3FZCA

Oxa-24 beta-lactamase complex with sa3-53 inhibitor
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
244
structure length
243
Chain Sequence
HISSQQHEKAIKSYFDEAQTQGVIIIKEGKNLSTYGNALARANKEYVPASTFMLNALIGLENHKATTNEIFKWDGKKRTYPMWEKDMTLGEAMALSAVPVYQELARRTGLELMQKEVKRVNFGNTNIGTQVDNFWLVGPLKITPVQEVNFADDLAHNRLPFKLETQEEVKKMLLIKEVNGSKIYAKSGWGMGVTPQVGWLTGWVEQANGKKIPFSLNLEMKEGMSGSIRNEITYKSLENLGII
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactamase OXA-24
publication title Design, synthesis, and crystal structures of 6-alkylidene-2'-substituted penicillanic acid sulfones as potent inhibitors of Acinetobacter baumannii OXA-24 carbapenemase.
pubmed doi rcsb
source organism Acinetobacter baumannii
molecule tags Hydrolase
total genus 78
structure length 243
sequence length 244
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2009-01-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 3fzcA00
4DE3A 2HDRA 3UDFA 1BSGA 3GTCA 1KVMA 4E6XA 2J9OA 4GN2A 5FA7A 3IXHA 3C5AA 4LV1A 5F1FA 1FCMA 4JXWA 4WZ5A 3FKWA 3G2YA 4X55A 5FI6A 4EUZA 5CHMA 4FH2A 1GHMA 2Y55A 4DDSA 3VP4A 4Y0TA 3Q7ZA 1NY0A 5HARA 3G31A 1KVLA 2Y2QA 4PM6A 2JC7A 2Y2PA 1BLCA 4NK3A 4JF6A 3G4PA 1FOFA 4S2IA 3PBTA 3WS1A 3IXGA 5FASA 4E6WA 5CEDA 3SH8A 1FSYA 1MKIA 3RJUA 2HDUA 3A3FA 3IQAA 4JBFA 1Z6FA 3HLFA 3C4PA 3GV9A 3WS0A 2DCFA 3N7WA 5E2FA 3MKEA 2XDMA 3LY3A 1C3BA 3ZG5A 4B4ZA 3ITAA 4UHUA 3W4PA 3WS4A 3HLGA 5E43A 2H0YA 4F94A 3M6HA 4B4XA 3MBZA 4GZBA 3SH7A 1XXMA 1KE0A 3N4IA 4OOMA 1H8ZA 2X02A 1MBLA 4O7DA 4OOLA 4DF6A 5HAQA 1SHVA 3PBNA 2P74A 3QHYA 4A5RA 2JBFA 2ZC3B 1PI5A 1TVFA 1MWRA 1YLJA 1YLWA 3LO7A 3TSGA 4N1HA 3UN7A 1NXYA 5GLAA 4C6YA 1BLSA 3NIAA 4LV2A 2PBYA 4DE2A 1L0DA 2J9PA 3VOYA 2XFSA 3S22A 1G6AA 2ZMAA 1GA9A 2EX9A 4K0WA 2ZC6B 4GB7A 1M6KA 4S2LA 5CEBA 4ZDXA 1L0FA 4KQRA 3W8KA 3V39A 4JKTA 4QB8A 5HX9A 2OSUA 4MNRA 1LI0A 3RXWA 3HL9A 1N4OA 1KDSA 1PW8A 3VP0A 1NYMA 4EQIA 4FSFA 3IWIA 2R9WA 5FQMA 3HLBA 4D2OA 1K4EA 1YLYA 3G35A 3HBRA 4PM9A 2V1ZA 4QHCA 4E3LA 1IYSA 2ZC7A 3LY4A 4S2KA 5TFQA 2EFUA 1FQGA 2XD5A 1ESUA 1BULA 4OLGA 5KSCA 4PM8A 4P85A 1BLHA 3ZNYA 1LI9A 1PZPA 1YT4A 2VGJA 3VMAA 1CI8A 3BM6A 3MXSA 4KENB 4UAAA 2WGVA 1XA7A 2XQZA 3E2KA 3M2JA 4MBFA 1ZKJA 2IWCA 3SH9A 4X53A 3ZG0A 2EXAA 1U60A 5IHVA 1JTGA 3JYIA 4L0LA 4P6BA 5DF8A 2JE5A 3SS4A 2XLNA 2WGWB 1L2SA 4ZJ3A 1ERQA 2A49A 2EFXA 2HP5A 1JWZA 5EVLA 3SS3A 3ZGAB 3VP3A 1Q2PA 4DDYA 4PM5A 5F82A 3M2KA 3UDXA 1J9MA 3WRTA 3GSGA 1K6SA 1FR1A 1DJCA 1K55A 5EVIA 3ZG8B 3N6IA 1DY6A 4LV3A 2Z2LB 5CXWA 4E3MA 3AGEA 3V3SA 4C75A 4U3TA 1VQQA 4KG5A 5FSRA 1VM1A 4ZJ1A 3NI9A 3Q7VB 3BLSA 4FH4A 4N9LA 4XUZA 3ISGA 3NCKA 1HZOA 4S2NA 1WYBA 5U47A 2EX6A 3BFCA 3BRMA 4UA7A 1IELA 4IBRA 4KZ6A 5GLBA 3VSKA 1FCNA 4WEJA 1CI9A 3NBLA 3Q82A 3IF6C 2Y91A 4JXVA 3UO9A 5CHJA 1YLTA 1FSWA 3WWXA 4N9KA 2ZD8A 1K57C 3VFHA 1MPLA 3A3JA 1ES4A 2HDSA 2WZZA 4S2OA 5EVIC 5FI7A 3VP1A 4E3NA 1KE4A 3OC2A 4DRTA 5CERA 1DJAA 1ES3A 1SKFA 5A93A 1BZAA 3C7UA 3DWKA 4K91A 4XUXA 4RA7A 2WK0A 4BL3A 3VFFA 3N8RA 5DF7A 3VOZA 3BFDA 3NDEA 3IWQA 5KSHA 1FR6A 1MXOA 3OZHA 4S2NC 5JYPA 2WGIA 1JTDA 1PI4A 1KGFA 2P9VA 3HLEA 4HEFA 3N8SA 4GOGA 2Y2NA 5TR7A 2DRWA 4FCFA 2WKEA 1EWZA 4Q8IA 2ZQ7A 1I2SA 3DTMA 4WELA 3WS2A 3PBRA 4Z9QA 5HFOA 2ZJ9A 3S1YA 1QMFA 1K6RA 2XF3A 5M1AA 1XGJA 3O3VA 4OH0A 5DTTA 1NZUA 2E8IA 2OV5A 1ZG4A 2H5SA 3BECA 5GHZA 5AQBA 2V2FF 2WADA 4KZ7A 5BOHA 5FATA 3G2ZA 2FFFB 5GLDA 1K38A 4WZ5C 3ITBA 4BQMA 2BLSA 2Y2LA 3IH9A 3OCLA 3B3XA 5CTMA 4RX2A 2ZC5B 5E2HA 3G34A 1K54A 2Y2KA 3DWZA 4OP8A 1IKIA 2Y2IA 4KG6A 4EWFA 4X68A 1QMEA 5DF9A 4OPQA 2J7VA 5E2EA 5G18A 3OPLA 4OPZA 5DVAA 1YLPA 4P0MA 3UY6A 2Z2MB 3QNBA 5L2FA 1BT5A 3HREA 5FDHA 3HVFA 1WYCA 1I2WA 3RXXA 2OLUA 2Y2OA 3UNWA 1XX2A 1KGGA 4WZ4A 3IXDA 3DW0A 4R1GA 4JXGA 4UA9A 1GHIA 5TGFA 4JPMA 2QZ6A 1LL9A 5CGXA 3CG5A 4R0QA 2WYXA 3GVBA 2J8YA 1K54C 3MFDA 4R4SA 4QD4A 5EOOA 4E3OA 1YQSA 1FCOA 4Y7PA 4ZBEA 2EXBA 4GNUA 3IH8A 5A90A 4KZ4A 1PIOA 1O07A 1NYYA 3MZDA 4FD8A 4HBUA 4IVKA 4LV0A 4ID4A 3PTEA 2ZLYA 2Q9NA 2WKHA 4P87A 4KQOA 5CECA 2PU2A 4B88A 1PYYA 2Q9MA 1PWGA 2PU4A 3BFEA 3HLCA 3SS5A 3MXRA 4RVAA 1IEMA 5JYOA 4BL2A 4DE1A 5CGWA 3LCEA 2DNSA 1YMSA 2BG1A 4MLLA 5FQIA 1WE4A 2CC1A 1YLZA 2Y4AA 2ZQAA 3GR2A 3ZCZA 2HP6A 4H8RA 4JXSA 1CEFA 1CK3A 4GD6A 1XA1A 4OQIA 1RCJA 2ZM8A 3UE0A 1KDWA 3ZFZA 2HP9A 5I94A 5KMWA 3EQUA 3ZHHA 2JCHA 2WGWA 3MZFA 3NY4A 1SDEA 4KZ8A 1ALQA 2C5WB 4S2MA 5A92A 1PWCA 5EECA 4EBLA 4EBNA 1DJBA 1JVJA 1HVBA 1BTLA 3WS5A 1I5QA 1EROA 3OPHA 2ZQ9A 4OQGA 2IWBA 3IWOA 3HUNA 1PWDA 4Y0OA 4YFMA 2OLVA 3MZEA 4N1XA 2WZXA 1O7EA 1EI5A 3GMWA 3PBSA 1XPBA 5FQKA 4OONA 1BLPA 2WAFA 2Y2HA 3GQZA 1L0EA 1LLBA 3Q7VA 1BUEA 4ZTKA 1XGIA 2ZM0A 3A3EA 1K55C 4IVIA 4N92A 5F83A 4OP5A 2Y2MA 3G30A 1E3UD 4PM7A 2FFYA 3V5MA 4EV4A 1LL5A 5FQQA 3FV7A 3OCNA 1TDGA 3Q1FA 4OLDA 4OQHA 2G2UA 1HTZA 4WYYA 2ZM2A 1JWVA 4R3BA 4QU3A 4U0XA 5CTNA 1MWTA 3VP2A 1OMEA 3V50A 2XK1A 1AXBA 5J8XA 3FZCA 4YINA 1E25A 4WMCD 4OVDA 4KQQA 2X71A 3UPPA 3ZG9B 4OQ0A 1Q2QA 3TOIA 1ES5A 3WRZA 5HAPA 3OPRA 2ZQDA 1LHYA 4IBXA 4NETA 5GHYA 3FKVA 3FYZA 2C6WB 4GDBA 1RGZA 5FI2A 4E3IA 4DXCA 1IYQA 4HESA 4KZAA 4LCLA 3HLWA 2WKIA 1NRFA 4PMAA 1KE3A 4HBTA 3ZVWA 4CPKA 4JLFA 3BLMA 3IHAA 4RX3A 1NJ4A 3BEBA 1ONHA 2WUQA 2Y2JA 3PAEA 5HW3A 1K25A 2Y2GA 5FAOA 3A3DA 1W79A 3ZVTA 4QY6A 4BJPA 1PZOA 3P09A 4E3KA 1SDNA 1YM1A 1ERMA 4PPRA 1GHPA 3PBOA 1JWPA 2XR0A 1S0WA 3BFFA 4K0XA 4KZ5A 4OPRA 4C3QA 4S2JA 3NC8A 3ZNTA 2HPBA 5FQ9A 2ZQCA 3EQVA 4EBPA 2UWXA 4WBGA 3CMZA 4OKPA 4JF4A 4DE0A 3CJMA 1TEMA 4ZJ2A 2QMIA 1W8YA 3D4FA 1IYPA 3AGFA 3C7VA 3VSLA 5CHUA 4KZBA 5EVID 4KZ3A 2VGKA 4WEKA 1ZG6A 3OPPA 2A3UA 4OOYA 2XGNA 3UPNA 2WAEA 5DTSA 3P98A 5GL9A 1E3UA 1K56D 2IWDA 4UA6A 5A91A 3O87A 1TDLA 4GD8A 4E3JA 4BLMA 1ESIA 2RL3A 1NZOA 1RP5A 5F1GA 4XXRA 4X6TA 3IT9A 1E4DA 1XKZA 1GA0A 4R23A 1GCEA 4GKUA 1IYOA 4MBHA 4OPYA 5CRFA 3UE3A 2ZQ8A 1IKGA 2EX8A 4WMCA 1W7FA 3Q07A 3MKFA 4LENA 1RGYA 3Q81A 3O88A 3AGDA 1H5XA 1ONGA 1Y54A 4QY5A 2G2WA 4DXBA 5KZHA 4BD1A 4BD0A 3GRJA 5FQJA 4IEDA 1PW1A 4JF5A 4R4RA 2V20A 3V3RA 3PAGA 2QPNA 5EE8A 3ZG7B 4X69A 3BYDA 5AQ7A 2XD1A 4RYEA 1ES2A 4DKIA 5HAIA 4MEZA 4Y0UA 1SCWA 3HUOA 4QJGA 5M18A 2XFTA 3O86A 1MWUA 3IF6B 5GLCA 5D3OA 3I7JA 3M6BA 2EX2A 5M19A 4LCMA 1H8YA 3G32A 1HD8A 5HL1A 3IHBA 4U0TA 5EVIB 5FAQA 1MWSA 1MY8A 5AQ9A 4CJNA 1K4FA 2B5RA 3IF6A 5FAPA 2ZC4B 2R9XA 1G68A 3N8LA 3HLDA 1K57A 1M40A 4MBKA 3S4XA 1L0GA 3A3IA 3E2LA 3UDIA 3IF5A 2RCXA 1W8QA 2X01A 4KZ9A 4X56A 2XH9A 5EUAA 3UPOA 5CGSA 1K56A 1KGEA 3UE1A 3W4OA 2XEPA 2H0TA 3BFGA 2H10A 4BENA 1CEGA 4GDNA 2GDNA 3QNCA 5EOEA 5GHXA 3TG9A 3IXBA 4R3JA 5DTKA 3HUMA 2Y59A 5AQAA 3PBQA 1ZC2A 1XP4A 5EPHA 2HDQA 4M3KA 1W5DA 3C4OA 5E2GA 1N9BA 4WM9A 3ZDJA 4ZAMA 2I72A 4KG2A 3SOIA 4S2PA 3W4QA 3CZDA 1YMXA 3LEZA 3FWLA 3NDGA 2P9VB 1S6RA
chains in the Genus database with same CATH superfamily
4DE3A 2HDRA 2AVXA 4E6XA 5HL6A 5FA7A 3C5AA 2A24A 3CWFA 4MCWA 1GHMA 1V9YA 2Y55A 4ZRRA 5HDCA 3VP4A 2A2LA 5HARA 4XT2A 1KVLA 5IT5A 2BASA 3G4PA 4S2IA 3PBTA 5I5LA 3WS1A 2W0NA 3C2WA 5CEDA 1FSYA 3RJUA 2HDUA 3A3FA 4P6ZS 3MKEA 1A0KA 4B4ZA 3ITAA 4UHUA 5E43A 4F94A 4OOMA 3V67A 2P74A 3O5YA 3QHYA 2JBFA 1VHMA 3A0VA 5FEFA 5GLAA 3QP5A 3NIAA 4HJ4A 3K2NA 2J9PA 1YSPA 3LI8A 2EX9A 4GJ4A 5CEBA 1M6KA 4S2LA 2O9BA 3V39A 2D02A 5DFYA 4L9EA 2OSUA 3T4QA 1OTAA 2XROA 2L1MA 2W3FA 4EW7A 5EVEA 1VB6A 1NYMA 2R9WA 5FQMA 1K4EA 2PT7A 4S2KA 4OLGA 2QKPA 4P85A 5HWVA 4I3JA 3MXSA 3GECA 1XA7A 3M2JA 2IWCA 3ZG0A 3LR4A 1Y4OA 5IHVA 5DF8A 3D3OA 3D9YA 4ZJ3A 3JVUA 2A49A 2EFXA 1JWZA 1Q2PA 4NG2A 1J9MA 3GSGA 5EVIA 5FL3A 4LV3A 2VEAA 3V3SA 3S7QA 5FSRA 4KG5A 5J7EA 4ZJ1A 4FUWA 1CJFA 2Q0OA 4S2NA 5U47A 3BFCA 3VSKA 4EQIA 1FCNA 3Q82A 2Y91A 3UO9A 1UWPX 2LB9A 2ZD8A 5EVIC 1J3WA 3VP1A 1ES3A 4WLAA 3BFDA 3NDEA 1FR6A 1MXOA 3LR0A 4S2NC 1PI4A 3HLEA 4FCFA 2WKEA 1EWZA 4Q8IA 4Z9QA 2XF3A 3KO6A 1IOUA 4OH0A 1GSXA 4Y3IA 4P6ZM 1ODVA 3LIFA 3LIAA 5AVFA 5AQBA 2WADA 4KZ7A 4GS9B 2FFFB 3U4LP 4X1MA 3ITBA 4LRYC 4BQMA 4MN6A 4RX2A 1NLZA 3G34A 1KOUA 1IKIA 2Y2IA 5DVAA 4OPZA 1YLPA 2Z6DA 2V9AA 3UY6A 4B93A 1ACFA 5FDHA 4DJ2A 3RXXA 2OLUA 3IXDA 4JPMA 2QZ6A 2WYXA 3GVBA 4E3OA 4Y7PA 3IH8A 5A90A 4YOFA 1O07A 4HBUA 2ZLYA 2WKHA 1STZA 4KQOA 3HLCA 4MN5A 3C8CA 3SS5A 2OWJA 4F3LA 4PKYA 2BG1A 3K3DA 5FQIA 3GR2A 2GNXA 1XA1A 4OQIA 3ZFZA 1KDWA 4FTXA 3ZHHA 3MZFA 1SDEA 1JVJA 1BTLA 3WS5A 5HSQA 4YFMA 2OLVA 1O7EA 3BW6A 4K08A 1BLPA 4OONA 2WAFA 3C30A 4EU0A 1UWNX 1XGIA 3KYEA 4N92A 1WA9A 1E3UD 2VGLS 4EV4A 5FQQA 3FV7A 2W3DA 3OCNA 4OLDA 4OQHA 4WYYA 2ZM2A 1DP6A 4QU3A 1MWTA 4GCZA 3C38A 3E4QA 1E25A 5F6AA 1D7EA 3ZG9B 1Q2QA 1ES5A 4BBVA 5HPIA 2C6WB 1RGZA 2O9CA 3HLWA 1XJ4A 2WKIA 1DRMA 4NKPA 4RX3A 3UB9A 3EGDC 3PAEA 5HW3A 2PD8A 2Y2GA 5HDDA 3JVVA 4R6LA 1SDNA 1YM1A 1GHPA 1JWPA 4I3AA 3T12B 2ZQCA 4JGRA 3CJMA 4ZJ2A 3CITA 3PYPA 3CLOA 1SKOB 3T1RA 2VGKA 4LRXC 4WEKA 5TBMA 4EWFA 5DTSA 5A91A 3P98A 1OTEA 3CPTB 4GD8A 5EFWA 2RL3A 1RP5A 4UEYA 4X6TA 3IT9A 2FH5A 3UMEA 1VETA 2ZQ8A 2VKSA 4GLQA 4G3VA 2W3EA 1Y54A 4DXBA 5KZHA 4WN5A 1PW1A 3UB6A 1XFNA 1GSWA 4R4RA 2M1CA 2ACGA 2QPNA 4H6JA 3T4KA 3ZG7B 4UQIS 2XD1A 4DKIA 5HAIA 2PRFA 3VE4A 4QJGA 5M18A 3IF6B 3I7JA 1H8YA 2XA7M 3IHBA 4U0TA 3MFXA 3VV4A 1K4FA 5FAPA 2R9XA 2GX5A 3HLDA 1M40A 2PBDP 2RCXA 2W27A 1TD5A 3UE1A 4EXOA 2VGLM 2YKHA 3IXBA 2WKQA 5AQAA 5IU1A 4KQDA 4NXBA 4ARZB 3NOUC 1N9BA 4WM9A 2I72A 4KG2A 2QJ5A 3CZDA 2ZBBA 3LEZA 3FWLA 2P9VB 3UDFA 1BSGA 4JXWA 3FKWA 1UGUA 4X55A 4EUZA 5CHMA 4FH2A 4DDSA 1W63M 3T1SA 2JC7A 2Y2PA 4NK3A 1P9WA 1FOFA 4E6WA 1GSVA 1MKIA 4CLCD 4JBFA 3HLFA 3C4PA 3BJNA 4G3WA 2DCFA 3N7WA 5E2FA 3LY3A 3ZG5A 3W4PA 3HLGA 3M6HA 3MBZA 4GZBA 3SH7A 1XXMA 4DF6A 2MJ6A 1OPXA 2ZC3B 1YLJA 1NXYA 1BLSA 4LV2A 4II7A 2PBYA 4DE2A 3T4LA 3S22A 4K0WA 4GB7A 5KIZA 1H0MA 4HHDA 1VEUA 5FDSA 1LI0A 1N4OA 4FSFA 4WUJA 2J3WA 3HLBA 1YLYA 3IX3A 1HLUP 2V1ZA 4E3LA 1BULA 3EEAA 1F9IA 4CLCB 3HCYA 1BLHA 1YT4A 4LLOB 3E2KA 1ZKJA 2L4RA 4P6BA 2JE5A 2XLNA 1T18A 3F1OB 2B95A 2HP5A 5EVLA 3H7WA 1S4RA 5F82A 3WRTA 1FR1A 3ZG8B 3N6IA 2KOIA 4MMNA 4U3TA 3EEHA 3NI9A 3BLSA 4FH4A 4EESA 3ISGA 3NCKA 1HZOA 3FC7A 2EX6A 2PDRA 4KZ6A 2XRNA 4IUHA 1CI9A 4GHIA 4JXVA 2L0WA 5CHJA 1YLTA 2W3GA 4N9KA 3E98A 2VK3A 1ES4A 4S2OA 5FI7A 1W63Q 4DRTA 2IA2A 4R38A 4K91A 3QP4A 4XUXA 3VFFA 3N8RA 3VOZA 3IWQA 3OZHA 2WGIA 2KX6A 3PHYA 3P01A 2DRWA 4CLCE 1I2SA 3DTMA 1OTIA 3WS2A 2ZJ9A 3S1YA 1K6RA 5M1AA 1XGJA 3O3VA 1OTBA 1S1ZA 3G6OA 2OV5A 2H5SA 5G4YA 5GHZA 2PAVP 5DKKA 5BOHA 5FATA 3T1XA 2Y2KA 4OP8A 2ZL1A 4X68A 1Z09A 1QMEA 3OPLA 2Z2MB 3QNBA 4RQ9A 5L10A 3HREA 1V9ZA 3BY9A 1WYCA 1I2WA 3RTYA 1KGGA 3DW0A 3T4JA 3DTKA 4JXGA 5TGFA 3T4SA 4EUVA 1P97A 4R4SA 3MFDA 5HWTA 1YQSA 2Z6CA 4Z1WA 4IVKA 4FD8A 2Q9NA 1PRQA 5HD5A 3UMDA 5CECA 2PU2A 1CQAA 1PYYA 1YPRA 1PWGA 3BFEA 1IEMA 3H82A 4BL2A 3W2ZA 1YMSA 1F98A 2Y4AA 1F5MA 4H8RA 4JXSA 1CEFA 1CK3A 2ZM8A 3QP8A 5I94A 2PD7A 3EQUA 2WGWA 2B02A 1ALQA 2C5WB 4EBLA 4EBNA 2EA9A 1I5QA 3OPHA 4OQGA 4E04A 3IWOA 4Y0OA 3MZEA 4N1XA 2WZXA 1EI5A 3GMWA 3F1PB 1XPBA 5FQKA 1YSQA 2Y2HA 1L0EA 1LLBA 3Q7VA 4ZTKA 2JHEA 3A3EA 2Y2MA 3TRCA 1TDGA 2HGVA 2VX8A 2R78A 3VP2A 1OMEA 3V50A 1AXBA 2KLIA 4YINA 4Y15A 3UPPA 2A24B 1TS8A 5GHYA 4XT2B 4DMZA 5A8BA 3HJIA 4EEPA 4E3IA 1NRFA 1KE3A 4CPKA 1NJ4A 4LPZA 1ONHA 2WUQA 2Y2JA 2EWVA 2EWWA 4D60A 3A3DA 4BJPA 1PZOA 1XJ3A 3P09A 3TW8A 4K0XA 3NC8A 5DJUA 5LBRA 3CMZA 3KSIA 4JF4A 4DE0A 2QMIA 3D4FA 3QP6A 1BYWA 3C7VA 3VSLA 5CHUA 4KZBA 5EVID 5TJJA 4KZ3A 4OOYA 1E3UA 1K56D 5L8MA 3ZQ5A 4E3JA 1ESIA 4LGWA 2VV8A 1E4DA 1XJ6A 4GKUA 4OPYA 3Q07A 1RGYA 1ONGA 4QY5A 3MQOA 3BWLA 5FQJA 2E8JA 4WF0A 4JF5A 2V20A 3V3RA 1S67L 3PAGA 5EE8A 4RYEA 1ES2A 4MEZA 4Y0UA 1SCWA 3O86A 2W1TA 5GLCA 5D3OA 4HH3A 1ZHHB 3M6BA 2EX2A 5M19A 3G32A 1HD8A 5EVIB 5FAQA 3S7OA 3MF0A 1MWSA 1MY8A 3IS2A 1P9RA 3IF6A 1K57A 1L0GA 1IFQA 5DJTA 1W8QA 2HF6A 2X01A 2XH9A 3UPOA 5CGSA 2XEPA 2LB5A 3BFGA 3GDIA 2H10A 1CEGA 3QNCA 3CHWP 4R3JA 4ESPA 3A0RA 3L7HA 2HJEA 3PBQA 1XP4A 2INWA 5EPHA 4M3KA 1W5DA 1NWZA 2O99A 3W4QA 1T1AA 3NDGA 3ICYA 3F1NA 2J9OA 1LSWA 4LV1A 1FCMA 4WZ5A 5DFXA 5FI6A 2PR5A 3IBJA 3Q7ZA 3G31A 4PM6A 1BLCA 4L9FA 5FASA 4IUKA 4Y5FA 2M7UA 3IQAA 1L3LA 3WS0A 3EOIA 3NULA 1LL8A 2XDMA 5HDSA 4B4XA 1KE0A 3N4IA 5F69A 4O7DA 3PBNA 4A5RA 1TVFA 5CX7A 3LO7A 4N1HA 4C6YA 4O8GA 3B33A 4HI4A 5MC7A 1L0FA 4LFUA 3W8KA 2NUTC 4MNRA 3RXWA 3LGOA 1KDSA 1PW8A 2OAP1 2VA0A 2W1RA 3IWIA 5J3WA 1LSVA 3HBRA 4PM9A 4QHCA 5TFQA 3LY4A 2WKRA 3T4OA 2EFUA 1FQGA 1ESUA 4F3LB 4I3IA 3ZNYA 3VMAA 1CI8A 4KENB 4UAAA 2XQZA 3SH9A 4BMWA 4X53A 2EXAA 2UV0E 1JTGA 4L0LA 4ME4A 3R7WA 1L2SA 3NHQA 3SS3A 3VP3A 4PM5A 3QP2A 1MZUA 1K55A 4HP4A 3IX8A 4KUKA 4DJ3A 2Z2LB 4NEED 4E3MA 4C75A 1VQQA 2GJ3A 1VM1A 4N9LA 1WYBA 3BRMA 4UA7A 5GLBA 1IELA 1EW0A 3U2AA 1N9OA 4WL9A 5G4ZA 4Y13A 2QHKA 1OT6A 1NLYA 3VFHA 1D06A 1MPLA 3LIDA 2BTFP 3A3JA 4M4XA 2WZZA 4E3NA 1KE4A 3OC2A 1SKFA 2J3TC 4GW9A 5A93A 3C7UA 2PHYA 4HIAA 2WK0A 4I5SA 1OJGA 3LR5A 5DF7A 3D72A 3MQ0A 5KSHA 3A0SA 3DTEA 5JYPA 1JTDA 1KGFA 2DMWA 3N8SA 4GOGA 4EETB 2Y2NA 1DP8A 5TR7A 2ZQ7A 1LSXA 4WELA 3PBRA 3FPWA 1NZUA 2B18A 2E8IA 2JKRI 1ZG4A 4JGOA 4L9GA 3BECA 3BQ8A 2V2FF 2ZOHA 5GLDA 1T1CA 3DTIA 5HPFA 2BLSA 2Y2LA 3IH9A 1TS6A 2P04A 3OCLA 1K54A 3DWZA 2V8FA 2J80A 3RH8B 5DF9A 4OPQA 5G18A 5TBMB 4P0MA 4MN7A 2ZMVA 2JKTI 3UNWA 1XX2A 4WZ4A 2V0WA 4UA9A 2OWHA 5CGXA 3CG5A 1VETB 3R4KA 4R0QA 5EOOA 2J8YA 1K54C 4JGQA 1ZTUA 4ZBEA 2EXBA 2JKFA 5EM0A 4GNUA 4UQIM 1X0OA 1NYYA 3PTEA 5EM1A 5F5YA 4B88A 4H6JB 2PU4A 3MXRA 5JYOA 4DE1A 3LCEA 2OAQ1 4JGPA 4MLLA 1WE4A 2CC1A 2ZQAA 3RFBA 4KUOA 2VV6A 3ZCZA 3LIBA 4GD6A 1RCJA 3NY4A 4KZ8A 2HJ9C 4S2MA 5EECA 4O01A 4PHTA 1HVBA 4PKYG 2IWBA 3KX0X 1TS7A 4NXGA 1FIKA 3GQZA 3FG8A 1PNEA 2VV7A 2ZM0A 3MR0A 5F83A 3MQQA 1G5UA 4OP5A 4PM7A 2FFYA 3V5MA 1AWIA 1LL5A 3Q1FA 2G2UA 1PFLA 1HTZA 1JWVA 4R3BA 5CTNA 1OTDA 5J8XA 4WMCD 4OVDA 4KQQA 2X71A 5HD3A 4OQ0A 3TOIA 3WRZA 2ZQDA 1LHYA 4IBXA 4NETA 4FOFA 4GDBA 5FI2A 2PR6A 1IYQA 4LCLA 4PMAA 3ZVWA 4JLFA 1K25A 1OT9A 5FAOA 3ZVTA 1TS0A 2VJWA 5AVEA 1ERMA 3MSHA 4OPRA 1G28A 1S0WA 2XR0A 3BFFA 4GS9A 4KZ5A 4C3QA 1S66L 5FQ9A 4OKPA 1TEMA 1IYPA 3VE3A 4ETZA 1ZG6A 2A3UA 2XGNA 2WAEA 5GL9A 2HV1A 4UA6A 2I9VA 3O87A 1TDLA 1VEUB 3UB7A 4O0PA 2K7SA 1NZOA 2WKPA 5F1GA 4I39A 1XKZA 2GZAA 1NRJA 4R23A 2NUPC 3UE3A 5IS1A 1IKGA 2EX8A 2Y8HA 1H5XA 3MMHA 3P7NA 2PYRA 3GRJA 2OOLA 4IEDA 3KSHA 1YKDA 2VZWA 1SZVA 1G6OA 5AQ7A 4IHQA 2XFTA 1MWUA 4HY8A 3H7WB 4LCMA 2Y79A 5HL1A 4I38A 3ULFA 2B5RA 1G68A 3KSGA 3KYZA 4Y2FA 3N8LA 4MBKA 3A3IA 3SZTA 3LICA 3E2LA 2K31A 3LR3A 4KZ9A 4X56A 5EUAA 3CUEA 1K56A 4GHIB 3LUQA 4BENA 2GDNA 5EOEA 5GHXA 3HUMA 4HNBA 2Y59A 3S7NA 2K2NA 5E2GA 3ZDJA 4ZAMA 3SOIA 4S2PA 5C5KA 3HUNA 3CUEC 1S6RA 3GTCA 3BQAA 1KVMA 3OBFA 3LEQA 4GN2A 2CMNA 5F1FA 3IXHA 1OJ5A 2FZ0A 3G2YA 1N9LA 3UB8A 4Y0TA 1NY0A 2Y2QA 4JF6A 1T19A 3TE8A 1F2KA 3IXGA 4MDZA 3SH8A 1Z6FA 3GV9A 3UE6A 3T1QB 1C3BA 2ZL1B 3NOPC 3WS4A 2H0YA 1H8ZA 2X02A 1MBLA 4OOLA 1XJ2A 5HAQA 1SHVA 1MC0A 3IX4A 1PI5A 1MWRA 1YAXA 1YLWA 3TSGA 3UN7A 4Q0IA 4HP9A 1L0DA 3VOYA 2XFSA 5L09A 1G6AA 2P7JA 2ZMAA 1GA9A 1SKOA 2ZC6B 4ZDXA 4HJ3A 4KQRA 4JKTA 4QB8A 3CPTA 5HX9A 1Y28A 3HL9A 4HJ6A 3E4OA 3VP0A 4D2OA 3HJKA 3G35A 1IYSA 2ZC7A 3CI6A 2XD5A 3H82B 5KSCA 4PM8A 1LI9A 1PZPA 2VGJA 3BM6A 2WGVA 4MBFA 2D01A 1S1YA 1U60A 4HOIA 3JYIA 3SS4A 2PYPA 2WGWB 3T4TA 1MKMA 1ERQA 3ZGAB 4DDYA 3M2KA 3UDXA 2QJ7A 3PXPA 3PR6A 1K6SA 1DJCA 1DY6A 5CXWA 3AGEA 4NXFA 2XA7S 3E4PA 3Q7VB 4XUZA 4EERA 2VLGA 4IBRA 4WEJA 3NBLA 3IF6C 1FSWA 3WWXA 1P0ZA 3E0YA 1K57C 2KDKA 2HDSA 1H8MA 2ZMFA 4B9OA 5CERA 1DJAA 1BZAA 3DWKA 3L9KA 1N9NA 4RA7A 3FPVA 4ARZA 4BL3A 4HQAA 5HZHA 1FILA 4Y17A 2P9VA 1CF0A 4HEFA 1T1BA 4CQHA 5HFOA 1QMFA 5DTTA 3LYXA 3OOVA 1S4SA 3G2ZA 1K38A 4R3AA 4X1LA 4WZ5C 3LFVA 1TF1A 3B3XA 5CTMA 4NXEA 2W3HA 2ZC5B 5E2HA 2JKRM 5HWWA 4KG6A 2ZOIA 3NJAA 2G7UA 2J7VA 5E2EA 4Q0JA 3MXQA 5L2FA 1BT5A 3HVFA 2Y2OA 3SW1A 2JN7A 4HH2A 3LIEA 3TJZC 4R1GA 1D1JA 1GHIA 2P08A 1K0KA 1LL9A 4QD4A 1FCOA 2JKTM 3VOLA 5L07A 4KZ4A 1PIOA 3MZDA 4LV0A 4ID4A 4P87A 2Q9MA 2V1BA 4RVAA 4DN0A 4CLCA 5CGWA 2DNSA 3OLOA 2W1TB 3K3CA 1YLZA 5FEGA 2HP6A 5AJGA 3UE0A 4EQ1A 5KMWA 2HP9A 3IS2B 2JCHA 3F1OA 4BWIA 5A92A 1PWCA 1DJBA 4QWOA 1EROA 3MJQA 2ZQ9A 4CLCC 1PWDA 4IJGA 3PBSA 3NECA 1BUEA 2QWSA 1K55C 4IVIA 3QP1A 3G30A 4U0XA 2XK1A 3FZCA 3F1NB 3T50A 4X25A 5HAPA 3OPRA 3NOTC 3FKVA 3FYZA 4DXCA 4HESA 2JKGA 4KZAA 1XFQA 3KYQA 4HBTA 3BLMA 3IHAA 2V0UA 3EGXC 3BEBA 1W79A 4QY6A 3KSFA 4E3KA 4PPRA 4ETXA 3PBOA 2QYBA 3MS6A 3H9WA 4S2JA 3ZNTA 4Q0HA 2HPBA 4EBPA 3EQVA 2UWXA 4WBGA 1W8YA 5EV0A 3AGFA 4YNRA 2M7VA 3OPPA 3UPNA 4AFIA 5DKLA 2IWDA 2J3TD 3IBRA 4EEUA 2YKFA 4BLMA 3B42A 4XXRA 2H28A 1GA0A 1GCEA 4MBHA 1IYOA 5CRFA 4G3KA 4WMCA 1W7FA 3MKFA 4LENA 3Q81A 3O88A 3AGDA 2G2WA 2V1AA 5K5BA 4BD1A 4BD0A 3LI9A 5J4EA 4PAUA 2HZ5A 1DP9A 3B47A 3BYDA 4X69A 3R7WB 3HUOA 4BBTA 3BY8A 4YWZA 5F68A 5AQ9A 3UB5P 3DBAA 4CJNA 2ZC4B 2V8CA 3S4XA 3UDIA 3IF5A 4BBUA 1KGEA 3CAXA 4LRZE 3W4OA 2H0TA 3DAVA 3F1PA 1H3QA 4QPRA 4R70A 4GDNA 3ZYTA 3TG9A 2O0YA 1JNUA 5DTKA 2O9AA 1ZC2A 3JPUA 2HDQA 3S7PA 3C4OA 1LT0A 2XSSA 1YMXA 3EWKA
chains in the Genus database with same CATH topology
4DE3A 2HDRA 3UDFA 1BSGA 3GTCA 1KVMA 4E6XA 2J9OA 4GN2A 5FA7A 3IXHA 3C5AA 4LV1A 5F1FA 1FCMA 4JXWA 4WZ5A 3FKWA 3G2YA 4X55A 5FI6A 4EUZA 5CHMA 4FH2A 1GHMA 2Y55A 4DDSA 3VP4A 4Y0TA 3Q7ZA 1NY0A 5HARA 3G31A 1KVLA 2Y2QA 4PM6A 2JC7A 2Y2PA 1BLCA 4NK3A 4JF6A 3G4PA 1FOFA 4S2IA 3PBTA 3WS1A 3IXGA 5FASA 4E6WA 5CEDA 3SH8A 1FSYA 1MKIA 3RJUA 2HDUA 3A3FA 3IQAA 4JBFA 1Z6FA 3HLFA 3C4PA 3GV9A 3WS0A 2DCFA 3N7WA 5E2FA 3MKEA 2XDMA 3LY3A 1C3BA 3ZG5A 4B4ZA 3ITAA 4UHUA 3W4PA 3WS4A 3HLGA 5E43A 2H0YA 4F94A 3M6HA 4B4XA 3MBZA 4GZBA 3SH7A 1XXMA 1KE0A 3N4IA 4OOMA 1H8ZA 2X02A 1MBLA 4O7DA 4OOLA 4DF6A 5HAQA 1SHVA 3PBNA 2P74A 3QHYA 4A5RA 2JBFA 2ZC3B 1PI5A 1TVFA 1MWRA 1YLJA 1YLWA 3LO7A 3TSGA 4N1HA 3UN7A 1NXYA 5GLAA 4C6YA 1BLSA 3NIAA 4LV2A 2PBYA 4DE2A 1L0DA 2J9PA 3VOYA 2XFSA 3S22A 1G6AA 2ZMAA 1GA9A 2EX9A 4K0WA 2ZC6B 4GB7A 1M6KA 4S2LA 5CEBA 4ZDXA 1L0FA 4KQRA 3W8KA 3V39A 4JKTA 4QB8A 5HX9A 2OSUA 4MNRA 1LI0A 3RXWA 3HL9A 1N4OA 1KDSA 1PW8A 3VP0A 1NYMA 4EQIA 4FSFA 3IWIA 2R9WA 5FQMA 3HLBA 4D2OA 1K4EA 1YLYA 3G35A 3HBRA 4PM9A 2V1ZA 4QHCA 4E3LA 1IYSA 2ZC7A 3LY4A 4S2KA 5TFQA 2EFUA 1FQGA 2XD5A 1ESUA 1BULA 4OLGA 5KSCA 4PM8A 4P85A 1BLHA 3ZNYA 1LI9A 1PZPA 1YT4A 2VGJA 3VMAA 1CI8A 3BM6A 3MXSA 4KENB 4UAAA 2WGVA 1XA7A 2XQZA 3E2KA 3M2JA 4MBFA 1ZKJA 2IWCA 3SH9A 4X53A 3ZG0A 2EXAA 1U60A 5IHVA 1JTGA 3JYIA 4L0LA 4P6BA 5DF8A 2JE5A 3SS4A 2XLNA 2WGWB 1L2SA 4ZJ3A 1ERQA 2A49A 2EFXA 2HP5A 1JWZA 5EVLA 3SS3A 3ZGAB 3VP3A 1Q2PA 4DDYA 4PM5A 5F82A 3M2KA 3UDXA 1J9MA 3WRTA 3GSGA 1K6SA 1FR1A 1DJCA 1K55A 5EVIA 3ZG8B 3N6IA 1DY6A 4LV3A 2Z2LB 5CXWA 4E3MA 3AGEA 3V3SA 4C75A 4U3TA 1VQQA 4KG5A 5FSRA 1VM1A 4ZJ1A 3NI9A 3Q7VB 3BLSA 4FH4A 4N9LA 4XUZA 3ISGA 3NCKA 1HZOA 4S2NA 1WYBA 5U47A 2EX6A 3BFCA 3BRMA 4UA7A 1IELA 4IBRA 4KZ6A 5GLBA 3VSKA 1FCNA 4WEJA 1CI9A 3NBLA 3Q82A 3IF6C 2Y91A 4JXVA 3UO9A 5CHJA 1YLTA 1FSWA 3WWXA 4N9KA 2ZD8A 1K57C 3VFHA 1MPLA 3A3JA 1ES4A 2HDSA 2WZZA 4S2OA 5EVIC 5FI7A 3VP1A 4E3NA 1KE4A 3OC2A 4DRTA 5CERA 1DJAA 1ES3A 1SKFA 5A93A 1BZAA 3C7UA 3DWKA 4K91A 4XUXA 4RA7A 2WK0A 4BL3A 3VFFA 3N8RA 5DF7A 3VOZA 3BFDA 3NDEA 3IWQA 5KSHA 1FR6A 1MXOA 3OZHA 4S2NC 5JYPA 2WGIA 1JTDA 1PI4A 1KGFA 2P9VA 3HLEA 4HEFA 3N8SA 4GOGA 2Y2NA 5TR7A 2DRWA 4FCFA 2WKEA 1EWZA 4Q8IA 2ZQ7A 1I2SA 3DTMA 4WELA 3WS2A 3PBRA 4Z9QA 5HFOA 2ZJ9A 3S1YA 1QMFA 1K6RA 2XF3A 5M1AA 1XGJA 3O3VA 4OH0A 5DTTA 1NZUA 2E8IA 2OV5A 1ZG4A 2H5SA 3BECA 5GHZA 5AQBA 2V2FF 2WADA 4KZ7A 5BOHA 5FATA 3G2ZA 2FFFB 5GLDA 1K38A 4WZ5C 3ITBA 4BQMA 2BLSA 2Y2LA 3IH9A 3OCLA 3B3XA 5CTMA 4RX2A 2ZC5B 5E2HA 3G34A 1K54A 2Y2KA 3DWZA 4OP8A 1IKIA 2Y2IA 4KG6A 4EWFA 4X68A 1QMEA 5DF9A 4OPQA 2J7VA 5E2EA 5G18A 3OPLA 4OPZA 5DVAA 1YLPA 4P0MA 3UY6A 2Z2MB 3QNBA 5L2FA 1BT5A 3HREA 5FDHA 3HVFA 1WYCA 1I2WA 3RXXA 2OLUA 2Y2OA 3UNWA 1XX2A 1KGGA 4WZ4A 3IXDA 3DW0A 4R1GA 4JXGA 4UA9A 1GHIA 5TGFA 4JPMA 2QZ6A 1LL9A 5CGXA 3CG5A 4R0QA 2WYXA 3GVBA 2J8YA 1K54C 3MFDA 4R4SA 4QD4A 5EOOA 4E3OA 1YQSA 1FCOA 4Y7PA 4ZBEA 2EXBA 4GNUA 3IH8A 5A90A 4KZ4A 1PIOA 1O07A 1NYYA 3MZDA 4FD8A 4HBUA 4IVKA 4LV0A 4ID4A 3PTEA 2ZLYA 2Q9NA 2WKHA 4P87A 4KQOA 5CECA 2PU2A 4B88A 1PYYA 2Q9MA 1PWGA 2PU4A 3BFEA 3HLCA 3SS5A 3MXRA 4RVAA 1IEMA 5JYOA 4BL2A 4DE1A 5CGWA 3LCEA 2DNSA 1YMSA 2BG1A 4MLLA 5FQIA 1WE4A 2CC1A 1YLZA 2Y4AA 2ZQAA 3GR2A 3ZCZA 2HP6A 4H8RA 4JXSA 1CEFA 1CK3A 4GD6A 1XA1A 4OQIA 1RCJA 2ZM8A 3UE0A 1KDWA 3ZFZA 2HP9A 5I94A 5KMWA 3EQUA 3ZHHA 2JCHA 2WGWA 3MZFA 3NY4A 1SDEA 4KZ8A 1ALQA 2C5WB 4S2MA 5A92A 1PWCA 5EECA 4EBLA 4EBNA 1DJBA 1JVJA 1HVBA 1BTLA 3WS5A 1I5QA 1EROA 3OPHA 2ZQ9A 4OQGA 2IWBA 3IWOA 3HUNA 1PWDA 4Y0OA 4YFMA 2OLVA 3MZEA 4N1XA 2WZXA 1O7EA 1EI5A 3GMWA 3PBSA 1XPBA 5FQKA 4OONA 1BLPA 2WAFA 2Y2HA 3GQZA 1L0EA 1LLBA 3Q7VA 1BUEA 4ZTKA 1XGIA 2ZM0A 3A3EA 1K55C 4IVIA 4N92A 5F83A 4OP5A 2Y2MA 3G30A 1E3UD 4PM7A 2FFYA 3V5MA 4EV4A 1LL5A 5FQQA 3FV7A 3OCNA 1TDGA 3Q1FA 4OLDA 4OQHA 2G2UA 1HTZA 4WYYA 2ZM2A 1JWVA 4R3BA 4QU3A 4U0XA 5CTNA 1MWTA 3VP2A 1OMEA 3V50A 2XK1A 1AXBA 5J8XA 3FZCA 4YINA 1E25A 4WMCD 4OVDA 4KQQA 2X71A 3UPPA 3ZG9B 4OQ0A 1Q2QA 3TOIA 1ES5A 3WRZA 5HAPA 3OPRA 2ZQDA 1LHYA 4IBXA 4NETA 5GHYA 3FKVA 3FYZA 2C6WB 4GDBA 1RGZA 5FI2A 4E3IA 4DXCA 1IYQA 4HESA 4KZAA 4LCLA 3HLWA 2WKIA 1NRFA 4PMAA 1KE3A 4HBTA 3ZVWA 4CPKA 4JLFA 3BLMA 3IHAA 4RX3A 1NJ4A 3BEBA 1ONHA 2WUQA 2Y2JA 3PAEA 5HW3A 1K25A 2Y2GA 5FAOA 3A3DA 1W79A 3ZVTA 4QY6A 4BJPA 1PZOA 3P09A 4E3KA 1SDNA 1YM1A 1ERMA 4PPRA 1GHPA 3PBOA 1JWPA 2XR0A 1S0WA 3BFFA 4K0XA 4KZ5A 4OPRA 4C3QA 4S2JA 3NC8A 3ZNTA 2HPBA 5FQ9A 2ZQCA 3EQVA 4EBPA 2UWXA 4WBGA 3CMZA 4OKPA 4JF4A 4DE0A 3CJMA 1TEMA 4ZJ2A 2QMIA 1W8YA 3D4FA 1IYPA 3AGFA 3C7VA 3VSLA 5CHUA 4KZBA 5EVID 4KZ3A 2VGKA 4WEKA 1ZG6A 3OPPA 2A3UA 4OOYA 2XGNA 3UPNA 2WAEA 5DTSA 3P98A 5GL9A 1E3UA 1K56D 2IWDA 4UA6A 5A91A 3O87A 1TDLA 4GD8A 4E3JA 4BLMA 1ESIA 2RL3A 1NZOA 1RP5A 5F1GA 4XXRA 4X6TA 3IT9A 1E4DA 1XKZA 1GA0A 4R23A 1GCEA 4GKUA 1IYOA 4MBHA 4OPYA 5CRFA 3UE3A 2ZQ8A 1IKGA 2EX8A 4WMCA 1W7FA 3Q07A 3MKFA 4LENA 1RGYA 3Q81A 3O88A 3AGDA 1H5XA 1ONGA 1Y54A 4QY5A 2G2WA 4DXBA 5KZHA 4BD1A 4BD0A 3GRJA 5FQJA 4IEDA 1PW1A 4JF5A 4R4RA 2V20A 3V3RA 3PAGA 2QPNA 5EE8A 3ZG7B 4X69A 3BYDA 5AQ7A 2XD1A 4RYEA 1ES2A 4DKIA 5HAIA 4MEZA 4Y0UA 1SCWA 3HUOA 4QJGA 5M18A 2XFTA 3O86A 1MWUA 3IF6B 5GLCA 5D3OA 3I7JA 3M6BA 2EX2A 5M19A 4LCMA 1H8YA 3G32A 1HD8A 5HL1A 3IHBA 4U0TA 5EVIB 5FAQA 1MWSA 1MY8A 5AQ9A 4CJNA 1K4FA 2B5RA 3IF6A 5FAPA 2ZC4B 2R9XA 1G68A 3N8LA 3HLDA 1K57A 1M40A 4MBKA 3S4XA 1L0GA 3A3IA 3E2LA 3UDIA 3IF5A 2RCXA 1W8QA 2X01A 4KZ9A 4X56A 2XH9A 5EUAA 3UPOA 5CGSA 1K56A 1KGEA 3UE1A 3W4OA 2XEPA 2H0TA 3BFGA 2H10A 4BENA 1CEGA 4GDNA 2GDNA 3QNCA 5EOEA 5GHXA 3TG9A 3IXBA 4R3JA 5DTKA 3HUMA 2Y59A 5AQAA 3PBQA 1ZC2A 1XP4A 5EPHA 2HDQA 4M3KA 1W5DA 3C4OA 5E2GA 1N9BA 4WM9A 3ZDJA 4ZAMA 2I72A 4KG2A 3SOIA 4S2PA 3W4QA 3CZDA 1YMXA 3LEZA 3FWLA 3NDGA 2P9VB 1S6RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DE3 A;  2HDR A;  3UDF A;  1BSG A;  3GTC A;  1KVM A;  4E6X A;  2J9O A;  4GN2 A;  5FA7 A;  3IXH A;  3C5A A;  4LV1 A;  5F1F A;  1FCM A;  4JXW A;  4WZ5 A;  3FKW A;  3G2Y A;  4X55 A;  5FI6 A;  4EUZ A;  5CHM A;  4FH2 A;  1GHM A;  2Y55 A;  4DDS A;  3VP4 A;  4Y0T A;  3Q7Z A;  1NY0 A;  5HAR A;  3G31 A;  1KVL A;  2Y2Q A;  4PM6 A;  2JC7 A;  2Y2P A;  1BLC A;  4NK3 A;  4JF6 A;  3G4P A;  1FOF A;  4S2I A;  3PBT A;  3WS1 A;  3IXG A;  5FAS A;  4E6W A;  5CED A;  3SH8 A;  1FSY A;  1MKI A;  3RJU A;  2HDU A;  3A3F A;  3IQA A;  4JBF A;  1Z6F A;  3HLF A;  3C4P A;  3GV9 A;  3WS0 A;  2DCF A;  3N7W A;  5E2F A;  3MKE A;  2XDM A;  3LY3 A;  1C3B A;  3ZG5 A;  4B4Z A;  3ITA A;  4UHU A;  3W4P A;  3WS4 A;  3HLG A;  5E43 A;  2H0Y A;  4F94 A;  3M6H A;  4B4X A;  3MBZ A;  4GZB A;  3SH7 A;  1XXM A;  1KE0 A;  3N4I A;  4OOM A;  1H8Z A;  2X02 A;  1MBL A;  4O7D A;  4OOL A;  4DF6 A;  5HAQ A;  1SHV A;  3PBN A;  2P74 A;  3QHY A;  4A5R A;  2JBF A;  2ZC3 B;  1PI5 A;  1TVF A;  1MWR A;  1YLJ A;  1YLW A;  3LO7 A;  3TSG A;  4N1H A;  3UN7 A;  1NXY A;  5GLA A;  4C6Y A;  1BLS A;  3NIA A;  4LV2 A;  2PBY A;  4DE2 A;  1L0D A;  2J9P A;  3VOY A;  2XFS A;  3S22 A;  1G6A A;  2ZMA A;  1GA9 A;  2EX9 A;  4K0W A;  2ZC6 B;  4GB7 A;  1M6K A;  4S2L A;  5CEB A;  4ZDX A;  1L0F A;  4KQR A;  3W8K A;  3V39 A;  4JKT A;  4QB8 A;  5HX9 A;  2OSU A;  4MNR A;  1LI0 A;  3RXW A;  3HL9 A;  1N4O A;  1KDS A;  1PW8 A;  3VP0 A;  1NYM A;  4EQI A;  4FSF A;  3IWI A;  2R9W A;  5FQM A;  3HLB A;  4D2O A;  1K4E A;  1YLY A;  3G35 A;  3HBR A;  4PM9 A;  2V1Z A;  4QHC A;  4E3L A;  1IYS A;  2ZC7 A;  3LY4 A;  4S2K A;  5TFQ A;  2EFU A;  1FQG A;  2XD5 A;  1ESU A;  1BUL A;  4OLG A;  5KSC A;  4PM8 A;  4P85 A;  1BLH A;  3ZNY A;  1LI9 A;  1PZP A;  1YT4 A;  2VGJ A;  3VMA A;  1CI8 A;  3BM6 A;  3MXS A;  4KEN B;  4UAA A;  2WGV A;  1XA7 A;  2XQZ A;  3E2K A;  3M2J A;  4MBF A;  1ZKJ A;  2IWC A;  3SH9 A;  4X53 A;  3ZG0 A;  2EXA A;  1U60 A;  5IHV A;  1JTG A;  3JYI A;  4L0L A;  4P6B A;  5DF8 A;  2JE5 A;  3SS4 A;  2XLN A;  2WGW B;  1L2S A;  4ZJ3 A;  1ERQ A;  2A49 A;  2EFX A;  2HP5 A;  1JWZ A;  5EVL A;  3SS3 A;  3ZGA B;  3VP3 A;  1Q2P A;  4DDY A;  4PM5 A;  5F82 A;  3M2K A;  3UDX A;  1J9M A;  3WRT A;  3GSG A;  1K6S A;  1FR1 A;  1DJC A;  1K55 A;  5EVI A;  3ZG8 B;  3N6I A;  1DY6 A;  4LV3 A;  2Z2L B;  5CXW A;  4E3M A;  3AGE A;  3V3S A;  4C75 A;  4U3T A;  1VQQ A;  4KG5 A;  5FSR A;  1VM1 A;  4ZJ1 A;  3NI9 A;  3Q7V B;  3BLS A;  4FH4 A;  4N9L A;  4XUZ A;  3ISG A;  3NCK A;  1HZO A;  4S2N A;  1WYB A;  5U47 A;  2EX6 A;  3BFC A;  3BRM A;  4UA7 A;  1IEL A;  4IBR A;  4KZ6 A;  5GLB A;  3VSK A;  1FCN A;  4WEJ A;  1CI9 A;  3NBL A;  3Q82 A;  3IF6 C;  2Y91 A;  4JXV A;  3UO9 A;  5CHJ A;  1YLT A;  1FSW A;  3WWX A;  4N9K A;  2ZD8 A;  1K57 C;  3VFH A;  1MPL A;  3A3J A;  1ES4 A;  2HDS A;  2WZZ A;  4S2O A;  5EVI C;  5FI7 A;  3VP1 A;  4E3N A;  1KE4 A;  3OC2 A;  4DRT A;  5CER A;  1DJA A;  1ES3 A;  1SKF A;  5A93 A;  1BZA A;  3C7U A;  3DWK A;  4K91 A;  4XUX A;  4RA7 A;  2WK0 A;  4BL3 A;  3VFF A;  3N8R A;  5DF7 A;  3VOZ A;  3BFD A;  3NDE A;  3IWQ A;  5KSH A;  1FR6 A;  1MXO A;  3OZH A;  4S2N C;  5JYP A;  2WGI A;  1JTD A;  1PI4 A;  1KGF A;  2P9V A;  3HLE A;  4HEF A;  3N8S A;  4GOG A;  2Y2N A;  5TR7 A;  2DRW A;  4FCF A;  2WKE A;  1EWZ A;  4Q8I A;  2ZQ7 A;  1I2S A;  3DTM A;  4WEL A;  3WS2 A;  3PBR A;  4Z9Q A;  5HFO A;  2ZJ9 A;  3S1Y A;  1QMF A;  1K6R A;  2XF3 A;  5M1A A;  1XGJ A;  3O3V A;  4OH0 A;  5DTT A;  1NZU A;  2E8I A;  2OV5 A;  1ZG4 A;  2H5S A;  3BEC A;  5GHZ A;  5AQB A;  2V2F F;  2WAD A;  4KZ7 A;  5BOH A;  5FAT A;  3G2Z A;  2FFF B;  5GLD A;  1K38 A;  4WZ5 C;  3ITB A;  4BQM A;  2BLS A;  2Y2L A;  3IH9 A;  3OCL A;  3B3X A;  5CTM A;  4RX2 A;  2ZC5 B;  5E2H A;  3G34 A;  1K54 A;  2Y2K A;  3DWZ A;  4OP8 A;  1IKI A;  2Y2I A;  4KG6 A;  4EWF A;  4X68 A;  1QME A;  5DF9 A;  4OPQ A;  2J7V A;  5E2E A;  5G18 A;  3OPL A;  4OPZ A;  5DVA A;  1YLP A;  4P0M A;  3UY6 A;  2Z2M B;  3QNB A;  5L2F A;  1BT5 A;  3HRE A;  5FDH A;  3HVF A;  1WYC A;  1I2W A;  3RXX A;  2OLU A;  2Y2O A;  3UNW A;  1XX2 A;  1KGG A;  4WZ4 A;  3IXD A;  3DW0 A;  4R1G A;  4JXG A;  4UA9 A;  1GHI A;  5TGF A;  4JPM A;  2QZ6 A;  1LL9 A;  5CGX A;  3CG5 A;  4R0Q A;  2WYX A;  3GVB A;  2J8Y A;  1K54 C;  3MFD A;  4R4S A;  4QD4 A;  5EOO A;  4E3O A;  1YQS A;  1FCO A;  4Y7P A;  4ZBE A;  2EXB A;  4GNU A;  3IH8 A;  5A90 A;  4KZ4 A;  1PIO A;  1O07 A;  1NYY A;  3MZD A;  4FD8 A;  4HBU A;  4IVK A;  4LV0 A;  4ID4 A;  3PTE A;  2ZLY A;  2Q9N A;  2WKH A;  4P87 A;  4KQO A;  5CEC A;  2PU2 A;  4B88 A;  1PYY A;  2Q9M A;  1PWG A;  2PU4 A;  3BFE A;  3HLC A;  3SS5 A;  3MXR A;  4RVA A;  1IEM A;  5JYO A;  4BL2 A;  4DE1 A;  5CGW A;  3LCE A;  2DNS A;  1YMS A;  2BG1 A;  4MLL A;  5FQI A;  1WE4 A;  2CC1 A;  1YLZ A;  2Y4A A;  2ZQA A;  3GR2 A;  3ZCZ A;  2HP6 A;  4H8R A;  4JXS A;  1CEF A;  1CK3 A;  4GD6 A;  1XA1 A;  4OQI A;  1RCJ A;  2ZM8 A;  3UE0 A;  1KDW A;  3ZFZ A;  2HP9 A;  5I94 A;  5KMW A;  3EQU A;  3ZHH A;  2JCH A;  2WGW A;  3MZF A;  3NY4 A;  1SDE A;  4KZ8 A;  1ALQ A;  2C5W B;  4S2M A;  5A92 A;  1PWC A;  5EEC A;  4EBL A;  4EBN A;  1DJB A;  1JVJ A;  1HVB A;  1BTL A;  3WS5 A;  1I5Q A;  1ERO A;  3OPH A;  2ZQ9 A;  4OQG A;  2IWB A;  3IWO A;  3HUN A;  1PWD A;  4Y0O A;  4YFM A;  2OLV A;  3MZE A;  4N1X A;  2WZX A;  1O7E A;  1EI5 A;  3GMW A;  3PBS A;  1XPB A;  5FQK A;  4OON A;  1BLP A;  2WAF A;  2Y2H A;  3GQZ A;  1L0E A;  1LLB A;  3Q7V A;  1BUE A;  4ZTK A;  1XGI A;  2ZM0 A;  3A3E A;  1K55 C;  4IVI A;  4N92 A;  5F83 A;  4OP5 A;  2Y2M A;  3G30 A;  1E3U D;  4PM7 A;  2FFY A;  3V5M A;  4EV4 A;  1LL5 A;  5FQQ A;  3FV7 A;  3OCN A;  1TDG A;  3Q1F A;  4OLD A;  4OQH A;  2G2U A;  1HTZ A;  4WYY A;  2ZM2 A;  1JWV A;  4R3B A;  4QU3 A;  4U0X A;  5CTN A;  1MWT A;  3VP2 A;  1OME A;  3V50 A;  2XK1 A;  1AXB A;  5J8X A;  3FZC A;  4YIN A;  1E25 A;  4WMC D;  4OVD A;  4KQQ A;  2X71 A;  3UPP A;  3ZG9 B;  4OQ0 A;  1Q2Q A;  3TOI A;  1ES5 A;  3WRZ A;  5HAP A;  3OPR A;  2ZQD A;  1LHY A;  4IBX A;  4NET A;  5GHY A;  3FKV A;  3FYZ A;  2C6W B;  4GDB A;  1RGZ A;  5FI2 A;  4E3I A;  4DXC A;  1IYQ A;  4HES A;  4KZA A;  4LCL A;  3HLW A;  2WKI A;  1NRF A;  4PMA A;  1KE3 A;  4HBT A;  3ZVW A;  4CPK A;  4JLF A;  3BLM A;  3IHA A;  4RX3 A;  1NJ4 A;  3BEB A;  1ONH A;  2WUQ A;  2Y2J A;  3PAE A;  5HW3 A;  1K25 A;  2Y2G A;  5FAO A;  3A3D A;  1W79 A;  3ZVT A;  4QY6 A;  4BJP A;  1PZO A;  3P09 A;  4E3K A;  1SDN A;  1YM1 A;  1ERM A;  4PPR A;  1GHP A;  3PBO A;  1JWP A;  2XR0 A;  1S0W A;  3BFF A;  4K0X A;  4KZ5 A;  4OPR A;  4C3Q A;  4S2J A;  3NC8 A;  3ZNT A;  2HPB A;  5FQ9 A;  2ZQC A;  3EQV A;  4EBP A;  2UWX A;  4WBG A;  3CMZ A;  4OKP A;  4JF4 A;  4DE0 A;  3CJM A;  1TEM A;  4ZJ2 A;  2QMI A;  1W8Y A;  3D4F A;  1IYP A;  3AGF A;  3C7V A;  3VSL A;  5CHU A;  4KZB A;  5EVI D;  4KZ3 A;  2VGK A;  4WEK A;  1ZG6 A;  3OPP A;  2A3U A;  4OOY A;  2XGN A;  3UPN A;  2WAE A;  5DTS A;  3P98 A;  5GL9 A;  1E3U A;  1K56 D;  2IWD A;  4UA6 A;  5A91 A;  3O87 A;  1TDL A;  4GD8 A;  4E3J A;  4BLM A;  1ESI A;  2RL3 A;  1NZO A;  1RP5 A;  5F1G A;  4XXR A;  4X6T A;  3IT9 A;  1E4D A;  1XKZ A;  1GA0 A;  4R23 A;  1GCE A;  4GKU A;  1IYO A;  4MBH A;  4OPY A;  5CRF A;  3UE3 A;  2ZQ8 A;  1IKG A;  2EX8 A;  4WMC A;  1W7F A;  3Q07 A;  3MKF A;  4LEN A;  1RGY A;  3Q81 A;  3O88 A;  3AGD A;  1H5X A;  1ONG A;  1Y54 A;  4QY5 A;  2G2W A;  4DXB A;  5KZH A;  4BD1 A;  4BD0 A;  3GRJ A;  5FQJ A;  4IED A;  1PW1 A;  4JF5 A;  4R4R A;  2V20 A;  3V3R A;  3PAG A;  2QPN A;  5EE8 A;  3ZG7 B;  4X69 A;  3BYD A;  5AQ7 A;  2XD1 A;  4RYE A;  1ES2 A;  4DKI A;  5HAI A;  4MEZ A;  4Y0U A;  1SCW A;  3HUO A;  4QJG A;  5M18 A;  2XFT A;  3O86 A;  1MWU A;  3IF6 B;  5GLC A;  5D3O A;  3I7J A;  3M6B A;  2EX2 A;  5M19 A;  4LCM A;  1H8Y A;  3G32 A;  1HD8 A;  5HL1 A;  3IHB A;  4U0T A;  5EVI B;  5FAQ A;  1MWS A;  1MY8 A;  5AQ9 A;  4CJN A;  1K4F A;  2B5R A;  3IF6 A;  5FAP A;  2ZC4 B;  2R9X A;  1G68 A;  3N8L A;  3HLD A;  1K57 A;  1M40 A;  4MBK A;  3S4X A;  1L0G A;  3A3I A;  3E2L A;  3UDI A;  3IF5 A;  2RCX A;  1W8Q A;  2X01 A;  4KZ9 A;  4X56 A;  2XH9 A;  5EUA A;  3UPO A;  5CGS A;  1K56 A;  1KGE A;  3UE1 A;  3W4O A;  2XEP A;  2H0T A;  3BFG A;  2H10 A;  4BEN A;  1CEG A;  4GDN A;  2GDN A;  3QNC A;  5EOE A;  5GHX A;  3TG9 A;  3IXB A;  4R3J A;  5DTK A;  3HUM A;  2Y59 A;  5AQA A;  3PBQ A;  1ZC2 A;  1XP4 A;  5EPH A;  2HDQ A;  4M3K A;  1W5D A;  3C4O A;  5E2G A;  1N9B A;  4WM9 A;  3ZDJ A;  4ZAM A;  2I72 A;  4KG2 A;  3SOI A;  4S2P A;  3W4Q A;  3CZD A;  1YMX A;  3LEZ A;  3FWL A;  3NDG A;  2P9V B;  1S6R A; 
#chains in the Genus database with same CATH topology
 4DE3 A;  2HDR A;  2AVX A;  4E6X A;  5HL6 A;  5FA7 A;  3C5A A;  2A24 A;  3CWF A;  4MCW A;  1GHM A;  1V9Y A;  2Y55 A;  4ZRR A;  5HDC A;  3VP4 A;  2A2L A;  5HAR A;  4XT2 A;  1KVL A;  5IT5 A;  2BAS A;  3G4P A;  4S2I A;  3PBT A;  5I5L A;  3WS1 A;  2W0N A;  3C2W A;  5CED A;  1FSY A;  3RJU A;  2HDU A;  3A3F A;  4P6Z S;  3MKE A;  1A0K A;  4B4Z A;  3ITA A;  4UHU A;  5E43 A;  4F94 A;  4OOM A;  3V67 A;  2P74 A;  3O5Y A;  3QHY A;  2JBF A;  1VHM A;  3A0V A;  5FEF A;  5GLA A;  3QP5 A;  3NIA A;  4HJ4 A;  3K2N A;  2J9P A;  1YSP A;  3LI8 A;  2EX9 A;  4GJ4 A;  5CEB A;  1M6K A;  4S2L A;  2O9B A;  3V39 A;  2D02 A;  5DFY A;  4L9E A;  2OSU A;  3T4Q A;  1OTA A;  2XRO A;  2L1M A;  2W3F A;  4EW7 A;  5EVE A;  1VB6 A;  1NYM A;  2R9W A;  5FQM A;  1K4E A;  2PT7 A;  4S2K A;  4OLG A;  2QKP A;  4P85 A;  5HWV A;  4I3J A;  3MXS A;  3GEC A;  1XA7 A;  3M2J A;  2IWC A;  3ZG0 A;  3LR4 A;  1Y4O A;  5IHV A;  5DF8 A;  3D3O A;  3D9Y A;  4ZJ3 A;  3JVU A;  2A49 A;  2EFX A;  1JWZ A;  1Q2P A;  4NG2 A;  1J9M A;  3GSG A;  5EVI A;  5FL3 A;  4LV3 A;  2VEA A;  3V3S A;  3S7Q A;  5FSR A;  4KG5 A;  5J7E A;  4ZJ1 A;  4FUW A;  1CJF A;  2Q0O A;  4S2N A;  5U47 A;  3BFC A;  3VSK A;  4EQI A;  1FCN A;  3Q82 A;  2Y91 A;  3UO9 A;  1UWP X;  2LB9 A;  2ZD8 A;  5EVI C;  1J3W A;  3VP1 A;  1ES3 A;  4WLA A;  3BFD A;  3NDE A;  1FR6 A;  1MXO A;  3LR0 A;  4S2N C;  1PI4 A;  3HLE A;  4FCF A;  2WKE A;  1EWZ A;  4Q8I A;  4Z9Q A;  2XF3 A;  3KO6 A;  1IOU A;  4OH0 A;  1GSX A;  4Y3I A;  4P6Z M;  1ODV A;  3LIF A;  3LIA A;  5AVF A;  5AQB A;  2WAD A;  4KZ7 A;  4GS9 B;  2FFF B;  3U4L P;  4X1M A;  3ITB A;  4LRY C;  4BQM A;  4MN6 A;  4RX2 A;  1NLZ A;  3G34 A;  1KOU A;  1IKI A;  2Y2I A;  5DVA A;  4OPZ A;  1YLP A;  2Z6D A;  2V9A A;  3UY6 A;  4B93 A;  1ACF A;  5FDH A;  4DJ2 A;  3RXX A;  2OLU A;  3IXD A;  4JPM A;  2QZ6 A;  2WYX A;  3GVB A;  4E3O A;  4Y7P A;  3IH8 A;  5A90 A;  4YOF A;  1O07 A;  4HBU A;  2ZLY A;  2WKH A;  1STZ A;  4KQO A;  3HLC A;  4MN5 A;  3C8C A;  3SS5 A;  2OWJ A;  4F3L A;  4PKY A;  2BG1 A;  3K3D A;  5FQI A;  3GR2 A;  2GNX A;  1XA1 A;  4OQI A;  3ZFZ A;  1KDW A;  4FTX A;  3ZHH A;  3MZF A;  1SDE A;  1JVJ A;  1BTL A;  3WS5 A;  5HSQ A;  4YFM A;  2OLV A;  1O7E A;  3BW6 A;  4K08 A;  1BLP A;  4OON A;  2WAF A;  3C30 A;  4EU0 A;  1UWN X;  1XGI A;  3KYE A;  4N92 A;  1WA9 A;  1E3U D;  2VGL S;  4EV4 A;  5FQQ A;  3FV7 A;  2W3D A;  3OCN A;  4OLD A;  4OQH A;  4WYY A;  2ZM2 A;  1DP6 A;  4QU3 A;  1MWT A;  4GCZ A;  3C38 A;  3E4Q A;  1E25 A;  5F6A A;  1D7E A;  3ZG9 B;  1Q2Q A;  1ES5 A;  4BBV A;  5HPI A;  2C6W B;  1RGZ A;  2O9C A;  3HLW A;  1XJ4 A;  2WKI A;  1DRM A;  4NKP A;  4RX3 A;  3UB9 A;  3EGD C;  3PAE A;  5HW3 A;  2PD8 A;  2Y2G A;  5HDD A;  3JVV A;  4R6L A;  1SDN A;  1YM1 A;  1GHP A;  1JWP A;  4I3A A;  3T12 B;  2ZQC A;  4JGR A;  3CJM A;  4ZJ2 A;  3CIT A;  3PYP A;  3CLO A;  1SKO B;  3T1R A;  2VGK A;  4LRX C;  4WEK A;  5TBM A;  4EWF A;  5DTS A;  5A91 A;  3P98 A;  1OTE A;  3CPT B;  4GD8 A;  5EFW A;  2RL3 A;  1RP5 A;  4UEY A;  4X6T A;  3IT9 A;  2FH5 A;  3UME A;  1VET A;  2ZQ8 A;  2VKS A;  4GLQ A;  4G3V A;  2W3E A;  1Y54 A;  4DXB A;  5KZH A;  4WN5 A;  1PW1 A;  3UB6 A;  1XFN A;  1GSW A;  4R4R A;  2M1C A;  2ACG A;  2QPN A;  4H6J A;  3T4K A;  3ZG7 B;  4UQI S;  2XD1 A;  4DKI A;  5HAI A;  2PRF A;  3VE4 A;  4QJG A;  5M18 A;  3IF6 B;  3I7J A;  1H8Y A;  2XA7 M;  3IHB A;  4U0T A;  3MFX A;  3VV4 A;  1K4F A;  5FAP A;  2R9X A;  2GX5 A;  3HLD A;  1M40 A;  2PBD P;  2RCX A;  2W27 A;  1TD5 A;  3UE1 A;  4EXO A;  2VGL M;  2YKH A;  3IXB A;  2WKQ A;  5AQA A;  5IU1 A;  4KQD A;  4NXB A;  4ARZ B;  3NOU C;  1N9B A;  4WM9 A;  2I72 A;  4KG2 A;  2QJ5 A;  3CZD A;  2ZBB A;  3LEZ A;  3FWL A;  2P9V B;  3UDF A;  1BSG A;  4JXW A;  3FKW A;  1UGU A;  4X55 A;  4EUZ A;  5CHM A;  4FH2 A;  4DDS A;  1W63 M;  3T1S A;  2JC7 A;  2Y2P A;  4NK3 A;  1P9W A;  1FOF A;  4E6W A;  1GSV A;  1MKI A;  4CLC D;  4JBF A;  3HLF A;  3C4P A;  3BJN A;  4G3W A;  2DCF A;  3N7W A;  5E2F A;  3LY3 A;  3ZG5 A;  3W4P A;  3HLG A;  3M6H A;  3MBZ A;  4GZB A;  3SH7 A;  1XXM A;  4DF6 A;  2MJ6 A;  1OPX A;  2ZC3 B;  1YLJ A;  1NXY A;  1BLS A;  4LV2 A;  4II7 A;  2PBY A;  4DE2 A;  3T4L A;  3S22 A;  4K0W A;  4GB7 A;  5KIZ A;  1H0M A;  4HHD A;  1VEU A;  5FDS A;  1LI0 A;  1N4O A;  4FSF A;  4WUJ A;  2J3W A;  3HLB A;  1YLY A;  3IX3 A;  1HLU P;  2V1Z A;  4E3L A;  1BUL A;  3EEA A;  1F9I A;  4CLC B;  3HCY A;  1BLH A;  1YT4 A;  4LLO B;  3E2K A;  1ZKJ A;  2L4R A;  4P6B A;  2JE5 A;  2XLN A;  1T18 A;  3F1O B;  2B95 A;  2HP5 A;  5EVL A;  3H7W A;  1S4R A;  5F82 A;  3WRT A;  1FR1 A;  3ZG8 B;  3N6I A;  2KOI A;  4MMN A;  4U3T A;  3EEH A;  3NI9 A;  3BLS A;  4FH4 A;  4EES A;  3ISG A;  3NCK A;  1HZO A;  3FC7 A;  2EX6 A;  2PDR A;  4KZ6 A;  2XRN A;  4IUH A;  1CI9 A;  4GHI A;  4JXV A;  2L0W A;  5CHJ A;  1YLT A;  2W3G A;  4N9K A;  3E98 A;  2VK3 A;  1ES4 A;  4S2O A;  5FI7 A;  1W63 Q;  4DRT A;  2IA2 A;  4R38 A;  4K91 A;  3QP4 A;  4XUX A;  3VFF A;  3N8R A;  3VOZ A;  3IWQ A;  3OZH A;  2WGI A;  2KX6 A;  3PHY A;  3P01 A;  2DRW A;  4CLC E;  1I2S A;  3DTM A;  1OTI A;  3WS2 A;  2ZJ9 A;  3S1Y A;  1K6R A;  5M1A A;  1XGJ A;  3O3V A;  1OTB A;  1S1Z A;  3G6O A;  2OV5 A;  2H5S A;  5G4Y A;  5GHZ A;  2PAV P;  5DKK A;  5BOH A;  5FAT A;  3T1X A;  2Y2K A;  4OP8 A;  2ZL1 A;  4X68 A;  1Z09 A;  1QME A;  3OPL A;  2Z2M B;  3QNB A;  4RQ9 A;  5L10 A;  3HRE A;  1V9Z A;  3BY9 A;  1WYC A;  1I2W A;  3RTY A;  1KGG A;  3DW0 A;  3T4J A;  3DTK A;  4JXG A;  5TGF A;  3T4S A;  4EUV A;  1P97 A;  4R4S A;  3MFD A;  5HWT A;  1YQS A;  2Z6C A;  4Z1W A;  4IVK A;  4FD8 A;  2Q9N A;  1PRQ A;  5HD5 A;  3UMD A;  5CEC A;  2PU2 A;  1CQA A;  1PYY A;  1YPR A;  1PWG A;  3BFE A;  1IEM A;  3H82 A;  4BL2 A;  3W2Z A;  1YMS A;  1F98 A;  2Y4A A;  1F5M A;  4H8R A;  4JXS A;  1CEF A;  1CK3 A;  2ZM8 A;  3QP8 A;  5I94 A;  2PD7 A;  3EQU A;  2WGW A;  2B02 A;  1ALQ A;  2C5W B;  4EBL A;  4EBN A;  2EA9 A;  1I5Q A;  3OPH A;  4OQG A;  4E04 A;  3IWO A;  4Y0O A;  3MZE A;  4N1X A;  2WZX A;  1EI5 A;  3GMW A;  3F1P B;  1XPB A;  5FQK A;  1YSQ A;  2Y2H A;  1L0E A;  1LLB A;  3Q7V A;  4ZTK A;  2JHE A;  3A3E A;  2Y2M A;  3TRC A;  1TDG A;  2HGV A;  2VX8 A;  2R78 A;  3VP2 A;  1OME A;  3V50 A;  1AXB A;  2KLI A;  4YIN A;  4Y15 A;  3UPP A;  2A24 B;  1TS8 A;  5GHY A;  4XT2 B;  4DMZ A;  5A8B A;  3HJI A;  4EEP A;  4E3I A;  1NRF A;  1KE3 A;  4CPK A;  1NJ4 A;  4LPZ A;  1ONH A;  2WUQ A;  2Y2J A;  2EWV A;  2EWW A;  4D60 A;  3A3D A;  4BJP A;  1PZO A;  1XJ3 A;  3P09 A;  3TW8 A;  4K0X A;  3NC8 A;  5DJU A;  5LBR A;  3CMZ A;  3KSI A;  4JF4 A;  4DE0 A;  2QMI A;  3D4F A;  3QP6 A;  1BYW A;  3C7V A;  3VSL A;  5CHU A;  4KZB A;  5EVI D;  5TJJ A;  4KZ3 A;  4OOY A;  1E3U A;  1K56 D;  5L8M A;  3ZQ5 A;  4E3J A;  1ESI A;  4LGW A;  2VV8 A;  1E4D A;  1XJ6 A;  4GKU A;  4OPY A;  3Q07 A;  1RGY A;  1ONG A;  4QY5 A;  3MQO A;  3BWL A;  5FQJ A;  2E8J A;  4WF0 A;  4JF5 A;  2V20 A;  3V3R A;  1S67 L;  3PAG A;  5EE8 A;  4RYE A;  1ES2 A;  4MEZ A;  4Y0U A;  1SCW A;  3O86 A;  2W1T A;  5GLC A;  5D3O A;  4HH3 A;  1ZHH B;  3M6B A;  2EX2 A;  5M19 A;  3G32 A;  1HD8 A;  5EVI B;  5FAQ A;  3S7O A;  3MF0 A;  1MWS A;  1MY8 A;  3IS2 A;  1P9R A;  3IF6 A;  1K57 A;  1L0G A;  1IFQ A;  5DJT A;  1W8Q A;  2HF6 A;  2X01 A;  2XH9 A;  3UPO A;  5CGS A;  2XEP A;  2LB5 A;  3BFG A;  3GDI A;  2H10 A;  1CEG A;  3QNC A;  3CHW P;  4R3J A;  4ESP A;  3A0R A;  3L7H A;  2HJE A;  3PBQ A;  1XP4 A;  2INW A;  5EPH A;  4M3K A;  1W5D A;  1NWZ A;  2O99 A;  3W4Q A;  1T1A A;  3NDG A;  3ICY A;  3F1N A;  2J9O A;  1LSW A;  4LV1 A;  1FCM A;  4WZ5 A;  5DFX A;  5FI6 A;  2PR5 A;  3IBJ A;  3Q7Z A;  3G31 A;  4PM6 A;  1BLC A;  4L9F A;  5FAS A;  4IUK A;  4Y5F A;  2M7U A;  3IQA A;  1L3L A;  3WS0 A;  3EOI A;  3NUL A;  1LL8 A;  2XDM A;  5HDS A;  4B4X A;  1KE0 A;  3N4I A;  5F69 A;  4O7D A;  3PBN A;  4A5R A;  1TVF A;  5CX7 A;  3LO7 A;  4N1H A;  4C6Y A;  4O8G A;  3B33 A;  4HI4 A;  5MC7 A;  1L0F A;  4LFU A;  3W8K A;  2NUT C;  4MNR A;  3RXW A;  3LGO A;  1KDS A;  1PW8 A;  2OAP 1;  2VA0 A;  2W1R A;  3IWI A;  5J3W A;  1LSV A;  3HBR A;  4PM9 A;  4QHC A;  5TFQ A;  3LY4 A;  2WKR A;  3T4O A;  2EFU A;  1FQG A;  1ESU A;  4F3L B;  4I3I A;  3ZNY A;  3VMA A;  1CI8 A;  4KEN B;  4UAA A;  2XQZ A;  3SH9 A;  4BMW A;  4X53 A;  2EXA A;  2UV0 E;  1JTG A;  4L0L A;  4ME4 A;  3R7W A;  1L2S A;  3NHQ A;  3SS3 A;  3VP3 A;  4PM5 A;  3QP2 A;  1MZU A;  1K55 A;  4HP4 A;  3IX8 A;  4KUK A;  4DJ3 A;  2Z2L B;  4NEE D;  4E3M A;  4C75 A;  1VQQ A;  2GJ3 A;  1VM1 A;  4N9L A;  1WYB A;  3BRM A;  4UA7 A;  5GLB A;  1IEL A;  1EW0 A;  3U2A A;  1N9O A;  4WL9 A;  5G4Z A;  4Y13 A;  2QHK A;  1OT6 A;  1NLY A;  3VFH A;  1D06 A;  1MPL A;  3LID A;  2BTF P;  3A3J A;  4M4X A;  2WZZ A;  4E3N A;  1KE4 A;  3OC2 A;  1SKF A;  2J3T C;  4GW9 A;  5A93 A;  3C7U A;  2PHY A;  4HIA A;  2WK0 A;  4I5S A;  1OJG A;  3LR5 A;  5DF7 A;  3D72 A;  3MQ0 A;  5KSH A;  3A0S A;  3DTE A;  5JYP A;  1JTD A;  1KGF A;  2DMW A;  3N8S A;  4GOG A;  4EET B;  2Y2N A;  1DP8 A;  5TR7 A;  2ZQ7 A;  1LSX A;  4WEL A;  3PBR A;  3FPW A;  1NZU A;  2B18 A;  2E8I A;  2JKR I;  1ZG4 A;  4JGO A;  4L9G A;  3BEC A;  3BQ8 A;  2V2F F;  2ZOH A;  5GLD A;  1T1C A;  3DTI A;  5HPF A;  2BLS A;  2Y2L A;  3IH9 A;  1TS6 A;  2P04 A;  3OCL A;  1K54 A;  3DWZ A;  2V8F A;  2J80 A;  3RH8 B;  5DF9 A;  4OPQ A;  5G18 A;  5TBM B;  4P0M A;  4MN7 A;  2ZMV A;  2JKT I;  3UNW A;  1XX2 A;  4WZ4 A;  2V0W A;  4UA9 A;  2OWH A;  5CGX A;  3CG5 A;  1VET B;  3R4K A;  4R0Q A;  5EOO A;  2J8Y A;  1K54 C;  4JGQ A;  1ZTU A;  4ZBE A;  2EXB A;  2JKF A;  5EM0 A;  4GNU A;  4UQI M;  1X0O A;  1NYY A;  3PTE A;  5EM1 A;  5F5Y A;  4B88 A;  4H6J B;  2PU4 A;  3MXR A;  5JYO A;  4DE1 A;  3LCE A;  2OAQ 1;  4JGP A;  4MLL A;  1WE4 A;  2CC1 A;  2ZQA A;  3RFB A;  4KUO A;  2VV6 A;  3ZCZ A;  3LIB A;  4GD6 A;  1RCJ A;  3NY4 A;  4KZ8 A;  2HJ9 C;  4S2M A;  5EEC A;  4O01 A;  4PHT A;  1HVB A;  4PKY G;  2IWB A;  3KX0 X;  1TS7 A;  4NXG A;  1FIK A;  3GQZ A;  3FG8 A;  1PNE A;  2VV7 A;  2ZM0 A;  3MR0 A;  5F83 A;  3MQQ A;  1G5U A;  4OP5 A;  4PM7 A;  2FFY A;  3V5M A;  1AWI A;  1LL5 A;  3Q1F A;  2G2U A;  1PFL A;  1HTZ A;  1JWV A;  4R3B A;  5CTN A;  1OTD A;  5J8X A;  4WMC D;  4OVD A;  4KQQ A;  2X71 A;  5HD3 A;  4OQ0 A;  3TOI A;  3WRZ A;  2ZQD A;  1LHY A;  4IBX A;  4NET A;  4FOF A;  4GDB A;  5FI2 A;  2PR6 A;  1IYQ A;  4LCL A;  4PMA A;  3ZVW A;  4JLF A;  1K25 A;  1OT9 A;  5FAO A;  3ZVT A;  1TS0 A;  2VJW A;  5AVE A;  1ERM A;  3MSH A;  4OPR A;  1G28 A;  1S0W A;  2XR0 A;  3BFF A;  4GS9 A;  4KZ5 A;  4C3Q A;  1S66 L;  5FQ9 A;  4OKP A;  1TEM A;  1IYP A;  3VE3 A;  4ETZ A;  1ZG6 A;  2A3U A;  2XGN A;  2WAE A;  5GL9 A;  2HV1 A;  4UA6 A;  2I9V A;  3O87 A;  1TDL A;  1VEU B;  3UB7 A;  4O0P A;  2K7S A;  1NZO A;  2WKP A;  5F1G A;  4I39 A;  1XKZ A;  2GZA A;  1NRJ A;  4R23 A;  2NUP C;  3UE3 A;  5IS1 A;  1IKG A;  2EX8 A;  2Y8H A;  1H5X A;  3MMH A;  3P7N A;  2PYR A;  3GRJ A;  2OOL A;  4IED A;  3KSH A;  1YKD A;  2VZW A;  1SZV A;  1G6O A;  5AQ7 A;  4IHQ A;  2XFT A;  1MWU A;  4HY8 A;  3H7W B;  4LCM A;  2Y79 A;  5HL1 A;  4I38 A;  3ULF A;  2B5R A;  1G68 A;  3KSG A;  3KYZ A;  4Y2F A;  3N8L A;  4MBK A;  3A3I A;  3SZT A;  3LIC A;  3E2L A;  2K31 A;  3LR3 A;  4KZ9 A;  4X56 A;  5EUA A;  3CUE A;  1K56 A;  4GHI B;  3LUQ A;  4BEN A;  2GDN A;  5EOE A;  5GHX A;  3HUM A;  4HNB A;  2Y59 A;  3S7N A;  2K2N A;  5E2G A;  3ZDJ A;  4ZAM A;  3SOI A;  4S2P A;  5C5K A;  3HUN A;  3CUE C;  1S6R A;  3GTC A;  3BQA A;  1KVM A;  3OBF A;  3LEQ A;  4GN2 A;  2CMN A;  5F1F A;  3IXH A;  1OJ5 A;  2FZ0 A;  3G2Y A;  1N9L A;  3UB8 A;  4Y0T A;  1NY0 A;  2Y2Q A;  4JF6 A;  1T19 A;  3TE8 A;  1F2K A;  3IXG A;  4MDZ A;  3SH8 A;  1Z6F A;  3GV9 A;  3UE6 A;  3T1Q B;  1C3B A;  2ZL1 B;  3NOP C;  3WS4 A;  2H0Y A;  1H8Z A;  2X02 A;  1MBL A;  4OOL A;  1XJ2 A;  5HAQ A;  1SHV A;  1MC0 A;  3IX4 A;  1PI5 A;  1MWR A;  1YAX A;  1YLW A;  3TSG A;  3UN7 A;  4Q0I A;  4HP9 A;  1L0D A;  3VOY A;  2XFS A;  5L09 A;  1G6A A;  2P7J A;  2ZMA A;  1GA9 A;  1SKO A;  2ZC6 B;  4ZDX A;  4HJ3 A;  4KQR A;  4JKT A;  4QB8 A;  3CPT A;  5HX9 A;  1Y28 A;  3HL9 A;  4HJ6 A;  3E4O A;  3VP0 A;  4D2O A;  3HJK A;  3G35 A;  1IYS A;  2ZC7 A;  3CI6 A;  2XD5 A;  3H82 B;  5KSC A;  4PM8 A;  1LI9 A;  1PZP A;  2VGJ A;  3BM6 A;  2WGV A;  4MBF A;  2D01 A;  1S1Y A;  1U60 A;  4HOI A;  3JYI A;  3SS4 A;  2PYP A;  2WGW B;  3T4T A;  1MKM A;  1ERQ A;  3ZGA B;  4DDY A;  3M2K A;  3UDX A;  2QJ7 A;  3PXP A;  3PR6 A;  1K6S A;  1DJC A;  1DY6 A;  5CXW A;  3AGE A;  4NXF A;  2XA7 S;  3E4P A;  3Q7V B;  4XUZ A;  4EER A;  2VLG A;  4IBR A;  4WEJ A;  3NBL A;  3IF6 C;  1FSW A;  3WWX A;  1P0Z A;  3E0Y A;  1K57 C;  2KDK A;  2HDS A;  1H8M A;  2ZMF A;  4B9O A;  5CER A;  1DJA A;  1BZA A;  3DWK A;  3L9K A;  1N9N A;  4RA7 A;  3FPV A;  4ARZ A;  4BL3 A;  4HQA A;  5HZH A;  1FIL A;  4Y17 A;  2P9V A;  1CF0 A;  4HEF A;  1T1B A;  4CQH A;  5HFO A;  1QMF A;  5DTT A;  3LYX A;  3OOV A;  1S4S A;  3G2Z A;  1K38 A;  4R3A A;  4X1L A;  4WZ5 C;  3LFV A;  1TF1 A;  3B3X A;  5CTM A;  4NXE A;  2W3H A;  2ZC5 B;  5E2H A;  2JKR M;  5HWW A;  4KG6 A;  2ZOI A;  3NJA A;  2G7U A;  2J7V A;  5E2E A;  4Q0J A;  3MXQ A;  5L2F A;  1BT5 A;  3HVF A;  2Y2O A;  3SW1 A;  2JN7 A;  4HH2 A;  3LIE A;  3TJZ C;  4R1G A;  1D1J A;  1GHI A;  2P08 A;  1K0K A;  1LL9 A;  4QD4 A;  1FCO A;  2JKT M;  3VOL A;  5L07 A;  4KZ4 A;  1PIO A;  3MZD A;  4LV0 A;  4ID4 A;  4P87 A;  2Q9M A;  2V1B A;  4RVA A;  4DN0 A;  4CLC A;  5CGW A;  2DNS A;  3OLO A;  2W1T B;  3K3C A;  1YLZ A;  5FEG A;  2HP6 A;  5AJG A;  3UE0 A;  4EQ1 A;  5KMW A;  2HP9 A;  3IS2 B;  2JCH A;  3F1O A;  4BWI A;  5A92 A;  1PWC A;  1DJB A;  4QWO A;  1ERO A;  3MJQ A;  2ZQ9 A;  4CLC C;  1PWD A;  4IJG A;  3PBS A;  3NEC A;  1BUE A;  2QWS A;  1K55 C;  4IVI A;  3QP1 A;  3G30 A;  4U0X A;  2XK1 A;  3FZC A;  3F1N B;  3T50 A;  4X25 A;  5HAP A;  3OPR A;  3NOT C;  3FKV A;  3FYZ A;  4DXC A;  4HES A;  2JKG A;  4KZA A;  1XFQ A;  3KYQ A;  4HBT A;  3BLM A;  3IHA A;  2V0U A;  3EGX C;  3BEB A;  1W79 A;  4QY6 A;  3KSF A;  4E3K A;  4PPR A;  4ETX A;  3PBO A;  2QYB A;  3MS6 A;  3H9W A;  4S2J A;  3ZNT A;  4Q0H A;  2HPB A;  4EBP A;  3EQV A;  2UWX A;  4WBG A;  1W8Y A;  5EV0 A;  3AGF A;  4YNR A;  2M7V A;  3OPP A;  3UPN A;  4AFI A;  5DKL A;  2IWD A;  2J3T D;  3IBR A;  4EEU A;  2YKF A;  4BLM A;  3B42 A;  4XXR A;  2H28 A;  1GA0 A;  1GCE A;  4MBH A;  1IYO A;  5CRF A;  4G3K A;  4WMC A;  1W7F A;  3MKF A;  4LEN A;  3Q81 A;  3O88 A;  3AGD A;  2G2W A;  2V1A A;  5K5B A;  4BD1 A;  4BD0 A;  3LI9 A;  5J4E A;  4PAU A;  2HZ5 A;  1DP9 A;  3B47 A;  3BYD A;  4X69 A;  3R7W B;  3HUO A;  4BBT A;  3BY8 A;  4YWZ A;  5F68 A;  5AQ9 A;  3UB5 P;  3DBA A;  4CJN A;  2ZC4 B;  2V8C A;  3S4X A;  3UDI A;  3IF5 A;  4BBU A;  1KGE A;  3CAX A;  4LRZ E;  3W4O A;  2H0T A;  3DAV A;  3F1P A;  1H3Q A;  4QPR A;  4R70 A;  4GDN A;  3ZYT A;  3TG9 A;  2O0Y A;  1JNU A;  5DTK A;  2O9A A;  1ZC2 A;  3JPU A;  2HDQ A;  3S7P A;  3C4O A;  1LT0 A;  2XSS A;  1YMX A;  3EWK A; 
#chains in the Genus database with same CATH homology
 4DE3 A;  2HDR A;  3UDF A;  1BSG A;  3GTC A;  1KVM A;  4E6X A;  2J9O A;  4GN2 A;  5FA7 A;  3IXH A;  3C5A A;  4LV1 A;  5F1F A;  1FCM A;  4JXW A;  4WZ5 A;  3FKW A;  3G2Y A;  4X55 A;  5FI6 A;  4EUZ A;  5CHM A;  4FH2 A;  1GHM A;  2Y55 A;  4DDS A;  3VP4 A;  4Y0T A;  3Q7Z A;  1NY0 A;  5HAR A;  3G31 A;  1KVL A;  2Y2Q A;  4PM6 A;  2JC7 A;  2Y2P A;  1BLC A;  4NK3 A;  4JF6 A;  3G4P A;  1FOF A;  4S2I A;  3PBT A;  3WS1 A;  3IXG A;  5FAS A;  4E6W A;  5CED A;  3SH8 A;  1FSY A;  1MKI A;  3RJU A;  2HDU A;  3A3F A;  3IQA A;  4JBF A;  1Z6F A;  3HLF A;  3C4P A;  3GV9 A;  3WS0 A;  2DCF A;  3N7W A;  5E2F A;  3MKE A;  2XDM A;  3LY3 A;  1C3B A;  3ZG5 A;  4B4Z A;  3ITA A;  4UHU A;  3W4P A;  3WS4 A;  3HLG A;  5E43 A;  2H0Y A;  4F94 A;  3M6H A;  4B4X A;  3MBZ A;  4GZB A;  3SH7 A;  1XXM A;  1KE0 A;  3N4I A;  4OOM A;  1H8Z A;  2X02 A;  1MBL A;  4O7D A;  4OOL A;  4DF6 A;  5HAQ A;  1SHV A;  3PBN A;  2P74 A;  3QHY A;  4A5R A;  2JBF A;  2ZC3 B;  1PI5 A;  1TVF A;  1MWR A;  1YLJ A;  1YLW A;  3LO7 A;  3TSG A;  4N1H A;  3UN7 A;  1NXY A;  5GLA A;  4C6Y A;  1BLS A;  3NIA A;  4LV2 A;  2PBY A;  4DE2 A;  1L0D A;  2J9P A;  3VOY A;  2XFS A;  3S22 A;  1G6A A;  2ZMA A;  1GA9 A;  2EX9 A;  4K0W A;  2ZC6 B;  4GB7 A;  1M6K A;  4S2L A;  5CEB A;  4ZDX A;  1L0F A;  4KQR A;  3W8K A;  3V39 A;  4JKT A;  4QB8 A;  5HX9 A;  2OSU A;  4MNR A;  1LI0 A;  3RXW A;  3HL9 A;  1N4O A;  1KDS A;  1PW8 A;  3VP0 A;  1NYM A;  4EQI A;  4FSF A;  3IWI A;  2R9W A;  5FQM A;  3HLB A;  4D2O A;  1K4E A;  1YLY A;  3G35 A;  3HBR A;  4PM9 A;  2V1Z A;  4QHC A;  4E3L A;  1IYS A;  2ZC7 A;  3LY4 A;  4S2K A;  5TFQ A;  2EFU A;  1FQG A;  2XD5 A;  1ESU A;  1BUL A;  4OLG A;  5KSC A;  4PM8 A;  4P85 A;  1BLH A;  3ZNY A;  1LI9 A;  1PZP A;  1YT4 A;  2VGJ A;  3VMA A;  1CI8 A;  3BM6 A;  3MXS A;  4KEN B;  4UAA A;  2WGV A;  1XA7 A;  2XQZ A;  3E2K A;  3M2J A;  4MBF A;  1ZKJ A;  2IWC A;  3SH9 A;  4X53 A;  3ZG0 A;  2EXA A;  1U60 A;  5IHV A;  1JTG A;  3JYI A;  4L0L A;  4P6B A;  5DF8 A;  2JE5 A;  3SS4 A;  2XLN A;  2WGW B;  1L2S A;  4ZJ3 A;  1ERQ A;  2A49 A;  2EFX A;  2HP5 A;  1JWZ A;  5EVL A;  3SS3 A;  3ZGA B;  3VP3 A;  1Q2P A;  4DDY A;  4PM5 A;  5F82 A;  3M2K A;  3UDX A;  1J9M A;  3WRT A;  3GSG A;  1K6S A;  1FR1 A;  1DJC A;  1K55 A;  5EVI A;  3ZG8 B;  3N6I A;  1DY6 A;  4LV3 A;  2Z2L B;  5CXW A;  4E3M A;  3AGE A;  3V3S A;  4C75 A;  4U3T A;  1VQQ A;  4KG5 A;  5FSR A;  1VM1 A;  4ZJ1 A;  3NI9 A;  3Q7V B;  3BLS A;  4FH4 A;  4N9L A;  4XUZ A;  3ISG A;  3NCK A;  1HZO A;  4S2N A;  1WYB A;  5U47 A;  2EX6 A;  3BFC A;  3BRM A;  4UA7 A;  1IEL A;  4IBR A;  4KZ6 A;  5GLB A;  3VSK A;  1FCN A;  4WEJ A;  1CI9 A;  3NBL A;  3Q82 A;  3IF6 C;  2Y91 A;  4JXV A;  3UO9 A;  5CHJ A;  1YLT A;  1FSW A;  3WWX A;  4N9K A;  2ZD8 A;  1K57 C;  3VFH A;  1MPL A;  3A3J A;  1ES4 A;  2HDS A;  2WZZ A;  4S2O A;  5EVI C;  5FI7 A;  3VP1 A;  4E3N A;  1KE4 A;  3OC2 A;  4DRT A;  5CER A;  1DJA A;  1ES3 A;  1SKF A;  5A93 A;  1BZA A;  3C7U A;  3DWK A;  4K91 A;  4XUX A;  4RA7 A;  2WK0 A;  4BL3 A;  3VFF A;  3N8R A;  5DF7 A;  3VOZ A;  3BFD A;  3NDE A;  3IWQ A;  5KSH A;  1FR6 A;  1MXO A;  3OZH A;  4S2N C;  5JYP A;  2WGI A;  1JTD A;  1PI4 A;  1KGF A;  2P9V A;  3HLE A;  4HEF A;  3N8S A;  4GOG A;  2Y2N A;  5TR7 A;  2DRW A;  4FCF A;  2WKE A;  1EWZ A;  4Q8I A;  2ZQ7 A;  1I2S A;  3DTM A;  4WEL A;  3WS2 A;  3PBR A;  4Z9Q A;  5HFO A;  2ZJ9 A;  3S1Y A;  1QMF A;  1K6R A;  2XF3 A;  5M1A A;  1XGJ A;  3O3V A;  4OH0 A;  5DTT A;  1NZU A;  2E8I A;  2OV5 A;  1ZG4 A;  2H5S A;  3BEC A;  5GHZ A;  5AQB A;  2V2F F;  2WAD A;  4KZ7 A;  5BOH A;  5FAT A;  3G2Z A;  2FFF B;  5GLD A;  1K38 A;  4WZ5 C;  3ITB A;  4BQM A;  2BLS A;  2Y2L A;  3IH9 A;  3OCL A;  3B3X A;  5CTM A;  4RX2 A;  2ZC5 B;  5E2H A;  3G34 A;  1K54 A;  2Y2K A;  3DWZ A;  4OP8 A;  1IKI A;  2Y2I A;  4KG6 A;  4EWF A;  4X68 A;  1QME A;  5DF9 A;  4OPQ A;  2J7V A;  5E2E A;  5G18 A;  3OPL A;  4OPZ A;  5DVA A;  1YLP A;  4P0M A;  3UY6 A;  2Z2M B;  3QNB A;  5L2F A;  1BT5 A;  3HRE A;  5FDH A;  3HVF A;  1WYC A;  1I2W A;  3RXX A;  2OLU A;  2Y2O A;  3UNW A;  1XX2 A;  1KGG A;  4WZ4 A;  3IXD A;  3DW0 A;  4R1G A;  4JXG A;  4UA9 A;  1GHI A;  5TGF A;  4JPM A;  2QZ6 A;  1LL9 A;  5CGX A;  3CG5 A;  4R0Q A;  2WYX A;  3GVB A;  2J8Y A;  1K54 C;  3MFD A;  4R4S A;  4QD4 A;  5EOO A;  4E3O A;  1YQS A;  1FCO A;  4Y7P A;  4ZBE A;  2EXB A;  4GNU A;  3IH8 A;  5A90 A;  4KZ4 A;  1PIO A;  1O07 A;  1NYY A;  3MZD A;  4FD8 A;  4HBU A;  4IVK A;  4LV0 A;  4ID4 A;  3PTE A;  2ZLY A;  2Q9N A;  2WKH A;  4P87 A;  4KQO A;  5CEC A;  2PU2 A;  4B88 A;  1PYY A;  2Q9M A;  1PWG A;  2PU4 A;  3BFE A;  3HLC A;  3SS5 A;  3MXR A;  4RVA A;  1IEM A;  5JYO A;  4BL2 A;  4DE1 A;  5CGW A;  3LCE A;  2DNS A;  1YMS A;  2BG1 A;  4MLL A;  5FQI A;  1WE4 A;  2CC1 A;  1YLZ A;  2Y4A A;  2ZQA A;  3GR2 A;  3ZCZ A;  2HP6 A;  4H8R A;  4JXS A;  1CEF A;  1CK3 A;  4GD6 A;  1XA1 A;  4OQI A;  1RCJ A;  2ZM8 A;  3UE0 A;  1KDW A;  3ZFZ A;  2HP9 A;  5I94 A;  5KMW A;  3EQU A;  3ZHH A;  2JCH A;  2WGW A;  3MZF A;  3NY4 A;  1SDE A;  4KZ8 A;  1ALQ A;  2C5W B;  4S2M A;  5A92 A;  1PWC A;  5EEC A;  4EBL A;  4EBN A;  1DJB A;  1JVJ A;  1HVB A;  1BTL A;  3WS5 A;  1I5Q A;  1ERO A;  3OPH A;  2ZQ9 A;  4OQG A;  2IWB A;  3IWO A;  3HUN A;  1PWD A;  4Y0O A;  4YFM A;  2OLV A;  3MZE A;  4N1X A;  2WZX A;  1O7E A;  1EI5 A;  3GMW A;  3PBS A;  1XPB A;  5FQK A;  4OON A;  1BLP A;  2WAF A;  2Y2H A;  3GQZ A;  1L0E A;  1LLB A;  3Q7V A;  1BUE A;  4ZTK A;  1XGI A;  2ZM0 A;  3A3E A;  1K55 C;  4IVI A;  4N92 A;  5F83 A;  4OP5 A;  2Y2M A;  3G30 A;  1E3U D;  4PM7 A;  2FFY A;  3V5M A;  4EV4 A;  1LL5 A;  5FQQ A;  3FV7 A;  3OCN A;  1TDG A;  3Q1F A;  4OLD A;  4OQH A;  2G2U A;  1HTZ A;  4WYY A;  2ZM2 A;  1JWV A;  4R3B A;  4QU3 A;  4U0X A;  5CTN A;  1MWT A;  3VP2 A;  1OME A;  3V50 A;  2XK1 A;  1AXB A;  5J8X A;  3FZC A;  4YIN A;  1E25 A;  4WMC D;  4OVD A;  4KQQ A;  2X71 A;  3UPP A;  3ZG9 B;  4OQ0 A;  1Q2Q A;  3TOI A;  1ES5 A;  3WRZ A;  5HAP A;  3OPR A;  2ZQD A;  1LHY A;  4IBX A;  4NET A;  5GHY A;  3FKV A;  3FYZ A;  2C6W B;  4GDB A;  1RGZ A;  5FI2 A;  4E3I A;  4DXC A;  1IYQ A;  4HES A;  4KZA A;  4LCL A;  3HLW A;  2WKI A;  1NRF A;  4PMA A;  1KE3 A;  4HBT A;  3ZVW A;  4CPK A;  4JLF A;  3BLM A;  3IHA A;  4RX3 A;  1NJ4 A;  3BEB A;  1ONH A;  2WUQ A;  2Y2J A;  3PAE A;  5HW3 A;  1K25 A;  2Y2G A;  5FAO A;  3A3D A;  1W79 A;  3ZVT A;  4QY6 A;  4BJP A;  1PZO A;  3P09 A;  4E3K A;  1SDN A;  1YM1 A;  1ERM A;  4PPR A;  1GHP A;  3PBO A;  1JWP A;  2XR0 A;  1S0W A;  3BFF A;  4K0X A;  4KZ5 A;  4OPR A;  4C3Q A;  4S2J A;  3NC8 A;  3ZNT A;  2HPB A;  5FQ9 A;  2ZQC A;  3EQV A;  4EBP A;  2UWX A;  4WBG A;  3CMZ A;  4OKP A;  4JF4 A;  4DE0 A;  3CJM A;  1TEM A;  4ZJ2 A;  2QMI A;  1W8Y A;  3D4F A;  1IYP A;  3AGF A;  3C7V A;  3VSL A;  5CHU A;  4KZB A;  5EVI D;  4KZ3 A;  2VGK A;  4WEK A;  1ZG6 A;  3OPP A;  2A3U A;  4OOY A;  2XGN A;  3UPN A;  2WAE A;  5DTS A;  3P98 A;  5GL9 A;  1E3U A;  1K56 D;  2IWD A;  4UA6 A;  5A91 A;  3O87 A;  1TDL A;  4GD8 A;  4E3J A;  4BLM A;  1ESI A;  2RL3 A;  1NZO A;  1RP5 A;  5F1G A;  4XXR A;  4X6T A;  3IT9 A;  1E4D A;  1XKZ A;  1GA0 A;  4R23 A;  1GCE A;  4GKU A;  1IYO A;  4MBH A;  4OPY A;  5CRF A;  3UE3 A;  2ZQ8 A;  1IKG A;  2EX8 A;  4WMC A;  1W7F A;  3Q07 A;  3MKF A;  4LEN A;  1RGY A;  3Q81 A;  3O88 A;  3AGD A;  1H5X A;  1ONG A;  1Y54 A;  4QY5 A;  2G2W A;  4DXB A;  5KZH A;  4BD1 A;  4BD0 A;  3GRJ A;  5FQJ A;  4IED A;  1PW1 A;  4JF5 A;  4R4R A;  2V20 A;  3V3R A;  3PAG A;  2QPN A;  5EE8 A;  3ZG7 B;  4X69 A;  3BYD A;  5AQ7 A;  2XD1 A;  4RYE A;  1ES2 A;  4DKI A;  5HAI A;  4MEZ A;  4Y0U A;  1SCW A;  3HUO A;  4QJG A;  5M18 A;  2XFT A;  3O86 A;  1MWU A;  3IF6 B;  5GLC A;  5D3O A;  3I7J A;  3M6B A;  2EX2 A;  5M19 A;  4LCM A;  1H8Y A;  3G32 A;  1HD8 A;  5HL1 A;  3IHB A;  4U0T A;  5EVI B;  5FAQ A;  1MWS A;  1MY8 A;  5AQ9 A;  4CJN A;  1K4F A;  2B5R A;  3IF6 A;  5FAP A;  2ZC4 B;  2R9X A;  1G68 A;  3N8L A;  3HLD A;  1K57 A;  1M40 A;  4MBK A;  3S4X A;  1L0G A;  3A3I A;  3E2L A;  3UDI A;  3IF5 A;  2RCX A;  1W8Q A;  2X01 A;  4KZ9 A;  4X56 A;  2XH9 A;  5EUA A;  3UPO A;  5CGS A;  1K56 A;  1KGE A;  3UE1 A;  3W4O A;  2XEP A;  2H0T A;  3BFG A;  2H10 A;  4BEN A;  1CEG A;  4GDN A;  2GDN A;  3QNC A;  5EOE A;  5GHX A;  3TG9 A;  3IXB A;  4R3J A;  5DTK A;  3HUM A;  2Y59 A;  5AQA A;  3PBQ A;  1ZC2 A;  1XP4 A;  5EPH A;  2HDQ A;  4M3K A;  1W5D A;  3C4O A;  5E2G A;  1N9B A;  4WM9 A;  3ZDJ A;  4ZAM A;  2I72 A;  4KG2 A;  3SOI A;  4S2P A;  3W4Q A;  3CZD A;  1YMX A;  3LEZ A;  3FWL A;  3NDG A;  2P9V B;  1S6R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...