWLA 1YPRA 1XFNA 3BFCA 4ARZB 2XD1A 2BG1A 1TS6A 5CEBA 3UMDA 3UPOA 2Y55A 3HVFA 2WUQA 4Y0OA 1TS8A 1OTAA 2P7JA 3KYQA 3MQ0A 4XUZA 3O87A 3C2WA 1ES5A 5HWVA 2HDRA 2Z2LB 2D02A 5DTTA 3T1QB 1Y4OA 3TSGA 4K0XA 4FH2A 3KYZA 3IX8A 4IHQA 4OONA
chains in the Genus database with same CATH topology
1PW8A 5EOOA 4OVDA 1ESIA 1FCOA 2RCXA 3PAEA 2WK0A 3HUOA 3Q7VB 4K91A 4B4XA 4B4ZA 2Y2LA 1PW1A 4S2KA 4U0TA 2J9PA 3N7WA 3GR2A 1GA0A 1XP4A 2ZQDA 3CJMA 1ERQA 3LCEA 4Q8IA 1IKGA 4KZ8A 4QB8A 4Y0UA 3W8KA 3ZHHA 3G2ZA 2G2WA 4LCMA 4ZAMA 1KVMA 2XD5A 1GHMA 1HTZA 3ZFZA 2Y2PA 1GHPA 3IF6C 5FQMA 4JXGA 3VP2A 4C75A 3LY3A 4P0MA 3VFHA 5DF8A 3HLDA 1ES4A 5L2FA 1YLZA 5HAQA 2EX2A 4JXVA 1KE3A 3BFGA 1GCEA 3NY4A 4UAAA 4UA9A 5FSRA 2WKEA 4ZTKA 1I2WA 3HUMA 2WGWB 4PM9A 3FZCA 5TGFA 4LV0A 4OPZA 4U3TA 3G34A 1LHYA 1FSWA 3QNCA 2P9VA 4DE0A 4EQIA 1K4EA 5FA7A 1BSGA 2WGIA 3VP1A 4R3JA 5E2EA 1IYOA 4OOLA 5HARA 4NETA 1AXBA 2PBYA 4BENA 4EBPA 4OKPA 1RCJA 5DVAA 2ZQ7A 2HPBA 1NZOA 4KQOA 3ITAA 4OLDA 3ZNYA 2P74A 4E3KA 1DY6A 4DDSA 1U60A 2XR0A 3NIAA 5F82A 1O07A 3ZG9B 2Y2QA 4F94A 1YLYA 3BRMA 1FQGA 3UY6A 5KZHA 3OZHA 4R23A 1K54A 5FQIA 1FR1A 3S4XA 4LV3A 4H8RA 3UE0A 1K57C 1H8ZA 3I7JA 1S0WA 4KZ9A 4ZJ2A 3VP0A 1VQQA 3IHAA 4EV4A 1K4FA 2J9OA 3O3VA 1H5XA 1YLTA 5A92A 4FH4A 1FSYA 2FFFB 5HW3A 1LL5A 2WGWA 4LENA 1L0FA 1ERMA 3G32A 2Q9NA 1E3UD 1W5DA 4N92A 1EROA 2CC1A 4IVKA 1E3UA 2XEPA 1H8YA 3IF6B 2Y2IA 2DCFA 1XGJA 3G4PA 4FD8A 2IWCA 5CGSA 2WKHA 3MKEA 5CECA 4QJGA 4KG5A 4X6TA 3DTMA 3EQVA 2Q9MA 5IHVA 1IEMA 4RX3A 1I2SA 2Y2NA 2EX6A 2A3UA 2XQZA 2XLNA 4P6BA 1OMEA 1JWVA 4PM7A 4GDBA 4N9KA 4JF4A 3UDXA 4JF5A 4KZ5A 2BLSA 4RX2A 2ZC4B 1PZPA 3C4OA 3A3EA 2HDUA 3W4QA 5EOEA 4DXBA 4KZ6A 3VSKA 1PWCA 4OPQA 1KE0A 2Y2MA 3OC2A 4DKIA 3MFDA 4NK3A 1SHVA 3N8RA 2HP5A 4X69A 3A3FA 1Z6FA 1KDWA 5DTSA 2OSUA 3UE3A 1ONGA 5GHYA 1O7EA 5I94A 1EI5A 1KGEA 2IWDA 1YMSA 3GQZA 4MBHA 4MNRA 4IBXA 1Q2QA 2Y2GA 1SDEA 1KVLA 3UE1A 1E4DA 4MLLA 3S22A 4PPRA 1K56D 2XF3A 3IWQA 2WZZA 1RGZA 1NYYA 2EXBA 3Q82A 5FQJA 1BULA 1CEFA 1PYYA 5E2FA 2ZJ9A 1VM1A 3UN7A 3OPPA 4OPRA 3HUNA 1K38A 4GN2A 5GLDA 1JTGA 4ZDXA 1IYSA 4KG6A 2R9WA 1PI5A 1M40A 1NRFA 4HBUA 2WZXA 4OQIA 1ES3A 4QY5A 4S2IA 1J9MA 4BD0A 5F1GA 5FQQA 2WAEA 5FASA 3PBRA 1SCWA 3PAGA 4GOGA 5FI6A 3WS0A 1WYBA 3VMAA 3IT9A 5GHZA 2H10A 1YLJA 3PBSA 3P09A 2V20A 1K6SA 3HLFA 3TG9A 3D4FA 1W8QA 5FDHA 3V3RA 5JYOA 1GA9A 1BLPA 3HL9A 1BTLA 4BLMA 3ZNTA 3Q81A 3NC8A 2E8IA 4OQGA 5DF9A 1M6KA 4N1HA 4ZBEA 3UDIA 3NBLA 5FAQA 3N8LA 3O88A 1RP5A 4P85A 3ZVWA 2B5RA 4PM8A 1HVBA 1MXOA 1IKIA 3NI9A 2C5WB 3P98A 5FATA 2XK1A 4PMAA 1JWPA 4KENB 4X56A 1FCMA 5EUAA 2ZMAA 1IYPA 5CERA 3OPRA 2X71A 3SH7A 5AQAA 1PWDA 1CI8A 3IXBA 1K57A 4S2MA 4JKTA 5CHJA 5HFOA 3SS5A 1Y54A 1QMFA 2JE5A 3WS4A 4PM5A 1LL9A 2EX8A 3AGFA 4R1GA 1K6RA 2WKIA 5CTMA 2WAFA 3FV7A 3V50A 4D2OA 4Y0TA 4FSFA 1JVJA 1NYMA 3Q7ZA 1FR6A 1L2SA 1BUEA 2WGVA 4QU3A 5HL1A 1XA1A 5A90A 2XDMA 4S2LA 3UPPA 4WZ5A 2P9VB 3DW0A 3PTEA 3BYDA 4N9LA 3C7UA 4CJNA 4OQHA 4DF6A 5F1FA 4KZAA 4DE1A 3ZG5A 3G30A 5E2GA 5CTNA 4N1XA 1EWZA 2X01A 4EBLA 4LCLA 2HDSA 1L0EA 2Y2OA 1PIOA 1HD8A 4BD1A 4GKUA 1YLWA 1BLSA 2Y4AA 3SH9A 3UPNA 3IF6A 3NCKA 3OCLA 3Q07A 3IXDA 4C3QA 3LEZA 2GDNA 3WS1A 4EWFA 3OPHA 1MWRA 1BLHA 3ZG0A 3HLGA 3IWIA 4EBNA 2Y91A 3BECA 3BFFA 4JPMA 3UNWA 2PU2A 5M19A 4FCFA 4PM6A 1XA7A 2FFYA 3MZFA 3RJUA 1K56A 5HX9A 2DNSA 4IVIA 1JWZA 3HLBA 1I5QA 4Z9QA 4OPYA 1YMXA 1ZG4A 4R4SA 5A91A 2JCHA 3CG5A 5GHXA 1TDLA 4U0XA 4KZ4A 4S2PA 3UDFA 2QPNA 5M1AA 3HLEA 3GMWA 3ZG7B 5F83A 2EFXA 4LV1A 1KE4A 2Y59A 3E2KA 2EX9A 3BLMA 3LO7A 1K54C 1YQSA 4WMCD 3M2KA 2RL3A 1G6AA 3VSLA 3BFDA 4X53A 4JXSA 5EE8A 4E3MA 4E3OA 5GLBA 2X02A 3IH8A 2ZM8A 3IQAA 4WYYA 4WM9A 3ZCZA 4OQ0A 1G68A 1ESUA 2VGKA 5M18A 3BEBA 4E6WA 1YLPA 5CEDA 4IEDA 3AGEA 2C6WB 3RXXA 4A5RA 4E3IA 3WWXA 5FAPA 3GTCA 3M6BA 3VFFA 2ZD8A 4E3NA 5EVIA 1ALQA 4WMCA 3WS2A 3IXHA 1IELA 5EVID 3IXGA 4WELA 1MWSA 1TVFA 3AGDA 5EECA 4ZJ1A 1KGGA 2J7VA 4XUXA 4OP5A 1MPLA 3VP3A 3ZDJA 4RVAA 5FAOA 3A3JA 1FOFA 3VOZA 3Q1FA 1K55A 4K0WA 3W4OA 4B88A 3M6HA 3QHYA 4BQMA 1MWUA 2I72A 1XXMA 4S2NC 5CXWA 4JF6A 1YT4A 4RYEA 2ZLYA 3NDEA 4DRTA 3SH8A 4UHUA 2QZ6A 4MEZA 3IF5A 5CHMA 5DTKA 5FI2A 5DF7A 1XKZA 5AQ9A 1N9BA 5TFQA 4KG2A 3SS4A 4DDYA 4GD8A 1N4OA 4IBRA 1CK3A 1ZG6A 1FCNA 5G18A 1W7FA 4YFMA 5U47A 2OLVA 2UWXA 2ZC3B 3IWOA 3LY4A 1K55C 2XGNA 3G2YA 1ZKJA 3GSGA 3GRJA 3FKWA 2IWBA 3G35A 1DJAA 2ZQ8A 3MKFA 3MXSA 3MZEA 4O7DA 4R0QA 4S2OA 3A3DA 1JTDA 4QD4A 4QY6A 1L0GA 3V5MA 1TDGA 4OH0A 3WS5A 4YINA 1NY0A 5CGWA 1C3BA 1PWGA 3VP4A 2A49A 3UO9A 5CRFA 4XXRA 1WE4A 1W8YA 3M2JA 1YM1A 1K25A 4Y7PA 3SS3A 5KSHA 4DE2A 4E3JA 4ZJ3A 1TEMA 4BL3A 3BFEA 5BOHA 4R4RA 2V1ZA 3Q7VA 3RXWA 1CEGA 1XX2A 2JBFA 4JBFA 3A3IA 4R3BA 2XH9A 2PU4A 5FI7A 1L0DA 2Y2JA 4X68A 5AQ7A 1ONHA 1W79A 3ZVTA 1MBLA 1PZOA 4GB7A 3MZDA 3OPLA 4CPKA 1LI9A 4C6YA 2QMIA 3N8SA 4OOMA 3PBTA 4OOYA 5GLAA 3EQUA 3MXRA 2XFSA 1XPBA 5HAPA 2V2FF 3DWZA 3HREA 2ZM0A 4GD6A 1Q2PA 3IHBA 2Y2HA 3N4IA 3B3XA 5D3OA 3V3SA 2ZQ9A 3MBZA 3PBNA 3W4PA 3VOYA 1LLBA 3ZG8B 5EPHA 5HAIA 3N6IA 1GHIA 2OV5A 1NXYA 1BZAA 2ZM2A 1DJBA 4OLGA 4S2JA 5CHUA 1PI4A 4JLFA 3O86A 3SOIA 3HLWA 4LV2A 2J8YA 5FQ9A 2WYXA 3HBRA 2H0YA 4JXWA 5FQKA 5GLCA 3JYIA 5AQBA 2H5SA 5A93A 4KZ7A 5E43A 1XGIA 3C7VA 5KSCA 2JC7A 2Y2KA 3ZGAB 1QMEA 3FKVA 1SKFA 4WEKA 5KMWA 4L0LA 3HLCA 3CMZA 4UA6A 1BT5A 4WEJA 2HP6A 1ES2A 4MBKA 5EVIB 4X55A 2OLUA 4UA7A 1KDSA 3TOIA 4WZ4A 3GV9A 3PBOA 4DE3A 1WYCA 4EUZA 4BL2A 5EVIC 2H0TA 4KQQA 2R9XA 4HEFA 1MWTA 2XFTA 3E2LA 5JYPA 1RGYA 5TR7A 4KZBA 3OCNA 3V39A 1SDNA 3CZDA 4KZ3A 4WBGA 4BJPA 1DJCA 2WADA 4ID4A 2DRWA 5J8XA 4MBFA 1MY8A 4P87A 4WZ5C 1CI9A 3FWLA 2ZQAA 1LI0A 3PBQA 3C5AA 3BFCA 5GL9A 2HP9A 4GNUA 4DXCA 1NZUA 3QNBA 4GZBA 2XD1A 2BG1A 4QHCA 1NJ4A 5CEBA 3UPOA 3ITBA 3NDGA 2Y55A 3HVFA 2WUQA 4Y0OA 2ZC5B 1ZC2A 4E6XA 1S6RA 3IH9A 4XUZA 3O87A 5CGXA 2ZC6B 3C4PA 3ISGA 1ES5A 2ZQCA 3WRTA 4E3LA 3DWKA 1BLCA 2EXAA 5EVLA 1MKIA 2HDRA 2Z2LB 1IYQA 5E2HA 2Z2MB 5DTTA 2EFUA 4OP8A 2VGJA 3GVBA 3WRZA 1E25A 3TSGA 4K0XA 2ZC7A 1KGFA 4FH2A 4HBTA 3BLSA 3G31A 2HDQA 4GDNA 1HZOA 3S1YA 3FYZA 2G2UA 4RA7A 3BM6A 4S2NA 4OONA 4M3KA 4KQRA 4HESA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PW8 A;  5EOO A;  4OVD A;  1ESI A;  1FCO A;  2RCX A;  3PAE A;  2WK0 A;  3HUO A;  3Q7V B;  4K91 A;  4B4X A;  4B4Z A;  2Y2L A;  1PW1 A;  4S2K A;  4U0T A;  2J9P A;  3N7W A;  3GR2 A;  1GA0 A;  1XP4 A;  2ZQD A;  3CJM A;  1ERQ A;  3LCE A;  4Q8I A;  1IKG A;  4KZ8 A;  4QB8 A;  4Y0U A;  3W8K A;  3ZHH A;  3G2Z A;  2G2W A;  4LCM A;  4ZAM A;  1KVM A;  2XD5 A;  1GHM A;  1HTZ A;  3ZFZ A;  2Y2P A;  1GHP A;  3IF6 C;  5FQM A;  4JXG A;  3VP2 A;  4C75 A;  3LY3 A;  4P0M A;  3VFH A;  5DF8 A;  3HLD A;  1ES4 A;  5L2F A;  1YLZ A;  5HAQ A;  2EX2 A;  4JXV A;  1KE3 A;  3BFG A;  1GCE A;  3NY4 A;  4UAA A;  4UA9 A;  5FSR A;  2WKE A;  4ZTK A;  1I2W A;  3HUM A;  2WGW B;  4PM9 A;  3FZC A;  5TGF A;  4LV0 A;  4OPZ A;  4U3T A;  3G34 A;  1LHY A;  1FSW A;  3QNC A;  2P9V A;  4DE0 A;  4EQI A;  1K4E A;  5FA7 A;  1BSG A;  2WGI A;  3VP1 A;  4R3J A;  5E2E A;  1IYO A;  4OOL A;  5HAR A;  4NET A;  1AXB A;  2PBY A;  4BEN A;  4EBP A;  4OKP A;  1RCJ A;  5DVA A;  2ZQ7 A;  2HPB A;  1NZO A;  4KQO A;  3ITA A;  4OLD A;  3ZNY A;  2P74 A;  4E3K A;  1DY6 A;  4DDS A;  1U60 A;  2XR0 A;  3NIA A;  5F82 A;  1O07 A;  3ZG9 B;  2Y2Q A;  4F94 A;  1YLY A;  3BRM A;  1FQG A;  3UY6 A;  5KZH A;  3OZH A;  4R23 A;  1K54 A;  5FQI A;  1FR1 A;  3S4X A;  4LV3 A;  4H8R A;  3UE0 A;  1K57 C;  1H8Z A;  3I7J A;  1S0W A;  4KZ9 A;  4ZJ2 A;  3VP0 A;  1VQQ A;  3IHA A;  4EV4 A;  1K4F A;  2J9O A;  3O3V A;  1H5X A;  1YLT A;  5A92 A;  4FH4 A;  1FSY A;  2FFF B;  5HW3 A;  1LL5 A;  2WGW A;  4LEN A;  1L0F A;  1ERM A;  3G32 A;  2Q9N A;  1E3U D;  1W5D A;  4N92 A;  1ERO A;  2CC1 A;  4IVK A;  1E3U A;  2XEP A;  1H8Y A;  3IF6 B;  2Y2I A;  2DCF A;  1XGJ A;  3G4P A;  4FD8 A;  2IWC A;  5CGS A;  2WKH A;  3MKE A;  5CEC A;  4QJG A;  4KG5 A;  4X6T A;  3DTM A;  3EQV A;  2Q9M A;  5IHV A;  1IEM A;  4RX3 A;  1I2S A;  2Y2N A;  2EX6 A;  2A3U A;  2XQZ A;  2XLN A;  4P6B A;  1OME A;  1JWV A;  4PM7 A;  4GDB A;  4N9K A;  4JF4 A;  3UDX A;  4JF5 A;  4KZ5 A;  2BLS A;  4RX2 A;  2ZC4 B;  1PZP A;  3C4O A;  3A3E A;  2HDU A;  3W4Q A;  5EOE A;  4DXB A;  4KZ6 A;  3VSK A;  1PWC A;  4OPQ A;  1KE0 A;  2Y2M A;  3OC2 A;  4DKI A;  3MFD A;  4NK3 A;  1SHV A;  3N8R A;  2HP5 A;  4X69 A;  3A3F A;  1Z6F A;  1KDW A;  5DTS A;  2OSU A;  3UE3 A;  1ONG A;  5GHY A;  1O7E A;  5I94 A;  1EI5 A;  1KGE A;  2IWD A;  1YMS A;  3GQZ A;  4MBH A;  4MNR A;  4IBX A;  1Q2Q A;  2Y2G A;  1SDE A;  1KVL A;  3UE1 A;  1E4D A;  4MLL A;  3S22 A;  4PPR A;  1K56 D;  2XF3 A;  3IWQ A;  2WZZ A;  1RGZ A;  1NYY A;  2EXB A;  3Q82 A;  5FQJ A;  1BUL A;  1CEF A;  1PYY A;  5E2F A;  2ZJ9 A;  1VM1 A;  3UN7 A;  3OPP A;  4OPR A;  3HUN A;  1K38 A;  4GN2 A;  5GLD A;  1JTG A;  4ZDX A;  1IYS A;  4KG6 A;  2R9W A;  1PI5 A;  1M40 A;  1NRF A;  4HBU A;  2WZX A;  4OQI A;  1ES3 A;  4QY5 A;  4S2I A;  1J9M A;  4BD0 A;  5F1G A;  5FQQ A;  2WAE A;  5FAS A;  3PBR A;  1SCW A;  3PAG A;  4GOG A;  5FI6 A;  3WS0 A;  1WYB A;  3VMA A;  3IT9 A;  5GHZ A;  2H10 A;  1YLJ A;  3PBS A;  3P09 A;  2V20 A;  1K6S A;  3HLF A;  3TG9 A;  3D4F A;  1W8Q A;  5FDH A;  3V3R A;  5JYO A;  1GA9 A;  1BLP A;  3HL9 A;  1BTL A;  4BLM A;  3ZNT A;  3Q81 A;  3NC8 A;  2E8I A;  4OQG A;  5DF9 A;  1M6K A;  4N1H A;  4ZBE A;  3UDI A;  3NBL A;  5FAQ A;  3N8L A;  3O88 A;  1RP5 A;  4P85 A;  3ZVW A;  2B5R A;  4PM8 A;  1HVB A;  1MXO A;  1IKI A;  3NI9 A;  2C5W B;  3P98 A;  5FAT A;  2XK1 A;  4PMA A;  1JWP A;  4KEN B;  4X56 A;  1FCM A;  5EUA A;  2ZMA A;  1IYP A;  5CER A;  3OPR A;  2X71 A;  3SH7 A;  5AQA A;  1PWD A;  1CI8 A;  3IXB A;  1K57 A;  4S2M A;  4JKT A;  5CHJ A;  5HFO A;  3SS5 A;  1Y54 A;  1QMF A;  2JE5 A;  3WS4 A;  4PM5 A;  1LL9 A;  2EX8 A;  3AGF A;  4R1G A;  1K6R A;  2WKI A;  5CTM A;  2WAF A;  3FV7 A;  3V50 A;  4D2O A;  4Y0T A;  4FSF A;  1JVJ A;  1NYM A;  3Q7Z A;  1FR6 A;  1L2S A;  1BUE A;  2WGV A;  4QU3 A;  5HL1 A;  1XA1 A;  5A90 A;  2XDM A;  4S2L A;  3UPP A;  4WZ5 A;  2P9V B;  3DW0 A;  3PTE A;  3BYD A;  4N9L A;  3C7U A;  4CJN A;  4OQH A;  4DF6 A;  5F1F A;  4KZA A;  4DE1 A;  3ZG5 A;  3G30 A;  5E2G A;  5CTN A;  4N1X A;  1EWZ A;  2X01 A;  4EBL A;  4LCL A;  2HDS A;  1L0E A;  2Y2O A;  1PIO A;  1HD8 A;  4BD1 A;  4GKU A;  1YLW A;  1BLS A;  2Y4A A;  3SH9 A;  3UPN A;  3IF6 A;  3NCK A;  3OCL A;  3Q07 A;  3IXD A;  4C3Q A;  3LEZ A;  2GDN A;  3WS1 A;  4EWF A;  3OPH A;  1MWR A;  1BLH A;  3ZG0 A;  3HLG A;  3IWI A;  4EBN A;  2Y91 A;  3BEC A;  3BFF A;  4JPM A;  3UNW A;  2PU2 A;  5M19 A;  4FCF A;  4PM6 A;  1XA7 A;  2FFY A;  3MZF A;  3RJU A;  1K56 A;  5HX9 A;  2DNS A;  4IVI A;  1JWZ A;  3HLB A;  1I5Q A;  4Z9Q A;  4OPY A;  1YMX A;  1ZG4 A;  4R4S A;  5A91 A;  2JCH A;  3CG5 A;  5GHX A;  1TDL A;  4U0X A;  4KZ4 A;  4S2P A;  3UDF A;  2QPN A;  5M1A A;  3HLE A;  3GMW A;  3ZG7 B;  5F83 A;  2EFX A;  4LV1 A;  1KE4 A;  2Y59 A;  3E2K A;  2EX9 A;  3BLM A;  3LO7 A;  1K54 C;  1YQS A;  4WMC D;  3M2K A;  2RL3 A;  1G6A A;  3VSL A;  3BFD A;  4X53 A;  4JXS A;  5EE8 A;  4E3M A;  4E3O A;  5GLB A;  2X02 A;  3IH8 A;  2ZM8 A;  3IQA A;  4WYY A;  4WM9 A;  3ZCZ A;  4OQ0 A;  1G68 A;  1ESU A;  2VGK A;  5M18 A;  3BEB A;  4E6W A;  1YLP A;  5CED A;  4IED A;  3AGE A;  2C6W B;  3RXX A;  4A5R A;  4E3I A;  3WWX A;  5FAP A;  3GTC A;  3M6B A;  3VFF A;  2ZD8 A;  4E3N A;  5EVI A;  1ALQ A;  4WMC A;  3WS2 A;  3IXH A;  1IEL A;  5EVI D;  3IXG A;  4WEL A;  1MWS A;  1TVF A;  3AGD A;  5EEC A;  4ZJ1 A;  1KGG A;  2J7V A;  4XUX A;  4OP5 A;  1MPL A;  3VP3 A;  3ZDJ A;  4RVA A;  5FAO A;  3A3J A;  1FOF A;  3VOZ A;  3Q1F A;  1K55 A;  4K0W A;  3W4O A;  4B88 A;  3M6H A;  3QHY A;  4BQM A;  1MWU A;  2I72 A;  1XXM A;  4S2N C;  5CXW A;  4JF6 A;  1YT4 A;  4RYE A;  2ZLY A;  3NDE A;  4DRT A;  3SH8 A;  4UHU A;  2QZ6 A;  4MEZ A;  3IF5 A;  5CHM A;  5DTK A;  5FI2 A;  5DF7 A;  1XKZ A;  5AQ9 A;  1N9B A;  5TFQ A;  4KG2 A;  3SS4 A;  4DDY A;  4GD8 A;  1N4O A;  4IBR A;  1CK3 A;  1ZG6 A;  1FCN A;  5G18 A;  1W7F A;  4YFM A;  5U47 A;  2OLV A;  2UWX A;  2ZC3 B;  3IWO A;  3LY4 A;  1K55 C;  2XGN A;  3G2Y A;  1ZKJ A;  3GSG A;  3GRJ A;  3FKW A;  2IWB A;  3G35 A;  1DJA A;  2ZQ8 A;  3MKF A;  3MXS A;  3MZE A;  4O7D A;  4R0Q A;  4S2O A;  3A3D A;  1JTD A;  4QD4 A;  4QY6 A;  1L0G A;  3V5M A;  1TDG A;  4OH0 A;  3WS5 A;  4YIN A;  1NY0 A;  5CGW A;  1C3B A;  1PWG A;  3VP4 A;  2A49 A;  3UO9 A;  5CRF A;  4XXR A;  1WE4 A;  1W8Y A;  3M2J A;  1YM1 A;  1K25 A;  4Y7P A;  3SS3 A;  5KSH A;  4DE2 A;  4E3J A;  4ZJ3 A;  1TEM A;  4BL3 A;  3BFE A;  5BOH A;  4R4R A;  2V1Z A;  3Q7V A;  3RXW A;  1CEG A;  1XX2 A;  2JBF A;  4JBF A;  3A3I A;  4R3B A;  2XH9 A;  2PU4 A;  5FI7 A;  1L0D A;  2Y2J A;  4X68 A;  5AQ7 A;  1ONH A;  1W79 A;  3ZVT A;  1MBL A;  1PZO A;  4GB7 A;  3MZD A;  3OPL A;  4CPK A;  1LI9 A;  4C6Y A;  2QMI A;  3N8S A;  4OOM A;  3PBT A;  4OOY A;  5GLA A;  3EQU A;  3MXR A;  2XFS A;  1XPB A;  5HAP A;  2V2F F;  3DWZ A;  3HRE A;  2ZM0 A;  4GD6 A;  1Q2P A;  3IHB A;  2Y2H A;  3N4I A;  3B3X A;  5D3O A;  3V3S A;  2ZQ9 A;  3MBZ A;  3PBN A;  3W4P A;  3VOY A;  1LLB A;  3ZG8 B;  5EPH A;  5HAI A;  3N6I A;  1GHI A;  2OV5 A;  1NXY A;  1BZA A;  2ZM2 A;  1DJB A;  4OLG A;  4S2J A;  5CHU A;  1PI4 A;  4JLF A;  3O86 A;  3SOI A;  3HLW A;  4LV2 A;  2J8Y A;  5FQ9 A;  2WYX A;  3HBR A;  2H0Y A;  4JXW A;  5FQK A;  5GLC A;  3JYI A;  5AQB A;  2H5S A;  5A93 A;  4KZ7 A;  5E43 A;  1XGI A;  3C7V A;  5KSC A;  2JC7 A;  2Y2K A;  3ZGA B;  1QME A;  3FKV A;  1SKF A;  4WEK A;  5KMW A;  4L0L A;  3HLC A;  3CMZ A;  4UA6 A;  1BT5 A;  4WEJ A;  2HP6 A;  1ES2 A;  4MBK A;  5EVI B;  4X55 A;  2OLU A;  4UA7 A;  1KDS A;  3TOI A;  4WZ4 A;  3GV9 A;  3PBO A;  4DE3 A;  1WYC A;  4EUZ A;  4BL2 A;  5EVI C;  2H0T A;  4KQQ A;  2R9X A;  4HEF A;  1MWT A;  2XFT A;  3E2L A;  5JYP A;  1RGY A;  5TR7 A;  4KZB A;  3OCN A;  3V39 A;  1SDN A;  3CZD A;  4KZ3 A;  4WBG A;  4BJP A;  1DJC A;  2WAD A;  4ID4 A;  2DRW A;  5J8X A;  4MBF A;  1MY8 A;  4P87 A;  4WZ5 C;  1CI9 A;  3FWL A;  2ZQA A;  1LI0 A;  3PBQ A;  3C5A A;  3BFC A;  5GL9 A;  2HP9 A;  4GNU A;  4DXC A;  1NZU A;  3QNB A;  4GZB A;  2XD1 A;  2BG1 A;  4QHC A;  1NJ4 A;  5CEB A;  3UPO A;  3ITB A;  3NDG A;  2Y55 A;  3HVF A;  2WUQ A;  4Y0O A;  2ZC5 B;  1ZC2 A;  4E6X A;  1S6R A;  3IH9 A;  4XUZ A;  3O87 A;  5CGX A;  2ZC6 B;  3C4P A;  3ISG A;  1ES5 A;  2ZQC A;  3WRT A;  4E3L A;  3DWK A;  1BLC A;  2EXA A;  5EVL A;  1MKI A;  2HDR A;  2Z2L B;  1IYQ A;  5E2H A;  2Z2M B;  5DTT A;  2EFU A;  4OP8 A;  2VGJ A;  3GVB A;  3WRZ A;  1E25 A;  3TSG A;  4K0X A;  2ZC7 A;  1KGF A;  4FH2 A;  4HBT A;  3BLS A;  3G31 A;  2HDQ A;  4GDN A;  1HZO A;  3S1Y A;  3FYZ A;  2G2U A;  4RA7 A;  3BM6 A;  4S2N A;  4OON A;  4M3K A;  4KQR A;  4HES A; 
#chains in the Genus database with same CATH topology
 4OVD A;  2OWJ A;  3HUO A;  2V0W A;  4S2K A;  3T4O A;  4HH2 A;  4U0T A;  4I3A A;  3NOP C;  1GA0 A;  3T4J A;  1ERQ A;  3LCE A;  4L9G A;  4QB8 A;  5FEG A;  4Y17 A;  2JN7 A;  1KVM A;  5FQM A;  3FG8 A;  3C8C A;  3VP2 A;  2VV6 A;  1KE3 A;  5K5B A;  4UAA A;  1I2W A;  2WGW B;  4OPZ A;  2W3F A;  3G34 A;  1DP9 A;  2KOI A;  4NET A;  4HJ6 A;  4EBP A;  2ZQ7 A;  3T50 A;  2XRO A;  3CLO A;  1DY6 A;  5CX7 A;  2PR5 A;  3NIA A;  4KUK A;  4LPZ A;  3DTK A;  3OZH A;  5FQI A;  1FR1 A;  3VP0 A;  4RQ9 A;  4EV4 A;  1K4F A;  3DTI A;  3F1O A;  3G32 A;  1A0K A;  4WN5 A;  4N92 A;  3T1S A;  2CC1 A;  1E3U A;  5HDS A;  3IF6 B;  4I38 A;  4ETZ A;  3CAX A;  4FD8 A;  5CEC A;  4X6T A;  3VE3 A;  5IHV A;  1IEM A;  1D06 A;  1I2S A;  2Y2N A;  2EX6 A;  1DP6 A;  2A3U A;  2XQZ A;  3K2N A;  4GDB A;  4RX2 A;  3A0V A;  4QWO A;  4DXB A;  1K0K A;  3OC2 A;  2BAS A;  3MFD A;  4NK3 A;  1SHV A;  2HP5 A;  2QHK A;  3A3F A;  3CPT A;  1Z6F A;  3UE3 A;  1O7E A;  1Q2Q A;  1KVL A;  1E4D A;  5F69 A;  1K56 D;  2XF3 A;  3IWQ A;  1NYY A;  2HJ9 C;  1UGU A;  4GN2 A;  5IT5 A;  1NLY A;  1W63 M;  3CUE C;  1YKD A;  1PI5 A;  1NRF A;  3NEC A;  5FEF A;  4QY5 A;  1J9M A;  4BD0 A;  4CLC A;  2WAE A;  1MZU A;  1SCW A;  3PAG A;  4GOG A;  3CWF A;  4CQH A;  3KSH A;  1YSP A;  2H10 A;  3PBS A;  5EM1 A;  2ZL1 A;  3TG9 A;  1GSV A;  1BLP A;  4BLM A;  4OQG A;  4ESP A;  1M6K A;  2HV1 A;  1MXO A;  2C5W B;  4PMA A;  4KEN B;  1FCM A;  3SH7 A;  2HJE A;  3OPR A;  5CER A;  1T1A A;  3IXB A;  4S2M A;  2JKT I;  4JKT A;  4EER A;  1Y54 A;  1QMF A;  4PM5 A;  1LL9 A;  2WKI A;  4Y13 A;  4FSF A;  2JKG A;  5MC7 A;  4H6J A;  4QU3 A;  3KO6 A;  2VGL M;  2W3H A;  2XDM A;  4S2L A;  2P9V B;  4N9L A;  3DW0 A;  2PHY A;  4LRZ E;  4FTX A;  1OPX A;  3LR3 A;  4L9E A;  3BY9 A;  4KZA A;  3MJQ A;  3ZG5 A;  2W27 A;  3LR5 A;  4EBL A;  2Y2O A;  4DJ2 A;  1BLS A;  2Y4A A;  1FIK A;  3MF0 A;  3OCL A;  1VEU B;  4X1M A;  3OPH A;  3ZG0 A;  3D9Y A;  2L4R A;  5FDS A;  2Y91 A;  2PU2 A;  1T1C A;  4FCF A;  1PNE A;  1XA7 A;  2FFY A;  4PM6 A;  2Q0O A;  1JWZ A;  3HLB A;  2INW A;  2KLI A;  1OTD A;  3EOI A;  3PXP A;  4U0X A;  4KZ4 A;  5M1A A;  3GMW A;  3E2K A;  3BLM A;  3LO7 A;  1K54 C;  3O5Y A;  3M2K A;  3BJN A;  2NUP C;  3BFD A;  4GJ4 A;  2O0Y A;  4WYY A;  5M18 A;  2YKH A;  4E6W A;  1YLP A;  4CLC B;  4IED A;  3VE4 A;  2C6W B;  4A5R A;  4WL9 A;  2XA7 S;  4E3N A;  5EVI D;  5EEC A;  2FH5 A;  4XUX A;  4OP5 A;  2W1R A;  5AVE A;  3VP3 A;  2UV0 E;  3VOZ A;  4K0W A;  4B88 A;  2O9B A;  4JF6 A;  3ZQ5 A;  3H82 A;  4RYE A;  2ZLY A;  3SH8 A;  4GS9 B;  3R7W B;  3LR0 A;  3IF5 A;  5CHM A;  5DTK A;  5TFQ A;  3SS4 A;  3KYE A;  1FCN A;  3G2Y A;  3GRJ A;  3FKW A;  4WF0 A;  4G3W A;  3G35 A;  3MKF A;  3MZE A;  5FAS A;  1L0G A;  1LSX A;  4HI4 A;  2WKQ A;  1W8Y A;  1YM1 A;  4Y7P A;  4B93 A;  4ZJ3 A;  4G3K A;  1TEM A;  4I39 A;  3BFE A;  5BOH A;  4H6J B;  4EW7 A;  3A3I A;  2XH9 A;  2Y2J A;  3KSG A;  2A2L A;  3ZVT A;  1MBL A;  1LI9 A;  4OOM A;  2HZ5 A;  3MR0 A;  5TJJ A;  5F5Y A;  3IBJ A;  3PBN A;  3ZYT A;  3W4P A;  1LLB A;  5EPH A;  2OV5 A;  3UB6 A;  1DJB A;  4OLG A;  4S2J A;  1PI4 A;  3SOI A;  1GSX A;  4LV2 A;  5GLC A;  3L7H A;  5A93 A;  3FC7 A;  3D3O A;  4KZ7 A;  4HJ3 A;  5G4Y A;  2Y2K A;  4WEK A;  3KSF A;  5KMW A;  3HLC A;  2LB5 A;  3CMZ A;  4R3A A;  4WEJ A;  4MN6 A;  4JGR A;  2Z6C A;  3PBO A;  2H0T A;  4HEF A;  1PRQ A;  3OCN A;  4WBG A;  1DJC A;  2DRW A;  2ZQA A;  1LI0 A;  3C5A A;  1S1Z A;  3T12 B;  4DXC A;  4Z1W A;  1NZU A;  3QNB A;  3DTE A;  4QHC A;  1NJ4 A;  5L8M A;  4R6L A;  3ITB A;  1S6R A;  4GLQ A;  3IH9 A;  4I5S A;  4HOI A;  4O01 A;  3K3D A;  3DWK A;  1BLC A;  1MKI A;  1IYQ A;  2EFU A;  2VGJ A;  3GVB A;  3JVU A;  1E25 A;  2JKR M;  1KGF A;  2D01 A;  4HBT A;  4ZRR A;  3BLS A;  3G31 A;  1HZO A;  4RA7 A;  3BM6 A;  2PD8 A;  5L10 A;  3PHY A;  1PW8 A;  3IS2 B;  1ESI A;  1S66 L;  1FCO A;  3Q7V B;  2Y2L A;  2V8C A;  3N7W A;  4DN0 A;  1XP4 A;  3OBF A;  2ZQD A;  1IKG A;  3ZHH A;  2WKP A;  5DKK A;  1HTZ A;  1GHP A;  4BWI A;  4JXG A;  5DF8 A;  2JHE A;  4JXV A;  3NY4 A;  4UA9 A;  1IFQ A;  3FZC A;  4LV0 A;  4YNR A;  3G6O A;  2KDK A;  4EQI A;  3VP1 A;  2OAP 1;  5E2E A;  2V0U A;  2PBY A;  3QP8 A;  4BEN A;  3MXQ A;  5DVA A;  2HPB A;  1NZO A;  5L07 A;  2XR0 A;  1VHM A;  5F82 A;  3E4O A;  2EWV A;  1IOU A;  3BRM A;  1FQG A;  1V9Y A;  5KZH A;  4R23 A;  2A24 A;  3S4X A;  4LV3 A;  4H8R A;  4KZ9 A;  3GDI A;  4JGQ A;  1P9R A;  2J9O A;  3T4K A;  3C30 A;  2VZW A;  3MSH A;  5A92 A;  4FH4 A;  1FSY A;  1LL5 A;  1ERM A;  4IVK A;  4XT2 A;  4IUH A;  3LEQ A;  2Y2I A;  1XGJ A;  3T1R A;  3ICY A;  5KIZ A;  2E8J A;  2IWC A;  2WKH A;  2CMN A;  4NXE A;  4RX3 A;  5I5L A;  2XLN A;  4P6B A;  1OME A;  5F68 A;  5AVF A;  1LT0 A;  3C4O A;  3A3E A;  3W4Q A;  4DKI A;  3FPW A;  3D72 A;  5DTS A;  3B33 A;  1XJ6 A;  3IX4 A;  3SZT A;  3GQZ A;  1T18 A;  3UE1 A;  4HH3 A;  4Y2F A;  2J3T D;  3VOL A;  1CEF A;  1VM1 A;  2W1T B;  3UN7 A;  4OPR A;  1K38 A;  2O9C A;  1JTG A;  5A8B A;  1S67 L;  4KG6 A;  2R9W A;  4S2I A;  5FQQ A;  3PBR A;  4JGO A;  4GW9 A;  3IT9 A;  5GHZ A;  3P09 A;  1GSW A;  5FDH A;  3V3R A;  1BTL A;  5DF9 A;  5FAQ A;  1RP5 A;  2B5R A;  1IKI A;  1JWP A;  1EW0 A;  5EUA A;  5AQA A;  3E4Q A;  1UWN X;  4R1G A;  4Y0T A;  2WAF A;  4D2O A;  1NYM A;  1L2S A;  4AFI A;  2AVX A;  5HL1 A;  1XA1 A;  3DAV A;  2M1C A;  1TD5 A;  4HQA A;  4WZ5 A;  4OQH A;  1G6O A;  2B02 A;  5E2G A;  3F1P B;  2X01 A;  5J4E A;  1L0E A;  1PIO A;  1HD8 A;  4GKU A;  3UPN A;  4NXF A;  2VV7 A;  3IF6 A;  3CUE A;  3EEA A;  2GDN A;  1MWR A;  3QP4 A;  3MFX A;  3BFF A;  3RFB A;  2H28 A;  2PR6 A;  2VA0 A;  4IVI A;  1I5Q A;  4Z9Q A;  1D7E A;  1W63 Q;  2V1B A;  1YMX A;  2PYR A;  1G5U A;  3GEC A;  5A91 A;  3TJZ C;  3BQA A;  1VB6 A;  1TDL A;  4S2P A;  3UDF A;  4I3I A;  2QPN A;  3HLE A;  3ZG7 B;  2EX9 A;  1G6A A;  4MCW A;  4E3O A;  3NOT C;  5GLB A;  1OTI A;  4HHD A;  3IQA A;  4WM9 A;  1VET B;  4OQ0 A;  2VGK A;  1ESU A;  1P0Z A;  3BEB A;  5CED A;  4Q0H A;  3M6B A;  3VFF A;  2ZD8 A;  3WS2 A;  1IEL A;  3IXG A;  2ZOI A;  1TVF A;  1F5M A;  1KGG A;  1N9L A;  2J7V A;  3DBA A;  4EXO A;  5FAO A;  3T4T A;  3LI8 A;  3LI9 A;  1FOF A;  2VJW A;  3B47 A;  2I72 A;  5CXW A;  4R38 A;  1YT4 A;  2YKF A;  3NDE A;  4DRT A;  2QZ6 A;  4MEZ A;  5DF7 A;  1XKZ A;  2L0W A;  4K08 A;  3LIA A;  3CIT A;  1CK3 A;  2OLV A;  2ZC3 B;  3IWO A;  1TS7 A;  3LY4 A;  3PYP A;  1K55 C;  1DJA A;  4R0Q A;  4S2O A;  4QY6 A;  1TDG A;  4OH0 A;  3VP4 A;  3UO9 A;  2Y79 A;  1WE4 A;  3M2J A;  2MJ6 A;  3SS3 A;  4E3J A;  3LIC A;  2V1Z A;  2ACG A;  4R4R A;  3Q7V A;  2ZBB A;  4JBF A;  4HIA A;  4UQI M;  4X68 A;  1ONH A;  2VEA A;  4EU0 A;  3PR6 A;  4HY8 A;  4CPK A;  2JKT M;  1H0M A;  3KSI A;  4OOY A;  5GLA A;  2XFS A;  2ZM0 A;  3IHB A;  2PAV P;  4FOF A;  3N4I A;  3S7P A;  5D3O A;  3V3S A;  3EEH A;  5HAI A;  3N6I A;  2QJ7 A;  1BZA A;  2ZM2 A;  4IJG A;  4DMZ A;  5HWW A;  3O86 A;  3K3C A;  5HSQ A;  4BBT A;  4JXW A;  5FQK A;  3JYI A;  3MQQ A;  3MQO A;  2JC7 A;  3TE8 A;  3ZGA B;  3FKV A;  1SKF A;  4Y15 A;  4ME4 A;  4UA6 A;  4HP4 A;  2OLU A;  4P6Z M;  1KDS A;  4WZ4 A;  4DE3 A;  1WYC A;  4BL2 A;  1P9W A;  1Y28 A;  1MWT A;  2XFT A;  3E2L A;  4KZB A;  3V39 A;  4KZ3 A;  2WAD A;  4ID4 A;  4MBF A;  1CI9 A;  1H8M A;  3PBQ A;  4GS9 A;  2QWS A;  4GNU A;  5EM0 A;  5HDD A;  3NDG A;  4D60 A;  3E0Y A;  2K7S A;  3RH8 B;  4GHI B;  3ISG A;  2ZQC A;  3WRT A;  4E3L A;  5E2H A;  2Z2M B;  4EUV A;  4FUW A;  4GDN A;  3FYZ A;  2L1M A;  1AWI A;  2G2U A;  4M3K A;  4KQR A;  4HES A;  2GJ3 A;  2RCX A;  4K91 A;  4B4Z A;  2WK0 A;  1PW1 A;  2GNX A;  3A0R A;  3CJM A;  4Q0J A;  4HNB A;  4KZ8 A;  4Y0U A;  1FIL A;  4C6Y A;  3G2Z A;  2G2W A;  4LCM A;  5FL3 A;  2Y2P A;  5C5K A;  3IF6 C;  3H7W A;  4C75 A;  3LY3 A;  3VFH A;  3BW6 A;  3HLD A;  3F1N A;  1YLZ A;  5HAQ A;  2EX2 A;  3CI6 A;  3BFG A;  1GCE A;  5FSR A;  5HL6 A;  2WKE A;  4ZTK A;  3A0S A;  4PM9 A;  4M4X A;  3R7W A;  1FSW A;  4DE0 A;  1K4E A;  5FA7 A;  1BSG A;  2WGI A;  4II7 A;  4R3J A;  3H9W A;  1IYO A;  4OOL A;  5HAR A;  5IU1 A;  1AXB A;  1T1B A;  2OAQ 1;  3BWL A;  5LBR A;  3ITA A;  2PDR A;  4E3K A;  1U60 A;  1TS0 A;  1O07 A;  2Y2Q A;  4EET B;  1YLY A;  3UY6 A;  1K54 A;  4BBV A;  3UE0 A;  1H8Z A;  3I7J A;  1S0W A;  4ZJ2 A;  3L9K A;  3O3V A;  1H5X A;  1YLT A;  1F98 A;  3S7N A;  2QJ5 A;  1L0F A;  2Q9N A;  2XEP A;  1CQA A;  5CGS A;  3MKE A;  4QJG A;  3EQV A;  4ARZ A;  3NUL A;  4KZ5 A;  3B42 A;  2ZC4 B;  1PZP A;  5EOE A;  1ZTU A;  2FZ0 A;  1ACF A;  4OPQ A;  1KE0 A;  1XJ4 A;  2EWW A;  1S4R A;  4O8G A;  3BY8 A;  1N9N A;  3HJK A;  1KDW A;  2OSU A;  5GHY A;  3UB5 P;  4LRY C;  1KGE A;  4LFU A;  1YMS A;  2W3G A;  4MBH A;  4MNR A;  2Y2G A;  2PT7 A;  4MLL A;  3S22 A;  4PPR A;  2EXB A;  3Q82 A;  5FQJ A;  1BUL A;  1PYY A;  3HUN A;  5F6A A;  3P01 A;  2VX8 A;  1M40 A;  4HBU A;  4QPR A;  2WZX A;  4OQI A;  4X1L A;  2W0N A;  5F1G A;  5FI6 A;  3WS0 A;  4O0P A;  1WYB A;  4GHI A;  4PKY A;  3VMA A;  1DRM A;  1K6S A;  2V20 A;  5JYO A;  4BBU A;  1GA9 A;  3HL9 A;  1N9O A;  3Q81 A;  3NC8 A;  4MMN A;  3UDI A;  5TBM A;  4PAU A;  5DJU A;  3O88 A;  3ZVW A;  4PM8 A;  1HVB A;  3NI9 A;  5FAT A;  4NKP A;  2ZMA A;  1IYP A;  2X71 A;  1CI8 A;  1K57 A;  3IS2 A;  5CHJ A;  3NJA A;  5HFO A;  1SKO A;  2JE5 A;  3WS4 A;  2EX8 A;  3AGF A;  3FV7 A;  1JVJ A;  3Q7Z A;  1MKM A;  1FR6 A;  2XA7 M;  1BUE A;  4KQD A;  4ETX A;  3UPP A;  3EGD C;  1LSW A;  3C7U A;  4CJN A;  1SZV A;  2J3T C;  5F1F A;  4DE1 A;  3G30 A;  4N1X A;  4Q0I A;  4LCL A;  2HDS A;  4BD1 A;  2P08 A;  3MMH A;  3NCK A;  1J3W A;  3Q07 A;  3IXD A;  4C3Q A;  3WS1 A;  4EWF A;  1BLH A;  3HLG A;  4EBN A;  3UNW A;  1D1J A;  3RJU A;  1K56 A;  3IBR A;  5DJT A;  4R4S A;  3CG5 A;  5GHX A;  4BMW A;  3JPU A;  3VV4 A;  2EFX A;  3OOV A;  2Z6D A;  1YQS A;  2RL3 A;  1KOU A;  2B95 A;  4X53 A;  2PYP A;  4JXS A;  4WLA A;  5EE8 A;  2X02 A;  3IH8 A;  2ZM8 A;  1G68 A;  3AGE A;  4E3I A;  3WWX A;  5FAP A;  3GTC A;  1ALQ A;  4WMC A;  3IXH A;  5HPF A;  3CPT B;  1SKO B;  4ZJ1 A;  3OLO A;  3AGD A;  3BQ8 A;  1MPL A;  3HCY A;  4RVA A;  4PKY G;  3A3J A;  3T4L A;  1K55 A;  3W4O A;  2JKF A;  1XXM A;  4S2N C;  3SW1 A;  2XSS A;  1BYW A;  1H3Q A;  4UHU A;  4KG2 A;  1L3L A;  4IBR A;  1VET A;  1CJF A;  3CHW P;  4YFM A;  2KX6 A;  2XGN A;  1ZKJ A;  2PD7 A;  2IWB A;  2ZQ8 A;  4O7D A;  3A3D A;  1JTD A;  4QD4 A;  3WS5 A;  3H82 B;  4YIN A;  1NY0 A;  5CGW A;  1C3B A;  1PWG A;  2A49 A;  2BTF P;  4XXR A;  5HD3 A;  5KSH A;  4DE2 A;  5DKL A;  4BL3 A;  2VKS A;  1XX2 A;  2JBF A;  4R3B A;  1T19 A;  2PU4 A;  4CLC D;  1L0D A;  1W79 A;  4GB7 A;  5EVE A;  2OWH A;  3MZD A;  3UE6 A;  4MN7 A;  3N8S A;  4G3V A;  3PBT A;  3EQU A;  2B18 A;  2QKP A;  2V2F F;  3DWZ A;  4GD6 A;  1OJ5 A;  1Q2P A;  2Y2H A;  3B3X A;  1NRJ A;  3MBZ A;  3EWK A;  3VOY A;  3ZG8 B;  4LGW A;  3LR4 A;  3HLW A;  3UB9 A;  5FQ9 A;  2WYX A;  3HBR A;  4HJ4 A;  5AQB A;  5E43 A;  1XGI A;  5KSC A;  1BT5 A;  1S4S A;  1CF0 A;  4UA7 A;  2HF6 A;  4I3J A;  3GV9 A;  1UWP X;  4F3L A;  4EUZ A;  5EVI C;  4KQQ A;  5J3W A;  2R9X A;  4EQ1 A;  1YAX A;  1SDN A;  3CZD A;  1VEU A;  4P87 A;  2OOL A;  5GL9 A;  2HP9 A;  2W3E A;  4GZB A;  2ZC5 B;  1ZC2 A;  4DJ3 A;  4E6X A;  5CGX A;  2ZC6 B;  2R78 A;  3C4P A;  4EEP A;  5TBM B;  2EXA A;  5EVL A;  3U4L P;  2O9A A;  4OP8 A;  4UQI S;  3WRZ A;  4F3L B;  2ZC7 A;  2HDQ A;  2VV8 A;  4HP9 A;  3S1Y A;  4Y3I A;  3NHQ A;  4S2N A;  2A24 B;  5EOO A;  3PAE A;  4B4X A;  2O99 A;  2J9P A;  3GR2 A;  4LLO B;  2GX5 A;  4Q8I A;  3W8K A;  3HJI A;  3ZFZ A;  4ZAM A;  2XD5 A;  1GHM A;  3U2A A;  3S7O A;  4P0M A;  1ES4 A;  2J80 A;  5L2F A;  1S1Y A;  4GCZ A;  3HUM A;  5TGF A;  1DP8 A;  4U3T A;  1LHY A;  4EES A;  3QNC A;  2P9V A;  3NOU C;  3QP1 A;  4Y5F A;  4OKP A;  1RCJ A;  4KQO A;  2I9V A;  4OLD A;  3ZNY A;  2P74 A;  4DDS A;  3ZG9 B;  2VLG A;  4F94 A;  1WA9 A;  2GZA A;  1K57 C;  1VQQ A;  3LUQ A;  3F1N B;  3IHA A;  1MC0 A;  2DMW A;  3UB7 A;  2FFF B;  5HW3 A;  2WGW A;  4LEN A;  1JNU A;  1E3U D;  1W5D A;  1ERO A;  5AJG A;  3V67 A;  1H8Y A;  2DCF A;  3G4P A;  4KG5 A;  3DTM A;  2Q9M A;  1F2K A;  1JWV A;  4N9K A;  4PM7 A;  4JF4 A;  3UDX A;  4JF5 A;  2BLS A;  4CLC C;  3F1O B;  2HDU A;  4KZ6 A;  3VSK A;  4P6Z S;  1PWC A;  2Y2M A;  2NUT C;  3T1X A;  3N8R A;  4X69 A;  4L9F A;  1OJG A;  1ONG A;  5EV0 A;  5I94 A;  5EFW A;  1EI5 A;  2IWD A;  5DFY A;  5G4Z A;  1XFQ A;  3QP5 A;  4IBX A;  1SDE A;  2J3W A;  4MN5 A;  2WZZ A;  1RGZ A;  1OT9 A;  5E2F A;  2ZJ9 A;  3OPP A;  5GLD A;  4ZDX A;  1IYS A;  2V9A A;  3R4K A;  1ES3 A;  4CLC E;  1YLJ A;  3HLF A;  4NEE D;  3D4F A;  1XJ2 A;  1W8Q A;  1OTE A;  1G28 A;  3QP2 A;  5HPI A;  3ZNT A;  2E8I A;  2V1A A;  4WUJ A;  4ZBE A;  4N1H A;  3NBL A;  3N8L A;  4P85 A;  3LGO A;  3P98 A;  3TRC A;  2XK1 A;  4X56 A;  4E04 A;  1PWD A;  1ZHH B;  3SS5 A;  1F9I A;  1K6R A;  2LB9 A;  5CTM A;  3V50 A;  2G7U A;  2EA9 A;  2WGV A;  1OT6 A;  2PRF A;  5A90 A;  3PTE A;  3BYD A;  2WKR A;  2M7U A;  1XJ3 A;  3TW8 A;  3UB8 A;  4DF6 A;  3MS6 A;  5CTN A;  1EWZ A;  4JGP A;  4PHT A;  5IS1 A;  3LIB A;  1YLW A;  3C38 A;  5HZH A;  3SH9 A;  3LEZ A;  3IWI A;  3BEC A;  4JPM A;  1ODV A;  5M19 A;  3IX3 A;  3MZF A;  3QP6 A;  5HX9 A;  2DNS A;  4EEU A;  1LL8 A;  4YOF A;  4IUK A;  3LYX A;  4OPY A;  2QYB A;  1ZG4 A;  2JCH A;  1HLU P;  4MDZ A;  5F83 A;  1LSV A;  4LV1 A;  1KE4 A;  2Y59 A;  4YWZ A;  4WMC D;  3F1P A;  3VSL A;  4E3M A;  4UEY A;  3E98 A;  3RTY A;  2ZMF A;  3LFV A;  3ZCZ A;  3EGX C;  4NXG A;  3RXX A;  2W3D A;  2M7V A;  5EVI A;  3UME A;  4R70 A;  4WEL A;  1MWS A;  3H7W B;  3ZDJ A;  1P97 A;  5L09 A;  2P04 A;  3Q1F A;  2XRN A;  3M6H A;  3P7N A;  3QHY A;  4BQM A;  1MWU A;  3E4P A;  5J7E A;  1NWZ A;  5FI2 A;  5AQ9 A;  2ZMV A;  1N9B A;  5HD5 A;  4DDY A;  4GD8 A;  1N4O A;  4B9O A;  1ZG6 A;  5G18 A;  5U47 A;  1W7F A;  2UWX A;  3GSG A;  3MXS A;  3V5M A;  3FPV A;  2IA2 A;  2V8F A;  5CRF A;  3LIF A;  3W2Z A;  4NG2 A;  1K25 A;  3RXW A;  3S7Q A;  2JKR I;  1CEG A;  1YSQ A;  4NXB A;  2W1T A;  5FI7 A;  3T4S A;  5AQ7 A;  2ZOH A;  1PZO A;  1OTB A;  2PBD P;  2K2N A;  3JVV A;  3OPL A;  2QMI A;  3KX0 X;  3MXR A;  1XPB A;  5HAP A;  1PFL A;  2VGL S;  3HRE A;  3LIE A;  1NLZ A;  4LRX C;  2ZL1 B;  2VK3 A;  2ZQ9 A;  5DFX A;  1GHI A;  1NXY A;  5HDC A;  2K31 A;  5CHU A;  4JLF A;  2Y8H A;  2J8Y A;  2H0Y A;  2HGV A;  5HWT A;  2H5S A;  3C7V A;  1STZ A;  1QME A;  1X0O A;  3T4Q A;  3ULF A;  1Z09 A;  4L0L A;  2HP6 A;  5EVI B;  1ES2 A;  4KUO A;  4MBK A;  4X55 A;  3TOI A;  1TF1 A;  3LID A;  4XT2 B;  5JYP A;  1RGY A;  5TR7 A;  1V9Z A;  4BJP A;  4X25 A;  5J8X A;  4WZ5 C;  1MY8 A;  3FWL A;  1YPR A;  1XFN A;  3BFC A;  4ARZ B;  2XD1 A;  2BG1 A;  1TS6 A;  5CEB A;  3UMD A;  3UPO A;  2Y55 A;  3HVF A;  2WUQ A;  4Y0O A;  1TS8 A;  1OTA A;  2P7J A;  3KYQ A;  3MQ0 A;  4XUZ A;  3O87 A;  3C2W A;  1ES5 A;  5HWV A;  2HDR A;  2Z2L B;  2D02 A;  5DTT A;  3T1Q B;  1Y4O A;  3TSG A;  4K0X A;  4FH2 A;  3KYZ A;  3IX8 A;  4IHQ A;  4OON A; 
#chains in the Genus database with same CATH homology
 1PW8 A;  5EOO A;  4OVD A;  1ESI A;  1FCO A;  2RCX A;  3PAE A;  2WK0 A;  3HUO A;  3Q7V B;  4K91 A;  4B4X A;  4B4Z A;  2Y2L A;  1PW1 A;  4S2K A;  4U0T A;  2J9P A;  3N7W A;  3GR2 A;  1GA0 A;  1XP4 A;  2ZQD A;  3CJM A;  1ERQ A;  3LCE A;  4Q8I A;  1IKG A;  4KZ8 A;  4QB8 A;  4Y0U A;  3W8K A;  3ZHH A;  3G2Z A;  2G2W A;  4LCM A;  4ZAM A;  1KVM A;  2XD5 A;  1GHM A;  1HTZ A;  3ZFZ A;  2Y2P A;  1GHP A;  3IF6 C;  5FQM A;  4JXG A;  3VP2 A;  4C75 A;  3LY3 A;  4P0M A;  3VFH A;  5DF8 A;  3HLD A;  1ES4 A;  5L2F A;  1YLZ A;  5HAQ A;  2EX2 A;  4JXV A;  1KE3 A;  3BFG A;  1GCE A;  3NY4 A;  4UAA A;  4UA9 A;  5FSR A;  2WKE A;  4ZTK A;  1I2W A;  3HUM A;  2WGW B;  4PM9 A;  3FZC A;  5TGF A;  4LV0 A;  4OPZ A;  4U3T A;  3G34 A;  1LHY A;  1FSW A;  3QNC A;  2P9V A;  4DE0 A;  4EQI A;  1K4E A;  5FA7 A;  1BSG A;  2WGI A;  3VP1 A;  4R3J A;  5E2E A;  1IYO A;  4OOL A;  5HAR A;  4NET A;  1AXB A;  2PBY A;  4BEN A;  4EBP A;  4OKP A;  1RCJ A;  5DVA A;  2ZQ7 A;  2HPB A;  1NZO A;  4KQO A;  3ITA A;  4OLD A;  3ZNY A;  2P74 A;  4E3K A;  1DY6 A;  4DDS A;  1U60 A;  2XR0 A;  3NIA A;  5F82 A;  1O07 A;  3ZG9 B;  2Y2Q A;  4F94 A;  1YLY A;  3BRM A;  1FQG A;  3UY6 A;  5KZH A;  3OZH A;  4R23 A;  1K54 A;  5FQI A;  1FR1 A;  3S4X A;  4LV3 A;  4H8R A;  3UE0 A;  1K57 C;  1H8Z A;  3I7J A;  1S0W A;  4KZ9 A;  4ZJ2 A;  3VP0 A;  1VQQ A;  3IHA A;  4EV4 A;  1K4F A;  2J9O A;  3O3V A;  1H5X A;  1YLT A;  5A92 A;  4FH4 A;  1FSY A;  2FFF B;  5HW3 A;  1LL5 A;  2WGW A;  4LEN A;  1L0F A;  1ERM A;  3G32 A;  2Q9N A;  1E3U D;  1W5D A;  4N92 A;  1ERO A;  2CC1 A;  4IVK A;  1E3U A;  2XEP A;  1H8Y A;  3IF6 B;  2Y2I A;  2DCF A;  1XGJ A;  3G4P A;  4FD8 A;  2IWC A;  5CGS A;  2WKH A;  3MKE A;  5CEC A;  4QJG A;  4KG5 A;  4X6T A;  3DTM A;  3EQV A;  2Q9M A;  5IHV A;  1IEM A;  4RX3 A;  1I2S A;  2Y2N A;  2EX6 A;  2A3U A;  2XQZ A;  2XLN A;  4P6B A;  1OME A;  1JWV A;  4PM7 A;  4GDB A;  4N9K A;  4JF4 A;  3UDX A;  4JF5 A;  4KZ5 A;  2BLS A;  4RX2 A;  2ZC4 B;  1PZP A;  3C4O A;  3A3E A;  2HDU A;  3W4Q A;  5EOE A;  4DXB A;  4KZ6 A;  3VSK A;  1PWC A;  4OPQ A;  1KE0 A;  2Y2M A;  3OC2 A;  4DKI A;  3MFD A;  4NK3 A;  1SHV A;  3N8R A;  2HP5 A;  4X69 A;  3A3F A;  1Z6F A;  1KDW A;  5DTS A;  2OSU A;  3UE3 A;  1ONG A;  5GHY A;  1O7E A;  5I94 A;  1EI5 A;  1KGE A;  2IWD A;  1YMS A;  3GQZ A;  4MBH A;  4MNR A;  4IBX A;  1Q2Q A;  2Y2G A;  1SDE A;  1KVL A;  3UE1 A;  1E4D A;  4MLL A;  3S22 A;  4PPR A;  1K56 D;  2XF3 A;  3IWQ A;  2WZZ A;  1RGZ A;  1NYY A;  2EXB A;  3Q82 A;  5FQJ A;  1BUL A;  1CEF A;  1PYY A;  5E2F A;  2ZJ9 A;  1VM1 A;  3UN7 A;  3OPP A;  4OPR A;  3HUN A;  1K38 A;  4GN2 A;  5GLD A;  1JTG A;  4ZDX A;  1IYS A;  4KG6 A;  2R9W A;  1PI5 A;  1M40 A;  1NRF A;  4HBU A;  2WZX A;  4OQI A;  1ES3 A;  4QY5 A;  4S2I A;  1J9M A;  4BD0 A;  5F1G A;  5FQQ A;  2WAE A;  5FAS A;  3PBR A;  1SCW A;  3PAG A;  4GOG A;  5FI6 A;  3WS0 A;  1WYB A;  3VMA A;  3IT9 A;  5GHZ A;  2H10 A;  1YLJ A;  3PBS A;  3P09 A;  2V20 A;  1K6S A;  3HLF A;  3TG9 A;  3D4F A;  1W8Q A;  5FDH A;  3V3R A;  5JYO A;  1GA9 A;  1BLP A;  3HL9 A;  1BTL A;  4BLM A;  3ZNT A;  3Q81 A;  3NC8 A;  2E8I A;  4OQG A;  5DF9 A;  1M6K A;  4N1H A;  4ZBE A;  3UDI A;  3NBL A;  5FAQ A;  3N8L A;  3O88 A;  1RP5 A;  4P85 A;  3ZVW A;  2B5R A;  4PM8 A;  1HVB A;  1MXO A;  1IKI A;  3NI9 A;  2C5W B;  3P98 A;  5FAT A;  2XK1 A;  4PMA A;  1JWP A;  4KEN B;  4X56 A;  1FCM A;  5EUA A;  2ZMA A;  1IYP A;  5CER A;  3OPR A;  2X71 A;  3SH7 A;  5AQA A;  1PWD A;  1CI8 A;  3IXB A;  1K57 A;  4S2M A;  4JKT A;  5CHJ A;  5HFO A;  3SS5 A;  1Y54 A;  1QMF A;  2JE5 A;  3WS4 A;  4PM5 A;  1LL9 A;  2EX8 A;  3AGF A;  4R1G A;  1K6R A;  2WKI A;  5CTM A;  2WAF A;  3FV7 A;  3V50 A;  4D2O A;  4Y0T A;  4FSF A;  1JVJ A;  1NYM A;  3Q7Z A;  1FR6 A;  1L2S A;  1BUE A;  2WGV A;  4QU3 A;  5HL1 A;  1XA1 A;  5A90 A;  2XDM A;  4S2L A;  3UPP A;  4WZ5 A;  2P9V B;  3DW0 A;  3PTE A;  3BYD A;  4N9L A;  3C7U A;  4CJN A;  4OQH A;  4DF6 A;  5F1F A;  4KZA A;  4DE1 A;  3ZG5 A;  3G30 A;  5E2G A;  5CTN A;  4N1X A;  1EWZ A;  2X01 A;  4EBL A;  4LCL A;  2HDS A;  1L0E A;  2Y2O A;  1PIO A;  1HD8 A;  4BD1 A;  4GKU A;  1YLW A;  1BLS A;  2Y4A A;  3SH9 A;  3UPN A;  3IF6 A;  3NCK A;  3OCL A;  3Q07 A;  3IXD A;  4C3Q A;  3LEZ A;  2GDN A;  3WS1 A;  4EWF A;  3OPH A;  1MWR A;  1BLH A;  3ZG0 A;  3HLG A;  3IWI A;  4EBN A;  2Y91 A;  3BEC A;  3BFF A;  4JPM A;  3UNW A;  2PU2 A;  5M19 A;  4FCF A;  4PM6 A;  1XA7 A;  2FFY A;  3MZF A;  3RJU A;  1K56 A;  5HX9 A;  2DNS A;  4IVI A;  1JWZ A;  3HLB A;  1I5Q A;  4Z9Q A;  4OPY A;  1YMX A;  1ZG4 A;  4R4S A;  5A91 A;  2JCH A;  3CG5 A;  5GHX A;  1TDL A;  4U0X A;  4KZ4 A;  4S2P A;  3UDF A;  2QPN A;  5M1A A;  3HLE A;  3GMW A;  3ZG7 B;  5F83 A;  2EFX A;  4LV1 A;  1KE4 A;  2Y59 A;  3E2K A;  2EX9 A;  3BLM A;  3LO7 A;  1K54 C;  1YQS A;  4WMC D;  3M2K A;  2RL3 A;  1G6A A;  3VSL A;  3BFD A;  4X53 A;  4JXS A;  5EE8 A;  4E3M A;  4E3O A;  5GLB A;  2X02 A;  3IH8 A;  2ZM8 A;  3IQA A;  4WYY A;  4WM9 A;  3ZCZ A;  4OQ0 A;  1G68 A;  1ESU A;  2VGK A;  5M18 A;  3BEB A;  4E6W A;  1YLP A;  5CED A;  4IED A;  3AGE A;  2C6W B;  3RXX A;  4A5R A;  4E3I A;  3WWX A;  5FAP A;  3GTC A;  3M6B A;  3VFF A;  2ZD8 A;  4E3N A;  5EVI A;  1ALQ A;  4WMC A;  3WS2 A;  3IXH A;  1IEL A;  5EVI D;  3IXG A;  4WEL A;  1MWS A;  1TVF A;  3AGD A;  5EEC A;  4ZJ1 A;  1KGG A;  2J7V A;  4XUX A;  4OP5 A;  1MPL A;  3VP3 A;  3ZDJ A;  4RVA A;  5FAO A;  3A3J A;  1FOF A;  3VOZ A;  3Q1F A;  1K55 A;  4K0W A;  3W4O A;  4B88 A;  3M6H A;  3QHY A;  4BQM A;  1MWU A;  2I72 A;  1XXM A;  4S2N C;  5CXW A;  4JF6 A;  1YT4 A;  4RYE A;  2ZLY A;  3NDE A;  4DRT A;  3SH8 A;  4UHU A;  2QZ6 A;  4MEZ A;  3IF5 A;  5CHM A;  5DTK A;  5FI2 A;  5DF7 A;  1XKZ A;  5AQ9 A;  1N9B A;  5TFQ A;  4KG2 A;  3SS4 A;  4DDY A;  4GD8 A;  1N4O A;  4IBR A;  1CK3 A;  1ZG6 A;  1FCN A;  5G18 A;  1W7F A;  4YFM A;  5U47 A;  2OLV A;  2UWX A;  2ZC3 B;  3IWO A;  3LY4 A;  1K55 C;  2XGN A;  3G2Y A;  1ZKJ A;  3GSG A;  3GRJ A;  3FKW A;  2IWB A;  3G35 A;  1DJA A;  2ZQ8 A;  3MKF A;  3MXS A;  3MZE A;  4O7D A;  4R0Q A;  4S2O A;  3A3D A;  1JTD A;  4QD4 A;  4QY6 A;  1L0G A;  3V5M A;  1TDG A;  4OH0 A;  3WS5 A;  4YIN A;  1NY0 A;  5CGW A;  1C3B A;  1PWG A;  3VP4 A;  2A49 A;  3UO9 A;  5CRF A;  4XXR A;  1WE4 A;  1W8Y A;  3M2J A;  1YM1 A;  1K25 A;  4Y7P A;  3SS3 A;  5KSH A;  4DE2 A;  4E3J A;  4ZJ3 A;  1TEM A;  4BL3 A;  3BFE A;  5BOH A;  4R4R A;  2V1Z A;  3Q7V A;  3RXW A;  1CEG A;  1XX2 A;  2JBF A;  4JBF A;  3A3I A;  4R3B A;  2XH9 A;  2PU4 A;  5FI7 A;  1L0D A;  2Y2J A;  4X68 A;  5AQ7 A;  1ONH A;  1W79 A;  3ZVT A;  1MBL A;  1PZO A;  4GB7 A;  3MZD A;  3OPL A;  4CPK A;  1LI9 A;  4C6Y A;  2QMI A;  3N8S A;  4OOM A;  3PBT A;  4OOY A;  5GLA A;  3EQU A;  3MXR A;  2XFS A;  1XPB A;  5HAP A;  2V2F F;  3DWZ A;  3HRE A;  2ZM0 A;  4GD6 A;  1Q2P A;  3IHB A;  2Y2H A;  3N4I A;  3B3X A;  5D3O A;  3V3S A;  2ZQ9 A;  3MBZ A;  3PBN A;  3W4P A;  3VOY A;  1LLB A;  3ZG8 B;  5EPH A;  5HAI A;  3N6I A;  1GHI A;  2OV5 A;  1NXY A;  1BZA A;  2ZM2 A;  1DJB A;  4OLG A;  4S2J A;  5CHU A;  1PI4 A;  4JLF A;  3O86 A;  3SOI A;  3HLW A;  4LV2 A;  2J8Y A;  5FQ9 A;  2WYX A;  3HBR A;  2H0Y A;  4JXW A;  5FQK A;  5GLC A;  3JYI A;  5AQB A;  2H5S A;  5A93 A;  4KZ7 A;  5E43 A;  1XGI A;  3C7V A;  5KSC A;  2JC7 A;  2Y2K A;  3ZGA B;  1QME A;  3FKV A;  1SKF A;  4WEK A;  5KMW A;  4L0L A;  3HLC A;  3CMZ A;  4UA6 A;  1BT5 A;  4WEJ A;  2HP6 A;  1ES2 A;  4MBK A;  5EVI B;  4X55 A;  2OLU A;  4UA7 A;  1KDS A;  3TOI A;  4WZ4 A;  3GV9 A;  3PBO A;  4DE3 A;  1WYC A;  4EUZ A;  4BL2 A;  5EVI C;  2H0T A;  4KQQ A;  2R9X A;  4HEF A;  1MWT A;  2XFT A;  3E2L A;  5JYP A;  1RGY A;  5TR7 A;  4KZB A;  3OCN A;  3V39 A;  1SDN A;  3CZD A;  4KZ3 A;  4WBG A;  4BJP A;  1DJC A;  2WAD A;  4ID4 A;  2DRW A;  5J8X A;  4MBF A;  1MY8 A;  4P87 A;  4WZ5 C;  1CI9 A;  3FWL A;  2ZQA A;  1LI0 A;  3PBQ A;  3C5A A;  3BFC A;  5GL9 A;  2HP9 A;  4GNU A;  4DXC A;  1NZU A;  3QNB A;  4GZB A;  2XD1 A;  2BG1 A;  4QHC A;  1NJ4 A;  5CEB A;  3UPO A;  3ITB A;  3NDG A;  2Y55 A;  3HVF A;  2WUQ A;  4Y0O A;  2ZC5 B;  1ZC2 A;  4E6X A;  1S6R A;  3IH9 A;  4XUZ A;  3O87 A;  5CGX A;  2ZC6 B;  3C4P A;  3ISG A;  1ES5 A;  2ZQC A;  3WRT A;  4E3L A;  3DWK A;  1BLC A;  2EXA A;  5EVL A;  1MKI A;  2HDR A;  2Z2L B;  1IYQ A;  5E2H A;  2Z2M B;  5DTT A;  2EFU A;  4OP8 A;  2VGJ A;  3GVB A;  3WRZ A;  1E25 A;  3TSG A;  4K0X A;  2ZC7 A;  1KGF A;  4FH2 A;  4HBT A;  3BLS A;  3G31 A;  2HDQ A;  4GDN A;  1HZO A;  3S1Y A;  3FYZ A;  2G2U A;  4RA7 A;  3BM6 A;  4S2N A;  4OON A;  4M3K A;  4KQR A;  4HES A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...