1HTZA

Crystal structure of tem52 beta-lactamase
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
263
structure length
263
Chain Sequence
HPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVKYSPVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRWEPELNEAIPNDERDTTTPAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGASERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA-LACTAMASE MUTANT TEM52
publication title Predicting the emergence of antibiotic resistance by directed evolution and structural analysis.
pubmed doi rcsb
source organism Klebsiella pneumoniae
molecule tags Hydrolase
total genus 91
structure length 263
sequence length 263
chains with identical sequence B, C, D, E, F
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2001-01-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 1htzA00
2DRWA 1IELA 4KZ4A 3ITAA 5E2HA 2P9VA 4KG6A 2ZMAA 4BLMA 3C4OA 4ZDXA 2IWCA 3PTEA 1MPLA 1K55A 3DWZA 4UA7A 3VMAA 4KZ7A 2XFSA 3ZG5A 4E6XA 4JXWA 3ZFZA 3M6BA 4C75A 5CHMA 1N9BA 1I5QA 3CG5A 1K56A 3N8LA 4F94A 1RP5A 3UE3A 3B3XA 5F1GA 3UPNA 4PM6A 2EXBA 4B4XA 1WYBA 5CECA 5HARA 1SDNA 2Y2KA 1HTZA 4FCFA 3UPOA 4DKIA 3PBQA 3S4XA 4DE3A 4LV2A 2HP9A 1JWVA 2Y2QA 3TSGA 3BFFA 5FATA 1K38A 3AGFA 1MWSA 1ERQA 3V39A 4LV1A 2WKIA 1ALQA 4MBFA 1SKFA 3MXRA 3WRTA 2Q9MA 4IBRA 2R9XA 3IWQA 1KGGA 4X55A 4JF6A 2ZQ8A 2QZ6A 3FZCA 4PPRA 3RXWA 4GNUA 3V5MA 3IF6B 4HBUA 4E3MA 3ZHHA 3WS1A 5HW3A 2XF3A 3OPPA 3ITBA 4OLGA 3UO9A 5EOEA 1MXOA 3VFFA 4UA9A 3ZG9B 4RVAA 3HLFA 4X53A 4A5RA 3IWIA 3Q1FA 3UY6A 3HBRA 5FQJA 2DNSA 4BD0A 5TR7A 4KQOA 4WM9A 4Y7PA 2WADA 2Y2NA 1XX2A 2Q9NA 4E3JA 2IWDA 2V20A 2WAEA 4GZBA 4ZJ1A 1YM1A 3C7VA 4X6TA 4OP8A 3TOIA 4BENA 1I2SA 4C3QA 4GD8A 1NZUA 3C7UA 3M2KA 1YLWA 5E2FA 2Y2MA 4RX3A 4HEFA 4FSFA 1MY8A 4LCLA 1E25A 2H0YA 3VP4A 4DXCA 3FYZA 4C6YA 1NZOA 3GTCA 5A91A 3MZEA 1L2SA 1LI0A 3Q7VB 4NETA 1SDEA 1ESUA 4JPMA 4QD4A 4D2OA 5CHJA 2C6WB 1K6RA 5HFOA 5FAPA 4S2JA 1BUEA 5GLDA 1FCMA 3QNBA 1CI9A 4KZ8A 4RX2A 4CPKA 1BLSA 1CI8A 5FQ9A 4Y0TA 4JBFA 1W79A 3VP0A 3HUNA 3OCNA 3V3RA 4B4ZA 3OC2A 1CK3A 1ES5A 3BM6A 1PWDA 4E3LA 2Z2LB 3G30A 4Q8IA 4S2PA 3WS2A 3ZDJA 4OOLA 1DJCA 4JXVA 5CTNA 1YMXA 4WELA 3W4OA 2J9OA 2OSUA 4ZBEA 3CJMA 4GDNA 3VSLA 4GD6A 4HBTA 1XGIA 4U0TA 4MNRA 1RGYA 3NBLA 4WEJA 1K6SA 2X02A 3TG9A 2HDUA 1IKIA 2EXAA 1PW1A 5L2FA 3SH7A 3BLSA 4R0QA 4U3TA 4UHUA 3S1YA 4E3KA 5M18A 2J7VA 4R4SA 3OPLA 3QNCA 2WGWB 2PBYA 1LI9A 3P09A 4PMAA 2WKEA 4EQIA 5M19A 1K54A 2H5SA 1FSWA 4DRTA 1IKGA 3A3IA 2X01A 1K55C 3SS4A 3NI9A 3DW0A 3IWOA 1NY0A 1S0WA 5CRFA 3RJUA 1K4FA 3NIAA 1LL9A 1KE3A 2CC1A 4NK3A 5CXWA 4EWFA 1GHMA 3MZDA 3VSKA 1GHPA 5BOHA 4QU3A 5G18A 3SS5A 5A90A 5KMWA 2I72A 3NDEA 4WYYA 5FDHA 1NYMA 1K57A 2ZC7A 2HDSA 3PBOA 2G2UA 5D3OA 5IHVA 1KGFA 4S2MA 3Q7ZA 5F82A 3WS4A 4BL2A 3BLMA 2PU2A 3IQAA 4WBGA 3IF6A 2G2WA 5EE8A 4WZ4A 3VP1A 3WWXA 1KE4A 1QMFA 4N92A 1IYOA 1E3UD 4QY5A 4S2LA 3BRMA 1XKZA 4FD8A 1GA0A 3NDGA 2X71A 3VOYA 4OKPA 3BYDA 3GMWA 1L0GA 5HAQA 3N7WA 4OLDA 2XK1A 1FQGA 4IBXA 4OPQA 3IH9A 3ISGA 2WZZA 2EFUA 4PM7A 1CEGA 4IEDA 3PBTA 5DTSA 3VOZA 1K25A 3NC8A 3RXXA 4ZTKA 4JKTA 2HDQA 2IWBA 4E3OA 4JLFA 3M2JA 4KZBA 4MEZA 2EFXA 5A93A 1BTLA 5DTTA 4DDSA 3OCLA 2A49A 2WGVA 3FWLA 3HLCA 5U47A 3ZVWA 2BLSA 3G35A 3E2KA 1BLHA 3Q7VA 5KSCA 1PWCA 3IHBA 4X56A 1JWZA 5E43A 2ZM8A 5GHXA 1W7FA 2Y2GA 4OONA 3OZHA 2R9WA 1Z6FA 5EOOA 5AQAA 3V50A 3P98A 2ZQ7A 4KZ5A 2XLNA 3G31A 5FQIA 1Y54A 1DY6A 1KVLA 1EWZA 1JTDA 2Z2MB 3G34A 2XD1A 3C5AA 1O07A 1MWUA 3N8SA 4OVDA 4UA6A 1XPBA 1M6KA 2HPBA 4DE1A 4S2NA 5I94A 1H5XA 2J8YA 2JCHA 4WZ5A 1BLPA 5FI2A 1DJBA 1TDGA 3D4FA 2XFTA 5GHZA 3HREA 1BULA 3GRJA 3HL9A 1RCJA 1WE4A 2EX9A 1XA7A 4OQIA 1ES4A 3ZG0A 3HLDA 5GLCA 1C3BA 1VM1A 1NRFA 1HD8A 5FQQA 3SH9A 1JWPA 2XH9A 3PBRA 4EBPA 1ERMA 3CMZA 5AQ9A 4KG5A 4JXGA 1ESIA 1H8YA 4N1XA 1ZG6A 4H8RA 1I2WA 1ZKJA 1IYSA 2XGNA 4XUZA 4DE2A 2ZD8A 4PM5A 4R4RA 4OP5A 5FI7A 3IXDA 4U0XA 2XEPA 4IVIA 5E2EA 3ZCZA 4DXBA 5EVLA 4EV4A 3ZNYA 1KVMA 2WGWA 5GLBA 5DF8A 4LCMA 3ZG7B 1FOFA 1N4OA 4FH4A 4N9KA 2WGIA 1SCWA 1EROA 1H8ZA 4DDYA 5KZHA 3ZNTA 1W5DA 1YLZA 3GSGA 1MWRA 3GVBA 1HZOA 2E8IA 5TFQA 4BJPA 2WYXA 5JYPA 1M40A 1ES3A 2HP6A 4JF4A 2Y4AA 1K54C 1Q2QA 2Y2JA 5FQKA 1AXBA 1J9MA 2UWXA 4ZJ2A 3JYIA 3I7JA 5DTKA 3UDXA 2VGJA 3N6IA 3E2LA 3IH8A 3IXBA 3N4IA 3SH8A 3UE1A 4JXSA 5FQMA 4Z9QA 2Y2OA 3HLGA 5EVIA 2OLUA 4L0LA 4O7DA 4R3BA 4R23A 4XUXA 3AGEA 1K57C 1ES2A 4OQ0A 1S6RA 4K0WA 5EVID 3HLWA 3UDFA 4DE0A 4LV3A 4K0XA 3O86A 4MLLA 2ZM2A 4OQGA 5GL9A 3IF6C 4OH0A 5EECA 2XQZA 4EUZA 3WS0A 1E3UA 5HAPA 4WMCA 5FAOA 1XXMA 2JC7A 5EVIB 1FSYA 1GCEA 1L0EA 3LY4A 5GHYA 1BT5A 5HAIA 3UDIA 4K91A 4WEKA 1IEMA 4DF6A 2JBFA 4OPZA 3MBZA 1L0DA 4WMCD 2ZC5B 2WZXA 1E4DA 1O7EA 3FKWA 1G6AA 2C5WB 3MKEA 3ZG8B 1FCOA 1RGZA 3MFDA 1W8YA 3UNWA 2OV5A 5CEDA 4X69A 4GOGA 4JF5A 4EBLA 3ZGAB 4BQMA 3M6HA 1FCNA 2VGKA 2Y2PA 2OLVA 5DF7A 1TEMA 1ZG4A 3A3DA 3BEBA 2P9VB 1YQSA 1MBLA 3GQZA 4GKUA 1K56D 2XDMA 1BSGA 5DF9A 3OPHA 1KDWA 3Q07A 4GDBA 4KQQA 2ZJ9A 2Y2IA 1FR6A 3GR2A 5CTMA 4YFMA 5FI6A 4MBHA 3HVFA 3Q82A 1U60A 3W4QA 5HX9A 5FASA 2V2FF 1YLPA 4UAAA 3BFCA 3BFEA 3UN7A 1JVJA 4ZJ3A 4R3JA 4OQHA 4LENA 2QPNA 3DWKA 4M3KA 4QY6A 1BZAA 4BL3A 2ZC6B 4PM8A 1TDLA 4YINA 1NXYA 1PI5A 3EQUA 3LCEA 4Y0UA 3PAGA 3QHYA 2A3UA 3Q81A 5J8XA 1NYYA 2B5RA 2EX8A 4KZ9A 5E2GA 4CJNA 5M1AA 5EPHA 4S2NC 3G2YA 1KE0A 4PM9A 5CEBA 1YLJA 4P0MA 3UPPA 4WZ5C 4LV0A 3A3EA 4N1HA 5AQ7A 3AGDA 5CHUA 4KENB 4KQRA 1LLBA 2WUQA 1XGJA 3DTMA 4Y0OA 3A3FA 4P85A 3V3SA 3LEZA 1PI4A 2V1ZA 3MZFA 4OOYA 4OPRA 2HP5A 1MWTA 1XP4A 2WK0A 3A3JA 2Y2LA 4E3NA 1LL5A 2Y59A 3SS3A 1MKIA 4S2OA 1KDSA 3W8KA 1JTGA 1YT4A 3NY4A 2ZM0A 1PWGA 3BECA 5CGWA 5FA7A 2XD5A 1IYPA 3SOIA 3C4PA 3G32A 3MXSA 1NJ4A 2P74A 3IXGA 4GN2A 3WS5A 1PYYA 4RYEA 1BLCA 1ZC2A 4KZ3A 2BG1A 1L0FA 2WKHA 1HVBA 2ZC3B 3FV7A 1EI5A 3W4PA 3O87A 1CEFA 3HLBA 2RCXA 2H0TA 3BFDA 5EUAA 3GV9A 4QJGA 1YLTA 4FH2A 4MBKA 1PZPA 2ZQCA 2Y91A 4P6BA 3IF5A 4P87A 3IT9A 4X68A 2XR0A 1W8QA 2FFYA 5KSHA 1YLYA 1PZOA 1QMEA 5AQBA 4XXRA 3S22A 3IXHA 4B88A 4RA7A 3UE0A 1VQQA 5DVAA 3VFHA 5CGXA 5CGSA 2GDNA 3IHAA 1Q2PA 3OPRA 3PBNA 1DJAA 3PBSA 4S2IA 4ZAMA 3PAEA 5TGFA 4KZAA 4QB8A 3VP2A 1K4EA 5F83A 3G4PA 4BD1A 1PW8A 1KGEA 3NCKA 2ZQ9A 5F1FA 1PIOA 1ONHA 2Y55A 5GLAA 4E6WA 3FKVA 1TVFA 2PU4A 3HLEA 1FR1A 1WYCA 4QHCA 1LHYA 1XA1A 1G68A 3EQVA 3LY3A 2ZLYA 3BFGA 5EVIC 4IVKA 4OOMA 1GA9A 4S2KA 3N8RA 4OPYA 5JYOA 2ZQAA 2HDRA 4KZ6A 4R1GA 3LO7A 4ID4A 3ZVTA 4EBNA 2QMIA 1GHIA 2H10A 2DCFA 5CERA 1YMSA 3CZDA 1SHVA 5FSRA 5A92A 5HL1A 2ZC4B 2RL3A 2Y2HA 2FFFB 1ONGA 2J9PA 2ZQDA 2EX2A 4KG2A 2EX6A 3O3VA 3MKFA 4N9LA 3G2ZA 4E3IA 3HUOA 4HESA 5FAQA 2WAFA 3VP3A 1OMEA 2JE5A 3O88A 1IYQA 4GB7A 3WRZA 3HUMA
chains in the Genus database with same CATH superfamily
5E2HA 4KG6A 2ZMAA 2B95A 3IBJA 1MKMA 3FC7A 1K55A 5L09A 4E6XA 3UB8A 3ZFZA 3LIAA 3F1NA 4YWZA 3M6BA 4C75A 1K56A 3N8LA 3UE3A 4I38A 5F1GA 3UPNA 3HJKA 1V9ZA 1SDNA 3UPOA 3PBQA 3E4QA 1JWVA 2VV6A 1K38A 1MWSA 2WKIA 1ALQA 1SKFA 2Q9MA 4JF6A 4R70A 3T4KA 4PPRA 2NUTC 5J3WA 3V5MA 3FPVA 4HBUA 4WLAA 3MJQA 1MXOA 3VFFA 3HLFA 3HBRA 4O0PA 5FQJA 3B42A 2WADA 2Y2NA 3GECA 1DP8A 2KX6A 1W63Q 1OTDA 2V20A 5E2FA 1YLWA 2Y2MA 4RX3A 2HJ9C 4IUKA 4FSFA 1DP6A 1S66L 1E25A 3FYZA 1L2SA 1SDEA 1G28A 2VKSA 2Y8HA 3QNBA 5FQ9A 1OJ5A 2EWWA 4HJ6A 3OCNA 3OC2A 1Y28A 4E3LA 3S7NA 1DJCA 4JXVA 5F68A 2J9OA 4CQHA 1GSWA 5MC7A 3VSLA 3H9WA 3EWKA 4U0TA 1XGIA 4LLOB 3U4LP 2X02A 2ZL1A 4U3TA 4UHUA 5M18A 2J7VA 4DJ2A 5IU1A 4PMAA 4EQIA 1K54A 3SS4A 3P01A 1EW0A 1NLYA 5CRFA 4P6ZM 1K4FA 3QP2A 4HY8A 2CC1A 1OTBA 2Y79A 1GHPA 4I3JA 3VSKA 4NEED 2Q0OA 3SS5A 5KMWA 5FDHA 1NYMA 5D3OA 5IHVA 5F82A 3BLMA 3IQAA 4EW7A 2HGVA 1E3UD 3B33A 3BRMA 4BMWA 3NDGA 4WN5A 2OWHA 1L0GA 4NXFA 3G6OA 4OPQA 3IH9A 2EFUA 3UMDA 3BWLA 4ETZA 4ZTKA 1Z09A 2IWBA 5HDDA 5A93A 2W1TB 1BTLA 1YAXA 3NOPC 2WGVA 3HLCA 4H6JA 3T4SA 3IS2A 5KSCA 1PWCA 4F3LA 4IUHA 1JWZA 2ZM8A 5GHXA 2Y2GA 4OONA 1GSVA 4KZ5A 5FQIA 1KVLA 3T1XA 2Z2MB 4UA6A 3LUQA 1MWUA 1XPBA 3QP8A 1OTIA 1TDGA 3HREA 3GRJA 1RCJA 2EX9A 1ES4A 1F98A 1TS7A 3HLDA 5GLCA 5FQQA 4JXGA 4N1XA 3R7WA 4H8RA 3LEQA 4XUZA 2W1RA 4EV4A 2CMNA 1SKOB 5DF8A 4LCMA 3MR0A 4P6ZS 1SCWA 5L8MA 4HP9A 4DDYA 4B9OA 1F5MA 1YLZA 4BJPA 2HP6A 4JF4A 4DJ3A 1Q2QA 5F5YA 1AXBA 3KO6A 4ARZA 3I7JA 3R4KA 3NULA 4NG2A 2Y2OA 1OT6A 4L0LA 4R3BA 1ES2A 4K0WA 4DE0A 4EXOA 1LT0A 2QYBA 2ZM2A 4K08A 4MLLA 2XQZA 2QHKA 2XROA 1XXMA 1FSYA 3LY4A 2J3TC 1BT5A 4K91A 2O9BA 1OJGA 3P7NA 1L0DA 1E4DA 1W8YA 5TJJA 3LR0A 2OLVA 5DF7A 1ZG4A 1MBLA 2K31A 3GQZA 1K56D 4NXGA 1KDWA 1IOUA 3KSIA 4MN6A 4YFMA 1WA9A 2V0UA 3Q82A 2V2FF 3W2ZA 4LENA 3IX4A 4BL3A 4ME4A 5HSQA 1ZTUA 3EQUA 4CJNA 2L4RA 3PHYA 4S2NC 4PM9A 4WZ5C 4LV0A 3AGDA 3DTMA 3V3SA 3MZFA 4OPRA 2M1CA 2HP5A 1XP4A 4E3NA 1KDSA 1T18A 5FA7A 3NY4A 2XD5A 3SOIA 2JHEA 3MXSA 3WS5A 4RYEA 4EQ1A 4KZ3A 2HZ5A 2XA7M 3O87A 2H0TA 2QJ5A 2M7UA 1PZPA 2O9AA 1YLYA 5HPIA 2HF6A 3UE0A 1Q2PA 2O9CA 3PBSA 4QB8A 3CITA 3G4PA 2PYPA 5GLAA 2ZBBA 4E6WA 3L7HA 3FKVA 4QHCA 1CQAA 1G68A 4MN5A 3BFGA 3N8RA 4HH3A 4ID4A 1GHIA 3C8CA 2DCFA 5CERA 1YMSA 2I9VA 3CZDA 5A92A 2BASA 4X1MA 2V8FA 2EX2A 3HUOA 2KLIA 2WAFA 2JE5A 2W3FA 2ZL1B 3WRZA 2DRWA 4KZ4A 2W3HA 3C4OA 4ZDXA 2IWCA 2LB5A 3L9KA 4JGRA 4UA7A 3VMAA 4KZ7A 3QP1A 3ZG5A 4JXWA 3C2WA 5CHMA 4HH2A 3JPUA 4PM6A 1GSXA 1WYBA 3T50A 3S4XA 1XJ6A 3BFFA 3AGFA 2WKPA 1ERQA 1VEUA 2VLGA 4LV1A 4MBFA 2VEAA 3MXRA 1TF1A 4I3AA 2PRFA 3IWQA 3LI9A 4GNUA 3ZHHA 2WKRA 3UE6A 3WS1A 5HW3A 2XF3A 3OPPA 3UO9A 2ZMFA 3Q1FA 2DNSA 3T1RA 4WUJA 5TR7A 5HDCA 4WM9A 3BQAA 2XRNA 1XX2A 3SW1A 2IWDA 2XSSA 4GZBA 4ZJ1A 4OP8A 2ACGA 1I2SA 1NZUA 3M2KA 4KUOA 3SZTA 2VGLS 3UB6A 1MY8A 2H0YA 3VP4A 4IHQA 4RQ9A 2EWVA 3IS2B 3BY8A 3LYXA 4F3LB 1K6RA 3CHWP 5FAPA 4S2JA 1BUEA 2PT7A 3NJAA 5GLDA 1CI8A 4Y0TA 1W79A 3VP0A 3E4PA 4B4ZA 5HWVA 3F1OA 1CK3A 3CAXA 1PWDA 4MDZA 5LBRA 2Z2LB 3G30A 3WS2A 1TD5A 5EM0A 4OOLA 2OAQ1 5CTNA 1YMXA 4LRXC 3LIEA 4ZBEA 2NUPC 1VETB 4CLCE 2KDKA 4WEJA 1RGYA 1XJ4A 4MNRA 1XFNA 4Q0HA 3F1PA 3R7WB 1N9OA 2PHYA 1D06A 1LI9A 3P09A 2WKEA 5M19A 1DP9A 4JGQA 2X01A 3DW0A 1S0WA 3CLOA 1FIKA 5CXWA 5BOHA 4QU3A 4WYYA 4ARZB 2ZC7A 2HDSA 1KGFA 5L07A 3Q7ZA 2PU2A 4M4XA 2G2WA 4WZ4A 1T1CA 3LICA 4BWIA 1XKZA 4LRYC 3DTEA 2X71A 3B47A 4OKPA 3GMWA 5HAQA 4L9GA 1MZUA 2D02A 1FQGA 4I5SA 4IBXA 5K5BA 4X25A 4X1LA 4IEDA 1MC0A 3VOZA 4JKTA 4Q0IA 4MEZA 2EFXA 2GX5A 3LI8A 3FWLA 3CUEC 3CI6A 2BLSA 2W27A 3UB9A 3E2KA 3NOTC 3E0YA 4X56A 2PDRA 1XJ3A 1W7FA 3OZHA 3G31A 1Y54A 1DY6A 2E8JA 4OVDA 2HJEA 4S2NA 5I94A 2FH5A 2J8YA 4WZ5A 3T4QA 5DKLA 2P04A 2PR5A 1F2KA 1WE4A 4OQIA 1XA7A 1NRFA 1JWPA 3VV4A 1I2WA 3C30A 4PM5A 4OP5A 3ZCZA 2XEPA 4IVIA 4DXBA 5EVLA 1KVMA 2WGWA 5GLBA 1P0ZA 1N4OA 4HHDA 5KZHA 2E8IA 5TFQA 5JYPA 3NHQA 1P9RA 5HL6A 5DTKA 4GCZA 3UDXA 2VGJA 3MFXA 3SH8A 2GNXA 4JXSA 4Z9QA 1OPXA 3V67A 3HLGA 4R6LA 2VV7A 4O7DA 4GS9A 3KSGA 4OQ0A 1S6RA 5EVID 5IT5A 4LV3A 2W0NA 4BBUA 1YKDA 5GL9A 3IF6C 4WMCA 5FAOA 5EVIB 1GCEA 5GHYA 5HAIA 4DF6A 2JBFA 3MBZA 2WZXA 1O7EA 1V9YA 5DKKA 4X69A 1FCNA 2Y2PA 4FTXA 2R78A 3BEBA 1YQSA 4GKUA 2XDMA 3CPTA 1S4SA 4EEUA 4GDBA 4KQQA 2ZJ9A 3GR2A 4GHIB 4PAUA 5FASA 5DJTA 3BFCA 2ZOIA 3BFEA 1TS8A 4OQHA 4HOIA 2QPNA 4M3KA 3IBRA 2K7SA 4PM8A 3LCEA 1IFQA 4LRZE 4Y0UA 3QHYA 3K3DA 3G2YA 4ZRRA 1VEUB 1YLJA 5HDSA 1D1JA 4N1HA 1G6OA 5CHUA 4KQRA 1LLBA 1SZVA 4GLQA 5L10A 3A3FA 4PKYG 4WL9A 4OOYA 2WK0A 4MN7A 2V1BA 1MKIA 4EETB 1HLUP 2ZM0A 1PWGA 3G32A 3IXGA 3LIFA 4GN2A 2Z6CA 1BLCA 5AVFA 5HPFA 1HVBA 3ZYTA 3FG8A 1CEFA 2HV1A 2Y91A 4P6BA 3IT9A 1K0KA 3S7PA 1QMEA 5AQBA 4B88A 4RA7A 5DVAA 5KIZA 3EOIA 3IHAA 1DJAA 3DTIA 4ZAMA 3PAEA 1K4EA 2O0YA 4BD1A 1PW8A 1KGEA 3NCKA 2ZQ9A 1PIOA 4Y3IA 1TVFA 4YOFA 1FR1A 1LHYA 1XA1A 3EQVA 3LY3A 4HP4A 4IVKA 4OOMA 1GA9A 4S2KA 2HDRA 4Z1WA 3F1OB 3ZVTA 1UWNX 1STZA 1SHVA 5FSRA 5HL1A 2ZC4B 3QP6A 3S7OA 1PFLA 3O3VA 2IA2A 1JNUA 3T4LA 3VP3A 3A0SA 2GZAA 3MSHA 5CX7A 5AVEA 3T4OA 1S67L 1IELA 2P9VA 4BLMA 3K2NA 3PXPA 4CLCC 1I5QA 2O99A 1RP5A 3B3XA 4D60A 1P97A 4L9EA 4ETXA 4B4XA 5CECA 3EGXC 5FATA 3F1NB 4IBRA 2J3TD 2YKHA 2B18A 2QZ6A 3RXWA 4OLGA 4EESA 1YPRA 4UA9A 5J4EA 3EEAA 3ZG9B 4RVAA 4X53A 4A5RA 3IWIA 2JKRI 2QWSA 4Y5FA 4KQOA 1LSWA 2WAEA 3C7VA 4X6TA 3CUEA 4C3QA 3TOIA 4B93A 1NLZA 4KUKA 1LSXA 4BBTA 4DXCA 4C6YA 3GTCA 3MZEA 4G3VA 4JPMA 4D2OA 3QP4A 3CWFA 5DFXA 3EGDC 3PYPA 4KZ8A 1BLSA 3HUNA 4Q8IA 4S2PA 5DJUA 4WELA 2OSUA 4GDNA 3S7QA 4GD6A 3NBLA 4XT2A 1K6SA 5G4ZA 3TG9A 2HDUA 1IKIA 2DMWA 5L2FA 4FUWA 3BLSA 4E3KA 4R4SA 3PR6A 3MQQA 2WGWB 2H5SA 1FSWA 4DRTA 1IKGA 4Y13A 3NI9A 3IWOA 3RJUA 3NIAA 5A8BA 2INWA 1KE3A 1GHMA 5EFWA 1UWPX 2V9AA 5A90A 2I72A 3NDEA 3PBOA 3LIBA 4S2MA 3WS4A 4NKPA 3IF6A 5EE8A 1KE4A 1IYOA 4S2LA 3KSHA 1GA0A 3VOYA 2W1TA 3BYDA 3N7WA 4OLDA 2XK1A 3RFBA 4PM7A 1CEGA 1K25A 3KX0X 4E3OA 4JLFA 2XA7S 2G7UA 4KZBA 2V0WA 5U47A 2OAP1 3G35A 3UMEA 1BLHA 3Q7VA 5EM1A 5E43A 3CPTB 4R3AA 5AQAA 5EOOA 3P98A 2ZQ7A 2XLNA 1H3QA 2K2NA 4IJGA 1JTDA 3C5AA 4H6JB 1O07A 3N8SA 3VE3A 1M6KA 2HPBA 1H5XA 1N9NA 1BLPA 1DJBA 3D4FA 4O8GA 1BULA 2VJWA 1J3WA 1SKOA 3HL9A 4R38A 1VM1A 1S4RA 1X0OA 5AQ9A 4KG5A 3MF0A 1ZG6A 3IX8A 1ZKJA 1IYSA 4DE2A 4R4RA 5FI7A 4U0XA 2JKFA 4DN0A 3LFVA 3ZG7B 1FOFA 4FH4A 4N9KA 2WGIA 1EROA 1H8ZA 2A2LA 1HZOA 2WYXA 1M40A 1ES3A 2Y4AA 2Y2JA 5HD3A 2J3WA 5HD5A 3K3CA 1J9MA 2UWXA 3JYIA 5HZHA 3TE8A 1LSVA 3OLOA 1S1ZA 1K57C 4K0XA 3GDIA 3ICYA 5TBMA 2JC7A 5J7EA 1L0EA 1UGUA 3UDIA 4WEKA 1A0KA 3HCYA 3MKEA 2A24A 1AWIA 3RTYA 2J80A 1RGZA 3MFDA 5CEDA 2JKTI 4GOGA 3ZGAB 4CLCA 1TEMA 2P9VB 3H82A 1BSGA 5DF9A 3BQ8A 3D72A 5CTMA 1FR6A 5FI6A 1U60A 5HX9A 1NWZA 1YLPA 3E4OA 2JKRM 4UQIM 1BZAA 1FILA 1TDLA 1LL8A 3PAGA 2A3UA 5J8XA 1NYYA 2B5RA 2EX8A 4KZ9A 5E2GA 5M1AA 5EPHA 1KE0A 5CEBA 3A3EA 5AQ7A 4KENB 4Y0OA 1XGJA 2W3DA 4P85A 2V1ZA 1TS0A 1MWTA 3A3JA 2Y2LA 3SS3A 2H28A 4S2OA 2PR6A 3C4PA 4LPZA 1ZHHB 1NJ4A 2P74A 1PYYA 1ZC2A 2BG1A 2WKHA 2ZC3B 5EVEA 3W4PA 5FDSA 3HLBA 2RCXA 3BFDA 5EUAA 3GV9A 4QJGA 1YLTA 2ZQCA 4P87A 4X68A 2AVXA 1W8QA 2FFYA 3S22A 4XXRA 1VQQA 2ZOHA 2GDNA 3OPRA 4S2IA 4AFIA 3VP2A 4KZAA 2L0WA 2ZMVA 3TJZC 4II7A 1S1YA 5F1FA 1CJFA 1ONHA 2Z6DA 5EVIC 3A0VA 5JYOA 2ZQAA 2H10A 4Y15A 2RL3A 2FFFB 1ONGA 2J9PA 4KG2A 2EX6A 4N9LA 3G2ZA 4HESA 5FAQA 3C38A 4XT2B 3O88A 3U2AA 1T1BA 3RH8B 4GB7A 3ITAA 4QPRA 3PTEA 1MPLA 3T4JA 3DWZA 2XFSA 3H7WA 4UQIS 1ODVA 5IS1A 1N9BA 3CG5A 3QP5A 4F94A 3O5YA 2EXBA 5HARA 2JN7A 1HTZA 2Y2KA 4FCFA 4DKIA 4DE3A 4LV2A 3HJIA 2HP9A 3UB7A 2Y2QA 1YSPA 3TSGA 4LFUA 2P7JA 3BJNA 3V39A 3WRTA 3VOLA 2R9XA 1KGGA 4X55A 2ZQ8A 3FZCA 2VA0A 4Y2FA 3DTKA 3IF6B 5G4YA 4E3MA 3D9YA 4HJ4A 3ITBA 5EOEA 5FEGA 2V1AA 3UY6A 4BD0A 3MS6A 1G5UA 4Y7PA 1F9IA 2Q9NA 4E3JA 2LB9A 4JGOA 5I5LA 1YM1A 2PAVP 4BENA 4GD8A 3C7UA 4HEFA 4G3KA 4LCLA 5F69A 1NZOA 5A91A 1LI0A 3Q7VB 4NETA 3DBAA 1ESUA 4QD4A 5CHJA 2C6WB 5HFOA 3DAVA 2PD8A 1FCMA 1CI9A 4RX2A 4CPKA 1VETA 3NOUC 4JBFA 3A0RA 5F6AA 3V3RA 2W3GA 3LIDA 1ES5A 3BM6A 2VK3A 3ZDJA 3W4OA 4EUVA 3CJMA 4JGPA 1BYWA 4HBTA 4DMZA 1PRQA 2EXAA 1PW1A 3SH7A 4R0QA 3S1YA 3OPLA 4I3IA 3KYQA 2VV8A 3QNCA 2PBYA 3MMHA 2FZ0A 3F1PB 3A3IA 3TW8A 4GJ4A 1K55C 2VZWA 2PD7A 5DFYA 1NY0A 3ZQ5A 5HWTA 1LL9A 4NK3A 4EWFA 3KYZA 3MZDA 4HI4A 5G18A 1K57A 2JKTM 2G2UA 4BL2A 4WBGA 3VP1A 3WWXA 1QMFA 2JKGA 4N92A 4QY5A 4HQAA 4FD8A 3MQOA 2EA9A 3ISGA 5TBMB 2PBDP 2WZZA 4UEYA 3PBTA 5DTSA 1YSQA 3T1QB 3NC8A 3RXXA 2HDQA 4CLCD 1ACFA 2A24B 3M2JA 3BY9A 4NXEA 5DTTA 4DDSA 1CF0A 3OCLA 2A49A 4EERA 3ZVWA 1KOUA 4PKYA 4CLCB 3H82B 2D01A 3IHBA 3LGOA 1NRJA 2R9WA 1Z6FA 4YNRA 3V50A 1H8MA 3LR4A 1EWZA 3G34A 2XD1A 1TS6A 2BTFP 4DE1A 2JCHA 1H0MA 3LR5A 2MJ6A 5FI2A 3BW6A 2XFTA 5GHZA 4FOFA 1OTEA 3ZG0A 1C3BA 1HD8A 3SH9A 2XH9A 3PBRA 4EBPA 1ERMA 3CMZA 1XJ2A 1ESIA 1H8YA 2V8CA 2XGNA 2L1MA 2ZD8A 2OOLA 3IXDA 5E2EA 2GJ3A 3ZNYA 4HJ3A 4E04A 4ESPA 2PYRA 3LR3A 2VGLM 2YKFA 3ZNTA 1W5DA 3GSGA 3GVBA 1MWRA 3JVUA 4WF0A 3D3OA 1K54C 4MCWA 5FQKA 3T1SA 1L3LA 4ZJ2A 2W3EA 3N6IA 3E2LA 1W63M 3IH8A 3IXBA 3N4IA 3UE1A 4O01A 5FQMA 3JVVA 5EVIA 2B02A 2OLUA 1DRMA 4R23A 4XUXA 5EV0A 3AGEA 3HLWA 3UDFA 3KYEA 3O86A 4OQGA 2VX8A 4OH0A 5EECA 4EUZA 3WS0A 1E3UA 4QWOA 5HAPA 1OTAA 1PNEA 2P08A 3VE4A 1IEMA 4GS9B 4OPZA 1D7EA 4WMCD 2ZC5B 3FKWA 1G6AA 2C5WB 5FEFA 4HIAA 3ZG8B 3KSFA 4GHIA 1FCOA 4PHTA 3MQ0A 3ULFA 3UNWA 2OV5A 3NECA 4JF5A 4EBLA 4BQMA 3M6HA 2VGKA 3A3DA 4LGWA 4EEPA 3OPHA 3Q07A 4G3WA 2Y2IA 3H7WB 4MBHA 3HVFA 3W4QA 4UAAA 4BBVA 3UN7A 1JVJA 4ZJ3A 3T4TA 4NXBA 4R3JA 3DWKA 4QY6A 4GW9A 2ZC6B 2WKQA 4YINA 1NXYA 1PI5A 3Q81A 4L9FA 1VHMA 4P0MA 3UPPA 4MMNA 3OOVA 3E98A 4I39A 2WUQA 3LEZA 1PI4A 5HWWA 1LL5A 1VB6A 2Y59A 4KQDA 3W8KA 1JTGA 1YT4A 1T19A 3BECA 5CGWA 1IYPA 1Y4OA 1L0FA 3FV7A 1EI5A 4FH2A 4MBKA 3IF5A 2XR0A 5KSHA 1PZOA 1T1AA 3IXHA 3IX3A 2QKPA 3VFHA 5CGXA 5CGSA 3PBNA 5TGFA 5F83A 1XFQA 3FPWA 4Q0JA 1OT9A 3MXQA 2Y55A 2KOIA 2PU4A 3HLEA 1WYCA 2ZLYA 4OPYA 4HNBA 4EU0A 3EEHA 4KZ6A 4R1GA 3LO7A 4EBNA 2QMIA 4Y17A 1P9WA 3OBFA 5FL3A 3TRCA 2Y2HA 1N9LA 2QJ7A 2ZQDA 2M7VA 3MKFA 5C5KA 3T12B 4E3IA 2UV0E 3UB5P 2OWJA 1OMEA 5AJGA 1IYQA 3HUMA
chains in the Genus database with same CATH topology
2DRWA 1IELA 4KZ4A 3ITAA 5E2HA 2P9VA 4KG6A 2ZMAA 4BLMA 3C4OA 4ZDXA 2IWCA 3PTEA 1MPLA 1K55A 3DWZA 4UA7A 3VMAA 4KZ7A 2XFSA 3ZG5A 4E6XA 4JXWA 3ZFZA 3M6BA 4C75A 5CHMA 1N9BA 1I5QA 3CG5A 1K56A 3N8LA 4F94A 1RP5A 3UE3A 3B3XA 5F1GA 3UPNA 4PM6A 2EXBA 4B4XA 1WYBA 5CECA 5HARA 1SDNA 2Y2KA 1HTZA 4FCFA 3UPOA 4DKIA 3PBQA 3S4XA 4DE3A 4LV2A 2HP9A 1JWVA 2Y2QA 3TSGA 3BFFA 5FATA 1K38A 3AGFA 1MWSA 1ERQA 3V39A 4LV1A 2WKIA 1ALQA 4MBFA 1SKFA 3MXRA 3WRTA 2Q9MA 4IBRA 2R9XA 3IWQA 1KGGA 4X55A 4JF6A 2ZQ8A 2QZ6A 3FZCA 4PPRA 3RXWA 4GNUA 3V5MA 3IF6B 4HBUA 4E3MA 3ZHHA 3WS1A 5HW3A 2XF3A 3OPPA 3ITBA 4OLGA 3UO9A 5EOEA 1MXOA 3VFFA 4UA9A 3ZG9B 4RVAA 3HLFA 4X53A 4A5RA 3IWIA 3Q1FA 3UY6A 3HBRA 5FQJA 2DNSA 4BD0A 5TR7A 4KQOA 4WM9A 4Y7PA 2WADA 2Y2NA 1XX2A 2Q9NA 4E3JA 2IWDA 2V20A 2WAEA 4GZBA 4ZJ1A 1YM1A 3C7VA 4X6TA 4OP8A 3TOIA 4BENA 1I2SA 4C3QA 4GD8A 1NZUA 3C7UA 3M2KA 1YLWA 5E2FA 2Y2MA 4RX3A 4HEFA 4FSFA 1MY8A 4LCLA 1E25A 2H0YA 3VP4A 4DXCA 3FYZA 4C6YA 1NZOA 3GTCA 5A91A 3MZEA 1L2SA 1LI0A 3Q7VB 4NETA 1SDEA 1ESUA 4JPMA 4QD4A 4D2OA 5CHJA 2C6WB 1K6RA 5HFOA 5FAPA 4S2JA 1BUEA 5GLDA 1FCMA 3QNBA 1CI9A 4KZ8A 4RX2A 4CPKA 1BLSA 1CI8A 5FQ9A 4Y0TA 4JBFA 1W79A 3VP0A 3HUNA 3OCNA 3V3RA 4B4ZA 3OC2A 1CK3A 1ES5A 3BM6A 1PWDA 4E3LA 2Z2LB 3G30A 4Q8IA 4S2PA 3WS2A 3ZDJA 4OOLA 1DJCA 4JXVA 5CTNA 1YMXA 4WELA 3W4OA 2J9OA 2OSUA 4ZBEA 3CJMA 4GDNA 3VSLA 4GD6A 4HBTA 1XGIA 4U0TA 4MNRA 1RGYA 3NBLA 4WEJA 1K6SA 2X02A 3TG9A 2HDUA 1IKIA 2EXAA 1PW1A 5L2FA 3SH7A 3BLSA 4R0QA 4U3TA 4UHUA 3S1YA 4E3KA 5M18A 2J7VA 4R4SA 3OPLA 3QNCA 2WGWB 2PBYA 1LI9A 3P09A 4PMAA 2WKEA 4EQIA 5M19A 1K54A 2H5SA 1FSWA 4DRTA 1IKGA 3A3IA 2X01A 1K55C 3SS4A 3NI9A 3DW0A 3IWOA 1NY0A 1S0WA 5CRFA 3RJUA 1K4FA 3NIAA 1LL9A 1KE3A 2CC1A 4NK3A 5CXWA 4EWFA 1GHMA 3MZDA 3VSKA 1GHPA 5BOHA 4QU3A 5G18A 3SS5A 5A90A 5KMWA 2I72A 3NDEA 4WYYA 5FDHA 1NYMA 1K57A 2ZC7A 2HDSA 3PBOA 2G2UA 5D3OA 5IHVA 1KGFA 4S2MA 3Q7ZA 5F82A 3WS4A 4BL2A 3BLMA 2PU2A 3IQAA 4WBGA 3IF6A 2G2WA 5EE8A 4WZ4A 3VP1A 3WWXA 1KE4A 1QMFA 4N92A 1IYOA 1E3UD 4QY5A 4S2LA 3BRMA 1XKZA 4FD8A 1GA0A 3NDGA 2X71A 3VOYA 4OKPA 3BYDA 3GMWA 1L0GA 5HAQA 3N7WA 4OLDA 2XK1A 1FQGA 4IBXA 4OPQA 3IH9A 3ISGA 2WZZA 2EFUA 4PM7A 1CEGA 4IEDA 3PBTA 5DTSA 3VOZA 1K25A 3NC8A 3RXXA 4ZTKA 4JKTA 2HDQA 2IWBA 4E3OA 4JLFA 3M2JA 4KZBA 4MEZA 2EFXA 5A93A 1BTLA 5DTTA 4DDSA 3OCLA 2A49A 2WGVA 3FWLA 3HLCA 5U47A 3ZVWA 2BLSA 3G35A 3E2KA 1BLHA 3Q7VA 5KSCA 1PWCA 3IHBA 4X56A 1JWZA 5E43A 2ZM8A 5GHXA 1W7FA 2Y2GA 4OONA 3OZHA 2R9WA 1Z6FA 5EOOA 5AQAA 3V50A 3P98A 2ZQ7A 4KZ5A 2XLNA 3G31A 5FQIA 1Y54A 1DY6A 1KVLA 1EWZA 1JTDA 2Z2MB 3G34A 2XD1A 3C5AA 1O07A 1MWUA 3N8SA 4OVDA 4UA6A 1XPBA 1M6KA 2HPBA 4DE1A 4S2NA 5I94A 1H5XA 2J8YA 2JCHA 4WZ5A 1BLPA 5FI2A 1DJBA 1TDGA 3D4FA 2XFTA 5GHZA 3HREA 1BULA 3GRJA 3HL9A 1RCJA 1WE4A 2EX9A 1XA7A 4OQIA 1ES4A 3ZG0A 3HLDA 5GLCA 1C3BA 1VM1A 1NRFA 1HD8A 5FQQA 3SH9A 1JWPA 2XH9A 3PBRA 4EBPA 1ERMA 3CMZA 5AQ9A 4KG5A 4JXGA 1ESIA 1H8YA 4N1XA 1ZG6A 4H8RA 1I2WA 1ZKJA 1IYSA 2XGNA 4XUZA 4DE2A 2ZD8A 4PM5A 4R4RA 4OP5A 5FI7A 3IXDA 4U0XA 2XEPA 4IVIA 5E2EA 3ZCZA 4DXBA 5EVLA 4EV4A 3ZNYA 1KVMA 2WGWA 5GLBA 5DF8A 4LCMA 3ZG7B 1FOFA 1N4OA 4FH4A 4N9KA 2WGIA 1SCWA 1EROA 1H8ZA 4DDYA 5KZHA 3ZNTA 1W5DA 1YLZA 3GSGA 1MWRA 3GVBA 1HZOA 2E8IA 5TFQA 4BJPA 2WYXA 5JYPA 1M40A 1ES3A 2HP6A 4JF4A 2Y4AA 1K54C 1Q2QA 2Y2JA 5FQKA 1AXBA 1J9MA 2UWXA 4ZJ2A 3JYIA 3I7JA 5DTKA 3UDXA 2VGJA 3N6IA 3E2LA 3IH8A 3IXBA 3N4IA 3SH8A 3UE1A 4JXSA 5FQMA 4Z9QA 2Y2OA 3HLGA 5EVIA 2OLUA 4L0LA 4O7DA 4R3BA 4R23A 4XUXA 3AGEA 1K57C 1ES2A 4OQ0A 1S6RA 4K0WA 5EVID 3HLWA 3UDFA 4DE0A 4LV3A 4K0XA 3O86A 4MLLA 2ZM2A 4OQGA 5GL9A 3IF6C 4OH0A 5EECA 2XQZA 4EUZA 3WS0A 1E3UA 5HAPA 4WMCA 5FAOA 1XXMA 2JC7A 5EVIB 1FSYA 1GCEA 1L0EA 3LY4A 5GHYA 1BT5A 5HAIA 3UDIA 4K91A 4WEKA 1IEMA 4DF6A 2JBFA 4OPZA 3MBZA 1L0DA 4WMCD 2ZC5B 2WZXA 1E4DA 1O7EA 3FKWA 1G6AA 2C5WB 3MKEA 3ZG8B 1FCOA 1RGZA 3MFDA 1W8YA 3UNWA 2OV5A 5CEDA 4X69A 4GOGA 4JF5A 4EBLA 3ZGAB 4BQMA 3M6HA 1FCNA 2VGKA 2Y2PA 2OLVA 5DF7A 1TEMA 1ZG4A 3A3DA 3BEBA 2P9VB 1YQSA 1MBLA 3GQZA 4GKUA 1K56D 2XDMA 1BSGA 5DF9A 3OPHA 1KDWA 3Q07A 4GDBA 4KQQA 2ZJ9A 2Y2IA 1FR6A 3GR2A 5CTMA 4YFMA 5FI6A 4MBHA 3HVFA 3Q82A 1U60A 3W4QA 5HX9A 5FASA 2V2FF 1YLPA 4UAAA 3BFCA 3BFEA 3UN7A 1JVJA 4ZJ3A 4R3JA 4OQHA 4LENA 2QPNA 3DWKA 4M3KA 4QY6A 1BZAA 4BL3A 2ZC6B 4PM8A 1TDLA 4YINA 1NXYA 1PI5A 3EQUA 3LCEA 4Y0UA 3PAGA 3QHYA 2A3UA 3Q81A 5J8XA 1NYYA 2B5RA 2EX8A 4KZ9A 5E2GA 4CJNA 5M1AA 5EPHA 4S2NC 3G2YA 1KE0A 4PM9A 5CEBA 1YLJA 4P0MA 3UPPA 4WZ5C 4LV0A 3A3EA 4N1HA 5AQ7A 3AGDA 5CHUA 4KENB 4KQRA 1LLBA 2WUQA 1XGJA 3DTMA 4Y0OA 3A3FA 4P85A 3V3SA 3LEZA 1PI4A 2V1ZA 3MZFA 4OOYA 4OPRA 2HP5A 1MWTA 1XP4A 2WK0A 3A3JA 2Y2LA 4E3NA 1LL5A 2Y59A 3SS3A 1MKIA 4S2OA 1KDSA 3W8KA 1JTGA 1YT4A 3NY4A 2ZM0A 1PWGA 3BECA 5CGWA 5FA7A 2XD5A 1IYPA 3SOIA 3C4PA 3G32A 3MXSA 1NJ4A 2P74A 3IXGA 4GN2A 3WS5A 1PYYA 4RYEA 1BLCA 1ZC2A 4KZ3A 2BG1A 1L0FA 2WKHA 1HVBA 2ZC3B 3FV7A 1EI5A 3W4PA 3O87A 1CEFA 3HLBA 2RCXA 2H0TA 3BFDA 5EUAA 3GV9A 4QJGA 1YLTA 4FH2A 4MBKA 1PZPA 2ZQCA 2Y91A 4P6BA 3IF5A 4P87A 3IT9A 4X68A 2XR0A 1W8QA 2FFYA 5KSHA 1YLYA 1PZOA 1QMEA 5AQBA 4XXRA 3S22A 3IXHA 4B88A 4RA7A 3UE0A 1VQQA 5DVAA 3VFHA 5CGXA 5CGSA 2GDNA 3IHAA 1Q2PA 3OPRA 3PBNA 1DJAA 3PBSA 4S2IA 4ZAMA 3PAEA 5TGFA 4KZAA 4QB8A 3VP2A 1K4EA 5F83A 3G4PA 4BD1A 1PW8A 1KGEA 3NCKA 2ZQ9A 5F1FA 1PIOA 1ONHA 2Y55A 5GLAA 4E6WA 3FKVA 1TVFA 2PU4A 3HLEA 1FR1A 1WYCA 4QHCA 1LHYA 1XA1A 1G68A 3EQVA 3LY3A 2ZLYA 3BFGA 5EVIC 4IVKA 4OOMA 1GA9A 4S2KA 3N8RA 4OPYA 5JYOA 2ZQAA 2HDRA 4KZ6A 4R1GA 3LO7A 4ID4A 3ZVTA 4EBNA 2QMIA 1GHIA 2H10A 2DCFA 5CERA 1YMSA 3CZDA 1SHVA 5FSRA 5A92A 5HL1A 2ZC4B 2RL3A 2Y2HA 2FFFB 1ONGA 2J9PA 2ZQDA 2EX2A 4KG2A 2EX6A 3O3VA 3MKFA 4N9LA 3G2ZA 4E3IA 3HUOA 4HESA 5FAQA 2WAFA 3VP3A 1OMEA 2JE5A 3O88A 1IYQA 4GB7A 3WRZA 3HUMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DRW A;  1IEL A;  4KZ4 A;  3ITA A;  5E2H A;  2P9V A;  4KG6 A;  2ZMA A;  4BLM A;  3C4O A;  4ZDX A;  2IWC A;  3PTE A;  1MPL A;  1K55 A;  3DWZ A;  4UA7 A;  3VMA A;  4KZ7 A;  2XFS A;  3ZG5 A;  4E6X A;  4JXW A;  3ZFZ A;  3M6B A;  4C75 A;  5CHM A;  1N9B A;  1I5Q A;  3CG5 A;  1K56 A;  3N8L A;  4F94 A;  1RP5 A;  3UE3 A;  3B3X A;  5F1G A;  3UPN A;  4PM6 A;  2EXB A;  4B4X A;  1WYB A;  5CEC A;  5HAR A;  1SDN A;  2Y2K A;  1HTZ A;  4FCF A;  3UPO A;  4DKI A;  3PBQ A;  3S4X A;  4DE3 A;  4LV2 A;  2HP9 A;  1JWV A;  2Y2Q A;  3TSG A;  3BFF A;  5FAT A;  1K38 A;  3AGF A;  1MWS A;  1ERQ A;  3V39 A;  4LV1 A;  2WKI A;  1ALQ A;  4MBF A;  1SKF A;  3MXR A;  3WRT A;  2Q9M A;  4IBR A;  2R9X A;  3IWQ A;  1KGG A;  4X55 A;  4JF6 A;  2ZQ8 A;  2QZ6 A;  3FZC A;  4PPR A;  3RXW A;  4GNU A;  3V5M A;  3IF6 B;  4HBU A;  4E3M A;  3ZHH A;  3WS1 A;  5HW3 A;  2XF3 A;  3OPP A;  3ITB A;  4OLG A;  3UO9 A;  5EOE A;  1MXO A;  3VFF A;  4UA9 A;  3ZG9 B;  4RVA A;  3HLF A;  4X53 A;  4A5R A;  3IWI A;  3Q1F A;  3UY6 A;  3HBR A;  5FQJ A;  2DNS A;  4BD0 A;  5TR7 A;  4KQO A;  4WM9 A;  4Y7P A;  2WAD A;  2Y2N A;  1XX2 A;  2Q9N A;  4E3J A;  2IWD A;  2V20 A;  2WAE A;  4GZB A;  4ZJ1 A;  1YM1 A;  3C7V A;  4X6T A;  4OP8 A;  3TOI A;  4BEN A;  1I2S A;  4C3Q A;  4GD8 A;  1NZU A;  3C7U A;  3M2K A;  1YLW A;  5E2F A;  2Y2M A;  4RX3 A;  4HEF A;  4FSF A;  1MY8 A;  4LCL A;  1E25 A;  2H0Y A;  3VP4 A;  4DXC A;  3FYZ A;  4C6Y A;  1NZO A;  3GTC A;  5A91 A;  3MZE A;  1L2S A;  1LI0 A;  3Q7V B;  4NET A;  1SDE A;  1ESU A;  4JPM A;  4QD4 A;  4D2O A;  5CHJ A;  2C6W B;  1K6R A;  5HFO A;  5FAP A;  4S2J A;  1BUE A;  5GLD A;  1FCM A;  3QNB A;  1CI9 A;  4KZ8 A;  4RX2 A;  4CPK A;  1BLS A;  1CI8 A;  5FQ9 A;  4Y0T A;  4JBF A;  1W79 A;  3VP0 A;  3HUN A;  3OCN A;  3V3R A;  4B4Z A;  3OC2 A;  1CK3 A;  1ES5 A;  3BM6 A;  1PWD A;  4E3L A;  2Z2L B;  3G30 A;  4Q8I A;  4S2P A;  3WS2 A;  3ZDJ A;  4OOL A;  1DJC A;  4JXV A;  5CTN A;  1YMX A;  4WEL A;  3W4O A;  2J9O A;  2OSU A;  4ZBE A;  3CJM A;  4GDN A;  3VSL A;  4GD6 A;  4HBT A;  1XGI A;  4U0T A;  4MNR A;  1RGY A;  3NBL A;  4WEJ A;  1K6S A;  2X02 A;  3TG9 A;  2HDU A;  1IKI A;  2EXA A;  1PW1 A;  5L2F A;  3SH7 A;  3BLS A;  4R0Q A;  4U3T A;  4UHU A;  3S1Y A;  4E3K A;  5M18 A;  2J7V A;  4R4S A;  3OPL A;  3QNC A;  2WGW B;  2PBY A;  1LI9 A;  3P09 A;  4PMA A;  2WKE A;  4EQI A;  5M19 A;  1K54 A;  2H5S A;  1FSW A;  4DRT A;  1IKG A;  3A3I A;  2X01 A;  1K55 C;  3SS4 A;  3NI9 A;  3DW0 A;  3IWO A;  1NY0 A;  1S0W A;  5CRF A;  3RJU A;  1K4F A;  3NIA A;  1LL9 A;  1KE3 A;  2CC1 A;  4NK3 A;  5CXW A;  4EWF A;  1GHM A;  3MZD A;  3VSK A;  1GHP A;  5BOH A;  4QU3 A;  5G18 A;  3SS5 A;  5A90 A;  5KMW A;  2I72 A;  3NDE A;  4WYY A;  5FDH A;  1NYM A;  1K57 A;  2ZC7 A;  2HDS A;  3PBO A;  2G2U A;  5D3O A;  5IHV A;  1KGF A;  4S2M A;  3Q7Z A;  5F82 A;  3WS4 A;  4BL2 A;  3BLM A;  2PU2 A;  3IQA A;  4WBG A;  3IF6 A;  2G2W A;  5EE8 A;  4WZ4 A;  3VP1 A;  3WWX A;  1KE4 A;  1QMF A;  4N92 A;  1IYO A;  1E3U D;  4QY5 A;  4S2L A;  3BRM A;  1XKZ A;  4FD8 A;  1GA0 A;  3NDG A;  2X71 A;  3VOY A;  4OKP A;  3BYD A;  3GMW A;  1L0G A;  5HAQ A;  3N7W A;  4OLD A;  2XK1 A;  1FQG A;  4IBX A;  4OPQ A;  3IH9 A;  3ISG A;  2WZZ A;  2EFU A;  4PM7 A;  1CEG A;  4IED A;  3PBT A;  5DTS A;  3VOZ A;  1K25 A;  3NC8 A;  3RXX A;  4ZTK A;  4JKT A;  2HDQ A;  2IWB A;  4E3O A;  4JLF A;  3M2J A;  4KZB A;  4MEZ A;  2EFX A;  5A93 A;  1BTL A;  5DTT A;  4DDS A;  3OCL A;  2A49 A;  2WGV A;  3FWL A;  3HLC A;  5U47 A;  3ZVW A;  2BLS A;  3G35 A;  3E2K A;  1BLH A;  3Q7V A;  5KSC A;  1PWC A;  3IHB A;  4X56 A;  1JWZ A;  5E43 A;  2ZM8 A;  5GHX A;  1W7F A;  2Y2G A;  4OON A;  3OZH A;  2R9W A;  1Z6F A;  5EOO A;  5AQA A;  3V50 A;  3P98 A;  2ZQ7 A;  4KZ5 A;  2XLN A;  3G31 A;  5FQI A;  1Y54 A;  1DY6 A;  1KVL A;  1EWZ A;  1JTD A;  2Z2M B;  3G34 A;  2XD1 A;  3C5A A;  1O07 A;  1MWU A;  3N8S A;  4OVD A;  4UA6 A;  1XPB A;  1M6K A;  2HPB A;  4DE1 A;  4S2N A;  5I94 A;  1H5X A;  2J8Y A;  2JCH A;  4WZ5 A;  1BLP A;  5FI2 A;  1DJB A;  1TDG A;  3D4F A;  2XFT A;  5GHZ A;  3HRE A;  1BUL A;  3GRJ A;  3HL9 A;  1RCJ A;  1WE4 A;  2EX9 A;  1XA7 A;  4OQI A;  1ES4 A;  3ZG0 A;  3HLD A;  5GLC A;  1C3B A;  1VM1 A;  1NRF A;  1HD8 A;  5FQQ A;  3SH9 A;  1JWP A;  2XH9 A;  3PBR A;  4EBP A;  1ERM A;  3CMZ A;  5AQ9 A;  4KG5 A;  4JXG A;  1ESI A;  1H8Y A;  4N1X A;  1ZG6 A;  4H8R A;  1I2W A;  1ZKJ A;  1IYS A;  2XGN A;  4XUZ A;  4DE2 A;  2ZD8 A;  4PM5 A;  4R4R A;  4OP5 A;  5FI7 A;  3IXD A;  4U0X A;  2XEP A;  4IVI A;  5E2E A;  3ZCZ A;  4DXB A;  5EVL A;  4EV4 A;  3ZNY A;  1KVM A;  2WGW A;  5GLB A;  5DF8 A;  4LCM A;  3ZG7 B;  1FOF A;  1N4O A;  4FH4 A;  4N9K A;  2WGI A;  1SCW A;  1ERO A;  1H8Z A;  4DDY A;  5KZH A;  3ZNT A;  1W5D A;  1YLZ A;  3GSG A;  1MWR A;  3GVB A;  1HZO A;  2E8I A;  5TFQ A;  4BJP A;  2WYX A;  5JYP A;  1M40 A;  1ES3 A;  2HP6 A;  4JF4 A;  2Y4A A;  1K54 C;  1Q2Q A;  2Y2J A;  5FQK A;  1AXB A;  1J9M A;  2UWX A;  4ZJ2 A;  3JYI A;  3I7J A;  5DTK A;  3UDX A;  2VGJ A;  3N6I A;  3E2L A;  3IH8 A;  3IXB A;  3N4I A;  3SH8 A;  3UE1 A;  4JXS A;  5FQM A;  4Z9Q A;  2Y2O A;  3HLG A;  5EVI A;  2OLU A;  4L0L A;  4O7D A;  4R3B A;  4R23 A;  4XUX A;  3AGE A;  1K57 C;  1ES2 A;  4OQ0 A;  1S6R A;  4K0W A;  5EVI D;  3HLW A;  3UDF A;  4DE0 A;  4LV3 A;  4K0X A;  3O86 A;  4MLL A;  2ZM2 A;  4OQG A;  5GL9 A;  3IF6 C;  4OH0 A;  5EEC A;  2XQZ A;  4EUZ A;  3WS0 A;  1E3U A;  5HAP A;  4WMC A;  5FAO A;  1XXM A;  2JC7 A;  5EVI B;  1FSY A;  1GCE A;  1L0E A;  3LY4 A;  5GHY A;  1BT5 A;  5HAI A;  3UDI A;  4K91 A;  4WEK A;  1IEM A;  4DF6 A;  2JBF A;  4OPZ A;  3MBZ A;  1L0D A;  4WMC D;  2ZC5 B;  2WZX A;  1E4D A;  1O7E A;  3FKW A;  1G6A A;  2C5W B;  3MKE A;  3ZG8 B;  1FCO A;  1RGZ A;  3MFD A;  1W8Y A;  3UNW A;  2OV5 A;  5CED A;  4X69 A;  4GOG A;  4JF5 A;  4EBL A;  3ZGA B;  4BQM A;  3M6H A;  1FCN A;  2VGK A;  2Y2P A;  2OLV A;  5DF7 A;  1TEM A;  1ZG4 A;  3A3D A;  3BEB A;  2P9V B;  1YQS A;  1MBL A;  3GQZ A;  4GKU A;  1K56 D;  2XDM A;  1BSG A;  5DF9 A;  3OPH A;  1KDW A;  3Q07 A;  4GDB A;  4KQQ A;  2ZJ9 A;  2Y2I A;  1FR6 A;  3GR2 A;  5CTM A;  4YFM A;  5FI6 A;  4MBH A;  3HVF A;  3Q82 A;  1U60 A;  3W4Q A;  5HX9 A;  5FAS A;  2V2F F;  1YLP A;  4UAA A;  3BFC A;  3BFE A;  3UN7 A;  1JVJ A;  4ZJ3 A;  4R3J A;  4OQH A;  4LEN A;  2QPN A;  3DWK A;  4M3K A;  4QY6 A;  1BZA A;  4BL3 A;  2ZC6 B;  4PM8 A;  1TDL A;  4YIN A;  1NXY A;  1PI5 A;  3EQU A;  3LCE A;  4Y0U A;  3PAG A;  3QHY A;  2A3U A;  3Q81 A;  5J8X A;  1NYY A;  2B5R A;  2EX8 A;  4KZ9 A;  5E2G A;  4CJN A;  5M1A A;  5EPH A;  4S2N C;  3G2Y A;  1KE0 A;  4PM9 A;  5CEB A;  1YLJ A;  4P0M A;  3UPP A;  4WZ5 C;  4LV0 A;  3A3E A;  4N1H A;  5AQ7 A;  3AGD A;  5CHU A;  4KEN B;  4KQR A;  1LLB A;  2WUQ A;  1XGJ A;  3DTM A;  4Y0O A;  3A3F A;  4P85 A;  3V3S A;  3LEZ A;  1PI4 A;  2V1Z A;  3MZF A;  4OOY A;  4OPR A;  2HP5 A;  1MWT A;  1XP4 A;  2WK0 A;  3A3J A;  2Y2L A;  4E3N A;  1LL5 A;  2Y59 A;  3SS3 A;  1MKI A;  4S2O A;  1KDS A;  3W8K A;  1JTG A;  1YT4 A;  3NY4 A;  2ZM0 A;  1PWG A;  3BEC A;  5CGW A;  5FA7 A;  2XD5 A;  1IYP A;  3SOI A;  3C4P A;  3G32 A;  3MXS A;  1NJ4 A;  2P74 A;  3IXG A;  4GN2 A;  3WS5 A;  1PYY A;  4RYE A;  1BLC A;  1ZC2 A;  4KZ3 A;  2BG1 A;  1L0F A;  2WKH A;  1HVB A;  2ZC3 B;  3FV7 A;  1EI5 A;  3W4P A;  3O87 A;  1CEF A;  3HLB A;  2RCX A;  2H0T A;  3BFD A;  5EUA A;  3GV9 A;  4QJG A;  1YLT A;  4FH2 A;  4MBK A;  1PZP A;  2ZQC A;  2Y91 A;  4P6B A;  3IF5 A;  4P87 A;  3IT9 A;  4X68 A;  2XR0 A;  1W8Q A;  2FFY A;  5KSH A;  1YLY A;  1PZO A;  1QME A;  5AQB A;  4XXR A;  3S22 A;  3IXH A;  4B88 A;  4RA7 A;  3UE0 A;  1VQQ A;  5DVA A;  3VFH A;  5CGX A;  5CGS A;  2GDN A;  3IHA A;  1Q2P A;  3OPR A;  3PBN A;  1DJA A;  3PBS A;  4S2I A;  4ZAM A;  3PAE A;  5TGF A;  4KZA A;  4QB8 A;  3VP2 A;  1K4E A;  5F83 A;  3G4P A;  4BD1 A;  1PW8 A;  1KGE A;  3NCK A;  2ZQ9 A;  5F1F A;  1PIO A;  1ONH A;  2Y55 A;  5GLA A;  4E6W A;  3FKV A;  1TVF A;  2PU4 A;  3HLE A;  1FR1 A;  1WYC A;  4QHC A;  1LHY A;  1XA1 A;  1G68 A;  3EQV A;  3LY3 A;  2ZLY A;  3BFG A;  5EVI C;  4IVK A;  4OOM A;  1GA9 A;  4S2K A;  3N8R A;  4OPY A;  5JYO A;  2ZQA A;  2HDR A;  4KZ6 A;  4R1G A;  3LO7 A;  4ID4 A;  3ZVT A;  4EBN A;  2QMI A;  1GHI A;  2H10 A;  2DCF A;  5CER A;  1YMS A;  3CZD A;  1SHV A;  5FSR A;  5A92 A;  5HL1 A;  2ZC4 B;  2RL3 A;  2Y2H A;  2FFF B;  1ONG A;  2J9P A;  2ZQD A;  2EX2 A;  4KG2 A;  2EX6 A;  3O3V A;  3MKF A;  4N9L A;  3G2Z A;  4E3I A;  3HUO A;  4HES A;  5FAQ A;  2WAF A;  3VP3 A;  1OME A;  2JE5 A;  3O88 A;  1IYQ A;  4GB7 A;  3WRZ A;  3HUM A; 
#chains in the Genus database with same CATH topology
 5E2H A;  4KG6 A;  2ZMA A;  2B95 A;  3IBJ A;  1MKM A;  3FC7 A;  1K55 A;  5L09 A;  4E6X A;  3UB8 A;  3ZFZ A;  3LIA A;  3F1N A;  4YWZ A;  3M6B A;  4C75 A;  1K56 A;  3N8L A;  3UE3 A;  4I38 A;  5F1G A;  3UPN A;  3HJK A;  1V9Z A;  1SDN A;  3UPO A;  3PBQ A;  3E4Q A;  1JWV A;  2VV6 A;  1K38 A;  1MWS A;  2WKI A;  1ALQ A;  1SKF A;  2Q9M A;  4JF6 A;  4R70 A;  3T4K A;  4PPR A;  2NUT C;  5J3W A;  3V5M A;  3FPV A;  4HBU A;  4WLA A;  3MJQ A;  1MXO A;  3VFF A;  3HLF A;  3HBR A;  4O0P A;  5FQJ A;  3B42 A;  2WAD A;  2Y2N A;  3GEC A;  1DP8 A;  2KX6 A;  1W63 Q;  1OTD A;  2V20 A;  5E2F A;  1YLW A;  2Y2M A;  4RX3 A;  2HJ9 C;  4IUK A;  4FSF A;  1DP6 A;  1S66 L;  1E25 A;  3FYZ A;  1L2S A;  1SDE A;  1G28 A;  2VKS A;  2Y8H A;  3QNB A;  5FQ9 A;  1OJ5 A;  2EWW A;  4HJ6 A;  3OCN A;  3OC2 A;  1Y28 A;  4E3L A;  3S7N A;  1DJC A;  4JXV A;  5F68 A;  2J9O A;  4CQH A;  1GSW A;  5MC7 A;  3VSL A;  3H9W A;  3EWK A;  4U0T A;  1XGI A;  4LLO B;  3U4L P;  2X02 A;  2ZL1 A;  4U3T A;  4UHU A;  5M18 A;  2J7V A;  4DJ2 A;  5IU1 A;  4PMA A;  4EQI A;  1K54 A;  3SS4 A;  3P01 A;  1EW0 A;  1NLY A;  5CRF A;  4P6Z M;  1K4F A;  3QP2 A;  4HY8 A;  2CC1 A;  1OTB A;  2Y79 A;  1GHP A;  4I3J A;  3VSK A;  4NEE D;  2Q0O A;  3SS5 A;  5KMW A;  5FDH A;  1NYM A;  5D3O A;  5IHV A;  5F82 A;  3BLM A;  3IQA A;  4EW7 A;  2HGV A;  1E3U D;  3B33 A;  3BRM A;  4BMW A;  3NDG A;  4WN5 A;  2OWH A;  1L0G A;  4NXF A;  3G6O A;  4OPQ A;  3IH9 A;  2EFU A;  3UMD A;  3BWL A;  4ETZ A;  4ZTK A;  1Z09 A;  2IWB A;  5HDD A;  5A93 A;  2W1T B;  1BTL A;  1YAX A;  3NOP C;  2WGV A;  3HLC A;  4H6J A;  3T4S A;  3IS2 A;  5KSC A;  1PWC A;  4F3L A;  4IUH A;  1JWZ A;  2ZM8 A;  5GHX A;  2Y2G A;  4OON A;  1GSV A;  4KZ5 A;  5FQI A;  1KVL A;  3T1X A;  2Z2M B;  4UA6 A;  3LUQ A;  1MWU A;  1XPB A;  3QP8 A;  1OTI A;  1TDG A;  3HRE A;  3GRJ A;  1RCJ A;  2EX9 A;  1ES4 A;  1F98 A;  1TS7 A;  3HLD A;  5GLC A;  5FQQ A;  4JXG A;  4N1X A;  3R7W A;  4H8R A;  3LEQ A;  4XUZ A;  2W1R A;  4EV4 A;  2CMN A;  1SKO B;  5DF8 A;  4LCM A;  3MR0 A;  4P6Z S;  1SCW A;  5L8M A;  4HP9 A;  4DDY A;  4B9O A;  1F5M A;  1YLZ A;  4BJP A;  2HP6 A;  4JF4 A;  4DJ3 A;  1Q2Q A;  5F5Y A;  1AXB A;  3KO6 A;  4ARZ A;  3I7J A;  3R4K A;  3NUL A;  4NG2 A;  2Y2O A;  1OT6 A;  4L0L A;  4R3B A;  1ES2 A;  4K0W A;  4DE0 A;  4EXO A;  1LT0 A;  2QYB A;  2ZM2 A;  4K08 A;  4MLL A;  2XQZ A;  2QHK A;  2XRO A;  1XXM A;  1FSY A;  3LY4 A;  2J3T C;  1BT5 A;  4K91 A;  2O9B A;  1OJG A;  3P7N A;  1L0D A;  1E4D A;  1W8Y A;  5TJJ A;  3LR0 A;  2OLV A;  5DF7 A;  1ZG4 A;  1MBL A;  2K31 A;  3GQZ A;  1K56 D;  4NXG A;  1KDW A;  1IOU A;  3KSI A;  4MN6 A;  4YFM A;  1WA9 A;  2V0U A;  3Q82 A;  2V2F F;  3W2Z A;  4LEN A;  3IX4 A;  4BL3 A;  4ME4 A;  5HSQ A;  1ZTU A;  3EQU A;  4CJN A;  2L4R A;  3PHY A;  4S2N C;  4PM9 A;  4WZ5 C;  4LV0 A;  3AGD A;  3DTM A;  3V3S A;  3MZF A;  4OPR A;  2M1C A;  2HP5 A;  1XP4 A;  4E3N A;  1KDS A;  1T18 A;  5FA7 A;  3NY4 A;  2XD5 A;  3SOI A;  2JHE A;  3MXS A;  3WS5 A;  4RYE A;  4EQ1 A;  4KZ3 A;  2HZ5 A;  2XA7 M;  3O87 A;  2H0T A;  2QJ5 A;  2M7U A;  1PZP A;  2O9A A;  1YLY A;  5HPI A;  2HF6 A;  3UE0 A;  1Q2P A;  2O9C A;  3PBS A;  4QB8 A;  3CIT A;  3G4P A;  2PYP A;  5GLA A;  2ZBB A;  4E6W A;  3L7H A;  3FKV A;  4QHC A;  1CQA A;  1G68 A;  4MN5 A;  3BFG A;  3N8R A;  4HH3 A;  4ID4 A;  1GHI A;  3C8C A;  2DCF A;  5CER A;  1YMS A;  2I9V A;  3CZD A;  5A92 A;  2BAS A;  4X1M A;  2V8F A;  2EX2 A;  3HUO A;  2KLI A;  2WAF A;  2JE5 A;  2W3F A;  2ZL1 B;  3WRZ A;  2DRW A;  4KZ4 A;  2W3H A;  3C4O A;  4ZDX A;  2IWC A;  2LB5 A;  3L9K A;  4JGR A;  4UA7 A;  3VMA A;  4KZ7 A;  3QP1 A;  3ZG5 A;  4JXW A;  3C2W A;  5CHM A;  4HH2 A;  3JPU A;  4PM6 A;  1GSX A;  1WYB A;  3T50 A;  3S4X A;  1XJ6 A;  3BFF A;  3AGF A;  2WKP A;  1ERQ A;  1VEU A;  2VLG A;  4LV1 A;  4MBF A;  2VEA A;  3MXR A;  1TF1 A;  4I3A A;  2PRF A;  3IWQ A;  3LI9 A;  4GNU A;  3ZHH A;  2WKR A;  3UE6 A;  3WS1 A;  5HW3 A;  2XF3 A;  3OPP A;  3UO9 A;  2ZMF A;  3Q1F A;  2DNS A;  3T1R A;  4WUJ A;  5TR7 A;  5HDC A;  4WM9 A;  3BQA A;  2XRN A;  1XX2 A;  3SW1 A;  2IWD A;  2XSS A;  4GZB A;  4ZJ1 A;  4OP8 A;  2ACG A;  1I2S A;  1NZU A;  3M2K A;  4KUO A;  3SZT A;  2VGL S;  3UB6 A;  1MY8 A;  2H0Y A;  3VP4 A;  4IHQ A;  4RQ9 A;  2EWV A;  3IS2 B;  3BY8 A;  3LYX A;  4F3L B;  1K6R A;  3CHW P;  5FAP A;  4S2J A;  1BUE A;  2PT7 A;  3NJA A;  5GLD A;  1CI8 A;  4Y0T A;  1W79 A;  3VP0 A;  3E4P A;  4B4Z A;  5HWV A;  3F1O A;  1CK3 A;  3CAX A;  1PWD A;  4MDZ A;  5LBR A;  2Z2L B;  3G30 A;  3WS2 A;  1TD5 A;  5EM0 A;  4OOL A;  2OAQ 1;  5CTN A;  1YMX A;  4LRX C;  3LIE A;  4ZBE A;  2NUP C;  1VET B;  4CLC E;  2KDK A;  4WEJ A;  1RGY A;  1XJ4 A;  4MNR A;  1XFN A;  4Q0H A;  3F1P A;  3R7W B;  1N9O A;  2PHY A;  1D06 A;  1LI9 A;  3P09 A;  2WKE A;  5M19 A;  1DP9 A;  4JGQ A;  2X01 A;  3DW0 A;  1S0W A;  3CLO A;  1FIK A;  5CXW A;  5BOH A;  4QU3 A;  4WYY A;  4ARZ B;  2ZC7 A;  2HDS A;  1KGF A;  5L07 A;  3Q7Z A;  2PU2 A;  4M4X A;  2G2W A;  4WZ4 A;  1T1C A;  3LIC A;  4BWI A;  1XKZ A;  4LRY C;  3DTE A;  2X71 A;  3B47 A;  4OKP A;  3GMW A;  5HAQ A;  4L9G A;  1MZU A;  2D02 A;  1FQG A;  4I5S A;  4IBX A;  5K5B A;  4X25 A;  4X1L A;  4IED A;  1MC0 A;  3VOZ A;  4JKT A;  4Q0I A;  4MEZ A;  2EFX A;  2GX5 A;  3LI8 A;  3FWL A;  3CUE C;  3CI6 A;  2BLS A;  2W27 A;  3UB9 A;  3E2K A;  3NOT C;  3E0Y A;  4X56 A;  2PDR A;  1XJ3 A;  1W7F A;  3OZH A;  3G31 A;  1Y54 A;  1DY6 A;  2E8J A;  4OVD A;  2HJE A;  4S2N A;  5I94 A;  2FH5 A;  2J8Y A;  4WZ5 A;  3T4Q A;  5DKL A;  2P04 A;  2PR5 A;  1F2K A;  1WE4 A;  4OQI A;  1XA7 A;  1NRF A;  1JWP A;  3VV4 A;  1I2W A;  3C30 A;  4PM5 A;  4OP5 A;  3ZCZ A;  2XEP A;  4IVI A;  4DXB A;  5EVL A;  1KVM A;  2WGW A;  5GLB A;  1P0Z A;  1N4O A;  4HHD A;  5KZH A;  2E8I A;  5TFQ A;  5JYP A;  3NHQ A;  1P9R A;  5HL6 A;  5DTK A;  4GCZ A;  3UDX A;  2VGJ A;  3MFX A;  3SH8 A;  2GNX A;  4JXS A;  4Z9Q A;  1OPX A;  3V67 A;  3HLG A;  4R6L A;  2VV7 A;  4O7D A;  4GS9 A;  3KSG A;  4OQ0 A;  1S6R A;  5EVI D;  5IT5 A;  4LV3 A;  2W0N A;  4BBU A;  1YKD A;  5GL9 A;  3IF6 C;  4WMC A;  5FAO A;  5EVI B;  1GCE A;  5GHY A;  5HAI A;  4DF6 A;  2JBF A;  3MBZ A;  2WZX A;  1O7E A;  1V9Y A;  5DKK A;  4X69 A;  1FCN A;  2Y2P A;  4FTX A;  2R78 A;  3BEB A;  1YQS A;  4GKU A;  2XDM A;  3CPT A;  1S4S A;  4EEU A;  4GDB A;  4KQQ A;  2ZJ9 A;  3GR2 A;  4GHI B;  4PAU A;  5FAS A;  5DJT A;  3BFC A;  2ZOI A;  3BFE A;  1TS8 A;  4OQH A;  4HOI A;  2QPN A;  4M3K A;  3IBR A;  2K7S A;  4PM8 A;  3LCE A;  1IFQ A;  4LRZ E;  4Y0U A;  3QHY A;  3K3D A;  3G2Y A;  4ZRR A;  1VEU B;  1YLJ A;  5HDS A;  1D1J A;  4N1H A;  1G6O A;  5CHU A;  4KQR A;  1LLB A;  1SZV A;  4GLQ A;  5L10 A;  3A3F A;  4PKY G;  4WL9 A;  4OOY A;  2WK0 A;  4MN7 A;  2V1B A;  1MKI A;  4EET B;  1HLU P;  2ZM0 A;  1PWG A;  3G32 A;  3IXG A;  3LIF A;  4GN2 A;  2Z6C A;  1BLC A;  5AVF A;  5HPF A;  1HVB A;  3ZYT A;  3FG8 A;  1CEF A;  2HV1 A;  2Y91 A;  4P6B A;  3IT9 A;  1K0K A;  3S7P A;  1QME A;  5AQB A;  4B88 A;  4RA7 A;  5DVA A;  5KIZ A;  3EOI A;  3IHA A;  1DJA A;  3DTI A;  4ZAM A;  3PAE A;  1K4E A;  2O0Y A;  4BD1 A;  1PW8 A;  1KGE A;  3NCK A;  2ZQ9 A;  1PIO A;  4Y3I A;  1TVF A;  4YOF A;  1FR1 A;  1LHY A;  1XA1 A;  3EQV A;  3LY3 A;  4HP4 A;  4IVK A;  4OOM A;  1GA9 A;  4S2K A;  2HDR A;  4Z1W A;  3F1O B;  3ZVT A;  1UWN X;  1STZ A;  1SHV A;  5FSR A;  5HL1 A;  2ZC4 B;  3QP6 A;  3S7O A;  1PFL A;  3O3V A;  2IA2 A;  1JNU A;  3T4L A;  3VP3 A;  3A0S A;  2GZA A;  3MSH A;  5CX7 A;  5AVE A;  3T4O A;  1S67 L;  1IEL A;  2P9V A;  4BLM A;  3K2N A;  3PXP A;  4CLC C;  1I5Q A;  2O99 A;  1RP5 A;  3B3X A;  4D60 A;  1P97 A;  4L9E A;  4ETX A;  4B4X A;  5CEC A;  3EGX C;  5FAT A;  3F1N B;  4IBR A;  2J3T D;  2YKH A;  2B18 A;  2QZ6 A;  3RXW A;  4OLG A;  4EES A;  1YPR A;  4UA9 A;  5J4E A;  3EEA A;  3ZG9 B;  4RVA A;  4X53 A;  4A5R A;  3IWI A;  2JKR I;  2QWS A;  4Y5F A;  4KQO A;  1LSW A;  2WAE A;  3C7V A;  4X6T A;  3CUE A;  4C3Q A;  3TOI A;  4B93 A;  1NLZ A;  4KUK A;  1LSX A;  4BBT A;  4DXC A;  4C6Y A;  3GTC A;  3MZE A;  4G3V A;  4JPM A;  4D2O A;  3QP4 A;  3CWF A;  5DFX A;  3EGD C;  3PYP A;  4KZ8 A;  1BLS A;  3HUN A;  4Q8I A;  4S2P A;  5DJU A;  4WEL A;  2OSU A;  4GDN A;  3S7Q A;  4GD6 A;  3NBL A;  4XT2 A;  1K6S A;  5G4Z A;  3TG9 A;  2HDU A;  1IKI A;  2DMW A;  5L2F A;  4FUW A;  3BLS A;  4E3K A;  4R4S A;  3PR6 A;  3MQQ A;  2WGW B;  2H5S A;  1FSW A;  4DRT A;  1IKG A;  4Y13 A;  3NI9 A;  3IWO A;  3RJU A;  3NIA A;  5A8B A;  2INW A;  1KE3 A;  1GHM A;  5EFW A;  1UWP X;  2V9A A;  5A90 A;  2I72 A;  3NDE A;  3PBO A;  3LIB A;  4S2M A;  3WS4 A;  4NKP A;  3IF6 A;  5EE8 A;  1KE4 A;  1IYO A;  4S2L A;  3KSH A;  1GA0 A;  3VOY A;  2W1T A;  3BYD A;  3N7W A;  4OLD A;  2XK1 A;  3RFB A;  4PM7 A;  1CEG A;  1K25 A;  3KX0 X;  4E3O A;  4JLF A;  2XA7 S;  2G7U A;  4KZB A;  2V0W A;  5U47 A;  2OAP 1;  3G35 A;  3UME A;  1BLH A;  3Q7V A;  5EM1 A;  5E43 A;  3CPT B;  4R3A A;  5AQA A;  5EOO A;  3P98 A;  2ZQ7 A;  2XLN A;  1H3Q A;  2K2N A;  4IJG A;  1JTD A;  3C5A A;  4H6J B;  1O07 A;  3N8S A;  3VE3 A;  1M6K A;  2HPB A;  1H5X A;  1N9N A;  1BLP A;  1DJB A;  3D4F A;  4O8G A;  1BUL A;  2VJW A;  1J3W A;  1SKO A;  3HL9 A;  4R38 A;  1VM1 A;  1S4R A;  1X0O A;  5AQ9 A;  4KG5 A;  3MF0 A;  1ZG6 A;  3IX8 A;  1ZKJ A;  1IYS A;  4DE2 A;  4R4R A;  5FI7 A;  4U0X A;  2JKF A;  4DN0 A;  3LFV A;  3ZG7 B;  1FOF A;  4FH4 A;  4N9K A;  2WGI A;  1ERO A;  1H8Z A;  2A2L A;  1HZO A;  2WYX A;  1M40 A;  1ES3 A;  2Y4A A;  2Y2J A;  5HD3 A;  2J3W A;  5HD5 A;  3K3C A;  1J9M A;  2UWX A;  3JYI A;  5HZH A;  3TE8 A;  1LSV A;  3OLO A;  1S1Z A;  1K57 C;  4K0X A;  3GDI A;  3ICY A;  5TBM A;  2JC7 A;  5J7E A;  1L0E A;  1UGU A;  3UDI A;  4WEK A;  1A0K A;  3HCY A;  3MKE A;  2A24 A;  1AWI A;  3RTY A;  2J80 A;  1RGZ A;  3MFD A;  5CED A;  2JKT I;  4GOG A;  3ZGA B;  4CLC A;  1TEM A;  2P9V B;  3H82 A;  1BSG A;  5DF9 A;  3BQ8 A;  3D72 A;  5CTM A;  1FR6 A;  5FI6 A;  1U60 A;  5HX9 A;  1NWZ A;  1YLP A;  3E4O A;  2JKR M;  4UQI M;  1BZA A;  1FIL A;  1TDL A;  1LL8 A;  3PAG A;  2A3U A;  5J8X A;  1NYY A;  2B5R A;  2EX8 A;  4KZ9 A;  5E2G A;  5M1A A;  5EPH A;  1KE0 A;  5CEB A;  3A3E A;  5AQ7 A;  4KEN B;  4Y0O A;  1XGJ A;  2W3D A;  4P85 A;  2V1Z A;  1TS0 A;  1MWT A;  3A3J A;  2Y2L A;  3SS3 A;  2H28 A;  4S2O A;  2PR6 A;  3C4P A;  4LPZ A;  1ZHH B;  1NJ4 A;  2P74 A;  1PYY A;  1ZC2 A;  2BG1 A;  2WKH A;  2ZC3 B;  5EVE A;  3W4P A;  5FDS A;  3HLB A;  2RCX A;  3BFD A;  5EUA A;  3GV9 A;  4QJG A;  1YLT A;  2ZQC A;  4P87 A;  4X68 A;  2AVX A;  1W8Q A;  2FFY A;  3S22 A;  4XXR A;  1VQQ A;  2ZOH A;  2GDN A;  3OPR A;  4S2I A;  4AFI A;  3VP2 A;  4KZA A;  2L0W A;  2ZMV A;  3TJZ C;  4II7 A;  1S1Y A;  5F1F A;  1CJF A;  1ONH A;  2Z6D A;  5EVI C;  3A0V A;  5JYO A;  2ZQA A;  2H10 A;  4Y15 A;  2RL3 A;  2FFF B;  1ONG A;  2J9P A;  4KG2 A;  2EX6 A;  4N9L A;  3G2Z A;  4HES A;  5FAQ A;  3C38 A;  4XT2 B;  3O88 A;  3U2A A;  1T1B A;  3RH8 B;  4GB7 A;  3ITA A;  4QPR A;  3PTE A;  1MPL A;  3T4J A;  3DWZ A;  2XFS A;  3H7W A;  4UQI S;  1ODV A;  5IS1 A;  1N9B A;  3CG5 A;  3QP5 A;  4F94 A;  3O5Y A;  2EXB A;  5HAR A;  2JN7 A;  1HTZ A;  2Y2K A;  4FCF A;  4DKI A;  4DE3 A;  4LV2 A;  3HJI A;  2HP9 A;  3UB7 A;  2Y2Q A;  1YSP A;  3TSG A;  4LFU A;  2P7J A;  3BJN A;  3V39 A;  3WRT A;  3VOL A;  2R9X A;  1KGG A;  4X55 A;  2ZQ8 A;  3FZC A;  2VA0 A;  4Y2F A;  3DTK A;  3IF6 B;  5G4Y A;  4E3M A;  3D9Y A;  4HJ4 A;  3ITB A;  5EOE A;  5FEG A;  2V1A A;  3UY6 A;  4BD0 A;  3MS6 A;  1G5U A;  4Y7P A;  1F9I A;  2Q9N A;  4E3J A;  2LB9 A;  4JGO A;  5I5L A;  1YM1 A;  2PAV P;  4BEN A;  4GD8 A;  3C7U A;  4HEF A;  4G3K A;  4LCL A;  5F69 A;  1NZO A;  5A91 A;  1LI0 A;  3Q7V B;  4NET A;  3DBA A;  1ESU A;  4QD4 A;  5CHJ A;  2C6W B;  5HFO A;  3DAV A;  2PD8 A;  1FCM A;  1CI9 A;  4RX2 A;  4CPK A;  1VET A;  3NOU C;  4JBF A;  3A0R A;  5F6A A;  3V3R A;  2W3G A;  3LID A;  1ES5 A;  3BM6 A;  2VK3 A;  3ZDJ A;  3W4O A;  4EUV A;  3CJM A;  4JGP A;  1BYW A;  4HBT A;  4DMZ A;  1PRQ A;  2EXA A;  1PW1 A;  3SH7 A;  4R0Q A;  3S1Y A;  3OPL A;  4I3I A;  3KYQ A;  2VV8 A;  3QNC A;  2PBY A;  3MMH A;  2FZ0 A;  3F1P B;  3A3I A;  3TW8 A;  4GJ4 A;  1K55 C;  2VZW A;  2PD7 A;  5DFY A;  1NY0 A;  3ZQ5 A;  5HWT A;  1LL9 A;  4NK3 A;  4EWF A;  3KYZ A;  3MZD A;  4HI4 A;  5G18 A;  1K57 A;  2JKT M;  2G2U A;  4BL2 A;  4WBG A;  3VP1 A;  3WWX A;  1QMF A;  2JKG A;  4N92 A;  4QY5 A;  4HQA A;  4FD8 A;  3MQO A;  2EA9 A;  3ISG A;  5TBM B;  2PBD P;  2WZZ A;  4UEY A;  3PBT A;  5DTS A;  1YSQ A;  3T1Q B;  3NC8 A;  3RXX A;  2HDQ A;  4CLC D;  1ACF A;  2A24 B;  3M2J A;  3BY9 A;  4NXE A;  5DTT A;  4DDS A;  1CF0 A;  3OCL A;  2A49 A;  4EER A;  3ZVW A;  1KOU A;  4PKY A;  4CLC B;  3H82 B;  2D01 A;  3IHB A;  3LGO A;  1NRJ A;  2R9W A;  1Z6F A;  4YNR A;  3V50 A;  1H8M A;  3LR4 A;  1EWZ A;  3G34 A;  2XD1 A;  1TS6 A;  2BTF P;  4DE1 A;  2JCH A;  1H0M A;  3LR5 A;  2MJ6 A;  5FI2 A;  3BW6 A;  2XFT A;  5GHZ A;  4FOF A;  1OTE A;  3ZG0 A;  1C3B A;  1HD8 A;  3SH9 A;  2XH9 A;  3PBR A;  4EBP A;  1ERM A;  3CMZ A;  1XJ2 A;  1ESI A;  1H8Y A;  2V8C A;  2XGN A;  2L1M A;  2ZD8 A;  2OOL A;  3IXD A;  5E2E A;  2GJ3 A;  3ZNY A;  4HJ3 A;  4E04 A;  4ESP A;  2PYR A;  3LR3 A;  2VGL M;  2YKF A;  3ZNT A;  1W5D A;  3GSG A;  3GVB A;  1MWR A;  3JVU A;  4WF0 A;  3D3O A;  1K54 C;  4MCW A;  5FQK A;  3T1S A;  1L3L A;  4ZJ2 A;  2W3E A;  3N6I A;  3E2L A;  1W63 M;  3IH8 A;  3IXB A;  3N4I A;  3UE1 A;  4O01 A;  5FQM A;  3JVV A;  5EVI A;  2B02 A;  2OLU A;  1DRM A;  4R23 A;  4XUX A;  5EV0 A;  3AGE A;  3HLW A;  3UDF A;  3KYE A;  3O86 A;  4OQG A;  2VX8 A;  4OH0 A;  5EEC A;  4EUZ A;  3WS0 A;  1E3U A;  4QWO A;  5HAP A;  1OTA A;  1PNE A;  2P08 A;  3VE4 A;  1IEM A;  4GS9 B;  4OPZ A;  1D7E A;  4WMC D;  2ZC5 B;  3FKW A;  1G6A A;  2C5W B;  5FEF A;  4HIA A;  3ZG8 B;  3KSF A;  4GHI A;  1FCO A;  4PHT A;  3MQ0 A;  3ULF A;  3UNW A;  2OV5 A;  3NEC A;  4JF5 A;  4EBL A;  4BQM A;  3M6H A;  2VGK A;  3A3D A;  4LGW A;  4EEP A;  3OPH A;  3Q07 A;  4G3W A;  2Y2I A;  3H7W B;  4MBH A;  3HVF A;  3W4Q A;  4UAA A;  4BBV A;  3UN7 A;  1JVJ A;  4ZJ3 A;  3T4T A;  4NXB A;  4R3J A;  3DWK A;  4QY6 A;  4GW9 A;  2ZC6 B;  2WKQ A;  4YIN A;  1NXY A;  1PI5 A;  3Q81 A;  4L9F A;  1VHM A;  4P0M A;  3UPP A;  4MMN A;  3OOV A;  3E98 A;  4I39 A;  2WUQ A;  3LEZ A;  1PI4 A;  5HWW A;  1LL5 A;  1VB6 A;  2Y59 A;  4KQD A;  3W8K A;  1JTG A;  1YT4 A;  1T19 A;  3BEC A;  5CGW A;  1IYP A;  1Y4O A;  1L0F A;  3FV7 A;  1EI5 A;  4FH2 A;  4MBK A;  3IF5 A;  2XR0 A;  5KSH A;  1PZO A;  1T1A A;  3IXH A;  3IX3 A;  2QKP A;  3VFH A;  5CGX A;  5CGS A;  3PBN A;  5TGF A;  5F83 A;  1XFQ A;  3FPW A;  4Q0J A;  1OT9 A;  3MXQ A;  2Y55 A;  2KOI A;  2PU4 A;  3HLE A;  1WYC A;  2ZLY A;  4OPY A;  4HNB A;  4EU0 A;  3EEH A;  4KZ6 A;  4R1G A;  3LO7 A;  4EBN A;  2QMI A;  4Y17 A;  1P9W A;  3OBF A;  5FL3 A;  3TRC A;  2Y2H A;  1N9L A;  2QJ7 A;  2ZQD A;  2M7V A;  3MKF A;  5C5K A;  3T12 B;  4E3I A;  2UV0 E;  3UB5 P;  2OWJ A;  1OME A;  5AJG A;  1IYQ A;  3HUM A; 
#chains in the Genus database with same CATH homology
 2DRW A;  1IEL A;  4KZ4 A;  3ITA A;  5E2H A;  2P9V A;  4KG6 A;  2ZMA A;  4BLM A;  3C4O A;  4ZDX A;  2IWC A;  3PTE A;  1MPL A;  1K55 A;  3DWZ A;  4UA7 A;  3VMA A;  4KZ7 A;  2XFS A;  3ZG5 A;  4E6X A;  4JXW A;  3ZFZ A;  3M6B A;  4C75 A;  5CHM A;  1N9B A;  1I5Q A;  3CG5 A;  1K56 A;  3N8L A;  4F94 A;  1RP5 A;  3UE3 A;  3B3X A;  5F1G A;  3UPN A;  4PM6 A;  2EXB A;  4B4X A;  1WYB A;  5CEC A;  5HAR A;  1SDN A;  2Y2K A;  1HTZ A;  4FCF A;  3UPO A;  4DKI A;  3PBQ A;  3S4X A;  4DE3 A;  4LV2 A;  2HP9 A;  1JWV A;  2Y2Q A;  3TSG A;  3BFF A;  5FAT A;  1K38 A;  3AGF A;  1MWS A;  1ERQ A;  3V39 A;  4LV1 A;  2WKI A;  1ALQ A;  4MBF A;  1SKF A;  3MXR A;  3WRT A;  2Q9M A;  4IBR A;  2R9X A;  3IWQ A;  1KGG A;  4X55 A;  4JF6 A;  2ZQ8 A;  2QZ6 A;  3FZC A;  4PPR A;  3RXW A;  4GNU A;  3V5M A;  3IF6 B;  4HBU A;  4E3M A;  3ZHH A;  3WS1 A;  5HW3 A;  2XF3 A;  3OPP A;  3ITB A;  4OLG A;  3UO9 A;  5EOE A;  1MXO A;  3VFF A;  4UA9 A;  3ZG9 B;  4RVA A;  3HLF A;  4X53 A;  4A5R A;  3IWI A;  3Q1F A;  3UY6 A;  3HBR A;  5FQJ A;  2DNS A;  4BD0 A;  5TR7 A;  4KQO A;  4WM9 A;  4Y7P A;  2WAD A;  2Y2N A;  1XX2 A;  2Q9N A;  4E3J A;  2IWD A;  2V20 A;  2WAE A;  4GZB A;  4ZJ1 A;  1YM1 A;  3C7V A;  4X6T A;  4OP8 A;  3TOI A;  4BEN A;  1I2S A;  4C3Q A;  4GD8 A;  1NZU A;  3C7U A;  3M2K A;  1YLW A;  5E2F A;  2Y2M A;  4RX3 A;  4HEF A;  4FSF A;  1MY8 A;  4LCL A;  1E25 A;  2H0Y A;  3VP4 A;  4DXC A;  3FYZ A;  4C6Y A;  1NZO A;  3GTC A;  5A91 A;  3MZE A;  1L2S A;  1LI0 A;  3Q7V B;  4NET A;  1SDE A;  1ESU A;  4JPM A;  4QD4 A;  4D2O A;  5CHJ A;  2C6W B;  1K6R A;  5HFO A;  5FAP A;  4S2J A;  1BUE A;  5GLD A;  1FCM A;  3QNB A;  1CI9 A;  4KZ8 A;  4RX2 A;  4CPK A;  1BLS A;  1CI8 A;  5FQ9 A;  4Y0T A;  4JBF A;  1W79 A;  3VP0 A;  3HUN A;  3OCN A;  3V3R A;  4B4Z A;  3OC2 A;  1CK3 A;  1ES5 A;  3BM6 A;  1PWD A;  4E3L A;  2Z2L B;  3G30 A;  4Q8I A;  4S2P A;  3WS2 A;  3ZDJ A;  4OOL A;  1DJC A;  4JXV A;  5CTN A;  1YMX A;  4WEL A;  3W4O A;  2J9O A;  2OSU A;  4ZBE A;  3CJM A;  4GDN A;  3VSL A;  4GD6 A;  4HBT A;  1XGI A;  4U0T A;  4MNR A;  1RGY A;  3NBL A;  4WEJ A;  1K6S A;  2X02 A;  3TG9 A;  2HDU A;  1IKI A;  2EXA A;  1PW1 A;  5L2F A;  3SH7 A;  3BLS A;  4R0Q A;  4U3T A;  4UHU A;  3S1Y A;  4E3K A;  5M18 A;  2J7V A;  4R4S A;  3OPL A;  3QNC A;  2WGW B;  2PBY A;  1LI9 A;  3P09 A;  4PMA A;  2WKE A;  4EQI A;  5M19 A;  1K54 A;  2H5S A;  1FSW A;  4DRT A;  1IKG A;  3A3I A;  2X01 A;  1K55 C;  3SS4 A;  3NI9 A;  3DW0 A;  3IWO A;  1NY0 A;  1S0W A;  5CRF A;  3RJU A;  1K4F A;  3NIA A;  1LL9 A;  1KE3 A;  2CC1 A;  4NK3 A;  5CXW A;  4EWF A;  1GHM A;  3MZD A;  3VSK A;  1GHP A;  5BOH A;  4QU3 A;  5G18 A;  3SS5 A;  5A90 A;  5KMW A;  2I72 A;  3NDE A;  4WYY A;  5FDH A;  1NYM A;  1K57 A;  2ZC7 A;  2HDS A;  3PBO A;  2G2U A;  5D3O A;  5IHV A;  1KGF A;  4S2M A;  3Q7Z A;  5F82 A;  3WS4 A;  4BL2 A;  3BLM A;  2PU2 A;  3IQA A;  4WBG A;  3IF6 A;  2G2W A;  5EE8 A;  4WZ4 A;  3VP1 A;  3WWX A;  1KE4 A;  1QMF A;  4N92 A;  1IYO A;  1E3U D;  4QY5 A;  4S2L A;  3BRM A;  1XKZ A;  4FD8 A;  1GA0 A;  3NDG A;  2X71 A;  3VOY A;  4OKP A;  3BYD A;  3GMW A;  1L0G A;  5HAQ A;  3N7W A;  4OLD A;  2XK1 A;  1FQG A;  4IBX A;  4OPQ A;  3IH9 A;  3ISG A;  2WZZ A;  2EFU A;  4PM7 A;  1CEG A;  4IED A;  3PBT A;  5DTS A;  3VOZ A;  1K25 A;  3NC8 A;  3RXX A;  4ZTK A;  4JKT A;  2HDQ A;  2IWB A;  4E3O A;  4JLF A;  3M2J A;  4KZB A;  4MEZ A;  2EFX A;  5A93 A;  1BTL A;  5DTT A;  4DDS A;  3OCL A;  2A49 A;  2WGV A;  3FWL A;  3HLC A;  5U47 A;  3ZVW A;  2BLS A;  3G35 A;  3E2K A;  1BLH A;  3Q7V A;  5KSC A;  1PWC A;  3IHB A;  4X56 A;  1JWZ A;  5E43 A;  2ZM8 A;  5GHX A;  1W7F A;  2Y2G A;  4OON A;  3OZH A;  2R9W A;  1Z6F A;  5EOO A;  5AQA A;  3V50 A;  3P98 A;  2ZQ7 A;  4KZ5 A;  2XLN A;  3G31 A;  5FQI A;  1Y54 A;  1DY6 A;  1KVL A;  1EWZ A;  1JTD A;  2Z2M B;  3G34 A;  2XD1 A;  3C5A A;  1O07 A;  1MWU A;  3N8S A;  4OVD A;  4UA6 A;  1XPB A;  1M6K A;  2HPB A;  4DE1 A;  4S2N A;  5I94 A;  1H5X A;  2J8Y A;  2JCH A;  4WZ5 A;  1BLP A;  5FI2 A;  1DJB A;  1TDG A;  3D4F A;  2XFT A;  5GHZ A;  3HRE A;  1BUL A;  3GRJ A;  3HL9 A;  1RCJ A;  1WE4 A;  2EX9 A;  1XA7 A;  4OQI A;  1ES4 A;  3ZG0 A;  3HLD A;  5GLC A;  1C3B A;  1VM1 A;  1NRF A;  1HD8 A;  5FQQ A;  3SH9 A;  1JWP A;  2XH9 A;  3PBR A;  4EBP A;  1ERM A;  3CMZ A;  5AQ9 A;  4KG5 A;  4JXG A;  1ESI A;  1H8Y A;  4N1X A;  1ZG6 A;  4H8R A;  1I2W A;  1ZKJ A;  1IYS A;  2XGN A;  4XUZ A;  4DE2 A;  2ZD8 A;  4PM5 A;  4R4R A;  4OP5 A;  5FI7 A;  3IXD A;  4U0X A;  2XEP A;  4IVI A;  5E2E A;  3ZCZ A;  4DXB A;  5EVL A;  4EV4 A;  3ZNY A;  1KVM A;  2WGW A;  5GLB A;  5DF8 A;  4LCM A;  3ZG7 B;  1FOF A;  1N4O A;  4FH4 A;  4N9K A;  2WGI A;  1SCW A;  1ERO A;  1H8Z A;  4DDY A;  5KZH A;  3ZNT A;  1W5D A;  1YLZ A;  3GSG A;  1MWR A;  3GVB A;  1HZO A;  2E8I A;  5TFQ A;  4BJP A;  2WYX A;  5JYP A;  1M40 A;  1ES3 A;  2HP6 A;  4JF4 A;  2Y4A A;  1K54 C;  1Q2Q A;  2Y2J A;  5FQK A;  1AXB A;  1J9M A;  2UWX A;  4ZJ2 A;  3JYI A;  3I7J A;  5DTK A;  3UDX A;  2VGJ A;  3N6I A;  3E2L A;  3IH8 A;  3IXB A;  3N4I A;  3SH8 A;  3UE1 A;  4JXS A;  5FQM A;  4Z9Q A;  2Y2O A;  3HLG A;  5EVI A;  2OLU A;  4L0L A;  4O7D A;  4R3B A;  4R23 A;  4XUX A;  3AGE A;  1K57 C;  1ES2 A;  4OQ0 A;  1S6R A;  4K0W A;  5EVI D;  3HLW A;  3UDF A;  4DE0 A;  4LV3 A;  4K0X A;  3O86 A;  4MLL A;  2ZM2 A;  4OQG A;  5GL9 A;  3IF6 C;  4OH0 A;  5EEC A;  2XQZ A;  4EUZ A;  3WS0 A;  1E3U A;  5HAP A;  4WMC A;  5FAO A;  1XXM A;  2JC7 A;  5EVI B;  1FSY A;  1GCE A;  1L0E A;  3LY4 A;  5GHY A;  1BT5 A;  5HAI A;  3UDI A;  4K91 A;  4WEK A;  1IEM A;  4DF6 A;  2JBF A;  4OPZ A;  3MBZ A;  1L0D A;  4WMC D;  2ZC5 B;  2WZX A;  1E4D A;  1O7E A;  3FKW A;  1G6A A;  2C5W B;  3MKE A;  3ZG8 B;  1FCO A;  1RGZ A;  3MFD A;  1W8Y A;  3UNW A;  2OV5 A;  5CED A;  4X69 A;  4GOG A;  4JF5 A;  4EBL A;  3ZGA B;  4BQM A;  3M6H A;  1FCN A;  2VGK A;  2Y2P A;  2OLV A;  5DF7 A;  1TEM A;  1ZG4 A;  3A3D A;  3BEB A;  2P9V B;  1YQS A;  1MBL A;  3GQZ A;  4GKU A;  1K56 D;  2XDM A;  1BSG A;  5DF9 A;  3OPH A;  1KDW A;  3Q07 A;  4GDB A;  4KQQ A;  2ZJ9 A;  2Y2I A;  1FR6 A;  3GR2 A;  5CTM A;  4YFM A;  5FI6 A;  4MBH A;  3HVF A;  3Q82 A;  1U60 A;  3W4Q A;  5HX9 A;  5FAS A;  2V2F F;  1YLP A;  4UAA A;  3BFC A;  3BFE A;  3UN7 A;  1JVJ A;  4ZJ3 A;  4R3J A;  4OQH A;  4LEN A;  2QPN A;  3DWK A;  4M3K A;  4QY6 A;  1BZA A;  4BL3 A;  2ZC6 B;  4PM8 A;  1TDL A;  4YIN A;  1NXY A;  1PI5 A;  3EQU A;  3LCE A;  4Y0U A;  3PAG A;  3QHY A;  2A3U A;  3Q81 A;  5J8X A;  1NYY A;  2B5R A;  2EX8 A;  4KZ9 A;  5E2G A;  4CJN A;  5M1A A;  5EPH A;  4S2N C;  3G2Y A;  1KE0 A;  4PM9 A;  5CEB A;  1YLJ A;  4P0M A;  3UPP A;  4WZ5 C;  4LV0 A;  3A3E A;  4N1H A;  5AQ7 A;  3AGD A;  5CHU A;  4KEN B;  4KQR A;  1LLB A;  2WUQ A;  1XGJ A;  3DTM A;  4Y0O A;  3A3F A;  4P85 A;  3V3S A;  3LEZ A;  1PI4 A;  2V1Z A;  3MZF A;  4OOY A;  4OPR A;  2HP5 A;  1MWT A;  1XP4 A;  2WK0 A;  3A3J A;  2Y2L A;  4E3N A;  1LL5 A;  2Y59 A;  3SS3 A;  1MKI A;  4S2O A;  1KDS A;  3W8K A;  1JTG A;  1YT4 A;  3NY4 A;  2ZM0 A;  1PWG A;  3BEC A;  5CGW A;  5FA7 A;  2XD5 A;  1IYP A;  3SOI A;  3C4P A;  3G32 A;  3MXS A;  1NJ4 A;  2P74 A;  3IXG A;  4GN2 A;  3WS5 A;  1PYY A;  4RYE A;  1BLC A;  1ZC2 A;  4KZ3 A;  2BG1 A;  1L0F A;  2WKH A;  1HVB A;  2ZC3 B;  3FV7 A;  1EI5 A;  3W4P A;  3O87 A;  1CEF A;  3HLB A;  2RCX A;  2H0T A;  3BFD A;  5EUA A;  3GV9 A;  4QJG A;  1YLT A;  4FH2 A;  4MBK A;  1PZP A;  2ZQC A;  2Y91 A;  4P6B A;  3IF5 A;  4P87 A;  3IT9 A;  4X68 A;  2XR0 A;  1W8Q A;  2FFY A;  5KSH A;  1YLY A;  1PZO A;  1QME A;  5AQB A;  4XXR A;  3S22 A;  3IXH A;  4B88 A;  4RA7 A;  3UE0 A;  1VQQ A;  5DVA A;  3VFH A;  5CGX A;  5CGS A;  2GDN A;  3IHA A;  1Q2P A;  3OPR A;  3PBN A;  1DJA A;  3PBS A;  4S2I A;  4ZAM A;  3PAE A;  5TGF A;  4KZA A;  4QB8 A;  3VP2 A;  1K4E A;  5F83 A;  3G4P A;  4BD1 A;  1PW8 A;  1KGE A;  3NCK A;  2ZQ9 A;  5F1F A;  1PIO A;  1ONH A;  2Y55 A;  5GLA A;  4E6W A;  3FKV A;  1TVF A;  2PU4 A;  3HLE A;  1FR1 A;  1WYC A;  4QHC A;  1LHY A;  1XA1 A;  1G68 A;  3EQV A;  3LY3 A;  2ZLY A;  3BFG A;  5EVI C;  4IVK A;  4OOM A;  1GA9 A;  4S2K A;  3N8R A;  4OPY A;  5JYO A;  2ZQA A;  2HDR A;  4KZ6 A;  4R1G A;  3LO7 A;  4ID4 A;  3ZVT A;  4EBN A;  2QMI A;  1GHI A;  2H10 A;  2DCF A;  5CER A;  1YMS A;  3CZD A;  1SHV A;  5FSR A;  5A92 A;  5HL1 A;  2ZC4 B;  2RL3 A;  2Y2H A;  2FFF B;  1ONG A;  2J9P A;  2ZQD A;  2EX2 A;  4KG2 A;  2EX6 A;  3O3V A;  3MKF A;  4N9L A;  3G2Z A;  4E3I A;  3HUO A;  4HES A;  5FAQ A;  2WAF A;  3VP3 A;  1OME A;  2JE5 A;  3O88 A;  1IYQ A;  4GB7 A;  3WRZ A;  3HUM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...