3FZCA

Oxa-24 beta-lactamase complex with sa3-53 inhibitor
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
244
structure length
243
Chain Sequence
HISSQQHEKAIKSYFDEAQTQGVIIIKEGKNLSTYGNALARANKEYVPASTFMLNALIGLENHKATTNEIFKWDGKKRTYPMWEKDMTLGEAMALSAVPVYQELARRTGLELMQKEVKRVNFGNTNIGTQVDNFWLVGPLKITPVQEVNFADDLAHNRLPFKLETQEEVKKMLLIKEVNGSKIYAKSGWGMGVTPQVGWLTGWVEQANGKKIPFSLNLEMKEGMSGSIRNEITYKSLENLGII
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Beta-lactamase OXA-24
publication title Design, synthesis, and crystal structures of 6-alkylidene-2'-substituted penicillanic acid sulfones as potent inhibitors of Acinetobacter baumannii OXA-24 carbapenemase.
pubmed doi rcsb
source organism Acinetobacter baumannii
total genus 78
structure length 243
sequence length 244
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2009-01-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 3fzcA00
3W4PA 3HLCA 2HP9A 3BFDA 4OONA 1XP4A 1KE4A 3VSLA 4RVAA 2HP6A 4K91A 3OCNA 4OQ0A 4LV3A 5AQ7A 3WS4A 3PAEA 1CK3A 3ZNTA 4S2PA 4N1HA 1FOFA 1PIOA 5IHVA 3G34A 1XKZA 3BFGA 2DRWA 1PYYA 3ZFZA 1L0DA 1ALQA 1GA9A 1TDGA 2H10A 3VSKA 3TOIA 1PWCA 2P9VB 5CGXA 5CERA 4E3LA 3Q81A 4BD0A 5GHXA 3QHYA 4GN2A 1EI5A 3CZDA 4MBFA 3OCLA 3HLEA 4JLFA 4WEJA 3N8SA 3P09A 4Y7PA 1ES4A 5GLDA 3UDFA 4OQHA 1GA0A 3G2ZA 2WGIA 4OP5A 4ID4A 4UA7A 4MLLA 4X53A 4WZ4A 3TSGA 3HLDA 4JXWA 4Y0UA 5A93A 3TG9A 4RX3A 5HFOA 2Q9NA 2Y55A 4MBKA 2IWDA 2ZQCA 5BOHA 2WAFA 3GQZA 3MZEA 5FQJA 4P87A 4X6TA 1KVMA 1ES3A 3IXHA 4S2KA 5FAPA 4E6WA 2V20A 4FD8A 3N8RA 3CG5A 1C3BA 1S6RA 4PM7A 1JVJA 2EXBA 5GLCA 4LCMA 1YLPA 1NXYA 1FCNA 3CMZA 5F82A 1QMEA 3BRMA 4JXSA 2WZXA 3HUNA 3PBSA 3IWQA 4K0WA 3FKWA 5JYPA 5EECA 5FATA 2FFYA 1BULA 1CEGA 2J8YA 2R9XA 1HD8A 2A3UA 1MXOA 1K57A 3CJMA 4FH4A 4JKTA 1KE3A 1Q2QA 4KENB 4KG6A 4C6YA 2JCHA 3A3EA 4OPRA 4WM9A 5F1GA 3ZG8B 3QNCA 4E3KA 2ZQ7A 1K54A 1ONGA 3WS1A 2WZZA 3OPHA 4WMCA 5A92A 2P9VA 2HDRA 3A3IA 1WYBA 1SDNA 1M6KA 2XR0A 4QB8A 1HVBA 5FI6A 3NIAA 4BL3A 1G68A 4BL2A 4OKPA 2WKHA 2J7VA 3FYZA 4PMAA 1OMEA 3A3DA 1K6SA 3NC8A 4JBFA 3LY3A 3M6HA 1FQGA 1GHIA 1K25A 3MXSA 5CEDA 5CECA 3DW0A 3MZDA 3C7VA 5EVLA 2WKEA 4KG2A 1ES5A 4S2NA 4E3NA 4DKIA 2EX9A 1E25A 4OOYA 2EFXA 1BT5A 3HLBA 2Y2LA 4UHUA 1K57C 3Q82A 3ZDJA 2XK1A 3FZCA 5E2FA 4B4XA 2PBYA 3PBQA 5D3OA 2ZJ9A 4KQOA 1K4EA 4GDBA 4XXRA 3ZG9B 1DJCA 2XFSA 3NI9A 3HREA 4H8RA 3GTCA 4WZ5A 1K54C 4B88A 4DE2A 3SH7A 1MY8A 4N92A 3PAGA 1GHPA 2QMIA 1BLHA 4OQGA 3OC2A 4UAAA 4Y0TA 3ZHHA 1E3UA 1FSWA 3VFFA 5CTMA 5HX9A 2Y2QA 3ZVWA 4R0QA 2UWXA 2RL3A 3ZVTA 5AQAA 2JBFA 4CJNA 3ZCZA 4OQIA 3FKVA 4DXBA 4EBPA 4YINA 3IQAA 4S2NC 3SS3A 3D4FA 4E6XA 1W8YA 4L0LA 5EVIA 2Y2NA 4FSFA 1RGZA 1O07A 5E2GA 4ZJ1A 3BLSA 1I5QA 1L0GA 4RX2A 2OV5A 4R23A 4Q8IA 5M18A 3MKEA 1KDWA 3P98A 4LV1A 3RJUA 2ZM8A 4WZ5C 2BLSA 4U0XA 1NJ4A 4ZDXA 3GV9A 1FR1A 3S4XA 2I72A 1GHMA 4JF6A 3VOZA 2Y59A 5EOOA 1MKIA 3C7UA 1W7FA 5CTNA 5GLAA 3W4QA 4E3IA 4RYEA 1PWGA 1NYMA 3FV7A 5E43A 4OH0A 3V39A 3BYDA 4WMCD 5DTSA 5HAPA 1LL9A 3IF5A 3EQVA 5EUAA 3UY6A 4S2LA 4Y0OA 3VOYA 3W4OA 1IYSA 3WS0A 3GMWA 3G31A 4P0MA 3DTMA 5GL9A 3UPNA 4OVDA 1K55A 3N8LA 5EVIC 1ERMA 4HESA 4GKUA 2Y91A 4C3QA 4EUZA 3BLMA 3IWOA 4OOMA 4GDNA 4UA9A 4PM6A 3UPPA 4XUXA 4ZJ2A 3S22A 5EPHA 4EBNA 4IBXA 1FCMA 1JWZA 4PPRA 4KZ9A 5DF8A 4LV2A 4OLDA 3PBNA 2Q9MA 2EX8A 5CGSA 1TDLA 1ZG6A 2ZLYA 3BFEA 1SHVA 4K0XA 3VP4A 4DXCA 5KMWA 5DTKA 2XF3A 3VP2A 3ITAA 4JPMA 3V3SA 5M1AA 3SH9A 5TGFA 3C4OA 1JWVA 4E3MA 4S2MA 5FI2A 3ZGAB 4WELA 1BUEA 2Z2LB 1FCOA 3NDGA 4KZBA 3FWLA 1E3UD 3IHAA 4D2OA 1SCWA 1BTLA 1K55C 5DTTA 5FQIA 2Z2MB 1LLBA 3IH8A 4GOGA 3G4PA 4C75A 5FA7A 2X02A 5CHMA 4JXVA 1L0FA 1IKGA 3PBRA 1H8YA 5FAQA 1LL5A 2ZQ8A 3M6BA 4WYYA 5EVID 4S2OA 3C4PA 1BLCA 4OLGA 4RA7A 5KZHA 4KZ3A 3VFHA 1N4OA 5CRFA 4OP8A 5I94A 2Y2HA 3VMAA 3MBZA 3BEBA 2XH9A 1PZOA 2ZM2A 2IWBA 4CPKA 1LHYA 2V2FF 3Q7VB 2Y2GA 2EFUA 3OPPA 2EX2A 2WUQA 1W8QA 2HDUA 5HARA 3UPOA 4BD1A 5E2HA 4BJPA 1ERQA 4E3OA 3G32A 4BENA 1KDSA 2DNSA 4E3JA 1G6AA 3Q7ZA 1YM1A 1HZOA 5TFQA 1RGYA 1YQSA 1JTDA 4DRTA 4O7DA 3SS5A 3WWXA 2ZC7A 3NBLA 4R4RA 4GNUA 3OPRA 4KZ4A 3RXXA 1CI8A 1KGEA 1Y54A 1NZUA 1NZOA 4HBUA 2EX6A 3A3JA 2BG1A 1ONHA 3LY4A 5AQBA 3UE3A 4KQRA 3IF6B 2RCXA 1MWRA 2E8IA 2XQZA 4FCFA 1IYOA 1E4DA 5A90A 3M2KA 1MWSA 4X68A 3BM6A 1K56A 3VP3A 3NY4A 2Y2KA 4R4SA 3HL9A 3VP0A 2FFFB 5HL1A 3JYIA 4IVKA 3UNWA 1HTZA 4PM9A 4KZ8A 2H5SA 2ZC3B 4DE0A 3E2LA 3UO9A 1I2SA 2J9PA 4GZBA 3NDEA 3N7WA 2X01A 3HLGA 2WGWB 1DJAA 1VQQA 3EQUA 4EWFA 2XEPA 3IWIA 2H0TA 5L2FA 2JC7A 2XGNA 4JF4A 1EWZA 3DWZA 3M2JA 3S1YA 2VGKA 4KQQA 3UN7A 3IHBA 1Q2PA 1CI9A 4EBLA 2ZC6B 5HAQA 1DJBA 2WKIA 3OPLA 1JWPA 1XA1A 4LCLA 3UDIA 1NRFA 4P6BA 1MWUA 1NYYA 4Z9QA 3BECA 3V3RA 1PI4A 2EXAA 1K38A 1W79A 1KE0A 4NETA 3GSGA 5EE8A 1PI5A 1WE4A 1IEMA 3AGFA 4JXGA 5F1FA 3SOIA 2ZM0A 4MBHA 3V50A 1ZG4A 5GHZA 1IKIA 1FR6A 1BSGA 3IF6A 1O7EA 3HBRA 1KGFA 3IH9A 4X55A 4N9KA 2CC1A 3MKFA 4R1GA 5KSHA 3ITBA 2PU2A 1XA7A 2H0YA 4X56A 4QD4A 4N9LA 1YLJA 5E2EA 4PM5A 3RXWA 1K6RA 5CHJA 3HLFA 3ZG7B 3PBTA 5CGWA 4ZTKA 4GD6A 5HAIA 4QU3A 1K4FA 1YT4A 2V1ZA 4R3BA 5DF9A 1W5DA 3E2KA 1PWDA 3LO7A 1K56D 5FI7A 4S2JA 1XGJA 4OPYA 1SKFA 1QMFA 4LV0A 4QJGA 4QHCA 2HDQA 2XD1A 1KVLA 3DWKA 1XXMA 1LI9A 2VGJA 2XLNA 2ZC4B 3QNBA 4JF5A 4BLMA 2WGWA 4M3KA 3IF6C 3UDXA 5KSCA 4U0TA 5FQ9A 3ZNYA 3NCKA 1ZC2A 3IXGA 4EV4A 2WGVA 2R9WA 3IXBA 5DF7A 3B3XA 3O87A 2OLVA 2G2WA 4KZ7A 3IT9A 3G35A 2Y2OA 5CEBA 2ZQAA 2HP5A 1XGIA 2HPBA 4GB7A 1AXBA 1ZKJA 3Q1FA 1L0EA 1PZPA 2Y2PA 1NY0A 4WEKA 1XPBA 5AQ9A 4BQMA 2B5RA 1MPLA 1IYQA 2ZD8A 5GHYA 1BLPA 3OZHA 3G30A 4A5RA 5A91A 4YFMA 5J8XA 1ES2A 5FSRA 2Y2JA 1WYCA 1SDEA 5CHUA 2WAEA 3MXRA 2XD5A 4OOLA 5FASA 3WS2A 1DY6A 1J9MA 2OLUA 4PM8A 4ZAMA 2WYXA 3V5MA 4X69A 1EROA 4DF6A 2J9OA 3GVBA 1H5XA 4FH2A 4GD8A 2P74A 5DVAA 3O3VA 3C5AA 1U60A 1YLZA 1YLYA 3VP1A 2Y4AA 4IVIA 4IEDA 1ESIA 4KZ6A 4UA6A 1IYPA 4MEZA 5EVIB 5HW3A 4HEFA 1BZAA 3I7JA 3PTEA 4IBRA 2QZ6A 1H8ZA 1ESUA 2ZQDA 5U47A 3W8KA 4ZBEA 5CXWA 4R3JA 3O86A 1PW1A 2G2UA 3MFDA 1PW8A 4U3TA 2IWCA 1CEFA 3G2YA 3N6IA 4DE3A 3IXDA 3UE1A 3A3FA 3HUOA 4LENA 2C6WB 4DDSA 2OSUA 1M40A 4QY6A 4KZAA 3ZG5A 1IELA 4DDYA 3WRZA 2GDNA 5FDHA 3UE0A 2QPNA 1FSYA 3SS4A 1GCEA 5FQKA 3ISGA 1VM1A 4P85A 1BLSA 1S0WA 2PU4A 2X71A 3LEZA 1L2SA 3HLWA 3AGDA 1YLWA 4ZJ3A 3GRJA 3AGEA 1Z6FA 2XFTA 4NK3A 3GR2A 4B4ZA 2ZC5B 2ZMAA 2ZQ9A 4F94A 3MZFA 4N1XA 5EOEA 5GLBA 3ZG0A 4KZ5A 3WRTA 2HDSA 2XDMA 5FQQA 3BFFA 1MWTA 3Q7VA 3PBOA 5G18A 1N9BA 1MBLA 1KGGA 1YLTA 5FAOA 1I2WA 1TEMA 2WK0A 2DCFA 3BFCA 5FQMA 4OPQA 5JYOA 4XUZA 5F83A 5TR7A 4KG5A 1LI0A 2C5WB 3HUMA 1TVFA 2A49A 1YMSA 3Q07A 4EQIA 1JTGA 1XX2A 4MNRA 4WBGA 5M19A 4QY5A 4HBTA 3LCEA 2WADA 3HVFA 3O88A 2Y2MA 4OPZA 4S2IA 3N4IA 4DE1A 1RP5A 1RCJA 1YMXA 3SH8A 3WS5A 2JE5A 2Y2IA
chains in the Genus database with same CATH superfamily
3HLCA 2HP9A 1KE4A 5F5YA 3OCNA 3KO6A 3KSGA 3PAEA 1V9ZA 5IHVA 1XKZA 1L0DA 1ALQA 1GA9A 4EERA 2H10A 3EGDC 2P9VB 4E3LA 2MJ6A 3QHYA 3GDIA 1T19A 1Z09A 5HPIA 3OCLA 4WEJA 2WGIA 1BYWA 4O8GA 4OP5A 4UA7A 4X53A 4WZ4A 4Y0UA 4BBUA 2Q9NA 2ZMVA 4JGOA 1KVMA 2GJ3A 3GECA 4IJGA 2PR6A 1C3BA 2EXBA 5GLCA 2BASA 1YLPA 1QMEA 4HP9A 4HH2A 3IWQA 1VEUA 3FKWA 4Q0JA 5FATA 4KQDA 1CEGA 2J8YA 4Z1WA 5EM1A 2R9XA 4JKTA 1KE3A 4C6YA 2JCHA 1P0ZA 2LB9A 3ZG8B 4B93A 4E3KA 1K54A 4WMCA 3A3IA 1WYBA 3UB6A 4BL3A 1G68A 1K6SA 1NRJA 5EVEA 2LB5A 2VV6A 3MZDA 2OWHA 4S2NA 3F1NB 2Y2LA 1K57C 5E2FA 3NECA 3PBQA 1SKOB 4KQOA 4GDBA 4XXRA 3LIEA 3QP5A 2XFSA 3NI9A 3HREA 4B88A 3GTCA 3PAGA 1CF0A 3ZYTA 3OC2A 5CTMA 1FIKA 1W63M 1SZVA 4CJNA 5HSQA 3FKVA 4UEYA 4YINA 2K31A 3D4FA 3PHYA 4L0LA 5EVIA 5F69A 2Y79A 5E2GA 3BLSA 5M18A 4X1LA 4HJ4A 1KDWA 3P98A 4LV1A 3LR5A 3UB5P 2ZM8A 1FR1A 3S4XA 1GHMA 4LRZE 4HJ3A 2Y59A 5EOOA 1HLUP 5GLAA 2V0UA 3FV7A 5FEGA 1LL9A 3IF5A 3MSHA 3W4OA 2PYPA 3GMWA 3G31A 5GL9A 1K55A 3TW8A 4GKUA 2JKTI 3BLMA 3IWOA 2Z6CA 5EPHA 5DF8A 1FCMA 4PPRA 4KZ9A 3C38A 3F1PB 4LV2A 4OLDA 3KYQA 3TRCA 5AJGA 3S7QA 2VX8A 2ZLYA 4K0XA 5KMWA 4G3KA 2XF3A 1IOUA 3ITAA 3V3SA 5M1AA 4E3MA 3ZGAB 2W1RA 1BUEA 1DRMA 2Z2LB 4KZBA 3E4OA 3IHAA 5DTTA 4DMZA 4C75A 5FA7A 4NXGA 5FAQA 4GHIA 3ICYA 4S2OA 4GJ4A 4RA7A 3S7NA 5KZHA 4KZ3A 4OP8A 4WL9A 4LRXC 2XH9A 1PZOA 3DTKA 1WA9A 3Q7VB 2Y2GA 5HARA 4BD1A 5E2HA 4Y15A 1ERQA 4E3OA 3KSHA 4LRYC 4PAUA 4ETXA 3FG8A 4ESPA 5L8MA 4DRTA 3SS5A 2OAP1 4MDZA 4KZ4A 3RXXA 5HWTA 3MQ0A 3A3JA 2BG1A 2A24B 1ONHA 1P97A 3LY4A 3IF6B 4LPZA 1MWRA 2E8IA 1E4DA 2PHYA 1K56A 2W3EA 3H7WA 4R4SA 3JYIA 2V9AA 4PM9A 4KZ8A 1CJFA 2V0WA 4DE0A 1I2SA 2J9PA 2V1AA 4KUOA 4HH3A 3K3CA 1DJAA 1VQQA 3EQUA 4DN0A 4EWFA 4F3LB 2H0TA 2XGNA 3A0RA 4JF4A 1EWZA 5F6AA 1JWPA 1XA1A 4P6BA 1NYYA 2EXAA 3H9WA 4NETA 1WE4A 3SZTA 3F1NA 3SOIA 3K2NA 1ZG4A 5GHZA 1S4SA 1FR6A 1O7EA 3NOUC 3TE8A 1F98A 2ZL1B 3MKFA 4R1GA 3MXQA 1DP6A 1XA7A 2H0YA 4N9LA 1K6RA 1N9LA 2WKRA 2J3WA 4LV0A 4QJGA 4QHCA 4AFIA 1KVLA 1LI9A 2GZAA 2ZC4B 1EW0A 2WGWA 4M3KA 2VLGA 3UDXA 4U0TA 3G6OA 1H3QA 2L4RA 2VK3A 4WN5A 1NLZA 2AVXA 3IXBA 5DF7A 5EV0A 3L7HA 4KZ7A 2W3DA 3IT9A 2Y2OA 2HV1A 4I38A 1S4RA 1T1CA 1ZKJA 4BQMA 1P9RA 1XPBA 5AQ9A 1G28A 1NWZA 4FOFA 4YFMA 1ES2A 1GSVA 1DP8A 5CHUA 1SDEA 3LUQA 1NLYA 1EROA 3GVBA 5DVAA 2J3TD 1YLYA 4UA6A 5TBMA 4EETB 3I7JA 4IBRA 2QZ6A 4PKYG 4R3JA 4Y17A 4GCZA 4YOFA 3MQOA 3UE1A 4EEPA 2OSUA 2QPNA 1GCEA 3ISGA 2G7UA 1BLSA 1S0WA 5FEFA 3LEZA 3HLWA 1YLWA 3U4LP 2XFTA 4B4ZA 2ZMAA 3T4LA 3WRTA 2HDSA 3BJNA 3Q7VA 1P9WA 3PBOA 1N9BA 1TF1A 1I2WA 2DCFA 4GW9A 2JKRM 5TR7A 3T1RA 3HUMA 3UB7A 1TVFA 2PBDP 4EQIA 4WBGA 3HVFA 4II7A 3N4IA 1RP5A 1OPXA 3SH8A 3WS5A 2A24A 2YKFA 3BFDA 2A2LA 4RVAA 2J80A 1XJ6A 2XA7S 2HP6A 1T1AA 4K91A 1OTDA 5AQ7A 3VE4A 4N1HA 3G34A 2DRWA 1PYYA 3ZFZA 1TDGA 3TOIA 1PWCA 5CERA 5GHXA 2FH5A 2Q0OA 2L1MA 1ES4A 3CWFA 4HNBA 2JHEA 1GA0A 2ACGA 4ID4A 1H0MA 4MLLA 3TSGA 5AVFA 4JXWA 2IWDA 5BOHA 2WAFA 3GQZA 3MZEA 4E6WA 4FD8A 2W3GA 4PM7A 1YSPA 1FCNA 5F82A 4JXSA 2O9CA 2ZL1A 3E4QA 2FFYA 3L9KA 2M7UA 1HD8A 4KENB 4OPRA 5F1GA 2ZQ7A 3PYPA 2HDRA 1SDNA 1M6KA 2XR0A 1YSQA 4BL2A 4OKPA 2J7VA 3FYZA 4PMAA 3NOPC 1OTAA 4JBFA 3M6HA 1FQGA 2OAQ1 5CEDA 5CECA 1OJGA 4KG2A 1ES5A 1E25A 2BTFP 2HZ5A 2PD8A 4E04A 2PBYA 5D3OA 2KDKA 1K4EA 4WZ5A 1OT9A 4Y0TA 1OJ5A 1FSWA 3MF0A 5HX9A 4R0QA 2UWXA 3ZVTA 5AQAA 3ZCZA 4OQIA 4EBPA 4Y5FA 4E6XA 2Z6DA 3E4PA 2ZOHA 1O07A 1I5QA 1L0GA 2BLSA 4U0XA 1NJ4A 4ZDXA 4MMNA 4YNRA 4GHIB 3RFBA 4E3IA 4RYEA 4JGPA 3QP2A 3V39A 5DTSA 4WMCD 4YWZA 5HAPA 5EUAA 3EQVA 3E0YA 1F5MA 1ACFA 3UPNA 3N8LA 4HESA 1LSWA 4OOMA 4ZJ2A 3PBNA 4JGQA 3D72A 3KYZA 1LL8A 3SH9A 5EM0A 5DKKA 5TGFA 3C4OA 1XFNA 3NDGA 1VHMA 5HDSA 1LLBA 3IH8A 3H7WB 3KX0X 1H8YA 5F68A 1LL5A 2ZQ8A 5EVID 4R38A 1LT0A 5HL6A 2INWA 5G4ZA 3MFXA 3MBZA 2IWBA 2V2FF 2WUQA 1W8QA 4I3AA 4BENA 1KDSA 4E3JA 1RGYA 1GSWA 1YQSA 1JTDA 4O7DA 3WWXA 3NBLA 1CI8A 4HBUA 2EX6A 3VE3A 5K5BA 5AQBA 3T4JA 4KQRA 4FCFA 5DFXA 1MWSA 3BW6A 3W2ZA 3VP0A 4IVKA 5DJUA 3HJIA 1OT6A 2X01A 3HLGA 2WGWB 2YKHA 2KLIA 2XEPA 3DWZA 3S1YA 2VGKA 3IHBA 4QPRA 1Q2PA 2VV8A 4EBLA 3OPLA 1NRFA 1MWUA 2JKGA 1PI4A 3VV4A 3UMDA 1S67L 1YPRA 2ZM0A 3MS6A 4MBHA 1KGFA 3IH9A 3KSIA 4N9KA 3MR0A 5E2EA 5CHJA 1XJ3A 3VOLA 4GD6A 5TBMB 3CUEC 4QU3A 4R3BA 4WF0A 5DF9A 1TS6A 4HHDA 3LO7A 1K56D 3T1QB 4S2JA 5AVEA 2J3TC 2O9BA 2XD1A 1XJ4A 2XLNA 3QNBA 4BLMA 3IF6C 4CLCA 5KSCA 1V9YA 2WGVA 2R9WA 2O99A 3O87A 4I3IA 4I39A 3CI6A 1S1ZA 2B5RA 1K0KA 1BLPA 4A5RA 3PR6A 4Y3IA 3MXRA 3WS2A 2V8CA 4FTXA 4QWOA 3MMHA 3V5MA 4X69A 4DF6A 4FH2A 2DMWA 2P74A 1U60A 5HW3A 4MEZA 1ESUA 2ZQDA 5CXWA 4ARZA 1PW8A 2K2NA 3N6IA 3A3FA 3HUOA 1VETA 4LENA 2C6WB 1M40A 4QY6A 3JPUA 4KZAA 1STZA 2W1TA 5J7EA 3PXPA 4NK3A 3GR2A 2ZC5B 3MJQA 3MZFA 5GLBA 1UWNX 3ZG0A 4KZ5A 5FQQA 1MWTA 3NULA 5FAOA 3OLOA 1TEMA 2PT7A 4XUZA 5F83A 4KG5A 1LI0A 1H8MA 4DJ3A 4HQAA 1XX2A 5M19A 4UQIM 4HBTA 2WADA 4OPZA 4L9GA 4DE1A 3JVVA 2EA9A 1Y28A 4OONA 2PYRA 4LV3A 3WS4A 1CK3A 4S2PA 5HWVA 3VSKA 5CGXA 4BD0A 4GN2A 1EI5A 4MBFA 3DTIA 3HLEA 4JLFA 3N8SA 3P09A 5LBRA 1VB6A 3UDFA 3IS2B 2QYBA 1Y4OA 5A93A 3TG9A 4RX3A 5HFOA 3BQAA 4X6TA 3IXHA 2V20A 3N8RA 1S6RA 4K08A 3T4QA 4LCMA 3BRMA 2UV0E 2WZXA 5HDCA 4B9OA 1XFQA 3BY8A 3FPWA 3LIFA 1BULA 5HDDA 1ODVA 1MXOA 1K57A 4FH4A 4KG6A 2M7VA 4WM9A 3QNCA 3S7OA 3OPHA 4CQHA 5IT5A 2VA0A 1ZTUA 3DTEA 5FI6A 3NIAA 3A3DA 3T4KA 4O01A 1K25A 5G4YA 1GSXA 3C7VA 5EVLA 2EX9A 3LR3A 4OOYA 3CLOA 5EFWA 4UHUA 3UE6A 4B4XA 3ZG9B 2ZJ9A 3NJAA 1DJCA 4H8RA 1K54C 3SH7A 1MY8A 4N92A 4OQGA 1GHPA 1PNEA 3CITA 4UAAA 1E3UA 5DKLA 2H28A 2Y2QA 4BBTA 2JBFA 4Q0IA 1TS8A 4DXBA 3IQAA 4S2NC 1YKDA 1W8YA 2Y2NA 4FSFA 1RGZA 4ZJ1A 4RX2A 3R7WB 1N9NA 1XJ2A 5HZHA 3T50A 3LI8A 1MKIA 2WKQA 3B33A 1W7FA 3C7UA 3W4QA 1PWGA 1NYMA 5E43A 4OH0A 1D1JA 3UY6A 3WS0A 5EVIC 4LLOB 2Y91A 4EUZA 2PRFA 4GDNA 4UA9A 4PM6A 3UPPA 3S22A 4EBNA 4IBXA 2EX8A 5CGSA 2HJ9C 1TDLA 1ZG6A 3ZQ5A 3VP4A 3LIAA 4DXCA 4D60A 4JPMA 1IFQA 1JWVA 4S2MA 5FI2A 1FCOA 4D2OA 1UWPX 2ZOIA 1SCWA 1K55C 2Z2MB 4EEUA 4GOGA 2ZBBA 3CAXA 1L0FA 1IKGA 3PBRA 2QKPA 3C8CA 1D7EA 4MN7A 3IBJA 3C4PA 4OLGA 5IU1A 2D01A 4NKPA 3VMAA 3D9YA 1A0KA 5L10A 3U2AA 3RTYA 3LR0A 3OPPA 2EX2A 1TD5A 2V1BA 5HPFA 3G32A 2DNSA 3Q7ZA 1YM1A 3NHQA 1HZOA 3D3OA 5TFQA 3O5YA 3IS2A 2ZC7A 4GNUA 4P6ZS 4BBVA 4JGRA 1KGEA 1NZUA 4I5SA 1IYOA 2VEAA 3M2KA 3BM6A 4X25A 2VV7A 4P6ZM 3B47A 4EU0A 4MN6A 3UNWA 2JKTM 2VZWA 2JE5A 3E2LA 4EW7A 4O0PA 2W0NA 4CLCB 2XROA 3M2JA 3EOIA 4HI4A 1CI9A 1UGUA 3BY9A 5HAQA 1T18A 4LCLA 3E98A 3IX3A 3BECA 3V3RA 1K38A 1KE0A 4M4XA 1PI5A 1IEMA 3AGFA 4JXGA 4R3AA 3V50A 4DJ2A 1IKIA 1BSGA 4IUKA 1PRQA 3R4KA 4X56A 4Y2FA 1YLJA 4Y13A 3RXWA 3HLFA 3ZG7B 4ZTKA 4FUWA 1K4FA 2V1ZA 3E2KA 5FI7A 4ARZB 4OPYA 1SKFA 2JKRI 2HDQA 3DWKA 3T4TA 1MKMA 3R7WA 1VETB 3NCKA 1ZC2A 4EV4A 2QJ5A 2W1TB 3P7NA 3G35A 4XT2B 5CEBA 3Q1FA 1PZPA 2Y2PA 4WEKA 5GHYA 3OZHA 3QP8A 3G30A 5A91A 5A8BA 2Y2JA 4EESA 2WAEA 2XD5A 1OTBA 4OOLA 1J9MA 4ZAMA 3RH8B 2J9OA 1H5XA 4GD8A 3O3VA 3C5AA 3KYEA 2E8JA 1YLZA 4IEDA 4KZ6A 3PTEA 3CPTB 1H8ZA 3W8KA 3BQ8A 4RQ9A 4ZBEA 1PW1A 4PHTA 3MFDA 4U3TA 2IWCA 2QJ7A 3DBAA 1MZUA 4DE3A 1TS7A 1D06A 4DDSA 4DDYA 1W63Q 3WRZA 5FDHA 5FQKA 2GX5A 1VM1A 2K7SA 2B02A 4CLCD 2PU4A 3EEHA 2X71A 1L2SA 4ZJ3A 3QP6A 4GS9A 1Z6FA 2OOLA 4N1XA 5EOEA 2XDMA 3BFFA 5DFYA 3UB9A 1MBLA 3C2WA 1TS0A 2KX6A 2WK0A 3BFCA 4OPQA 5JYOA 3P01A 5C5KA 2C5WB 2A49A 4R6LA 3IX4A 3IBRA 1JTGA 4MNRA 1PFLA 3O88A 2Y2MA 4S2IA 2GNXA 1RCJA 2CMNA 2Y2IA 2ZMFA 3W4PA 5TJJA 1XP4A 3T12B 3VSLA 4NG2A 4WUJA 2W3HA 4OQ0A 3ZNTA 3FC7A 1FOFA 1PIOA 2KOIA 3BFGA 5FL3A 4H6JB 5HD5A 4NXBA 4I3JA 3Q81A 3ULFA 3CZDA 3LGOA 3H82A 3F1OB 2WKPA 4Y7PA 5GLDA 4OQHA 3G2ZA 1DP9A 3T1XA 3HLDA 2Y55A 4MBKA 4G3WA 5DJTA 2ZQCA 3LICA 1T1BA 1X0OA 5FQJA 4P87A 1ES3A 5FAPA 2FZ0A 4S2KA 3CG5A 4X1MA 1JVJA 5FDSA 1AWIA 1NXYA 3CMZA 1MC0A 2NUPC 3LIDA 3HUNA 3PBSA 4K0WA 5JYPA 5EECA 2NUTC 2A3UA 4WLAA 3CJMA 3T1SA 1Q2QA 3V67A 3A3EA 1OTIA 4HJ6A 1ONGA 3WS1A 2WZZA 5A92A 2P9VA 4Q0HA 4ZRRA 4QB8A 1HVBA 2XRNA 2WKHA 1OMEA 3NC8A 3LY3A 1GHIA 3MXSA 1OTEA 3DW0A 4HOIA 2WKEA 4E3NA 2R78A 3NOTC 4DKIA 2EFXA 1BT5A 3HLBA 4XT2A 3TJZC 3Q82A 3ZDJA 2XK1A 3FZCA 2W3FA 4DE2A 4UQIS 2QMIA 1BLHA 3ZHHA 3CHWP 2OWJA 3VFFA 3LYXA 3ZVWA 2HJEA 2RL3A 4HY8A 3SS3A 5L07A 2P08A 2PD7A 4KUKA 2PAVP 5HD3A 3CPTA 2OV5A 4R23A 4Q8IA 2EWVA 3MKEA 2PDRA 3RJUA 4WZ5C 1KOUA 3GV9A 2I72A 4JF6A 3VOZA 2QWSA 2VKSA 5CTNA 3BYDA 4S2LA 4Y0OA 3VOYA 1IYSA 4P0MA 3DTMA 5KIZA 4OVDA 1ERMA 4C3QA 1SKOA 2M1CA 2XSSA 4XUXA 2O0YA 2QHKA 1JWZA 1F2KA 2Y8HA 3LI9A 2Q9MA 3BFEA 2W27A 1SHVA 3A0VA 5DTKA 3VP2A 1YAXA 1F9IA 4WELA 3FWLA 1E3UD 1BTLA 5FQIA 4R70A 3G4PA 2X02A 5CHMA 4JXVA 4L9EA 3UMEA 4BMWA 3M6BA 4WYYA 3QP1A 1BLCA 1LSVA 3EGXC 1N9OA 1N4OA 5CRFA 3VFHA 3IX8A 1ZHHB 5I94A 2Y2HA 2VJWA 2V8FA 2O9AA 3BEBA 4CPKA 3T4OA 1LHYA 1S66L 4H6JA 2EFUA 3T4SA 2HDUA 3UPOA 4BJPA 1G6AA 3F1PA 4BWIA 3F1OA 4R4RA 3OPRA 3LIBA 1Y54A 1NZOA 1L3LA 3KSFA 3UE3A 2RCXA 2XQZA 2L0WA 5A90A 3LR4A 2PR5A 2D02A 4X68A 3JVUA 1G5UA 3NY4A 3VP3A 3UB8A 2Y2KA 3HL9A 3LFVA 2FFFB 5HL1A 1HTZA 2H5SA 3K3DA 2ZC3B 4NXFA 3B42A 3UO9A 4GZBA 3SW1A 3NDEA 3N7WA 2P04A 4HP4A 1S1YA 3IWIA 5L2FA 3MQQA 1G6OA 2JC7A 3A0SA 4KQQA 3UN7A 4LGWA 2ZC6B 3CUEA 1DJBA 2WKIA 3OBFA 3UDIA 4Z9QA 1W79A 4LFUA 3GSGA 4PKYA 5EE8A 5F1FA 3OOVA 3IF6A 3HBRA 2I9VA 1VEUB 4X55A 2CC1A 5KSHA 3ITBA 2PU2A 2HF6A 4QD4A 4PM5A 4NXEA 3PBTA 5CGWA 5HAIA 1YT4A 4ME4A 1W5DA 1PWDA 1XGJA 1QMFA 1XXMA 2XA7M 2VGJA 4JF5A 4ETZA 4EXOA 5FQ9A 1JNUA 4MN5A 3ZNYA 2VGLS 3IXGA 4F3LA 3B3XA 3HJKA 2OLVA 2G2WA 4EUVA 4L9FA 4G3VA 2ZQAA 2HP5A 1XGIA 2HPBA 1J3WA 4GB7A 1AXBA 1L0EA 5MC7A 1NY0A 5J3WA 3EWKA 1MPLA 4GS9B 1IYQA 2ZD8A 1LSXA 5J8XA 5FSRA 2VGLM 3S7PA 4EQ1A 1WYCA 3LEQA 3DAVA 3BWLA 5FASA 4CLCC 1DY6A 2OLUA 4PM8A 5CX7A 2WYXA 3HCYA 2JN7A 3VP1A 2Y4AA 1FILA 4IVIA 1ESIA 5EVIB 1IYPA 4HEFA 1BZAA 5U47A 3C30A 2IA2A 2HGVA 3O86A 5IS1A 2G2UA 1CEFA 3G2YA 3IXDA 4IHQA 3ZG5A 1IELA 2GDNA 5HWWA 3UE0A 1FSYA 3SS4A 2B95A 3EEAA 4P85A 3QP4A 4IUHA 5L09A 3AGDA 3GRJA 3AGEA 4F94A 4CLCE 2ZQ9A 3H82B 4GLQA 4NEED 5G18A 1KGGA 1YLTA 2P7JA 5FQMA 4HIAA 2EWWA 1YMSA 3Q07A 2B18A 4QY5A 3LCEA 2JKFA 5J4EA 1YMXA 4MCWA 3FPVA 5I5LA 2ZM2A 1CQAA
chains in the Genus database with same CATH topology
3W4PA 3HLCA 2HP9A 3BFDA 4OONA 1XP4A 1KE4A 3VSLA 4RVAA 2HP6A 4K91A 3OCNA 4OQ0A 4LV3A 5AQ7A 3WS4A 3PAEA 1CK3A 3ZNTA 4S2PA 4N1HA 1FOFA 1PIOA 5IHVA 3G34A 1XKZA 3BFGA 2DRWA 1PYYA 3ZFZA 1L0DA 1ALQA 1GA9A 1TDGA 2H10A 3VSKA 3TOIA 1PWCA 2P9VB 5CGXA 5CERA 4E3LA 3Q81A 4BD0A 5GHXA 3QHYA 4GN2A 1EI5A 3CZDA 4MBFA 3OCLA 3HLEA 4JLFA 4WEJA 3N8SA 3P09A 4Y7PA 1ES4A 5GLDA 3UDFA 4OQHA 1GA0A 3G2ZA 2WGIA 4OP5A 4ID4A 4UA7A 4MLLA 4X53A 4WZ4A 3TSGA 3HLDA 4JXWA 4Y0UA 5A93A 3TG9A 4RX3A 5HFOA 2Q9NA 2Y55A 4MBKA 2IWDA 2ZQCA 5BOHA 2WAFA 3GQZA 3MZEA 5FQJA 4P87A 4X6TA 1KVMA 1ES3A 3IXHA 4S2KA 5FAPA 4E6WA 2V20A 4FD8A 3N8RA 3CG5A 1C3BA 1S6RA 4PM7A 1JVJA 2EXBA 5GLCA 4LCMA 1YLPA 1NXYA 1FCNA 3CMZA 5F82A 1QMEA 3BRMA 4JXSA 2WZXA 3HUNA 3PBSA 3IWQA 4K0WA 3FKWA 5JYPA 5EECA 5FATA 2FFYA 1BULA 1CEGA 2J8YA 2R9XA 1HD8A 2A3UA 1MXOA 1K57A 3CJMA 4FH4A 4JKTA 1KE3A 1Q2QA 4KENB 4KG6A 4C6YA 2JCHA 3A3EA 4OPRA 4WM9A 5F1GA 3ZG8B 3QNCA 4E3KA 2ZQ7A 1K54A 1ONGA 3WS1A 2WZZA 3OPHA 4WMCA 5A92A 2P9VA 2HDRA 3A3IA 1WYBA 1SDNA 1M6KA 2XR0A 4QB8A 1HVBA 5FI6A 3NIAA 4BL3A 1G68A 4BL2A 4OKPA 2WKHA 2J7VA 3FYZA 4PMAA 1OMEA 3A3DA 1K6SA 3NC8A 4JBFA 3LY3A 3M6HA 1FQGA 1GHIA 1K25A 3MXSA 5CEDA 5CECA 3DW0A 3MZDA 3C7VA 5EVLA 2WKEA 4KG2A 1ES5A 4S2NA 4E3NA 4DKIA 2EX9A 1E25A 4OOYA 2EFXA 1BT5A 3HLBA 2Y2LA 4UHUA 1K57C 3Q82A 3ZDJA 2XK1A 3FZCA 5E2FA 4B4XA 2PBYA 3PBQA 5D3OA 2ZJ9A 4KQOA 1K4EA 4GDBA 4XXRA 3ZG9B 1DJCA 2XFSA 3NI9A 3HREA 4H8RA 3GTCA 4WZ5A 1K54C 4B88A 4DE2A 3SH7A 1MY8A 4N92A 3PAGA 1GHPA 2QMIA 1BLHA 4OQGA 3OC2A 4UAAA 4Y0TA 3ZHHA 1E3UA 1FSWA 3VFFA 5CTMA 5HX9A 2Y2QA 3ZVWA 4R0QA 2UWXA 2RL3A 3ZVTA 5AQAA 2JBFA 4CJNA 3ZCZA 4OQIA 3FKVA 4DXBA 4EBPA 4YINA 3IQAA 4S2NC 3SS3A 3D4FA 4E6XA 1W8YA 4L0LA 5EVIA 2Y2NA 4FSFA 1RGZA 1O07A 5E2GA 4ZJ1A 3BLSA 1I5QA 1L0GA 4RX2A 2OV5A 4R23A 4Q8IA 5M18A 3MKEA 1KDWA 3P98A 4LV1A 3RJUA 2ZM8A 4WZ5C 2BLSA 4U0XA 1NJ4A 4ZDXA 3GV9A 1FR1A 3S4XA 2I72A 1GHMA 4JF6A 3VOZA 2Y59A 5EOOA 1MKIA 3C7UA 1W7FA 5CTNA 5GLAA 3W4QA 4E3IA 4RYEA 1PWGA 1NYMA 3FV7A 5E43A 4OH0A 3V39A 3BYDA 4WMCD 5DTSA 5HAPA 1LL9A 3IF5A 3EQVA 5EUAA 3UY6A 4S2LA 4Y0OA 3VOYA 3W4OA 1IYSA 3WS0A 3GMWA 3G31A 4P0MA 3DTMA 5GL9A 3UPNA 4OVDA 1K55A 3N8LA 5EVIC 1ERMA 4HESA 4GKUA 2Y91A 4C3QA 4EUZA 3BLMA 3IWOA 4OOMA 4GDNA 4UA9A 4PM6A 3UPPA 4XUXA 4ZJ2A 3S22A 5EPHA 4EBNA 4IBXA 1FCMA 1JWZA 4PPRA 4KZ9A 5DF8A 4LV2A 4OLDA 3PBNA 2Q9MA 2EX8A 5CGSA 1TDLA 1ZG6A 2ZLYA 3BFEA 1SHVA 4K0XA 3VP4A 4DXCA 5KMWA 5DTKA 2XF3A 3VP2A 3ITAA 4JPMA 3V3SA 5M1AA 3SH9A 5TGFA 3C4OA 1JWVA 4E3MA 4S2MA 5FI2A 3ZGAB 4WELA 1BUEA 2Z2LB 1FCOA 3NDGA 4KZBA 3FWLA 1E3UD 3IHAA 4D2OA 1SCWA 1BTLA 1K55C 5DTTA 5FQIA 2Z2MB 1LLBA 3IH8A 4GOGA 3G4PA 4C75A 5FA7A 2X02A 5CHMA 4JXVA 1L0FA 1IKGA 3PBRA 1H8YA 5FAQA 1LL5A 2ZQ8A 3M6BA 4WYYA 5EVID 4S2OA 3C4PA 1BLCA 4OLGA 4RA7A 5KZHA 4KZ3A 3VFHA 1N4OA 5CRFA 4OP8A 5I94A 2Y2HA 3VMAA 3MBZA 3BEBA 2XH9A 1PZOA 2ZM2A 2IWBA 4CPKA 1LHYA 2V2FF 3Q7VB 2Y2GA 2EFUA 3OPPA 2EX2A 2WUQA 1W8QA 2HDUA 5HARA 3UPOA 4BD1A 5E2HA 4BJPA 1ERQA 4E3OA 3G32A 4BENA 1KDSA 2DNSA 4E3JA 1G6AA 3Q7ZA 1YM1A 1HZOA 5TFQA 1RGYA 1YQSA 1JTDA 4DRTA 4O7DA 3SS5A 3WWXA 2ZC7A 3NBLA 4R4RA 4GNUA 3OPRA 4KZ4A 3RXXA 1CI8A 1KGEA 1Y54A 1NZUA 1NZOA 4HBUA 2EX6A 3A3JA 2BG1A 1ONHA 3LY4A 5AQBA 3UE3A 4KQRA 3IF6B 2RCXA 1MWRA 2E8IA 2XQZA 4FCFA 1IYOA 1E4DA 5A90A 3M2KA 1MWSA 4X68A 3BM6A 1K56A 3VP3A 3NY4A 2Y2KA 4R4SA 3HL9A 3VP0A 2FFFB 5HL1A 3JYIA 4IVKA 3UNWA 1HTZA 4PM9A 4KZ8A 2H5SA 2ZC3B 4DE0A 3E2LA 3UO9A 1I2SA 2J9PA 4GZBA 3NDEA 3N7WA 2X01A 3HLGA 2WGWB 1DJAA 1VQQA 3EQUA 4EWFA 2XEPA 3IWIA 2H0TA 5L2FA 2JC7A 2XGNA 4JF4A 1EWZA 3DWZA 3M2JA 3S1YA 2VGKA 4KQQA 3UN7A 3IHBA 1Q2PA 1CI9A 4EBLA 2ZC6B 5HAQA 1DJBA 2WKIA 3OPLA 1JWPA 1XA1A 4LCLA 3UDIA 1NRFA 4P6BA 1MWUA 1NYYA 4Z9QA 3BECA 3V3RA 1PI4A 2EXAA 1K38A 1W79A 1KE0A 4NETA 3GSGA 5EE8A 1PI5A 1WE4A 1IEMA 3AGFA 4JXGA 5F1FA 3SOIA 2ZM0A 4MBHA 3V50A 1ZG4A 5GHZA 1IKIA 1FR6A 1BSGA 3IF6A 1O7EA 3HBRA 1KGFA 3IH9A 4X55A 4N9KA 2CC1A 3MKFA 4R1GA 5KSHA 3ITBA 2PU2A 1XA7A 2H0YA 4X56A 4QD4A 4N9LA 1YLJA 5E2EA 4PM5A 3RXWA 1K6RA 5CHJA 3HLFA 3ZG7B 3PBTA 5CGWA 4ZTKA 4GD6A 5HAIA 4QU3A 1K4FA 1YT4A 2V1ZA 4R3BA 5DF9A 1W5DA 3E2KA 1PWDA 3LO7A 1K56D 5FI7A 4S2JA 1XGJA 4OPYA 1SKFA 1QMFA 4LV0A 4QJGA 4QHCA 2HDQA 2XD1A 1KVLA 3DWKA 1XXMA 1LI9A 2VGJA 2XLNA 2ZC4B 3QNBA 4JF5A 4BLMA 2WGWA 4M3KA 3IF6C 3UDXA 5KSCA 4U0TA 5FQ9A 3ZNYA 3NCKA 1ZC2A 3IXGA 4EV4A 2WGVA 2R9WA 3IXBA 5DF7A 3B3XA 3O87A 2OLVA 2G2WA 4KZ7A 3IT9A 3G35A 2Y2OA 5CEBA 2ZQAA 2HP5A 1XGIA 2HPBA 4GB7A 1AXBA 1ZKJA 3Q1FA 1L0EA 1PZPA 2Y2PA 1NY0A 4WEKA 1XPBA 5AQ9A 4BQMA 2B5RA 1MPLA 1IYQA 2ZD8A 5GHYA 1BLPA 3OZHA 3G30A 4A5RA 5A91A 4YFMA 5J8XA 1ES2A 5FSRA 2Y2JA 1WYCA 1SDEA 5CHUA 2WAEA 3MXRA 2XD5A 4OOLA 5FASA 3WS2A 1DY6A 1J9MA 2OLUA 4PM8A 4ZAMA 2WYXA 3V5MA 4X69A 1EROA 4DF6A 2J9OA 3GVBA 1H5XA 4FH2A 4GD8A 2P74A 5DVAA 3O3VA 3C5AA 1U60A 1YLZA 1YLYA 3VP1A 2Y4AA 4IVIA 4IEDA 1ESIA 4KZ6A 4UA6A 1IYPA 4MEZA 5EVIB 5HW3A 4HEFA 1BZAA 3I7JA 3PTEA 4IBRA 2QZ6A 1H8ZA 1ESUA 2ZQDA 5U47A 3W8KA 4ZBEA 5CXWA 4R3JA 3O86A 1PW1A 2G2UA 3MFDA 1PW8A 4U3TA 2IWCA 1CEFA 3G2YA 3N6IA 4DE3A 3IXDA 3UE1A 3A3FA 3HUOA 4LENA 2C6WB 4DDSA 2OSUA 1M40A 4QY6A 4KZAA 3ZG5A 1IELA 4DDYA 3WRZA 2GDNA 5FDHA 3UE0A 2QPNA 1FSYA 3SS4A 1GCEA 5FQKA 3ISGA 1VM1A 4P85A 1BLSA 1S0WA 2PU4A 2X71A 3LEZA 1L2SA 3HLWA 3AGDA 1YLWA 4ZJ3A 3GRJA 3AGEA 1Z6FA 2XFTA 4NK3A 3GR2A 4B4ZA 2ZC5B 2ZMAA 2ZQ9A 4F94A 3MZFA 4N1XA 5EOEA 5GLBA 3ZG0A 4KZ5A 3WRTA 2HDSA 2XDMA 5FQQA 3BFFA 1MWTA 3Q7VA 3PBOA 5G18A 1N9BA 1MBLA 1KGGA 1YLTA 5FAOA 1I2WA 1TEMA 2WK0A 2DCFA 3BFCA 5FQMA 4OPQA 5JYOA 4XUZA 5F83A 5TR7A 4KG5A 1LI0A 2C5WB 3HUMA 1TVFA 2A49A 1YMSA 3Q07A 4EQIA 1JTGA 1XX2A 4MNRA 4WBGA 5M19A 4QY5A 4HBTA 3LCEA 2WADA 3HVFA 3O88A 2Y2MA 4OPZA 4S2IA 3N4IA 4DE1A 1RP5A 1RCJA 1YMXA 3SH8A 3WS5A 2JE5A 2Y2IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3W4P A;  3HLC A;  2HP9 A;  3BFD A;  4OON A;  1XP4 A;  1KE4 A;  3VSL A;  4RVA A;  2HP6 A;  4K91 A;  3OCN A;  4OQ0 A;  4LV3 A;  5AQ7 A;  3WS4 A;  3PAE A;  1CK3 A;  3ZNT A;  4S2P A;  4N1H A;  1FOF A;  1PIO A;  5IHV A;  3G34 A;  1XKZ A;  3BFG A;  2DRW A;  1PYY A;  3ZFZ A;  1L0D A;  1ALQ A;  1GA9 A;  1TDG A;  2H10 A;  3VSK A;  3TOI A;  1PWC A;  2P9V B;  5CGX A;  5CER A;  4E3L A;  3Q81 A;  4BD0 A;  5GHX A;  3QHY A;  4GN2 A;  1EI5 A;  3CZD A;  4MBF A;  3OCL A;  3HLE A;  4JLF A;  4WEJ A;  3N8S A;  3P09 A;  4Y7P A;  1ES4 A;  5GLD A;  3UDF A;  4OQH A;  1GA0 A;  3G2Z A;  2WGI A;  4OP5 A;  4ID4 A;  4UA7 A;  4MLL A;  4X53 A;  4WZ4 A;  3TSG A;  3HLD A;  4JXW A;  4Y0U A;  5A93 A;  3TG9 A;  4RX3 A;  5HFO A;  2Q9N A;  2Y55 A;  4MBK A;  2IWD A;  2ZQC A;  5BOH A;  2WAF A;  3GQZ A;  3MZE A;  5FQJ A;  4P87 A;  4X6T A;  1KVM A;  1ES3 A;  3IXH A;  4S2K A;  5FAP A;  4E6W A;  2V20 A;  4FD8 A;  3N8R A;  3CG5 A;  1C3B A;  1S6R A;  4PM7 A;  1JVJ A;  2EXB A;  5GLC A;  4LCM A;  1YLP A;  1NXY A;  1FCN A;  3CMZ A;  5F82 A;  1QME A;  3BRM A;  4JXS A;  2WZX A;  3HUN A;  3PBS A;  3IWQ A;  4K0W A;  3FKW A;  5JYP A;  5EEC A;  5FAT A;  2FFY A;  1BUL A;  1CEG A;  2J8Y A;  2R9X A;  1HD8 A;  2A3U A;  1MXO A;  1K57 A;  3CJM A;  4FH4 A;  4JKT A;  1KE3 A;  1Q2Q A;  4KEN B;  4KG6 A;  4C6Y A;  2JCH A;  3A3E A;  4OPR A;  4WM9 A;  5F1G A;  3ZG8 B;  3QNC A;  4E3K A;  2ZQ7 A;  1K54 A;  1ONG A;  3WS1 A;  2WZZ A;  3OPH A;  4WMC A;  5A92 A;  2P9V A;  2HDR A;  3A3I A;  1WYB A;  1SDN A;  1M6K A;  2XR0 A;  4QB8 A;  1HVB A;  5FI6 A;  3NIA A;  4BL3 A;  1G68 A;  4BL2 A;  4OKP A;  2WKH A;  2J7V A;  3FYZ A;  4PMA A;  1OME A;  3A3D A;  1K6S A;  3NC8 A;  4JBF A;  3LY3 A;  3M6H A;  1FQG A;  1GHI A;  1K25 A;  3MXS A;  5CED A;  5CEC A;  3DW0 A;  3MZD A;  3C7V A;  5EVL A;  2WKE A;  4KG2 A;  1ES5 A;  4S2N A;  4E3N A;  4DKI A;  2EX9 A;  1E25 A;  4OOY A;  2EFX A;  1BT5 A;  3HLB A;  2Y2L A;  4UHU A;  1K57 C;  3Q82 A;  3ZDJ A;  2XK1 A;  3FZC A;  5E2F A;  4B4X A;  2PBY A;  3PBQ A;  5D3O A;  2ZJ9 A;  4KQO A;  1K4E A;  4GDB A;  4XXR A;  3ZG9 B;  1DJC A;  2XFS A;  3NI9 A;  3HRE A;  4H8R A;  3GTC A;  4WZ5 A;  1K54 C;  4B88 A;  4DE2 A;  3SH7 A;  1MY8 A;  4N92 A;  3PAG A;  1GHP A;  2QMI A;  1BLH A;  4OQG A;  3OC2 A;  4UAA A;  4Y0T A;  3ZHH A;  1E3U A;  1FSW A;  3VFF A;  5CTM A;  5HX9 A;  2Y2Q A;  3ZVW A;  4R0Q A;  2UWX A;  2RL3 A;  3ZVT A;  5AQA A;  2JBF A;  4CJN A;  3ZCZ A;  4OQI A;  3FKV A;  4DXB A;  4EBP A;  4YIN A;  3IQA A;  4S2N C;  3SS3 A;  3D4F A;  4E6X A;  1W8Y A;  4L0L A;  5EVI A;  2Y2N A;  4FSF A;  1RGZ A;  1O07 A;  5E2G A;  4ZJ1 A;  3BLS A;  1I5Q A;  1L0G A;  4RX2 A;  2OV5 A;  4R23 A;  4Q8I A;  5M18 A;  3MKE A;  1KDW A;  3P98 A;  4LV1 A;  3RJU A;  2ZM8 A;  4WZ5 C;  2BLS A;  4U0X A;  1NJ4 A;  4ZDX A;  3GV9 A;  1FR1 A;  3S4X A;  2I72 A;  1GHM A;  4JF6 A;  3VOZ A;  2Y59 A;  5EOO A;  1MKI A;  3C7U A;  1W7F A;  5CTN A;  5GLA A;  3W4Q A;  4E3I A;  4RYE A;  1PWG A;  1NYM A;  3FV7 A;  5E43 A;  4OH0 A;  3V39 A;  3BYD A;  4WMC D;  5DTS A;  5HAP A;  1LL9 A;  3IF5 A;  3EQV A;  5EUA A;  3UY6 A;  4S2L A;  4Y0O A;  3VOY A;  3W4O A;  1IYS A;  3WS0 A;  3GMW A;  3G31 A;  4P0M A;  3DTM A;  5GL9 A;  3UPN A;  4OVD A;  1K55 A;  3N8L A;  5EVI C;  1ERM A;  4HES A;  4GKU A;  2Y91 A;  4C3Q A;  4EUZ A;  3BLM A;  3IWO A;  4OOM A;  4GDN A;  4UA9 A;  4PM6 A;  3UPP A;  4XUX A;  4ZJ2 A;  3S22 A;  5EPH A;  4EBN A;  4IBX A;  1FCM A;  1JWZ A;  4PPR A;  4KZ9 A;  5DF8 A;  4LV2 A;  4OLD A;  3PBN A;  2Q9M A;  2EX8 A;  5CGS A;  1TDL A;  1ZG6 A;  2ZLY A;  3BFE A;  1SHV A;  4K0X A;  3VP4 A;  4DXC A;  5KMW A;  5DTK A;  2XF3 A;  3VP2 A;  3ITA A;  4JPM A;  3V3S A;  5M1A A;  3SH9 A;  5TGF A;  3C4O A;  1JWV A;  4E3M A;  4S2M A;  5FI2 A;  3ZGA B;  4WEL A;  1BUE A;  2Z2L B;  1FCO A;  3NDG A;  4KZB A;  3FWL A;  1E3U D;  3IHA A;  4D2O A;  1SCW A;  1BTL A;  1K55 C;  5DTT A;  5FQI A;  2Z2M B;  1LLB A;  3IH8 A;  4GOG A;  3G4P A;  4C75 A;  5FA7 A;  2X02 A;  5CHM A;  4JXV A;  1L0F A;  1IKG A;  3PBR A;  1H8Y A;  5FAQ A;  1LL5 A;  2ZQ8 A;  3M6B A;  4WYY A;  5EVI D;  4S2O A;  3C4P A;  1BLC A;  4OLG A;  4RA7 A;  5KZH A;  4KZ3 A;  3VFH A;  1N4O A;  5CRF A;  4OP8 A;  5I94 A;  2Y2H A;  3VMA A;  3MBZ A;  3BEB A;  2XH9 A;  1PZO A;  2ZM2 A;  2IWB A;  4CPK A;  1LHY A;  2V2F F;  3Q7V B;  2Y2G A;  2EFU A;  3OPP A;  2EX2 A;  2WUQ A;  1W8Q A;  2HDU A;  5HAR A;  3UPO A;  4BD1 A;  5E2H A;  4BJP A;  1ERQ A;  4E3O A;  3G32 A;  4BEN A;  1KDS A;  2DNS A;  4E3J A;  1G6A A;  3Q7Z A;  1YM1 A;  1HZO A;  5TFQ A;  1RGY A;  1YQS A;  1JTD A;  4DRT A;  4O7D A;  3SS5 A;  3WWX A;  2ZC7 A;  3NBL A;  4R4R A;  4GNU A;  3OPR A;  4KZ4 A;  3RXX A;  1CI8 A;  1KGE A;  1Y54 A;  1NZU A;  1NZO A;  4HBU A;  2EX6 A;  3A3J A;  2BG1 A;  1ONH A;  3LY4 A;  5AQB A;  3UE3 A;  4KQR A;  3IF6 B;  2RCX A;  1MWR A;  2E8I A;  2XQZ A;  4FCF A;  1IYO A;  1E4D A;  5A90 A;  3M2K A;  1MWS A;  4X68 A;  3BM6 A;  1K56 A;  3VP3 A;  3NY4 A;  2Y2K A;  4R4S A;  3HL9 A;  3VP0 A;  2FFF B;  5HL1 A;  3JYI A;  4IVK A;  3UNW A;  1HTZ A;  4PM9 A;  4KZ8 A;  2H5S A;  2ZC3 B;  4DE0 A;  3E2L A;  3UO9 A;  1I2S A;  2J9P A;  4GZB A;  3NDE A;  3N7W A;  2X01 A;  3HLG A;  2WGW B;  1DJA A;  1VQQ A;  3EQU A;  4EWF A;  2XEP A;  3IWI A;  2H0T A;  5L2F A;  2JC7 A;  2XGN A;  4JF4 A;  1EWZ A;  3DWZ A;  3M2J A;  3S1Y A;  2VGK A;  4KQQ A;  3UN7 A;  3IHB A;  1Q2P A;  1CI9 A;  4EBL A;  2ZC6 B;  5HAQ A;  1DJB A;  2WKI A;  3OPL A;  1JWP A;  1XA1 A;  4LCL A;  3UDI A;  1NRF A;  4P6B A;  1MWU A;  1NYY A;  4Z9Q A;  3BEC A;  3V3R A;  1PI4 A;  2EXA A;  1K38 A;  1W79 A;  1KE0 A;  4NET A;  3GSG A;  5EE8 A;  1PI5 A;  1WE4 A;  1IEM A;  3AGF A;  4JXG A;  5F1F A;  3SOI A;  2ZM0 A;  4MBH A;  3V50 A;  1ZG4 A;  5GHZ A;  1IKI A;  1FR6 A;  1BSG A;  3IF6 A;  1O7E A;  3HBR A;  1KGF A;  3IH9 A;  4X55 A;  4N9K A;  2CC1 A;  3MKF A;  4R1G A;  5KSH A;  3ITB A;  2PU2 A;  1XA7 A;  2H0Y A;  4X56 A;  4QD4 A;  4N9L A;  1YLJ A;  5E2E A;  4PM5 A;  3RXW A;  1K6R A;  5CHJ A;  3HLF A;  3ZG7 B;  3PBT A;  5CGW A;  4ZTK A;  4GD6 A;  5HAI A;  4QU3 A;  1K4F A;  1YT4 A;  2V1Z A;  4R3B A;  5DF9 A;  1W5D A;  3E2K A;  1PWD A;  3LO7 A;  1K56 D;  5FI7 A;  4S2J A;  1XGJ A;  4OPY A;  1SKF A;  1QMF A;  4LV0 A;  4QJG A;  4QHC A;  2HDQ A;  2XD1 A;  1KVL A;  3DWK A;  1XXM A;  1LI9 A;  2VGJ A;  2XLN A;  2ZC4 B;  3QNB A;  4JF5 A;  4BLM A;  2WGW A;  4M3K A;  3IF6 C;  3UDX A;  5KSC A;  4U0T A;  5FQ9 A;  3ZNY A;  3NCK A;  1ZC2 A;  3IXG A;  4EV4 A;  2WGV A;  2R9W A;  3IXB A;  5DF7 A;  3B3X A;  3O87 A;  2OLV A;  2G2W A;  4KZ7 A;  3IT9 A;  3G35 A;  2Y2O A;  5CEB A;  2ZQA A;  2HP5 A;  1XGI A;  2HPB A;  4GB7 A;  1AXB A;  1ZKJ A;  3Q1F A;  1L0E A;  1PZP A;  2Y2P A;  1NY0 A;  4WEK A;  1XPB A;  5AQ9 A;  4BQM A;  2B5R A;  1MPL A;  1IYQ A;  2ZD8 A;  5GHY A;  1BLP A;  3OZH A;  3G30 A;  4A5R A;  5A91 A;  4YFM A;  5J8X A;  1ES2 A;  5FSR A;  2Y2J A;  1WYC A;  1SDE A;  5CHU A;  2WAE A;  3MXR A;  2XD5 A;  4OOL A;  5FAS A;  3WS2 A;  1DY6 A;  1J9M A;  2OLU A;  4PM8 A;  4ZAM A;  2WYX A;  3V5M A;  4X69 A;  1ERO A;  4DF6 A;  2J9O A;  3GVB A;  1H5X A;  4FH2 A;  4GD8 A;  2P74 A;  5DVA A;  3O3V A;  3C5A A;  1U60 A;  1YLZ A;  1YLY A;  3VP1 A;  2Y4A A;  4IVI A;  4IED A;  1ESI A;  4KZ6 A;  4UA6 A;  1IYP A;  4MEZ A;  5EVI B;  5HW3 A;  4HEF A;  1BZA A;  3I7J A;  3PTE A;  4IBR A;  2QZ6 A;  1H8Z A;  1ESU A;  2ZQD A;  5U47 A;  3W8K A;  4ZBE A;  5CXW A;  4R3J A;  3O86 A;  1PW1 A;  2G2U A;  3MFD A;  1PW8 A;  4U3T A;  2IWC A;  1CEF A;  3G2Y A;  3N6I A;  4DE3 A;  3IXD A;  3UE1 A;  3A3F A;  3HUO A;  4LEN A;  2C6W B;  4DDS A;  2OSU A;  1M40 A;  4QY6 A;  4KZA A;  3ZG5 A;  1IEL A;  4DDY A;  3WRZ A;  2GDN A;  5FDH A;  3UE0 A;  2QPN A;  1FSY A;  3SS4 A;  1GCE A;  5FQK A;  3ISG A;  1VM1 A;  4P85 A;  1BLS A;  1S0W A;  2PU4 A;  2X71 A;  3LEZ A;  1L2S A;  3HLW A;  3AGD A;  1YLW A;  4ZJ3 A;  3GRJ A;  3AGE A;  1Z6F A;  2XFT A;  4NK3 A;  3GR2 A;  4B4Z A;  2ZC5 B;  2ZMA A;  2ZQ9 A;  4F94 A;  3MZF A;  4N1X A;  5EOE A;  5GLB A;  3ZG0 A;  4KZ5 A;  3WRT A;  2HDS A;  2XDM A;  5FQQ A;  3BFF A;  1MWT A;  3Q7V A;  3PBO A;  5G18 A;  1N9B A;  1MBL A;  1KGG A;  1YLT A;  5FAO A;  1I2W A;  1TEM A;  2WK0 A;  2DCF A;  3BFC A;  5FQM A;  4OPQ A;  5JYO A;  4XUZ A;  5F83 A;  5TR7 A;  4KG5 A;  1LI0 A;  2C5W B;  3HUM A;  1TVF A;  2A49 A;  1YMS A;  3Q07 A;  4EQI A;  1JTG A;  1XX2 A;  4MNR A;  4WBG A;  5M19 A;  4QY5 A;  4HBT A;  3LCE A;  2WAD A;  3HVF A;  3O88 A;  2Y2M A;  4OPZ A;  4S2I A;  3N4I A;  4DE1 A;  1RP5 A;  1RCJ A;  1YMX A;  3SH8 A;  3WS5 A;  2JE5 A;  2Y2I A; 
#chains in the Genus database with same CATH topology
 3HLC A;  2HP9 A;  1KE4 A;  5F5Y A;  3OCN A;  3KO6 A;  3KSG A;  3PAE A;  1V9Z A;  5IHV A;  1XKZ A;  1L0D A;  1ALQ A;  1GA9 A;  4EER A;  2H10 A;  3EGD C;  2P9V B;  4E3L A;  2MJ6 A;  3QHY A;  3GDI A;  1T19 A;  1Z09 A;  5HPI A;  3OCL A;  4WEJ A;  2WGI A;  1BYW A;  4O8G A;  4OP5 A;  4UA7 A;  4X53 A;  4WZ4 A;  4Y0U A;  4BBU A;  2Q9N A;  2ZMV A;  4JGO A;  1KVM A;  2GJ3 A;  3GEC A;  4IJG A;  2PR6 A;  1C3B A;  2EXB A;  5GLC A;  2BAS A;  1YLP A;  1QME A;  4HP9 A;  4HH2 A;  3IWQ A;  1VEU A;  3FKW A;  4Q0J A;  5FAT A;  4KQD A;  1CEG A;  2J8Y A;  4Z1W A;  5EM1 A;  2R9X A;  4JKT A;  1KE3 A;  4C6Y A;  2JCH A;  1P0Z A;  2LB9 A;  3ZG8 B;  4B93 A;  4E3K A;  1K54 A;  4WMC A;  3A3I A;  1WYB A;  3UB6 A;  4BL3 A;  1G68 A;  1K6S A;  1NRJ A;  5EVE A;  2LB5 A;  2VV6 A;  3MZD A;  2OWH A;  4S2N A;  3F1N B;  2Y2L A;  1K57 C;  5E2F A;  3NEC A;  3PBQ A;  1SKO B;  4KQO A;  4GDB A;  4XXR A;  3LIE A;  3QP5 A;  2XFS A;  3NI9 A;  3HRE A;  4B88 A;  3GTC A;  3PAG A;  1CF0 A;  3ZYT A;  3OC2 A;  5CTM A;  1FIK A;  1W63 M;  1SZV A;  4CJN A;  5HSQ A;  3FKV A;  4UEY A;  4YIN A;  2K31 A;  3D4F A;  3PHY A;  4L0L A;  5EVI A;  5F69 A;  2Y79 A;  5E2G A;  3BLS A;  5M18 A;  4X1L A;  4HJ4 A;  1KDW A;  3P98 A;  4LV1 A;  3LR5 A;  3UB5 P;  2ZM8 A;  1FR1 A;  3S4X A;  1GHM A;  4LRZ E;  4HJ3 A;  2Y59 A;  5EOO A;  1HLU P;  5GLA A;  2V0U A;  3FV7 A;  5FEG A;  1LL9 A;  3IF5 A;  3MSH A;  3W4O A;  2PYP A;  3GMW A;  3G31 A;  5GL9 A;  1K55 A;  3TW8 A;  4GKU A;  2JKT I;  3BLM A;  3IWO A;  2Z6C A;  5EPH A;  5DF8 A;  1FCM A;  4PPR A;  4KZ9 A;  3C38 A;  3F1P B;  4LV2 A;  4OLD A;  3KYQ A;  3TRC A;  5AJG A;  3S7Q A;  2VX8 A;  2ZLY A;  4K0X A;  5KMW A;  4G3K A;  2XF3 A;  1IOU A;  3ITA A;  3V3S A;  5M1A A;  4E3M A;  3ZGA B;  2W1R A;  1BUE A;  1DRM A;  2Z2L B;  4KZB A;  3E4O A;  3IHA A;  5DTT A;  4DMZ A;  4C75 A;  5FA7 A;  4NXG A;  5FAQ A;  4GHI A;  3ICY A;  4S2O A;  4GJ4 A;  4RA7 A;  3S7N A;  5KZH A;  4KZ3 A;  4OP8 A;  4WL9 A;  4LRX C;  2XH9 A;  1PZO A;  3DTK A;  1WA9 A;  3Q7V B;  2Y2G A;  5HAR A;  4BD1 A;  5E2H A;  4Y15 A;  1ERQ A;  4E3O A;  3KSH A;  4LRY C;  4PAU A;  4ETX A;  3FG8 A;  4ESP A;  5L8M A;  4DRT A;  3SS5 A;  2OAP 1;  4MDZ A;  4KZ4 A;  3RXX A;  5HWT A;  3MQ0 A;  3A3J A;  2BG1 A;  2A24 B;  1ONH A;  1P97 A;  3LY4 A;  3IF6 B;  4LPZ A;  1MWR A;  2E8I A;  1E4D A;  2PHY A;  1K56 A;  2W3E A;  3H7W A;  4R4S A;  3JYI A;  2V9A A;  4PM9 A;  4KZ8 A;  1CJF A;  2V0W A;  4DE0 A;  1I2S A;  2J9P A;  2V1A A;  4KUO A;  4HH3 A;  3K3C A;  1DJA A;  1VQQ A;  3EQU A;  4DN0 A;  4EWF A;  4F3L B;  2H0T A;  2XGN A;  3A0R A;  4JF4 A;  1EWZ A;  5F6A A;  1JWP A;  1XA1 A;  4P6B A;  1NYY A;  2EXA A;  3H9W A;  4NET A;  1WE4 A;  3SZT A;  3F1N A;  3SOI A;  3K2N A;  1ZG4 A;  5GHZ A;  1S4S A;  1FR6 A;  1O7E A;  3NOU C;  3TE8 A;  1F98 A;  2ZL1 B;  3MKF A;  4R1G A;  3MXQ A;  1DP6 A;  1XA7 A;  2H0Y A;  4N9L A;  1K6R A;  1N9L A;  2WKR A;  2J3W A;  4LV0 A;  4QJG A;  4QHC A;  4AFI A;  1KVL A;  1LI9 A;  2GZA A;  2ZC4 B;  1EW0 A;  2WGW A;  4M3K A;  2VLG A;  3UDX A;  4U0T A;  3G6O A;  1H3Q A;  2L4R A;  2VK3 A;  4WN5 A;  1NLZ A;  2AVX A;  3IXB A;  5DF7 A;  5EV0 A;  3L7H A;  4KZ7 A;  2W3D A;  3IT9 A;  2Y2O A;  2HV1 A;  4I38 A;  1S4R A;  1T1C A;  1ZKJ A;  4BQM A;  1P9R A;  1XPB A;  5AQ9 A;  1G28 A;  1NWZ A;  4FOF A;  4YFM A;  1ES2 A;  1GSV A;  1DP8 A;  5CHU A;  1SDE A;  3LUQ A;  1NLY A;  1ERO A;  3GVB A;  5DVA A;  2J3T D;  1YLY A;  4UA6 A;  5TBM A;  4EET B;  3I7J A;  4IBR A;  2QZ6 A;  4PKY G;  4R3J A;  4Y17 A;  4GCZ A;  4YOF A;  3MQO A;  3UE1 A;  4EEP A;  2OSU A;  2QPN A;  1GCE A;  3ISG A;  2G7U A;  1BLS A;  1S0W A;  5FEF A;  3LEZ A;  3HLW A;  1YLW A;  3U4L P;  2XFT A;  4B4Z A;  2ZMA A;  3T4L A;  3WRT A;  2HDS A;  3BJN A;  3Q7V A;  1P9W A;  3PBO A;  1N9B A;  1TF1 A;  1I2W A;  2DCF A;  4GW9 A;  2JKR M;  5TR7 A;  3T1R A;  3HUM A;  3UB7 A;  1TVF A;  2PBD P;  4EQI A;  4WBG A;  3HVF A;  4II7 A;  3N4I A;  1RP5 A;  1OPX A;  3SH8 A;  3WS5 A;  2A24 A;  2YKF A;  3BFD A;  2A2L A;  4RVA A;  2J80 A;  1XJ6 A;  2XA7 S;  2HP6 A;  1T1A A;  4K91 A;  1OTD A;  5AQ7 A;  3VE4 A;  4N1H A;  3G34 A;  2DRW A;  1PYY A;  3ZFZ A;  1TDG A;  3TOI A;  1PWC A;  5CER A;  5GHX A;  2FH5 A;  2Q0O A;  2L1M A;  1ES4 A;  3CWF A;  4HNB A;  2JHE A;  1GA0 A;  2ACG A;  4ID4 A;  1H0M A;  4MLL A;  3TSG A;  5AVF A;  4JXW A;  2IWD A;  5BOH A;  2WAF A;  3GQZ A;  3MZE A;  4E6W A;  4FD8 A;  2W3G A;  4PM7 A;  1YSP A;  1FCN A;  5F82 A;  4JXS A;  2O9C A;  2ZL1 A;  3E4Q A;  2FFY A;  3L9K A;  2M7U A;  1HD8 A;  4KEN B;  4OPR A;  5F1G A;  2ZQ7 A;  3PYP A;  2HDR A;  1SDN A;  1M6K A;  2XR0 A;  1YSQ A;  4BL2 A;  4OKP A;  2J7V A;  3FYZ A;  4PMA A;  3NOP C;  1OTA A;  4JBF A;  3M6H A;  1FQG A;  2OAQ 1;  5CED A;  5CEC A;  1OJG A;  4KG2 A;  1ES5 A;  1E25 A;  2BTF P;  2HZ5 A;  2PD8 A;  4E04 A;  2PBY A;  5D3O A;  2KDK A;  1K4E A;  4WZ5 A;  1OT9 A;  4Y0T A;  1OJ5 A;  1FSW A;  3MF0 A;  5HX9 A;  4R0Q A;  2UWX A;  3ZVT A;  5AQA A;  3ZCZ A;  4OQI A;  4EBP A;  4Y5F A;  4E6X A;  2Z6D A;  3E4P A;  2ZOH A;  1O07 A;  1I5Q A;  1L0G A;  2BLS A;  4U0X A;  1NJ4 A;  4ZDX A;  4MMN A;  4YNR A;  4GHI B;  3RFB A;  4E3I A;  4RYE A;  4JGP A;  3QP2 A;  3V39 A;  5DTS A;  4WMC D;  4YWZ A;  5HAP A;  5EUA A;  3EQV A;  3E0Y A;  1F5M A;  1ACF A;  3UPN A;  3N8L A;  4HES A;  1LSW A;  4OOM A;  4ZJ2 A;  3PBN A;  4JGQ A;  3D72 A;  3KYZ A;  1LL8 A;  3SH9 A;  5EM0 A;  5DKK A;  5TGF A;  3C4O A;  1XFN A;  3NDG A;  1VHM A;  5HDS A;  1LLB A;  3IH8 A;  3H7W B;  3KX0 X;  1H8Y A;  5F68 A;  1LL5 A;  2ZQ8 A;  5EVI D;  4R38 A;  1LT0 A;  5HL6 A;  2INW A;  5G4Z A;  3MFX A;  3MBZ A;  2IWB A;  2V2F F;  2WUQ A;  1W8Q A;  4I3A A;  4BEN A;  1KDS A;  4E3J A;  1RGY A;  1GSW A;  1YQS A;  1JTD A;  4O7D A;  3WWX A;  3NBL A;  1CI8 A;  4HBU A;  2EX6 A;  3VE3 A;  5K5B A;  5AQB A;  3T4J A;  4KQR A;  4FCF A;  5DFX A;  1MWS A;  3BW6 A;  3W2Z A;  3VP0 A;  4IVK A;  5DJU A;  3HJI A;  1OT6 A;  2X01 A;  3HLG A;  2WGW B;  2YKH A;  2KLI A;  2XEP A;  3DWZ A;  3S1Y A;  2VGK A;  3IHB A;  4QPR A;  1Q2P A;  2VV8 A;  4EBL A;  3OPL A;  1NRF A;  1MWU A;  2JKG A;  1PI4 A;  3VV4 A;  3UMD A;  1S67 L;  1YPR A;  2ZM0 A;  3MS6 A;  4MBH A;  1KGF A;  3IH9 A;  3KSI A;  4N9K A;  3MR0 A;  5E2E A;  5CHJ A;  1XJ3 A;  3VOL A;  4GD6 A;  5TBM B;  3CUE C;  4QU3 A;  4R3B A;  4WF0 A;  5DF9 A;  1TS6 A;  4HHD A;  3LO7 A;  1K56 D;  3T1Q B;  4S2J A;  5AVE A;  2J3T C;  2O9B A;  2XD1 A;  1XJ4 A;  2XLN A;  3QNB A;  4BLM A;  3IF6 C;  4CLC A;  5KSC A;  1V9Y A;  2WGV A;  2R9W A;  2O99 A;  3O87 A;  4I3I A;  4I39 A;  3CI6 A;  1S1Z A;  2B5R A;  1K0K A;  1BLP A;  4A5R A;  3PR6 A;  4Y3I A;  3MXR A;  3WS2 A;  2V8C A;  4FTX A;  4QWO A;  3MMH A;  3V5M A;  4X69 A;  4DF6 A;  4FH2 A;  2DMW A;  2P74 A;  1U60 A;  5HW3 A;  4MEZ A;  1ESU A;  2ZQD A;  5CXW A;  4ARZ A;  1PW8 A;  2K2N A;  3N6I A;  3A3F A;  3HUO A;  1VET A;  4LEN A;  2C6W B;  1M40 A;  4QY6 A;  3JPU A;  4KZA A;  1STZ A;  2W1T A;  5J7E A;  3PXP A;  4NK3 A;  3GR2 A;  2ZC5 B;  3MJQ A;  3MZF A;  5GLB A;  1UWN X;  3ZG0 A;  4KZ5 A;  5FQQ A;  1MWT A;  3NUL A;  5FAO A;  3OLO A;  1TEM A;  2PT7 A;  4XUZ A;  5F83 A;  4KG5 A;  1LI0 A;  1H8M A;  4DJ3 A;  4HQA A;  1XX2 A;  5M19 A;  4UQI M;  4HBT A;  2WAD A;  4OPZ A;  4L9G A;  4DE1 A;  3JVV A;  2EA9 A;  1Y28 A;  4OON A;  2PYR A;  4LV3 A;  3WS4 A;  1CK3 A;  4S2P A;  5HWV A;  3VSK A;  5CGX A;  4BD0 A;  4GN2 A;  1EI5 A;  4MBF A;  3DTI A;  3HLE A;  4JLF A;  3N8S A;  3P09 A;  5LBR A;  1VB6 A;  3UDF A;  3IS2 B;  2QYB A;  1Y4O A;  5A93 A;  3TG9 A;  4RX3 A;  5HFO A;  3BQA A;  4X6T A;  3IXH A;  2V20 A;  3N8R A;  1S6R A;  4K08 A;  3T4Q A;  4LCM A;  3BRM A;  2UV0 E;  2WZX A;  5HDC A;  4B9O A;  1XFQ A;  3BY8 A;  3FPW A;  3LIF A;  1BUL A;  5HDD A;  1ODV A;  1MXO A;  1K57 A;  4FH4 A;  4KG6 A;  2M7V A;  4WM9 A;  3QNC A;  3S7O A;  3OPH A;  4CQH A;  5IT5 A;  2VA0 A;  1ZTU A;  3DTE A;  5FI6 A;  3NIA A;  3A3D A;  3T4K A;  4O01 A;  1K25 A;  5G4Y A;  1GSX A;  3C7V A;  5EVL A;  2EX9 A;  3LR3 A;  4OOY A;  3CLO A;  5EFW A;  4UHU A;  3UE6 A;  4B4X A;  3ZG9 B;  2ZJ9 A;  3NJA A;  1DJC A;  4H8R A;  1K54 C;  3SH7 A;  1MY8 A;  4N92 A;  4OQG A;  1GHP A;  1PNE A;  3CIT A;  4UAA A;  1E3U A;  5DKL A;  2H28 A;  2Y2Q A;  4BBT A;  2JBF A;  4Q0I A;  1TS8 A;  4DXB A;  3IQA A;  4S2N C;  1YKD A;  1W8Y A;  2Y2N A;  4FSF A;  1RGZ A;  4ZJ1 A;  4RX2 A;  3R7W B;  1N9N A;  1XJ2 A;  5HZH A;  3T50 A;  3LI8 A;  1MKI A;  2WKQ A;  3B33 A;  1W7F A;  3C7U A;  3W4Q A;  1PWG A;  1NYM A;  5E43 A;  4OH0 A;  1D1J A;  3UY6 A;  3WS0 A;  5EVI C;  4LLO B;  2Y91 A;  4EUZ A;  2PRF A;  4GDN A;  4UA9 A;  4PM6 A;  3UPP A;  3S22 A;  4EBN A;  4IBX A;  2EX8 A;  5CGS A;  2HJ9 C;  1TDL A;  1ZG6 A;  3ZQ5 A;  3VP4 A;  3LIA A;  4DXC A;  4D60 A;  4JPM A;  1IFQ A;  1JWV A;  4S2M A;  5FI2 A;  1FCO A;  4D2O A;  1UWP X;  2ZOI A;  1SCW A;  1K55 C;  2Z2M B;  4EEU A;  4GOG A;  2ZBB A;  3CAX A;  1L0F A;  1IKG A;  3PBR A;  2QKP A;  3C8C A;  1D7E A;  4MN7 A;  3IBJ A;  3C4P A;  4OLG A;  5IU1 A;  2D01 A;  4NKP A;  3VMA A;  3D9Y A;  1A0K A;  5L10 A;  3U2A A;  3RTY A;  3LR0 A;  3OPP A;  2EX2 A;  1TD5 A;  2V1B A;  5HPF A;  3G32 A;  2DNS A;  3Q7Z A;  1YM1 A;  3NHQ A;  1HZO A;  3D3O A;  5TFQ A;  3O5Y A;  3IS2 A;  2ZC7 A;  4GNU A;  4P6Z S;  4BBV A;  4JGR A;  1KGE A;  1NZU A;  4I5S A;  1IYO A;  2VEA A;  3M2K A;  3BM6 A;  4X25 A;  2VV7 A;  4P6Z M;  3B47 A;  4EU0 A;  4MN6 A;  3UNW A;  2JKT M;  2VZW A;  2JE5 A;  3E2L A;  4EW7 A;  4O0P A;  2W0N A;  4CLC B;  2XRO A;  3M2J A;  3EOI A;  4HI4 A;  1CI9 A;  1UGU A;  3BY9 A;  5HAQ A;  1T18 A;  4LCL A;  3E98 A;  3IX3 A;  3BEC A;  3V3R A;  1K38 A;  1KE0 A;  4M4X A;  1PI5 A;  1IEM A;  3AGF A;  4JXG A;  4R3A A;  3V50 A;  4DJ2 A;  1IKI A;  1BSG A;  4IUK A;  1PRQ A;  3R4K A;  4X56 A;  4Y2F A;  1YLJ A;  4Y13 A;  3RXW A;  3HLF A;  3ZG7 B;  4ZTK A;  4FUW A;  1K4F A;  2V1Z A;  3E2K A;  5FI7 A;  4ARZ B;  4OPY A;  1SKF A;  2JKR I;  2HDQ A;  3DWK A;  3T4T A;  1MKM A;  3R7W A;  1VET B;  3NCK A;  1ZC2 A;  4EV4 A;  2QJ5 A;  2W1T B;  3P7N A;  3G35 A;  4XT2 B;  5CEB A;  3Q1F A;  1PZP A;  2Y2P A;  4WEK A;  5GHY A;  3OZH A;  3QP8 A;  3G30 A;  5A91 A;  5A8B A;  2Y2J A;  4EES A;  2WAE A;  2XD5 A;  1OTB A;  4OOL A;  1J9M A;  4ZAM A;  3RH8 B;  2J9O A;  1H5X A;  4GD8 A;  3O3V A;  3C5A A;  3KYE A;  2E8J A;  1YLZ A;  4IED A;  4KZ6 A;  3PTE A;  3CPT B;  1H8Z A;  3W8K A;  3BQ8 A;  4RQ9 A;  4ZBE A;  1PW1 A;  4PHT A;  3MFD A;  4U3T A;  2IWC A;  2QJ7 A;  3DBA A;  1MZU A;  4DE3 A;  1TS7 A;  1D06 A;  4DDS A;  4DDY A;  1W63 Q;  3WRZ A;  5FDH A;  5FQK A;  2GX5 A;  1VM1 A;  2K7S A;  2B02 A;  4CLC D;  2PU4 A;  3EEH A;  2X71 A;  1L2S A;  4ZJ3 A;  3QP6 A;  4GS9 A;  1Z6F A;  2OOL A;  4N1X A;  5EOE A;  2XDM A;  3BFF A;  5DFY A;  3UB9 A;  1MBL A;  3C2W A;  1TS0 A;  2KX6 A;  2WK0 A;  3BFC A;  4OPQ A;  5JYO A;  3P01 A;  5C5K A;  2C5W B;  2A49 A;  4R6L A;  3IX4 A;  3IBR A;  1JTG A;  4MNR A;  1PFL A;  3O88 A;  2Y2M A;  4S2I A;  2GNX A;  1RCJ A;  2CMN A;  2Y2I A;  2ZMF A;  3W4P A;  5TJJ A;  1XP4 A;  3T12 B;  3VSL A;  4NG2 A;  4WUJ A;  2W3H A;  4OQ0 A;  3ZNT A;  3FC7 A;  1FOF A;  1PIO A;  2KOI A;  3BFG A;  5FL3 A;  4H6J B;  5HD5 A;  4NXB A;  4I3J A;  3Q81 A;  3ULF A;  3CZD A;  3LGO A;  3H82 A;  3F1O B;  2WKP A;  4Y7P A;  5GLD A;  4OQH A;  3G2Z A;  1DP9 A;  3T1X A;  3HLD A;  2Y55 A;  4MBK A;  4G3W A;  5DJT A;  2ZQC A;  3LIC A;  1T1B A;  1X0O A;  5FQJ A;  4P87 A;  1ES3 A;  5FAP A;  2FZ0 A;  4S2K A;  3CG5 A;  4X1M A;  1JVJ A;  5FDS A;  1AWI A;  1NXY A;  3CMZ A;  1MC0 A;  2NUP C;  3LID A;  3HUN A;  3PBS A;  4K0W A;  5JYP A;  5EEC A;  2NUT C;  2A3U A;  4WLA A;  3CJM A;  3T1S A;  1Q2Q A;  3V67 A;  3A3E A;  1OTI A;  4HJ6 A;  1ONG A;  3WS1 A;  2WZZ A;  5A92 A;  2P9V A;  4Q0H A;  4ZRR A;  4QB8 A;  1HVB A;  2XRN A;  2WKH A;  1OME A;  3NC8 A;  3LY3 A;  1GHI A;  3MXS A;  1OTE A;  3DW0 A;  4HOI A;  2WKE A;  4E3N A;  2R78 A;  3NOT C;  4DKI A;  2EFX A;  1BT5 A;  3HLB A;  4XT2 A;  3TJZ C;  3Q82 A;  3ZDJ A;  2XK1 A;  3FZC A;  2W3F A;  4DE2 A;  4UQI S;  2QMI A;  1BLH A;  3ZHH A;  3CHW P;  2OWJ A;  3VFF A;  3LYX A;  3ZVW A;  2HJE A;  2RL3 A;  4HY8 A;  3SS3 A;  5L07 A;  2P08 A;  2PD7 A;  4KUK A;  2PAV P;  5HD3 A;  3CPT A;  2OV5 A;  4R23 A;  4Q8I A;  2EWV A;  3MKE A;  2PDR A;  3RJU A;  4WZ5 C;  1KOU A;  3GV9 A;  2I72 A;  4JF6 A;  3VOZ A;  2QWS A;  2VKS A;  5CTN A;  3BYD A;  4S2L A;  4Y0O A;  3VOY A;  1IYS A;  4P0M A;  3DTM A;  5KIZ A;  4OVD A;  1ERM A;  4C3Q A;  1SKO A;  2M1C A;  2XSS A;  4XUX A;  2O0Y A;  2QHK A;  1JWZ A;  1F2K A;  2Y8H A;  3LI9 A;  2Q9M A;  3BFE A;  2W27 A;  1SHV A;  3A0V A;  5DTK A;  3VP2 A;  1YAX A;  1F9I A;  4WEL A;  3FWL A;  1E3U D;  1BTL A;  5FQI A;  4R70 A;  3G4P A;  2X02 A;  5CHM A;  4JXV A;  4L9E A;  3UME A;  4BMW A;  3M6B A;  4WYY A;  3QP1 A;  1BLC A;  1LSV A;  3EGX C;  1N9O A;  1N4O A;  5CRF A;  3VFH A;  3IX8 A;  1ZHH B;  5I94 A;  2Y2H A;  2VJW A;  2V8F A;  2O9A A;  3BEB A;  4CPK A;  3T4O A;  1LHY A;  1S66 L;  4H6J A;  2EFU A;  3T4S A;  2HDU A;  3UPO A;  4BJP A;  1G6A A;  3F1P A;  4BWI A;  3F1O A;  4R4R A;  3OPR A;  3LIB A;  1Y54 A;  1NZO A;  1L3L A;  3KSF A;  3UE3 A;  2RCX A;  2XQZ A;  2L0W A;  5A90 A;  3LR4 A;  2PR5 A;  2D02 A;  4X68 A;  3JVU A;  1G5U A;  3NY4 A;  3VP3 A;  3UB8 A;  2Y2K A;  3HL9 A;  3LFV A;  2FFF B;  5HL1 A;  1HTZ A;  2H5S A;  3K3D A;  2ZC3 B;  4NXF A;  3B42 A;  3UO9 A;  4GZB A;  3SW1 A;  3NDE A;  3N7W A;  2P04 A;  4HP4 A;  1S1Y A;  3IWI A;  5L2F A;  3MQQ A;  1G6O A;  2JC7 A;  3A0S A;  4KQQ A;  3UN7 A;  4LGW A;  2ZC6 B;  3CUE A;  1DJB A;  2WKI A;  3OBF A;  3UDI A;  4Z9Q A;  1W79 A;  4LFU A;  3GSG A;  4PKY A;  5EE8 A;  5F1F A;  3OOV A;  3IF6 A;  3HBR A;  2I9V A;  1VEU B;  4X55 A;  2CC1 A;  5KSH A;  3ITB A;  2PU2 A;  2HF6 A;  4QD4 A;  4PM5 A;  4NXE A;  3PBT A;  5CGW A;  5HAI A;  1YT4 A;  4ME4 A;  1W5D A;  1PWD A;  1XGJ A;  1QMF A;  1XXM A;  2XA7 M;  2VGJ A;  4JF5 A;  4ETZ A;  4EXO A;  5FQ9 A;  1JNU A;  4MN5 A;  3ZNY A;  2VGL S;  3IXG A;  4F3L A;  3B3X A;  3HJK A;  2OLV A;  2G2W A;  4EUV A;  4L9F A;  4G3V A;  2ZQA A;  2HP5 A;  1XGI A;  2HPB A;  1J3W A;  4GB7 A;  1AXB A;  1L0E A;  5MC7 A;  1NY0 A;  5J3W A;  3EWK A;  1MPL A;  4GS9 B;  1IYQ A;  2ZD8 A;  1LSX A;  5J8X A;  5FSR A;  2VGL M;  3S7P A;  4EQ1 A;  1WYC A;  3LEQ A;  3DAV A;  3BWL A;  5FAS A;  4CLC C;  1DY6 A;  2OLU A;  4PM8 A;  5CX7 A;  2WYX A;  3HCY A;  2JN7 A;  3VP1 A;  2Y4A A;  1FIL A;  4IVI A;  1ESI A;  5EVI B;  1IYP A;  4HEF A;  1BZA A;  5U47 A;  3C30 A;  2IA2 A;  2HGV A;  3O86 A;  5IS1 A;  2G2U A;  1CEF A;  3G2Y A;  3IXD A;  4IHQ A;  3ZG5 A;  1IEL A;  2GDN A;  5HWW A;  3UE0 A;  1FSY A;  3SS4 A;  2B95 A;  3EEA A;  4P85 A;  3QP4 A;  4IUH A;  5L09 A;  3AGD A;  3GRJ A;  3AGE A;  4F94 A;  4CLC E;  2ZQ9 A;  3H82 B;  4GLQ A;  4NEE D;  5G18 A;  1KGG A;  1YLT A;  2P7J A;  5FQM A;  4HIA A;  2EWW A;  1YMS A;  3Q07 A;  2B18 A;  4QY5 A;  3LCE A;  2JKF A;  5J4E A;  1YMX A;  4MCW A;  3FPV A;  5I5L A;  2ZM2 A;  1CQA A; 
#chains in the Genus database with same CATH homology
 3W4P A;  3HLC A;  2HP9 A;  3BFD A;  4OON A;  1XP4 A;  1KE4 A;  3VSL A;  4RVA A;  2HP6 A;  4K91 A;  3OCN A;  4OQ0 A;  4LV3 A;  5AQ7 A;  3WS4 A;  3PAE A;  1CK3 A;  3ZNT A;  4S2P A;  4N1H A;  1FOF A;  1PIO A;  5IHV A;  3G34 A;  1XKZ A;  3BFG A;  2DRW A;  1PYY A;  3ZFZ A;  1L0D A;  1ALQ A;  1GA9 A;  1TDG A;  2H10 A;  3VSK A;  3TOI A;  1PWC A;  2P9V B;  5CGX A;  5CER A;  4E3L A;  3Q81 A;  4BD0 A;  5GHX A;  3QHY A;  4GN2 A;  1EI5 A;  3CZD A;  4MBF A;  3OCL A;  3HLE A;  4JLF A;  4WEJ A;  3N8S A;  3P09 A;  4Y7P A;  1ES4 A;  5GLD A;  3UDF A;  4OQH A;  1GA0 A;  3G2Z A;  2WGI A;  4OP5 A;  4ID4 A;  4UA7 A;  4MLL A;  4X53 A;  4WZ4 A;  3TSG A;  3HLD A;  4JXW A;  4Y0U A;  5A93 A;  3TG9 A;  4RX3 A;  5HFO A;  2Q9N A;  2Y55 A;  4MBK A;  2IWD A;  2ZQC A;  5BOH A;  2WAF A;  3GQZ A;  3MZE A;  5FQJ A;  4P87 A;  4X6T A;  1KVM A;  1ES3 A;  3IXH A;  4S2K A;  5FAP A;  4E6W A;  2V20 A;  4FD8 A;  3N8R A;  3CG5 A;  1C3B A;  1S6R A;  4PM7 A;  1JVJ A;  2EXB A;  5GLC A;  4LCM A;  1YLP A;  1NXY A;  1FCN A;  3CMZ A;  5F82 A;  1QME A;  3BRM A;  4JXS A;  2WZX A;  3HUN A;  3PBS A;  3IWQ A;  4K0W A;  3FKW A;  5JYP A;  5EEC A;  5FAT A;  2FFY A;  1BUL A;  1CEG A;  2J8Y A;  2R9X A;  1HD8 A;  2A3U A;  1MXO A;  1K57 A;  3CJM A;  4FH4 A;  4JKT A;  1KE3 A;  1Q2Q A;  4KEN B;  4KG6 A;  4C6Y A;  2JCH A;  3A3E A;  4OPR A;  4WM9 A;  5F1G A;  3ZG8 B;  3QNC A;  4E3K A;  2ZQ7 A;  1K54 A;  1ONG A;  3WS1 A;  2WZZ A;  3OPH A;  4WMC A;  5A92 A;  2P9V A;  2HDR A;  3A3I A;  1WYB A;  1SDN A;  1M6K A;  2XR0 A;  4QB8 A;  1HVB A;  5FI6 A;  3NIA A;  4BL3 A;  1G68 A;  4BL2 A;  4OKP A;  2WKH A;  2J7V A;  3FYZ A;  4PMA A;  1OME A;  3A3D A;  1K6S A;  3NC8 A;  4JBF A;  3LY3 A;  3M6H A;  1FQG A;  1GHI A;  1K25 A;  3MXS A;  5CED A;  5CEC A;  3DW0 A;  3MZD A;  3C7V A;  5EVL A;  2WKE A;  4KG2 A;  1ES5 A;  4S2N A;  4E3N A;  4DKI A;  2EX9 A;  1E25 A;  4OOY A;  2EFX A;  1BT5 A;  3HLB A;  2Y2L A;  4UHU A;  1K57 C;  3Q82 A;  3ZDJ A;  2XK1 A;  3FZC A;  5E2F A;  4B4X A;  2PBY A;  3PBQ A;  5D3O A;  2ZJ9 A;  4KQO A;  1K4E A;  4GDB A;  4XXR A;  3ZG9 B;  1DJC A;  2XFS A;  3NI9 A;  3HRE A;  4H8R A;  3GTC A;  4WZ5 A;  1K54 C;  4B88 A;  4DE2 A;  3SH7 A;  1MY8 A;  4N92 A;  3PAG A;  1GHP A;  2QMI A;  1BLH A;  4OQG A;  3OC2 A;  4UAA A;  4Y0T A;  3ZHH A;  1E3U A;  1FSW A;  3VFF A;  5CTM A;  5HX9 A;  2Y2Q A;  3ZVW A;  4R0Q A;  2UWX A;  2RL3 A;  3ZVT A;  5AQA A;  2JBF A;  4CJN A;  3ZCZ A;  4OQI A;  3FKV A;  4DXB A;  4EBP A;  4YIN A;  3IQA A;  4S2N C;  3SS3 A;  3D4F A;  4E6X A;  1W8Y A;  4L0L A;  5EVI A;  2Y2N A;  4FSF A;  1RGZ A;  1O07 A;  5E2G A;  4ZJ1 A;  3BLS A;  1I5Q A;  1L0G A;  4RX2 A;  2OV5 A;  4R23 A;  4Q8I A;  5M18 A;  3MKE A;  1KDW A;  3P98 A;  4LV1 A;  3RJU A;  2ZM8 A;  4WZ5 C;  2BLS A;  4U0X A;  1NJ4 A;  4ZDX A;  3GV9 A;  1FR1 A;  3S4X A;  2I72 A;  1GHM A;  4JF6 A;  3VOZ A;  2Y59 A;  5EOO A;  1MKI A;  3C7U A;  1W7F A;  5CTN A;  5GLA A;  3W4Q A;  4E3I A;  4RYE A;  1PWG A;  1NYM A;  3FV7 A;  5E43 A;  4OH0 A;  3V39 A;  3BYD A;  4WMC D;  5DTS A;  5HAP A;  1LL9 A;  3IF5 A;  3EQV A;  5EUA A;  3UY6 A;  4S2L A;  4Y0O A;  3VOY A;  3W4O A;  1IYS A;  3WS0 A;  3GMW A;  3G31 A;  4P0M A;  3DTM A;  5GL9 A;  3UPN A;  4OVD A;  1K55 A;  3N8L A;  5EVI C;  1ERM A;  4HES A;  4GKU A;  2Y91 A;  4C3Q A;  4EUZ A;  3BLM A;  3IWO A;  4OOM A;  4GDN A;  4UA9 A;  4PM6 A;  3UPP A;  4XUX A;  4ZJ2 A;  3S22 A;  5EPH A;  4EBN A;  4IBX A;  1FCM A;  1JWZ A;  4PPR A;  4KZ9 A;  5DF8 A;  4LV2 A;  4OLD A;  3PBN A;  2Q9M A;  2EX8 A;  5CGS A;  1TDL A;  1ZG6 A;  2ZLY A;  3BFE A;  1SHV A;  4K0X A;  3VP4 A;  4DXC A;  5KMW A;  5DTK A;  2XF3 A;  3VP2 A;  3ITA A;  4JPM A;  3V3S A;  5M1A A;  3SH9 A;  5TGF A;  3C4O A;  1JWV A;  4E3M A;  4S2M A;  5FI2 A;  3ZGA B;  4WEL A;  1BUE A;  2Z2L B;  1FCO A;  3NDG A;  4KZB A;  3FWL A;  1E3U D;  3IHA A;  4D2O A;  1SCW A;  1BTL A;  1K55 C;  5DTT A;  5FQI A;  2Z2M B;  1LLB A;  3IH8 A;  4GOG A;  3G4P A;  4C75 A;  5FA7 A;  2X02 A;  5CHM A;  4JXV A;  1L0F A;  1IKG A;  3PBR A;  1H8Y A;  5FAQ A;  1LL5 A;  2ZQ8 A;  3M6B A;  4WYY A;  5EVI D;  4S2O A;  3C4P A;  1BLC A;  4OLG A;  4RA7 A;  5KZH A;  4KZ3 A;  3VFH A;  1N4O A;  5CRF A;  4OP8 A;  5I94 A;  2Y2H A;  3VMA A;  3MBZ A;  3BEB A;  2XH9 A;  1PZO A;  2ZM2 A;  2IWB A;  4CPK A;  1LHY A;  2V2F F;  3Q7V B;  2Y2G A;  2EFU A;  3OPP A;  2EX2 A;  2WUQ A;  1W8Q A;  2HDU A;  5HAR A;  3UPO A;  4BD1 A;  5E2H A;  4BJP A;  1ERQ A;  4E3O A;  3G32 A;  4BEN A;  1KDS A;  2DNS A;  4E3J A;  1G6A A;  3Q7Z A;  1YM1 A;  1HZO A;  5TFQ A;  1RGY A;  1YQS A;  1JTD A;  4DRT A;  4O7D A;  3SS5 A;  3WWX A;  2ZC7 A;  3NBL A;  4R4R A;  4GNU A;  3OPR A;  4KZ4 A;  3RXX A;  1CI8 A;  1KGE A;  1Y54 A;  1NZU A;  1NZO A;  4HBU A;  2EX6 A;  3A3J A;  2BG1 A;  1ONH A;  3LY4 A;  5AQB A;  3UE3 A;  4KQR A;  3IF6 B;  2RCX A;  1MWR A;  2E8I A;  2XQZ A;  4FCF A;  1IYO A;  1E4D A;  5A90 A;  3M2K A;  1MWS A;  4X68 A;  3BM6 A;  1K56 A;  3VP3 A;  3NY4 A;  2Y2K A;  4R4S A;  3HL9 A;  3VP0 A;  2FFF B;  5HL1 A;  3JYI A;  4IVK A;  3UNW A;  1HTZ A;  4PM9 A;  4KZ8 A;  2H5S A;  2ZC3 B;  4DE0 A;  3E2L A;  3UO9 A;  1I2S A;  2J9P A;  4GZB A;  3NDE A;  3N7W A;  2X01 A;  3HLG A;  2WGW B;  1DJA A;  1VQQ A;  3EQU A;  4EWF A;  2XEP A;  3IWI A;  2H0T A;  5L2F A;  2JC7 A;  2XGN A;  4JF4 A;  1EWZ A;  3DWZ A;  3M2J A;  3S1Y A;  2VGK A;  4KQQ A;  3UN7 A;  3IHB A;  1Q2P A;  1CI9 A;  4EBL A;  2ZC6 B;  5HAQ A;  1DJB A;  2WKI A;  3OPL A;  1JWP A;  1XA1 A;  4LCL A;  3UDI A;  1NRF A;  4P6B A;  1MWU A;  1NYY A;  4Z9Q A;  3BEC A;  3V3R A;  1PI4 A;  2EXA A;  1K38 A;  1W79 A;  1KE0 A;  4NET A;  3GSG A;  5EE8 A;  1PI5 A;  1WE4 A;  1IEM A;  3AGF A;  4JXG A;  5F1F A;  3SOI A;  2ZM0 A;  4MBH A;  3V50 A;  1ZG4 A;  5GHZ A;  1IKI A;  1FR6 A;  1BSG A;  3IF6 A;  1O7E A;  3HBR A;  1KGF A;  3IH9 A;  4X55 A;  4N9K A;  2CC1 A;  3MKF A;  4R1G A;  5KSH A;  3ITB A;  2PU2 A;  1XA7 A;  2H0Y A;  4X56 A;  4QD4 A;  4N9L A;  1YLJ A;  5E2E A;  4PM5 A;  3RXW A;  1K6R A;  5CHJ A;  3HLF A;  3ZG7 B;  3PBT A;  5CGW A;  4ZTK A;  4GD6 A;  5HAI A;  4QU3 A;  1K4F A;  1YT4 A;  2V1Z A;  4R3B A;  5DF9 A;  1W5D A;  3E2K A;  1PWD A;  3LO7 A;  1K56 D;  5FI7 A;  4S2J A;  1XGJ A;  4OPY A;  1SKF A;  1QMF A;  4LV0 A;  4QJG A;  4QHC A;  2HDQ A;  2XD1 A;  1KVL A;  3DWK A;  1XXM A;  1LI9 A;  2VGJ A;  2XLN A;  2ZC4 B;  3QNB A;  4JF5 A;  4BLM A;  2WGW A;  4M3K A;  3IF6 C;  3UDX A;  5KSC A;  4U0T A;  5FQ9 A;  3ZNY A;  3NCK A;  1ZC2 A;  3IXG A;  4EV4 A;  2WGV A;  2R9W A;  3IXB A;  5DF7 A;  3B3X A;  3O87 A;  2OLV A;  2G2W A;  4KZ7 A;  3IT9 A;  3G35 A;  2Y2O A;  5CEB A;  2ZQA A;  2HP5 A;  1XGI A;  2HPB A;  4GB7 A;  1AXB A;  1ZKJ A;  3Q1F A;  1L0E A;  1PZP A;  2Y2P A;  1NY0 A;  4WEK A;  1XPB A;  5AQ9 A;  4BQM A;  2B5R A;  1MPL A;  1IYQ A;  2ZD8 A;  5GHY A;  1BLP A;  3OZH A;  3G30 A;  4A5R A;  5A91 A;  4YFM A;  5J8X A;  1ES2 A;  5FSR A;  2Y2J A;  1WYC A;  1SDE A;  5CHU A;  2WAE A;  3MXR A;  2XD5 A;  4OOL A;  5FAS A;  3WS2 A;  1DY6 A;  1J9M A;  2OLU A;  4PM8 A;  4ZAM A;  2WYX A;  3V5M A;  4X69 A;  1ERO A;  4DF6 A;  2J9O A;  3GVB A;  1H5X A;  4FH2 A;  4GD8 A;  2P74 A;  5DVA A;  3O3V A;  3C5A A;  1U60 A;  1YLZ A;  1YLY A;  3VP1 A;  2Y4A A;  4IVI A;  4IED A;  1ESI A;  4KZ6 A;  4UA6 A;  1IYP A;  4MEZ A;  5EVI B;  5HW3 A;  4HEF A;  1BZA A;  3I7J A;  3PTE A;  4IBR A;  2QZ6 A;  1H8Z A;  1ESU A;  2ZQD A;  5U47 A;  3W8K A;  4ZBE A;  5CXW A;  4R3J A;  3O86 A;  1PW1 A;  2G2U A;  3MFD A;  1PW8 A;  4U3T A;  2IWC A;  1CEF A;  3G2Y A;  3N6I A;  4DE3 A;  3IXD A;  3UE1 A;  3A3F A;  3HUO A;  4LEN A;  2C6W B;  4DDS A;  2OSU A;  1M40 A;  4QY6 A;  4KZA A;  3ZG5 A;  1IEL A;  4DDY A;  3WRZ A;  2GDN A;  5FDH A;  3UE0 A;  2QPN A;  1FSY A;  3SS4 A;  1GCE A;  5FQK A;  3ISG A;  1VM1 A;  4P85 A;  1BLS A;  1S0W A;  2PU4 A;  2X71 A;  3LEZ A;  1L2S A;  3HLW A;  3AGD A;  1YLW A;  4ZJ3 A;  3GRJ A;  3AGE A;  1Z6F A;  2XFT A;  4NK3 A;  3GR2 A;  4B4Z A;  2ZC5 B;  2ZMA A;  2ZQ9 A;  4F94 A;  3MZF A;  4N1X A;  5EOE A;  5GLB A;  3ZG0 A;  4KZ5 A;  3WRT A;  2HDS A;  2XDM A;  5FQQ A;  3BFF A;  1MWT A;  3Q7V A;  3PBO A;  5G18 A;  1N9B A;  1MBL A;  1KGG A;  1YLT A;  5FAO A;  1I2W A;  1TEM A;  2WK0 A;  2DCF A;  3BFC A;  5FQM A;  4OPQ A;  5JYO A;  4XUZ A;  5F83 A;  5TR7 A;  4KG5 A;  1LI0 A;  2C5W B;  3HUM A;  1TVF A;  2A49 A;  1YMS A;  3Q07 A;  4EQI A;  1JTG A;  1XX2 A;  4MNR A;  4WBG A;  5M19 A;  4QY5 A;  4HBT A;  3LCE A;  2WAD A;  3HVF A;  3O88 A;  2Y2M A;  4OPZ A;  4S2I A;  3N4I A;  4DE1 A;  1RP5 A;  1RCJ A;  1YMX A;  3SH8 A;  3WS5 A;  2JE5 A;  2Y2I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...