1HTZA

Crystal structure of tem52 beta-lactamase
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
263
structure length
263
Chain Sequence
b'HPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVKYSPVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRWEPELNEAIPNDERDTTTPAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGASERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA-LACTAMASE MUTANT TEM52
publication title Predicting the emergence of antibiotic resistance by directed evolution and structural analysis.
pubmed doi rcsb
source organism Klebsiella pneumoniae
molecule tags Hydrolase
total genus 91
structure length 263
sequence length 263
chains with identical sequence B, C, D, E, F
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2001-01-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 1htzA00
3VFFA 3WS4A 1ZKJA 4FSFA 2E8IA 2WGVA 3N8SA 4WZ5A 1LI0A 3I7JA 1NY0A 4RX3A 4ZTKA 3UO9A 3VOZA 1FCOA 5CERA 4GDBA 3SOIA 1K54C 2QPNA 4B4ZA 2WKHA 2EX8A 3N8LA 4N1XA 4CPKA 3VP0A 4E3NA 4BENA 5DF9A 3V3SA 5GHXA 2OSUA 3UPNA 3ZG8B 1ES5A 1EROA 3SH9A 1E4DA 3FKVA 3IF6C 1BSGA 2EX2A 2XLNA 4MEZA 4DXCA 1Q2PA 1PYYA 1W8YA 1Z6FA 2HDRA 5BOHA 1HTZA 2Y2OA 3VP1A 3BFEA 4R4SA 3DWZA 2EXBA 3SH8A 5CTMA 1K57A 3BYDA 4KENB 4GD8A 4JBFA 3UN7A 4WZ4A 1QMFA 3G35A 4Z9QA 4GB7A 3C4OA 5DTSA 4B88A 2GDNA 5F83A 1MWTA 1XXMA 1FR1A 2V1ZA 5TFQA 5F82A 4PPRA 4K91A 2HDUA 1XX2A 4MNRA 4DE1A 3BRMA 4X53A 4JF5A 1YM1A 1YLWA 5A90A 2XDMA 1NJ4A 1MXOA 1ONHA 2H5SA 4N1HA 4NK3A 4JXSA 3ZG7B 5HW3A 2Z2MB 1IELA 4KG2A 1ERMA 2G2UA 4DRTA 4BD1A 3Q81A 4RVAA 3FWLA 3RXWA 2HDSA 4DE0A 5HARA 4YINA 1YLYA 1BUEA 2Y2GA 4UA6A 3BLMA 3IHBA 1N4OA 4F94A 2C5WB 4S2KA 5GLCA 3VOYA 5EOEA 1M40A 3CMZA 4OOYA 2WZXA 1TDLA 3ISGA 3LY3A 1DJCA 3WRTA 3C7VA 2Q9NA 5FQKA 4C3QA 3RJUA 2QZ6A 5HAPA 5A93A 5EOOA 2ZC7A 1HZOA 3MFDA 4S2LA 3G4PA 1MKIA 4S2IA 1XA1A 1XPBA 2ZC6B 2V20A 2Y2QA 3IXDA 3M2JA 1NXYA 2ZQDA 5GLAA 1PWGA 1SCWA 3GSGA 3S4XA 5M18A 5E2GA 5CTNA 1BZAA 2WAFA 3Q7ZA 4BD0A 3M2KA 5CGSA 3IF6B 1ES2A 1DY6A 2A3UA 2Y2KA 3C4PA 4ZBEA 2BG1A 1LL9A 3B3XA 3QHYA 4LV1A 3HREA 4OOMA 4OPYA 4R0QA 5CECA 2XR0A 5HAQA 3HLFA 2V2FF 5CEBA 1LLBA 4P6BA 2IWCA 2DCFA 4E6WA 3W8KA 1QMEA 5CHMA 5FA7A 1XP4A 1ALQA 3OC2A 4U3TA 5L2FA 3QNCA 3LEZA 5CHJA 3E2KA 2ZQ8A 5FQQA 4JLFA 3TSGA 1FR6A 1K56A 1BULA 5FQJA 3DTMA 2HPBA 5FQMA 2Y2PA 2Y59A 4OLDA 5E2FA 1XKZA 2PU4A 3NIAA 3HLEA 2ZD8A 3GVBA 3UDFA 4IEDA 3BFCA 3Q7VA 1K6SA 4FCFA 5FATA 1XGIA 4E3IA 3N6IA 4LV2A 5FI2A 4DE3A 5I94A 4L0LA 5DVAA 5GL9A 2IWBA 4OPZA 1JTGA 3M6HA 4PM6A 1PZPA 5GLBA 1U60A 3SS4A 4OONA 3UE1A 1L0DA 4BL2A 1SHVA 1E25A 1JWZA 2UWXA 3D4FA 2XK1A 3FYZA 1K6RA 4M3KA 1KVMA 4GD6A 5GHZA 3IT9A 3MXRA 2HP5A 3C5AA 3ZDJA 1YLJA 1W79A 1LI9A 1G6AA 4CJNA 3OCLA 1JWVA 4X6TA 3FV7A 5M1AA 3IWQA 1K38A 5EVLA 1HVBA 3JYIA 1Q2QA 5CHUA 4E6XA 4E3LA 3UE3A 5EVIC 1MWUA 3BFDA 4GOGA 1M6KA 4OOLA 2ZQCA 2WGWB 3G31A 4H8RA 5A91A 1OMEA 2PBYA 2Y2LA 3CZDA 3EQUA 2Y91A 2I72A 4IVIA 4K0WA 3ZG5A 4DDSA 3VSKA 3Q1FA 4WMCD 3FZCA 1NRFA 5E2HA 3N7WA 1FSWA 1DJBA 1BLHA 4HEFA 4ID4A 4JF6A 1IYOA 4KQRA 4XUXA 3ZVWA 1KGGA 1JVJA 1LL5A 1YMXA 4Y0TA 4BQMA 3VP4A 5KMWA 3GMWA 3GTCA 3ZG0A 3IF5A 3OPHA 4JPMA 3O88A 4OQIA 5FASA 3WS0A 2WGWA 2WK0A 3UDIA 3NI9A 5CEDA 2VGKA 1VQQA 1S0WA 1KDWA 1BLCA 2XD5A 3RXXA 1DJAA 3N8RA 2RCXA 1GHMA 2WUQA 2FFFB 5FI6A 5HAIA 4R23A 4WYYA 4S2NC 2HDQA 4C6YA 4UAAA 3MZFA 2J9PA 1IKIA 2ZQ9A 5JYPA 1YLPA 4KQOA 2C6WB 4HBUA 3NDGA 5FI7A 3IXBA 1PIOA 2WAEA 4P85A 1O07A 4WELA 2OV5A 4OP8A 1RCJA 2JE5A 2Y55A 3GRJA 5DTKA 1IKGA 1TEMA 5FSRA 4PM7A 3NC8A 4WZ5C 1FCNA 3GR2A 4U0XA 4S2JA 4E3OA 3G2ZA 4LCMA 1G68A 2QMIA 4OP5A 4UA9A 4X69A 3PTEA 3UY6A 5GLDA 3P98A 4IBXA 4OQGA 5EVIB 5IHVA 4GNUA 3PBRA 2JBFA 1KDSA 2XEPA 1EI5A 3WWXA 5KSHA 3N4IA 5EVID 2ZLYA 1K55A 3NBLA 4Y0OA 1MY8A 4HESA 3HLDA 2JC7A 4MLLA 5AQBA 4XUZA 4KQQA 2Y2JA 3BECA 4LV3A 4GDNA 3MZDA 2X02A 4EUZA 4A5RA 4R1GA 1K57C 1FQGA 1RGYA 3VMAA 2Y2MA 4JKTA 4WM9A 4JXGA 3G30A 5EE8A 4EQIA 1L2SA 5HX9A 2ZQ7A 1BLPA 5A92A 2ZM8A 3HLGA 5F1FA 1K54A 1CEGA 2P74A 1PI5A 1AXBA 3ITBA 2JCHA 2EXAA 2WYXA 5FAOA 4GZBA 3O86A 3PBOA 4FH4A 3BEBA 1K56D 4KZ9A 4OH0A 4R4RA 3AGDA 1CI8A 4S2PA 3G34A 3NCKA 3IF6A 3W4OA 4Y0UA 3OPLA 4EBLA 1H8YA 1JTDA 3C7UA 1CEFA 2H0TA 3BLSA 4KZ4A 1PW1A 2DNSA 2Y2NA 3CG5A 3IXGA 1BT5A 1I2WA 3MXSA 4OVDA 1RP5A 4KZ7A 4LCLA 4P87A 3TOIA 3PBQA 3HBRA 3MBZA 5CXWA 1IYSA 3BFGA 4O7DA 3O87A 2Y2IA 1H5XA 5E43A 4JXVA 1PI4A 1E3UD 4BLMA 1L0EA 5CGXA 1KGEA 5KZHA 4BL3A 3V50A 1ESUA 3FKWA 4Q8IA 3IWOA 2J7VA 3HUNA 3VP2A 4DKIA 1YMSA 3GV9A 3IH9A 5TGFA 3ZVTA 1KGFA 2ZC5B 3HVFA 4XXRA 4OPQA 2G2WA 1MWRA 1I2SA 5E2EA 4S2OA 3S1YA 1YLTA 3TG9A 4EWFA 2XQZA 2B5RA 4MBHA 1KE4A 2X71A 1XGJA 4IBRA 1H8ZA 4IVKA 1S6RA 2WZZA 5AQ9A 4OKPA 3MZEA 4X56A 3IXHA 1YT4A 1FSYA 2H0YA 1ZG6A 4DXBA 1CK3A 3CJMA 4UHUA 2ZC3B 3HLCA 3A3JA 3SS3A 3AGFA 2Y2HA 4FD8A 4BJPA 4X55A 3HUMA 4N9LA 3IH8A 4C75A 3E2LA 1SKFA 3W4PA 4S2MA 3IQAA 3IHAA 4QHCA 3LO7A 5JYOA 3AGEA 2X01A 5G18A 4PM5A 2XF3A 1EWZA 1L0FA 3ZCZA 3DW0A 4ZJ1A 3ZG9B 2P9VB 4X68A 4KZ6A 5AQAA 4KZBA 2XH9A 2HP6A 4PMAA 4WMCA 5TR7A 4R3BA 1SDEA 4RYEA 5HL1A 3G32A 2XFSA 1FOFA 2OLVA 4D2OA 3OPRA 3OZHA 3PBNA 4WBGA 2XD1A 1VM1A 4OPRA 2ZQAA 4LENA 1WE4A 3A3FA 3NDEA 1HD8A 1TVFA 5FAQA 4E3MA 4KZ5A 4JF4A 1L0GA 3A3EA 5D3OA 1GHPA 1ERQA 3O3VA 3OCNA 4GKUA 3PAGA 2PU2A 3HL9A 3UPOA 2P9VA 1ZG4A 4B4XA 4EV4A 2H10A 1BTLA 2J8YA 4PM8A 4ZAMA 1MWSA 3UPPA 3ZHHA 3G2YA 4QU3A 4U0TA 1YQSA 1J9MA 1W5DA 1PZOA 3A3DA 3LY4A 5FQIA 4LV0A 3ITAA 1JWPA 1MBLA 3HLWA 4KZAA 4WEKA 5AQ7A 2RL3A 4YFMA 2OLUA 5EPHA 4DF6A 1ES3A 2Z2LB 1KE0A 1KE3A 2WADA 3M6BA 4WEJA 3VP3A 2VGJA 2DRWA 1GHIA 1WYCA 5EUAA 5FQ9A 1MPLA 2XFTA 3LCEA 4N9KA 5GHYA 1IEMA 4HBTA 3ZNYA 5HFOA 1ZC2A 4MBFA 5DF8A 4KZ3A 3WS5A 3HUOA 4E3KA 4FH2A 1K4FA 3MKEA 2R9XA 3UNWA 5DTTA 3P09A 4DDYA 4QD4A 1XA7A 1K25A 4EBPA 4RX2A 2EX9A 3PBTA 1CI9A 1PWDA 1KVLA 3Q82A 4OQ0A 5EVIA 4KG5A 4R3JA 3ZFZA 2A49A 2Q9MA 5FDHA 1O7EA 1WYBA 4GN2A 4P0MA 4OLGA 3A3IA 3OPPA 4N92A 3IWIA 3VSLA 5J8XA 3Q7VB 3Q07A 2R9WA 2ZJ9A 2ZM0A 3WS1A 2EX6A 3ZNTA 2WGIA 3W4QA 3S22A 2ZC4B 2CC1A 1NYYA 3WS2A 3V5MA 5M19A 1N9BA 1NZOA 4OQHA 1GA0A 3BFFA 4ZDXA 4QY5A 3UDXA 3MKFA 1K4EA 4NETA 4K0XA 1RGZA 4DE2A 1ES4A 2XGNA 3QNBA 5DF7A 5U47A 5EECA 1FCMA 4E3JA 3ZGAB 4ZJ2A 4QY6A 1TDGA 2WKEA 4MBKA 4PM9A 1I5QA 5CGWA 4QJGA 1IYQA 1ONGA 2HP9A 1Y54A 3V3RA 1NZUA 1ESIA 1SDNA 2BLSA 2Y4AA 4ZJ3A 2EFUA 4KZ8A 5CRFA 4QB8A 1C3BA 5FAPA 3PBSA 4KG6A 1W8QA 2ZMAA 3HLBA 4EBNA 1GA9A 1K55C 1PW8A 4S2NA 2IWDA 1IYPA 1LHYA 2EFXA 3SS5A 3UE0A 3GQZA 3BM6A 3NY4A 2J9OA 1E3UA 1PWCA 4UA7A 4Y7PA 1W7FA 4JXWA 5KSCA 3PAEA 2WKIA 3SH7A 1NYMA 3EQVA 5F1GA 3VFHA 3V39A 2FFYA 3DWKA 1YLZA 4RA7A 1GCEA 3WRZA 2ZM2A 1BLSA
chains in the Genus database with same CATH superfamily
3VFFA 3WS4A 2WGVA 3N8SA 3F1PA 4WZ5A 3VOZA 3I7JA 4GDBA 4HQAA 1UWNX 3VP0A 1T19A 3V3SA 3PXPA 3UPNA 4HI4A 1EROA 3FKVA 2A2LA 4MCWA 5J3WA 4MEZA 4DXCA 4P6ZM 1Z6FA 4R4SA 1OTIA 3SH8A 3LICA 4KENB 4EESA 3UN7A 1H8MA 4WZ4A 5L8MA 4Z9QA 2AVXA 3GECA 1XXMA 2VJWA 2ZL1B 4EQ1A 3BRMA 4JF5A 3BY8A 2XDMA 2H28A 4Y5FA 3ZG7B 4JXSA 1IELA 4KG2A 4DRTA 4LPZA 4RVAA 3FWLA 3PHYA 2HDSA 5HARA 1YLYA 2QJ7A 3IHBA 1N4OA 4F94A 1TF1A 5GLCA 3VOYA 4OOYA 3ISGA 3WRTA 1DJCA 2Q9NA 5FQKA 2QZ6A 5A93A 1N9LA 1XA1A 2XA7S 2J3WA 3EGDC 5L10A 2ZQDA 5GLAA 3GSGA 2JKRI 3IF6B 1ES2A 1T1BA 4PHTA 3C4PA 1LL9A 4OPYA 2Q0OA 2XR0A 5HAQA 3LR5A 2IWCA 4ME4A 5CHMA 2A24B 1ALQA 4U3TA 5L2FA 3QNCA 5CHJA 4MN6A 4JLFA 3TSGA 1BULA 4JGQA 2Y2PA 1AWIA 2Y59A 5E2FA 3NIAA 3HLEA 2ZD8A 3GVBA 3UDFA 3Q7VA 1ZHHB 4LV2A 5DVAA 4I3AA 3E0YA 1L0DA 3KO6A 3S7PA 3T4TA 1KVMA 2W1TB 1XFQA 3MXRA 2PR5A 1YLJA 4X6TA 2JKFA 3IWQA 1K38A 3JYIA 4E3LA 1MWUA 2WGWB 4H8RA 5A91A 1FIKA 2PBYA 4JGPA 3L7HA 3FZCA 2HV1A 4JF6A 4CQHA 4DJ2A 5AVFA 1TS6A 3IF5A 2QJ5A 3O88A 4OQIA 3E4OA 3UDIA 2VKSA 3NI9A 3C2WA 3CITA 4GCZA 1GHMA 2WUQA 5HDDA 4C6YA 3OLOA 3T12B 3MQQA 4F3LA 4I38A 4WELA 1RCJA 2GZAA 3C8CA 5HWTA 1WA9A 2QKPA 3G2ZA 1LSWA 1G68A 4HP4A 3UY6A 3P98A 4IBXA 4OQGA 1SKOB 5HWWA 1KDSA 2XEPA 1EI5A 3WWXA 3IX8A 2ZLYA 1OT9A 1MY8A 2P7JA 4MLLA 5AQBA 4EUZA 4A5RA 1H3QA 2V0WA 1RGYA 1LSVA 4JKTA 4Y3IA 3G30A 5F1FA 3KSGA 2JCHA 2WYXA 4XT2B 4GZBA 3F1OB 4FH4A 5F5YA 4S2PA 3NCKA 3E4QA 4EBLA 3OPLA 4FTXA 1JTDA 3BLSA 1PW1A 3MXSA 3CG5A 4P87A 1IYSA 2PAVP 1PI4A 1L0EA 1KGEA 2KLIA 4GS9B 4BL3A 4Z1WA 3CLOA 3IWOA 3HUNA 3FPWA 3LR3A 3IH9A 4Q0HA 3ZVTA 4EERA 1G28A 3S1YA 1MWRA 4S2OA 4EWFA 3D3OA 2WZZA 5AQ9A 3MZEA 3IXHA 3MF0A 2GX5A 1ZG6A 3CJMA 4UHUA 3A3JA 2Y2HA 3P7NA 4BJPA 3C30A 3HUMA 2Y79A 5JYOA 3MQOA 5G18A 2XF3A 1L0FA 4ZJ1A 3ZG9B 4EETB 2HP6A 5TR7A 4WMCA 5HL1A 1SDEA 3G32A 3OZHA 3PBNA 3NDEA 3UE6A 5FAQA 1TVFA 4KZ5A 4JF4A 1GHPA 1ERQA 3CAXA 4NEED 4WL9A 3O3VA 3HL9A 3UPOA 3EWKA 3G6OA 4MN5A 2J8YA 4PM8A 3UPPA 3ZHHA 3G2YA 1PZOA 5FQIA 4KZAA 4WEKA 4PKYA 5AQ7A 4DF6A 3M6BA 4WEJA 5K5BA 2VGJA 4IUKA 2NUTC 5CX7A 4NXFA 5HPIA 5DTTA 4DDYA 2BTFP 4EBPA 1Y28A 1CI9A 1KVLA 4NXGA 4EUVA 4R70A 3A3IA 5LBRA 3VSLA 3IWIA 2ZM0A 3ZNTA 4HJ3A 3UMEA 1N9BA 4OQHA 1MKMA 3DAVA 4LGWA 1SZVA 2XROA 4K0XA 4CLCC 4KUOA 2XGNA 5DF7A 2WKQA 4E3JA 2L4RA 4ZJ2A 1GSWA 5CGWA 1TDGA 3CHWP 4HHDA 3QP8A 4Q0IA 1SDNA 2V0UA 1K55C 2PD7A 1LHYA 3BM6A 3R4KA 1E3UA 4Y7PA 1N9OA 3PAEA 3SH7A 2FFYA 3DWKA 4E3NA 4FSFA 2E8IA 1LI0A 1NY0A 3UO9A 1Y4OA 1S1ZA 2M1CA 2EA9A 2WKHA 3N8LA 3PYPA 3UB7A 4BENA 3ULFA 4HIAA 4LLOB 2ZBBA 3SH9A 1E4DA 2XLNA 2UV0E 1Q2PA 1PYYA 5BOHA 2Y2OA 3BFEA 4IUHA 4L9FA 2OAQ1 2OWHA 1QMFA 4GB7A 5DTSA 4EEUA 5A8BA 5EFWA 2GDNA 2E8JA 2XSSA 2V1ZA 5TFQA 4X1MA 4PPRA 4K91A 4MNRA 1F2KA 1YLWA 5A90A 3K3CA 1MXOA 1ONHA 1YAXA 2H5SA 4NK3A 3U2AA 4WN5A 4I3JA 3Q81A 3R7WB 4P6ZS 4WF0A 4YINA 4UA6A 1BUEA 4JGOA 2C5WB 5EOEA 3D9YA 1ACFA 2PT7A 2VX8A 2ZL1A 4C3QA 5IS1A 3RJUA 1DP8A 5IU1A 5FEFA 5HAPA 2INWA 4S2LA 5HL6A 1W63M 1H0MA 4M4XA 3LFVA 3IXDA 3M2JA 1NXYA 2JHEA 5CTNA 2PRFA 4RQ9A 4BWIA 3HLFA 4NXEA 5HDCA 3DTKA 1NWZA 3LEZA 3E2KA 5FQQA 1YKDA 2PU4A 2VK3A 3BFCA 5FATA 5I94A 1XGIA 3N6IA 5FI2A 3MS6A 3ZQ5A 4OPZA 1JTGA 3M6HA 5GLBA 1PZPA 3QP2A 4GHIB 3SS4A 3UE1A 3D4FA 1E25A 1JWZA 2UWXA 4M3KA 4GD6A 4Y13A 3RFBA 5IT5A 3JVVA 4CJNA 2DMWA 3FV7A 3RH8B 5TBMA 4G3WA 3H7WB 5CHUA 5EVIC 1V9YA 1M6KA 4OOLA 2ZQCA 3U4LP 2Y2LA 5DKLA 3PR6A 1FSWA 1DJBA 5KIZA 1BLHA 4ID4A 5HSQA 3ZVWA 1KGGA 1JVJA 4BQMA 2BASA 1VHMA 2ZMVA 4DJ3A 3S7QA 5FASA 3WS0A 2WGWA 3DTEA 5CEDA 5FI6A 4Y2FA 4WYYA 4WLAA 3CI6A 4UAAA 2ZQ9A 2Y8HA 1YLPA 2V8CA 5JYPA 3NDGA 5FI7A 1PIOA 2WAEA 4P85A 2J3TC 4OP8A 3S7NA 1MC0A 4ETZA 4CLCA 4E04A 2P04A 4E3OA 4OP5A 4UA9A 3PTEA 5GLDA 4GNUA 2JBFA 3N4IA 1K55A 2VGLM 4ARZB 2JC7A 4FOFA 4K08A 3BECA 2M7VA 2X02A 5I5LA 3HCYA 1K57C 3VMAA 2HJEA 3IS2A 1BLPA 1ODVA 3NOPC 3HLGA 3EGXC 4EXOA 1CEGA 2P74A 1AXBA 2VEAA 3TJZC 2EXAA 2O0YA 4YNRA 4OH0A 3AGDA 3NOUC 1GSXA 2VLGA 3G34A 3W4OA 3UB8A 2DNSA 2Y2NA 1BT5A 4KZ7A 2WKPA 3E98A 3HBRA 3MBZA 3T1SA 4O7DA 3O87A 2V9AA 3FC7A 5E43A 4JXVA 3QP1A 4II7A 4BLMA 5G4YA 2V1AA 3T4LA 5KZHA 3FKWA 1IOUA 4DKIA 2JN7A 4XT2A 3F1OA 5TGFA 3VOLA 2XRNA 4R3AA 3L9KA 5E2EA 3TG9A 3VE4A 2B5RA 1KE4A 2X71A 1XGJA 4IBRA 1P97A 1S6RA 2K7SA 4H6JB 4X56A 2K31A 1NLZA 4DXBA 4R6LA 2ZC3B 4GS9A 1T1AA 3W4PA 3IHAA 3LO7A 5F6AA 4PM5A 1EWZA 1GSVA 5AJGA 4KZ6A 5DFXA 5AQAA 1PRQA 4PMAA 4B9OA 5FEGA 2XFSA 4WBGA 4OPRA 1OJGA 2ZQAA 4G3KA 3A3EA 5D3OA 3OCNA 3KYQA 3EEHA 3PAGA 1ZG4A 4EV4A 2B95A 2R78A 3LI8A 1MWSA 5EM1A 4HJ4A 2K2NA 1YQSA 1LT0A 3LY4A 4LV0A 4YFMA 2OLUA 1ES3A 2Z2LB 1KE0A 3VP3A 2L0WA 1GHIA 1WYCA 4IHQA 2XFTA 1T1CA 4N9KA 5GHYA 1IEMA 3ZNYA 5HFOA 1ZC2A 3KSHA 5DF8A 3V67A 1K4FA 1XFNA 5EVIA 4OQ0A 4R3JA 5FDHA 4P0MA 4N92A 3Q7VB 3WS1A 2EWWA 3W4QA 1NYYA 3MJQA 3V5MA 3BFFA 3UDXA 3MKFA 1K4EA 4DE2A 1ES4A 5EECA 3ZGAB 4PM9A 1I5QA 1IYQA 1ONGA 2HP9A 2GJ3A 3V3RA 5EV0A 1F5MA 2BLSA 4CLCE 4KZ8A 4QB8A 2ZMAA 1IYPA 3UE0A 3GQZA 4UA7A 4JXWA 2WKIA 1CF0A 3LR0A 3VFHA 4EU0A 2ZOIA 3VE3A 3ZDJA 3RTYA 4ZTKA 3QP5A 2QPNA 2OAP1 3OBFA 4CPKA 2OSUA 3ZG8B 3IF6C 2EX2A 3KSFA 1G5UA 1YPRA 1W8YA 4QPRA 3CPTA 5MC7A 2EXBA 1K57A 3BYDA 4GD8A 4B88A 2B18A 1S67L 5F83A 1MWTA 1FR1A 2HJ9C 5FDSA 3LIFA 1D7EA 5F82A 2HDUA 1XX2A 1P9RA 1OTAA 5HDSA 1YM1A 4I5SA 5HW3A 2Z2MB 1ERMA 2KDKA 3RXWA 2J80A 4DE0A 5J7EA 2YKFA 2Y2GA 3BLMA 2V1BA 4S2KA 1M40A 3CMZA 2WZXA 1TDLA 2QYBA 3C7VA 2ZC7A 3G4PA 4GJ4A 1MKIA 2WKRA 4S2IA 4I39A 2ZC6B 2V20A 2Y2QA 1VETB 1PWGA 1SCWA 5M18A 5E2GA 1BZAA 3A0VA 4BD0A 3R7WA 5F69A 1DY6A 2A3UA 2BG1A 3QHYA 4LV1A 4R0QA 1V9ZA 1S4SA 4HP9A 1LLBA 4P6BA 2DCFA 3W8KA 1QMEA 5FA7A 4HOIA 3GDIA 3TW8A 4MDZA 3MSHA 1FR6A 2HPBA 5FQMA 4OLDA 1D06A 1PNEA 3FG8A 2W3FA 4IEDA 4E3IA 4FCFA 4X25A 4DE3A 2O9AA 2IWBA 1U60A 3FYZA 5C5KA 5GHZA 3LEQA 2HP5A 3C5AA 4R38A 1W79A 1G6AA 3OCLA 1JWVA 4ZRRA 1P9WA 2VZWA 1W63Q 1VEUB 4G3VA 4GOGA 1BYWA 3EQUA 3CZDA 4IVIA 2Y91A 2I72A 4K0WA 4B93A 5AVEA 3Q1FA 4WMCD 1NRFA 1G6OA 2V8FA 5HPFA 4HEFA 3KX0X 4KQRA 4XUXA 1LL5A 4Y0TA 3ICYA 2W27A 2W3DA 3GTCA 3ZG0A 3QP4A 5FL3A 4JPMA 4X1LA 4ETXA 3ZYTA 1S0WA 1BLCA 2W3EA 2XD5A 1DJAA 2RCXA 5G4ZA 2GNXA 5HAIA 4R23A 3BQ8A 4S2NC 2HDQA 2PD8A 3MZFA 4MMNA 4EW7A 3IXBA 3MXQA 1DP9A 2JE5A 3GRJA 3NULA 5DTKA 4IJGA 1TEMA 1YSQA 1K0KA 3NC8A 1FCNA 2PR6A 4U0XA 4S2JA 4LCMA 2QMIA 3CWFA 2LB5A 1OJ5A 3LIAA 1OTEA 4Y0OA 3HLDA 4XUZA 2Y2JA 4GDNA 2O99A 3OOVA 2VV8A 4BBTA 1TS0A 2JKTM 4EQIA 1L2SA 4NXBA 2ZM8A 1PI5A 2VV6A 1TS8A 1DRMA 3PBOA 3BEBA 4R4RA 1CI8A 4ARZA 3IF6A 2O9CA 3CUEC 4Y0UA 3H82B 2H0TA 2VGLS 3BWLA 4KZ4A 4OVDA 1LL8A 1I2WA 3LYXA 3TOIA 1RP5A 1N9NA 5CXWA 3BFGA 2Y2IA 1H5XA 2VV7A 1E3UD 3BW6A 2A24A 3T4SA 3V50A 3VP2A 2J7VA 2ZOHA 1YMSA 3GV9A 4L9EA 3B42A 1KGFA 3HVFA 4XXRA 4OPQA 1MZUA 1Z09A 2HZ5A 2XQZA 1H8ZA 4IVKA 5TJJA 1YT4A 1FSYA 1CK3A 4GW9A 3HLCA 2W3HA 2W1TA 4N9LA 2D01A 3E2LA 1SKFA 4S2MA 4QHCA 1NRJA 3AGEA 3LIDA 3ZCZA 3UB9A 2P9VB 4X68A 4KZBA 5F68A 4H6JA 2XH9A 4R3BA 1FOFA 2OLVA 4KUKA 2D02A 3OPRA 4D2OA 4Q0JA 1NLYA 4LENA 1WE4A 3C38A 4HNBA 1A0KA 1OTDA 1DP6A 1BTLA 4ZAMA 1D1JA 3SZTA 1LSXA 1W5DA 4LRYC 3ITAA 1MBLA 3UB5P 2WADA 2DRWA 1S1YA 3P01A 4O8GA 5EUAA 1MPLA 4AFIA 3DBAA 4KZ3A 4UEYA 4E3KA 4FH2A 3LI9A 5HD3A 5HD5A 3A0SA 4QD4A 1XA7A 1K25A 3F1NB 2HF6A 1PWDA 1SKOA 2A49A 2Q9MA 1WYBA 4GN2A 2EWVA 3OPPA 2VA0A 3Q07A 2R9WA 2ZJ9A 2EX6A 3T4JA 2ZC4B 2CC1A 3WS2A 4ESPA 3EOIA 1NZOA 1GA0A 4ZDXA 3QNBA 5U47A 3B33A 3TE8A 1FCMA 2WKEA 3F1PB 3FPVA 5TBMB 3LGOA 1NZUA 1ESIA 4ZJ3A 2EFUA 5CRFA 5FAPA 2JKTI 3PBSA 1W8QA 3HLBA 4KG6A 4KQDA 4EBNA 3T1RA 1GA9A 1PW8A 4S2NA 2IWDA 5EVEA 3NY4A 2J9OA 3LIEA 3O5YA 3IBRA 3EQVA 4Y17A 3BJNA 2IA2A 3V39A 2NUPC 1YLZA 4RA7A 1GCEA 3HUOA 1BLSA 1KOUA 1ZKJA 5KSCA 1PFLA 2ACGA 4RX3A 1FCOA 5CERA 3SOIA 1K54C 4B4ZA 2G7UA 2EX8A 4N1XA 5DF9A 2CMNA 5GHXA 1ES5A 2HGVA 3IX3A 1BSGA 4O01A 2ZMFA 2PHYA 2HDRA 1HTZA 3VP1A 3DWZA 5CTMA 1HLUP 3SW1A 3D72A 1OPXA 4JBFA 2OOLA 3G35A 3C4OA 3T4QA 4CLCB 2XA7M 1JNUA 4CLCD 4DE1A 4X53A 1NJ4A 3CUEA 4N1HA 3JPUA 2G2UA 4FUWA 4PAUA 4BD1A 4WUJA 3IBJA 2Z6CA 2QHKA 3LY3A 4HY8A 5EOOA 1HZOA 3MFDA 3IS2B 3EEAA 1XPBA 3S4XA 2MJ6A 5DJTA 2M7UA 2WAFA 3Q7ZA 3M2KA 5CGSA 2Y2KA 4ZBEA 3B3XA 3HREA 1T18A 4OOMA 5CECA 3T1XA 2V2FF 4BBUA 5CEBA 2OWJA 4E6WA 1XP4A 3OC2A 3KYZA 1VETA 2ZQ8A 1OT6A 1K56A 5FQJA 3DTMA 3UB6A 3LUQA 4DN0A 1XKZA 4HH3A 1ZTUA 2KX6A 2LB9A 1K6SA 1L3LA 4L0LA 1FILA 5GL9A 4PM6A 4BL2A 4OONA 1SHVA 2W1RA 2XK1A 1K6RA 3IT9A 3QP6A 2B02A 4BMWA 1LI9A 5DJUA 5M1AA 5EVLA 1HVBA 1Q2QA 4E6XA 3UE3A 4PKYG 5EM0A 3BFDA 3G31A 1XJ4A 1OMEA 3ZG5A 4DDSA 3MQ0A 3VSKA 2O9BA 1F9IA 5E2HA 3N7WA 1STZA 1X0OA 1IYOA 1YMXA 4I3IA 3NJAA 3VP4A 5KMWA 3BQAA 4F3LB 4GLQA 3GMWA 1S4RA 1VEUA 4QWOA 3OPHA 1CJFA 2WK0A 2VGKA 1VQQA 1KDWA 3HJIA 3RXXA 3N8RA 2PDRA 1TD5A 2FFFB 2QWSA 2J9PA 1IKIA 4KQOA 2C6WB 4HBUA 4MN7A 3T4KA 1OTBA 3VV4A 1O07A 3DTIA 4HJ6A 2FZ0A 2OV5A 2Y55A 5FSRA 1IKGA 4PM7A 3LIBA 4WZ5C 3MR0A 3GR2A 4LRZE 3NOTC 4X69A 3A0RA 5EVIB 5IHVA 1YSPA 3PBRA 5KSHA 5EVID 3NBLA 1XJ6A 3IX4A 4HESA 4KQQA 4LV3A 3MZDA 4R1GA 1FQGA 2W3GA 2Y2MA 4WM9A 4JXGA 5EE8A 5HX9A 2ZQ7A 5A92A 2PBDP 1K54A 3ITBA 5FAOA 1EW0A 3O86A 1K56D 3H9WA 4KZ9A 1J3WA 1H8YA 2L1MA 3C7UA 1CEFA 1XJ2A 3KSIA 3IXGA 3UMDA 1XJ3A 3T4OA 4LCLA 3PBQA 2I9VA 3T50A 1UWPX 5CGXA 4Q8IA 1ESUA 2J3TD 1TS7A 4Y15A 2ZC5B 2G2WA 1I2SA 1S66L 1YLTA 3H82A 4MBHA 2PYPA 5J4EA 2P08A 4OKPA 3NECA 5DFYA 4YOFA 2H0YA 4GHIA 5L07A 4UQIS 3SS3A 3CPTB 3AGFA 4FD8A 4HH2A 4NKPA 4X55A 3T1QB 3IH8A 4C75A 4LRXC 3IQAA 3KYEA 2X01A 3DW0A 3H7WA 1P0ZA 3HJKA 5DKKA 4RYEA 4LFUA 2KOIA 2XD1A 1VM1A 4EEPA 3A3FA 1HD8A 2JKGA 4YWZA 4E3MA 1L0GA 1UGUA 2JKRM 3NHQA 1IFQA 4GKUA 2PU2A 3B47A 2P9VA 4B4XA 2H10A 2PYRA 4QU3A 1F98A 4U0TA 1J9MA 4D60A 3A3DA 2FH5A 1JWPA 3HLWA 4L9GA 2RL3A 5EPHA 1KE3A 4O0PA 5FQ9A 3LCEA 4HBTA 4MBFA 3WS5A 2Z6DA 3MKEA 2R9XA 3UNWA 3P09A 3E4PA 4BBVA 4RX2A 2EX9A 3PBTA 3BY9A 3Q82A 4KG5A 3ZFZA 1O7EA 3K3DA 4OLGA 3MMHA 5J8XA 3S7OA 3JVUA 5HZHA 2WGIA 3K2NA 3S22A 5M19A 4UQIM 3TRCA 4QY5A 4NG2A 2W0NA 4NETA 1VB6A 1RGZA 3F1NA 2YKHA 4DMZA 4QY6A 3LR4A 4MBKA 4QJGA 1Y54A 2Y4AA 1C3BA 5HWVA 3W2ZA 3SS5A 2EFXA 1CQAA 1PWCA 1NYMA 5F1GA 5L09A 4JGRA 3MFXA 1W7FA 3WRZA 2ZM2A
chains in the Genus database with same CATH topology
3VFFA 3WS4A 1ZKJA 4FSFA 2E8IA 2WGVA 3N8SA 4WZ5A 1LI0A 3I7JA 1NY0A 4RX3A 4ZTKA 3UO9A 3VOZA 1FCOA 5CERA 4GDBA 3SOIA 1K54C 2QPNA 4B4ZA 2WKHA 2EX8A 3N8LA 4N1XA 4CPKA 3VP0A 4E3NA 4BENA 5DF9A 3V3SA 5GHXA 2OSUA 3UPNA 3ZG8B 1ES5A 1EROA 3SH9A 1E4DA 3FKVA 3IF6C 1BSGA 2EX2A 2XLNA 4MEZA 4DXCA 1Q2PA 1PYYA 1W8YA 1Z6FA 2HDRA 5BOHA 1HTZA 2Y2OA 3VP1A 3BFEA 4R4SA 3DWZA 2EXBA 3SH8A 5CTMA 1K57A 3BYDA 4KENB 4GD8A 4JBFA 3UN7A 4WZ4A 1QMFA 3G35A 4Z9QA 4GB7A 3C4OA 5DTSA 4B88A 2GDNA 5F83A 1MWTA 1XXMA 1FR1A 2V1ZA 5TFQA 5F82A 4PPRA 4K91A 2HDUA 1XX2A 4MNRA 4DE1A 3BRMA 4X53A 4JF5A 1YM1A 1YLWA 5A90A 2XDMA 1NJ4A 1MXOA 1ONHA 2H5SA 4N1HA 4NK3A 4JXSA 3ZG7B 5HW3A 2Z2MB 1IELA 4KG2A 1ERMA 2G2UA 4DRTA 4BD1A 3Q81A 4RVAA 3FWLA 3RXWA 2HDSA 4DE0A 5HARA 4YINA 1YLYA 1BUEA 2Y2GA 4UA6A 3BLMA 3IHBA 1N4OA 4F94A 2C5WB 4S2KA 5GLCA 3VOYA 5EOEA 1M40A 3CMZA 4OOYA 2WZXA 1TDLA 3ISGA 3LY3A 1DJCA 3WRTA 3C7VA 2Q9NA 5FQKA 4C3QA 3RJUA 2QZ6A 5HAPA 5A93A 5EOOA 2ZC7A 1HZOA 3MFDA 4S2LA 3G4PA 1MKIA 4S2IA 1XA1A 1XPBA 2ZC6B 2V20A 2Y2QA 3IXDA 3M2JA 1NXYA 2ZQDA 5GLAA 1PWGA 1SCWA 3GSGA 3S4XA 5M18A 5E2GA 5CTNA 1BZAA 2WAFA 3Q7ZA 4BD0A 3M2KA 5CGSA 3IF6B 1ES2A 1DY6A 2A3UA 2Y2KA 3C4PA 4ZBEA 2BG1A 1LL9A 3B3XA 3QHYA 4LV1A 3HREA 4OOMA 4OPYA 4R0QA 5CECA 2XR0A 5HAQA 3HLFA 2V2FF 5CEBA 1LLBA 4P6BA 2IWCA 2DCFA 4E6WA 3W8KA 1QMEA 5CHMA 5FA7A 1XP4A 1ALQA 3OC2A 4U3TA 5L2FA 3QNCA 3LEZA 5CHJA 3E2KA 2ZQ8A 5FQQA 4JLFA 3TSGA 1FR6A 1K56A 1BULA 5FQJA 3DTMA 2HPBA 5FQMA 2Y2PA 2Y59A 4OLDA 5E2FA 1XKZA 2PU4A 3NIAA 3HLEA 2ZD8A 3GVBA 3UDFA 4IEDA 3BFCA 3Q7VA 1K6SA 4FCFA 5FATA 1XGIA 4E3IA 3N6IA 4LV2A 5FI2A 4DE3A 5I94A 4L0LA 5DVAA 5GL9A 2IWBA 4OPZA 1JTGA 3M6HA 4PM6A 1PZPA 5GLBA 1U60A 3SS4A 4OONA 3UE1A 1L0DA 4BL2A 1SHVA 1E25A 1JWZA 2UWXA 3D4FA 2XK1A 3FYZA 1K6RA 4M3KA 1KVMA 4GD6A 5GHZA 3IT9A 3MXRA 2HP5A 3C5AA 3ZDJA 1YLJA 1W79A 1LI9A 1G6AA 4CJNA 3OCLA 1JWVA 4X6TA 3FV7A 5M1AA 3IWQA 1K38A 5EVLA 1HVBA 3JYIA 1Q2QA 5CHUA 4E6XA 4E3LA 3UE3A 5EVIC 1MWUA 3BFDA 4GOGA 1M6KA 4OOLA 2ZQCA 2WGWB 3G31A 4H8RA 5A91A 1OMEA 2PBYA 2Y2LA 3CZDA 3EQUA 2Y91A 2I72A 4IVIA 4K0WA 3ZG5A 4DDSA 3VSKA 3Q1FA 4WMCD 3FZCA 1NRFA 5E2HA 3N7WA 1FSWA 1DJBA 1BLHA 4HEFA 4ID4A 4JF6A 1IYOA 4KQRA 4XUXA 3ZVWA 1KGGA 1JVJA 1LL5A 1YMXA 4Y0TA 4BQMA 3VP4A 5KMWA 3GMWA 3GTCA 3ZG0A 3IF5A 3OPHA 4JPMA 3O88A 4OQIA 5FASA 3WS0A 2WGWA 2WK0A 3UDIA 3NI9A 5CEDA 2VGKA 1VQQA 1S0WA 1KDWA 1BLCA 2XD5A 3RXXA 1DJAA 3N8RA 2RCXA 1GHMA 2WUQA 2FFFB 5FI6A 5HAIA 4R23A 4WYYA 4S2NC 2HDQA 4C6YA 4UAAA 3MZFA 2J9PA 1IKIA 2ZQ9A 5JYPA 1YLPA 4KQOA 2C6WB 4HBUA 3NDGA 5FI7A 3IXBA 1PIOA 2WAEA 4P85A 1O07A 4WELA 2OV5A 4OP8A 1RCJA 2JE5A 2Y55A 3GRJA 5DTKA 1IKGA 1TEMA 5FSRA 4PM7A 3NC8A 4WZ5C 1FCNA 3GR2A 4U0XA 4S2JA 4E3OA 3G2ZA 4LCMA 1G68A 2QMIA 4OP5A 4UA9A 4X69A 3PTEA 3UY6A 5GLDA 3P98A 4IBXA 4OQGA 5EVIB 5IHVA 4GNUA 3PBRA 2JBFA 1KDSA 2XEPA 1EI5A 3WWXA 5KSHA 3N4IA 5EVID 2ZLYA 1K55A 3NBLA 4Y0OA 1MY8A 4HESA 3HLDA 2JC7A 4MLLA 5AQBA 4XUZA 4KQQA 2Y2JA 3BECA 4LV3A 4GDNA 3MZDA 2X02A 4EUZA 4A5RA 4R1GA 1K57C 1FQGA 1RGYA 3VMAA 2Y2MA 4JKTA 4WM9A 4JXGA 3G30A 5EE8A 4EQIA 1L2SA 5HX9A 2ZQ7A 1BLPA 5A92A 2ZM8A 3HLGA 5F1FA 1K54A 1CEGA 2P74A 1PI5A 1AXBA 3ITBA 2JCHA 2EXAA 2WYXA 5FAOA 4GZBA 3O86A 3PBOA 4FH4A 3BEBA 1K56D 4KZ9A 4OH0A 4R4RA 3AGDA 1CI8A 4S2PA 3G34A 3NCKA 3IF6A 3W4OA 4Y0UA 3OPLA 4EBLA 1H8YA 1JTDA 3C7UA 1CEFA 2H0TA 3BLSA 4KZ4A 1PW1A 2DNSA 2Y2NA 3CG5A 3IXGA 1BT5A 1I2WA 3MXSA 4OVDA 1RP5A 4KZ7A 4LCLA 4P87A 3TOIA 3PBQA 3HBRA 3MBZA 5CXWA 1IYSA 3BFGA 4O7DA 3O87A 2Y2IA 1H5XA 5E43A 4JXVA 1PI4A 1E3UD 4BLMA 1L0EA 5CGXA 1KGEA 5KZHA 4BL3A 3V50A 1ESUA 3FKWA 4Q8IA 3IWOA 2J7VA 3HUNA 3VP2A 4DKIA 1YMSA 3GV9A 3IH9A 5TGFA 3ZVTA 1KGFA 2ZC5B 3HVFA 4XXRA 4OPQA 2G2WA 1MWRA 1I2SA 5E2EA 4S2OA 3S1YA 1YLTA 3TG9A 4EWFA 2XQZA 2B5RA 4MBHA 1KE4A 2X71A 1XGJA 4IBRA 1H8ZA 4IVKA 1S6RA 2WZZA 5AQ9A 4OKPA 3MZEA 4X56A 3IXHA 1YT4A 1FSYA 2H0YA 1ZG6A 4DXBA 1CK3A 3CJMA 4UHUA 2ZC3B 3HLCA 3A3JA 3SS3A 3AGFA 2Y2HA 4FD8A 4BJPA 4X55A 3HUMA 4N9LA 3IH8A 4C75A 3E2LA 1SKFA 3W4PA 4S2MA 3IQAA 3IHAA 4QHCA 3LO7A 5JYOA 3AGEA 2X01A 5G18A 4PM5A 2XF3A 1EWZA 1L0FA 3ZCZA 3DW0A 4ZJ1A 3ZG9B 2P9VB 4X68A 4KZ6A 5AQAA 4KZBA 2XH9A 2HP6A 4PMAA 4WMCA 5TR7A 4R3BA 1SDEA 4RYEA 5HL1A 3G32A 2XFSA 1FOFA 2OLVA 4D2OA 3OPRA 3OZHA 3PBNA 4WBGA 2XD1A 1VM1A 4OPRA 2ZQAA 4LENA 1WE4A 3A3FA 3NDEA 1HD8A 1TVFA 5FAQA 4E3MA 4KZ5A 4JF4A 1L0GA 3A3EA 5D3OA 1GHPA 1ERQA 3O3VA 3OCNA 4GKUA 3PAGA 2PU2A 3HL9A 3UPOA 2P9VA 1ZG4A 4B4XA 4EV4A 2H10A 1BTLA 2J8YA 4PM8A 4ZAMA 1MWSA 3UPPA 3ZHHA 3G2YA 4QU3A 4U0TA 1YQSA 1J9MA 1W5DA 1PZOA 3A3DA 3LY4A 5FQIA 4LV0A 3ITAA 1JWPA 1MBLA 3HLWA 4KZAA 4WEKA 5AQ7A 2RL3A 4YFMA 2OLUA 5EPHA 4DF6A 1ES3A 2Z2LB 1KE0A 1KE3A 2WADA 3M6BA 4WEJA 3VP3A 2VGJA 2DRWA 1GHIA 1WYCA 5EUAA 5FQ9A 1MPLA 2XFTA 3LCEA 4N9KA 5GHYA 1IEMA 4HBTA 3ZNYA 5HFOA 1ZC2A 4MBFA 5DF8A 4KZ3A 3WS5A 3HUOA 4E3KA 4FH2A 1K4FA 3MKEA 2R9XA 3UNWA 5DTTA 3P09A 4DDYA 4QD4A 1XA7A 1K25A 4EBPA 4RX2A 2EX9A 3PBTA 1CI9A 1PWDA 1KVLA 3Q82A 4OQ0A 5EVIA 4KG5A 4R3JA 3ZFZA 2A49A 2Q9MA 5FDHA 1O7EA 1WYBA 4GN2A 4P0MA 4OLGA 3A3IA 3OPPA 4N92A 3IWIA 3VSLA 5J8XA 3Q7VB 3Q07A 2R9WA 2ZJ9A 2ZM0A 3WS1A 2EX6A 3ZNTA 2WGIA 3W4QA 3S22A 2ZC4B 2CC1A 1NYYA 3WS2A 3V5MA 5M19A 1N9BA 1NZOA 4OQHA 1GA0A 3BFFA 4ZDXA 4QY5A 3UDXA 3MKFA 1K4EA 4NETA 4K0XA 1RGZA 4DE2A 1ES4A 2XGNA 3QNBA 5DF7A 5U47A 5EECA 1FCMA 4E3JA 3ZGAB 4ZJ2A 4QY6A 1TDGA 2WKEA 4MBKA 4PM9A 1I5QA 5CGWA 4QJGA 1IYQA 1ONGA 2HP9A 1Y54A 3V3RA 1NZUA 1ESIA 1SDNA 2BLSA 2Y4AA 4ZJ3A 2EFUA 4KZ8A 5CRFA 4QB8A 1C3BA 5FAPA 3PBSA 4KG6A 1W8QA 2ZMAA 3HLBA 4EBNA 1GA9A 1K55C 1PW8A 4S2NA 2IWDA 1IYPA 1LHYA 2EFXA 3SS5A 3UE0A 3GQZA 3BM6A 3NY4A 2J9OA 1E3UA 1PWCA 4UA7A 4Y7PA 1W7FA 4JXWA 5KSCA 3PAEA 2WKIA 3SH7A 1NYMA 3EQVA 5F1GA 3VFHA 3V39A 2FFYA 3DWKA 1YLZA 4RA7A 1GCEA 3WRZA 2ZM2A 1BLSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VFF A;  3WS4 A;  1ZKJ A;  4FSF A;  2E8I A;  2WGV A;  3N8S A;  4WZ5 A;  1LI0 A;  3I7J A;  1NY0 A;  4RX3 A;  4ZTK A;  3UO9 A;  3VOZ A;  1FCO A;  5CER A;  4GDB A;  3SOI A;  1K54 C;  2QPN A;  4B4Z A;  2WKH A;  2EX8 A;  3N8L A;  4N1X A;  4CPK A;  3VP0 A;  4E3N A;  4BEN A;  5DF9 A;  3V3S A;  5GHX A;  2OSU A;  3UPN A;  3ZG8 B;  1ES5 A;  1ERO A;  3SH9 A;  1E4D A;  3FKV A;  3IF6 C;  1BSG A;  2EX2 A;  2XLN A;  4MEZ A;  4DXC A;  1Q2P A;  1PYY A;  1W8Y A;  1Z6F A;  2HDR A;  5BOH A;  1HTZ A;  2Y2O A;  3VP1 A;  3BFE A;  4R4S A;  3DWZ A;  2EXB A;  3SH8 A;  5CTM A;  1K57 A;  3BYD A;  4KEN B;  4GD8 A;  4JBF A;  3UN7 A;  4WZ4 A;  1QMF A;  3G35 A;  4Z9Q A;  4GB7 A;  3C4O A;  5DTS A;  4B88 A;  2GDN A;  5F83 A;  1MWT A;  1XXM A;  1FR1 A;  2V1Z A;  5TFQ A;  5F82 A;  4PPR A;  4K91 A;  2HDU A;  1XX2 A;  4MNR A;  4DE1 A;  3BRM A;  4X53 A;  4JF5 A;  1YM1 A;  1YLW A;  5A90 A;  2XDM A;  1NJ4 A;  1MXO A;  1ONH A;  2H5S A;  4N1H A;  4NK3 A;  4JXS A;  3ZG7 B;  5HW3 A;  2Z2M B;  1IEL A;  4KG2 A;  1ERM A;  2G2U A;  4DRT A;  4BD1 A;  3Q81 A;  4RVA A;  3FWL A;  3RXW A;  2HDS A;  4DE0 A;  5HAR A;  4YIN A;  1YLY A;  1BUE A;  2Y2G A;  4UA6 A;  3BLM A;  3IHB A;  1N4O A;  4F94 A;  2C5W B;  4S2K A;  5GLC A;  3VOY A;  5EOE A;  1M40 A;  3CMZ A;  4OOY A;  2WZX A;  1TDL A;  3ISG A;  3LY3 A;  1DJC A;  3WRT A;  3C7V A;  2Q9N A;  5FQK A;  4C3Q A;  3RJU A;  2QZ6 A;  5HAP A;  5A93 A;  5EOO A;  2ZC7 A;  1HZO A;  3MFD A;  4S2L A;  3G4P A;  1MKI A;  4S2I A;  1XA1 A;  1XPB A;  2ZC6 B;  2V20 A;  2Y2Q A;  3IXD A;  3M2J A;  1NXY A;  2ZQD A;  5GLA A;  1PWG A;  1SCW A;  3GSG A;  3S4X A;  5M18 A;  5E2G A;  5CTN A;  1BZA A;  2WAF A;  3Q7Z A;  4BD0 A;  3M2K A;  5CGS A;  3IF6 B;  1ES2 A;  1DY6 A;  2A3U A;  2Y2K A;  3C4P A;  4ZBE A;  2BG1 A;  1LL9 A;  3B3X A;  3QHY A;  4LV1 A;  3HRE A;  4OOM A;  4OPY A;  4R0Q A;  5CEC A;  2XR0 A;  5HAQ A;  3HLF A;  2V2F F;  5CEB A;  1LLB A;  4P6B A;  2IWC A;  2DCF A;  4E6W A;  3W8K A;  1QME A;  5CHM A;  5FA7 A;  1XP4 A;  1ALQ A;  3OC2 A;  4U3T A;  5L2F A;  3QNC A;  3LEZ A;  5CHJ A;  3E2K A;  2ZQ8 A;  5FQQ A;  4JLF A;  3TSG A;  1FR6 A;  1K56 A;  1BUL A;  5FQJ A;  3DTM A;  2HPB A;  5FQM A;  2Y2P A;  2Y59 A;  4OLD A;  5E2F A;  1XKZ A;  2PU4 A;  3NIA A;  3HLE A;  2ZD8 A;  3GVB A;  3UDF A;  4IED A;  3BFC A;  3Q7V A;  1K6S A;  4FCF A;  5FAT A;  1XGI A;  4E3I A;  3N6I A;  4LV2 A;  5FI2 A;  4DE3 A;  5I94 A;  4L0L A;  5DVA A;  5GL9 A;  2IWB A;  4OPZ A;  1JTG A;  3M6H A;  4PM6 A;  1PZP A;  5GLB A;  1U60 A;  3SS4 A;  4OON A;  3UE1 A;  1L0D A;  4BL2 A;  1SHV A;  1E25 A;  1JWZ A;  2UWX A;  3D4F A;  2XK1 A;  3FYZ A;  1K6R A;  4M3K A;  1KVM A;  4GD6 A;  5GHZ A;  3IT9 A;  3MXR A;  2HP5 A;  3C5A A;  3ZDJ A;  1YLJ A;  1W79 A;  1LI9 A;  1G6A A;  4CJN A;  3OCL A;  1JWV A;  4X6T A;  3FV7 A;  5M1A A;  3IWQ A;  1K38 A;  5EVL A;  1HVB A;  3JYI A;  1Q2Q A;  5CHU A;  4E6X A;  4E3L A;  3UE3 A;  5EVI C;  1MWU A;  3BFD A;  4GOG A;  1M6K A;  4OOL A;  2ZQC A;  2WGW B;  3G31 A;  4H8R A;  5A91 A;  1OME A;  2PBY A;  2Y2L A;  3CZD A;  3EQU A;  2Y91 A;  2I72 A;  4IVI A;  4K0W A;  3ZG5 A;  4DDS A;  3VSK A;  3Q1F A;  4WMC D;  3FZC A;  1NRF A;  5E2H A;  3N7W A;  1FSW A;  1DJB A;  1BLH A;  4HEF A;  4ID4 A;  4JF6 A;  1IYO A;  4KQR A;  4XUX A;  3ZVW A;  1KGG A;  1JVJ A;  1LL5 A;  1YMX A;  4Y0T A;  4BQM A;  3VP4 A;  5KMW A;  3GMW A;  3GTC A;  3ZG0 A;  3IF5 A;  3OPH A;  4JPM A;  3O88 A;  4OQI A;  5FAS A;  3WS0 A;  2WGW A;  2WK0 A;  3UDI A;  3NI9 A;  5CED A;  2VGK A;  1VQQ A;  1S0W A;  1KDW A;  1BLC A;  2XD5 A;  3RXX A;  1DJA A;  3N8R A;  2RCX A;  1GHM A;  2WUQ A;  2FFF B;  5FI6 A;  5HAI A;  4R23 A;  4WYY A;  4S2N C;  2HDQ A;  4C6Y A;  4UAA A;  3MZF A;  2J9P A;  1IKI A;  2ZQ9 A;  5JYP A;  1YLP A;  4KQO A;  2C6W B;  4HBU A;  3NDG A;  5FI7 A;  3IXB A;  1PIO A;  2WAE A;  4P85 A;  1O07 A;  4WEL A;  2OV5 A;  4OP8 A;  1RCJ A;  2JE5 A;  2Y55 A;  3GRJ A;  5DTK A;  1IKG A;  1TEM A;  5FSR A;  4PM7 A;  3NC8 A;  4WZ5 C;  1FCN A;  3GR2 A;  4U0X A;  4S2J A;  4E3O A;  3G2Z A;  4LCM A;  1G68 A;  2QMI A;  4OP5 A;  4UA9 A;  4X69 A;  3PTE A;  3UY6 A;  5GLD A;  3P98 A;  4IBX A;  4OQG A;  5EVI B;  5IHV A;  4GNU A;  3PBR A;  2JBF A;  1KDS A;  2XEP A;  1EI5 A;  3WWX A;  5KSH A;  3N4I A;  5EVI D;  2ZLY A;  1K55 A;  3NBL A;  4Y0O A;  1MY8 A;  4HES A;  3HLD A;  2JC7 A;  4MLL A;  5AQB A;  4XUZ A;  4KQQ A;  2Y2J A;  3BEC A;  4LV3 A;  4GDN A;  3MZD A;  2X02 A;  4EUZ A;  4A5R A;  4R1G A;  1K57 C;  1FQG A;  1RGY A;  3VMA A;  2Y2M A;  4JKT A;  4WM9 A;  4JXG A;  3G30 A;  5EE8 A;  4EQI A;  1L2S A;  5HX9 A;  2ZQ7 A;  1BLP A;  5A92 A;  2ZM8 A;  3HLG A;  5F1F A;  1K54 A;  1CEG A;  2P74 A;  1PI5 A;  1AXB A;  3ITB A;  2JCH A;  2EXA A;  2WYX A;  5FAO A;  4GZB A;  3O86 A;  3PBO A;  4FH4 A;  3BEB A;  1K56 D;  4KZ9 A;  4OH0 A;  4R4R A;  3AGD A;  1CI8 A;  4S2P A;  3G34 A;  3NCK A;  3IF6 A;  3W4O A;  4Y0U A;  3OPL A;  4EBL A;  1H8Y A;  1JTD A;  3C7U A;  1CEF A;  2H0T A;  3BLS A;  4KZ4 A;  1PW1 A;  2DNS A;  2Y2N A;  3CG5 A;  3IXG A;  1BT5 A;  1I2W A;  3MXS A;  4OVD A;  1RP5 A;  4KZ7 A;  4LCL A;  4P87 A;  3TOI A;  3PBQ A;  3HBR A;  3MBZ A;  5CXW A;  1IYS A;  3BFG A;  4O7D A;  3O87 A;  2Y2I A;  1H5X A;  5E43 A;  4JXV A;  1PI4 A;  1E3U D;  4BLM A;  1L0E A;  5CGX A;  1KGE A;  5KZH A;  4BL3 A;  3V50 A;  1ESU A;  3FKW A;  4Q8I A;  3IWO A;  2J7V A;  3HUN A;  3VP2 A;  4DKI A;  1YMS A;  3GV9 A;  3IH9 A;  5TGF A;  3ZVT A;  1KGF A;  2ZC5 B;  3HVF A;  4XXR A;  4OPQ A;  2G2W A;  1MWR A;  1I2S A;  5E2E A;  4S2O A;  3S1Y A;  1YLT A;  3TG9 A;  4EWF A;  2XQZ A;  2B5R A;  4MBH A;  1KE4 A;  2X71 A;  1XGJ A;  4IBR A;  1H8Z A;  4IVK A;  1S6R A;  2WZZ A;  5AQ9 A;  4OKP A;  3MZE A;  4X56 A;  3IXH A;  1YT4 A;  1FSY A;  2H0Y A;  1ZG6 A;  4DXB A;  1CK3 A;  3CJM A;  4UHU A;  2ZC3 B;  3HLC A;  3A3J A;  3SS3 A;  3AGF A;  2Y2H A;  4FD8 A;  4BJP A;  4X55 A;  3HUM A;  4N9L A;  3IH8 A;  4C75 A;  3E2L A;  1SKF A;  3W4P A;  4S2M A;  3IQA A;  3IHA A;  4QHC A;  3LO7 A;  5JYO A;  3AGE A;  2X01 A;  5G18 A;  4PM5 A;  2XF3 A;  1EWZ A;  1L0F A;  3ZCZ A;  3DW0 A;  4ZJ1 A;  3ZG9 B;  2P9V B;  4X68 A;  4KZ6 A;  5AQA A;  4KZB A;  2XH9 A;  2HP6 A;  4PMA A;  4WMC A;  5TR7 A;  4R3B A;  1SDE A;  4RYE A;  5HL1 A;  3G32 A;  2XFS A;  1FOF A;  2OLV A;  4D2O A;  3OPR A;  3OZH A;  3PBN A;  4WBG A;  2XD1 A;  1VM1 A;  4OPR A;  2ZQA A;  4LEN A;  1WE4 A;  3A3F A;  3NDE A;  1HD8 A;  1TVF A;  5FAQ A;  4E3M A;  4KZ5 A;  4JF4 A;  1L0G A;  3A3E A;  5D3O A;  1GHP A;  1ERQ A;  3O3V A;  3OCN A;  4GKU A;  3PAG A;  2PU2 A;  3HL9 A;  3UPO A;  2P9V A;  1ZG4 A;  4B4X A;  4EV4 A;  2H10 A;  1BTL A;  2J8Y A;  4PM8 A;  4ZAM A;  1MWS A;  3UPP A;  3ZHH A;  3G2Y A;  4QU3 A;  4U0T A;  1YQS A;  1J9M A;  1W5D A;  1PZO A;  3A3D A;  3LY4 A;  5FQI A;  4LV0 A;  3ITA A;  1JWP A;  1MBL A;  3HLW A;  4KZA A;  4WEK A;  5AQ7 A;  2RL3 A;  4YFM A;  2OLU A;  5EPH A;  4DF6 A;  1ES3 A;  2Z2L B;  1KE0 A;  1KE3 A;  2WAD A;  3M6B A;  4WEJ A;  3VP3 A;  2VGJ A;  2DRW A;  1GHI A;  1WYC A;  5EUA A;  5FQ9 A;  1MPL A;  2XFT A;  3LCE A;  4N9K A;  5GHY A;  1IEM A;  4HBT A;  3ZNY A;  5HFO A;  1ZC2 A;  4MBF A;  5DF8 A;  4KZ3 A;  3WS5 A;  3HUO A;  4E3K A;  4FH2 A;  1K4F A;  3MKE A;  2R9X A;  3UNW A;  5DTT A;  3P09 A;  4DDY A;  4QD4 A;  1XA7 A;  1K25 A;  4EBP A;  4RX2 A;  2EX9 A;  3PBT A;  1CI9 A;  1PWD A;  1KVL A;  3Q82 A;  4OQ0 A;  5EVI A;  4KG5 A;  4R3J A;  3ZFZ A;  2A49 A;  2Q9M A;  5FDH A;  1O7E A;  1WYB A;  4GN2 A;  4P0M A;  4OLG A;  3A3I A;  3OPP A;  4N92 A;  3IWI A;  3VSL A;  5J8X A;  3Q7V B;  3Q07 A;  2R9W A;  2ZJ9 A;  2ZM0 A;  3WS1 A;  2EX6 A;  3ZNT A;  2WGI A;  3W4Q A;  3S22 A;  2ZC4 B;  2CC1 A;  1NYY A;  3WS2 A;  3V5M A;  5M19 A;  1N9B A;  1NZO A;  4OQH A;  1GA0 A;  3BFF A;  4ZDX A;  4QY5 A;  3UDX A;  3MKF A;  1K4E A;  4NET A;  4K0X A;  1RGZ A;  4DE2 A;  1ES4 A;  2XGN A;  3QNB A;  5DF7 A;  5U47 A;  5EEC A;  1FCM A;  4E3J A;  3ZGA B;  4ZJ2 A;  4QY6 A;  1TDG A;  2WKE A;  4MBK A;  4PM9 A;  1I5Q A;  5CGW A;  4QJG A;  1IYQ A;  1ONG A;  2HP9 A;  1Y54 A;  3V3R A;  1NZU A;  1ESI A;  1SDN A;  2BLS A;  2Y4A A;  4ZJ3 A;  2EFU A;  4KZ8 A;  5CRF A;  4QB8 A;  1C3B A;  5FAP A;  3PBS A;  4KG6 A;  1W8Q A;  2ZMA A;  3HLB A;  4EBN A;  1GA9 A;  1K55 C;  1PW8 A;  4S2N A;  2IWD A;  1IYP A;  1LHY A;  2EFX A;  3SS5 A;  3UE0 A;  3GQZ A;  3BM6 A;  3NY4 A;  2J9O A;  1E3U A;  1PWC A;  4UA7 A;  4Y7P A;  1W7F A;  4JXW A;  5KSC A;  3PAE A;  2WKI A;  3SH7 A;  1NYM A;  3EQV A;  5F1G A;  3VFH A;  3V39 A;  2FFY A;  3DWK A;  1YLZ A;  4RA7 A;  1GCE A;  3WRZ A;  2ZM2 A;  1BLS A; 
#chains in the Genus database with same CATH topology
 3VFF A;  3WS4 A;  2WGV A;  3N8S A;  3F1P A;  4WZ5 A;  3VOZ A;  3I7J A;  4GDB A;  4HQA A;  1UWN X;  3VP0 A;  1T19 A;  3V3S A;  3PXP A;  3UPN A;  4HI4 A;  1ERO A;  3FKV A;  2A2L A;  4MCW A;  5J3W A;  4MEZ A;  4DXC A;  4P6Z M;  1Z6F A;  4R4S A;  1OTI A;  3SH8 A;  3LIC A;  4KEN B;  4EES A;  3UN7 A;  1H8M A;  4WZ4 A;  5L8M A;  4Z9Q A;  2AVX A;  3GEC A;  1XXM A;  2VJW A;  2ZL1 B;  4EQ1 A;  3BRM A;  4JF5 A;  3BY8 A;  2XDM A;  2H28 A;  4Y5F A;  3ZG7 B;  4JXS A;  1IEL A;  4KG2 A;  4DRT A;  4LPZ A;  4RVA A;  3FWL A;  3PHY A;  2HDS A;  5HAR A;  1YLY A;  2QJ7 A;  3IHB A;  1N4O A;  4F94 A;  1TF1 A;  5GLC A;  3VOY A;  4OOY A;  3ISG A;  3WRT A;  1DJC A;  2Q9N A;  5FQK A;  2QZ6 A;  5A93 A;  1N9L A;  1XA1 A;  2XA7 S;  2J3W A;  3EGD C;  5L10 A;  2ZQD A;  5GLA A;  3GSG A;  2JKR I;  3IF6 B;  1ES2 A;  1T1B A;  4PHT A;  3C4P A;  1LL9 A;  4OPY A;  2Q0O A;  2XR0 A;  5HAQ A;  3LR5 A;  2IWC A;  4ME4 A;  5CHM A;  2A24 B;  1ALQ A;  4U3T A;  5L2F A;  3QNC A;  5CHJ A;  4MN6 A;  4JLF A;  3TSG A;  1BUL A;  4JGQ A;  2Y2P A;  1AWI A;  2Y59 A;  5E2F A;  3NIA A;  3HLE A;  2ZD8 A;  3GVB A;  3UDF A;  3Q7V A;  1ZHH B;  4LV2 A;  5DVA A;  4I3A A;  3E0Y A;  1L0D A;  3KO6 A;  3S7P A;  3T4T A;  1KVM A;  2W1T B;  1XFQ A;  3MXR A;  2PR5 A;  1YLJ A;  4X6T A;  2JKF A;  3IWQ A;  1K38 A;  3JYI A;  4E3L A;  1MWU A;  2WGW B;  4H8R A;  5A91 A;  1FIK A;  2PBY A;  4JGP A;  3L7H A;  3FZC A;  2HV1 A;  4JF6 A;  4CQH A;  4DJ2 A;  5AVF A;  1TS6 A;  3IF5 A;  2QJ5 A;  3O88 A;  4OQI A;  3E4O A;  3UDI A;  2VKS A;  3NI9 A;  3C2W A;  3CIT A;  4GCZ A;  1GHM A;  2WUQ A;  5HDD A;  4C6Y A;  3OLO A;  3T12 B;  3MQQ A;  4F3L A;  4I38 A;  4WEL A;  1RCJ A;  2GZA A;  3C8C A;  5HWT A;  1WA9 A;  2QKP A;  3G2Z A;  1LSW A;  1G68 A;  4HP4 A;  3UY6 A;  3P98 A;  4IBX A;  4OQG A;  1SKO B;  5HWW A;  1KDS A;  2XEP A;  1EI5 A;  3WWX A;  3IX8 A;  2ZLY A;  1OT9 A;  1MY8 A;  2P7J A;  4MLL A;  5AQB A;  4EUZ A;  4A5R A;  1H3Q A;  2V0W A;  1RGY A;  1LSV A;  4JKT A;  4Y3I A;  3G30 A;  5F1F A;  3KSG A;  2JCH A;  2WYX A;  4XT2 B;  4GZB A;  3F1O B;  4FH4 A;  5F5Y A;  4S2P A;  3NCK A;  3E4Q A;  4EBL A;  3OPL A;  4FTX A;  1JTD A;  3BLS A;  1PW1 A;  3MXS A;  3CG5 A;  4P87 A;  1IYS A;  2PAV P;  1PI4 A;  1L0E A;  1KGE A;  2KLI A;  4GS9 B;  4BL3 A;  4Z1W A;  3CLO A;  3IWO A;  3HUN A;  3FPW A;  3LR3 A;  3IH9 A;  4Q0H A;  3ZVT A;  4EER A;  1G28 A;  3S1Y A;  1MWR A;  4S2O A;  4EWF A;  3D3O A;  2WZZ A;  5AQ9 A;  3MZE A;  3IXH A;  3MF0 A;  2GX5 A;  1ZG6 A;  3CJM A;  4UHU A;  3A3J A;  2Y2H A;  3P7N A;  4BJP A;  3C30 A;  3HUM A;  2Y79 A;  5JYO A;  3MQO A;  5G18 A;  2XF3 A;  1L0F A;  4ZJ1 A;  3ZG9 B;  4EET B;  2HP6 A;  5TR7 A;  4WMC A;  5HL1 A;  1SDE A;  3G32 A;  3OZH A;  3PBN A;  3NDE A;  3UE6 A;  5FAQ A;  1TVF A;  4KZ5 A;  4JF4 A;  1GHP A;  1ERQ A;  3CAX A;  4NEE D;  4WL9 A;  3O3V A;  3HL9 A;  3UPO A;  3EWK A;  3G6O A;  4MN5 A;  2J8Y A;  4PM8 A;  3UPP A;  3ZHH A;  3G2Y A;  1PZO A;  5FQI A;  4KZA A;  4WEK A;  4PKY A;  5AQ7 A;  4DF6 A;  3M6B A;  4WEJ A;  5K5B A;  2VGJ A;  4IUK A;  2NUT C;  5CX7 A;  4NXF A;  5HPI A;  5DTT A;  4DDY A;  2BTF P;  4EBP A;  1Y28 A;  1CI9 A;  1KVL A;  4NXG A;  4EUV A;  4R70 A;  3A3I A;  5LBR A;  3VSL A;  3IWI A;  2ZM0 A;  3ZNT A;  4HJ3 A;  3UME A;  1N9B A;  4OQH A;  1MKM A;  3DAV A;  4LGW A;  1SZV A;  2XRO A;  4K0X A;  4CLC C;  4KUO A;  2XGN A;  5DF7 A;  2WKQ A;  4E3J A;  2L4R A;  4ZJ2 A;  1GSW A;  5CGW A;  1TDG A;  3CHW P;  4HHD A;  3QP8 A;  4Q0I A;  1SDN A;  2V0U A;  1K55 C;  2PD7 A;  1LHY A;  3BM6 A;  3R4K A;  1E3U A;  4Y7P A;  1N9O A;  3PAE A;  3SH7 A;  2FFY A;  3DWK A;  4E3N A;  4FSF A;  2E8I A;  1LI0 A;  1NY0 A;  3UO9 A;  1Y4O A;  1S1Z A;  2M1C A;  2EA9 A;  2WKH A;  3N8L A;  3PYP A;  3UB7 A;  4BEN A;  3ULF A;  4HIA A;  4LLO B;  2ZBB A;  3SH9 A;  1E4D A;  2XLN A;  2UV0 E;  1Q2P A;  1PYY A;  5BOH A;  2Y2O A;  3BFE A;  4IUH A;  4L9F A;  2OAQ 1;  2OWH A;  1QMF A;  4GB7 A;  5DTS A;  4EEU A;  5A8B A;  5EFW A;  2GDN A;  2E8J A;  2XSS A;  2V1Z A;  5TFQ A;  4X1M A;  4PPR A;  4K91 A;  4MNR A;  1F2K A;  1YLW A;  5A90 A;  3K3C A;  1MXO A;  1ONH A;  1YAX A;  2H5S A;  4NK3 A;  3U2A A;  4WN5 A;  4I3J A;  3Q81 A;  3R7W B;  4P6Z S;  4WF0 A;  4YIN A;  4UA6 A;  1BUE A;  4JGO A;  2C5W B;  5EOE A;  3D9Y A;  1ACF A;  2PT7 A;  2VX8 A;  2ZL1 A;  4C3Q A;  5IS1 A;  3RJU A;  1DP8 A;  5IU1 A;  5FEF A;  5HAP A;  2INW A;  4S2L A;  5HL6 A;  1W63 M;  1H0M A;  4M4X A;  3LFV A;  3IXD A;  3M2J A;  1NXY A;  2JHE A;  5CTN A;  2PRF A;  4RQ9 A;  4BWI A;  3HLF A;  4NXE A;  5HDC A;  3DTK A;  1NWZ A;  3LEZ A;  3E2K A;  5FQQ A;  1YKD A;  2PU4 A;  2VK3 A;  3BFC A;  5FAT A;  5I94 A;  1XGI A;  3N6I A;  5FI2 A;  3MS6 A;  3ZQ5 A;  4OPZ A;  1JTG A;  3M6H A;  5GLB A;  1PZP A;  3QP2 A;  4GHI B;  3SS4 A;  3UE1 A;  3D4F A;  1E25 A;  1JWZ A;  2UWX A;  4M3K A;  4GD6 A;  4Y13 A;  3RFB A;  5IT5 A;  3JVV A;  4CJN A;  2DMW A;  3FV7 A;  3RH8 B;  5TBM A;  4G3W A;  3H7W B;  5CHU A;  5EVI C;  1V9Y A;  1M6K A;  4OOL A;  2ZQC A;  3U4L P;  2Y2L A;  5DKL A;  3PR6 A;  1FSW A;  1DJB A;  5KIZ A;  1BLH A;  4ID4 A;  5HSQ A;  3ZVW A;  1KGG A;  1JVJ A;  4BQM A;  2BAS A;  1VHM A;  2ZMV A;  4DJ3 A;  3S7Q A;  5FAS A;  3WS0 A;  2WGW A;  3DTE A;  5CED A;  5FI6 A;  4Y2F A;  4WYY A;  4WLA A;  3CI6 A;  4UAA A;  2ZQ9 A;  2Y8H A;  1YLP A;  2V8C A;  5JYP A;  3NDG A;  5FI7 A;  1PIO A;  2WAE A;  4P85 A;  2J3T C;  4OP8 A;  3S7N A;  1MC0 A;  4ETZ A;  4CLC A;  4E04 A;  2P04 A;  4E3O A;  4OP5 A;  4UA9 A;  3PTE A;  5GLD A;  4GNU A;  2JBF A;  3N4I A;  1K55 A;  2VGL M;  4ARZ B;  2JC7 A;  4FOF A;  4K08 A;  3BEC A;  2M7V A;  2X02 A;  5I5L A;  3HCY A;  1K57 C;  3VMA A;  2HJE A;  3IS2 A;  1BLP A;  1ODV A;  3NOP C;  3HLG A;  3EGX C;  4EXO A;  1CEG A;  2P74 A;  1AXB A;  2VEA A;  3TJZ C;  2EXA A;  2O0Y A;  4YNR A;  4OH0 A;  3AGD A;  3NOU C;  1GSX A;  2VLG A;  3G34 A;  3W4O A;  3UB8 A;  2DNS A;  2Y2N A;  1BT5 A;  4KZ7 A;  2WKP A;  3E98 A;  3HBR A;  3MBZ A;  3T1S A;  4O7D A;  3O87 A;  2V9A A;  3FC7 A;  5E43 A;  4JXV A;  3QP1 A;  4II7 A;  4BLM A;  5G4Y A;  2V1A A;  3T4L A;  5KZH A;  3FKW A;  1IOU A;  4DKI A;  2JN7 A;  4XT2 A;  3F1O A;  5TGF A;  3VOL A;  2XRN A;  4R3A A;  3L9K A;  5E2E A;  3TG9 A;  3VE4 A;  2B5R A;  1KE4 A;  2X71 A;  1XGJ A;  4IBR A;  1P97 A;  1S6R A;  2K7S A;  4H6J B;  4X56 A;  2K31 A;  1NLZ A;  4DXB A;  4R6L A;  2ZC3 B;  4GS9 A;  1T1A A;  3W4P A;  3IHA A;  3LO7 A;  5F6A A;  4PM5 A;  1EWZ A;  1GSV A;  5AJG A;  4KZ6 A;  5DFX A;  5AQA A;  1PRQ A;  4PMA A;  4B9O A;  5FEG A;  2XFS A;  4WBG A;  4OPR A;  1OJG A;  2ZQA A;  4G3K A;  3A3E A;  5D3O A;  3OCN A;  3KYQ A;  3EEH A;  3PAG A;  1ZG4 A;  4EV4 A;  2B95 A;  2R78 A;  3LI8 A;  1MWS A;  5EM1 A;  4HJ4 A;  2K2N A;  1YQS A;  1LT0 A;  3LY4 A;  4LV0 A;  4YFM A;  2OLU A;  1ES3 A;  2Z2L B;  1KE0 A;  3VP3 A;  2L0W A;  1GHI A;  1WYC A;  4IHQ A;  2XFT A;  1T1C A;  4N9K A;  5GHY A;  1IEM A;  3ZNY A;  5HFO A;  1ZC2 A;  3KSH A;  5DF8 A;  3V67 A;  1K4F A;  1XFN A;  5EVI A;  4OQ0 A;  4R3J A;  5FDH A;  4P0M A;  4N92 A;  3Q7V B;  3WS1 A;  2EWW A;  3W4Q A;  1NYY A;  3MJQ A;  3V5M A;  3BFF A;  3UDX A;  3MKF A;  1K4E A;  4DE2 A;  1ES4 A;  5EEC A;  3ZGA B;  4PM9 A;  1I5Q A;  1IYQ A;  1ONG A;  2HP9 A;  2GJ3 A;  3V3R A;  5EV0 A;  1F5M A;  2BLS A;  4CLC E;  4KZ8 A;  4QB8 A;  2ZMA A;  1IYP A;  3UE0 A;  3GQZ A;  4UA7 A;  4JXW A;  2WKI A;  1CF0 A;  3LR0 A;  3VFH A;  4EU0 A;  2ZOI A;  3VE3 A;  3ZDJ A;  3RTY A;  4ZTK A;  3QP5 A;  2QPN A;  2OAP 1;  3OBF A;  4CPK A;  2OSU A;  3ZG8 B;  3IF6 C;  2EX2 A;  3KSF A;  1G5U A;  1YPR A;  1W8Y A;  4QPR A;  3CPT A;  5MC7 A;  2EXB A;  1K57 A;  3BYD A;  4GD8 A;  4B88 A;  2B18 A;  1S67 L;  5F83 A;  1MWT A;  1FR1 A;  2HJ9 C;  5FDS A;  3LIF A;  1D7E A;  5F82 A;  2HDU A;  1XX2 A;  1P9R A;  1OTA A;  5HDS A;  1YM1 A;  4I5S A;  5HW3 A;  2Z2M B;  1ERM A;  2KDK A;  3RXW A;  2J80 A;  4DE0 A;  5J7E A;  2YKF A;  2Y2G A;  3BLM A;  2V1B A;  4S2K A;  1M40 A;  3CMZ A;  2WZX A;  1TDL A;  2QYB A;  3C7V A;  2ZC7 A;  3G4P A;  4GJ4 A;  1MKI A;  2WKR A;  4S2I A;  4I39 A;  2ZC6 B;  2V20 A;  2Y2Q A;  1VET B;  1PWG A;  1SCW A;  5M18 A;  5E2G A;  1BZA A;  3A0V A;  4BD0 A;  3R7W A;  5F69 A;  1DY6 A;  2A3U A;  2BG1 A;  3QHY A;  4LV1 A;  4R0Q A;  1V9Z A;  1S4S A;  4HP9 A;  1LLB A;  4P6B A;  2DCF A;  3W8K A;  1QME A;  5FA7 A;  4HOI A;  3GDI A;  3TW8 A;  4MDZ A;  3MSH A;  1FR6 A;  2HPB A;  5FQM A;  4OLD A;  1D06 A;  1PNE A;  3FG8 A;  2W3F A;  4IED A;  4E3I A;  4FCF A;  4X25 A;  4DE3 A;  2O9A A;  2IWB A;  1U60 A;  3FYZ A;  5C5K A;  5GHZ A;  3LEQ A;  2HP5 A;  3C5A A;  4R38 A;  1W79 A;  1G6A A;  3OCL A;  1JWV A;  4ZRR A;  1P9W A;  2VZW A;  1W63 Q;  1VEU B;  4G3V A;  4GOG A;  1BYW A;  3EQU A;  3CZD A;  4IVI A;  2Y91 A;  2I72 A;  4K0W A;  4B93 A;  5AVE A;  3Q1F A;  4WMC D;  1NRF A;  1G6O A;  2V8F A;  5HPF A;  4HEF A;  3KX0 X;  4KQR A;  4XUX A;  1LL5 A;  4Y0T A;  3ICY A;  2W27 A;  2W3D A;  3GTC A;  3ZG0 A;  3QP4 A;  5FL3 A;  4JPM A;  4X1L A;  4ETX A;  3ZYT A;  1S0W A;  1BLC A;  2W3E A;  2XD5 A;  1DJA A;  2RCX A;  5G4Z A;  2GNX A;  5HAI A;  4R23 A;  3BQ8 A;  4S2N C;  2HDQ A;  2PD8 A;  3MZF A;  4MMN A;  4EW7 A;  3IXB A;  3MXQ A;  1DP9 A;  2JE5 A;  3GRJ A;  3NUL A;  5DTK A;  4IJG A;  1TEM A;  1YSQ A;  1K0K A;  3NC8 A;  1FCN A;  2PR6 A;  4U0X A;  4S2J A;  4LCM A;  2QMI A;  3CWF A;  2LB5 A;  1OJ5 A;  3LIA A;  1OTE A;  4Y0O A;  3HLD A;  4XUZ A;  2Y2J A;  4GDN A;  2O99 A;  3OOV A;  2VV8 A;  4BBT A;  1TS0 A;  2JKT M;  4EQI A;  1L2S A;  4NXB A;  2ZM8 A;  1PI5 A;  2VV6 A;  1TS8 A;  1DRM A;  3PBO A;  3BEB A;  4R4R A;  1CI8 A;  4ARZ A;  3IF6 A;  2O9C A;  3CUE C;  4Y0U A;  3H82 B;  2H0T A;  2VGL S;  3BWL A;  4KZ4 A;  4OVD A;  1LL8 A;  1I2W A;  3LYX A;  3TOI A;  1RP5 A;  1N9N A;  5CXW A;  3BFG A;  2Y2I A;  1H5X A;  2VV7 A;  1E3U D;  3BW6 A;  2A24 A;  3T4S A;  3V50 A;  3VP2 A;  2J7V A;  2ZOH A;  1YMS A;  3GV9 A;  4L9E A;  3B42 A;  1KGF A;  3HVF A;  4XXR A;  4OPQ A;  1MZU A;  1Z09 A;  2HZ5 A;  2XQZ A;  1H8Z A;  4IVK A;  5TJJ A;  1YT4 A;  1FSY A;  1CK3 A;  4GW9 A;  3HLC A;  2W3H A;  2W1T A;  4N9L A;  2D01 A;  3E2L A;  1SKF A;  4S2M A;  4QHC A;  1NRJ A;  3AGE A;  3LID A;  3ZCZ A;  3UB9 A;  2P9V B;  4X68 A;  4KZB A;  5F68 A;  4H6J A;  2XH9 A;  4R3B A;  1FOF A;  2OLV A;  4KUK A;  2D02 A;  3OPR A;  4D2O A;  4Q0J A;  1NLY A;  4LEN A;  1WE4 A;  3C38 A;  4HNB A;  1A0K A;  1OTD A;  1DP6 A;  1BTL A;  4ZAM A;  1D1J A;  3SZT A;  1LSX A;  1W5D A;  4LRY C;  3ITA A;  1MBL A;  3UB5 P;  2WAD A;  2DRW A;  1S1Y A;  3P01 A;  4O8G A;  5EUA A;  1MPL A;  4AFI A;  3DBA A;  4KZ3 A;  4UEY A;  4E3K A;  4FH2 A;  3LI9 A;  5HD3 A;  5HD5 A;  3A0S A;  4QD4 A;  1XA7 A;  1K25 A;  3F1N B;  2HF6 A;  1PWD A;  1SKO A;  2A49 A;  2Q9M A;  1WYB A;  4GN2 A;  2EWV A;  3OPP A;  2VA0 A;  3Q07 A;  2R9W A;  2ZJ9 A;  2EX6 A;  3T4J A;  2ZC4 B;  2CC1 A;  3WS2 A;  4ESP A;  3EOI A;  1NZO A;  1GA0 A;  4ZDX A;  3QNB A;  5U47 A;  3B33 A;  3TE8 A;  1FCM A;  2WKE A;  3F1P B;  3FPV A;  5TBM B;  3LGO A;  1NZU A;  1ESI A;  4ZJ3 A;  2EFU A;  5CRF A;  5FAP A;  2JKT I;  3PBS A;  1W8Q A;  3HLB A;  4KG6 A;  4KQD A;  4EBN A;  3T1R A;  1GA9 A;  1PW8 A;  4S2N A;  2IWD A;  5EVE A;  3NY4 A;  2J9O A;  3LIE A;  3O5Y A;  3IBR A;  3EQV A;  4Y17 A;  3BJN A;  2IA2 A;  3V39 A;  2NUP C;  1YLZ A;  4RA7 A;  1GCE A;  3HUO A;  1BLS A;  1KOU A;  1ZKJ A;  5KSC A;  1PFL A;  2ACG A;  4RX3 A;  1FCO A;  5CER A;  3SOI A;  1K54 C;  4B4Z A;  2G7U A;  2EX8 A;  4N1X A;  5DF9 A;  2CMN A;  5GHX A;  1ES5 A;  2HGV A;  3IX3 A;  1BSG A;  4O01 A;  2ZMF A;  2PHY A;  2HDR A;  1HTZ A;  3VP1 A;  3DWZ A;  5CTM A;  1HLU P;  3SW1 A;  3D72 A;  1OPX A;  4JBF A;  2OOL A;  3G35 A;  3C4O A;  3T4Q A;  4CLC B;  2XA7 M;  1JNU A;  4CLC D;  4DE1 A;  4X53 A;  1NJ4 A;  3CUE A;  4N1H A;  3JPU A;  2G2U A;  4FUW A;  4PAU A;  4BD1 A;  4WUJ A;  3IBJ A;  2Z6C A;  2QHK A;  3LY3 A;  4HY8 A;  5EOO A;  1HZO A;  3MFD A;  3IS2 B;  3EEA A;  1XPB A;  3S4X A;  2MJ6 A;  5DJT A;  2M7U A;  2WAF A;  3Q7Z A;  3M2K A;  5CGS A;  2Y2K A;  4ZBE A;  3B3X A;  3HRE A;  1T18 A;  4OOM A;  5CEC A;  3T1X A;  2V2F F;  4BBU A;  5CEB A;  2OWJ A;  4E6W A;  1XP4 A;  3OC2 A;  3KYZ A;  1VET A;  2ZQ8 A;  1OT6 A;  1K56 A;  5FQJ A;  3DTM A;  3UB6 A;  3LUQ A;  4DN0 A;  1XKZ A;  4HH3 A;  1ZTU A;  2KX6 A;  2LB9 A;  1K6S A;  1L3L A;  4L0L A;  1FIL A;  5GL9 A;  4PM6 A;  4BL2 A;  4OON A;  1SHV A;  2W1R A;  2XK1 A;  1K6R A;  3IT9 A;  3QP6 A;  2B02 A;  4BMW A;  1LI9 A;  5DJU A;  5M1A A;  5EVL A;  1HVB A;  1Q2Q A;  4E6X A;  3UE3 A;  4PKY G;  5EM0 A;  3BFD A;  3G31 A;  1XJ4 A;  1OME A;  3ZG5 A;  4DDS A;  3MQ0 A;  3VSK A;  2O9B A;  1F9I A;  5E2H A;  3N7W A;  1STZ A;  1X0O A;  1IYO A;  1YMX A;  4I3I A;  3NJA A;  3VP4 A;  5KMW A;  3BQA A;  4F3L B;  4GLQ A;  3GMW A;  1S4R A;  1VEU A;  4QWO A;  3OPH A;  1CJF A;  2WK0 A;  2VGK A;  1VQQ A;  1KDW A;  3HJI A;  3RXX A;  3N8R A;  2PDR A;  1TD5 A;  2FFF B;  2QWS A;  2J9P A;  1IKI A;  4KQO A;  2C6W B;  4HBU A;  4MN7 A;  3T4K A;  1OTB A;  3VV4 A;  1O07 A;  3DTI A;  4HJ6 A;  2FZ0 A;  2OV5 A;  2Y55 A;  5FSR A;  1IKG A;  4PM7 A;  3LIB A;  4WZ5 C;  3MR0 A;  3GR2 A;  4LRZ E;  3NOT C;  4X69 A;  3A0R A;  5EVI B;  5IHV A;  1YSP A;  3PBR A;  5KSH A;  5EVI D;  3NBL A;  1XJ6 A;  3IX4 A;  4HES A;  4KQQ A;  4LV3 A;  3MZD A;  4R1G A;  1FQG A;  2W3G A;  2Y2M A;  4WM9 A;  4JXG A;  5EE8 A;  5HX9 A;  2ZQ7 A;  5A92 A;  2PBD P;  1K54 A;  3ITB A;  5FAO A;  1EW0 A;  3O86 A;  1K56 D;  3H9W A;  4KZ9 A;  1J3W A;  1H8Y A;  2L1M A;  3C7U A;  1CEF A;  1XJ2 A;  3KSI A;  3IXG A;  3UMD A;  1XJ3 A;  3T4O A;  4LCL A;  3PBQ A;  2I9V A;  3T50 A;  1UWP X;  5CGX A;  4Q8I A;  1ESU A;  2J3T D;  1TS7 A;  4Y15 A;  2ZC5 B;  2G2W A;  1I2S A;  1S66 L;  1YLT A;  3H82 A;  4MBH A;  2PYP A;  5J4E A;  2P08 A;  4OKP A;  3NEC A;  5DFY A;  4YOF A;  2H0Y A;  4GHI A;  5L07 A;  4UQI S;  3SS3 A;  3CPT B;  3AGF A;  4FD8 A;  4HH2 A;  4NKP A;  4X55 A;  3T1Q B;  3IH8 A;  4C75 A;  4LRX C;  3IQA A;  3KYE A;  2X01 A;  3DW0 A;  3H7W A;  1P0Z A;  3HJK A;  5DKK A;  4RYE A;  4LFU A;  2KOI A;  2XD1 A;  1VM1 A;  4EEP A;  3A3F A;  1HD8 A;  2JKG A;  4YWZ A;  4E3M A;  1L0G A;  1UGU A;  2JKR M;  3NHQ A;  1IFQ A;  4GKU A;  2PU2 A;  3B47 A;  2P9V A;  4B4X A;  2H10 A;  2PYR A;  4QU3 A;  1F98 A;  4U0T A;  1J9M A;  4D60 A;  3A3D A;  2FH5 A;  1JWP A;  3HLW A;  4L9G A;  2RL3 A;  5EPH A;  1KE3 A;  4O0P A;  5FQ9 A;  3LCE A;  4HBT A;  4MBF A;  3WS5 A;  2Z6D A;  3MKE A;  2R9X A;  3UNW A;  3P09 A;  3E4P A;  4BBV A;  4RX2 A;  2EX9 A;  3PBT A;  3BY9 A;  3Q82 A;  4KG5 A;  3ZFZ A;  1O7E A;  3K3D A;  4OLG A;  3MMH A;  5J8X A;  3S7O A;  3JVU A;  5HZH A;  2WGI A;  3K2N A;  3S22 A;  5M19 A;  4UQI M;  3TRC A;  4QY5 A;  4NG2 A;  2W0N A;  4NET A;  1VB6 A;  1RGZ A;  3F1N A;  2YKH A;  4DMZ A;  4QY6 A;  3LR4 A;  4MBK A;  4QJG A;  1Y54 A;  2Y4A A;  1C3B A;  5HWV A;  3W2Z A;  3SS5 A;  2EFX A;  1CQA A;  1PWC A;  1NYM A;  5F1G A;  5L09 A;  4JGR A;  3MFX A;  1W7F A;  3WRZ A;  2ZM2 A; 
#chains in the Genus database with same CATH homology
 3VFF A;  3WS4 A;  1ZKJ A;  4FSF A;  2E8I A;  2WGV A;  3N8S A;  4WZ5 A;  1LI0 A;  3I7J A;  1NY0 A;  4RX3 A;  4ZTK A;  3UO9 A;  3VOZ A;  1FCO A;  5CER A;  4GDB A;  3SOI A;  1K54 C;  2QPN A;  4B4Z A;  2WKH A;  2EX8 A;  3N8L A;  4N1X A;  4CPK A;  3VP0 A;  4E3N A;  4BEN A;  5DF9 A;  3V3S A;  5GHX A;  2OSU A;  3UPN A;  3ZG8 B;  1ES5 A;  1ERO A;  3SH9 A;  1E4D A;  3FKV A;  3IF6 C;  1BSG A;  2EX2 A;  2XLN A;  4MEZ A;  4DXC A;  1Q2P A;  1PYY A;  1W8Y A;  1Z6F A;  2HDR A;  5BOH A;  1HTZ A;  2Y2O A;  3VP1 A;  3BFE A;  4R4S A;  3DWZ A;  2EXB A;  3SH8 A;  5CTM A;  1K57 A;  3BYD A;  4KEN B;  4GD8 A;  4JBF A;  3UN7 A;  4WZ4 A;  1QMF A;  3G35 A;  4Z9Q A;  4GB7 A;  3C4O A;  5DTS A;  4B88 A;  2GDN A;  5F83 A;  1MWT A;  1XXM A;  1FR1 A;  2V1Z A;  5TFQ A;  5F82 A;  4PPR A;  4K91 A;  2HDU A;  1XX2 A;  4MNR A;  4DE1 A;  3BRM A;  4X53 A;  4JF5 A;  1YM1 A;  1YLW A;  5A90 A;  2XDM A;  1NJ4 A;  1MXO A;  1ONH A;  2H5S A;  4N1H A;  4NK3 A;  4JXS A;  3ZG7 B;  5HW3 A;  2Z2M B;  1IEL A;  4KG2 A;  1ERM A;  2G2U A;  4DRT A;  4BD1 A;  3Q81 A;  4RVA A;  3FWL A;  3RXW A;  2HDS A;  4DE0 A;  5HAR A;  4YIN A;  1YLY A;  1BUE A;  2Y2G A;  4UA6 A;  3BLM A;  3IHB A;  1N4O A;  4F94 A;  2C5W B;  4S2K A;  5GLC A;  3VOY A;  5EOE A;  1M40 A;  3CMZ A;  4OOY A;  2WZX A;  1TDL A;  3ISG A;  3LY3 A;  1DJC A;  3WRT A;  3C7V A;  2Q9N A;  5FQK A;  4C3Q A;  3RJU A;  2QZ6 A;  5HAP A;  5A93 A;  5EOO A;  2ZC7 A;  1HZO A;  3MFD A;  4S2L A;  3G4P A;  1MKI A;  4S2I A;  1XA1 A;  1XPB A;  2ZC6 B;  2V20 A;  2Y2Q A;  3IXD A;  3M2J A;  1NXY A;  2ZQD A;  5GLA A;  1PWG A;  1SCW A;  3GSG A;  3S4X A;  5M18 A;  5E2G A;  5CTN A;  1BZA A;  2WAF A;  3Q7Z A;  4BD0 A;  3M2K A;  5CGS A;  3IF6 B;  1ES2 A;  1DY6 A;  2A3U A;  2Y2K A;  3C4P A;  4ZBE A;  2BG1 A;  1LL9 A;  3B3X A;  3QHY A;  4LV1 A;  3HRE A;  4OOM A;  4OPY A;  4R0Q A;  5CEC A;  2XR0 A;  5HAQ A;  3HLF A;  2V2F F;  5CEB A;  1LLB A;  4P6B A;  2IWC A;  2DCF A;  4E6W A;  3W8K A;  1QME A;  5CHM A;  5FA7 A;  1XP4 A;  1ALQ A;  3OC2 A;  4U3T A;  5L2F A;  3QNC A;  3LEZ A;  5CHJ A;  3E2K A;  2ZQ8 A;  5FQQ A;  4JLF A;  3TSG A;  1FR6 A;  1K56 A;  1BUL A;  5FQJ A;  3DTM A;  2HPB A;  5FQM A;  2Y2P A;  2Y59 A;  4OLD A;  5E2F A;  1XKZ A;  2PU4 A;  3NIA A;  3HLE A;  2ZD8 A;  3GVB A;  3UDF A;  4IED A;  3BFC A;  3Q7V A;  1K6S A;  4FCF A;  5FAT A;  1XGI A;  4E3I A;  3N6I A;  4LV2 A;  5FI2 A;  4DE3 A;  5I94 A;  4L0L A;  5DVA A;  5GL9 A;  2IWB A;  4OPZ A;  1JTG A;  3M6H A;  4PM6 A;  1PZP A;  5GLB A;  1U60 A;  3SS4 A;  4OON A;  3UE1 A;  1L0D A;  4BL2 A;  1SHV A;  1E25 A;  1JWZ A;  2UWX A;  3D4F A;  2XK1 A;  3FYZ A;  1K6R A;  4M3K A;  1KVM A;  4GD6 A;  5GHZ A;  3IT9 A;  3MXR A;  2HP5 A;  3C5A A;  3ZDJ A;  1YLJ A;  1W79 A;  1LI9 A;  1G6A A;  4CJN A;  3OCL A;  1JWV A;  4X6T A;  3FV7 A;  5M1A A;  3IWQ A;  1K38 A;  5EVL A;  1HVB A;  3JYI A;  1Q2Q A;  5CHU A;  4E6X A;  4E3L A;  3UE3 A;  5EVI C;  1MWU A;  3BFD A;  4GOG A;  1M6K A;  4OOL A;  2ZQC A;  2WGW B;  3G31 A;  4H8R A;  5A91 A;  1OME A;  2PBY A;  2Y2L A;  3CZD A;  3EQU A;  2Y91 A;  2I72 A;  4IVI A;  4K0W A;  3ZG5 A;  4DDS A;  3VSK A;  3Q1F A;  4WMC D;  3FZC A;  1NRF A;  5E2H A;  3N7W A;  1FSW A;  1DJB A;  1BLH A;  4HEF A;  4ID4 A;  4JF6 A;  1IYO A;  4KQR A;  4XUX A;  3ZVW A;  1KGG A;  1JVJ A;  1LL5 A;  1YMX A;  4Y0T A;  4BQM A;  3VP4 A;  5KMW A;  3GMW A;  3GTC A;  3ZG0 A;  3IF5 A;  3OPH A;  4JPM A;  3O88 A;  4OQI A;  5FAS A;  3WS0 A;  2WGW A;  2WK0 A;  3UDI A;  3NI9 A;  5CED A;  2VGK A;  1VQQ A;  1S0W A;  1KDW A;  1BLC A;  2XD5 A;  3RXX A;  1DJA A;  3N8R A;  2RCX A;  1GHM A;  2WUQ A;  2FFF B;  5FI6 A;  5HAI A;  4R23 A;  4WYY A;  4S2N C;  2HDQ A;  4C6Y A;  4UAA A;  3MZF A;  2J9P A;  1IKI A;  2ZQ9 A;  5JYP A;  1YLP A;  4KQO A;  2C6W B;  4HBU A;  3NDG A;  5FI7 A;  3IXB A;  1PIO A;  2WAE A;  4P85 A;  1O07 A;  4WEL A;  2OV5 A;  4OP8 A;  1RCJ A;  2JE5 A;  2Y55 A;  3GRJ A;  5DTK A;  1IKG A;  1TEM A;  5FSR A;  4PM7 A;  3NC8 A;  4WZ5 C;  1FCN A;  3GR2 A;  4U0X A;  4S2J A;  4E3O A;  3G2Z A;  4LCM A;  1G68 A;  2QMI A;  4OP5 A;  4UA9 A;  4X69 A;  3PTE A;  3UY6 A;  5GLD A;  3P98 A;  4IBX A;  4OQG A;  5EVI B;  5IHV A;  4GNU A;  3PBR A;  2JBF A;  1KDS A;  2XEP A;  1EI5 A;  3WWX A;  5KSH A;  3N4I A;  5EVI D;  2ZLY A;  1K55 A;  3NBL A;  4Y0O A;  1MY8 A;  4HES A;  3HLD A;  2JC7 A;  4MLL A;  5AQB A;  4XUZ A;  4KQQ A;  2Y2J A;  3BEC A;  4LV3 A;  4GDN A;  3MZD A;  2X02 A;  4EUZ A;  4A5R A;  4R1G A;  1K57 C;  1FQG A;  1RGY A;  3VMA A;  2Y2M A;  4JKT A;  4WM9 A;  4JXG A;  3G30 A;  5EE8 A;  4EQI A;  1L2S A;  5HX9 A;  2ZQ7 A;  1BLP A;  5A92 A;  2ZM8 A;  3HLG A;  5F1F A;  1K54 A;  1CEG A;  2P74 A;  1PI5 A;  1AXB A;  3ITB A;  2JCH A;  2EXA A;  2WYX A;  5FAO A;  4GZB A;  3O86 A;  3PBO A;  4FH4 A;  3BEB A;  1K56 D;  4KZ9 A;  4OH0 A;  4R4R A;  3AGD A;  1CI8 A;  4S2P A;  3G34 A;  3NCK A;  3IF6 A;  3W4O A;  4Y0U A;  3OPL A;  4EBL A;  1H8Y A;  1JTD A;  3C7U A;  1CEF A;  2H0T A;  3BLS A;  4KZ4 A;  1PW1 A;  2DNS A;  2Y2N A;  3CG5 A;  3IXG A;  1BT5 A;  1I2W A;  3MXS A;  4OVD A;  1RP5 A;  4KZ7 A;  4LCL A;  4P87 A;  3TOI A;  3PBQ A;  3HBR A;  3MBZ A;  5CXW A;  1IYS A;  3BFG A;  4O7D A;  3O87 A;  2Y2I A;  1H5X A;  5E43 A;  4JXV A;  1PI4 A;  1E3U D;  4BLM A;  1L0E A;  5CGX A;  1KGE A;  5KZH A;  4BL3 A;  3V50 A;  1ESU A;  3FKW A;  4Q8I A;  3IWO A;  2J7V A;  3HUN A;  3VP2 A;  4DKI A;  1YMS A;  3GV9 A;  3IH9 A;  5TGF A;  3ZVT A;  1KGF A;  2ZC5 B;  3HVF A;  4XXR A;  4OPQ A;  2G2W A;  1MWR A;  1I2S A;  5E2E A;  4S2O A;  3S1Y A;  1YLT A;  3TG9 A;  4EWF A;  2XQZ A;  2B5R A;  4MBH A;  1KE4 A;  2X71 A;  1XGJ A;  4IBR A;  1H8Z A;  4IVK A;  1S6R A;  2WZZ A;  5AQ9 A;  4OKP A;  3MZE A;  4X56 A;  3IXH A;  1YT4 A;  1FSY A;  2H0Y A;  1ZG6 A;  4DXB A;  1CK3 A;  3CJM A;  4UHU A;  2ZC3 B;  3HLC A;  3A3J A;  3SS3 A;  3AGF A;  2Y2H A;  4FD8 A;  4BJP A;  4X55 A;  3HUM A;  4N9L A;  3IH8 A;  4C75 A;  3E2L A;  1SKF A;  3W4P A;  4S2M A;  3IQA A;  3IHA A;  4QHC A;  3LO7 A;  5JYO A;  3AGE A;  2X01 A;  5G18 A;  4PM5 A;  2XF3 A;  1EWZ A;  1L0F A;  3ZCZ A;  3DW0 A;  4ZJ1 A;  3ZG9 B;  2P9V B;  4X68 A;  4KZ6 A;  5AQA A;  4KZB A;  2XH9 A;  2HP6 A;  4PMA A;  4WMC A;  5TR7 A;  4R3B A;  1SDE A;  4RYE A;  5HL1 A;  3G32 A;  2XFS A;  1FOF A;  2OLV A;  4D2O A;  3OPR A;  3OZH A;  3PBN A;  4WBG A;  2XD1 A;  1VM1 A;  4OPR A;  2ZQA A;  4LEN A;  1WE4 A;  3A3F A;  3NDE A;  1HD8 A;  1TVF A;  5FAQ A;  4E3M A;  4KZ5 A;  4JF4 A;  1L0G A;  3A3E A;  5D3O A;  1GHP A;  1ERQ A;  3O3V A;  3OCN A;  4GKU A;  3PAG A;  2PU2 A;  3HL9 A;  3UPO A;  2P9V A;  1ZG4 A;  4B4X A;  4EV4 A;  2H10 A;  1BTL A;  2J8Y A;  4PM8 A;  4ZAM A;  1MWS A;  3UPP A;  3ZHH A;  3G2Y A;  4QU3 A;  4U0T A;  1YQS A;  1J9M A;  1W5D A;  1PZO A;  3A3D A;  3LY4 A;  5FQI A;  4LV0 A;  3ITA A;  1JWP A;  1MBL A;  3HLW A;  4KZA A;  4WEK A;  5AQ7 A;  2RL3 A;  4YFM A;  2OLU A;  5EPH A;  4DF6 A;  1ES3 A;  2Z2L B;  1KE0 A;  1KE3 A;  2WAD A;  3M6B A;  4WEJ A;  3VP3 A;  2VGJ A;  2DRW A;  1GHI A;  1WYC A;  5EUA A;  5FQ9 A;  1MPL A;  2XFT A;  3LCE A;  4N9K A;  5GHY A;  1IEM A;  4HBT A;  3ZNY A;  5HFO A;  1ZC2 A;  4MBF A;  5DF8 A;  4KZ3 A;  3WS5 A;  3HUO A;  4E3K A;  4FH2 A;  1K4F A;  3MKE A;  2R9X A;  3UNW A;  5DTT A;  3P09 A;  4DDY A;  4QD4 A;  1XA7 A;  1K25 A;  4EBP A;  4RX2 A;  2EX9 A;  3PBT A;  1CI9 A;  1PWD A;  1KVL A;  3Q82 A;  4OQ0 A;  5EVI A;  4KG5 A;  4R3J A;  3ZFZ A;  2A49 A;  2Q9M A;  5FDH A;  1O7E A;  1WYB A;  4GN2 A;  4P0M A;  4OLG A;  3A3I A;  3OPP A;  4N92 A;  3IWI A;  3VSL A;  5J8X A;  3Q7V B;  3Q07 A;  2R9W A;  2ZJ9 A;  2ZM0 A;  3WS1 A;  2EX6 A;  3ZNT A;  2WGI A;  3W4Q A;  3S22 A;  2ZC4 B;  2CC1 A;  1NYY A;  3WS2 A;  3V5M A;  5M19 A;  1N9B A;  1NZO A;  4OQH A;  1GA0 A;  3BFF A;  4ZDX A;  4QY5 A;  3UDX A;  3MKF A;  1K4E A;  4NET A;  4K0X A;  1RGZ A;  4DE2 A;  1ES4 A;  2XGN A;  3QNB A;  5DF7 A;  5U47 A;  5EEC A;  1FCM A;  4E3J A;  3ZGA B;  4ZJ2 A;  4QY6 A;  1TDG A;  2WKE A;  4MBK A;  4PM9 A;  1I5Q A;  5CGW A;  4QJG A;  1IYQ A;  1ONG A;  2HP9 A;  1Y54 A;  3V3R A;  1NZU A;  1ESI A;  1SDN A;  2BLS A;  2Y4A A;  4ZJ3 A;  2EFU A;  4KZ8 A;  5CRF A;  4QB8 A;  1C3B A;  5FAP A;  3PBS A;  4KG6 A;  1W8Q A;  2ZMA A;  3HLB A;  4EBN A;  1GA9 A;  1K55 C;  1PW8 A;  4S2N A;  2IWD A;  1IYP A;  1LHY A;  2EFX A;  3SS5 A;  3UE0 A;  3GQZ A;  3BM6 A;  3NY4 A;  2J9O A;  1E3U A;  1PWC A;  4UA7 A;  4Y7P A;  1W7F A;  4JXW A;  5KSC A;  3PAE A;  2WKI A;  3SH7 A;  1NYM A;  3EQV A;  5F1G A;  3VFH A;  3V39 A;  2FFY A;  3DWK A;  1YLZ A;  4RA7 A;  1GCE A;  3WRZ A;  2ZM2 A;  1BLS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...