1HTZA

Crystal structure of tem52 beta-lactamase
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
263
structure length
263
Chain Sequence
HPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVKYSPVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRWEPELNEAIPNDERDTTTPAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGASERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Predicting the emergence of antibiotic resistance by directed evolution and structural analysis.
pubmed doi rcsb
source organism Klebsiella pneumoniae
molecule tags Hydrolase
molecule keywords BETA-LACTAMASE MUTANT TEM52
total genus 91
structure length 263
sequence length 263
chains with identical sequence B, C, D, E, F
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2001-01-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 1htzA00
3LEZA 2HP9A 3M6HA 1Z6FA 3OPHA 2GDNA 1ESIA 4MBKA 5GLDA 5FASA 3OCNA 1PW1A 2ZM2A 3O3VA 4R3BA 1NYMA 3IXDA 4XXRA 1PIOA 1Q2QA 1KE4A 3NI9A 4DDSA 2BLSA 3PBNA 3NDEA 3DW0A 3IWOA 2Y55A 4GDNA 1I2WA 1JWVA 3ZNYA 4GD8A 5EVIA 4B4XA 2Y2IA 2VGKA 5CECA 4X6TA 1FSYA 3G34A 2ZQ8A 1MY8A 1DY6A 1QMFA 4N1HA 4S2LA 1XPBA 2WKEA 4WYYA 5CTMA 5E2GA 2EXBA 2P74A 1EWZA 1K56D 1GA9A 2EX8A 3CG5A 1K6SA 4IVIA 3FV7A 2R9WA 4BD1A 1MPLA 4GD6A 3VP0A 3FZCA 4OPZA 5FI6A 5D3OA 3BM6A 4E3JA 1YLWA 4K0XA 3SH8A 3G35A 3ZG8B 2FFYA 2QMIA 1KE3A 3A3DA 4KQRA 4Q8IA 1L0EA 1XA7A 3D4FA 1BLSA 4E3IA 4P6BA 3VOYA 3ITAA 5GHXA 2XD5A 4X55A 1E25A 3HLCA 4FSFA 4WELA 5CXWA 3NY4A 4BJPA 2XR0A 3PTEA 1K38A 4OOYA 4DKIA 1K25A 4U3TA 4PMAA 4S2NC 5CEBA 1ALQA 5EVIC 4WZ5A 1L2SA 3P09A 3V3RA 5EVLA 2Y2JA 5I94A 3UPOA 2ZQ9A 5CTNA 3PBQA 3CJMA 4BL3A 3Q7ZA 4OLDA 4IEDA 2C5WB 3PBRA 3N4IA 4EQIA 5GHYA 5KMWA 5GLCA 3CMZA 1PI5A 3I7JA 3P98A 4E3KA 1SDEA 4FH2A 2WKIA 2WGWB 4OKPA 1ZG6A 1DJAA 2ZLYA 4S2MA 1ERQA 4OQIA 3IQAA 1JWPA 3FYZA 4PM6A 1MKIA 1IKIA 1O7EA 2ZC6B 4R4RA 4UA9A 2H0TA 1EI5A 4DRTA 5FQQA 1ZG4A 2CC1A 2P9VA 2HPBA 3ZNTA 3HREA 1L0FA 3HLEA 5FQIA 4WMCD 5M18A 1E4DA 2Y59A 3BFFA 2EFXA 4QY6A 2Z2LB 3VP4A 1HZOA 2Y2PA 1YMSA 1CEFA 4R0QA 4DE1A 3WWXA 5CEDA 4Y0UA 1L0GA 2Z2MB 2WZXA 1ONGA 2HP5A 2V1ZA 2PU2A 4O7DA 5E2HA 3W4OA 3ZVTA 5A92A 3WS1A 4DXBA 4ZJ2A 3EQVA 3A3FA 1XXMA 3UO9A 2ZM0A 3IT9A 3IH8A 2E8IA 3O86A 3IXHA 3LO7A 5GLAA 3ZGAB 4DE3A 2V2FF 1PZPA 4FD8A 3VSLA 1VQQA 1H8ZA 5HAQA 4GB7A 4IBRA 3IH9A 5FI7A 2JCHA 3Q07A 1MWTA 1RGYA 4KG6A 3A3IA 1GHMA 4KZ9A 5G18A 3RXWA 2XQZA 5FI2A 5HL1A 4N9KA 3C7UA 2DCFA 5EOOA 1G6AA 2XLNA 4OLGA 4U0XA 4KENB 1K6RA 4M3KA 2OV5A 4PM8A 4ZJ1A 1NZUA 1TDGA 1I5QA 1M6KA 1NXYA 4XUXA 4OOLA 4S2JA 3GRJA 2XGNA 4HBTA 2X02A 4E3LA 3QHYA 1K57A 1J9MA 2WADA 3BRMA 3C5AA 1NZOA 3NIAA 3OZHA 3SS5A 1HVBA 1WYCA 5FQJA 2WGWA 3IF6C 4OPQA 5DVAA 3JYIA 1K54C 1ES5A 4S2PA 4X53A 1TEMA 3E2LA 3RXXA 3SH9A 2WK0A 3C4OA 3OPRA 4ID4A 4KZ4A 5GL9A 5KZHA 5FATA 2OLUA 4S2IA 1LL5A 4C75A 3N6IA 4OPRA 2VGJA 4EBNA 3UN7A 1ES3A 1ES4A 1ES2A 3G2YA 2WZZA 3FWLA 5FAPA 5JYPA 1IYOA 1NJ4A 3MFDA 3UNWA 3FKVA 3PBTA 4C6YA 4EWFA 4PPRA 1BLHA 5CHMA 4KZ5A 1CI8A 3PBOA 1YLZA 4HBUA 1LL9A 5CHUA 2JC7A 4L0LA 4QJGA 1U60A 4JLFA 3Q7VB 4KZAA 2Y2GA 3PAGA 2QZ6A 4FCFA 4UHUA 5DF8A 2A49A 4WBGA 4CJNA 3SH7A 5CRFA 3HLWA 4R3JA 3BECA 1QMEA 3IHAA 4GOGA 4LCLA 4QY5A 4OH0A 4C3QA 3MZEA 1YQSA 3W8KA 5HAPA 1E3UD 3UDIA 2C6WB 4X56A 1K56A 2G2UA 4JBFA 2ZC5B 4HESA 1KGGA 4BD0A 1YM1A 4MEZA 5GLBA 4WMCA 5FQKA 2Y2MA 4BENA 2WGIA 2X01A 3HLGA 2RL3A 1WYBA 4KZ8A 1W5DA 1SDNA 4LENA 4N92A 4UA7A 5F1FA 2XF3A 1RCJA 2ZD8A 3E2KA 3Q81A 4OQ0A 4KQOA 2Y2QA 3DWKA 2IWBA 3IF6A 4E3MA 3O88A 4K0WA 1JWZA 4R4SA 4Y7PA 3VP1A 1W79A 2OLVA 4IBXA 2Y2OA 5EVIB 5CGSA 3DTMA 3HLBA 4LV3A 3ISGA 1PW8A 3LY3A 5M19A 3S22A 3TOIA 5J8XA 3LCEA 2R9XA 3MZDA 3UE3A 3BFCA 3S1YA 3ZVWA 2Y4AA 1FCMA 1SCWA 3UPPA 1RP5A 1S0WA 5M1AA 3N8RA 4MNRA 1Q2PA 4OP5A 3GMWA 4PM9A 2ZQCA 3BFDA 2Y2HA 4OOMA 4DE2A 3ITBA 4KG5A 4E6XA 4KZ6A 1BUEA 4JXGA 2BG1A 4ZBEA 3ZG0A 4GDBA 1G68A 3G31A 3IHBA 1GCEA 3IWQA 1CEGA 4JPMA 4PM7A 3HL9A 1IKGA 2PU4A 1SKFA 1O07A 3HBRA 4H8RA 5TR7A 3V3SA 2UWXA 1FSWA 3GVBA 3N7WA 1H5XA 5E2EA 2ZC3B 4A5RA 1FCNA 1LLBA 4RYEA 1N9BA 2HDRA 2Y2KA 2HDSA 3G2ZA 2XEPA 3AGEA 4HEFA 1NY0A 4IVKA 4KZBA 4RA7A 4E3NA 3UPNA 3G30A 5FAOA 1YT4A 2HP6A 3OCLA 4P85A 3WRTA 3C7VA 4N9LA 3WRZA 3WS2A 4Z9QA 1M40A 3Q1FA 4ZAMA 1XGIA 5JYOA 1W8YA 2I72A 2EFUA 3TSGA 3VFHA 5L2FA 1BZAA 3G4PA 3V5MA 1NRFA 2XDMA 1BSGA 4JXSA 4KZ7A 4X69A 3M2JA 1RGZA 4EV4A 3SS3A 2V20A 5A90A 4JF6A 1BULA 5FQMA 2Y2LA 2Y2NA 3CZDA 1KGFA 1YLPA 1HTZA 5AQ7A 3Q7VA 5IHVA 4BQMA 5KSHA 2WAEA 4JXWA 4F94A 2Q9NA 3BFEA 4OPYA 4NK3A 2DNSA 1HD8A 1YLTA 3MZFA 1FCOA 4OQHA 4S2OA 5CGXA 5EPHA 2WAFA 3WS0A 4B88A 4LV2A 3Q82A 3ZCZA 1K55C 3N8SA 5HAIA 1BLPA 2H0YA 3NC8A 4MBHA 4N1XA 5HFOA 1TVFA 1JTDA 1CK3A 4QU3A 4BL2A 4DXCA 1KVMA 2G2WA 3A3EA 3UDXA 1TDLA 3W4PA 3V50A 3UDFA 1SHVA 1IEMA 3WS5A 3BLMA 1EROA 3AGDA 3G32A 1KDWA 5DF9A 4X68A 4OQGA 3VP2A 1GHIA 1OMEA 2EX9A 4OVDA 2WGVA 4OONA 5FAQA 3UE1A 4JF4A 3PBSA 5KSCA 2EX2A 4JXVA 3BFGA 3GQZA 4FH4A 3VP3A 1XGJA 3HUOA 4MLLA 4WEKA 3IF5A 2ZQAA 1IYSA 4P87A 1KVLA 3NCKA 4U0TA 2H5SA 5F1GA 1Y54A 2H10A 1W7FA 4XUZA 3NDGA 1C3BA 4PM5A 3UE0A 1AXBA 1KGEA 3HUMA 5EUAA 3IXBA 5HARA 2XH9A 1MWSA 3TG9A 5BOHA 5TGFA 5F82A 4BLMA 3PAEA 3IXGA 2DRWA 1NYYA 2XFTA 5EVID 1W8QA 1K55A 2HDUA 1ZKJA 2IWCA 3DWZA 4DE0A 4K91A 1I2SA 3O87A 4LCMA 3NBLA 5CHJA 1PYYA 1KE0A 3BYDA 5TFQA 3ZG9B 1BTLA 4GNUA 1YLJA 2XFSA 3GSGA 3LY4A 1ESUA 3BEBA 2B5RA 4EUZA 5CGWA 1CI9A 3S4XA 4RVAA 4B4ZA 4E3OA 4Y0OA 4WEJA 3M2KA 1IYQA 3AGFA 1WE4A 2XD1A 2J9PA 1FOFA 3V39A 4S2NA 1ZC2A 1XKZA 3W4QA 1JVJA 3ZHHA 5DTKA 1LHYA 1MBLA 3OC2A 3A3JA 5DF7A 1PWCA 2A3UA 3MXRA 2QPNA 1XA1A 4MBFA 3FKWA 4GKUA 5FQ9A 4UAAA 1GA0A 2EXAA 2X71A 1YMXA 3HVFA 4KZ3A 4Y0TA 3IWIA 3ZG5A 2EX6A 3ZG7B 2J8YA 2ZM8A 4DF6A 4WZ5C 1MWRA 2P9VB 1XX2A 4WZ4A 3UY6A 1IYPA 1L0DA 3SS4A 2OSUA 4OP8A 1S6RA 4ZDXA 3MKFA 3QNBA 5DTSA 5A93A 1K57C 3MBZA 4KQQA 1KDSA 2JE5A 5AQBA 3GV9A 3VFFA 1H8YA 1PWDA 4E6WA 5U47A 1MWUA 1YLYA 1MXOA 3C4PA 1FQGA 3N8LA 2FFFB 4GZBA 4RX3A 4YFMA 2JBFA 5E43A 5AQAA 5FSRA 5CERA 1K54A 4WM9A 5HX9A 4DDYA 5EE8A 3VMAA 2ZJ9A 5FDHA 1FR6A 1K4FA 3GR2A 3GTCA 3IF6B 5F83A 3ZFZA 2RCXA 2ZC4B 2WUQA 1LI9A 3B3XA 1K4EA 3EQUA 5E2FA 3RJUA 3VOZA 3VSKA 4CPKA 2HDQA 3HUNA 3BLSA 1GHPA 5FA7A 1BLCA 2J9OA 5AQ9A 3WS4A 4EBLA 1IELA 5EOEA 1E3UA 2XK1A 1BT5A 1N4OA 2ZC7A 4ZJ3A 4GN2A 4R1GA 1DJCA 4LV0A 2ZMAA 2Q9MA 1PI4A 2ZQ7A 2WYXA 4RX2A 3QNCA 4YINA 2Y91A 1XP4A 1PWGA 4UA6A 1PZOA 4P0MA 5HW3A 3ZDJA 4JKTA 2PBYA 4D2OA 4QD4A 1FR1A 3HLFA 3MXSA 3OPLA 3OPPA 4QHCA 5A91A 1ONHA 4KG2A 2J7VA 1ERMA 4NETA 4QB8A 2ZQDA 5DTTA 4S2KA 2WKHA 4JF5A 4ZTKA 1DJBA 1LI0A 3M6BA 4R23A 5EECA 5GHZA 2IWDA 1JTGA 4EBPA 3SOIA 1VM1A 3MKEA 4LV1A 3HLDA
chains in the Genus database with same CATH superfamily
4IUKA 3M6HA 2GDNA 5FL3A 3SW1A 4L9GA 3O3VA 4R3BA 3IXDA 4XXRA 1Q2QA 3LGOA 3PBNA 4GDNA 1H0MA 4X6TA 3MF0A 3EEHA 1OTBA 5HSQA 2P74A 1K56D 3FV7A 3FZCA 2QHKA 1V9ZA 2KLIA 4K0XA 2FFYA 1KE3A 3A3DA 1ZTUA 5GHXA 2XD5A 5F6AA 4FSFA 3R4KA 1D7EA 4ESPA 2H28A 3PTEA 3T4TA 1K38A 5TBMA 4PMAA 1ALQA 1MC0A 3DTKA 1OT6A 2J3TC 4O01A 2C5WB 4WLAA 2VGLM 2R78A 5AVFA 5A8BA 4FH2A 2PD7A 2WKIA 4OKPA 1ERQA 3IQAA 1MKIA 2H0TA 5FQQA 2LB9A 3OLOA 3HREA 1L0FA 3HLEA 3LUQA 4DE1A 3WWXA 4G3KA 4Y0UA 1L0GA 1ONGA 3DTEA 3ZVTA 4BMWA 4ZJ2A 3EQVA 1F5MA 4P6ZS 1H8ZA 2WKRA 2JCHA 1RGYA 3RXWA 1GHMA 4LRZE 2DCFA 5EOOA 4U0XA 2OAP1 4KENB 4M3KA 2OV5A 5G4YA 1T1AA 3QHYA 3MS6A 1WYCA 4I39A 4OPQA 5DVAA 3JYIA 1ES5A 4S2PA 3BQ8A 3C2WA 3C4OA 4ID4A 4NXFA 5GL9A 5KZHA 2OLUA 3S7OA 3IX3A 4S2IA 1OTDA 2VGJA 5FAPA 1NJ4A 4HJ3A 4EXOA 4Y15A 4HBUA 1LL9A 3CLOA 4JLFA 1CQAA 3PAGA 4UHUA 5CRFA 2K7SA 4GOGA 4LCLA 4OH0A 3MZEA 3UDIA 1K56A 2ZC5B 1KGGA 1YM1A 5GLBA 4WMCA 2Y2MA 2QWSA 4WF0A 1OPXA 3HLGA 1WYBA 3PYPA 1RCJA 3Q81A 4JGPA 2JHEA 3DWKA 3MMHA 3LR4A 4Y7PA 4Q0JA 1WA9A 3EOIA 2Y2OA 5EVIB 5CGSA 2NUTC 3S22A 3MZDA 3UE3A 4KQDA 3ZVWA 1RP5A 1S0WA 5HPIA 2M7UA 3LI8A 4PM9A 2ZQCA 4KG5A 3OBFA 2VV8A 4JXGA 3H7WB 3JPUA 4ZBEA 3IHBA 1GCEA 3KSIA 4PM7A 1IKGA 5HL6A 1G5UA 2UWXA 2V8FA 5E2EA 4A5RA 1LLBA 2Y2KA 4HEFA 3HCYA 3UB8A 1OTIA 3ZYTA 3EEAA 3HJKA 1MKMA 3V5MA 2XDMA 3SS3A 2Y2LA 3VE3A 3L9KA 3F1NA 2QJ5A 5KSHA 4EW7A 3MFXA 1FCOA 5EPHA 2WAFA 3Q82A 1K55C 4KUKA 4BWIA 4HI4A 4N1XA 3TJZC 1TVFA 1JTDA 1KVMA 3NULA 2LB5A 2OAQ1 3VOLA 5EV0A 2OOLA 1EROA 3AGDA 4ARZB 5DF9A 4OQGA 3VP2A 2O0YA 4OONA 2OWJA 4FUWA 3R7WA 4X1LA 1T1BA 1C3BA 5HARA 2B18A 4NXEA 4QPRA 4BLMA 1S66L 2XA7M 2MJ6A 2XFTA 5EVID 1W63M 1K55A 1I2SA 4LCMA 3NBLA 1YLJA 1ESUA 2B5RA 4RVAA 4Y0OA 4LGWA 1IYQA 4S2NA 1ZC2A 2NUPC 2D01A 3ZHHA 1TS0A 4II7A 1XA1A 2HF6A 2L4RA 2P9VB 2HZ5A 5L07A 3UB5P 2OSUA 4OP8A 1NWZA 3FC7A 4R38A 3MBZA 4KQQA 5TBMB 3GV9A 3HLDA 1PWDA 5U47A 1MWUA 1FQGA 5FSRA 1TS7A 4WM9A 5HX9A 3IBRA 3BY9A 3ULFA 2GNXA 1LI9A 3VOZA 3EQUA 5E2FA 3RJUA 3VSKA 2W3GA 1VHMA 5FA7A 5HD5A 2J9OA 5KIZA 4EBLA 4GHIB 3LIFA 1JNUA 4HNBA 1E3UA 4ZJ3A 1N4OA 3LI9A 3UE6A 2WYXA 2Q0OA 1XP4A 3DBAA 1PWGA 2W3HA 1PZOA 3ZDJA 1BYWA 2PBYA 5DJTA 4QD4A 3HLFA 4QHCA 3OPPA 2J7VA 2ZQDA 1Z09A 4S2KA 2QYBA 3T4JA 5HDSA 4XT2A 4EBPA 4KG6A 1VM1A 3MKEA 2K2NA 3FPVA 5IS1A 4MBKA 2V1AA 1PIOA 1KE4A 1T1CA 1XFQA 1I2WA 2Y8HA 2P04A 5EVIA 1DRMA 3TW8A 1MY8A 1DY6A 1QMFA 1XPBA 2EXBA 1EWZA 1SKOA 1GA9A 4IVIA 4BBVA 2R9WA 4BD1A 1MPLA 3MXQA 2ZL1A 1S1YA 4OPZA 4X25A 5MC7A 2INWA 4IUHA 3ZG8B 4H6JA 4G3VA 1VEUB 5FEGA 2JKRI 3ITAA 4X55A 2XR0A 3B33A 4HJ6A 5CEBA 2WKPA 3P09A 4K08A 2Y2JA 3FG8A 3C30A 3UPOA 2JKFA 2P08A 3CJMA 4WN5A 4BL3A 4OLDA 2W1RA 4IEDA 3N4IA 5DJUA 5GHYA 4EQIA 5GLCA 1PI5A 2WGWB 1DJAA 4OQIA 2YKHA 4UA9A 2ZC6B 4R3AA 3UB9A 1ZG4A 2XSSA 2CC1A 1IFQA 3H82A 4Y17A 5FQIA 4WMCD 2Y59A 4QY6A 2Z2LB 3VP4A 1YMSA 3MJQA 1YPRA 2KX6A 5CEDA 2Z2MB 4O7DA 2PU2A 3IH8A 2XRNA 3KO6A 3LO7A 3ZGAB 4DE3A 1LSXA 4FD8A 4Y2FA 4ETZA 3IH9A 5G18A 3C8CA 2XQZA 5FI2A 5HL1A 3C7UA 2YKFA 2XLNA 4OLGA 1K6RA 2PYRA 5L10A 4PM8A 4ZJ1A 5J4EA 4JGRA 1HLUP 2HV1A 3HJIA 3IX8A 4MN6A 2XGNA 1N9LA 1J9MA 1YKDA 3S7PA 3NIAA 1HVBA 4PKYG 3IF6C 3A0RA 1N9OA 3F1PA 3SH9A 2VK3A 3E0YA 2O9CA 3H7WA 1LL5A 2W3DA 4ARZA 4EBNA 1Y4OA 1ES3A 2O99A 1IYOA 3PBOA 5CHUA 2JC7A 1H3QA 1LSWA 2Y2GA 3CAXA 2A49A 3F1NB 3UB7A 3SH7A 4R3JA 4QY5A 3NOTC 2C6WB 2ZOIA 4EERA 2Z6CA 3PXPA 4BD0A 4BENA 4KZ8A 1SDNA 2XF3A 3E2KA 2Y2QA 4NXBA 3O88A 4R4SA 3T4KA 4IBXA 3B42A 5M19A 1UWNX 4DJ2A 3RH8B 2R9XA 4QWOA 3BFCA 4GJ4A 1Q2PA 3GMWA 3BFDA 4DE2A 1S4RA 1XFNA 4F3LB 4GDBA 1G68A 3G31A 3W2ZA 3IWQA 3KSGA 1VETA 2PU4A 1SKFA 4Q0HA 1FSWA 3DAVA 1H5XA 4HOIA 1FCNA 4RYEA 5CX7A 2HDSA 4E3NA 4IVKA 5FAOA 3CPTB 3OCLA 1M40A 3Q1FA 1XGIA 2EFUA 3TSGA 2PYPA 3G4PA 1BSGA 3CHWP 4EV4A 1BULA 3F1OA 2ZMVA 3D9YA 1XJ6A 3IBJA 1HTZA 5AQ7A 3Q7VA 5IHVA 3BW6A 4F94A 4CLCA 1STZA 2DNSA 1YLTA 3MZFA 5CGXA 4OQHA 2HGVA 4B88A 5HAIA 3NC8A 5HFOA 4QU3A 4BL2A 2G2WA 3LR3A 3UDXA 1TDLA 3UDFA 1SHVA 3BLMA 1KDWA 5LBRA 5L09A 1D06A 1TS8A 5FAQA 5KSCA 1VEUA 2EX2A 3GQZA 1NRJA 3HUOA 4DJ3A 4HQAA 4WEKA 4YOFA 3IF5A 4U0TA 3MR0A 3SZTA 3LEQA 1P0ZA 2E8JA 3NDGA 3T50A 4UQIS 2D02A 4BBUA 2VZWA 4PM5A 5FEFA 1KGEA 3HUMA 3IXBA 2XH9A 1MWSA 3QP1A 3PAEA 1NYYA 2A24A 3DWZA 5EM1A 4K91A 1KE0A 3BQAA 5EVEA 4RQ9A 4IJGA 1GSXA 3LY4A 4NEED 3S4XA 1LSVA 2GZAA 4X1MA 4O8GA 4WEJA 1WE4A 3D3OA 3V39A 2ZMFA 4NXGA 1XKZA 3QP4A 2OWHA 4PAUA 1MBLA 3A3JA 1PWCA 3FKWA 3D72A 4UAAA 3HVFA 4DF6A 4Y13A 4WZ4A 1L0DA 1S6RA 2GJ3A 2JKGA 3FPWA 2ZBBA 3QNBA 3VFFA 1H8YA 4E6WA 1MXOA 4RX3A 4GZBA 5E43A 5CERA 3ZQ5A 4DDYA 4IHQA 2KDKA 4M4XA 2JN7A 4B9OA 4Z1WA 2EA9A 3P01A 2RCXA 2ZC4B 3B3XA 1K4EA 4CPKA 4HP9A 2HDQA 5HPFA 5AQ9A 5EOEA 1BT5A 4GN2A 4EESA 4R1GA 2ZMAA 2Q9MA 2ZQ7A 2Y91A 4UA6A 4P0MA 4JKTA 5A91A 4KG2A 5I5LA 2P7JA 3U2AA 4QB8A 5DTTA 3GDIA 4JF5A 1DJBA 3M6BA 2FH5A 1GSWA 1JTGA 4PKYA 3T4LA 3LEZA 3OPHA 4I3AA 2PD8A 5FASA 5GLDA 4CQHA 3QP5A 3NI9A 3LICA 4EQ1A 3IWOA 2Y55A 1VB6A 4E04A 1JWVA 1CF0A 4NG2A 3ZNYA 1TS6A 4B4XA 2VGKA 1FSYA 3G34A 1W63Q 4WYYA 2WKEA 5CTMA 5E2GA 2V8CA 2J3WA 2PHYA 2J80A 2Z6DA 3BM6A 1YLWA 4Q8IA 3UB6A 1L0EA 1XA7A 3D4FA 1BLSA 3NECA 4E3IA 5AVEA 4P6BA 3VOYA 3H82B 4WELA 5CXWA 4R6LA 2ACGA 3BY8A 3LIDA 4OOYA 1TD5A 4DKIA 3G6OA 1LL8A 3LR0A 5EVIC 1L2SA 3E4QA 5EVLA 5I94A 2ZQ9A 2VKSA 3PBQA 4CLCC 3PBRA 2VV6A 4MCWA 2GX5A 5KMWA 3P98A 4E3KA 4YWZA 4GCZA 2VX8A 1G28A 2ZLYA 4S2MA 1JWPA 4PM6A 1O7EA 4R4RA 1EI5A 4DRTA 2HPBA 5M18A 2CMNA 1DP8A 3KSFA 1HZOA 2Y2PA 1CEFA 4R0QA 2EWVA 3W4OA 2XA7S 2HP5A 5A92A 5E2HA 3WS1A 4DXBA 3A3FA 1IOUA 4HP4A 3IT9A 3LYXA 5K5BA 2E8IA 3IXHA 4EEPA 2V2FF 2PAVP 4UQIM 3VSLA 5HAQA 4IBRA 5AJGA 5FI7A 4KZ9A 1MWTA 2ZL1B 4N9KA 4GW9A 4YNRA 1P97A 1G6AA 3EGXC 1NZUA 1NXYA 1NLZA 4XUXA 2W27A 3GRJA 4HBTA 2X02A 4I3JA 4E3LA 1K57A 2WADA 3C5AA 1NZOA 2HJEA 2WGWA 3RXXA 3E2LA 2KOIA 4KZ4A 5FATA 1ES2A 1V9YA 2WZZA 3G2YA 3CUEA 3FWLA 1PFLA 5CHMA 4KZ5A 1CI8A 4GHIA 4L0LA 4KZAA 4CJNA 5DF8A 4WBGA 3HLWA 3BECA 1QMEA 3IHAA 1XJ3A 4CLCD 2JKTM 4HESA 2K31A 4B93A 4GLQA 3NOPC 2WGIA 2RL3A 4AFIA 1W5DA 4N92A 4UA7A 2ZD8A 1UGUA 1ACFA 4OQ0A 3IF6A 3CITA 4K0WA 3VP1A 1W79A 2OLVA 1K0KA 3PHYA 4DMZA 2W3FA 3CUEC 2VV7A 3HLBA 4I3IA 4LV3A 3ISGA 1PW8A 3LY3A 3TOIA 5J8XA 3KSHA 3QP6A 3S1YA 2Y4AA 1FCMA 1SCWA 3UPPA 4OP5A 2Y2HA 3EGDC 2W0NA 3UMDA 4KZ6A 1CEGA 3HL9A 4H8RA 5TR7A 3V3SA 1GSVA 3GVBA 4NKPA 2BASA 3LIBA 5IU1A 1N9BA 2HDRA 3G2ZA 1NY0A 3NOUC 3UPNA 4GS9B 3VV4A 3WRTA 3WS2A 4Z9QA 5F5YA 1S4SA 3BWLA 1W8YA 2I72A 3VFHA 1FIKA 1BZAA 1NRFA 5EM0A 5A90A 4X69A 1RGZA 2V20A 4JF6A 2Y2NA 3CZDA 1KGFA 1YLPA 3C38A 4Q0IA 4BQMA 2WAEA 2V0WA 4R70A 1P9WA 3BFEA 4Y5FA 1F98A 1FILA 4LV2A 4MN7A 4JGOA 2H0YA 4MBHA 1YSQA 1KOUA 1OTAA 3GECA 4HIAA 5HWWA 2VEAA 2VGLS 3W4PA 1F2KA 3TE8A 1T18A 4X68A 1GHIA 2EX9A 4OVDA 4JXVA 3BFGA 2I9VA 4FH4A 3EWKA 1XGJA 3VP3A 3QP8A 3F1PB 1IYSA 1KVLA 3NCKA 2H5SA 3QP2A 1Y54A 4XUZA 3UE0A 5EUAA 2PDRA 2V9AA 3TG9A 5BOHA 5F82A 3MQQA 3V67A 2DRWA 4ME4A 4DE0A 1ZKJA 2WKQA 1SZVA 1Y28A 2W3EA 3O87A 1PYYA 3ICYA 5C5KA 1X0OA 3ZG9B 4GNUA 3LIAA 2XFSA 3GSGA 2JKRM 3BEBA 4EUZA 4F3LA 3OOVA 3M2KA 5DKLA 2XD1A 2J9PA 1FOFA 3W4QA 2PRFA 3OC2A 3CWFA 3KYQA 4PHTA 4MBFA 5FQ9A 1MZUA 1XJ4A 1GA0A 4KZ3A 3CI6A 1D1JA 2J8YA 2ZM8A 1MWRA 1XX2A 4HY8A 1IYPA 1PRQA 1P9RA 4LLOB 2B02A 2PT7A 2JBFA 2EWWA 1K54A 3T4QA 3F1OB 5EE8A 3MSHA 4L9EA 3VMAA 5FDHA 1FR6A 3GR2A 3GTCA 3IF6B 5F83A 2WUQA 1OJ5A 4HH3A 5HWTA 3WS4A 4HHDA 1AWIA 1S67L 2ZC7A 4WUJA 4LV0A 4LFUA 4I5SA 4RX2A 4YINA 4I38A 3KX0X 4D2OA 1FR1A 3MXSA 4MDZA 1ONHA 4NETA 5L8MA 2PR6A 2BTFP 2WKHA 1ZHHB 2FZ0A 5EECA 4R23A 3E98A 5GHZA 4LV1A 1NLYA 2HP9A 1YAXA 1Z6FA 3A0SA 1ESIA 3OCNA 1PW1A 1VETB 2ZM2A 4WL9A 1NYMA 3T4OA 4DDSA 2BLSA 2A2LA 3NDEA 3DW0A 4EETB 4GD8A 2Y2IA 3RFBA 5CECA 2ZQ8A 4N1HA 4S2LA 1DP6A 1S1ZA 3IS2B 3U4LP 2EX8A 3CG5A 1K6SA 4GD6A 1XJ2A 2VLGA 3VP0A 5FI6A 5D3OA 4E3JA 3SH8A 3G35A 2A24B 3UMEA 4KQRA 2QMIA 2Y79A 4JGQA 1E25A 3HLCA 4EU0A 4EEUA 3NY4A 4BJPA 1K25A 3NJAA 2ZOHA 4U3TA 4S2NC 4WZ5A 2L1MA 3H9WA 4MN5A 3V3RA 3R7WB 5CTNA 3RTYA 3E4OA 3Q7ZA 2W1TB 3CMZA 3I7JA 2QJ7A 1SDEA 3LR5A 1ZG6A 3FYZA 1IKIA 3JVUA 2P9VA 3ZNTA 2XROA 1E4DA 3BFFA 2EFXA 3LIEA 5FDSA 3JVVA 2V1ZA 2WZXA 1XXMA 3UO9A 2ZM0A 3CPTA 3O86A 5GLAA 1TF1A 3KYZA 1PZPA 1VQQA 4GB7A 3Q07A 3A3IA 4LRYC 5DFXA 1TDGA 1I5QA 1M6KA 1LT0A 3K2NA 3NHQA 4OOLA 4S2JA 3T1QB 2PR5A 1PNEA 1UWPX 3K3CA 3BRMA 3OZHA 3SS5A 4MMNA 5FQJA 5G4ZA 1K54C 4X53A 1TEMA 3T12B 2WK0A 3OPRA 5TJJA 3MQ0A 4C75A 3N6IA 4OPRA 4G3WA 3UN7A 1ES4A 5JYPA 3S7NA 3UNWA 3MFDA 4C6YA 4EWFA 3FKVA 3PBTA 1N9NA 4PPRA 1BLHA 1YLZA 4CLCE 4QJGA 1U60A 3Q7VB 4FCFA 2QZ6A 2UV0E 1L3LA 4C3QA 3W8KA 1H8MA 1YQSA 5HAPA 1E3UD 4X56A 2G2UA 4JBFA 4MEZA 2O9AA 5FQKA 2X01A 2G7UA 4LENA 5F1FA 3DTIA 4KQOA 4LRXC 2IWBA 4E3MA 3O5YA 1JWZA 2DMWA 2VJWA 3T1SA 3DTMA 3LCEA 3L7HA 5DFYA 3TRCA 3PR6A 4BBTA 2V0UA 1T19A 3E4PA 5M1AA 3N8RA 4MNRA 4OOMA 3ITBA 4E6XA 1BUEA 2BG1A 3ZG0A 4JPMA 1YSPA 1J3WA 1O07A 5J3WA 3HBRA 3N7WA 2M7VA 2ZC3B 2XEPA 3AGEA 4KZBA 4RA7A 5HDCA 3G30A 5HWVA 1YT4A 2HP6A 3KYEA 4P85A 3C7VA 4N9LA 3WRZA 1EW0A 3B47A 4ZRRA 4ZAMA 5JYOA 5L2FA 2JKTI 4JXSA 4KZ7A 3M2JA 5FQMA 3LFVA 2AVXA 3K3DA 1OT9A 4FTXA 2PBDP 4FOFA 4JXWA 4KUOA 4D60A 2Q9NA 3VE4A 4HJ4A 4OPYA 4NK3A 3T1XA 5HD3A 1HD8A 4S2OA 1DP9A 3WS0A 3ZCZA 5F68A 3N8SA 1BLPA 1CJFA 1CK3A 4DXCA 1ODVA 5F69A 3A3EA 1A0KA 3V50A 1IEMA 4HH2A 3WS5A 1F9IA 3G32A 1OMEA 4LPZA 2WGVA 3UE1A 4JF4A 4ETXA 3PBSA 4L9FA 4MLLA 2O9BA 2QKPA 2ZQAA 4P87A 4CLCB 3P7NA 5F1GA 2H10A 1W7FA 5EFWA 1OJGA 3IS2A 2B95A 2J3TD 5TGFA 4GS9A 3IXGA 3A0VA 1W8QA 3T1RA 2HDUA 2IWCA 4P6ZM 5CHJA 3BYDA 4DN0A 5TFQA 5HDDA 1BTLA 3T4SA 5CGWA 1CI9A 1SKOB 3S7QA 4B4ZA 4E3OA 2IA2A 3AGFA 1JVJA 3BJNA 3MQOA 5IT5A 4Y3IA 5DTKA 1LHYA 5DF7A 2A3UA 3MXRA 2QPNA 4GKUA 2VA0A 2EXAA 2X71A 1YMXA 4Y0TA 3IWIA 2HJ9C 3ZG5A 2EX6A 3ZG7B 4WZ5C 2W1TA 1OTEA 5HZHA 3UY6A 3SS4A 4UEYA 4ZDXA 3MKFA 4EUVA 5DTSA 5A93A 1K57C 2M1CA 1KDSA 2JE5A 5AQBA 1YLYA 3N8LA 3C4PA 5AQAA 2FFFB 4YFMA 2ZJ9A 1K4FA 3ZFZA 5DKKA 3HUNA 3BLSA 1GHPA 1BLCA 3IX4A 1G6OA 1IELA 2XK1A 2L0WA 1DJCA 1PI4A 4O0PA 3QNCA 4H6JB 2V1BA 5HW3A 3OPLA 5J7EA 1ERMA 4ZTKA 1LI0A 2IWDA 3SOIA 1AXBA 4XT2B
chains in the Genus database with same CATH topology
3LEZA 2HP9A 3M6HA 1Z6FA 3OPHA 2GDNA 1ESIA 4MBKA 5GLDA 5FASA 3OCNA 1PW1A 2ZM2A 3O3VA 4R3BA 1NYMA 3IXDA 4XXRA 1PIOA 1Q2QA 1KE4A 3NI9A 4DDSA 2BLSA 3PBNA 3NDEA 3DW0A 3IWOA 2Y55A 4GDNA 1I2WA 1JWVA 3ZNYA 4GD8A 5EVIA 4B4XA 2Y2IA 2VGKA 5CECA 4X6TA 1FSYA 3G34A 2ZQ8A 1MY8A 1DY6A 1QMFA 4N1HA 4S2LA 1XPBA 2WKEA 4WYYA 5CTMA 5E2GA 2EXBA 2P74A 1EWZA 1K56D 1GA9A 2EX8A 3CG5A 1K6SA 4IVIA 3FV7A 2R9WA 4BD1A 1MPLA 4GD6A 3VP0A 3FZCA 4OPZA 5FI6A 5D3OA 3BM6A 4E3JA 1YLWA 4K0XA 3SH8A 3G35A 3ZG8B 2FFYA 2QMIA 1KE3A 3A3DA 4KQRA 4Q8IA 1L0EA 1XA7A 3D4FA 1BLSA 4E3IA 4P6BA 3VOYA 3ITAA 5GHXA 2XD5A 4X55A 1E25A 3HLCA 4FSFA 4WELA 5CXWA 3NY4A 4BJPA 2XR0A 3PTEA 1K38A 4OOYA 4DKIA 1K25A 4U3TA 4PMAA 4S2NC 5CEBA 1ALQA 5EVIC 4WZ5A 1L2SA 3P09A 3V3RA 5EVLA 2Y2JA 5I94A 3UPOA 2ZQ9A 5CTNA 3PBQA 3CJMA 4BL3A 3Q7ZA 4OLDA 4IEDA 2C5WB 3PBRA 3N4IA 4EQIA 5GHYA 5KMWA 5GLCA 3CMZA 1PI5A 3I7JA 3P98A 4E3KA 1SDEA 4FH2A 2WKIA 2WGWB 4OKPA 1ZG6A 1DJAA 2ZLYA 4S2MA 1ERQA 4OQIA 3IQAA 1JWPA 3FYZA 4PM6A 1MKIA 1IKIA 1O7EA 2ZC6B 4R4RA 4UA9A 2H0TA 1EI5A 4DRTA 5FQQA 1ZG4A 2CC1A 2P9VA 2HPBA 3ZNTA 3HREA 1L0FA 3HLEA 5FQIA 4WMCD 5M18A 1E4DA 2Y59A 3BFFA 2EFXA 4QY6A 2Z2LB 3VP4A 1HZOA 2Y2PA 1YMSA 1CEFA 4R0QA 4DE1A 3WWXA 5CEDA 4Y0UA 1L0GA 2Z2MB 2WZXA 1ONGA 2HP5A 2V1ZA 2PU2A 4O7DA 5E2HA 3W4OA 3ZVTA 5A92A 3WS1A 4DXBA 4ZJ2A 3EQVA 3A3FA 1XXMA 3UO9A 2ZM0A 3IT9A 3IH8A 2E8IA 3O86A 3IXHA 3LO7A 5GLAA 3ZGAB 4DE3A 2V2FF 1PZPA 4FD8A 3VSLA 1VQQA 1H8ZA 5HAQA 4GB7A 4IBRA 3IH9A 5FI7A 2JCHA 3Q07A 1MWTA 1RGYA 4KG6A 3A3IA 1GHMA 4KZ9A 5G18A 3RXWA 2XQZA 5FI2A 5HL1A 4N9KA 3C7UA 2DCFA 5EOOA 1G6AA 2XLNA 4OLGA 4U0XA 4KENB 1K6RA 4M3KA 2OV5A 4PM8A 4ZJ1A 1NZUA 1TDGA 1I5QA 1M6KA 1NXYA 4XUXA 4OOLA 4S2JA 3GRJA 2XGNA 4HBTA 2X02A 4E3LA 3QHYA 1K57A 1J9MA 2WADA 3BRMA 3C5AA 1NZOA 3NIAA 3OZHA 3SS5A 1HVBA 1WYCA 5FQJA 2WGWA 3IF6C 4OPQA 5DVAA 3JYIA 1K54C 1ES5A 4S2PA 4X53A 1TEMA 3E2LA 3RXXA 3SH9A 2WK0A 3C4OA 3OPRA 4ID4A 4KZ4A 5GL9A 5KZHA 5FATA 2OLUA 4S2IA 1LL5A 4C75A 3N6IA 4OPRA 2VGJA 4EBNA 3UN7A 1ES3A 1ES4A 1ES2A 3G2YA 2WZZA 3FWLA 5FAPA 5JYPA 1IYOA 1NJ4A 3MFDA 3UNWA 3FKVA 3PBTA 4C6YA 4EWFA 4PPRA 1BLHA 5CHMA 4KZ5A 1CI8A 3PBOA 1YLZA 4HBUA 1LL9A 5CHUA 2JC7A 4L0LA 4QJGA 1U60A 4JLFA 3Q7VB 4KZAA 2Y2GA 3PAGA 2QZ6A 4FCFA 4UHUA 5DF8A 2A49A 4WBGA 4CJNA 3SH7A 5CRFA 3HLWA 4R3JA 3BECA 1QMEA 3IHAA 4GOGA 4LCLA 4QY5A 4OH0A 4C3QA 3MZEA 1YQSA 3W8KA 5HAPA 1E3UD 3UDIA 2C6WB 4X56A 1K56A 2G2UA 4JBFA 2ZC5B 4HESA 1KGGA 4BD0A 1YM1A 4MEZA 5GLBA 4WMCA 5FQKA 2Y2MA 4BENA 2WGIA 2X01A 3HLGA 2RL3A 1WYBA 4KZ8A 1W5DA 1SDNA 4LENA 4N92A 4UA7A 5F1FA 2XF3A 1RCJA 2ZD8A 3E2KA 3Q81A 4OQ0A 4KQOA 2Y2QA 3DWKA 2IWBA 3IF6A 4E3MA 3O88A 4K0WA 1JWZA 4R4SA 4Y7PA 3VP1A 1W79A 2OLVA 4IBXA 2Y2OA 5EVIB 5CGSA 3DTMA 3HLBA 4LV3A 3ISGA 1PW8A 3LY3A 5M19A 3S22A 3TOIA 5J8XA 3LCEA 2R9XA 3MZDA 3UE3A 3BFCA 3S1YA 3ZVWA 2Y4AA 1FCMA 1SCWA 3UPPA 1RP5A 1S0WA 5M1AA 3N8RA 4MNRA 1Q2PA 4OP5A 3GMWA 4PM9A 2ZQCA 3BFDA 2Y2HA 4OOMA 4DE2A 3ITBA 4KG5A 4E6XA 4KZ6A 1BUEA 4JXGA 2BG1A 4ZBEA 3ZG0A 4GDBA 1G68A 3G31A 3IHBA 1GCEA 3IWQA 1CEGA 4JPMA 4PM7A 3HL9A 1IKGA 2PU4A 1SKFA 1O07A 3HBRA 4H8RA 5TR7A 3V3SA 2UWXA 1FSWA 3GVBA 3N7WA 1H5XA 5E2EA 2ZC3B 4A5RA 1FCNA 1LLBA 4RYEA 1N9BA 2HDRA 2Y2KA 2HDSA 3G2ZA 2XEPA 3AGEA 4HEFA 1NY0A 4IVKA 4KZBA 4RA7A 4E3NA 3UPNA 3G30A 5FAOA 1YT4A 2HP6A 3OCLA 4P85A 3WRTA 3C7VA 4N9LA 3WRZA 3WS2A 4Z9QA 1M40A 3Q1FA 4ZAMA 1XGIA 5JYOA 1W8YA 2I72A 2EFUA 3TSGA 3VFHA 5L2FA 1BZAA 3G4PA 3V5MA 1NRFA 2XDMA 1BSGA 4JXSA 4KZ7A 4X69A 3M2JA 1RGZA 4EV4A 3SS3A 2V20A 5A90A 4JF6A 1BULA 5FQMA 2Y2LA 2Y2NA 3CZDA 1KGFA 1YLPA 1HTZA 5AQ7A 3Q7VA 5IHVA 4BQMA 5KSHA 2WAEA 4JXWA 4F94A 2Q9NA 3BFEA 4OPYA 4NK3A 2DNSA 1HD8A 1YLTA 3MZFA 1FCOA 4OQHA 4S2OA 5CGXA 5EPHA 2WAFA 3WS0A 4B88A 4LV2A 3Q82A 3ZCZA 1K55C 3N8SA 5HAIA 1BLPA 2H0YA 3NC8A 4MBHA 4N1XA 5HFOA 1TVFA 1JTDA 1CK3A 4QU3A 4BL2A 4DXCA 1KVMA 2G2WA 3A3EA 3UDXA 1TDLA 3W4PA 3V50A 3UDFA 1SHVA 1IEMA 3WS5A 3BLMA 1EROA 3AGDA 3G32A 1KDWA 5DF9A 4X68A 4OQGA 3VP2A 1GHIA 1OMEA 2EX9A 4OVDA 2WGVA 4OONA 5FAQA 3UE1A 4JF4A 3PBSA 5KSCA 2EX2A 4JXVA 3BFGA 3GQZA 4FH4A 3VP3A 1XGJA 3HUOA 4MLLA 4WEKA 3IF5A 2ZQAA 1IYSA 4P87A 1KVLA 3NCKA 4U0TA 2H5SA 5F1GA 1Y54A 2H10A 1W7FA 4XUZA 3NDGA 1C3BA 4PM5A 3UE0A 1AXBA 1KGEA 3HUMA 5EUAA 3IXBA 5HARA 2XH9A 1MWSA 3TG9A 5BOHA 5TGFA 5F82A 4BLMA 3PAEA 3IXGA 2DRWA 1NYYA 2XFTA 5EVID 1W8QA 1K55A 2HDUA 1ZKJA 2IWCA 3DWZA 4DE0A 4K91A 1I2SA 3O87A 4LCMA 3NBLA 5CHJA 1PYYA 1KE0A 3BYDA 5TFQA 3ZG9B 1BTLA 4GNUA 1YLJA 2XFSA 3GSGA 3LY4A 1ESUA 3BEBA 2B5RA 4EUZA 5CGWA 1CI9A 3S4XA 4RVAA 4B4ZA 4E3OA 4Y0OA 4WEJA 3M2KA 1IYQA 3AGFA 1WE4A 2XD1A 2J9PA 1FOFA 3V39A 4S2NA 1ZC2A 1XKZA 3W4QA 1JVJA 3ZHHA 5DTKA 1LHYA 1MBLA 3OC2A 3A3JA 5DF7A 1PWCA 2A3UA 3MXRA 2QPNA 1XA1A 4MBFA 3FKWA 4GKUA 5FQ9A 4UAAA 1GA0A 2EXAA 2X71A 1YMXA 3HVFA 4KZ3A 4Y0TA 3IWIA 3ZG5A 2EX6A 3ZG7B 2J8YA 2ZM8A 4DF6A 4WZ5C 1MWRA 2P9VB 1XX2A 4WZ4A 3UY6A 1IYPA 1L0DA 3SS4A 2OSUA 4OP8A 1S6RA 4ZDXA 3MKFA 3QNBA 5DTSA 5A93A 1K57C 3MBZA 4KQQA 1KDSA 2JE5A 5AQBA 3GV9A 3VFFA 1H8YA 1PWDA 4E6WA 5U47A 1MWUA 1YLYA 1MXOA 3C4PA 1FQGA 3N8LA 2FFFB 4GZBA 4RX3A 4YFMA 2JBFA 5E43A 5AQAA 5FSRA 5CERA 1K54A 4WM9A 5HX9A 4DDYA 5EE8A 3VMAA 2ZJ9A 5FDHA 1FR6A 1K4FA 3GR2A 3GTCA 3IF6B 5F83A 3ZFZA 2RCXA 2ZC4B 2WUQA 1LI9A 3B3XA 1K4EA 3EQUA 5E2FA 3RJUA 3VOZA 3VSKA 4CPKA 2HDQA 3HUNA 3BLSA 1GHPA 5FA7A 1BLCA 2J9OA 5AQ9A 3WS4A 4EBLA 1IELA 5EOEA 1E3UA 2XK1A 1BT5A 1N4OA 2ZC7A 4ZJ3A 4GN2A 4R1GA 1DJCA 4LV0A 2ZMAA 2Q9MA 1PI4A 2ZQ7A 2WYXA 4RX2A 3QNCA 4YINA 2Y91A 1XP4A 1PWGA 4UA6A 1PZOA 4P0MA 5HW3A 3ZDJA 4JKTA 2PBYA 4D2OA 4QD4A 1FR1A 3HLFA 3MXSA 3OPLA 3OPPA 4QHCA 5A91A 1ONHA 4KG2A 2J7VA 1ERMA 4NETA 4QB8A 2ZQDA 5DTTA 4S2KA 2WKHA 4JF5A 4ZTKA 1DJBA 1LI0A 3M6BA 4R23A 5EECA 5GHZA 2IWDA 1JTGA 4EBPA 3SOIA 1VM1A 3MKEA 4LV1A 3HLDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LEZ A;  2HP9 A;  3M6H A;  1Z6F A;  3OPH A;  2GDN A;  1ESI A;  4MBK A;  5GLD A;  5FAS A;  3OCN A;  1PW1 A;  2ZM2 A;  3O3V A;  4R3B A;  1NYM A;  3IXD A;  4XXR A;  1PIO A;  1Q2Q A;  1KE4 A;  3NI9 A;  4DDS A;  2BLS A;  3PBN A;  3NDE A;  3DW0 A;  3IWO A;  2Y55 A;  4GDN A;  1I2W A;  1JWV A;  3ZNY A;  4GD8 A;  5EVI A;  4B4X A;  2Y2I A;  2VGK A;  5CEC A;  4X6T A;  1FSY A;  3G34 A;  2ZQ8 A;  1MY8 A;  1DY6 A;  1QMF A;  4N1H A;  4S2L A;  1XPB A;  2WKE A;  4WYY A;  5CTM A;  5E2G A;  2EXB A;  2P74 A;  1EWZ A;  1K56 D;  1GA9 A;  2EX8 A;  3CG5 A;  1K6S A;  4IVI A;  3FV7 A;  2R9W A;  4BD1 A;  1MPL A;  4GD6 A;  3VP0 A;  3FZC A;  4OPZ A;  5FI6 A;  5D3O A;  3BM6 A;  4E3J A;  1YLW A;  4K0X A;  3SH8 A;  3G35 A;  3ZG8 B;  2FFY A;  2QMI A;  1KE3 A;  3A3D A;  4KQR A;  4Q8I A;  1L0E A;  1XA7 A;  3D4F A;  1BLS A;  4E3I A;  4P6B A;  3VOY A;  3ITA A;  5GHX A;  2XD5 A;  4X55 A;  1E25 A;  3HLC A;  4FSF A;  4WEL A;  5CXW A;  3NY4 A;  4BJP A;  2XR0 A;  3PTE A;  1K38 A;  4OOY A;  4DKI A;  1K25 A;  4U3T A;  4PMA A;  4S2N C;  5CEB A;  1ALQ A;  5EVI C;  4WZ5 A;  1L2S A;  3P09 A;  3V3R A;  5EVL A;  2Y2J A;  5I94 A;  3UPO A;  2ZQ9 A;  5CTN A;  3PBQ A;  3CJM A;  4BL3 A;  3Q7Z A;  4OLD A;  4IED A;  2C5W B;  3PBR A;  3N4I A;  4EQI A;  5GHY A;  5KMW A;  5GLC A;  3CMZ A;  1PI5 A;  3I7J A;  3P98 A;  4E3K A;  1SDE A;  4FH2 A;  2WKI A;  2WGW B;  4OKP A;  1ZG6 A;  1DJA A;  2ZLY A;  4S2M A;  1ERQ A;  4OQI A;  3IQA A;  1JWP A;  3FYZ A;  4PM6 A;  1MKI A;  1IKI A;  1O7E A;  2ZC6 B;  4R4R A;  4UA9 A;  2H0T A;  1EI5 A;  4DRT A;  5FQQ A;  1ZG4 A;  2CC1 A;  2P9V A;  2HPB A;  3ZNT A;  3HRE A;  1L0F A;  3HLE A;  5FQI A;  4WMC D;  5M18 A;  1E4D A;  2Y59 A;  3BFF A;  2EFX A;  4QY6 A;  2Z2L B;  3VP4 A;  1HZO A;  2Y2P A;  1YMS A;  1CEF A;  4R0Q A;  4DE1 A;  3WWX A;  5CED A;  4Y0U A;  1L0G A;  2Z2M B;  2WZX A;  1ONG A;  2HP5 A;  2V1Z A;  2PU2 A;  4O7D A;  5E2H A;  3W4O A;  3ZVT A;  5A92 A;  3WS1 A;  4DXB A;  4ZJ2 A;  3EQV A;  3A3F A;  1XXM A;  3UO9 A;  2ZM0 A;  3IT9 A;  3IH8 A;  2E8I A;  3O86 A;  3IXH A;  3LO7 A;  5GLA A;  3ZGA B;  4DE3 A;  2V2F F;  1PZP A;  4FD8 A;  3VSL A;  1VQQ A;  1H8Z A;  5HAQ A;  4GB7 A;  4IBR A;  3IH9 A;  5FI7 A;  2JCH A;  3Q07 A;  1MWT A;  1RGY A;  4KG6 A;  3A3I A;  1GHM A;  4KZ9 A;  5G18 A;  3RXW A;  2XQZ A;  5FI2 A;  5HL1 A;  4N9K A;  3C7U A;  2DCF A;  5EOO A;  1G6A A;  2XLN A;  4OLG A;  4U0X A;  4KEN B;  1K6R A;  4M3K A;  2OV5 A;  4PM8 A;  4ZJ1 A;  1NZU A;  1TDG A;  1I5Q A;  1M6K A;  1NXY A;  4XUX A;  4OOL A;  4S2J A;  3GRJ A;  2XGN A;  4HBT A;  2X02 A;  4E3L A;  3QHY A;  1K57 A;  1J9M A;  2WAD A;  3BRM A;  3C5A A;  1NZO A;  3NIA A;  3OZH A;  3SS5 A;  1HVB A;  1WYC A;  5FQJ A;  2WGW A;  3IF6 C;  4OPQ A;  5DVA A;  3JYI A;  1K54 C;  1ES5 A;  4S2P A;  4X53 A;  1TEM A;  3E2L A;  3RXX A;  3SH9 A;  2WK0 A;  3C4O A;  3OPR A;  4ID4 A;  4KZ4 A;  5GL9 A;  5KZH A;  5FAT A;  2OLU A;  4S2I A;  1LL5 A;  4C75 A;  3N6I A;  4OPR A;  2VGJ A;  4EBN A;  3UN7 A;  1ES3 A;  1ES4 A;  1ES2 A;  3G2Y A;  2WZZ A;  3FWL A;  5FAP A;  5JYP A;  1IYO A;  1NJ4 A;  3MFD A;  3UNW A;  3FKV A;  3PBT A;  4C6Y A;  4EWF A;  4PPR A;  1BLH A;  5CHM A;  4KZ5 A;  1CI8 A;  3PBO A;  1YLZ A;  4HBU A;  1LL9 A;  5CHU A;  2JC7 A;  4L0L A;  4QJG A;  1U60 A;  4JLF A;  3Q7V B;  4KZA A;  2Y2G A;  3PAG A;  2QZ6 A;  4FCF A;  4UHU A;  5DF8 A;  2A49 A;  4WBG A;  4CJN A;  3SH7 A;  5CRF A;  3HLW A;  4R3J A;  3BEC A;  1QME A;  3IHA A;  4GOG A;  4LCL A;  4QY5 A;  4OH0 A;  4C3Q A;  3MZE A;  1YQS A;  3W8K A;  5HAP A;  1E3U D;  3UDI A;  2C6W B;  4X56 A;  1K56 A;  2G2U A;  4JBF A;  2ZC5 B;  4HES A;  1KGG A;  4BD0 A;  1YM1 A;  4MEZ A;  5GLB A;  4WMC A;  5FQK A;  2Y2M A;  4BEN A;  2WGI A;  2X01 A;  3HLG A;  2RL3 A;  1WYB A;  4KZ8 A;  1W5D A;  1SDN A;  4LEN A;  4N92 A;  4UA7 A;  5F1F A;  2XF3 A;  1RCJ A;  2ZD8 A;  3E2K A;  3Q81 A;  4OQ0 A;  4KQO A;  2Y2Q A;  3DWK A;  2IWB A;  3IF6 A;  4E3M A;  3O88 A;  4K0W A;  1JWZ A;  4R4S A;  4Y7P A;  3VP1 A;  1W79 A;  2OLV A;  4IBX A;  2Y2O A;  5EVI B;  5CGS A;  3DTM A;  3HLB A;  4LV3 A;  3ISG A;  1PW8 A;  3LY3 A;  5M19 A;  3S22 A;  3TOI A;  5J8X A;  3LCE A;  2R9X A;  3MZD A;  3UE3 A;  3BFC A;  3S1Y A;  3ZVW A;  2Y4A A;  1FCM A;  1SCW A;  3UPP A;  1RP5 A;  1S0W A;  5M1A A;  3N8R A;  4MNR A;  1Q2P A;  4OP5 A;  3GMW A;  4PM9 A;  2ZQC A;  3BFD A;  2Y2H A;  4OOM A;  4DE2 A;  3ITB A;  4KG5 A;  4E6X A;  4KZ6 A;  1BUE A;  4JXG A;  2BG1 A;  4ZBE A;  3ZG0 A;  4GDB A;  1G68 A;  3G31 A;  3IHB A;  1GCE A;  3IWQ A;  1CEG A;  4JPM A;  4PM7 A;  3HL9 A;  1IKG A;  2PU4 A;  1SKF A;  1O07 A;  3HBR A;  4H8R A;  5TR7 A;  3V3S A;  2UWX A;  1FSW A;  3GVB A;  3N7W A;  1H5X A;  5E2E A;  2ZC3 B;  4A5R A;  1FCN A;  1LLB A;  4RYE A;  1N9B A;  2HDR A;  2Y2K A;  2HDS A;  3G2Z A;  2XEP A;  3AGE A;  4HEF A;  1NY0 A;  4IVK A;  4KZB A;  4RA7 A;  4E3N A;  3UPN A;  3G30 A;  5FAO A;  1YT4 A;  2HP6 A;  3OCL A;  4P85 A;  3WRT A;  3C7V A;  4N9L A;  3WRZ A;  3WS2 A;  4Z9Q A;  1M40 A;  3Q1F A;  4ZAM A;  1XGI A;  5JYO A;  1W8Y A;  2I72 A;  2EFU A;  3TSG A;  3VFH A;  5L2F A;  1BZA A;  3G4P A;  3V5M A;  1NRF A;  2XDM A;  1BSG A;  4JXS A;  4KZ7 A;  4X69 A;  3M2J A;  1RGZ A;  4EV4 A;  3SS3 A;  2V20 A;  5A90 A;  4JF6 A;  1BUL A;  5FQM A;  2Y2L A;  2Y2N A;  3CZD A;  1KGF A;  1YLP A;  1HTZ A;  5AQ7 A;  3Q7V A;  5IHV A;  4BQM A;  5KSH A;  2WAE A;  4JXW A;  4F94 A;  2Q9N A;  3BFE A;  4OPY A;  4NK3 A;  2DNS A;  1HD8 A;  1YLT A;  3MZF A;  1FCO A;  4OQH A;  4S2O A;  5CGX A;  5EPH A;  2WAF A;  3WS0 A;  4B88 A;  4LV2 A;  3Q82 A;  3ZCZ A;  1K55 C;  3N8S A;  5HAI A;  1BLP A;  2H0Y A;  3NC8 A;  4MBH A;  4N1X A;  5HFO A;  1TVF A;  1JTD A;  1CK3 A;  4QU3 A;  4BL2 A;  4DXC A;  1KVM A;  2G2W A;  3A3E A;  3UDX A;  1TDL A;  3W4P A;  3V50 A;  3UDF A;  1SHV A;  1IEM A;  3WS5 A;  3BLM A;  1ERO A;  3AGD A;  3G32 A;  1KDW A;  5DF9 A;  4X68 A;  4OQG A;  3VP2 A;  1GHI A;  1OME A;  2EX9 A;  4OVD A;  2WGV A;  4OON A;  5FAQ A;  3UE1 A;  4JF4 A;  3PBS A;  5KSC A;  2EX2 A;  4JXV A;  3BFG A;  3GQZ A;  4FH4 A;  3VP3 A;  1XGJ A;  3HUO A;  4MLL A;  4WEK A;  3IF5 A;  2ZQA A;  1IYS A;  4P87 A;  1KVL A;  3NCK A;  4U0T A;  2H5S A;  5F1G A;  1Y54 A;  2H10 A;  1W7F A;  4XUZ A;  3NDG A;  1C3B A;  4PM5 A;  3UE0 A;  1AXB A;  1KGE A;  3HUM A;  5EUA A;  3IXB A;  5HAR A;  2XH9 A;  1MWS A;  3TG9 A;  5BOH A;  5TGF A;  5F82 A;  4BLM A;  3PAE A;  3IXG A;  2DRW A;  1NYY A;  2XFT A;  5EVI D;  1W8Q A;  1K55 A;  2HDU A;  1ZKJ A;  2IWC A;  3DWZ A;  4DE0 A;  4K91 A;  1I2S A;  3O87 A;  4LCM A;  3NBL A;  5CHJ A;  1PYY A;  1KE0 A;  3BYD A;  5TFQ A;  3ZG9 B;  1BTL A;  4GNU A;  1YLJ A;  2XFS A;  3GSG A;  3LY4 A;  1ESU A;  3BEB A;  2B5R A;  4EUZ A;  5CGW A;  1CI9 A;  3S4X A;  4RVA A;  4B4Z A;  4E3O A;  4Y0O A;  4WEJ A;  3M2K A;  1IYQ A;  3AGF A;  1WE4 A;  2XD1 A;  2J9P A;  1FOF A;  3V39 A;  4S2N A;  1ZC2 A;  1XKZ A;  3W4Q A;  1JVJ A;  3ZHH A;  5DTK A;  1LHY A;  1MBL A;  3OC2 A;  3A3J A;  5DF7 A;  1PWC A;  2A3U A;  3MXR A;  2QPN A;  1XA1 A;  4MBF A;  3FKW A;  4GKU A;  5FQ9 A;  4UAA A;  1GA0 A;  2EXA A;  2X71 A;  1YMX A;  3HVF A;  4KZ3 A;  4Y0T A;  3IWI A;  3ZG5 A;  2EX6 A;  3ZG7 B;  2J8Y A;  2ZM8 A;  4DF6 A;  4WZ5 C;  1MWR A;  2P9V B;  1XX2 A;  4WZ4 A;  3UY6 A;  1IYP A;  1L0D A;  3SS4 A;  2OSU A;  4OP8 A;  1S6R A;  4ZDX A;  3MKF A;  3QNB A;  5DTS A;  5A93 A;  1K57 C;  3MBZ A;  4KQQ A;  1KDS A;  2JE5 A;  5AQB A;  3GV9 A;  3VFF A;  1H8Y A;  1PWD A;  4E6W A;  5U47 A;  1MWU A;  1YLY A;  1MXO A;  3C4P A;  1FQG A;  3N8L A;  2FFF B;  4GZB A;  4RX3 A;  4YFM A;  2JBF A;  5E43 A;  5AQA A;  5FSR A;  5CER A;  1K54 A;  4WM9 A;  5HX9 A;  4DDY A;  5EE8 A;  3VMA A;  2ZJ9 A;  5FDH A;  1FR6 A;  1K4F A;  3GR2 A;  3GTC A;  3IF6 B;  5F83 A;  3ZFZ A;  2RCX A;  2ZC4 B;  2WUQ A;  1LI9 A;  3B3X A;  1K4E A;  3EQU A;  5E2F A;  3RJU A;  3VOZ A;  3VSK A;  4CPK A;  2HDQ A;  3HUN A;  3BLS A;  1GHP A;  5FA7 A;  1BLC A;  2J9O A;  5AQ9 A;  3WS4 A;  4EBL A;  1IEL A;  5EOE A;  1E3U A;  2XK1 A;  1BT5 A;  1N4O A;  2ZC7 A;  4ZJ3 A;  4GN2 A;  4R1G A;  1DJC A;  4LV0 A;  2ZMA A;  2Q9M A;  1PI4 A;  2ZQ7 A;  2WYX A;  4RX2 A;  3QNC A;  4YIN A;  2Y91 A;  1XP4 A;  1PWG A;  4UA6 A;  1PZO A;  4P0M A;  5HW3 A;  3ZDJ A;  4JKT A;  2PBY A;  4D2O A;  4QD4 A;  1FR1 A;  3HLF A;  3MXS A;  3OPL A;  3OPP A;  4QHC A;  5A91 A;  1ONH A;  4KG2 A;  2J7V A;  1ERM A;  4NET A;  4QB8 A;  2ZQD A;  5DTT A;  4S2K A;  2WKH A;  4JF5 A;  4ZTK A;  1DJB A;  1LI0 A;  3M6B A;  4R23 A;  5EEC A;  5GHZ A;  2IWD A;  1JTG A;  4EBP A;  3SOI A;  1VM1 A;  3MKE A;  4LV1 A;  3HLD A; 
#chains in the Genus database with same CATH topology
 4IUK A;  3M6H A;  2GDN A;  5FL3 A;  3SW1 A;  4L9G A;  3O3V A;  4R3B A;  3IXD A;  4XXR A;  1Q2Q A;  3LGO A;  3PBN A;  4GDN A;  1H0M A;  4X6T A;  3MF0 A;  3EEH A;  1OTB A;  5HSQ A;  2P74 A;  1K56 D;  3FV7 A;  3FZC A;  2QHK A;  1V9Z A;  2KLI A;  4K0X A;  2FFY A;  1KE3 A;  3A3D A;  1ZTU A;  5GHX A;  2XD5 A;  5F6A A;  4FSF A;  3R4K A;  1D7E A;  4ESP A;  2H28 A;  3PTE A;  3T4T A;  1K38 A;  5TBM A;  4PMA A;  1ALQ A;  1MC0 A;  3DTK A;  1OT6 A;  2J3T C;  4O01 A;  2C5W B;  4WLA A;  2VGL M;  2R78 A;  5AVF A;  5A8B A;  4FH2 A;  2PD7 A;  2WKI A;  4OKP A;  1ERQ A;  3IQA A;  1MKI A;  2H0T A;  5FQQ A;  2LB9 A;  3OLO A;  3HRE A;  1L0F A;  3HLE A;  3LUQ A;  4DE1 A;  3WWX A;  4G3K A;  4Y0U A;  1L0G A;  1ONG A;  3DTE A;  3ZVT A;  4BMW A;  4ZJ2 A;  3EQV A;  1F5M A;  4P6Z S;  1H8Z A;  2WKR A;  2JCH A;  1RGY A;  3RXW A;  1GHM A;  4LRZ E;  2DCF A;  5EOO A;  4U0X A;  2OAP 1;  4KEN B;  4M3K A;  2OV5 A;  5G4Y A;  1T1A A;  3QHY A;  3MS6 A;  1WYC A;  4I39 A;  4OPQ A;  5DVA A;  3JYI A;  1ES5 A;  4S2P A;  3BQ8 A;  3C2W A;  3C4O A;  4ID4 A;  4NXF A;  5GL9 A;  5KZH A;  2OLU A;  3S7O A;  3IX3 A;  4S2I A;  1OTD A;  2VGJ A;  5FAP A;  1NJ4 A;  4HJ3 A;  4EXO A;  4Y15 A;  4HBU A;  1LL9 A;  3CLO A;  4JLF A;  1CQA A;  3PAG A;  4UHU A;  5CRF A;  2K7S A;  4GOG A;  4LCL A;  4OH0 A;  3MZE A;  3UDI A;  1K56 A;  2ZC5 B;  1KGG A;  1YM1 A;  5GLB A;  4WMC A;  2Y2M A;  2QWS A;  4WF0 A;  1OPX A;  3HLG A;  1WYB A;  3PYP A;  1RCJ A;  3Q81 A;  4JGP A;  2JHE A;  3DWK A;  3MMH A;  3LR4 A;  4Y7P A;  4Q0J A;  1WA9 A;  3EOI A;  2Y2O A;  5EVI B;  5CGS A;  2NUT C;  3S22 A;  3MZD A;  3UE3 A;  4KQD A;  3ZVW A;  1RP5 A;  1S0W A;  5HPI A;  2M7U A;  3LI8 A;  4PM9 A;  2ZQC A;  4KG5 A;  3OBF A;  2VV8 A;  4JXG A;  3H7W B;  3JPU A;  4ZBE A;  3IHB A;  1GCE A;  3KSI A;  4PM7 A;  1IKG A;  5HL6 A;  1G5U A;  2UWX A;  2V8F A;  5E2E A;  4A5R A;  1LLB A;  2Y2K A;  4HEF A;  3HCY A;  3UB8 A;  1OTI A;  3ZYT A;  3EEA A;  3HJK A;  1MKM A;  3V5M A;  2XDM A;  3SS3 A;  2Y2L A;  3VE3 A;  3L9K A;  3F1N A;  2QJ5 A;  5KSH A;  4EW7 A;  3MFX A;  1FCO A;  5EPH A;  2WAF A;  3Q82 A;  1K55 C;  4KUK A;  4BWI A;  4HI4 A;  4N1X A;  3TJZ C;  1TVF A;  1JTD A;  1KVM A;  3NUL A;  2LB5 A;  2OAQ 1;  3VOL A;  5EV0 A;  2OOL A;  1ERO A;  3AGD A;  4ARZ B;  5DF9 A;  4OQG A;  3VP2 A;  2O0Y A;  4OON A;  2OWJ A;  4FUW A;  3R7W A;  4X1L A;  1T1B A;  1C3B A;  5HAR A;  2B18 A;  4NXE A;  4QPR A;  4BLM A;  1S66 L;  2XA7 M;  2MJ6 A;  2XFT A;  5EVI D;  1W63 M;  1K55 A;  1I2S A;  4LCM A;  3NBL A;  1YLJ A;  1ESU A;  2B5R A;  4RVA A;  4Y0O A;  4LGW A;  1IYQ A;  4S2N A;  1ZC2 A;  2NUP C;  2D01 A;  3ZHH A;  1TS0 A;  4II7 A;  1XA1 A;  2HF6 A;  2L4R A;  2P9V B;  2HZ5 A;  5L07 A;  3UB5 P;  2OSU A;  4OP8 A;  1NWZ A;  3FC7 A;  4R38 A;  3MBZ A;  4KQQ A;  5TBM B;  3GV9 A;  3HLD A;  1PWD A;  5U47 A;  1MWU A;  1FQG A;  5FSR A;  1TS7 A;  4WM9 A;  5HX9 A;  3IBR A;  3BY9 A;  3ULF A;  2GNX A;  1LI9 A;  3VOZ A;  3EQU A;  5E2F A;  3RJU A;  3VSK A;  2W3G A;  1VHM A;  5FA7 A;  5HD5 A;  2J9O A;  5KIZ A;  4EBL A;  4GHI B;  3LIF A;  1JNU A;  4HNB A;  1E3U A;  4ZJ3 A;  1N4O A;  3LI9 A;  3UE6 A;  2WYX A;  2Q0O A;  1XP4 A;  3DBA A;  1PWG A;  2W3H A;  1PZO A;  3ZDJ A;  1BYW A;  2PBY A;  5DJT A;  4QD4 A;  3HLF A;  4QHC A;  3OPP A;  2J7V A;  2ZQD A;  1Z09 A;  4S2K A;  2QYB A;  3T4J A;  5HDS A;  4XT2 A;  4EBP A;  4KG6 A;  1VM1 A;  3MKE A;  2K2N A;  3FPV A;  5IS1 A;  4MBK A;  2V1A A;  1PIO A;  1KE4 A;  1T1C A;  1XFQ A;  1I2W A;  2Y8H A;  2P04 A;  5EVI A;  1DRM A;  3TW8 A;  1MY8 A;  1DY6 A;  1QMF A;  1XPB A;  2EXB A;  1EWZ A;  1SKO A;  1GA9 A;  4IVI A;  4BBV A;  2R9W A;  4BD1 A;  1MPL A;  3MXQ A;  2ZL1 A;  1S1Y A;  4OPZ A;  4X25 A;  5MC7 A;  2INW A;  4IUH A;  3ZG8 B;  4H6J A;  4G3V A;  1VEU B;  5FEG A;  2JKR I;  3ITA A;  4X55 A;  2XR0 A;  3B33 A;  4HJ6 A;  5CEB A;  2WKP A;  3P09 A;  4K08 A;  2Y2J A;  3FG8 A;  3C30 A;  3UPO A;  2JKF A;  2P08 A;  3CJM A;  4WN5 A;  4BL3 A;  4OLD A;  2W1R A;  4IED A;  3N4I A;  5DJU A;  5GHY A;  4EQI A;  5GLC A;  1PI5 A;  2WGW B;  1DJA A;  4OQI A;  2YKH A;  4UA9 A;  2ZC6 B;  4R3A A;  3UB9 A;  1ZG4 A;  2XSS A;  2CC1 A;  1IFQ A;  3H82 A;  4Y17 A;  5FQI A;  4WMC D;  2Y59 A;  4QY6 A;  2Z2L B;  3VP4 A;  1YMS A;  3MJQ A;  1YPR A;  2KX6 A;  5CED A;  2Z2M B;  4O7D A;  2PU2 A;  3IH8 A;  2XRN A;  3KO6 A;  3LO7 A;  3ZGA B;  4DE3 A;  1LSX A;  4FD8 A;  4Y2F A;  4ETZ A;  3IH9 A;  5G18 A;  3C8C A;  2XQZ A;  5FI2 A;  5HL1 A;  3C7U A;  2YKF A;  2XLN A;  4OLG A;  1K6R A;  2PYR A;  5L10 A;  4PM8 A;  4ZJ1 A;  5J4E A;  4JGR A;  1HLU P;  2HV1 A;  3HJI A;  3IX8 A;  4MN6 A;  2XGN A;  1N9L A;  1J9M A;  1YKD A;  3S7P A;  3NIA A;  1HVB A;  4PKY G;  3IF6 C;  3A0R A;  1N9O A;  3F1P A;  3SH9 A;  2VK3 A;  3E0Y A;  2O9C A;  3H7W A;  1LL5 A;  2W3D A;  4ARZ A;  4EBN A;  1Y4O A;  1ES3 A;  2O99 A;  1IYO A;  3PBO A;  5CHU A;  2JC7 A;  1H3Q A;  1LSW A;  2Y2G A;  3CAX A;  2A49 A;  3F1N B;  3UB7 A;  3SH7 A;  4R3J A;  4QY5 A;  3NOT C;  2C6W B;  2ZOI A;  4EER A;  2Z6C A;  3PXP A;  4BD0 A;  4BEN A;  4KZ8 A;  1SDN A;  2XF3 A;  3E2K A;  2Y2Q A;  4NXB A;  3O88 A;  4R4S A;  3T4K A;  4IBX A;  3B42 A;  5M19 A;  1UWN X;  4DJ2 A;  3RH8 B;  2R9X A;  4QWO A;  3BFC A;  4GJ4 A;  1Q2P A;  3GMW A;  3BFD A;  4DE2 A;  1S4R A;  1XFN A;  4F3L B;  4GDB A;  1G68 A;  3G31 A;  3W2Z A;  3IWQ A;  3KSG A;  1VET A;  2PU4 A;  1SKF A;  4Q0H A;  1FSW A;  3DAV A;  1H5X A;  4HOI A;  1FCN A;  4RYE A;  5CX7 A;  2HDS A;  4E3N A;  4IVK A;  5FAO A;  3CPT B;  3OCL A;  1M40 A;  3Q1F A;  1XGI A;  2EFU A;  3TSG A;  2PYP A;  3G4P A;  1BSG A;  3CHW P;  4EV4 A;  1BUL A;  3F1O A;  2ZMV A;  3D9Y A;  1XJ6 A;  3IBJ A;  1HTZ A;  5AQ7 A;  3Q7V A;  5IHV A;  3BW6 A;  4F94 A;  4CLC A;  1STZ A;  2DNS A;  1YLT A;  3MZF A;  5CGX A;  4OQH A;  2HGV A;  4B88 A;  5HAI A;  3NC8 A;  5HFO A;  4QU3 A;  4BL2 A;  2G2W A;  3LR3 A;  3UDX A;  1TDL A;  3UDF A;  1SHV A;  3BLM A;  1KDW A;  5LBR A;  5L09 A;  1D06 A;  1TS8 A;  5FAQ A;  5KSC A;  1VEU A;  2EX2 A;  3GQZ A;  1NRJ A;  3HUO A;  4DJ3 A;  4HQA A;  4WEK A;  4YOF A;  3IF5 A;  4U0T A;  3MR0 A;  3SZT A;  3LEQ A;  1P0Z A;  2E8J A;  3NDG A;  3T50 A;  4UQI S;  2D02 A;  4BBU A;  2VZW A;  4PM5 A;  5FEF A;  1KGE A;  3HUM A;  3IXB A;  2XH9 A;  1MWS A;  3QP1 A;  3PAE A;  1NYY A;  2A24 A;  3DWZ A;  5EM1 A;  4K91 A;  1KE0 A;  3BQA A;  5EVE A;  4RQ9 A;  4IJG A;  1GSX A;  3LY4 A;  4NEE D;  3S4X A;  1LSV A;  2GZA A;  4X1M A;  4O8G A;  4WEJ A;  1WE4 A;  3D3O A;  3V39 A;  2ZMF A;  4NXG A;  1XKZ A;  3QP4 A;  2OWH A;  4PAU A;  1MBL A;  3A3J A;  1PWC A;  3FKW A;  3D72 A;  4UAA A;  3HVF A;  4DF6 A;  4Y13 A;  4WZ4 A;  1L0D A;  1S6R A;  2GJ3 A;  2JKG A;  3FPW A;  2ZBB A;  3QNB A;  3VFF A;  1H8Y A;  4E6W A;  1MXO A;  4RX3 A;  4GZB A;  5E43 A;  5CER A;  3ZQ5 A;  4DDY A;  4IHQ A;  2KDK A;  4M4X A;  2JN7 A;  4B9O A;  4Z1W A;  2EA9 A;  3P01 A;  2RCX A;  2ZC4 B;  3B3X A;  1K4E A;  4CPK A;  4HP9 A;  2HDQ A;  5HPF A;  5AQ9 A;  5EOE A;  1BT5 A;  4GN2 A;  4EES A;  4R1G A;  2ZMA A;  2Q9M A;  2ZQ7 A;  2Y91 A;  4UA6 A;  4P0M A;  4JKT A;  5A91 A;  4KG2 A;  5I5L A;  2P7J A;  3U2A A;  4QB8 A;  5DTT A;  3GDI A;  4JF5 A;  1DJB A;  3M6B A;  2FH5 A;  1GSW A;  1JTG A;  4PKY A;  3T4L A;  3LEZ A;  3OPH A;  4I3A A;  2PD8 A;  5FAS A;  5GLD A;  4CQH A;  3QP5 A;  3NI9 A;  3LIC A;  4EQ1 A;  3IWO A;  2Y55 A;  1VB6 A;  4E04 A;  1JWV A;  1CF0 A;  4NG2 A;  3ZNY A;  1TS6 A;  4B4X A;  2VGK A;  1FSY A;  3G34 A;  1W63 Q;  4WYY A;  2WKE A;  5CTM A;  5E2G A;  2V8C A;  2J3W A;  2PHY A;  2J80 A;  2Z6D A;  3BM6 A;  1YLW A;  4Q8I A;  3UB6 A;  1L0E A;  1XA7 A;  3D4F A;  1BLS A;  3NEC A;  4E3I A;  5AVE A;  4P6B A;  3VOY A;  3H82 B;  4WEL A;  5CXW A;  4R6L A;  2ACG A;  3BY8 A;  3LID A;  4OOY A;  1TD5 A;  4DKI A;  3G6O A;  1LL8 A;  3LR0 A;  5EVI C;  1L2S A;  3E4Q A;  5EVL A;  5I94 A;  2ZQ9 A;  2VKS A;  3PBQ A;  4CLC C;  3PBR A;  2VV6 A;  4MCW A;  2GX5 A;  5KMW A;  3P98 A;  4E3K A;  4YWZ A;  4GCZ A;  2VX8 A;  1G28 A;  2ZLY A;  4S2M A;  1JWP A;  4PM6 A;  1O7E A;  4R4R A;  1EI5 A;  4DRT A;  2HPB A;  5M18 A;  2CMN A;  1DP8 A;  3KSF A;  1HZO A;  2Y2P A;  1CEF A;  4R0Q A;  2EWV A;  3W4O A;  2XA7 S;  2HP5 A;  5A92 A;  5E2H A;  3WS1 A;  4DXB A;  3A3F A;  1IOU A;  4HP4 A;  3IT9 A;  3LYX A;  5K5B A;  2E8I A;  3IXH A;  4EEP A;  2V2F F;  2PAV P;  4UQI M;  3VSL A;  5HAQ A;  4IBR A;  5AJG A;  5FI7 A;  4KZ9 A;  1MWT A;  2ZL1 B;  4N9K A;  4GW9 A;  4YNR A;  1P97 A;  1G6A A;  3EGX C;  1NZU A;  1NXY A;  1NLZ A;  4XUX A;  2W27 A;  3GRJ A;  4HBT A;  2X02 A;  4I3J A;  4E3L A;  1K57 A;  2WAD A;  3C5A A;  1NZO A;  2HJE A;  2WGW A;  3RXX A;  3E2L A;  2KOI A;  4KZ4 A;  5FAT A;  1ES2 A;  1V9Y A;  2WZZ A;  3G2Y A;  3CUE A;  3FWL A;  1PFL A;  5CHM A;  4KZ5 A;  1CI8 A;  4GHI A;  4L0L A;  4KZA A;  4CJN A;  5DF8 A;  4WBG A;  3HLW A;  3BEC A;  1QME A;  3IHA A;  1XJ3 A;  4CLC D;  2JKT M;  4HES A;  2K31 A;  4B93 A;  4GLQ A;  3NOP C;  2WGI A;  2RL3 A;  4AFI A;  1W5D A;  4N92 A;  4UA7 A;  2ZD8 A;  1UGU A;  1ACF A;  4OQ0 A;  3IF6 A;  3CIT A;  4K0W A;  3VP1 A;  1W79 A;  2OLV A;  1K0K A;  3PHY A;  4DMZ A;  2W3F A;  3CUE C;  2VV7 A;  3HLB A;  4I3I A;  4LV3 A;  3ISG A;  1PW8 A;  3LY3 A;  3TOI A;  5J8X A;  3KSH A;  3QP6 A;  3S1Y A;  2Y4A A;  1FCM A;  1SCW A;  3UPP A;  4OP5 A;  2Y2H A;  3EGD C;  2W0N A;  3UMD A;  4KZ6 A;  1CEG A;  3HL9 A;  4H8R A;  5TR7 A;  3V3S A;  1GSV A;  3GVB A;  4NKP A;  2BAS A;  3LIB A;  5IU1 A;  1N9B A;  2HDR A;  3G2Z A;  1NY0 A;  3NOU C;  3UPN A;  4GS9 B;  3VV4 A;  3WRT A;  3WS2 A;  4Z9Q A;  5F5Y A;  1S4S A;  3BWL A;  1W8Y A;  2I72 A;  3VFH A;  1FIK A;  1BZA A;  1NRF A;  5EM0 A;  5A90 A;  4X69 A;  1RGZ A;  2V20 A;  4JF6 A;  2Y2N A;  3CZD A;  1KGF A;  1YLP A;  3C38 A;  4Q0I A;  4BQM A;  2WAE A;  2V0W A;  4R70 A;  1P9W A;  3BFE A;  4Y5F A;  1F98 A;  1FIL A;  4LV2 A;  4MN7 A;  4JGO A;  2H0Y A;  4MBH A;  1YSQ A;  1KOU A;  1OTA A;  3GEC A;  4HIA A;  5HWW A;  2VEA A;  2VGL S;  3W4P A;  1F2K A;  3TE8 A;  1T18 A;  4X68 A;  1GHI A;  2EX9 A;  4OVD A;  4JXV A;  3BFG A;  2I9V A;  4FH4 A;  3EWK A;  1XGJ A;  3VP3 A;  3QP8 A;  3F1P B;  1IYS A;  1KVL A;  3NCK A;  2H5S A;  3QP2 A;  1Y54 A;  4XUZ A;  3UE0 A;  5EUA A;  2PDR A;  2V9A A;  3TG9 A;  5BOH A;  5F82 A;  3MQQ A;  3V67 A;  2DRW A;  4ME4 A;  4DE0 A;  1ZKJ A;  2WKQ A;  1SZV A;  1Y28 A;  2W3E A;  3O87 A;  1PYY A;  3ICY A;  5C5K A;  1X0O A;  3ZG9 B;  4GNU A;  3LIA A;  2XFS A;  3GSG A;  2JKR M;  3BEB A;  4EUZ A;  4F3L A;  3OOV A;  3M2K A;  5DKL A;  2XD1 A;  2J9P A;  1FOF A;  3W4Q A;  2PRF A;  3OC2 A;  3CWF A;  3KYQ A;  4PHT A;  4MBF A;  5FQ9 A;  1MZU A;  1XJ4 A;  1GA0 A;  4KZ3 A;  3CI6 A;  1D1J A;  2J8Y A;  2ZM8 A;  1MWR A;  1XX2 A;  4HY8 A;  1IYP A;  1PRQ A;  1P9R A;  4LLO B;  2B02 A;  2PT7 A;  2JBF A;  2EWW A;  1K54 A;  3T4Q A;  3F1O B;  5EE8 A;  3MSH A;  4L9E A;  3VMA A;  5FDH A;  1FR6 A;  3GR2 A;  3GTC A;  3IF6 B;  5F83 A;  2WUQ A;  1OJ5 A;  4HH3 A;  5HWT A;  3WS4 A;  4HHD A;  1AWI A;  1S67 L;  2ZC7 A;  4WUJ A;  4LV0 A;  4LFU A;  4I5S A;  4RX2 A;  4YIN A;  4I38 A;  3KX0 X;  4D2O A;  1FR1 A;  3MXS A;  4MDZ A;  1ONH A;  4NET A;  5L8M A;  2PR6 A;  2BTF P;  2WKH A;  1ZHH B;  2FZ0 A;  5EEC A;  4R23 A;  3E98 A;  5GHZ A;  4LV1 A;  1NLY A;  2HP9 A;  1YAX A;  1Z6F A;  3A0S A;  1ESI A;  3OCN A;  1PW1 A;  1VET B;  2ZM2 A;  4WL9 A;  1NYM A;  3T4O A;  4DDS A;  2BLS A;  2A2L A;  3NDE A;  3DW0 A;  4EET B;  4GD8 A;  2Y2I A;  3RFB A;  5CEC A;  2ZQ8 A;  4N1H A;  4S2L A;  1DP6 A;  1S1Z A;  3IS2 B;  3U4L P;  2EX8 A;  3CG5 A;  1K6S A;  4GD6 A;  1XJ2 A;  2VLG A;  3VP0 A;  5FI6 A;  5D3O A;  4E3J A;  3SH8 A;  3G35 A;  2A24 B;  3UME A;  4KQR A;  2QMI A;  2Y79 A;  4JGQ A;  1E25 A;  3HLC A;  4EU0 A;  4EEU A;  3NY4 A;  4BJP A;  1K25 A;  3NJA A;  2ZOH A;  4U3T A;  4S2N C;  4WZ5 A;  2L1M A;  3H9W A;  4MN5 A;  3V3R A;  3R7W B;  5CTN A;  3RTY A;  3E4O A;  3Q7Z A;  2W1T B;  3CMZ A;  3I7J A;  2QJ7 A;  1SDE A;  3LR5 A;  1ZG6 A;  3FYZ A;  1IKI A;  3JVU A;  2P9V A;  3ZNT A;  2XRO A;  1E4D A;  3BFF A;  2EFX A;  3LIE A;  5FDS A;  3JVV A;  2V1Z A;  2WZX A;  1XXM A;  3UO9 A;  2ZM0 A;  3CPT A;  3O86 A;  5GLA A;  1TF1 A;  3KYZ A;  1PZP A;  1VQQ A;  4GB7 A;  3Q07 A;  3A3I A;  4LRY C;  5DFX A;  1TDG A;  1I5Q A;  1M6K A;  1LT0 A;  3K2N A;  3NHQ A;  4OOL A;  4S2J A;  3T1Q B;  2PR5 A;  1PNE A;  1UWP X;  3K3C A;  3BRM A;  3OZH A;  3SS5 A;  4MMN A;  5FQJ A;  5G4Z A;  1K54 C;  4X53 A;  1TEM A;  3T12 B;  2WK0 A;  3OPR A;  5TJJ A;  3MQ0 A;  4C75 A;  3N6I A;  4OPR A;  4G3W A;  3UN7 A;  1ES4 A;  5JYP A;  3S7N A;  3UNW A;  3MFD A;  4C6Y A;  4EWF A;  3FKV A;  3PBT A;  1N9N A;  4PPR A;  1BLH A;  1YLZ A;  4CLC E;  4QJG A;  1U60 A;  3Q7V B;  4FCF A;  2QZ6 A;  2UV0 E;  1L3L A;  4C3Q A;  3W8K A;  1H8M A;  1YQS A;  5HAP A;  1E3U D;  4X56 A;  2G2U A;  4JBF A;  4MEZ A;  2O9A A;  5FQK A;  2X01 A;  2G7U A;  4LEN A;  5F1F A;  3DTI A;  4KQO A;  4LRX C;  2IWB A;  4E3M A;  3O5Y A;  1JWZ A;  2DMW A;  2VJW A;  3T1S A;  3DTM A;  3LCE A;  3L7H A;  5DFY A;  3TRC A;  3PR6 A;  4BBT A;  2V0U A;  1T19 A;  3E4P A;  5M1A A;  3N8R A;  4MNR A;  4OOM A;  3ITB A;  4E6X A;  1BUE A;  2BG1 A;  3ZG0 A;  4JPM A;  1YSP A;  1J3W A;  1O07 A;  5J3W A;  3HBR A;  3N7W A;  2M7V A;  2ZC3 B;  2XEP A;  3AGE A;  4KZB A;  4RA7 A;  5HDC A;  3G30 A;  5HWV A;  1YT4 A;  2HP6 A;  3KYE A;  4P85 A;  3C7V A;  4N9L A;  3WRZ A;  1EW0 A;  3B47 A;  4ZRR A;  4ZAM A;  5JYO A;  5L2F A;  2JKT I;  4JXS A;  4KZ7 A;  3M2J A;  5FQM A;  3LFV A;  2AVX A;  3K3D A;  1OT9 A;  4FTX A;  2PBD P;  4FOF A;  4JXW A;  4KUO A;  4D60 A;  2Q9N A;  3VE4 A;  4HJ4 A;  4OPY A;  4NK3 A;  3T1X A;  5HD3 A;  1HD8 A;  4S2O A;  1DP9 A;  3WS0 A;  3ZCZ A;  5F68 A;  3N8S A;  1BLP A;  1CJF A;  1CK3 A;  4DXC A;  1ODV A;  5F69 A;  3A3E A;  1A0K A;  3V50 A;  1IEM A;  4HH2 A;  3WS5 A;  1F9I A;  3G32 A;  1OME A;  4LPZ A;  2WGV A;  3UE1 A;  4JF4 A;  4ETX A;  3PBS A;  4L9F A;  4MLL A;  2O9B A;  2QKP A;  2ZQA A;  4P87 A;  4CLC B;  3P7N A;  5F1G A;  2H10 A;  1W7F A;  5EFW A;  1OJG A;  3IS2 A;  2B95 A;  2J3T D;  5TGF A;  4GS9 A;  3IXG A;  3A0V A;  1W8Q A;  3T1R A;  2HDU A;  2IWC A;  4P6Z M;  5CHJ A;  3BYD A;  4DN0 A;  5TFQ A;  5HDD A;  1BTL A;  3T4S A;  5CGW A;  1CI9 A;  1SKO B;  3S7Q A;  4B4Z A;  4E3O A;  2IA2 A;  3AGF A;  1JVJ A;  3BJN A;  3MQO A;  5IT5 A;  4Y3I A;  5DTK A;  1LHY A;  5DF7 A;  2A3U A;  3MXR A;  2QPN A;  4GKU A;  2VA0 A;  2EXA A;  2X71 A;  1YMX A;  4Y0T A;  3IWI A;  2HJ9 C;  3ZG5 A;  2EX6 A;  3ZG7 B;  4WZ5 C;  2W1T A;  1OTE A;  5HZH A;  3UY6 A;  3SS4 A;  4UEY A;  4ZDX A;  3MKF A;  4EUV A;  5DTS A;  5A93 A;  1K57 C;  2M1C A;  1KDS A;  2JE5 A;  5AQB A;  1YLY A;  3N8L A;  3C4P A;  5AQA A;  2FFF B;  4YFM A;  2ZJ9 A;  1K4F A;  3ZFZ A;  5DKK A;  3HUN A;  3BLS A;  1GHP A;  1BLC A;  3IX4 A;  1G6O A;  1IEL A;  2XK1 A;  2L0W A;  1DJC A;  1PI4 A;  4O0P A;  3QNC A;  4H6J B;  2V1B A;  5HW3 A;  3OPL A;  5J7E A;  1ERM A;  4ZTK A;  1LI0 A;  2IWD A;  3SOI A;  1AXB A;  4XT2 B; 
#chains in the Genus database with same CATH homology
 3LEZ A;  2HP9 A;  3M6H A;  1Z6F A;  3OPH A;  2GDN A;  1ESI A;  4MBK A;  5GLD A;  5FAS A;  3OCN A;  1PW1 A;  2ZM2 A;  3O3V A;  4R3B A;  1NYM A;  3IXD A;  4XXR A;  1PIO A;  1Q2Q A;  1KE4 A;  3NI9 A;  4DDS A;  2BLS A;  3PBN A;  3NDE A;  3DW0 A;  3IWO A;  2Y55 A;  4GDN A;  1I2W A;  1JWV A;  3ZNY A;  4GD8 A;  5EVI A;  4B4X A;  2Y2I A;  2VGK A;  5CEC A;  4X6T A;  1FSY A;  3G34 A;  2ZQ8 A;  1MY8 A;  1DY6 A;  1QMF A;  4N1H A;  4S2L A;  1XPB A;  2WKE A;  4WYY A;  5CTM A;  5E2G A;  2EXB A;  2P74 A;  1EWZ A;  1K56 D;  1GA9 A;  2EX8 A;  3CG5 A;  1K6S A;  4IVI A;  3FV7 A;  2R9W A;  4BD1 A;  1MPL A;  4GD6 A;  3VP0 A;  3FZC A;  4OPZ A;  5FI6 A;  5D3O A;  3BM6 A;  4E3J A;  1YLW A;  4K0X A;  3SH8 A;  3G35 A;  3ZG8 B;  2FFY A;  2QMI A;  1KE3 A;  3A3D A;  4KQR A;  4Q8I A;  1L0E A;  1XA7 A;  3D4F A;  1BLS A;  4E3I A;  4P6B A;  3VOY A;  3ITA A;  5GHX A;  2XD5 A;  4X55 A;  1E25 A;  3HLC A;  4FSF A;  4WEL A;  5CXW A;  3NY4 A;  4BJP A;  2XR0 A;  3PTE A;  1K38 A;  4OOY A;  4DKI A;  1K25 A;  4U3T A;  4PMA A;  4S2N C;  5CEB A;  1ALQ A;  5EVI C;  4WZ5 A;  1L2S A;  3P09 A;  3V3R A;  5EVL A;  2Y2J A;  5I94 A;  3UPO A;  2ZQ9 A;  5CTN A;  3PBQ A;  3CJM A;  4BL3 A;  3Q7Z A;  4OLD A;  4IED A;  2C5W B;  3PBR A;  3N4I A;  4EQI A;  5GHY A;  5KMW A;  5GLC A;  3CMZ A;  1PI5 A;  3I7J A;  3P98 A;  4E3K A;  1SDE A;  4FH2 A;  2WKI A;  2WGW B;  4OKP A;  1ZG6 A;  1DJA A;  2ZLY A;  4S2M A;  1ERQ A;  4OQI A;  3IQA A;  1JWP A;  3FYZ A;  4PM6 A;  1MKI A;  1IKI A;  1O7E A;  2ZC6 B;  4R4R A;  4UA9 A;  2H0T A;  1EI5 A;  4DRT A;  5FQQ A;  1ZG4 A;  2CC1 A;  2P9V A;  2HPB A;  3ZNT A;  3HRE A;  1L0F A;  3HLE A;  5FQI A;  4WMC D;  5M18 A;  1E4D A;  2Y59 A;  3BFF A;  2EFX A;  4QY6 A;  2Z2L B;  3VP4 A;  1HZO A;  2Y2P A;  1YMS A;  1CEF A;  4R0Q A;  4DE1 A;  3WWX A;  5CED A;  4Y0U A;  1L0G A;  2Z2M B;  2WZX A;  1ONG A;  2HP5 A;  2V1Z A;  2PU2 A;  4O7D A;  5E2H A;  3W4O A;  3ZVT A;  5A92 A;  3WS1 A;  4DXB A;  4ZJ2 A;  3EQV A;  3A3F A;  1XXM A;  3UO9 A;  2ZM0 A;  3IT9 A;  3IH8 A;  2E8I A;  3O86 A;  3IXH A;  3LO7 A;  5GLA A;  3ZGA B;  4DE3 A;  2V2F F;  1PZP A;  4FD8 A;  3VSL A;  1VQQ A;  1H8Z A;  5HAQ A;  4GB7 A;  4IBR A;  3IH9 A;  5FI7 A;  2JCH A;  3Q07 A;  1MWT A;  1RGY A;  4KG6 A;  3A3I A;  1GHM A;  4KZ9 A;  5G18 A;  3RXW A;  2XQZ A;  5FI2 A;  5HL1 A;  4N9K A;  3C7U A;  2DCF A;  5EOO A;  1G6A A;  2XLN A;  4OLG A;  4U0X A;  4KEN B;  1K6R A;  4M3K A;  2OV5 A;  4PM8 A;  4ZJ1 A;  1NZU A;  1TDG A;  1I5Q A;  1M6K A;  1NXY A;  4XUX A;  4OOL A;  4S2J A;  3GRJ A;  2XGN A;  4HBT A;  2X02 A;  4E3L A;  3QHY A;  1K57 A;  1J9M A;  2WAD A;  3BRM A;  3C5A A;  1NZO A;  3NIA A;  3OZH A;  3SS5 A;  1HVB A;  1WYC A;  5FQJ A;  2WGW A;  3IF6 C;  4OPQ A;  5DVA A;  3JYI A;  1K54 C;  1ES5 A;  4S2P A;  4X53 A;  1TEM A;  3E2L A;  3RXX A;  3SH9 A;  2WK0 A;  3C4O A;  3OPR A;  4ID4 A;  4KZ4 A;  5GL9 A;  5KZH A;  5FAT A;  2OLU A;  4S2I A;  1LL5 A;  4C75 A;  3N6I A;  4OPR A;  2VGJ A;  4EBN A;  3UN7 A;  1ES3 A;  1ES4 A;  1ES2 A;  3G2Y A;  2WZZ A;  3FWL A;  5FAP A;  5JYP A;  1IYO A;  1NJ4 A;  3MFD A;  3UNW A;  3FKV A;  3PBT A;  4C6Y A;  4EWF A;  4PPR A;  1BLH A;  5CHM A;  4KZ5 A;  1CI8 A;  3PBO A;  1YLZ A;  4HBU A;  1LL9 A;  5CHU A;  2JC7 A;  4L0L A;  4QJG A;  1U60 A;  4JLF A;  3Q7V B;  4KZA A;  2Y2G A;  3PAG A;  2QZ6 A;  4FCF A;  4UHU A;  5DF8 A;  2A49 A;  4WBG A;  4CJN A;  3SH7 A;  5CRF A;  3HLW A;  4R3J A;  3BEC A;  1QME A;  3IHA A;  4GOG A;  4LCL A;  4QY5 A;  4OH0 A;  4C3Q A;  3MZE A;  1YQS A;  3W8K A;  5HAP A;  1E3U D;  3UDI A;  2C6W B;  4X56 A;  1K56 A;  2G2U A;  4JBF A;  2ZC5 B;  4HES A;  1KGG A;  4BD0 A;  1YM1 A;  4MEZ A;  5GLB A;  4WMC A;  5FQK A;  2Y2M A;  4BEN A;  2WGI A;  2X01 A;  3HLG A;  2RL3 A;  1WYB A;  4KZ8 A;  1W5D A;  1SDN A;  4LEN A;  4N92 A;  4UA7 A;  5F1F A;  2XF3 A;  1RCJ A;  2ZD8 A;  3E2K A;  3Q81 A;  4OQ0 A;  4KQO A;  2Y2Q A;  3DWK A;  2IWB A;  3IF6 A;  4E3M A;  3O88 A;  4K0W A;  1JWZ A;  4R4S A;  4Y7P A;  3VP1 A;  1W79 A;  2OLV A;  4IBX A;  2Y2O A;  5EVI B;  5CGS A;  3DTM A;  3HLB A;  4LV3 A;  3ISG A;  1PW8 A;  3LY3 A;  5M19 A;  3S22 A;  3TOI A;  5J8X A;  3LCE A;  2R9X A;  3MZD A;  3UE3 A;  3BFC A;  3S1Y A;  3ZVW A;  2Y4A A;  1FCM A;  1SCW A;  3UPP A;  1RP5 A;  1S0W A;  5M1A A;  3N8R A;  4MNR A;  1Q2P A;  4OP5 A;  3GMW A;  4PM9 A;  2ZQC A;  3BFD A;  2Y2H A;  4OOM A;  4DE2 A;  3ITB A;  4KG5 A;  4E6X A;  4KZ6 A;  1BUE A;  4JXG A;  2BG1 A;  4ZBE A;  3ZG0 A;  4GDB A;  1G68 A;  3G31 A;  3IHB A;  1GCE A;  3IWQ A;  1CEG A;  4JPM A;  4PM7 A;  3HL9 A;  1IKG A;  2PU4 A;  1SKF A;  1O07 A;  3HBR A;  4H8R A;  5TR7 A;  3V3S A;  2UWX A;  1FSW A;  3GVB A;  3N7W A;  1H5X A;  5E2E A;  2ZC3 B;  4A5R A;  1FCN A;  1LLB A;  4RYE A;  1N9B A;  2HDR A;  2Y2K A;  2HDS A;  3G2Z A;  2XEP A;  3AGE A;  4HEF A;  1NY0 A;  4IVK A;  4KZB A;  4RA7 A;  4E3N A;  3UPN A;  3G30 A;  5FAO A;  1YT4 A;  2HP6 A;  3OCL A;  4P85 A;  3WRT A;  3C7V A;  4N9L A;  3WRZ A;  3WS2 A;  4Z9Q A;  1M40 A;  3Q1F A;  4ZAM A;  1XGI A;  5JYO A;  1W8Y A;  2I72 A;  2EFU A;  3TSG A;  3VFH A;  5L2F A;  1BZA A;  3G4P A;  3V5M A;  1NRF A;  2XDM A;  1BSG A;  4JXS A;  4KZ7 A;  4X69 A;  3M2J A;  1RGZ A;  4EV4 A;  3SS3 A;  2V20 A;  5A90 A;  4JF6 A;  1BUL A;  5FQM A;  2Y2L A;  2Y2N A;  3CZD A;  1KGF A;  1YLP A;  1HTZ A;  5AQ7 A;  3Q7V A;  5IHV A;  4BQM A;  5KSH A;  2WAE A;  4JXW A;  4F94 A;  2Q9N A;  3BFE A;  4OPY A;  4NK3 A;  2DNS A;  1HD8 A;  1YLT A;  3MZF A;  1FCO A;  4OQH A;  4S2O A;  5CGX A;  5EPH A;  2WAF A;  3WS0 A;  4B88 A;  4LV2 A;  3Q82 A;  3ZCZ A;  1K55 C;  3N8S A;  5HAI A;  1BLP A;  2H0Y A;  3NC8 A;  4MBH A;  4N1X A;  5HFO A;  1TVF A;  1JTD A;  1CK3 A;  4QU3 A;  4BL2 A;  4DXC A;  1KVM A;  2G2W A;  3A3E A;  3UDX A;  1TDL A;  3W4P A;  3V50 A;  3UDF A;  1SHV A;  1IEM A;  3WS5 A;  3BLM A;  1ERO A;  3AGD A;  3G32 A;  1KDW A;  5DF9 A;  4X68 A;  4OQG A;  3VP2 A;  1GHI A;  1OME A;  2EX9 A;  4OVD A;  2WGV A;  4OON A;  5FAQ A;  3UE1 A;  4JF4 A;  3PBS A;  5KSC A;  2EX2 A;  4JXV A;  3BFG A;  3GQZ A;  4FH4 A;  3VP3 A;  1XGJ A;  3HUO A;  4MLL A;  4WEK A;  3IF5 A;  2ZQA A;  1IYS A;  4P87 A;  1KVL A;  3NCK A;  4U0T A;  2H5S A;  5F1G A;  1Y54 A;  2H10 A;  1W7F A;  4XUZ A;  3NDG A;  1C3B A;  4PM5 A;  3UE0 A;  1AXB A;  1KGE A;  3HUM A;  5EUA A;  3IXB A;  5HAR A;  2XH9 A;  1MWS A;  3TG9 A;  5BOH A;  5TGF A;  5F82 A;  4BLM A;  3PAE A;  3IXG A;  2DRW A;  1NYY A;  2XFT A;  5EVI D;  1W8Q A;  1K55 A;  2HDU A;  1ZKJ A;  2IWC A;  3DWZ A;  4DE0 A;  4K91 A;  1I2S A;  3O87 A;  4LCM A;  3NBL A;  5CHJ A;  1PYY A;  1KE0 A;  3BYD A;  5TFQ A;  3ZG9 B;  1BTL A;  4GNU A;  1YLJ A;  2XFS A;  3GSG A;  3LY4 A;  1ESU A;  3BEB A;  2B5R A;  4EUZ A;  5CGW A;  1CI9 A;  3S4X A;  4RVA A;  4B4Z A;  4E3O A;  4Y0O A;  4WEJ A;  3M2K A;  1IYQ A;  3AGF A;  1WE4 A;  2XD1 A;  2J9P A;  1FOF A;  3V39 A;  4S2N A;  1ZC2 A;  1XKZ A;  3W4Q A;  1JVJ A;  3ZHH A;  5DTK A;  1LHY A;  1MBL A;  3OC2 A;  3A3J A;  5DF7 A;  1PWC A;  2A3U A;  3MXR A;  2QPN A;  1XA1 A;  4MBF A;  3FKW A;  4GKU A;  5FQ9 A;  4UAA A;  1GA0 A;  2EXA A;  2X71 A;  1YMX A;  3HVF A;  4KZ3 A;  4Y0T A;  3IWI A;  3ZG5 A;  2EX6 A;  3ZG7 B;  2J8Y A;  2ZM8 A;  4DF6 A;  4WZ5 C;  1MWR A;  2P9V B;  1XX2 A;  4WZ4 A;  3UY6 A;  1IYP A;  1L0D A;  3SS4 A;  2OSU A;  4OP8 A;  1S6R A;  4ZDX A;  3MKF A;  3QNB A;  5DTS A;  5A93 A;  1K57 C;  3MBZ A;  4KQQ A;  1KDS A;  2JE5 A;  5AQB A;  3GV9 A;  3VFF A;  1H8Y A;  1PWD A;  4E6W A;  5U47 A;  1MWU A;  1YLY A;  1MXO A;  3C4P A;  1FQG A;  3N8L A;  2FFF B;  4GZB A;  4RX3 A;  4YFM A;  2JBF A;  5E43 A;  5AQA A;  5FSR A;  5CER A;  1K54 A;  4WM9 A;  5HX9 A;  4DDY A;  5EE8 A;  3VMA A;  2ZJ9 A;  5FDH A;  1FR6 A;  1K4F A;  3GR2 A;  3GTC A;  3IF6 B;  5F83 A;  3ZFZ A;  2RCX A;  2ZC4 B;  2WUQ A;  1LI9 A;  3B3X A;  1K4E A;  3EQU A;  5E2F A;  3RJU A;  3VOZ A;  3VSK A;  4CPK A;  2HDQ A;  3HUN A;  3BLS A;  1GHP A;  5FA7 A;  1BLC A;  2J9O A;  5AQ9 A;  3WS4 A;  4EBL A;  1IEL A;  5EOE A;  1E3U A;  2XK1 A;  1BT5 A;  1N4O A;  2ZC7 A;  4ZJ3 A;  4GN2 A;  4R1G A;  1DJC A;  4LV0 A;  2ZMA A;  2Q9M A;  1PI4 A;  2ZQ7 A;  2WYX A;  4RX2 A;  3QNC A;  4YIN A;  2Y91 A;  1XP4 A;  1PWG A;  4UA6 A;  1PZO A;  4P0M A;  5HW3 A;  3ZDJ A;  4JKT A;  2PBY A;  4D2O A;  4QD4 A;  1FR1 A;  3HLF A;  3MXS A;  3OPL A;  3OPP A;  4QHC A;  5A91 A;  1ONH A;  4KG2 A;  2J7V A;  1ERM A;  4NET A;  4QB8 A;  2ZQD A;  5DTT A;  4S2K A;  2WKH A;  4JF5 A;  4ZTK A;  1DJB A;  1LI0 A;  3M6B A;  4R23 A;  5EEC A;  5GHZ A;  2IWD A;  1JTG A;  4EBP A;  3SOI A;  1VM1 A;  3MKE A;  4LV1 A;  3HLD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...