3FZCA

Oxa-24 beta-lactamase complex with sa3-53 inhibitor
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
244
structure length
243
Chain Sequence
HISSQQHEKAIKSYFDEAQTQGVIIIKEGKNLSTYGNALARANKEYVPASTFMLNALIGLENHKATTNEIFKWDGKKRTYPMWEKDMTLGEAMALSAVPVYQELARRTGLELMQKEVKRVNFGNTNIGTQVDNFWLVGPLKITPVQEVNFADDLAHNRLPFKLETQEEVKKMLLIKEVNGSKIYAKSGWGMGVTPQVGWLTGWVEQANGKKIPFSLNLEMKEGMSGSIRNEITYKSLENLGII
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactamase OXA-24
publication title Design, synthesis, and crystal structures of 6-alkylidene-2'-substituted penicillanic acid sulfones as potent inhibitors of Acinetobacter baumannii OXA-24 carbapenemase.
pubmed doi rcsb
source organism Acinetobacter baumannii
molecule tags Hydrolase
total genus 78
structure length 243
sequence length 244
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2009-01-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 3fzcA00
5TGFA 3FYZA 4OPQA 1KE3A 5EVIA 1NZUA 4B4ZA 5FQMA 4Z9QA 1G6AA 2OLUA 5A91A 3LO7A 1I5QA 1O07A 1U60A 3G34A 3CJMA 1ES2A 2XF3A 2XEPA 3UDFA 4GOGA 5FATA 1LLBA 1IELA 3IHBA 5FDHA 4OQIA 1XPBA 5AQAA 1ERQA 2WK0A 5DTTA 5FA7A 1BUEA 3HL9A 3IF5A 3OZHA 1PIOA 4OPRA 1BLPA 4UA7A 5CGWA 3WRZA 1NXYA 4GD8A 5FASA 3N8LA 4YFMA 3BYDA 4GDBA 1E3UD 2UWXA 3MXRA 1KDWA 4WMCD 1XX2A 4GNUA 3N4IA 4XXRA 1LL9A 3IF6C 4IVIA 3MZEA 3Q82A 4HBUA 4GD6A 5HAQA 1YLJA 5FQKA 3RXXA 1PW8A 3CMZA 4Q8IA 4FH4A 3HBRA 4OKPA 4OOYA 2JE5A 4X56A 1CK3A 1N9BA 5EVIC 3QNCA 4E3IA 5CTMA 3PBQA 3QHYA 4JXWA 3UPOA 1DJBA 4R1GA 4WZ4A 4OQ0A 1WYCA 2RCXA 3FKWA 4Y0OA 3GSGA 5CECA 4DXBA 3RJUA 4C3QA 3M6HA 1KGGA 1BLHA 3RXWA 3UE0A 2HDSA 3BFFA 2Y2JA 3VOYA 5A90A 1YMXA 2XDMA 1FCOA 1ESUA 4JBFA 3GTCA 2J9PA 5AQ7A 1RP5A 3BEBA 2E8IA 3WS1A 4P0MA 3GQZA 3BLSA 5DTKA 2OV5A 4MBFA 5DF9A 5HX9A 4DRTA 4KZ6A 2ZC6B 1GHPA 5M18A 4OOLA 2EX8A 4NK3A 4OQHA 3DTMA 2EX6A 5JYOA 1PI5A 2G2WA 1ONGA 3OCNA 3FZCA 5CERA 4JKTA 3VP4A 1YLTA 4KZ7A 3W4QA 3ZG5A 1MWUA 4QD4A 2EX2A 4E3MA 2EX9A 3IXHA 4Y7PA 1GHIA 1XGJA 2Y91A 1GA0A 3SH9A 3VSLA 5FQ9A 3UDXA 2ZQ9A 1H5XA 3PBOA 3NY4A 4K0WA 2R9XA 3MZDA 1NYYA 2WZZA 3D4FA 3VFHA 2XFSA 1SDEA 1BULA 1VM1A 3MXSA 1BLSA 2WGIA 4ZDXA 2PU4A 2HDRA 1HD8A 4R0QA 4OOMA 3HLCA 1K6RA 3IXBA 1LI0A 1KE0A 4OLGA 3DW0A 2WAEA 3Q7VA 4OPYA 4PPRA 5HAIA 2WYXA 3IWIA 3GRJA 3ITBA 3WRTA 5CRFA 1VQQA 1K25A 3V39A 4JF6A 4S2IA 4EBPA 3OPPA 3O86A 2Q9NA 1MWTA 1BLCA 2WKHA 1ES5A 1SHVA 4BQMA 1KVLA 2C5WB 4WM9A 4X6TA 3I7JA 3WS4A 5M1AA 3W4OA 3ZG0A 4DXCA 1AXBA 2H0TA 4YINA 2ZM8A 4OVDA 1L0DA 4PM7A 3ZGAB 4IEDA 5AQ9A 5TFQA 2ZLYA 2Y2QA 5GLDA 4PM8A 2HDUA 3M2JA 5CHUA 3OCLA 4PM6A 4N1HA 2Y59A 5DF7A 4ZJ3A 4CJNA 3G31A 3MBZA 3S22A 5F1FA 3IF6A 1BT5A 1NY0A 1MKIA 3N8RA 3HLGA 1S0WA 1E4DA 2WGWA 4OLDA 2J9OA 1XA7A 4OONA 3FKVA 4L0LA 5JYPA 2XLNA 1E25A 1FR6A 3HUOA 1N4OA 1YM1A 2B5RA 4R3JA 3C4PA 5F83A 3PAGA 2ZMAA 4KG6A 1CEGA 1L0EA 1DY6A 1S6RA 2IWCA 3ZG9B 3VP2A 1H8YA 4X68A 2XD5A 2A49A 1ERMA 4PM5A 5HFOA 3CG5A 4KG2A 2PBYA 2PU2A 2IWDA 3V3SA 3NDEA 3W4PA 1IYPA 4S2OA 3ZNTA 3UO9A 1HTZA 4LV3A 4UAAA 1RCJA 2ZC4B 1IKGA 3NCKA 2ZJ9A 3VP0A 5EUAA 1MWSA 5EVID 2GDNA 4PMAA 1FSYA 1QMFA 1RGYA 4S2PA 4WEKA 2DCFA 4E3NA 3PTEA 1H8ZA 3OPHA 4WEJA 3WWXA 3NDGA 4GKUA 4BENA 1ZG6A 2DNSA 4S2JA 3IWOA 3SH8A 3G2ZA 4MBHA 3UPPA 4JXVA 1JWVA 3PAEA 1PI4A 5GLAA 4HEFA 3ZHHA 5EE8A 5E2EA 3O87A 1GHMA 2WZXA 4OP5A 4NETA 1XA1A 1YLPA 4JF5A 1PW1A 3Q81A 4IVKA 4MLLA 4QJGA 1K38A 2R9WA 2FFFB 3G32A 4C75A 3E2LA 5G18A 4WZ5C 5F1GA 2ZC7A 1M40A 2ZM2A 2CC1A 1KDSA 2Q9MA 4S2LA 4U0TA 5FQQA 4R4SA 3Q7ZA 3HLBA 4R4RA 4RX3A 5CHJA 4JXGA 1LHYA 3Q07A 3MKFA 3V5MA 1CI9A 4ZBEA 1LI9A 1K54A 5BOHA 5I94A 1NYMA 2FFYA 1PWCA 4P6BA 4KZBA 4EBLA 1NJ4A 4R3BA 1SDNA 1MY8A 3Q1FA 4DE3A 3V50A 1K56A 2QMIA 3Q7VB 2BLSA 4LV2A 1O7EA 4RX2A 1ZKJA 3BFDA 4E3LA 2RL3A 1HVBA 3ZDJA 4KZ3A 4O7DA 1ES3A 1GA9A 2G2UA 3UY6A 5HAPA 1KVMA 5EVLA 3M2KA 3A3EA 1JVJA 2BG1A 4KENB 3CZDA 3HVFA 4PM9A 2P9VB 4N1XA 2XR0A 3G30A 2IWBA 2V1ZA 3HREA 3VP3A 3VMAA 2JC7A 1BTLA 3ITAA 4KZ8A 3ISGA 3N8SA 1K54C 2XD1A 3SH7A 3JYIA 3G35A 3IH9A 4HESA 2Y4AA 3IT9A 2J8YA 3LY3A 3LEZA 3UE1A 3TG9A 4MNRA 3AGDA 2Y2GA 1M6KA 3IF6B 1L2SA 1YLZA 3GV9A 5CGXA 5E2FA 5AQBA 5FI7A 1DJCA 2Y2HA 2P74A 3P98A 5E2GA 4ZTKA 4K91A 5L2FA 2WGWB 3SS3A 4E3JA 4QB8A 2EXAA 5EVIB 1YLWA 5CEBA 4KZ4A 1FSWA 1W7FA 1JWZA 4QHCA 4N9KA 3GR2A 3MFDA 1IYOA 1ZG4A 4OQGA 2OLVA 4RA7A 3VP1A 1Q2QA 4N92A 4WELA 2QZ6A 3SS5A 2WKIA 1MPLA 1EROA 2WKEA 4IBXA 3IQAA 1YT4A 1IEMA 1L0FA 3MKEA 1PZOA 3IXDA 3WS5A 2XQZA 4KZ9A 1JWPA 1PWDA 1KGFA 5FAPA 2Y2IA 3BLMA 4DE1A 1BSGA 1W8YA 1DJAA 4K0XA 3HUNA 3QNBA 3FWLA 1JTGA 3GMWA 5GLBA 4DDYA 4WBGA 5FQIA 3HLWA 2VGJA 1J9MA 4WYYA 3G2YA 5E43A 4E3OA 4P87A 2I72A 3EQVA 3OPLA 4DF6A 2ZQ7A 4KQOA 4E3KA 1K55C 5EOOA 2ZQCA 3FV7A 2XGNA 4LV1A 1NRFA 1I2WA 4ID4A 5FSRA 5A92A 4MEZA 4S2NC 5E2HA 1EWZA 4KQRA 3WS2A 4B88A 3W8KA 3VOZA 3HLEA 1PWGA 2HP6A 4WZ5A 1CI8A 1Q2PA 1XXMA 3AGEA 3UE3A 4KZAA 2HDQA 4GB7A 3N7WA 4EQIA 3BFEA 5DTSA 3SOIA 1KGEA 1YQSA 5EECA 4ZJ1A 3SS4A 2ZQ8A 3N6IA 5M19A 1K4EA 4MBKA 4UHUA 5CGSA 2X02A 1GCEA 4D2OA 2V20A 5F82A 2QPNA 2ZC3B 3G4PA 2VGKA 3P09A 2XH9A 3ZNYA 4C6YA 1FCNA 4QY6A 2WADA 3ZVTA 4M3KA 2A3UA 4IBRA 3O3VA 4N9LA 2WAFA 3GVBA 4XUXA 1TVFA 3IWQA 4RYEA 1YMSA 4JLFA 3IXGA 5KZHA 1LL5A 1IKIA 1CEFA 3O88A 4LV0A 5FQJA 4X69A 4EUZA 3C7UA 4BD0A 2HPBA 4JF4A 2C6WB 4U3TA 4GDNA 3PBTA 3NC8A 4FH2A 4S2MA 5HW3A 4QU3A 3ZG8B 4LCLA 4S2KA 3LY4A 2Y2MA 4DKIA 2H10A 4UA6A 4JXSA 3OPRA 3HLFA 5CXWA 1OMEA 4JPMA 5DF8A 1WE4A 3V3RA 2EFUA 1HZOA 5DVAA 5IHVA 1IYQA 1QMEA 4BL2A 1Z6FA 2Y55A 3S4XA 4EWFA 5FAOA 3BRMA 3C4OA 1RGZA 2ZQDA 2EXBA 2Z2MB 3MZFA 1C3BA 1JTDA 3ZG7B 3A3IA 1SCWA 1TDLA 2WUQA 3BECA 1PYYA 5GL9A 2XFTA 4FCFA 4FSFA 1MBLA 2V2FF 2ZQAA 3DWZA 5TR7A 4DE0A 2ZC5B 5GHZA 4BJPA 4DDSA 2Y2KA 2Y2OA 5CTNA 4R23A 4X55A 2HP9A 4OH0A 4Y0UA 1KE4A 2XK1A 2HP5A 4HBTA 1K56D 1K57A 4FD8A 4OP8A 4XUZA 5CEDA 4GN2A 4Y0TA 1W5DA 1XP4A 3B3XA 4KG5A 4E6XA 3A3FA 3TSGA 5KSCA 4UA9A 4RVAA 5D3OA 5U47A 4OPZA 1ES4A 3NBLA 3VSKA 1K6SA 2X71A 1ONHA 4U0XA 3PBRA 1Y54A 2J7VA 3TOIA 1W79A 3AGFA 4DE2A 4BD1A 4LCMA 3UDIA 1FOFA 4BL3A 1IYSA 1K55A 3HLDA 3BFCA 3WS0A 4ZAMA 1FR1A 3BM6A 2Y2NA 5FI2A 3IH8A 5HARA 4S2NA 3OC2A 1MXOA 3ZFZA 5HL1A 4BLMA 2Y2LA 1K57C 1BZAA 1FQGA 1XGIA 3ZVWA 3C5AA 1K4FA 4KQQA 2X01A 1PZPA 2EFXA 3C7VA 3LCEA 2H0YA 5GHYA 4CPKA 1ESIA 3ZCZA 4H8RA 4EV4A 5KMWA 2DRWA 1WYBA 2WGVA 4GZBA 3M6BA 3A3DA 2P9VA 1ZC2A 1TDGA 2JCHA 4X53A 4ZJ2A 3VFFA 3NI9A 5GHXA 2OSUA 3PBSA 3UNWA 1XKZA 1I2SA 3UPNA 3DWKA 2ZM0A 3HUMA 1NZOA 4E6WA 3EQUA 4QY5A 1L0GA 1FCMA 5J8XA 2JBFA 1G68A 5A93A 3A3JA 1MWRA 3UN7A 1TEMA 5CHMA 5GLCA 2Y2PA 3E2KA 2H5SA 1YLYA 4KZ5A 4P85A 5FAQA 3NIAA 3BFGA 3S1YA 4B4XA 5KSHA 1E3UA 2Z2LB 1W8QA 5EOEA 5EPHA 4EBNA 2ZD8A 1EI5A 4WMCA 3IHAA 4F94A 1ALQA 5FI6A 3PBNA 4LENA 1SKFA 4A5RA
chains in the Genus database with same CATH superfamily
1KE3A 3LO7A 1O07A 1U60A 3G34A 2JKGA 1ES2A 2XEPA 1LLBA 5DFXA 1XPBA 2WK0A 3ZVWA 3HL9A 3OZHA 5CGWA 3WRZA 4GDBA 4WMCD 4HH3A 1LL9A 1XJ3A 1YLJA 1NWZA 4OOYA 4X56A 4E3IA 3UPOA 2XA7M 4R1GA 1OTBA 1F98A 4HOIA 2W1TA 5IS1A 4C3QA 5KIZA 2HDSA 3T4KA 3VOYA 2OWHA 5HPIA 3RTYA 4I3AA 3R7WB 2XDMA 5AQ7A 3GTCA 1RP5A 3S7QA 3BEBA 3GQZA 2OV5A 2V9AA 5DF9A 1TF1A 4NKPA 2PRFA 2EX8A 4OOLA 3H82B 3OCNA 5CERA 1YLTA 4E04A 1T1CA 3DAVA 3F1NA 3IS2A 4FUWA 5L09A 1GSXA 3D72A 2WZZA 4HY8A 3QP5A 5L10A 2JKRI 4R0QA 1HD8A 4OOMA 5J3WA 4OLGA 5DKKA 3DW0A 5HAIA 5CRFA 1K25A 3OPPA 4LRYC 2H28A 2G7UA 1SHVA 2L1MA 4X6TA 4NXFA 4YINA 2H0TA 4OVDA 3ZGAB 5AQ9A 4B9OA 2ZLYA 2Y2QA 5GLDA 5CHUA 4ARZB 1DRMA 4HP4A 1MKIA 2GJ3A 1H3QA 2J9OA 4OONA 2XLNA 1FR6A 2B5RA 3MMHA 3C4PA 3PAGA 4KG6A 4Y13A 3TE8A 3EEAA 1ERMA 4PM5A 2JKFA 3A0SA 3LR0A 2I9VA 4IHQA 3T12B 3BQAA 3NCKA 2BTFP 4PMAA 4MDZA 4E3NA 3WWXA 1H8ZA 3OPHA 4WEJA 3NDGA 4GKUA 2DNSA 4S2JA 3T4SA 3IWOA 3UE6A 3UB7A 4MBHA 3ZHHA 1PI4A 3LR3A 1GHMA 4OP5A 4NETA 1XA1A 4JF5A 4IVKA 1K38A 4WZ5C 5F1GA 1M40A 5MC7A 1KDSA 2Q9MA 4S2LA 4R4SA 3HLBA 3MKFA 4O0PA 4ZBEA 1K54A 5BOHA 1TS0A 2FFYA 1LL8A 4KZBA 1K56A 1D1JA 3Q7VB 4DJ3A 4LV2A 3BFDA 2MJ6A 4KZ3A 4O7DA 1ES3A 1GA9A 2G2UA 5HAPA 3HJKA 5EVLA 3M2KA 3A3EA 1JVJA 2P9VB 4N1XA 3K2NA 1FILA 2IWBA 3T4LA 3P01A 3IBRA 3ISGA 3N8SA 1K54C 1VHMA 4HESA 2Y4AA 3SW1A 1OTIA 4MNRA 3KO6A 1M6KA 3IF6B 2P74A 3P98A 2INWA 4MMNA 3SS3A 3R7WA 2KX6A 2ZBBA 5EVIB 4Q0HA 3F1OB 1MZUA 1IYOA 2OLVA 4DJ2A 3VP1A 1Q2QA 4N92A 2WKEA 5FEGA 1PZOA 3IXDA 3WS5A 3R4KA 2Y2IA 2ZL1A 3HUNA 3GMWA 5GLBA 1J9MA 4L9GA 2O0YA 3NOUC 2I72A 1TS6A 2ZQ7A 3FV7A 4UEYA 4LV1A 5E2HA 4KQRA 1G28A 1YSPA 3W8KA 1AWIA 3HLEA 1Q2PA 3OLOA 2HDQA 4GB7A 3SOIA 1KGEA 1YQSA 2PR5A 4WN5A 5CGSA 4R70A 3P09A 2XH9A 1CQAA 3ZNYA 1ODVA 1FCNA 2WADA 4HIAA 4N9LA 2WAFA 4XUXA 1TVFA 3IXGA 4L9FA 3O88A 5FQJA 4EUZA 4ARZA 3C7UA 4CLCE 2C6WB 3NC8A 4QU3A 3LY4A 4DKIA 3ICYA 5CXWA 3EWKA 5IHVA 5G4YA 1IYQA 1QMEA 1Z6FA 5FAOA 1OT9A 1OJGA 3MZFA 1C3BA 1JTDA 2LB9A 3DWZA 2HGVA 3F1PB 1GSVA 2ZC5B 1NLYA 4BJPA 4DDSA 2Y2OA 5CTNA 2PYRA 4G3WA 2AVXA 1K57A 1YKDA 4FD8A 2R78A 4GN2A 4Y0TA 1W5DA 3B3XA 4BBUA 5D3OA 2PT7A 4OPZA 3VSKA 3TOIA 1W79A 3AGFA 4BD1A 4LCMA 1IYSA 3HLDA 3WS0A 1FR1A 5TBMB 3BM6A 5FI2A 4S2NA 5F5YA 2VA0A 3KSIA 3U2AA 3T4OA 3ZFZA 4BLMA 1K57C 1BZAA 3ZYTA 3C8CA 3C7VA 2H0YA 3ZCZA 4EV4A 5KMWA 2WGVA 2VK3A 2P9VA 1ZC2A 2V0WA 3H7WB 2OSUA 3DTKA 3FG8A 2ZM0A 3HUMA 4E6WA 1L0GA 3A3JA 1MWRA 4Y17A 5CHMA 2A2LA 4NG2A 1D06A 3T50A 4B4XA 3S1YA 1E3UA 4EBNA 3IHAA 4F94A 1ALQA 4LENA 4A5RA 3FYZA 4FTXA 5EVIA 1NZUA 3CPTB 3F1OA 5A91A 1I5QA 3O5YA 2Y79A 2ZOIA 3CJMA 5FATA 5FA7A 1BUEA 4OPRA 1NXYA 1IFQA 4GD8A 5DJTA 3BYDA 1E3UD 2UWXA 4GNUA 2A24B 2YKHA 3IF6C 4IVIA 4H6JB 4UQIS 3Q82A 4GD6A 5HAQA 3LUQA 3CMZA 2VEAA 3HBRA 1CK3A 5EVIC 3QHYA 4WZ4A 2RCXA 3FKWA 2NUPC 4Y0OA 4HHDA 3GSGA 5CECA 4CLCD 3E4QA 1S4RA 3RJUA 1T19A 1ZTUA 4WL9A 3RXWA 2Y2JA 5C5KA 4WLAA 4PAUA 1YPRA 4MBFA 3MQ0A 5M18A 1OTAA 4OQHA 1PI5A 2G2WA 3CWFA 2HZ5A 3QP6A 3PHYA 5HZHA 3VP4A 4KZ7A 1MWUA 5F68A 2EX2A 4E3MA 2Y91A 1YAXA 5HSQA 3VSLA 3UDXA 3IX8A 1H5XA 2VV6A 1Y28A 1NYYA 3D4FA 5FL3A 3VFHA 3MXSA 3QP4A 3IXBA 1LI0A 3VE4A 2B95A 3ITBA 3V39A 1PNEA 2PBDP 3MR0A 3EGXC 4WM9A 3C2WA 3CI6A 3WS4A 5M1AA 3W4OA 4DXCA 2W3HA 4ETZA 1L0DA 4IEDA 3PXPA 2HJ9C 3OCLA 3UMDA 5DF7A 4ZJ3A 5HDSA 3CAXA 1BT5A 1NY0A 4JGQA 4CQHA 2WKPA 1E4DA 2WGWA 4LRXC 4OLDA 4GHIB 5JYPA 1E25A 3HUOA 5F83A 2ZMAA 1S1ZA 1S6RA 4R38A 5TBMA 5J4EA 2QJ5A 2IWCA 2QHKA 3VP2A 1H8YA 2A49A 3CG5A 4KG2A 3W4PA 1UWPX 1Z09A 3NDEA 5HDDA 2OAQ1 3UO9A 1HTZA 2PD8A 1IKGA 2ZJ9A 2UV0E 2PHYA 3UB5P 4I3JA 4S2PA 1FSYA 1QMFA 4G3VA 2DCFA 3H7WA 4GS9B 5HPFA 5DKLA 3SH8A 3UPPA 4JXVA 3PAEA 5GLAA 3E0YA 4HEFA 1YLPA 3BJNA 3Q81A 1P9WA 2R9WA 3G32A 2CC1A 3Q7ZA 1VETB 4R4RA 5CHJA 4RX3A 3Q07A 1LI9A 4HJ6A 3CPTA 4LPZA 2ZOHA 4P6BA 1SDNA 1MY8A 2W3DA 3V50A 2QMIA 1ZKJA 2KDKA 3QP2A 3MXQA 1HVBA 4NXGA 4R6LA 5HWTA 3H9WA 2ZMFA 2PAVP 1KVMA 1TD5A 2BG1A 2A24A 3HVFA 2J3WA 4PM9A 1LSVA 4UQIM 3LI8A 3ITAA 2XD1A 3G35A 1CJFA 3IT9A 1L2SA 1YLZA 5E2FA 5AQBA 1FIKA 1JNUA 4K91A 1S4SA 4E3JA 3D9YA 5CEBA 1JWZA 3UB6A 4N9KA 3SS5A 2VV8A 2WKIA 4HH2A 1EROA 4IBXA 3IX4A 1IEMA 1L0FA 1SZVA 2XQZA 1PWDA 3DTIA 1KGFA 5FAPA 4DE1A 4ETXA 4KUKA 4K0XA 2XRNA 4WBGA 4LGWA 4P87A 2ACGA 3OPLA 4EXOA 1N9NA 4KUOA 2ZQCA 2XGNA 3HJIA 4QWOA 1ACFA 1EWZA 3WS2A 3S7NA 2P7JA 4EQ1A 2HP6A 3MJQA 4WZ5A 4WUJA 3N7WA 5EECA 2X02A 2V20A 3NOTC 4Q0IA 3LIFA 4G3KA 4O8GA 3ZVTA 2A3UA 2W3GA 3GVBA 2D02A 4JLFA 1LL5A 3KSFA 4HQAA 4JF4A 4S2MA 5HW3A 4LCLA 2L0WA 4JXSA 1H8MA 4BBTA 3V3RA 4ZRRA 1HZOA 5DVAA 4EWFA 1STZA 3MQQA 2P04A 3BRMA 2Z2MB 3CUEA 2XSSA 4EETB 1TDLA 3BWLA 5GL9A 2XFTA 4FCFA 4FSFA 2M1CA 1MBLA 2V2FF 4HNBA 4DE0A 5L07A 2VZWA 2OOLA 4X55A 2JN7A 4OH0A 3B42A 2ZMVA 1KE4A 2HP5A 4HBTA 2Z6CA 4EU0A 1K56D 5CEDA 4KG5A 4UA9A 3CUEC 1ES4A 3T1QB 1ONHA 4U0XA 3PBRA 1OJ5A 1Y54A 3LFVA 1VETA 3UDIA 3MFXA 3BFCA 4YNRA 3H82A 3T1RA 2X01A 2Z6DA 5GHYA 3BQ8A 2DRWA 3MSHA 3VFFA 4X53A 5GHXA 3UNWA 4LFUA 2QYBA 3TJZC 3UN7A 2Y2PA 1YLYA 4KZ5A 1KOUA 4P85A 5EPHA 1W8QA 5EOEA 1MKMA 3S7OA 2QKPA 3LICA 3PBNA 1SKFA 4ZJ1A 5TGFA 3L7HA 5FQMA 1G6AA 2OLUA 2LB5A 4GCZA 1LSWA 4GOGA 3IHBA 3E98A 5FDHA 3NECA 1ERQA 5DTTA 5KSCA 4BWIA 1PIOA 4I38A 4UA7A 5EM0A 4YFMA 3LI9A 2O9CA 1X0OA 2WKQA 3CHWP 1XX2A 1G5UA 3N4IA 4XXRA 1F9IA 4HBUA 5FQKA 3LIEA 3RXXA 1PW8A 4LRZE 4FH4A 4OKPA 1N9BA 3QNCA 4MN7A 1XFNA 3IX3A 4P6ZM 3PBQA 3EGDC 4B93A 4ME4A 1BLHA 3UE0A 3BFFA 1FCOA 4JBFA 2E8IA 4JGRA 4P0MA 2W27A 3BLSA 3SZTA 5DTKA 2L4RA 5AVEA 5HX9A 3B47A 4KZ6A 4NK3A 3DTMA 2EX6A 3VOLA 3NHQA 3FZCA 3ZG5A 5K5BA 3IXHA 1GHIA 1NRJA 1CF0A 1GA0A 3LIBA 3SH9A 4YOFA 5FQ9A 3D3OA 3PBOA 3MZDA 4Y2FA 2XFSA 1SDEA 1BULA 1VM1A 3LR4A 1BLSA 3E4PA 3P7NA 2HDRA 3HLCA 1XJ4A 3QP1A 5EM1A 3Q7VA 4OPYA 4MN6A 2M7UA 2D01A 2WYXA 3IWIA 4JF6A 4EBPA 4D60A 2Q9NA 2OWJA 1MWTA 1BLCA 2WKHA 2P08A 2C5WB 2E8JA 3I7JA 3ZG0A 2ZM8A 4PM7A 2HDUA 4EEUA 1WA9A 2J80A 2Y59A 4CJNA 3MBZA 3S22A 3IF6A 3T4JA 3HLGA 1S0WA 1XA7A 3FKVA 2GX5A 4L0LA 1YM1A 1N9OA 1CEGA 1L0EA 2W1TB 3NJAA 3ZG9B 4X68A 2XD5A 5EVEA 3RH8B 5IU1A 2IWDA 1IYPA 4LV3A 4X25A 4GW9A 4UAAA 2K7SA 3VP0A 1GSWA 1MWSA 1S66L 5EVID 2GDNA 4WEKA 1P9RA 3LIAA 3NULA 1ZG6A 4QPRA 4RQ9A 1W63M 1JWVA 4FOFA 5EE8A 1PW1A 4QJGA 2FFFB 4KQDA 1F2KA 2FH5A 3ULFA 3V5MA 1CI9A 1NYMA 4EBLA 1NJ4A 4R3BA 3Q1FA 1YSQA 4R3AA 5AJGA 2IA2A 2BLSA 2XROA 4EEPA 3KYZA 1TS8A 5G4ZA 3JPUA 3CZDA 3KX0X 3G30A 2V1ZA 3HREA 2JC7A 1BTLA 5F6AA 1T18A 2W3FA 2K31A 2GNXA 5FDSA 3BY9A 3LY3A 3TG9A 2Y2GA 2Y2HA 4O01A 4ZTKA 3PYPA 2EXAA 2FZ0A 1YLWA 1UWNX 3F1PA 1N9LA 3GR2A 3MFDA 1ZG4A 4RA7A 4WELA 1MPLA 3IQAA 1YT4A 3MKEA 3T4QA 4KZ9A 1LT0A 1BSGA 1VB6A 3QNBA 3FWLA 4DDYA 4WYYA 4E3OA 3KYEA 2VGLS 1H0MA 4DF6A 2VV7A 1K55C 4Q0JA 2QJ7A 5FSRA 5A92A 1V9YA 4MEZA 5FEFA 1PWGA 4I3IA 1CI8A 2JKRM 1XXMA 3UMEA 4L9EA 5HDCA 3KSHA 4EQIA 5HWWA 2ZQ8A 4Y5FA 5M19A 1K4EA 4MBKA 4UHUA 3EEHA 5AVFA 4D2OA 5F82A 5L8MA 4M4XA 3G4PA 4DMZA 2V1BA 4M3KA 3O3VA 3W2ZA 1OTEA 4RYEA 5KZHA 1IKIA 1CEFA 3MF0A 4BD0A 4U3TA 4GDNA 3PBTA 4FH2A 4S2KA 2Y2MA 3OOVA 2NUTC 3E4OA 4AFIA 3FPWA 4I39A 3L9KA 2KOIA 3LR5A 2ZQDA 2EXBA 5HWVA 3A3IA 1PYYA 4MN5A 3T4TA 2ZQAA 2JKTI 3JVVA 4H6JA 5GHZA 2W0NA 2Y2KA 4R23A 4X1LA 3S7PA 2M7VA 2ZL1B 1P97A 1XJ2A 4RVAA 1K6SA 2PDRA 2VKSA 2VX8A 1DP6A 2J7VA 4YWZA 5EFWA 1FOFA 4ZAMA 2JHEA 2Y2NA 3OC2A 1MXOA 2Y2LA 1FQGA 4KQQA 3LIDA 2EFXA 2HJEA 4CPKA 1EW0A 1ESIA 4HI4A 1WYBA 3M6BA 3A3DA 1TDGA 3FPVA 4P6ZS 3NI9A 3PBSA 1XKZA 2B18A 1I2SA 3DWKA 3EQUA 4QY5A 1FCMA 5J8XA 5A93A 3DTEA 1TEMA 1DP8A 5GLCA 3E2KA 3TW8A 3NIAA 3BFGA 5KSHA 2HF6A 5FI6A 4DN0A 2EWVA 4OPQA 4B4ZA 4Z9QA 3T1SA 4MCWA 2XF3A 3UDFA 2YKFA 1IELA 4OQIA 5AQAA 3IF5A 1BLPA 5FASA 2V1AA 3N8LA 2K2NA 3IBJA 3MXRA 1KDWA 3T1XA 3MZEA 4Q8IA 2V0UA 2PR6A 4EESA 2JE5A 4GHIA 2QWSA 5CTMA 2VGLM 4JXWA 1DJBA 4OQ0A 1WYCA 3C30A 4DXBA 3M6HA 1KGGA 5A90A 1YMXA 1ESUA 2J9PA 1OTDA 5TJJA 3WS1A 4DRTA 2ZC6B 1GHPA 2B02A 5JYOA 1ONGA 4GS9A 4JKTA 4NXEA 3W4QA 4QD4A 4F3LB 5DJUA 2EX9A 4Y7PA 1XGJA 2ZQ9A 3NY4A 4K0WA 2W3EA 2R9XA 2W1RA 5J7EA 2WGIA 3MS6A 4ZDXA 2PU4A 1K6RA 1KE0A 1S67L 1XFQA 2WAEA 4PPRA 2CMNA 3K3DA 4EERA 3GRJA 3WRTA 1VQQA 4S2IA 3O86A 1ES5A 3CLOA 4BQMA 1KVLA 4IUHA 1AXBA 1PFLA 4WF0A 5TFQA 2GZAA 4PM8A 1TS7A 3M2JA 4CLCB 4PM6A 4N1HA 5HL6A 2WKRA 3G31A 5CX7A 5F1FA 3V67A 3N8RA 2VLGA 5LBRA 4LLOB 4R3JA 1N4OA 1DY6A 1HLUP 5HFOA 2PBYA 2PU2A 3V3SA 4S2OA 3ZNTA 1L3LA 1RCJA 2ZC4B 3OBFA 5EUAA 3TRCA 1RGYA 3KSGA 2Q0OA 3PTEA 4BENA 3GECA 3G2ZA 3UB9A 5E2EA 3O87A 4X1MA 2WZXA 3VE3A 4MLLA 2Y8HA 4C75A 3E2LA 4II7A 3K3CA 5G18A 1OT6A 2ZC7A 2ZM2A 1XJ6A 4U0TA 5FQQA 4JXGA 1W63Q 1LHYA 5DFYA 2PYPA 5I94A 4PHTA 1PWCA 4PKYA 1VEUB 4ESPA 4DE3A 1O7EA 4RX2A 1SKOB 1T1AA 3CITA 4E3LA 2RL3A 3DBAA 3ZDJA 3UY6A 3GDIA 4KENB 2XR0A 4JGPA 3VP3A 3VMAA 1DP9A 3LGOA 4KZ8A 5I5LA 3SH7A 3JYIA 3IH9A 1ZHHB 4HP9A 2J8YA 3UE1A 3LEZA 5HD5A 3AGDA 4XT2B 4Z1WA 5FI7A 3GV9A 5CGXA 5L2FA 1DJCA 5E2GA 2WGWB 4HJ4A 4QB8A 4KZ4A 1FSWA 1W7FA 3JVUA 4QHCA 4OQGA 1F5MA 2QZ6A 5HD3A 2O99A 1JWPA 4F3LA 4Y3IA 3BLMA 1W8YA 1DJAA 4GJ4A 1JTGA 5FQIA 3HLWA 2VGJA 3G2YA 5E43A 2XA7S 3EQVA 1MC0A 1J3WA 4KQOA 4E3KA 5EOOA 2KLIA 1NRFA 1I2WA 4ID4A 3MQOA 4S2NC 4B88A 1T1BA 3VOZA 3ZQ5A 1P0ZA 3UE3A 3AGEA 4KZAA 1NLZA 2EWWA 3BFEA 5DTSA 3SS4A 3N6IA 1GCEA 2EA9A 3A0RA 2QPNA 2ZC3B 2VJWA 2VGKA 4C6YA 4QY6A 4IBRA 3QP8A 3IWQA 4CLCA 1YMSA 3B33A 3FC7A 3F1NB 4LV0A 4X69A 2HPBA 3IS2B 3BW6A 4NEED 3UB8A 1UGUA 2HV1A 3LEQA 4Y15A 3C38A 3ZG8B 1Y4OA 3NOPC 2H10A 4UA6A 2OAP1 3OPRA 2BASA 3A0VA 3HLFA 1OMEA 4JPMA 5DF8A 1WE4A 2EFUA 4BL2A 3RFBA 2Y55A 3S4XA 4IUKA 3HCYA 3C4OA 1BYWA 1RGZA 4CLCC 3ZG7B 4BMWA 1SCWA 1PRQA 2WUQA 3BECA 2O9AA 4NXBA 5TR7A 4JGOA 1LSXA 1S1YA 3LYXA 1D7EA 2HP9A 1K0KA 2V8FA 4Y0UA 2XK1A 5A8BA 4HJ3A 4XUZA 4OP8A 1XP4A 4E6XA 3KYQA 1OPXA 2PD7A 3A3FA 3TSGA 3BY8A 4EUVA 5U47A 3NBLA 2X71A 4IJGA 4PKYG 4DE2A 5EV0A 4BL3A 4BBVA 1K55A 3IH8A 5HARA 1VEUA 4EW7A 5HL1A 1XGIA 1G6OA 1SKOA 3C5AA 1K4FA 1PZPA 3G6OA 3LCEA 2J3TD 4H8RA 1IOUA 5F69A 4GZBA 2J3TC 2JCHA 4ZJ2A 2O9BA 3U4LP 3UPNA 1NZOA 2JKTM 2V8CA 2DMWA 4K08A 2JBFA 1G68A 1A0KA 2H5SA 5IT5A 1V9ZA 5FAQA 4XT2A 3EOIA 4GLQA 2Z2LB 3VV4A 2ZD8A 1EI5A 4WMCA 3PR6A 4I5SA
chains in the Genus database with same CATH topology
5TGFA 3FYZA 4OPQA 1KE3A 5EVIA 1NZUA 4B4ZA 5FQMA 4Z9QA 1G6AA 2OLUA 5A91A 3LO7A 1I5QA 1O07A 1U60A 3G34A 3CJMA 1ES2A 2XF3A 2XEPA 3UDFA 4GOGA 5FATA 1LLBA 1IELA 3IHBA 5FDHA 4OQIA 1XPBA 5AQAA 1ERQA 2WK0A 5DTTA 5FA7A 1BUEA 3HL9A 3IF5A 3OZHA 1PIOA 4OPRA 1BLPA 4UA7A 5CGWA 3WRZA 1NXYA 4GD8A 5FASA 3N8LA 4YFMA 3BYDA 4GDBA 1E3UD 2UWXA 3MXRA 1KDWA 4WMCD 1XX2A 4GNUA 3N4IA 4XXRA 1LL9A 3IF6C 4IVIA 3MZEA 3Q82A 4HBUA 4GD6A 5HAQA 1YLJA 5FQKA 3RXXA 1PW8A 3CMZA 4Q8IA 4FH4A 3HBRA 4OKPA 4OOYA 2JE5A 4X56A 1CK3A 1N9BA 5EVIC 3QNCA 4E3IA 5CTMA 3PBQA 3QHYA 4JXWA 3UPOA 1DJBA 4R1GA 4WZ4A 4OQ0A 1WYCA 2RCXA 3FKWA 4Y0OA 3GSGA 5CECA 4DXBA 3RJUA 4C3QA 3M6HA 1KGGA 1BLHA 3RXWA 3UE0A 2HDSA 3BFFA 2Y2JA 3VOYA 5A90A 1YMXA 2XDMA 1FCOA 1ESUA 4JBFA 3GTCA 2J9PA 5AQ7A 1RP5A 3BEBA 2E8IA 3WS1A 4P0MA 3GQZA 3BLSA 5DTKA 2OV5A 4MBFA 5DF9A 5HX9A 4DRTA 4KZ6A 2ZC6B 1GHPA 5M18A 4OOLA 2EX8A 4NK3A 4OQHA 3DTMA 2EX6A 5JYOA 1PI5A 2G2WA 1ONGA 3OCNA 3FZCA 5CERA 4JKTA 3VP4A 1YLTA 4KZ7A 3W4QA 3ZG5A 1MWUA 4QD4A 2EX2A 4E3MA 2EX9A 3IXHA 4Y7PA 1GHIA 1XGJA 2Y91A 1GA0A 3SH9A 3VSLA 5FQ9A 3UDXA 2ZQ9A 1H5XA 3PBOA 3NY4A 4K0WA 2R9XA 3MZDA 1NYYA 2WZZA 3D4FA 3VFHA 2XFSA 1SDEA 1BULA 1VM1A 3MXSA 1BLSA 2WGIA 4ZDXA 2PU4A 2HDRA 1HD8A 4R0QA 4OOMA 3HLCA 1K6RA 3IXBA 1LI0A 1KE0A 4OLGA 3DW0A 2WAEA 3Q7VA 4OPYA 4PPRA 5HAIA 2WYXA 3IWIA 3GRJA 3ITBA 3WRTA 5CRFA 1VQQA 1K25A 3V39A 4JF6A 4S2IA 4EBPA 3OPPA 3O86A 2Q9NA 1MWTA 1BLCA 2WKHA 1ES5A 1SHVA 4BQMA 1KVLA 2C5WB 4WM9A 4X6TA 3I7JA 3WS4A 5M1AA 3W4OA 3ZG0A 4DXCA 1AXBA 2H0TA 4YINA 2ZM8A 4OVDA 1L0DA 4PM7A 3ZGAB 4IEDA 5AQ9A 5TFQA 2ZLYA 2Y2QA 5GLDA 4PM8A 2HDUA 3M2JA 5CHUA 3OCLA 4PM6A 4N1HA 2Y59A 5DF7A 4ZJ3A 4CJNA 3G31A 3MBZA 3S22A 5F1FA 3IF6A 1BT5A 1NY0A 1MKIA 3N8RA 3HLGA 1S0WA 1E4DA 2WGWA 4OLDA 2J9OA 1XA7A 4OONA 3FKVA 4L0LA 5JYPA 2XLNA 1E25A 1FR6A 3HUOA 1N4OA 1YM1A 2B5RA 4R3JA 3C4PA 5F83A 3PAGA 2ZMAA 4KG6A 1CEGA 1L0EA 1DY6A 1S6RA 2IWCA 3ZG9B 3VP2A 1H8YA 4X68A 2XD5A 2A49A 1ERMA 4PM5A 5HFOA 3CG5A 4KG2A 2PBYA 2PU2A 2IWDA 3V3SA 3NDEA 3W4PA 1IYPA 4S2OA 3ZNTA 3UO9A 1HTZA 4LV3A 4UAAA 1RCJA 2ZC4B 1IKGA 3NCKA 2ZJ9A 3VP0A 5EUAA 1MWSA 5EVID 2GDNA 4PMAA 1FSYA 1QMFA 1RGYA 4S2PA 4WEKA 2DCFA 4E3NA 3PTEA 1H8ZA 3OPHA 4WEJA 3WWXA 3NDGA 4GKUA 4BENA 1ZG6A 2DNSA 4S2JA 3IWOA 3SH8A 3G2ZA 4MBHA 3UPPA 4JXVA 1JWVA 3PAEA 1PI4A 5GLAA 4HEFA 3ZHHA 5EE8A 5E2EA 3O87A 1GHMA 2WZXA 4OP5A 4NETA 1XA1A 1YLPA 4JF5A 1PW1A 3Q81A 4IVKA 4MLLA 4QJGA 1K38A 2R9WA 2FFFB 3G32A 4C75A 3E2LA 5G18A 4WZ5C 5F1GA 2ZC7A 1M40A 2ZM2A 2CC1A 1KDSA 2Q9MA 4S2LA 4U0TA 5FQQA 4R4SA 3Q7ZA 3HLBA 4R4RA 4RX3A 5CHJA 4JXGA 1LHYA 3Q07A 3MKFA 3V5MA 1CI9A 4ZBEA 1LI9A 1K54A 5BOHA 5I94A 1NYMA 2FFYA 1PWCA 4P6BA 4KZBA 4EBLA 1NJ4A 4R3BA 1SDNA 1MY8A 3Q1FA 4DE3A 3V50A 1K56A 2QMIA 3Q7VB 2BLSA 4LV2A 1O7EA 4RX2A 1ZKJA 3BFDA 4E3LA 2RL3A 1HVBA 3ZDJA 4KZ3A 4O7DA 1ES3A 1GA9A 2G2UA 3UY6A 5HAPA 1KVMA 5EVLA 3M2KA 3A3EA 1JVJA 2BG1A 4KENB 3CZDA 3HVFA 4PM9A 2P9VB 4N1XA 2XR0A 3G30A 2IWBA 2V1ZA 3HREA 3VP3A 3VMAA 2JC7A 1BTLA 3ITAA 4KZ8A 3ISGA 3N8SA 1K54C 2XD1A 3SH7A 3JYIA 3G35A 3IH9A 4HESA 2Y4AA 3IT9A 2J8YA 3LY3A 3LEZA 3UE1A 3TG9A 4MNRA 3AGDA 2Y2GA 1M6KA 3IF6B 1L2SA 1YLZA 3GV9A 5CGXA 5E2FA 5AQBA 5FI7A 1DJCA 2Y2HA 2P74A 3P98A 5E2GA 4ZTKA 4K91A 5L2FA 2WGWB 3SS3A 4E3JA 4QB8A 2EXAA 5EVIB 1YLWA 5CEBA 4KZ4A 1FSWA 1W7FA 1JWZA 4QHCA 4N9KA 3GR2A 3MFDA 1IYOA 1ZG4A 4OQGA 2OLVA 4RA7A 3VP1A 1Q2QA 4N92A 4WELA 2QZ6A 3SS5A 2WKIA 1MPLA 1EROA 2WKEA 4IBXA 3IQAA 1YT4A 1IEMA 1L0FA 3MKEA 1PZOA 3IXDA 3WS5A 2XQZA 4KZ9A 1JWPA 1PWDA 1KGFA 5FAPA 2Y2IA 3BLMA 4DE1A 1BSGA 1W8YA 1DJAA 4K0XA 3HUNA 3QNBA 3FWLA 1JTGA 3GMWA 5GLBA 4DDYA 4WBGA 5FQIA 3HLWA 2VGJA 1J9MA 4WYYA 3G2YA 5E43A 4E3OA 4P87A 2I72A 3EQVA 3OPLA 4DF6A 2ZQ7A 4KQOA 4E3KA 1K55C 5EOOA 2ZQCA 3FV7A 2XGNA 4LV1A 1NRFA 1I2WA 4ID4A 5FSRA 5A92A 4MEZA 4S2NC 5E2HA 1EWZA 4KQRA 3WS2A 4B88A 3W8KA 3VOZA 3HLEA 1PWGA 2HP6A 4WZ5A 1CI8A 1Q2PA 1XXMA 3AGEA 3UE3A 4KZAA 2HDQA 4GB7A 3N7WA 4EQIA 3BFEA 5DTSA 3SOIA 1KGEA 1YQSA 5EECA 4ZJ1A 3SS4A 2ZQ8A 3N6IA 5M19A 1K4EA 4MBKA 4UHUA 5CGSA 2X02A 1GCEA 4D2OA 2V20A 5F82A 2QPNA 2ZC3B 3G4PA 2VGKA 3P09A 2XH9A 3ZNYA 4C6YA 1FCNA 4QY6A 2WADA 3ZVTA 4M3KA 2A3UA 4IBRA 3O3VA 4N9LA 2WAFA 3GVBA 4XUXA 1TVFA 3IWQA 4RYEA 1YMSA 4JLFA 3IXGA 5KZHA 1LL5A 1IKIA 1CEFA 3O88A 4LV0A 5FQJA 4X69A 4EUZA 3C7UA 4BD0A 2HPBA 4JF4A 2C6WB 4U3TA 4GDNA 3PBTA 3NC8A 4FH2A 4S2MA 5HW3A 4QU3A 3ZG8B 4LCLA 4S2KA 3LY4A 2Y2MA 4DKIA 2H10A 4UA6A 4JXSA 3OPRA 3HLFA 5CXWA 1OMEA 4JPMA 5DF8A 1WE4A 3V3RA 2EFUA 1HZOA 5DVAA 5IHVA 1IYQA 1QMEA 4BL2A 1Z6FA 2Y55A 3S4XA 4EWFA 5FAOA 3BRMA 3C4OA 1RGZA 2ZQDA 2EXBA 2Z2MB 3MZFA 1C3BA 1JTDA 3ZG7B 3A3IA 1SCWA 1TDLA 2WUQA 3BECA 1PYYA 5GL9A 2XFTA 4FCFA 4FSFA 1MBLA 2V2FF 2ZQAA 3DWZA 5TR7A 4DE0A 2ZC5B 5GHZA 4BJPA 4DDSA 2Y2KA 2Y2OA 5CTNA 4R23A 4X55A 2HP9A 4OH0A 4Y0UA 1KE4A 2XK1A 2HP5A 4HBTA 1K56D 1K57A 4FD8A 4OP8A 4XUZA 5CEDA 4GN2A 4Y0TA 1W5DA 1XP4A 3B3XA 4KG5A 4E6XA 3A3FA 3TSGA 5KSCA 4UA9A 4RVAA 5D3OA 5U47A 4OPZA 1ES4A 3NBLA 3VSKA 1K6SA 2X71A 1ONHA 4U0XA 3PBRA 1Y54A 2J7VA 3TOIA 1W79A 3AGFA 4DE2A 4BD1A 4LCMA 3UDIA 1FOFA 4BL3A 1IYSA 1K55A 3HLDA 3BFCA 3WS0A 4ZAMA 1FR1A 3BM6A 2Y2NA 5FI2A 3IH8A 5HARA 4S2NA 3OC2A 1MXOA 3ZFZA 5HL1A 4BLMA 2Y2LA 1K57C 1BZAA 1FQGA 1XGIA 3ZVWA 3C5AA 1K4FA 4KQQA 2X01A 1PZPA 2EFXA 3C7VA 3LCEA 2H0YA 5GHYA 4CPKA 1ESIA 3ZCZA 4H8RA 4EV4A 5KMWA 2DRWA 1WYBA 2WGVA 4GZBA 3M6BA 3A3DA 2P9VA 1ZC2A 1TDGA 2JCHA 4X53A 4ZJ2A 3VFFA 3NI9A 5GHXA 2OSUA 3PBSA 3UNWA 1XKZA 1I2SA 3UPNA 3DWKA 2ZM0A 3HUMA 1NZOA 4E6WA 3EQUA 4QY5A 1L0GA 1FCMA 5J8XA 2JBFA 1G68A 5A93A 3A3JA 1MWRA 3UN7A 1TEMA 5CHMA 5GLCA 2Y2PA 3E2KA 2H5SA 1YLYA 4KZ5A 4P85A 5FAQA 3NIAA 3BFGA 3S1YA 4B4XA 5KSHA 1E3UA 2Z2LB 1W8QA 5EOEA 5EPHA 4EBNA 2ZD8A 1EI5A 4WMCA 3IHAA 4F94A 1ALQA 5FI6A 3PBNA 4LENA 1SKFA 4A5RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5TGF A;  3FYZ A;  4OPQ A;  1KE3 A;  5EVI A;  1NZU A;  4B4Z A;  5FQM A;  4Z9Q A;  1G6A A;  2OLU A;  5A91 A;  3LO7 A;  1I5Q A;  1O07 A;  1U60 A;  3G34 A;  3CJM A;  1ES2 A;  2XF3 A;  2XEP A;  3UDF A;  4GOG A;  5FAT A;  1LLB A;  1IEL A;  3IHB A;  5FDH A;  4OQI A;  1XPB A;  5AQA A;  1ERQ A;  2WK0 A;  5DTT A;  5FA7 A;  1BUE A;  3HL9 A;  3IF5 A;  3OZH A;  1PIO A;  4OPR A;  1BLP A;  4UA7 A;  5CGW A;  3WRZ A;  1NXY A;  4GD8 A;  5FAS A;  3N8L A;  4YFM A;  3BYD A;  4GDB A;  1E3U D;  2UWX A;  3MXR A;  1KDW A;  4WMC D;  1XX2 A;  4GNU A;  3N4I A;  4XXR A;  1LL9 A;  3IF6 C;  4IVI A;  3MZE A;  3Q82 A;  4HBU A;  4GD6 A;  5HAQ A;  1YLJ A;  5FQK A;  3RXX A;  1PW8 A;  3CMZ A;  4Q8I A;  4FH4 A;  3HBR A;  4OKP A;  4OOY A;  2JE5 A;  4X56 A;  1CK3 A;  1N9B A;  5EVI C;  3QNC A;  4E3I A;  5CTM A;  3PBQ A;  3QHY A;  4JXW A;  3UPO A;  1DJB A;  4R1G A;  4WZ4 A;  4OQ0 A;  1WYC A;  2RCX A;  3FKW A;  4Y0O A;  3GSG A;  5CEC A;  4DXB A;  3RJU A;  4C3Q A;  3M6H A;  1KGG A;  1BLH A;  3RXW A;  3UE0 A;  2HDS A;  3BFF A;  2Y2J A;  3VOY A;  5A90 A;  1YMX A;  2XDM A;  1FCO A;  1ESU A;  4JBF A;  3GTC A;  2J9P A;  5AQ7 A;  1RP5 A;  3BEB A;  2E8I A;  3WS1 A;  4P0M A;  3GQZ A;  3BLS A;  5DTK A;  2OV5 A;  4MBF A;  5DF9 A;  5HX9 A;  4DRT A;  4KZ6 A;  2ZC6 B;  1GHP A;  5M18 A;  4OOL A;  2EX8 A;  4NK3 A;  4OQH A;  3DTM A;  2EX6 A;  5JYO A;  1PI5 A;  2G2W A;  1ONG A;  3OCN A;  3FZC A;  5CER A;  4JKT A;  3VP4 A;  1YLT A;  4KZ7 A;  3W4Q A;  3ZG5 A;  1MWU A;  4QD4 A;  2EX2 A;  4E3M A;  2EX9 A;  3IXH A;  4Y7P A;  1GHI A;  1XGJ A;  2Y91 A;  1GA0 A;  3SH9 A;  3VSL A;  5FQ9 A;  3UDX A;  2ZQ9 A;  1H5X A;  3PBO A;  3NY4 A;  4K0W A;  2R9X A;  3MZD A;  1NYY A;  2WZZ A;  3D4F A;  3VFH A;  2XFS A;  1SDE A;  1BUL A;  1VM1 A;  3MXS A;  1BLS A;  2WGI A;  4ZDX A;  2PU4 A;  2HDR A;  1HD8 A;  4R0Q A;  4OOM A;  3HLC A;  1K6R A;  3IXB A;  1LI0 A;  1KE0 A;  4OLG A;  3DW0 A;  2WAE A;  3Q7V A;  4OPY A;  4PPR A;  5HAI A;  2WYX A;  3IWI A;  3GRJ A;  3ITB A;  3WRT A;  5CRF A;  1VQQ A;  1K25 A;  3V39 A;  4JF6 A;  4S2I A;  4EBP A;  3OPP A;  3O86 A;  2Q9N A;  1MWT A;  1BLC A;  2WKH A;  1ES5 A;  1SHV A;  4BQM A;  1KVL A;  2C5W B;  4WM9 A;  4X6T A;  3I7J A;  3WS4 A;  5M1A A;  3W4O A;  3ZG0 A;  4DXC A;  1AXB A;  2H0T A;  4YIN A;  2ZM8 A;  4OVD A;  1L0D A;  4PM7 A;  3ZGA B;  4IED A;  5AQ9 A;  5TFQ A;  2ZLY A;  2Y2Q A;  5GLD A;  4PM8 A;  2HDU A;  3M2J A;  5CHU A;  3OCL A;  4PM6 A;  4N1H A;  2Y59 A;  5DF7 A;  4ZJ3 A;  4CJN A;  3G31 A;  3MBZ A;  3S22 A;  5F1F A;  3IF6 A;  1BT5 A;  1NY0 A;  1MKI A;  3N8R A;  3HLG A;  1S0W A;  1E4D A;  2WGW A;  4OLD A;  2J9O A;  1XA7 A;  4OON A;  3FKV A;  4L0L A;  5JYP A;  2XLN A;  1E25 A;  1FR6 A;  3HUO A;  1N4O A;  1YM1 A;  2B5R A;  4R3J A;  3C4P A;  5F83 A;  3PAG A;  2ZMA A;  4KG6 A;  1CEG A;  1L0E A;  1DY6 A;  1S6R A;  2IWC A;  3ZG9 B;  3VP2 A;  1H8Y A;  4X68 A;  2XD5 A;  2A49 A;  1ERM A;  4PM5 A;  5HFO A;  3CG5 A;  4KG2 A;  2PBY A;  2PU2 A;  2IWD A;  3V3S A;  3NDE A;  3W4P A;  1IYP A;  4S2O A;  3ZNT A;  3UO9 A;  1HTZ A;  4LV3 A;  4UAA A;  1RCJ A;  2ZC4 B;  1IKG A;  3NCK A;  2ZJ9 A;  3VP0 A;  5EUA A;  1MWS A;  5EVI D;  2GDN A;  4PMA A;  1FSY A;  1QMF A;  1RGY A;  4S2P A;  4WEK A;  2DCF A;  4E3N A;  3PTE A;  1H8Z A;  3OPH A;  4WEJ A;  3WWX A;  3NDG A;  4GKU A;  4BEN A;  1ZG6 A;  2DNS A;  4S2J A;  3IWO A;  3SH8 A;  3G2Z A;  4MBH A;  3UPP A;  4JXV A;  1JWV A;  3PAE A;  1PI4 A;  5GLA A;  4HEF A;  3ZHH A;  5EE8 A;  5E2E A;  3O87 A;  1GHM A;  2WZX A;  4OP5 A;  4NET A;  1XA1 A;  1YLP A;  4JF5 A;  1PW1 A;  3Q81 A;  4IVK A;  4MLL A;  4QJG A;  1K38 A;  2R9W A;  2FFF B;  3G32 A;  4C75 A;  3E2L A;  5G18 A;  4WZ5 C;  5F1G A;  2ZC7 A;  1M40 A;  2ZM2 A;  2CC1 A;  1KDS A;  2Q9M A;  4S2L A;  4U0T A;  5FQQ A;  4R4S A;  3Q7Z A;  3HLB A;  4R4R A;  4RX3 A;  5CHJ A;  4JXG A;  1LHY A;  3Q07 A;  3MKF A;  3V5M A;  1CI9 A;  4ZBE A;  1LI9 A;  1K54 A;  5BOH A;  5I94 A;  1NYM A;  2FFY A;  1PWC A;  4P6B A;  4KZB A;  4EBL A;  1NJ4 A;  4R3B A;  1SDN A;  1MY8 A;  3Q1F A;  4DE3 A;  3V50 A;  1K56 A;  2QMI A;  3Q7V B;  2BLS A;  4LV2 A;  1O7E A;  4RX2 A;  1ZKJ A;  3BFD A;  4E3L A;  2RL3 A;  1HVB A;  3ZDJ A;  4KZ3 A;  4O7D A;  1ES3 A;  1GA9 A;  2G2U A;  3UY6 A;  5HAP A;  1KVM A;  5EVL A;  3M2K A;  3A3E A;  1JVJ A;  2BG1 A;  4KEN B;  3CZD A;  3HVF A;  4PM9 A;  2P9V B;  4N1X A;  2XR0 A;  3G30 A;  2IWB A;  2V1Z A;  3HRE A;  3VP3 A;  3VMA A;  2JC7 A;  1BTL A;  3ITA A;  4KZ8 A;  3ISG A;  3N8S A;  1K54 C;  2XD1 A;  3SH7 A;  3JYI A;  3G35 A;  3IH9 A;  4HES A;  2Y4A A;  3IT9 A;  2J8Y A;  3LY3 A;  3LEZ A;  3UE1 A;  3TG9 A;  4MNR A;  3AGD A;  2Y2G A;  1M6K A;  3IF6 B;  1L2S A;  1YLZ A;  3GV9 A;  5CGX A;  5E2F A;  5AQB A;  5FI7 A;  1DJC A;  2Y2H A;  2P74 A;  3P98 A;  5E2G A;  4ZTK A;  4K91 A;  5L2F A;  2WGW B;  3SS3 A;  4E3J A;  4QB8 A;  2EXA A;  5EVI B;  1YLW A;  5CEB A;  4KZ4 A;  1FSW A;  1W7F A;  1JWZ A;  4QHC A;  4N9K A;  3GR2 A;  3MFD A;  1IYO A;  1ZG4 A;  4OQG A;  2OLV A;  4RA7 A;  3VP1 A;  1Q2Q A;  4N92 A;  4WEL A;  2QZ6 A;  3SS5 A;  2WKI A;  1MPL A;  1ERO A;  2WKE A;  4IBX A;  3IQA A;  1YT4 A;  1IEM A;  1L0F A;  3MKE A;  1PZO A;  3IXD A;  3WS5 A;  2XQZ A;  4KZ9 A;  1JWP A;  1PWD A;  1KGF A;  5FAP A;  2Y2I A;  3BLM A;  4DE1 A;  1BSG A;  1W8Y A;  1DJA A;  4K0X A;  3HUN A;  3QNB A;  3FWL A;  1JTG A;  3GMW A;  5GLB A;  4DDY A;  4WBG A;  5FQI A;  3HLW A;  2VGJ A;  1J9M A;  4WYY A;  3G2Y A;  5E43 A;  4E3O A;  4P87 A;  2I72 A;  3EQV A;  3OPL A;  4DF6 A;  2ZQ7 A;  4KQO A;  4E3K A;  1K55 C;  5EOO A;  2ZQC A;  3FV7 A;  2XGN A;  4LV1 A;  1NRF A;  1I2W A;  4ID4 A;  5FSR A;  5A92 A;  4MEZ A;  4S2N C;  5E2H A;  1EWZ A;  4KQR A;  3WS2 A;  4B88 A;  3W8K A;  3VOZ A;  3HLE A;  1PWG A;  2HP6 A;  4WZ5 A;  1CI8 A;  1Q2P A;  1XXM A;  3AGE A;  3UE3 A;  4KZA A;  2HDQ A;  4GB7 A;  3N7W A;  4EQI A;  3BFE A;  5DTS A;  3SOI A;  1KGE A;  1YQS A;  5EEC A;  4ZJ1 A;  3SS4 A;  2ZQ8 A;  3N6I A;  5M19 A;  1K4E A;  4MBK A;  4UHU A;  5CGS A;  2X02 A;  1GCE A;  4D2O A;  2V20 A;  5F82 A;  2QPN A;  2ZC3 B;  3G4P A;  2VGK A;  3P09 A;  2XH9 A;  3ZNY A;  4C6Y A;  1FCN A;  4QY6 A;  2WAD A;  3ZVT A;  4M3K A;  2A3U A;  4IBR A;  3O3V A;  4N9L A;  2WAF A;  3GVB A;  4XUX A;  1TVF A;  3IWQ A;  4RYE A;  1YMS A;  4JLF A;  3IXG A;  5KZH A;  1LL5 A;  1IKI A;  1CEF A;  3O88 A;  4LV0 A;  5FQJ A;  4X69 A;  4EUZ A;  3C7U A;  4BD0 A;  2HPB A;  4JF4 A;  2C6W B;  4U3T A;  4GDN A;  3PBT A;  3NC8 A;  4FH2 A;  4S2M A;  5HW3 A;  4QU3 A;  3ZG8 B;  4LCL A;  4S2K A;  3LY4 A;  2Y2M A;  4DKI A;  2H10 A;  4UA6 A;  4JXS A;  3OPR A;  3HLF A;  5CXW A;  1OME A;  4JPM A;  5DF8 A;  1WE4 A;  3V3R A;  2EFU A;  1HZO A;  5DVA A;  5IHV A;  1IYQ A;  1QME A;  4BL2 A;  1Z6F A;  2Y55 A;  3S4X A;  4EWF A;  5FAO A;  3BRM A;  3C4O A;  1RGZ A;  2ZQD A;  2EXB A;  2Z2M B;  3MZF A;  1C3B A;  1JTD A;  3ZG7 B;  3A3I A;  1SCW A;  1TDL A;  2WUQ A;  3BEC A;  1PYY A;  5GL9 A;  2XFT A;  4FCF A;  4FSF A;  1MBL A;  2V2F F;  2ZQA A;  3DWZ A;  5TR7 A;  4DE0 A;  2ZC5 B;  5GHZ A;  4BJP A;  4DDS A;  2Y2K A;  2Y2O A;  5CTN A;  4R23 A;  4X55 A;  2HP9 A;  4OH0 A;  4Y0U A;  1KE4 A;  2XK1 A;  2HP5 A;  4HBT A;  1K56 D;  1K57 A;  4FD8 A;  4OP8 A;  4XUZ A;  5CED A;  4GN2 A;  4Y0T A;  1W5D A;  1XP4 A;  3B3X A;  4KG5 A;  4E6X A;  3A3F A;  3TSG A;  5KSC A;  4UA9 A;  4RVA A;  5D3O A;  5U47 A;  4OPZ A;  1ES4 A;  3NBL A;  3VSK A;  1K6S A;  2X71 A;  1ONH A;  4U0X A;  3PBR A;  1Y54 A;  2J7V A;  3TOI A;  1W79 A;  3AGF A;  4DE2 A;  4BD1 A;  4LCM A;  3UDI A;  1FOF A;  4BL3 A;  1IYS A;  1K55 A;  3HLD A;  3BFC A;  3WS0 A;  4ZAM A;  1FR1 A;  3BM6 A;  2Y2N A;  5FI2 A;  3IH8 A;  5HAR A;  4S2N A;  3OC2 A;  1MXO A;  3ZFZ A;  5HL1 A;  4BLM A;  2Y2L A;  1K57 C;  1BZA A;  1FQG A;  1XGI A;  3ZVW A;  3C5A A;  1K4F A;  4KQQ A;  2X01 A;  1PZP A;  2EFX A;  3C7V A;  3LCE A;  2H0Y A;  5GHY A;  4CPK A;  1ESI A;  3ZCZ A;  4H8R A;  4EV4 A;  5KMW A;  2DRW A;  1WYB A;  2WGV A;  4GZB A;  3M6B A;  3A3D A;  2P9V A;  1ZC2 A;  1TDG A;  2JCH A;  4X53 A;  4ZJ2 A;  3VFF A;  3NI9 A;  5GHX A;  2OSU A;  3PBS A;  3UNW A;  1XKZ A;  1I2S A;  3UPN A;  3DWK A;  2ZM0 A;  3HUM A;  1NZO A;  4E6W A;  3EQU A;  4QY5 A;  1L0G A;  1FCM A;  5J8X A;  2JBF A;  1G68 A;  5A93 A;  3A3J A;  1MWR A;  3UN7 A;  1TEM A;  5CHM A;  5GLC A;  2Y2P A;  3E2K A;  2H5S A;  1YLY A;  4KZ5 A;  4P85 A;  5FAQ A;  3NIA A;  3BFG A;  3S1Y A;  4B4X A;  5KSH A;  1E3U A;  2Z2L B;  1W8Q A;  5EOE A;  5EPH A;  4EBN A;  2ZD8 A;  1EI5 A;  4WMC A;  3IHA A;  4F94 A;  1ALQ A;  5FI6 A;  3PBN A;  4LEN A;  1SKF A;  4A5R A; 
#chains in the Genus database with same CATH topology
 1KE3 A;  3LO7 A;  1O07 A;  1U60 A;  3G34 A;  2JKG A;  1ES2 A;  2XEP A;  1LLB A;  5DFX A;  1XPB A;  2WK0 A;  3ZVW A;  3HL9 A;  3OZH A;  5CGW A;  3WRZ A;  4GDB A;  4WMC D;  4HH3 A;  1LL9 A;  1XJ3 A;  1YLJ A;  1NWZ A;  4OOY A;  4X56 A;  4E3I A;  3UPO A;  2XA7 M;  4R1G A;  1OTB A;  1F98 A;  4HOI A;  2W1T A;  5IS1 A;  4C3Q A;  5KIZ A;  2HDS A;  3T4K A;  3VOY A;  2OWH A;  5HPI A;  3RTY A;  4I3A A;  3R7W B;  2XDM A;  5AQ7 A;  3GTC A;  1RP5 A;  3S7Q A;  3BEB A;  3GQZ A;  2OV5 A;  2V9A A;  5DF9 A;  1TF1 A;  4NKP A;  2PRF A;  2EX8 A;  4OOL A;  3H82 B;  3OCN A;  5CER A;  1YLT A;  4E04 A;  1T1C A;  3DAV A;  3F1N A;  3IS2 A;  4FUW A;  5L09 A;  1GSX A;  3D72 A;  2WZZ A;  4HY8 A;  3QP5 A;  5L10 A;  2JKR I;  4R0Q A;  1HD8 A;  4OOM A;  5J3W A;  4OLG A;  5DKK A;  3DW0 A;  5HAI A;  5CRF A;  1K25 A;  3OPP A;  4LRY C;  2H28 A;  2G7U A;  1SHV A;  2L1M A;  4X6T A;  4NXF A;  4YIN A;  2H0T A;  4OVD A;  3ZGA B;  5AQ9 A;  4B9O A;  2ZLY A;  2Y2Q A;  5GLD A;  5CHU A;  4ARZ B;  1DRM A;  4HP4 A;  1MKI A;  2GJ3 A;  1H3Q A;  2J9O A;  4OON A;  2XLN A;  1FR6 A;  2B5R A;  3MMH A;  3C4P A;  3PAG A;  4KG6 A;  4Y13 A;  3TE8 A;  3EEA A;  1ERM A;  4PM5 A;  2JKF A;  3A0S A;  3LR0 A;  2I9V A;  4IHQ A;  3T12 B;  3BQA A;  3NCK A;  2BTF P;  4PMA A;  4MDZ A;  4E3N A;  3WWX A;  1H8Z A;  3OPH A;  4WEJ A;  3NDG A;  4GKU A;  2DNS A;  4S2J A;  3T4S A;  3IWO A;  3UE6 A;  3UB7 A;  4MBH A;  3ZHH A;  1PI4 A;  3LR3 A;  1GHM A;  4OP5 A;  4NET A;  1XA1 A;  4JF5 A;  4IVK A;  1K38 A;  4WZ5 C;  5F1G A;  1M40 A;  5MC7 A;  1KDS A;  2Q9M A;  4S2L A;  4R4S A;  3HLB A;  3MKF A;  4O0P A;  4ZBE A;  1K54 A;  5BOH A;  1TS0 A;  2FFY A;  1LL8 A;  4KZB A;  1K56 A;  1D1J A;  3Q7V B;  4DJ3 A;  4LV2 A;  3BFD A;  2MJ6 A;  4KZ3 A;  4O7D A;  1ES3 A;  1GA9 A;  2G2U A;  5HAP A;  3HJK A;  5EVL A;  3M2K A;  3A3E A;  1JVJ A;  2P9V B;  4N1X A;  3K2N A;  1FIL A;  2IWB A;  3T4L A;  3P01 A;  3IBR A;  3ISG A;  3N8S A;  1K54 C;  1VHM A;  4HES A;  2Y4A A;  3SW1 A;  1OTI A;  4MNR A;  3KO6 A;  1M6K A;  3IF6 B;  2P74 A;  3P98 A;  2INW A;  4MMN A;  3SS3 A;  3R7W A;  2KX6 A;  2ZBB A;  5EVI B;  4Q0H A;  3F1O B;  1MZU A;  1IYO A;  2OLV A;  4DJ2 A;  3VP1 A;  1Q2Q A;  4N92 A;  2WKE A;  5FEG A;  1PZO A;  3IXD A;  3WS5 A;  3R4K A;  2Y2I A;  2ZL1 A;  3HUN A;  3GMW A;  5GLB A;  1J9M A;  4L9G A;  2O0Y A;  3NOU C;  2I72 A;  1TS6 A;  2ZQ7 A;  3FV7 A;  4UEY A;  4LV1 A;  5E2H A;  4KQR A;  1G28 A;  1YSP A;  3W8K A;  1AWI A;  3HLE A;  1Q2P A;  3OLO A;  2HDQ A;  4GB7 A;  3SOI A;  1KGE A;  1YQS A;  2PR5 A;  4WN5 A;  5CGS A;  4R70 A;  3P09 A;  2XH9 A;  1CQA A;  3ZNY A;  1ODV A;  1FCN A;  2WAD A;  4HIA A;  4N9L A;  2WAF A;  4XUX A;  1TVF A;  3IXG A;  4L9F A;  3O88 A;  5FQJ A;  4EUZ A;  4ARZ A;  3C7U A;  4CLC E;  2C6W B;  3NC8 A;  4QU3 A;  3LY4 A;  4DKI A;  3ICY A;  5CXW A;  3EWK A;  5IHV A;  5G4Y A;  1IYQ A;  1QME A;  1Z6F A;  5FAO A;  1OT9 A;  1OJG A;  3MZF A;  1C3B A;  1JTD A;  2LB9 A;  3DWZ A;  2HGV A;  3F1P B;  1GSV A;  2ZC5 B;  1NLY A;  4BJP A;  4DDS A;  2Y2O A;  5CTN A;  2PYR A;  4G3W A;  2AVX A;  1K57 A;  1YKD A;  4FD8 A;  2R78 A;  4GN2 A;  4Y0T A;  1W5D A;  3B3X A;  4BBU A;  5D3O A;  2PT7 A;  4OPZ A;  3VSK A;  3TOI A;  1W79 A;  3AGF A;  4BD1 A;  4LCM A;  1IYS A;  3HLD A;  3WS0 A;  1FR1 A;  5TBM B;  3BM6 A;  5FI2 A;  4S2N A;  5F5Y A;  2VA0 A;  3KSI A;  3U2A A;  3T4O A;  3ZFZ A;  4BLM A;  1K57 C;  1BZA A;  3ZYT A;  3C8C A;  3C7V A;  2H0Y A;  3ZCZ A;  4EV4 A;  5KMW A;  2WGV A;  2VK3 A;  2P9V A;  1ZC2 A;  2V0W A;  3H7W B;  2OSU A;  3DTK A;  3FG8 A;  2ZM0 A;  3HUM A;  4E6W A;  1L0G A;  3A3J A;  1MWR A;  4Y17 A;  5CHM A;  2A2L A;  4NG2 A;  1D06 A;  3T50 A;  4B4X A;  3S1Y A;  1E3U A;  4EBN A;  3IHA A;  4F94 A;  1ALQ A;  4LEN A;  4A5R A;  3FYZ A;  4FTX A;  5EVI A;  1NZU A;  3CPT B;  3F1O A;  5A91 A;  1I5Q A;  3O5Y A;  2Y79 A;  2ZOI A;  3CJM A;  5FAT A;  5FA7 A;  1BUE A;  4OPR A;  1NXY A;  1IFQ A;  4GD8 A;  5DJT A;  3BYD A;  1E3U D;  2UWX A;  4GNU A;  2A24 B;  2YKH A;  3IF6 C;  4IVI A;  4H6J B;  4UQI S;  3Q82 A;  4GD6 A;  5HAQ A;  3LUQ A;  3CMZ A;  2VEA A;  3HBR A;  1CK3 A;  5EVI C;  3QHY A;  4WZ4 A;  2RCX A;  3FKW A;  2NUP C;  4Y0O A;  4HHD A;  3GSG A;  5CEC A;  4CLC D;  3E4Q A;  1S4R A;  3RJU A;  1T19 A;  1ZTU A;  4WL9 A;  3RXW A;  2Y2J A;  5C5K A;  4WLA A;  4PAU A;  1YPR A;  4MBF A;  3MQ0 A;  5M18 A;  1OTA A;  4OQH A;  1PI5 A;  2G2W A;  3CWF A;  2HZ5 A;  3QP6 A;  3PHY A;  5HZH A;  3VP4 A;  4KZ7 A;  1MWU A;  5F68 A;  2EX2 A;  4E3M A;  2Y91 A;  1YAX A;  5HSQ A;  3VSL A;  3UDX A;  3IX8 A;  1H5X A;  2VV6 A;  1Y28 A;  1NYY A;  3D4F A;  5FL3 A;  3VFH A;  3MXS A;  3QP4 A;  3IXB A;  1LI0 A;  3VE4 A;  2B95 A;  3ITB A;  3V39 A;  1PNE A;  2PBD P;  3MR0 A;  3EGX C;  4WM9 A;  3C2W A;  3CI6 A;  3WS4 A;  5M1A A;  3W4O A;  4DXC A;  2W3H A;  4ETZ A;  1L0D A;  4IED A;  3PXP A;  2HJ9 C;  3OCL A;  3UMD A;  5DF7 A;  4ZJ3 A;  5HDS A;  3CAX A;  1BT5 A;  1NY0 A;  4JGQ A;  4CQH A;  2WKP A;  1E4D A;  2WGW A;  4LRX C;  4OLD A;  4GHI B;  5JYP A;  1E25 A;  3HUO A;  5F83 A;  2ZMA A;  1S1Z A;  1S6R A;  4R38 A;  5TBM A;  5J4E A;  2QJ5 A;  2IWC A;  2QHK A;  3VP2 A;  1H8Y A;  2A49 A;  3CG5 A;  4KG2 A;  3W4P A;  1UWP X;  1Z09 A;  3NDE A;  5HDD A;  2OAQ 1;  3UO9 A;  1HTZ A;  2PD8 A;  1IKG A;  2ZJ9 A;  2UV0 E;  2PHY A;  3UB5 P;  4I3J A;  4S2P A;  1FSY A;  1QMF A;  4G3V A;  2DCF A;  3H7W A;  4GS9 B;  5HPF A;  5DKL A;  3SH8 A;  3UPP A;  4JXV A;  3PAE A;  5GLA A;  3E0Y A;  4HEF A;  1YLP A;  3BJN A;  3Q81 A;  1P9W A;  2R9W A;  3G32 A;  2CC1 A;  3Q7Z A;  1VET B;  4R4R A;  5CHJ A;  4RX3 A;  3Q07 A;  1LI9 A;  4HJ6 A;  3CPT A;  4LPZ A;  2ZOH A;  4P6B A;  1SDN A;  1MY8 A;  2W3D A;  3V50 A;  2QMI A;  1ZKJ A;  2KDK A;  3QP2 A;  3MXQ A;  1HVB A;  4NXG A;  4R6L A;  5HWT A;  3H9W A;  2ZMF A;  2PAV P;  1KVM A;  1TD5 A;  2BG1 A;  2A24 A;  3HVF A;  2J3W A;  4PM9 A;  1LSV A;  4UQI M;  3LI8 A;  3ITA A;  2XD1 A;  3G35 A;  1CJF A;  3IT9 A;  1L2S A;  1YLZ A;  5E2F A;  5AQB A;  1FIK A;  1JNU A;  4K91 A;  1S4S A;  4E3J A;  3D9Y A;  5CEB A;  1JWZ A;  3UB6 A;  4N9K A;  3SS5 A;  2VV8 A;  2WKI A;  4HH2 A;  1ERO A;  4IBX A;  3IX4 A;  1IEM A;  1L0F A;  1SZV A;  2XQZ A;  1PWD A;  3DTI A;  1KGF A;  5FAP A;  4DE1 A;  4ETX A;  4KUK A;  4K0X A;  2XRN A;  4WBG A;  4LGW A;  4P87 A;  2ACG A;  3OPL A;  4EXO A;  1N9N A;  4KUO A;  2ZQC A;  2XGN A;  3HJI A;  4QWO A;  1ACF A;  1EWZ A;  3WS2 A;  3S7N A;  2P7J A;  4EQ1 A;  2HP6 A;  3MJQ A;  4WZ5 A;  4WUJ A;  3N7W A;  5EEC A;  2X02 A;  2V20 A;  3NOT C;  4Q0I A;  3LIF A;  4G3K A;  4O8G A;  3ZVT A;  2A3U A;  2W3G A;  3GVB A;  2D02 A;  4JLF A;  1LL5 A;  3KSF A;  4HQA A;  4JF4 A;  4S2M A;  5HW3 A;  4LCL A;  2L0W A;  4JXS A;  1H8M A;  4BBT A;  3V3R A;  4ZRR A;  1HZO A;  5DVA A;  4EWF A;  1STZ A;  3MQQ A;  2P04 A;  3BRM A;  2Z2M B;  3CUE A;  2XSS A;  4EET B;  1TDL A;  3BWL A;  5GL9 A;  2XFT A;  4FCF A;  4FSF A;  2M1C A;  1MBL A;  2V2F F;  4HNB A;  4DE0 A;  5L07 A;  2VZW A;  2OOL A;  4X55 A;  2JN7 A;  4OH0 A;  3B42 A;  2ZMV A;  1KE4 A;  2HP5 A;  4HBT A;  2Z6C A;  4EU0 A;  1K56 D;  5CED A;  4KG5 A;  4UA9 A;  3CUE C;  1ES4 A;  3T1Q B;  1ONH A;  4U0X A;  3PBR A;  1OJ5 A;  1Y54 A;  3LFV A;  1VET A;  3UDI A;  3MFX A;  3BFC A;  4YNR A;  3H82 A;  3T1R A;  2X01 A;  2Z6D A;  5GHY A;  3BQ8 A;  2DRW A;  3MSH A;  3VFF A;  4X53 A;  5GHX A;  3UNW A;  4LFU A;  2QYB A;  3TJZ C;  3UN7 A;  2Y2P A;  1YLY A;  4KZ5 A;  1KOU A;  4P85 A;  5EPH A;  1W8Q A;  5EOE A;  1MKM A;  3S7O A;  2QKP A;  3LIC A;  3PBN A;  1SKF A;  4ZJ1 A;  5TGF A;  3L7H A;  5FQM A;  1G6A A;  2OLU A;  2LB5 A;  4GCZ A;  1LSW A;  4GOG A;  3IHB A;  3E98 A;  5FDH A;  3NEC A;  1ERQ A;  5DTT A;  5KSC A;  4BWI A;  1PIO A;  4I38 A;  4UA7 A;  5EM0 A;  4YFM A;  3LI9 A;  2O9C A;  1X0O A;  2WKQ A;  3CHW P;  1XX2 A;  1G5U A;  3N4I A;  4XXR A;  1F9I A;  4HBU A;  5FQK A;  3LIE A;  3RXX A;  1PW8 A;  4LRZ E;  4FH4 A;  4OKP A;  1N9B A;  3QNC A;  4MN7 A;  1XFN A;  3IX3 A;  4P6Z M;  3PBQ A;  3EGD C;  4B93 A;  4ME4 A;  1BLH A;  3UE0 A;  3BFF A;  1FCO A;  4JBF A;  2E8I A;  4JGR A;  4P0M A;  2W27 A;  3BLS A;  3SZT A;  5DTK A;  2L4R A;  5AVE A;  5HX9 A;  3B47 A;  4KZ6 A;  4NK3 A;  3DTM A;  2EX6 A;  3VOL A;  3NHQ A;  3FZC A;  3ZG5 A;  5K5B A;  3IXH A;  1GHI A;  1NRJ A;  1CF0 A;  1GA0 A;  3LIB A;  3SH9 A;  4YOF A;  5FQ9 A;  3D3O A;  3PBO A;  3MZD A;  4Y2F A;  2XFS A;  1SDE A;  1BUL A;  1VM1 A;  3LR4 A;  1BLS A;  3E4P A;  3P7N A;  2HDR A;  3HLC A;  1XJ4 A;  3QP1 A;  5EM1 A;  3Q7V A;  4OPY A;  4MN6 A;  2M7U A;  2D01 A;  2WYX A;  3IWI A;  4JF6 A;  4EBP A;  4D60 A;  2Q9N A;  2OWJ A;  1MWT A;  1BLC A;  2WKH A;  2P08 A;  2C5W B;  2E8J A;  3I7J A;  3ZG0 A;  2ZM8 A;  4PM7 A;  2HDU A;  4EEU A;  1WA9 A;  2J80 A;  2Y59 A;  4CJN A;  3MBZ A;  3S22 A;  3IF6 A;  3T4J A;  3HLG A;  1S0W A;  1XA7 A;  3FKV A;  2GX5 A;  4L0L A;  1YM1 A;  1N9O A;  1CEG A;  1L0E A;  2W1T B;  3NJA A;  3ZG9 B;  4X68 A;  2XD5 A;  5EVE A;  3RH8 B;  5IU1 A;  2IWD A;  1IYP A;  4LV3 A;  4X25 A;  4GW9 A;  4UAA A;  2K7S A;  3VP0 A;  1GSW A;  1MWS A;  1S66 L;  5EVI D;  2GDN A;  4WEK A;  1P9R A;  3LIA A;  3NUL A;  1ZG6 A;  4QPR A;  4RQ9 A;  1W63 M;  1JWV A;  4FOF A;  5EE8 A;  1PW1 A;  4QJG A;  2FFF B;  4KQD A;  1F2K A;  2FH5 A;  3ULF A;  3V5M A;  1CI9 A;  1NYM A;  4EBL A;  1NJ4 A;  4R3B A;  3Q1F A;  1YSQ A;  4R3A A;  5AJG A;  2IA2 A;  2BLS A;  2XRO A;  4EEP A;  3KYZ A;  1TS8 A;  5G4Z A;  3JPU A;  3CZD A;  3KX0 X;  3G30 A;  2V1Z A;  3HRE A;  2JC7 A;  1BTL A;  5F6A A;  1T18 A;  2W3F A;  2K31 A;  2GNX A;  5FDS A;  3BY9 A;  3LY3 A;  3TG9 A;  2Y2G A;  2Y2H A;  4O01 A;  4ZTK A;  3PYP A;  2EXA A;  2FZ0 A;  1YLW A;  1UWN X;  3F1P A;  1N9L A;  3GR2 A;  3MFD A;  1ZG4 A;  4RA7 A;  4WEL A;  1MPL A;  3IQA A;  1YT4 A;  3MKE A;  3T4Q A;  4KZ9 A;  1LT0 A;  1BSG A;  1VB6 A;  3QNB A;  3FWL A;  4DDY A;  4WYY A;  4E3O A;  3KYE A;  2VGL S;  1H0M A;  4DF6 A;  2VV7 A;  1K55 C;  4Q0J A;  2QJ7 A;  5FSR A;  5A92 A;  1V9Y A;  4MEZ A;  5FEF A;  1PWG A;  4I3I A;  1CI8 A;  2JKR M;  1XXM A;  3UME A;  4L9E A;  5HDC A;  3KSH A;  4EQI A;  5HWW A;  2ZQ8 A;  4Y5F A;  5M19 A;  1K4E A;  4MBK A;  4UHU A;  3EEH A;  5AVF A;  4D2O A;  5F82 A;  5L8M A;  4M4X A;  3G4P A;  4DMZ A;  2V1B A;  4M3K A;  3O3V A;  3W2Z A;  1OTE A;  4RYE A;  5KZH A;  1IKI A;  1CEF A;  3MF0 A;  4BD0 A;  4U3T A;  4GDN A;  3PBT A;  4FH2 A;  4S2K A;  2Y2M A;  3OOV A;  2NUT C;  3E4O A;  4AFI A;  3FPW A;  4I39 A;  3L9K A;  2KOI A;  3LR5 A;  2ZQD A;  2EXB A;  5HWV A;  3A3I A;  1PYY A;  4MN5 A;  3T4T A;  2ZQA A;  2JKT I;  3JVV A;  4H6J A;  5GHZ A;  2W0N A;  2Y2K A;  4R23 A;  4X1L A;  3S7P A;  2M7V A;  2ZL1 B;  1P97 A;  1XJ2 A;  4RVA A;  1K6S A;  2PDR A;  2VKS A;  2VX8 A;  1DP6 A;  2J7V A;  4YWZ A;  5EFW A;  1FOF A;  4ZAM A;  2JHE A;  2Y2N A;  3OC2 A;  1MXO A;  2Y2L A;  1FQG A;  4KQQ A;  3LID A;  2EFX A;  2HJE A;  4CPK A;  1EW0 A;  1ESI A;  4HI4 A;  1WYB A;  3M6B A;  3A3D A;  1TDG A;  3FPV A;  4P6Z S;  3NI9 A;  3PBS A;  1XKZ A;  2B18 A;  1I2S A;  3DWK A;  3EQU A;  4QY5 A;  1FCM A;  5J8X A;  5A93 A;  3DTE A;  1TEM A;  1DP8 A;  5GLC A;  3E2K A;  3TW8 A;  3NIA A;  3BFG A;  5KSH A;  2HF6 A;  5FI6 A;  4DN0 A;  2EWV A;  4OPQ A;  4B4Z A;  4Z9Q A;  3T1S A;  4MCW A;  2XF3 A;  3UDF A;  2YKF A;  1IEL A;  4OQI A;  5AQA A;  3IF5 A;  1BLP A;  5FAS A;  2V1A A;  3N8L A;  2K2N A;  3IBJ A;  3MXR A;  1KDW A;  3T1X A;  3MZE A;  4Q8I A;  2V0U A;  2PR6 A;  4EES A;  2JE5 A;  4GHI A;  2QWS A;  5CTM A;  2VGL M;  4JXW A;  1DJB A;  4OQ0 A;  1WYC A;  3C30 A;  4DXB A;  3M6H A;  1KGG A;  5A90 A;  1YMX A;  1ESU A;  2J9P A;  1OTD A;  5TJJ A;  3WS1 A;  4DRT A;  2ZC6 B;  1GHP A;  2B02 A;  5JYO A;  1ONG A;  4GS9 A;  4JKT A;  4NXE A;  3W4Q A;  4QD4 A;  4F3L B;  5DJU A;  2EX9 A;  4Y7P A;  1XGJ A;  2ZQ9 A;  3NY4 A;  4K0W A;  2W3E A;  2R9X A;  2W1R A;  5J7E A;  2WGI A;  3MS6 A;  4ZDX A;  2PU4 A;  1K6R A;  1KE0 A;  1S67 L;  1XFQ A;  2WAE A;  4PPR A;  2CMN A;  3K3D A;  4EER A;  3GRJ A;  3WRT A;  1VQQ A;  4S2I A;  3O86 A;  1ES5 A;  3CLO A;  4BQM A;  1KVL A;  4IUH A;  1AXB A;  1PFL A;  4WF0 A;  5TFQ A;  2GZA A;  4PM8 A;  1TS7 A;  3M2J A;  4CLC B;  4PM6 A;  4N1H A;  5HL6 A;  2WKR A;  3G31 A;  5CX7 A;  5F1F A;  3V67 A;  3N8R A;  2VLG A;  5LBR A;  4LLO B;  4R3J A;  1N4O A;  1DY6 A;  1HLU P;  5HFO A;  2PBY A;  2PU2 A;  3V3S A;  4S2O A;  3ZNT A;  1L3L A;  1RCJ A;  2ZC4 B;  3OBF A;  5EUA A;  3TRC A;  1RGY A;  3KSG A;  2Q0O A;  3PTE A;  4BEN A;  3GEC A;  3G2Z A;  3UB9 A;  5E2E A;  3O87 A;  4X1M A;  2WZX A;  3VE3 A;  4MLL A;  2Y8H A;  4C75 A;  3E2L A;  4II7 A;  3K3C A;  5G18 A;  1OT6 A;  2ZC7 A;  2ZM2 A;  1XJ6 A;  4U0T A;  5FQQ A;  4JXG A;  1W63 Q;  1LHY A;  5DFY A;  2PYP A;  5I94 A;  4PHT A;  1PWC A;  4PKY A;  1VEU B;  4ESP A;  4DE3 A;  1O7E A;  4RX2 A;  1SKO B;  1T1A A;  3CIT A;  4E3L A;  2RL3 A;  3DBA A;  3ZDJ A;  3UY6 A;  3GDI A;  4KEN B;  2XR0 A;  4JGP A;  3VP3 A;  3VMA A;  1DP9 A;  3LGO A;  4KZ8 A;  5I5L A;  3SH7 A;  3JYI A;  3IH9 A;  1ZHH B;  4HP9 A;  2J8Y A;  3UE1 A;  3LEZ A;  5HD5 A;  3AGD A;  4XT2 B;  4Z1W A;  5FI7 A;  3GV9 A;  5CGX A;  5L2F A;  1DJC A;  5E2G A;  2WGW B;  4HJ4 A;  4QB8 A;  4KZ4 A;  1FSW A;  1W7F A;  3JVU A;  4QHC A;  4OQG A;  1F5M A;  2QZ6 A;  5HD3 A;  2O99 A;  1JWP A;  4F3L A;  4Y3I A;  3BLM A;  1W8Y A;  1DJA A;  4GJ4 A;  1JTG A;  5FQI A;  3HLW A;  2VGJ A;  3G2Y A;  5E43 A;  2XA7 S;  3EQV A;  1MC0 A;  1J3W A;  4KQO A;  4E3K A;  5EOO A;  2KLI A;  1NRF A;  1I2W A;  4ID4 A;  3MQO A;  4S2N C;  4B88 A;  1T1B A;  3VOZ A;  3ZQ5 A;  1P0Z A;  3UE3 A;  3AGE A;  4KZA A;  1NLZ A;  2EWW A;  3BFE A;  5DTS A;  3SS4 A;  3N6I A;  1GCE A;  2EA9 A;  3A0R A;  2QPN A;  2ZC3 B;  2VJW A;  2VGK A;  4C6Y A;  4QY6 A;  4IBR A;  3QP8 A;  3IWQ A;  4CLC A;  1YMS A;  3B33 A;  3FC7 A;  3F1N B;  4LV0 A;  4X69 A;  2HPB A;  3IS2 B;  3BW6 A;  4NEE D;  3UB8 A;  1UGU A;  2HV1 A;  3LEQ A;  4Y15 A;  3C38 A;  3ZG8 B;  1Y4O A;  3NOP C;  2H10 A;  4UA6 A;  2OAP 1;  3OPR A;  2BAS A;  3A0V A;  3HLF A;  1OME A;  4JPM A;  5DF8 A;  1WE4 A;  2EFU A;  4BL2 A;  3RFB A;  2Y55 A;  3S4X A;  4IUK A;  3HCY A;  3C4O A;  1BYW A;  1RGZ A;  4CLC C;  3ZG7 B;  4BMW A;  1SCW A;  1PRQ A;  2WUQ A;  3BEC A;  2O9A A;  4NXB A;  5TR7 A;  4JGO A;  1LSX A;  1S1Y A;  3LYX A;  1D7E A;  2HP9 A;  1K0K A;  2V8F A;  4Y0U A;  2XK1 A;  5A8B A;  4HJ3 A;  4XUZ A;  4OP8 A;  1XP4 A;  4E6X A;  3KYQ A;  1OPX A;  2PD7 A;  3A3F A;  3TSG A;  3BY8 A;  4EUV A;  5U47 A;  3NBL A;  2X71 A;  4IJG A;  4PKY G;  4DE2 A;  5EV0 A;  4BL3 A;  4BBV A;  1K55 A;  3IH8 A;  5HAR A;  1VEU A;  4EW7 A;  5HL1 A;  1XGI A;  1G6O A;  1SKO A;  3C5A A;  1K4F A;  1PZP A;  3G6O A;  3LCE A;  2J3T D;  4H8R A;  1IOU A;  5F69 A;  4GZB A;  2J3T C;  2JCH A;  4ZJ2 A;  2O9B A;  3U4L P;  3UPN A;  1NZO A;  2JKT M;  2V8C A;  2DMW A;  4K08 A;  2JBF A;  1G68 A;  1A0K A;  2H5S A;  5IT5 A;  1V9Z A;  5FAQ A;  4XT2 A;  3EOI A;  4GLQ A;  2Z2L B;  3VV4 A;  2ZD8 A;  1EI5 A;  4WMC A;  3PR6 A;  4I5S A; 
#chains in the Genus database with same CATH homology
 5TGF A;  3FYZ A;  4OPQ A;  1KE3 A;  5EVI A;  1NZU A;  4B4Z A;  5FQM A;  4Z9Q A;  1G6A A;  2OLU A;  5A91 A;  3LO7 A;  1I5Q A;  1O07 A;  1U60 A;  3G34 A;  3CJM A;  1ES2 A;  2XF3 A;  2XEP A;  3UDF A;  4GOG A;  5FAT A;  1LLB A;  1IEL A;  3IHB A;  5FDH A;  4OQI A;  1XPB A;  5AQA A;  1ERQ A;  2WK0 A;  5DTT A;  5FA7 A;  1BUE A;  3HL9 A;  3IF5 A;  3OZH A;  1PIO A;  4OPR A;  1BLP A;  4UA7 A;  5CGW A;  3WRZ A;  1NXY A;  4GD8 A;  5FAS A;  3N8L A;  4YFM A;  3BYD A;  4GDB A;  1E3U D;  2UWX A;  3MXR A;  1KDW A;  4WMC D;  1XX2 A;  4GNU A;  3N4I A;  4XXR A;  1LL9 A;  3IF6 C;  4IVI A;  3MZE A;  3Q82 A;  4HBU A;  4GD6 A;  5HAQ A;  1YLJ A;  5FQK A;  3RXX A;  1PW8 A;  3CMZ A;  4Q8I A;  4FH4 A;  3HBR A;  4OKP A;  4OOY A;  2JE5 A;  4X56 A;  1CK3 A;  1N9B A;  5EVI C;  3QNC A;  4E3I A;  5CTM A;  3PBQ A;  3QHY A;  4JXW A;  3UPO A;  1DJB A;  4R1G A;  4WZ4 A;  4OQ0 A;  1WYC A;  2RCX A;  3FKW A;  4Y0O A;  3GSG A;  5CEC A;  4DXB A;  3RJU A;  4C3Q A;  3M6H A;  1KGG A;  1BLH A;  3RXW A;  3UE0 A;  2HDS A;  3BFF A;  2Y2J A;  3VOY A;  5A90 A;  1YMX A;  2XDM A;  1FCO A;  1ESU A;  4JBF A;  3GTC A;  2J9P A;  5AQ7 A;  1RP5 A;  3BEB A;  2E8I A;  3WS1 A;  4P0M A;  3GQZ A;  3BLS A;  5DTK A;  2OV5 A;  4MBF A;  5DF9 A;  5HX9 A;  4DRT A;  4KZ6 A;  2ZC6 B;  1GHP A;  5M18 A;  4OOL A;  2EX8 A;  4NK3 A;  4OQH A;  3DTM A;  2EX6 A;  5JYO A;  1PI5 A;  2G2W A;  1ONG A;  3OCN A;  3FZC A;  5CER A;  4JKT A;  3VP4 A;  1YLT A;  4KZ7 A;  3W4Q A;  3ZG5 A;  1MWU A;  4QD4 A;  2EX2 A;  4E3M A;  2EX9 A;  3IXH A;  4Y7P A;  1GHI A;  1XGJ A;  2Y91 A;  1GA0 A;  3SH9 A;  3VSL A;  5FQ9 A;  3UDX A;  2ZQ9 A;  1H5X A;  3PBO A;  3NY4 A;  4K0W A;  2R9X A;  3MZD A;  1NYY A;  2WZZ A;  3D4F A;  3VFH A;  2XFS A;  1SDE A;  1BUL A;  1VM1 A;  3MXS A;  1BLS A;  2WGI A;  4ZDX A;  2PU4 A;  2HDR A;  1HD8 A;  4R0Q A;  4OOM A;  3HLC A;  1K6R A;  3IXB A;  1LI0 A;  1KE0 A;  4OLG A;  3DW0 A;  2WAE A;  3Q7V A;  4OPY A;  4PPR A;  5HAI A;  2WYX A;  3IWI A;  3GRJ A;  3ITB A;  3WRT A;  5CRF A;  1VQQ A;  1K25 A;  3V39 A;  4JF6 A;  4S2I A;  4EBP A;  3OPP A;  3O86 A;  2Q9N A;  1MWT A;  1BLC A;  2WKH A;  1ES5 A;  1SHV A;  4BQM A;  1KVL A;  2C5W B;  4WM9 A;  4X6T A;  3I7J A;  3WS4 A;  5M1A A;  3W4O A;  3ZG0 A;  4DXC A;  1AXB A;  2H0T A;  4YIN A;  2ZM8 A;  4OVD A;  1L0D A;  4PM7 A;  3ZGA B;  4IED A;  5AQ9 A;  5TFQ A;  2ZLY A;  2Y2Q A;  5GLD A;  4PM8 A;  2HDU A;  3M2J A;  5CHU A;  3OCL A;  4PM6 A;  4N1H A;  2Y59 A;  5DF7 A;  4ZJ3 A;  4CJN A;  3G31 A;  3MBZ A;  3S22 A;  5F1F A;  3IF6 A;  1BT5 A;  1NY0 A;  1MKI A;  3N8R A;  3HLG A;  1S0W A;  1E4D A;  2WGW A;  4OLD A;  2J9O A;  1XA7 A;  4OON A;  3FKV A;  4L0L A;  5JYP A;  2XLN A;  1E25 A;  1FR6 A;  3HUO A;  1N4O A;  1YM1 A;  2B5R A;  4R3J A;  3C4P A;  5F83 A;  3PAG A;  2ZMA A;  4KG6 A;  1CEG A;  1L0E A;  1DY6 A;  1S6R A;  2IWC A;  3ZG9 B;  3VP2 A;  1H8Y A;  4X68 A;  2XD5 A;  2A49 A;  1ERM A;  4PM5 A;  5HFO A;  3CG5 A;  4KG2 A;  2PBY A;  2PU2 A;  2IWD A;  3V3S A;  3NDE A;  3W4P A;  1IYP A;  4S2O A;  3ZNT A;  3UO9 A;  1HTZ A;  4LV3 A;  4UAA A;  1RCJ A;  2ZC4 B;  1IKG A;  3NCK A;  2ZJ9 A;  3VP0 A;  5EUA A;  1MWS A;  5EVI D;  2GDN A;  4PMA A;  1FSY A;  1QMF A;  1RGY A;  4S2P A;  4WEK A;  2DCF A;  4E3N A;  3PTE A;  1H8Z A;  3OPH A;  4WEJ A;  3WWX A;  3NDG A;  4GKU A;  4BEN A;  1ZG6 A;  2DNS A;  4S2J A;  3IWO A;  3SH8 A;  3G2Z A;  4MBH A;  3UPP A;  4JXV A;  1JWV A;  3PAE A;  1PI4 A;  5GLA A;  4HEF A;  3ZHH A;  5EE8 A;  5E2E A;  3O87 A;  1GHM A;  2WZX A;  4OP5 A;  4NET A;  1XA1 A;  1YLP A;  4JF5 A;  1PW1 A;  3Q81 A;  4IVK A;  4MLL A;  4QJG A;  1K38 A;  2R9W A;  2FFF B;  3G32 A;  4C75 A;  3E2L A;  5G18 A;  4WZ5 C;  5F1G A;  2ZC7 A;  1M40 A;  2ZM2 A;  2CC1 A;  1KDS A;  2Q9M A;  4S2L A;  4U0T A;  5FQQ A;  4R4S A;  3Q7Z A;  3HLB A;  4R4R A;  4RX3 A;  5CHJ A;  4JXG A;  1LHY A;  3Q07 A;  3MKF A;  3V5M A;  1CI9 A;  4ZBE A;  1LI9 A;  1K54 A;  5BOH A;  5I94 A;  1NYM A;  2FFY A;  1PWC A;  4P6B A;  4KZB A;  4EBL A;  1NJ4 A;  4R3B A;  1SDN A;  1MY8 A;  3Q1F A;  4DE3 A;  3V50 A;  1K56 A;  2QMI A;  3Q7V B;  2BLS A;  4LV2 A;  1O7E A;  4RX2 A;  1ZKJ A;  3BFD A;  4E3L A;  2RL3 A;  1HVB A;  3ZDJ A;  4KZ3 A;  4O7D A;  1ES3 A;  1GA9 A;  2G2U A;  3UY6 A;  5HAP A;  1KVM A;  5EVL A;  3M2K A;  3A3E A;  1JVJ A;  2BG1 A;  4KEN B;  3CZD A;  3HVF A;  4PM9 A;  2P9V B;  4N1X A;  2XR0 A;  3G30 A;  2IWB A;  2V1Z A;  3HRE A;  3VP3 A;  3VMA A;  2JC7 A;  1BTL A;  3ITA A;  4KZ8 A;  3ISG A;  3N8S A;  1K54 C;  2XD1 A;  3SH7 A;  3JYI A;  3G35 A;  3IH9 A;  4HES A;  2Y4A A;  3IT9 A;  2J8Y A;  3LY3 A;  3LEZ A;  3UE1 A;  3TG9 A;  4MNR A;  3AGD A;  2Y2G A;  1M6K A;  3IF6 B;  1L2S A;  1YLZ A;  3GV9 A;  5CGX A;  5E2F A;  5AQB A;  5FI7 A;  1DJC A;  2Y2H A;  2P74 A;  3P98 A;  5E2G A;  4ZTK A;  4K91 A;  5L2F A;  2WGW B;  3SS3 A;  4E3J A;  4QB8 A;  2EXA A;  5EVI B;  1YLW A;  5CEB A;  4KZ4 A;  1FSW A;  1W7F A;  1JWZ A;  4QHC A;  4N9K A;  3GR2 A;  3MFD A;  1IYO A;  1ZG4 A;  4OQG A;  2OLV A;  4RA7 A;  3VP1 A;  1Q2Q A;  4N92 A;  4WEL A;  2QZ6 A;  3SS5 A;  2WKI A;  1MPL A;  1ERO A;  2WKE A;  4IBX A;  3IQA A;  1YT4 A;  1IEM A;  1L0F A;  3MKE A;  1PZO A;  3IXD A;  3WS5 A;  2XQZ A;  4KZ9 A;  1JWP A;  1PWD A;  1KGF A;  5FAP A;  2Y2I A;  3BLM A;  4DE1 A;  1BSG A;  1W8Y A;  1DJA A;  4K0X A;  3HUN A;  3QNB A;  3FWL A;  1JTG A;  3GMW A;  5GLB A;  4DDY A;  4WBG A;  5FQI A;  3HLW A;  2VGJ A;  1J9M A;  4WYY A;  3G2Y A;  5E43 A;  4E3O A;  4P87 A;  2I72 A;  3EQV A;  3OPL A;  4DF6 A;  2ZQ7 A;  4KQO A;  4E3K A;  1K55 C;  5EOO A;  2ZQC A;  3FV7 A;  2XGN A;  4LV1 A;  1NRF A;  1I2W A;  4ID4 A;  5FSR A;  5A92 A;  4MEZ A;  4S2N C;  5E2H A;  1EWZ A;  4KQR A;  3WS2 A;  4B88 A;  3W8K A;  3VOZ A;  3HLE A;  1PWG A;  2HP6 A;  4WZ5 A;  1CI8 A;  1Q2P A;  1XXM A;  3AGE A;  3UE3 A;  4KZA A;  2HDQ A;  4GB7 A;  3N7W A;  4EQI A;  3BFE A;  5DTS A;  3SOI A;  1KGE A;  1YQS A;  5EEC A;  4ZJ1 A;  3SS4 A;  2ZQ8 A;  3N6I A;  5M19 A;  1K4E A;  4MBK A;  4UHU A;  5CGS A;  2X02 A;  1GCE A;  4D2O A;  2V20 A;  5F82 A;  2QPN A;  2ZC3 B;  3G4P A;  2VGK A;  3P09 A;  2XH9 A;  3ZNY A;  4C6Y A;  1FCN A;  4QY6 A;  2WAD A;  3ZVT A;  4M3K A;  2A3U A;  4IBR A;  3O3V A;  4N9L A;  2WAF A;  3GVB A;  4XUX A;  1TVF A;  3IWQ A;  4RYE A;  1YMS A;  4JLF A;  3IXG A;  5KZH A;  1LL5 A;  1IKI A;  1CEF A;  3O88 A;  4LV0 A;  5FQJ A;  4X69 A;  4EUZ A;  3C7U A;  4BD0 A;  2HPB A;  4JF4 A;  2C6W B;  4U3T A;  4GDN A;  3PBT A;  3NC8 A;  4FH2 A;  4S2M A;  5HW3 A;  4QU3 A;  3ZG8 B;  4LCL A;  4S2K A;  3LY4 A;  2Y2M A;  4DKI A;  2H10 A;  4UA6 A;  4JXS A;  3OPR A;  3HLF A;  5CXW A;  1OME A;  4JPM A;  5DF8 A;  1WE4 A;  3V3R A;  2EFU A;  1HZO A;  5DVA A;  5IHV A;  1IYQ A;  1QME A;  4BL2 A;  1Z6F A;  2Y55 A;  3S4X A;  4EWF A;  5FAO A;  3BRM A;  3C4O A;  1RGZ A;  2ZQD A;  2EXB A;  2Z2M B;  3MZF A;  1C3B A;  1JTD A;  3ZG7 B;  3A3I A;  1SCW A;  1TDL A;  2WUQ A;  3BEC A;  1PYY A;  5GL9 A;  2XFT A;  4FCF A;  4FSF A;  1MBL A;  2V2F F;  2ZQA A;  3DWZ A;  5TR7 A;  4DE0 A;  2ZC5 B;  5GHZ A;  4BJP A;  4DDS A;  2Y2K A;  2Y2O A;  5CTN A;  4R23 A;  4X55 A;  2HP9 A;  4OH0 A;  4Y0U A;  1KE4 A;  2XK1 A;  2HP5 A;  4HBT A;  1K56 D;  1K57 A;  4FD8 A;  4OP8 A;  4XUZ A;  5CED A;  4GN2 A;  4Y0T A;  1W5D A;  1XP4 A;  3B3X A;  4KG5 A;  4E6X A;  3A3F A;  3TSG A;  5KSC A;  4UA9 A;  4RVA A;  5D3O A;  5U47 A;  4OPZ A;  1ES4 A;  3NBL A;  3VSK A;  1K6S A;  2X71 A;  1ONH A;  4U0X A;  3PBR A;  1Y54 A;  2J7V A;  3TOI A;  1W79 A;  3AGF A;  4DE2 A;  4BD1 A;  4LCM A;  3UDI A;  1FOF A;  4BL3 A;  1IYS A;  1K55 A;  3HLD A;  3BFC A;  3WS0 A;  4ZAM A;  1FR1 A;  3BM6 A;  2Y2N A;  5FI2 A;  3IH8 A;  5HAR A;  4S2N A;  3OC2 A;  1MXO A;  3ZFZ A;  5HL1 A;  4BLM A;  2Y2L A;  1K57 C;  1BZA A;  1FQG A;  1XGI A;  3ZVW A;  3C5A A;  1K4F A;  4KQQ A;  2X01 A;  1PZP A;  2EFX A;  3C7V A;  3LCE A;  2H0Y A;  5GHY A;  4CPK A;  1ESI A;  3ZCZ A;  4H8R A;  4EV4 A;  5KMW A;  2DRW A;  1WYB A;  2WGV A;  4GZB A;  3M6B A;  3A3D A;  2P9V A;  1ZC2 A;  1TDG A;  2JCH A;  4X53 A;  4ZJ2 A;  3VFF A;  3NI9 A;  5GHX A;  2OSU A;  3PBS A;  3UNW A;  1XKZ A;  1I2S A;  3UPN A;  3DWK A;  2ZM0 A;  3HUM A;  1NZO A;  4E6W A;  3EQU A;  4QY5 A;  1L0G A;  1FCM A;  5J8X A;  2JBF A;  1G68 A;  5A93 A;  3A3J A;  1MWR A;  3UN7 A;  1TEM A;  5CHM A;  5GLC A;  2Y2P A;  3E2K A;  2H5S A;  1YLY A;  4KZ5 A;  4P85 A;  5FAQ A;  3NIA A;  3BFG A;  3S1Y A;  4B4X A;  5KSH A;  1E3U A;  2Z2L B;  1W8Q A;  5EOE A;  5EPH A;  4EBN A;  2ZD8 A;  1EI5 A;  4WMC A;  3IHA A;  4F94 A;  1ALQ A;  5FI6 A;  3PBN A;  4LEN A;  1SKF A;  4A5R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...