3RH8B

Crystal structure of the light-state dimer of fungal blue-light photoreceptor vivid
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
148
structure length
148
Chain Sequence
HTLYAPGGYDIMGYLIQIMNRPNPQVELGPVDTSCALILCDLKQKDTPIVYASEAFLYMTGYSNAEVLGRNCRFLQSPDGMVKPKSTRKYVDSNTINTIRKAIDRNAEVQVEVVNFKKNGQRFVNFLTIIPVRDETGEYRYSMGFQCE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a Light-Activated LOV Protein Dimer That Regulates Transcription.
pubmed doi rcsb
source organism Neurospora crassa
molecule tags Circadian clock protein
molecule keywords Vivid PAS protein VVD
total genus 34
structure length 148
sequence length 148
chains with identical sequence D
ec nomenclature
pdb deposition date 2011-04-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13426 PAS_9 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3rh8B00
4GHIB 3A0RA 3F1NB 1N9OA 4EW7A 4K08A 1TS7A 2PD7A 4HH3A 3LI9A 1N9NA 3IS2A 1OTBA 1T18A 4DJ2A 4HI4A 1TS6A 4MN5A 3CWFA 2KDKA 4M4XA 2PYRA 1V9ZA 4HNBA 3UMDA 5HWVA 5DKLA 2L0WA 4L9FA 1T1AA 5HWWA 1OJ5A 5TBMB 2JHEA 2PHYA 1XJ3A 2Z6CA 1S66L 3E4OA 3HJKA 3UB6A 4HH2A 4LLOB 5TBMA 4EEPA 5J4EA 3T50A 1G28A 4LPZA 4DJ3A 5EFWA 2PR5A 3PYPA 2ZBBA 3BY8A 2A24A 1DRMA 1LSXA 2INWA 2JN7A 3LI8A 2L1MA 4GS9A 4JGPA 4JGQA 2EA9A 4WUJA 4EETB 2OOLA 1S1ZA 4NXBA 3F1OB 5A8BA 2QHKA 1XFQA 2W27A 4LRXC 1XJ2A 3C2WA 5HWTA 2Z6DA 3IS2B 4B9OA 3NOPC 4BBTA 5KIZA 2QJ5A 4R3AA 1T19A 4JGRA 5DJTA 1OT6A 4EESA 3B33A 2VV8A 4PKYG 4F3LA 5J7EA 4KUOA 2V9AA 2W0NA 1DP9A 4XT2A 3NHQA 2YKHA 1D06A 1GSVA 1S1YA 5DJUA 3VE3A 2D01A 2PYPA 3GECA 1S67L 4HP9A 4HOIA 4I3JA 4LRZE 3MQOA 5HDCA 4XT2B 5I5LA 1XJ4A 4EXOA 3CAXA 3LIAA 5IU1A 2OWJA 5IS1A 1Y28A 1KOUA 3UB7A 3NJAA 2A24B 2WKPA 2VEAA 4HJ3A 1MZUA 4L9GA 3RTYA 3SW1A 1LSWA 3UE6A 1LL8A 1OTIA 1DP6A 2WKRA 3K3DA 4RQ9A 1OJGA 3UB9A 4BBUA 2V1AA 3CLOA 1TS8A 3MQQA 1EW0A 1TS0A 5DKKA 5F69A 3PHYA 3ZQ5A 1NWZA 4BBVA 2HV1A 3LUQA 1F9IA 4F3LB 3H7WB 5HSQA 2V0WA 4R38A 1OT9A 3MJQA 4NXFA 5HD5A 4WLAA 3MXQA 3LIFA 2GJ3A 1N9LA 3A0VA 4R6LA 3F1PA 2P7JA 4I3IA 3E4QA 3FC7A 3LICA 1XJ6A 3E4PA 1S4SA 2R78A 3F1PB 3VE4A 3EWKA 5HZHA 3NOTC 4GHIA 2QJ7A 1OTEA 3BWLA 3UB8A 2CMNA 3ICYA 3H82A 1LT0A 2PR6A 2YKFA 4HY8A 4I38A 5G4YA 2V0UA 4LRYC 5HD3A 5F68A 2OWHA 3A0SA 4EEUA 2VV7A 3H7WA 2VLGA 3IBRA 2K7SA 3KX0X 4KQDA 4NXGA 3UMEA 4I5SA 4WF0A 4EQ1A 5HDDA 4KUKA 2KX6A 1UWPX 3ULFA 3MFXA 4GCZA 1GSXA 1P97A 1JNUA 1T1CA 2QWSA 3D72A 4HJ4A 5AVEA 5HDSA 1D7EA 3BY9A 4GW9A 3RH8B 2ZOHA 3G6OA 2VV6A 4GS9B 4I3AA 3VOLA 5G4ZA 2PDRA 4JGOA 4E04A 1V9YA 2D02A 3K3CA 1P0ZA 3NOUC 1OTDA 5F5YA 2V1BA 1BYWA 2H28A 2WKQA 3GDIA 2I9VA 3LYXA 4H6JA 4NXEA 1X0OA 3H9WA 3LIDA 1T1BA 2QKPA 3LIEA 4HIAA 3P7NA 4R70A 4EERA 1DP8A 1VB6A 1F98A 1WA9A 1XFNA 4H6JB 4HP4A 1UWNX 4HQAA 2B02A 2BASA 1OTAA 4HJ6A 5F6AA 3MR0A 1UGUA 3HJIA 3EEHA 3OLOA 2ZOIA 4YWZA 4WL9A 1S4RA 3F1OA 5AVFA 4I39A 4L9EA 2M1CA 4HHDA 3F1NA 2J80A 2L4RA 1GSWA 3FG8A 3H82B 1LSVA 4MN6A 4PKYA 3C8CA 4WN5A 1ODVA 3LIBA 5J3WA 2PD8A
chains in the Genus database with same CATH superfamily
4PAUA 3DAVA 4Y7PA 4Y13A 4WMCD 4X69A 5E2EA 1K56A 5CTMA 3HJKA 4BJPA 3QNCA 5CGWA 2EX2A 1SKOA 2HP9A 1K55A 5EUAA 4FSFA 3IT9A 3IS2B 1W79A 4Q0JA 4NK3A 5U47A 3BFEA 1DP9A 4S2JA 4P0MA 2PU2A 2ZLYA 4CLCE 4OPRA 2RCXA 1PW1A 4P6BA 2E8JA 3ZQ5A 2X71A 3ZGAB 5HL1A 3F1PA 3FC7A 1XJ6A 3C38A 3WS1A 3ISGA 1H8MA 4U3TA 2HDSA 3Q7ZA 3KYEA 4OOYA 4EEUA 5A92A 2OLVA 4UHUA 3UE0A 4O7DA 2IWDA 5F1FA 4E3JA 4GS9B 3T4OA 1BZAA 4KZ6A 1BSGA 5TJJA 5F5YA 5M18A 2VGLS 2QMIA 4CLCD 3OZHA 4WBGA 4BENA 4HQAA 1PI5A 3ZNTA 4LCLA 4ETXA 2W1RA 4KQRA 3LY4A 3C8CA 3MZDA 1DJCA 4OP5A 5DTTA 1Q2QA 3FPVA 2H10A 3U2AA 3OCNA 5F1GA 5J4EA 2FZ0A 3PBQA 5CECA 4DJ3A 2A24A 3BW6A 3QNBA 3EOIA 5A8BA 4IEDA 4QD4A 4DE2A 3S22A 1OMEA 4LV1A 2QJ5A 1MBLA 4R3AA 4PKYG 1FILA 2ZM8A 3B42A 3G4PA 2XD1A 3E98A 5CGXA 4NKPA 2W3FA 4HESA 2Y2IA 4MEZA 2HDQA 3SW1A 1BLPA 2J9OA 4OLGA 1C3BA 1OTIA 1JVJA 3MXRA 3UB9A 1J9MA 1XGJA 3PHYA 4N9KA 3A3FA 3IH8A 2Y2QA 3MJQA 4Y0OA 4DKIA 3OCLA 5DF7A 3KSIA 3G32A 3NOTC 4K0WA 2CMNA 2XRNA 1XP4A 4L0LA 1JTGA 3T1SA 5HPIA 5FA7A 1EROA 3W4QA 4HJ4A 4BLMA 3HVFA 1NYYA 1V9YA 5E2FA 2HP5A 2O99A 2ZQAA 3DBAA 5FEFA 4HBUA 1Q2PA 4JXGA 1M40A 3S4XA 1H0MA 4EBNA 4GHIB 2VGJA 5FAOA 1PW8A 2HPBA 5FQQA 4B4ZA 1SDNA 3JPUA 3V3RA 3MS6A 1HLUP 3IF6A 5L2FA 2ZC6B 3IF6B 2VGLM 5GLBA 3CUEC 4Y5FA 2P9VA 5HWTA 1XJ2A 3IXBA 4OPQA 1MWUA 3NY4A 4F3LA 5DJUA 2J3WA 2D01A 5M19A 5E43A 4NG2A 4L9GA 1ALQA 4KG5A 5EVLA 3ZG9B 4BBUA 3VOYA 5F69A 3D4FA 1HTZA 4RX2A 1FR1A 1MWSA 1MC0A 3MXQA 3FWLA 4QWOA 2VJWA 4E6XA 3BWLA 2V0UA 4JBFA 3H7WA 5E2HA 3OPLA 2KX6A 4G3WA 5CGSA 3SS3A 5HDSA 4CLCC 4UA6A 2VV6A 4IHQA 5FAQA 1FOFA 5HD3A 2Y2JA 4G3VA 2XK1A 4KZ8A 3EEAA 3F1OA 4E3LA 4YOFA 1H8YA 3F1NA 2J80A 4Y2FA 1MPLA 1ONGA 4MMNA 1T18A 1JWZA 3BJNA 3C4OA 3GMWA 1S66L 4N9LA 3WS4A 1EI5A 2L1MA 4EETB 3FKWA 1XFQA 1W5DA 5G18A 2VV8A 2JKGA 4S2NA 1BUEA 4DRTA 5CERA 4XT2B 2WYXA 3T4KA 4JF6A 3PAGA 3MQQA 3SS4A 5DKKA 2XA7S 1G68A 3SH7A 3T4JA 3IXHA 4UEYA 3HLEA 2P7JA 3E4QA 1VHMA 2EX8A 2P9VB 3EWKA 4OH0A 5HARA 2O9CA 1SKFA 4OP8A 2EX9A 4ZTKA 3TJZC 2W3HA 1FQGA 4KG6A 5GHXA 2EWVA 3ZVWA 4I5SA 3UNWA 1UWPX 3T1QB 1GSXA 3D72A 1D7EA 2JE5A 5EVIB 1XGIA 4R3JA 2B95A 3IWQA 2P04A 2JC7A 4R70A 1E3UD 5BOHA 3M6HA 2VK3A 4N1XA 5TGFA 1IYQA 1SZVA 3MZFA 4WYYA 3EEHA 3T4QA 2AVXA 3Q82A 4I39A 4EWFA 3H82B 4WN5A 5CHUA 2V20A 3M2KA 4DJ2A 3IS2A 4OVDA 1VEUB 5CHJA 5DKLA 2L0WA 3E4OA 4GKUA 3NECA 3GRJA 3GQZA 3PYPA 1PIOA 2PT7A 4GD6A 5A93A 2VZWA 2EXBA 3TG9A 3FZCA 4YFMA 3Q7VB 2YKHA 2C6WB 4ZJ2A 1ZTUA 5I5LA 1KVLA 2V2FF 5A91A 5MC7A 3NULA 3ZDJA 5TFQA 3JVVA 4QB8A 3RFBA 3EQUA 4WZ5A 3W4OA 3CMZA 2HF6A 2G7UA 3VP3A 3LIFA 3L9KA 1L3LA 4FH2A 5DFYA 4X68A 3NDEA 2IWCA 3T1XA 5A90A 3ITBA 3C4PA 2PR6A 1I5QA 3DWZA 1IELA 4KQOA 1ERMA 4PM9A 3UDXA 2Y2NA 2K7SA 3P09A 2OSUA 1P97A 5EPHA 3C7VA 2D02A 1K38A 4H6JA 1W8QA 4FOFA 3VE3A 5IHVA 1WA9A 1ES3A 1WYCA 3ZYTA 1ZG4A 4D2OA 4GB7A 3QP5A 2J9PA 3MR0A 1TDGA 3HJIA 1SDEA 4O8GA 4L9EA 2M1CA 4P87A 2Y2LA 5GL9A 1ODVA 3S7PA 4LV0A 4R4SA 5J3WA 4XUXA 2PD8A 3WS5A 2Y79A 1FCNA 1K25A 3LCEA 3CWFA 2KDKA 2FFFB 3L7HA 2PHYA 2Z6CA 4GNUA 5HL6A 3A3DA 5EVID 3ZFZA 2PBDP 4II7A 4PHTA 4E3MA 2Y2MA 4GS9A 4MBKA 4NXBA 4ESPA 2WGWA 1W8YA 2Y2KA 4G3KA 1GA9A 5KIZA 4U0TA 5KMWA 2GDNA 4GOGA 3NHQA 3A3IA 1GSVA 2PYPA 4LRZE 5CHMA 4WEJA 2W3GA 2EFUA 3CAXA 2V8CA 1CI9A 2BTFP 2G2WA 2VEAA 5CTNA 4R4RA 3CLOA 5FSRA 3QHYA 2XEPA 4BBVA 1XPBA 4YINA 4IVKA 1P9WA 2V8FA 3HREA 3ZG7B 3NIAA 1SKOB 4FUWA 2O9AA 1YLWA 5FATA 4Y17A 4WZ5C 4KQDA 1YLJA 3P98A 4KUKA 5G4ZA 4E04A 3K3CA 4R0QA 2I9VA 1YAXA 3BECA 1VM1A 4HP4A 3UB5P 3KSFA 3E2KA 4CQHA 1IYSA 5EM0A 2VX8A 3AGEA 4GDNA 2L4RA 1GSWA 4Y15A 4MDZA 2OAP1 4LCMA 3LR4A 1JWVA 4DE3A 1NJ4A 1T1AA 5TBMB 3IXDA 3UPOA 2PR5A 1TF1A 2JKFA 2J3TD 4WUJA 1YMSA 2QZ6A 2JBFA 4LRXC 5E2GA 4JGRA 1HVBA 1K4EA 1Y54A 5AQ9A 1H3QA 5HDCA 2ZQ8A 3BEBA 1YLYA 1GHMA 5HW3A 5CEBA 4BMWA 5HSQA 5KZHA 3ZG5A 5DTKA 2QYBA 1E25A 1MWRA 4I3IA 2XF3A 1BT5A 3CZDA 4NETA 3LEZA 1STZA 1NLZA 1H8ZA 2OWHA 2Y55A 3A0SA 3LR0A 2B5RA 2VLGA 4NXGA 1U60A 5CXWA 2ZC4B 3UE3A 4PM8A 1T1CA 5FI7A 3D9YA 4OKPA 1LI0A 3FYZA 1FCOA 3NOUC 1RGYA 1QMFA 1FSWA 4EQIA 4HJ6A 2EXAA 2ZQCA 3DTMA 4O01A 3MQ0A 1YMXA 3IBJA 3ZVTA 3D3OA 1N9NA 3CJMA 4ZDXA 1YT4A 4M4XA 2XD5A 5GHYA 3I7JA 3UDFA 4CLCB 5TBMA 2H5SA 1PFLA 2ZBBA 1F5MA 4JGQA 3V67A 3ZNYA 3ITAA 4RVAA 4E3KA 1PWCA 5K5BA 1IEMA 3DTKA 4MBHA 3HLBA 1PZPA 3B33A 1ZKJA 4KUOA 3A3JA 4RYEA 4S2KA 1S1YA 1NLYA 3LIAA 4OONA 1KOUA 2XSSA 3R4KA 4JLFA 3UE6A 1ES5A 1LL8A 3GVBA 4RQ9A 1L0EA 3CPTB 4AFIA 1PRQA 3TSGA 4KZBA 1CJFA 2XQZA 3V39A 4R38A 4ZJ3A 4WLAA 1VETA 4NEED 1K55C 3F1PB 5FI6A 2WGIA 1O07A 4QU3A 2QJ7A 3NDGA 3HL9A 3S7QA 5DFXA 2YKFA 3MFDA 3T4SA 3VV4A 4ZRRA 3GV9A 3PBOA 4Q8IA 4X55A 1L2SA 4X6TA 4MCWA 2QWSA 3UPNA 3KYQA 4WM9A 3G6OA 2Y8HA 2PDRA 3UO9A 2WKQA 3GDIA 1SCWA 3R7WA 3HUNA 2DNSA 1KE3A 1G5UA 2WUQA 3FG8A 5FQKA 2A49A 2ZL1B 4K08A 1TS7A 2Y2GA 5FEGA 3Q1FA 1XJ3A 4OPYA 2FH5A 1K57C 4LPZA 5EVIC 4KENB 3UN7A 2K2NA 3G2YA 1K57A 5EVIA 4WELA 2EA9A 2XLNA 3G34A 3KO6A 1GA0A 5J7EA 2V9AA 2JKTI 4ID4A 1D06A 3MMHA 4HP9A 3IHAA 5KSHA 3E0YA 2QPNA 4JXVA 3UB7A 1FSYA 4HJ3A 5FQIA 1MWTA 3MZEA 5HAIA 1NWZA 1W63M 2GJ3A 1S4SA 3B3XA 3VE4A 4KZ3A 1FIKA 3DW0A 2KLIA 3ZCZA 3P01A 5EM1A 4B88A 4EU0A 3HBRA 1S0WA 1QMEA 5GHZA 3JYIA 1JNUA 5AVEA 2XFSA 1W7FA 4GW9A 3HLGA 3PBRA 4R23A 1P0ZA 5IU1A 5CEDA 3TW8A 1I2WA 3H9WA 2MJ6A 4OPZA 3LIEA 3O5YA 4UA9A 3WRZA 3E2LA 2ZOIA 1S4RA 4M3KA 2LB9A 3C30A 2A2LA 1L0GA 1CF0A 1AXBA 4Z1WA 4PKYA 2WKEA 4XUZA 1CI8A 2Y2PA 3A0RA 3F1NB 4IBXA 3MF0A 4E3OA 2JKTM 2P08A 1AWIA 2J7VA 2DMWA 3HUMA 4UA7A 4ARZA 5LBRA 3T50A 4E3NA 5L09A 1WYBA 1WE4A 2J3TC 2VGKA 2W27A 5FQ9A 1S6RA 4B9OA 4BBTA 4LV2A 5DJTA 4IBRA 3IH9A 4Q0IA 3ZHHA 1G6OA 3GECA 5CX7A 2XH9A 1XJ4A 1I2SA 5IS1A 1K56D 2A3UA 3K3DA 2LB5A 2XR0A 4MLLA 4F3LB 3LUQA 3H7WB 4PPRA 5F82A 1K6SA 2ZC7A 5L07A 4BQMA 4FTXA 4E3IA 3E4PA 3VSLA 3VP2A 3BLMA 3UB8A 3CITA 3CPTA 4C6YA 4ZBEA 3LEQA 1L0DA 2PAVP 4K0XA 4P85A 3IWIA 4EQ1A 3A3EA 5D3OA 4HBTA 3MFXA 1KE0A 1MKMA 3NBLA 3VOLA 1BTLA 3WS0A 2XFTA 3O88A 4EBLA 1DP8A 1VB6A 3UE1A 2M7VA 3IXGA 3S7OA 3KSGA 4HHDA 3DTIA 4KZ4A 2R9WA 1NRJA 1N9OA 3RXWA 1JTDA 1EWZA 4C3QA 2BG1A 3O87A 4HNBA 3UMDA 5DF8A 5HWWA 1W63Q 4FD8A 4JF5A 3BY8A 1K54A 4JGPA 3MSHA 3QP1A 2QHKA 2Z6DA 2UWXA 4U0XA 4ZAMA 2Y2HA 3N6IA 1KGEA 1ERQA 5AQAA 4H8RA 3QP4A 1NY0A 2R9XA 3NJAA 1KE4A 5FI2A 1MZUA 3RTYA 1XXMA 2V1ZA 4OOMA 1OJGA 2V1AA 1TS8A 4IUHA 3O3VA 1NYMA 4OOLA 3V50A 2ZM0A 2ZMFA 5AQBA 2Y59A 4KG2A 1G6AA 5FAPA 3SZTA 3RJUA 1ES4A 2ZQ9A 3BFCA 1XA1A 5FASA 1OTEA 4EV4A 4QPRA 3BM6A 5DF9A 3MKFA 1ESUA 3T4LA 3IBRA 2GNXA 3N4IA 4N92A 1IKGA 2WZXA 5L8MA 3ULFA 1PYYA 4XXRA 3BY9A 2HJEA 3BQAA 1PWDA 2E8IA 4HEFA 1Z09A 3N8LA 4NXEA 3LIDA 3PAEA 4R3BA 3BFGA 3NI9A 4MN6A 2WKIA 4KZ9A 5I94A 1NZOA 1LLBA 3PBTA 4EW7A 1A0KA 1K0KA 1SHVA 3EGDC 4HI4A 3WS2A 4KZAA 1OJ5A 2JHEA 4GLQA 4BWIA 1Y4OA 5EFWA 4S2OA 4FH4A 2G2UA 4PMAA 1IYPA 2PBYA 1ZG6A 2ACGA 1NZUA 3Q7VA 1OT6A 1VEUA 4EESA 1PNEA 1O7EA 4OQIA 4OQHA 4UAAA 4JKTA 5EE8A 3S1YA 3WRTA 1BLHA 3IX3A 3N8RA 2WKPA 4LV3A 1FR6A 2HJ9C 5HX9A 4ME4A 2O9BA 1TS0A 3WWXA 4B93A 1F9IA 1TD5A 2V0WA 1IKIA 3OPRA 5GLDA 2UV0E 3IQAA 1IOUA 4EUZA 4GDBA 5IT5A 2WK0A 3H82A 4S2LA 2VV7A 2FFYA 3MXSA 2ZD8A 3CI6A 2ZOHA 1LHYA 1YPRA 1GHIA 5J8XA 3QP8A 4JGOA 2C5WB 2X01A 3GR2A 1N9BA 4QHCA 1UWNX 2BASA 4KQQA 4IUKA 1DY6A 2HDRA 4IVIA 3SH9A 3W4PA 4IJGA 2O0YA 4CPKA 3SOIA 1OTBA 3T1RA 4S2MA 3O86A 3BQ8A 2ZMVA 2PYRA 3VFHA 4L9FA 3UB6A 4PM6A 4RX3A 2I72A 4HH2A 4LLOB 4QY5A 4DN0A 2ZJ9A 2ZM2A 1DRMA 1LSXA 2INWA 1IFQA 1K4FA 2JN7A 3LI8A 3C2WA 2HGVA 3LGOA 3SH8A 3JVUA 2ZL1A 1BULA 3LY3A 3N7WA 2XROA 4DE0A 3VSKA 3DWKA 2EWWA 3HLCA 2NUTC 2Q0OA 5DVAA 3S7NA 3R7WB 5EV0A 2ZC5B 1FCMA 3PTEA 1TDLA 3HLDA 4BL2A 2WADA 2BLSA 1E4DA 4P6ZS 3GSGA 3OOVA 2W3DA 3EGXC 3HUOA 3T4TA 4I38A 4LENA 1TEMA 3UMEA 4WF0A 3IF5A 5KSCA 4O0PA 2B18A 5AQ7A 3RH8B 1CEFA 3IWOA 4ETZA 4Y0UA 4X53A 5FQMA 2HZ5A 1BYWA 4ZJ1A 1YLZA 1PZOA 4P6ZM 1T1BA 2GZAA 5FL3A 2EFXA 1XA7A 1HD8A 1GCEA 3OLOA 3OPPA 1F2KA 2WGWB 3LIBA 3ZG0A 2PD7A 3ZG8B 1CQAA 5HPFA 4MN5A 2JKRI 3HLWA 5EECA 4BL3A 4EEPA 3G30A 5HFOA 4MN7A 4CLCA 2HP6A 3UY6A 4DDYA 3NC8A 2CC1A 4GD8A 4Q0HA 2OOLA 3OBFA 3AGFA 4WMCA 2W1TA 2IWBA 1RP5A 3LFVA 4XT2A 1XKZA 3BFFA 5EOOA 3QP2A 1BLSA 1Y28A 4JXWA 2Q9MA 1RCJA 1MXOA 1LSWA 3M2JA 1D1JA 5TR7A 1L0FA 3PXPA 3VP1A 1EW0A 1ESIA 3Q81A 3BLSA 2Z2MB 4NXFA 5HD5A 4BD1A 4X56A 3LO7A 2P74A 4GN2A 3V3SA 4EBPA 4KZ5A 2EX6A 3TRCA 5HZHA 4X1LA 4GHIA 1RGZA 3EQVA 1K54C 3GTCA 1VQQA 3ICYA 5DTSA 4FCFA 1LT0A 4HY8A 4MNRA 1LL9A 1ZC2A 5G4YA 4LRYC 5FQJA 3SS5A 1YLPA 3CHWP 3MBZA 1DJBA 1DJAA 1HZOA 4YNRA 1Z6FA 4MBFA 5EOEA 4S2IA 3IF6C 4I3AA 4F94A 1M6KA 2RL3A 2V1BA 3LYXA 4PM7A 1X0OA 2GX5A 1XFNA 2JCHA 3TOIA 4X25A 1KDWA 1OTAA 4DXBA 1UGUA 3W2ZA 4YWZA 3VFFA 1PWGA 1XX2A 2VA0A 2XGNA 3HLFA 4DF6A 4GZBA 3KSHA 2Q9NA 1TVFA 5JYPA 5GLAA 2NUPC 1YSPA 2M7UA 1TS6A 3IHBA 4KZ7A 1V9ZA 4WEKA 4DMZA 5HWVA 1YLTA 2X02A 4ARZB 2VKSA 3G2ZA 3CUEA 2PU4A 4LFUA 4QY6A 3IX8A 3PBNA 3FPWA 3K2NA 3PBSA 3QP6A 5GLCA 4DE1A 3G31A 2W3EA 5EVEA 2W0NA 2WAFA 4UQIS 2OLUA 3HCYA 4S2NC 1KVMA 3FKVA 4I3JA 4HOIA 3MQOA 5FDSA 2OWJA 3LR3A 1NRFA 2A24B 2ZC3B 1DP6A 2H0TA 4A5RA 2HV1A 3BYDA 2W1TB 2H0YA 3TE8A 3T12B 3C5AA 3LR5A 3MKEA 3KYZA 4OQGA 1N9LA 3A0VA 4WZ4A 3BFDA 3OPHA 2R78A 4UQIM 2K31A 1CEGA 3VP0A 5F83A 1MKIA 3KX0X 4JPMA 3C7UA 5HDDA 3PR6A 1YKDA 4DXCA 3CG5A 3UDIA 2Y2OA 4OQ0A 4X1MA 4Y3IA 3OC2A 2H28A 4N1HA 4JXSA 2QKPA 3P7NA 5F6AA 4WL9A 4CJNA 2Y4AA 5AVFA 2Z2LB 1OPXA 1LSVA 1H5XA 5CRFA 1YM1A 1CK3A 5HAPA 1GHPA 1IYOA 5AJGA 3NCKA 4HH3A 3LI9A 2ZQDA 2ZMAA 1JWPA 3VOZA 3B47A 2WKHA 5L10A 1G28A 4OLDA 2HDUA 2XDMA 3AGDA 2WZZA 4C75A 5C5KA 1S1ZA 3F1OB 3M6BA 2WAEA 4Y0TA 3NOPC 1T19A 1KGGA 4GJ4A 2J8YA 4D60A 2DCFA 4Z9QA 3V5MA 1S67L 4EXOA 2JKRM 2DRWA 3Q07A 4B4XA 2OV5A 1KGFA 1J3WA 1OT9A 4R1GA 3DTEA 4R6LA 3FV7A 1VETB 3LICA 2WGVA 2Y91A 4RA7A 4BD0A 3UPPA 1ZHHB 3VP4A 1MY8A 3RXXA 4K91A 1BLCA 3BRMA 3VMAA 1LL5A 1NXYA 5F68A 2IA2A 1E3UA 5FDHA 3W8KA 1P9RA 3N8SA 4GCZA 1YQSA 1ONHA 5M1AA 1N4OA 1K6RA 2ZQ7A 3U4LP 1ES2A 5JYOA 1OTDA 2KOIA 1LI9A 2OAQ1 4JF4A 4EERA 1PI4A 4HIAA 4E6WA 1F98A 4H6JB 2B02A 1ACFA 1YSQA 1KDSA 4EUVA 4PM5A 2PRFA 4DDSA 3G35A 2XA7M 5HAQA 4LGWA 4QJGA 2WKRA 3IX4A 4S2PA
chains in the Genus database with same CATH topology
4IJGA 2O0YA 4K08A 1TS7A 4DJ2A 3IS2A 1OTBA 4PAUA 3BQ8A 2ZMVA 2PYRA 5DKLA 2L0WA 4L9FA 1XJ3A 3E4OA 3HJKA 3UB6A 4BJPA 4HH2A 2FH5A 4LLOB 4DN0A 4LPZA 3PYPA 2PT7A 1DRMA 2K2NA 1LSXA 2INWA 1IFQA 2JN7A 3LI8A 4WELA 2EA9A 2VZWA 3C2WA 4FSFA 2HGVA 3IS2B 3JVUA 3KO6A 4Q0JA 5J7EA 2V9AA 2JKTI 1DP9A 2YKHA 1D06A 3MMHA 1ZTUA 2XROA 4HP9A 5I5LA 2EWWA 5KSHA 2NUTC 5MC7A 3E0YA 3UB7A 4HJ3A 4CLCE 3JVVA 3S7NA 3R7WB 3RFBA 3ZQ5A 1NWZA 1W63M 3EQUA 2HF6A 2G7UA 3LIFA 2GJ3A 3F1PA 3FC7A 5DFYA 1XJ6A 1S4SA 3C38A 4P6ZS 3VE4A 3OOVA 2W3DA 3EGXC 1H8MA 3T4TA 2KLIA 2PR6A 3P01A 4I38A 4KQOA 4EEUA 4EU0A 2K7SA 3UMEA 4WF0A 4O0PA 1P97A 1JNUA 2B18A 5AVEA 4GW9A 3RH8B 3PBRA 4GS9B 4ETZA 3T4OA 2D02A 5TJJA 5F5YA 1P0ZA 5IU1A 1BYWA 4FOFA 4H6JA 3TW8A 3VE3A 2VGLS 3H9WA 2MJ6A 4P6ZM 1T1BA 2GZAA 3LIEA 4CLCD 5FL3A 1WA9A 3ZYTA 4HQAA 3O5YA 3MR0A 3HJIA 3OLOA 2ZOIA 1S4RA 4ETXA 2LB9A 2W1RA 3C30A 4O8GA 4L9EA 2A2LA 2M1CA 4Z1WA 4PKYA 3C8CA 1ODVA 3S7PA 3LIBA 5J3WA 2PD8A 3A0RA 3F1NB 2PD7A 3MF0A 5HPFA 2Y79A 2JKTM 2P08A 4MN5A 3CWFA 2KDKA 2DMWA 2JKRI 3FPVA 3U2AA 3OCNA 4ARZA 2PHYA 2Z6CA 4EEPA 5J4EA 5HL6A 2FZ0A 4MN7A 5LBRA 3T50A 3PBQA 4DJ3A 4CLCA 4II7A 4PHTA 2A24A 3BW6A 4GS9A 3EOIA 2OOLA 4NXBA 2J3TC 3OBFA 4Q0HA 5A8BA 2W27A 4G3KA 4B9OA 4BBTA 5KIZA 2QJ5A 4R3AA 5DJTA 2W1TA 4PKYG 4Q0IA 3LFVA 4XT2A 3NHQA 1G6OA 1GSVA 2PYPA 3GECA 4LRZE 5CX7A 4WEJA 2W3GA 3B42A 1XJ4A 3CAXA 3E98A 4NKPA 1Y28A 5IS1A 2W3FA 2VEAA 3SW1A 1LSWA 1OTIA 3K3DA 2LB5A 3UB9A 3CLOA 3PXPA 1EW0A 3PHYA 4BBVA 4F3LB 3LUQA 3H7WB 3MJQA 4NXFA 5HD5A 1P9WA 3OCLA 3E4PA 3KSIA 3TRCA 5HZHA 3NOTC 4GHIA 3EQVA 3UB8A 2CMNA 3ICYA 2O9AA 2XRNA 3CITA 4L0LA 1LT0A 4HY8A 5HPIA 5G4YA 4LRYC 4KQDA 4EQ1A 4KUKA 3MFXA 4YNRA 4HJ4A 1MKMA 4I3AA 3VOLA 5G4ZA 4E04A 1V9YA 3K3CA 3LYXA 2V1BA 2I9VA 1X0OA 1YAXA 2GX5A 1DP8A 1VB6A 4HP4A 1XFNA 2O99A 2M7VA 3KSFA 1OTAA 3DBAA 3S7OA 1UGUA 3W2ZA 4YWZA 4CQHA 2VA0A 3KSGA 2VX8A 4HHDA 2L4RA 1GSWA 3KSHA 4MDZA 2OAP1 3LR4A 4GHIB 1NRJA 1N9OA 2NUPC 1YSPA 2M7UA 1TS6A 4WEKA 1V9ZA 4HNBA 3UMDA 4DMZA 5HWVA 1T1AA 5HWWA 5TBMB 4ARZB 2VKSA 3CUEA 1W63Q 2PR5A 2VGLM 1TF1A 3BY8A 3CUEC 4JGPA 2J3TD 4WUJA 4Y5FA 3PBNA 2QHKA 3FPWA 3K2NA 3PBSA 4LRXC 1XJ2A 5HWTA 2Z6DA 2W3EA 4JGRA 4F3LA 2W0NA 4UQIS 5DJUA 3HCYA 2J3WA 1H3QA 2D01A 5HDCA 4I3JA 4HOIA 3MQOA 2OWJA 3LR3A 3NJAA 2A24B 1MZUA 4L9GA 3RTYA 1DP6A 4OOMA 1OJGA 4BBUA 2V1AA 4BMWA 1TS8A 4IUHA 5F69A 5HSQA 2HV1A 2W1TB 3TE8A 3LR5A 4OOLA 2QYBA 3KYZA 3MXQA 1MC0A 2ZMFA 1N9LA 3A0VA 4I3IA 2R78A 4UQIM 2VJWA 2K31A 1OTEA 3BWLA 4QPRA 1STZA 1NLZA 5DF9A 2V0UA 3T4LA 2OWHA 3A0SA 3LR0A 3H7WA 3IBRA 2VLGA 4NXGA 2GNXA 3KX0X 5HDDA 3PR6A 2KX6A 1YKDA 4G3WA 5L8MA 3ULFA 3UE3A 5HDSA 4CLCC 1T1CA 3BY9A 2HJEA 3BQAA 2VV6A 4IHQA 4Y3IA 3OC2A 3NOUC 5HD3A 2H28A 4NXEA 4G3VA 3LIDA 2QKPA 3P7NA 4HJ6A 5F6AA 3EEAA 4WL9A 3F1OA 5AVFA 4YOFA 4O01A 3F1NA 2J80A 3MQ0A 1OPXA 4MN6A 4Y2FA 1LSVA 3IBJA 3PBTA 3D3OA 4EW7A 5AJGA 4HH3A 4MMNA 3LI9A 1N9NA 1T18A 3EGDC 4HI4A 3BJNA 4M4XA 3B47A 1OJ5A 2JHEA 4CLCB 4GLQA 4BWIA 1S66L 5TBMA 1G28A 5EFWA 2ZBBA 1F5MA 4JGQA 3V67A 2L1MA 4EETB 5C5KA 1S1ZA 3F1OB 1XFQA 5K5BA 3NOPC 1T19A 1OT6A 4EESA 3B33A 2VV8A 4KUOA 4GJ4A 1S1YA 1S67L 4EXOA 1NLYA 4XT2B 2JKRM 3LIAA 1KOUA 2XSSA 2WKPA 3R4KA 3UE6A 3T4KA 2HJ9C 1LL8A 4RQ9A 4ME4A 3MQQA 4AFIA 2O9BA 1TS0A 5DKKA 4B93A 2XA7S 3T4JA 1F9IA 1TD5A 4UEYA 2V0WA 4R38A 1OT9A 4WLAA 4R6LA 2P7JA 3E4QA 3LICA 4NEED 1VHMA 1IOUA 3F1PB 3EWKA 1ZHHB 2QJ7A 2O9CA 5IT5A 3H82A 3S7QA 5DFXA 2YKFA 3T4SA 3TJZC 3VV4A 2W3HA 5F68A 4ZRRA 2IA2A 2VV7A 3PBOA 2EWVA 4I5SA 1P9RA 1UWPX 4MCWA 4GCZA 1GSXA 2QWSA 3D72A 1D7EA 3CI6A 3KYQA 2ZOHA 3G6OA 2Y8HA 2PDRA 4JGOA 1OTDA 2KOIA 2WKQA 3GDIA 2P04A 2OAQ1 4EERA 4R70A 4HIAA 3R7WA 1F98A 4H6JB 1UWNX 2B02A 1YSQA 2BASA 4IUKA 4EUVA 3EEHA 3T4QA 2XA7M 4I39A 3FG8A 3H82B 4WN5A 2WKRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GHI B;  3A0R A;  3F1N B;  1N9O A;  4EW7 A;  4K08 A;  1TS7 A;  2PD7 A;  4HH3 A;  3LI9 A;  1N9N A;  3IS2 A;  1OTB A;  1T18 A;  4DJ2 A;  4HI4 A;  1TS6 A;  4MN5 A;  3CWF A;  2KDK A;  4M4X A;  2PYR A;  1V9Z A;  4HNB A;  3UMD A;  5HWV A;  5DKL A;  2L0W A;  4L9F A;  1T1A A;  5HWW A;  1OJ5 A;  5TBM B;  2JHE A;  2PHY A;  1XJ3 A;  2Z6C A;  1S66 L;  3E4O A;  3HJK A;  3UB6 A;  4HH2 A;  4LLO B;  5TBM A;  4EEP A;  5J4E A;  3T50 A;  1G28 A;  4LPZ A;  4DJ3 A;  5EFW A;  2PR5 A;  3PYP A;  2ZBB A;  3BY8 A;  2A24 A;  1DRM A;  1LSX A;  2INW A;  2JN7 A;  3LI8 A;  2L1M A;  4GS9 A;  4JGP A;  4JGQ A;  2EA9 A;  4WUJ A;  4EET B;  2OOL A;  1S1Z A;  4NXB A;  3F1O B;  5A8B A;  2QHK A;  1XFQ A;  2W27 A;  4LRX C;  1XJ2 A;  3C2W A;  5HWT A;  2Z6D A;  3IS2 B;  4B9O A;  3NOP C;  4BBT A;  5KIZ A;  2QJ5 A;  4R3A A;  1T19 A;  4JGR A;  5DJT A;  1OT6 A;  4EES A;  3B33 A;  2VV8 A;  4PKY G;  4F3L A;  5J7E A;  4KUO A;  2V9A A;  2W0N A;  1DP9 A;  4XT2 A;  3NHQ A;  2YKH A;  1D06 A;  1GSV A;  1S1Y A;  5DJU A;  3VE3 A;  2D01 A;  2PYP A;  3GEC A;  1S67 L;  4HP9 A;  4HOI A;  4I3J A;  4LRZ E;  3MQO A;  5HDC A;  4XT2 B;  5I5L A;  1XJ4 A;  4EXO A;  3CAX A;  3LIA A;  5IU1 A;  2OWJ A;  5IS1 A;  1Y28 A;  1KOU A;  3UB7 A;  3NJA A;  2A24 B;  2WKP A;  2VEA A;  4HJ3 A;  1MZU A;  4L9G A;  3RTY A;  3SW1 A;  1LSW A;  3UE6 A;  1LL8 A;  1OTI A;  1DP6 A;  2WKR A;  3K3D A;  4RQ9 A;  1OJG A;  3UB9 A;  4BBU A;  2V1A A;  3CLO A;  1TS8 A;  3MQQ A;  1EW0 A;  1TS0 A;  5DKK A;  5F69 A;  3PHY A;  3ZQ5 A;  1NWZ A;  4BBV A;  2HV1 A;  3LUQ A;  1F9I A;  4F3L B;  3H7W B;  5HSQ A;  2V0W A;  4R38 A;  1OT9 A;  3MJQ A;  4NXF A;  5HD5 A;  4WLA A;  3MXQ A;  3LIF A;  2GJ3 A;  1N9L A;  3A0V A;  4R6L A;  3F1P A;  2P7J A;  4I3I A;  3E4Q A;  3FC7 A;  3LIC A;  1XJ6 A;  3E4P A;  1S4S A;  2R78 A;  3F1P B;  3VE4 A;  3EWK A;  5HZH A;  3NOT C;  4GHI A;  2QJ7 A;  1OTE A;  3BWL A;  3UB8 A;  2CMN A;  3ICY A;  3H82 A;  1LT0 A;  2PR6 A;  2YKF A;  4HY8 A;  4I38 A;  5G4Y A;  2V0U A;  4LRY C;  5HD3 A;  5F68 A;  2OWH A;  3A0S A;  4EEU A;  2VV7 A;  3H7W A;  2VLG A;  3IBR A;  2K7S A;  3KX0 X;  4KQD A;  4NXG A;  3UME A;  4I5S A;  4WF0 A;  4EQ1 A;  5HDD A;  4KUK A;  2KX6 A;  1UWP X;  3ULF A;  3MFX A;  4GCZ A;  1GSX A;  1P97 A;  1JNU A;  1T1C A;  2QWS A;  3D72 A;  4HJ4 A;  5AVE A;  5HDS A;  1D7E A;  3BY9 A;  4GW9 A;  3RH8 B;  2ZOH A;  3G6O A;  2VV6 A;  4GS9 B;  4I3A A;  3VOL A;  5G4Z A;  2PDR A;  4JGO A;  4E04 A;  1V9Y A;  2D02 A;  3K3C A;  1P0Z A;  3NOU C;  1OTD A;  5F5Y A;  2V1B A;  1BYW A;  2H28 A;  2WKQ A;  3GDI A;  2I9V A;  3LYX A;  4H6J A;  4NXE A;  1X0O A;  3H9W A;  3LID A;  1T1B A;  2QKP A;  3LIE A;  4HIA A;  3P7N A;  4R70 A;  4EER A;  1DP8 A;  1VB6 A;  1F98 A;  1WA9 A;  1XFN A;  4H6J B;  4HP4 A;  1UWN X;  4HQA A;  2B02 A;  2BAS A;  1OTA A;  4HJ6 A;  5F6A A;  3MR0 A;  1UGU A;  3HJI A;  3EEH A;  3OLO A;  2ZOI A;  4YWZ A;  4WL9 A;  1S4R A;  3F1O A;  5AVF A;  4I39 A;  4L9E A;  2M1C A;  4HHD A;  3F1N A;  2J80 A;  2L4R A;  1GSW A;  3FG8 A;  3H82 B;  1LSV A;  4MN6 A;  4PKY A;  3C8C A;  4WN5 A;  1ODV A;  3LIB A;  5J3W A;  2PD8 A; 
#chains in the Genus database with same CATH topology
 4PAU A;  3DAV A;  4Y7P A;  4Y13 A;  4WMC D;  4X69 A;  5E2E A;  1K56 A;  5CTM A;  3HJK A;  4BJP A;  3QNC A;  5CGW A;  2EX2 A;  1SKO A;  2HP9 A;  1K55 A;  5EUA A;  4FSF A;  3IT9 A;  3IS2 B;  1W79 A;  4Q0J A;  4NK3 A;  5U47 A;  3BFE A;  1DP9 A;  4S2J A;  4P0M A;  2PU2 A;  2ZLY A;  4CLC E;  4OPR A;  2RCX A;  1PW1 A;  4P6B A;  2E8J A;  3ZQ5 A;  2X71 A;  3ZGA B;  5HL1 A;  3F1P A;  3FC7 A;  1XJ6 A;  3C38 A;  3WS1 A;  3ISG A;  1H8M A;  4U3T A;  2HDS A;  3Q7Z A;  3KYE A;  4OOY A;  4EEU A;  5A92 A;  2OLV A;  4UHU A;  3UE0 A;  4O7D A;  2IWD A;  5F1F A;  4E3J A;  4GS9 B;  3T4O A;  1BZA A;  4KZ6 A;  1BSG A;  5TJJ A;  5F5Y A;  5M18 A;  2VGL S;  2QMI A;  4CLC D;  3OZH A;  4WBG A;  4BEN A;  4HQA A;  1PI5 A;  3ZNT A;  4LCL A;  4ETX A;  2W1R A;  4KQR A;  3LY4 A;  3C8C A;  3MZD A;  1DJC A;  4OP5 A;  5DTT A;  1Q2Q A;  3FPV A;  2H10 A;  3U2A A;  3OCN A;  5F1G A;  5J4E A;  2FZ0 A;  3PBQ A;  5CEC A;  4DJ3 A;  2A24 A;  3BW6 A;  3QNB A;  3EOI A;  5A8B A;  4IED A;  4QD4 A;  4DE2 A;  3S22 A;  1OME A;  4LV1 A;  2QJ5 A;  1MBL A;  4R3A A;  4PKY G;  1FIL A;  2ZM8 A;  3B42 A;  3G4P A;  2XD1 A;  3E98 A;  5CGX A;  4NKP A;  2W3F A;  4HES A;  2Y2I A;  4MEZ A;  2HDQ A;  3SW1 A;  1BLP A;  2J9O A;  4OLG A;  1C3B A;  1OTI A;  1JVJ A;  3MXR A;  3UB9 A;  1J9M A;  1XGJ A;  3PHY A;  4N9K A;  3A3F A;  3IH8 A;  2Y2Q A;  3MJQ A;  4Y0O A;  4DKI A;  3OCL A;  5DF7 A;  3KSI A;  3G32 A;  3NOT C;  4K0W A;  2CMN A;  2XRN A;  1XP4 A;  4L0L A;  1JTG A;  3T1S A;  5HPI A;  5FA7 A;  1ERO A;  3W4Q A;  4HJ4 A;  4BLM A;  3HVF A;  1NYY A;  1V9Y A;  5E2F A;  2HP5 A;  2O99 A;  2ZQA A;  3DBA A;  5FEF A;  4HBU A;  1Q2P A;  4JXG A;  1M40 A;  3S4X A;  1H0M A;  4EBN A;  4GHI B;  2VGJ A;  5FAO A;  1PW8 A;  2HPB A;  5FQQ A;  4B4Z A;  1SDN A;  3JPU A;  3V3R A;  3MS6 A;  1HLU P;  3IF6 A;  5L2F A;  2ZC6 B;  3IF6 B;  2VGL M;  5GLB A;  3CUE C;  4Y5F A;  2P9V A;  5HWT A;  1XJ2 A;  3IXB A;  4OPQ A;  1MWU A;  3NY4 A;  4F3L A;  5DJU A;  2J3W A;  2D01 A;  5M19 A;  5E43 A;  4NG2 A;  4L9G A;  1ALQ A;  4KG5 A;  5EVL A;  3ZG9 B;  4BBU A;  3VOY A;  5F69 A;  3D4F A;  1HTZ A;  4RX2 A;  1FR1 A;  1MWS A;  1MC0 A;  3MXQ A;  3FWL A;  4QWO A;  2VJW A;  4E6X A;  3BWL A;  2V0U A;  4JBF A;  3H7W A;  5E2H A;  3OPL A;  2KX6 A;  4G3W A;  5CGS A;  3SS3 A;  5HDS A;  4CLC C;  4UA6 A;  2VV6 A;  4IHQ A;  5FAQ A;  1FOF A;  5HD3 A;  2Y2J A;  4G3V A;  2XK1 A;  4KZ8 A;  3EEA A;  3F1O A;  4E3L A;  4YOF A;  1H8Y A;  3F1N A;  2J80 A;  4Y2F A;  1MPL A;  1ONG A;  4MMN A;  1T18 A;  1JWZ A;  3BJN A;  3C4O A;  3GMW A;  1S66 L;  4N9L A;  3WS4 A;  1EI5 A;  2L1M A;  4EET B;  3FKW A;  1XFQ A;  1W5D A;  5G18 A;  2VV8 A;  2JKG A;  4S2N A;  1BUE A;  4DRT A;  5CER A;  4XT2 B;  2WYX A;  3T4K A;  4JF6 A;  3PAG A;  3MQQ A;  3SS4 A;  5DKK A;  2XA7 S;  1G68 A;  3SH7 A;  3T4J A;  3IXH A;  4UEY A;  3HLE A;  2P7J A;  3E4Q A;  1VHM A;  2EX8 A;  2P9V B;  3EWK A;  4OH0 A;  5HAR A;  2O9C A;  1SKF A;  4OP8 A;  2EX9 A;  4ZTK A;  3TJZ C;  2W3H A;  1FQG A;  4KG6 A;  5GHX A;  2EWV A;  3ZVW A;  4I5S A;  3UNW A;  1UWP X;  3T1Q B;  1GSX A;  3D72 A;  1D7E A;  2JE5 A;  5EVI B;  1XGI A;  4R3J A;  2B95 A;  3IWQ A;  2P04 A;  2JC7 A;  4R70 A;  1E3U D;  5BOH A;  3M6H A;  2VK3 A;  4N1X A;  5TGF A;  1IYQ A;  1SZV A;  3MZF A;  4WYY A;  3EEH A;  3T4Q A;  2AVX A;  3Q82 A;  4I39 A;  4EWF A;  3H82 B;  4WN5 A;  5CHU A;  2V20 A;  3M2K A;  4DJ2 A;  3IS2 A;  4OVD A;  1VEU B;  5CHJ A;  5DKL A;  2L0W A;  3E4O A;  4GKU A;  3NEC A;  3GRJ A;  3GQZ A;  3PYP A;  1PIO A;  2PT7 A;  4GD6 A;  5A93 A;  2VZW A;  2EXB A;  3TG9 A;  3FZC A;  4YFM A;  3Q7V B;  2YKH A;  2C6W B;  4ZJ2 A;  1ZTU A;  5I5L A;  1KVL A;  2V2F F;  5A91 A;  5MC7 A;  3NUL A;  3ZDJ A;  5TFQ A;  3JVV A;  4QB8 A;  3RFB A;  3EQU A;  4WZ5 A;  3W4O A;  3CMZ A;  2HF6 A;  2G7U A;  3VP3 A;  3LIF A;  3L9K A;  1L3L A;  4FH2 A;  5DFY A;  4X68 A;  3NDE A;  2IWC A;  3T1X A;  5A90 A;  3ITB A;  3C4P A;  2PR6 A;  1I5Q A;  3DWZ A;  1IEL A;  4KQO A;  1ERM A;  4PM9 A;  3UDX A;  2Y2N A;  2K7S A;  3P09 A;  2OSU A;  1P97 A;  5EPH A;  3C7V A;  2D02 A;  1K38 A;  4H6J A;  1W8Q A;  4FOF A;  3VE3 A;  5IHV A;  1WA9 A;  1ES3 A;  1WYC A;  3ZYT A;  1ZG4 A;  4D2O A;  4GB7 A;  3QP5 A;  2J9P A;  3MR0 A;  1TDG A;  3HJI A;  1SDE A;  4O8G A;  4L9E A;  2M1C A;  4P87 A;  2Y2L A;  5GL9 A;  1ODV A;  3S7P A;  4LV0 A;  4R4S A;  5J3W A;  4XUX A;  2PD8 A;  3WS5 A;  2Y79 A;  1FCN A;  1K25 A;  3LCE A;  3CWF A;  2KDK A;  2FFF B;  3L7H A;  2PHY A;  2Z6C A;  4GNU A;  5HL6 A;  3A3D A;  5EVI D;  3ZFZ A;  2PBD P;  4II7 A;  4PHT A;  4E3M A;  2Y2M A;  4GS9 A;  4MBK A;  4NXB A;  4ESP A;  2WGW A;  1W8Y A;  2Y2K A;  4G3K A;  1GA9 A;  5KIZ A;  4U0T A;  5KMW A;  2GDN A;  4GOG A;  3NHQ A;  3A3I A;  1GSV A;  2PYP A;  4LRZ E;  5CHM A;  4WEJ A;  2W3G A;  2EFU A;  3CAX A;  2V8C A;  1CI9 A;  2BTF P;  2G2W A;  2VEA A;  5CTN A;  4R4R A;  3CLO A;  5FSR A;  3QHY A;  2XEP A;  4BBV A;  1XPB A;  4YIN A;  4IVK A;  1P9W A;  2V8F A;  3HRE A;  3ZG7 B;  3NIA A;  1SKO B;  4FUW A;  2O9A A;  1YLW A;  5FAT A;  4Y17 A;  4WZ5 C;  4KQD A;  1YLJ A;  3P98 A;  4KUK A;  5G4Z A;  4E04 A;  3K3C A;  4R0Q A;  2I9V A;  1YAX A;  3BEC A;  1VM1 A;  4HP4 A;  3UB5 P;  3KSF A;  3E2K A;  4CQH A;  1IYS A;  5EM0 A;  2VX8 A;  3AGE A;  4GDN A;  2L4R A;  1GSW A;  4Y15 A;  4MDZ A;  2OAP 1;  4LCM A;  3LR4 A;  1JWV A;  4DE3 A;  1NJ4 A;  1T1A A;  5TBM B;  3IXD A;  3UPO A;  2PR5 A;  1TF1 A;  2JKF A;  2J3T D;  4WUJ A;  1YMS A;  2QZ6 A;  2JBF A;  4LRX C;  5E2G A;  4JGR A;  1HVB A;  1K4E A;  1Y54 A;  5AQ9 A;  1H3Q A;  5HDC A;  2ZQ8 A;  3BEB A;  1YLY A;  1GHM A;  5HW3 A;  5CEB A;  4BMW A;  5HSQ A;  5KZH A;  3ZG5 A;  5DTK A;  2QYB A;  1E25 A;  1MWR A;  4I3I A;  2XF3 A;  1BT5 A;  3CZD A;  4NET A;  3LEZ A;  1STZ A;  1NLZ A;  1H8Z A;  2OWH A;  2Y55 A;  3A0S A;  3LR0 A;  2B5R A;  2VLG A;  4NXG A;  1U60 A;  5CXW A;  2ZC4 B;  3UE3 A;  4PM8 A;  1T1C A;  5FI7 A;  3D9Y A;  4OKP A;  1LI0 A;  3FYZ A;  1FCO A;  3NOU C;  1RGY A;  1QMF A;  1FSW A;  4EQI A;  4HJ6 A;  2EXA A;  2ZQC A;  3DTM A;  4O01 A;  3MQ0 A;  1YMX A;  3IBJ A;  3ZVT A;  3D3O A;  1N9N A;  3CJM A;  4ZDX A;  1YT4 A;  4M4X A;  2XD5 A;  5GHY A;  3I7J A;  3UDF A;  4CLC B;  5TBM A;  2H5S A;  1PFL A;  2ZBB A;  1F5M A;  4JGQ A;  3V67 A;  3ZNY A;  3ITA A;  4RVA A;  4E3K A;  1PWC A;  5K5B A;  1IEM A;  3DTK A;  4MBH A;  3HLB A;  1PZP A;  3B33 A;  1ZKJ A;  4KUO A;  3A3J A;  4RYE A;  4S2K A;  1S1Y A;  1NLY A;  3LIA A;  4OON A;  1KOU A;  2XSS A;  3R4K A;  4JLF A;  3UE6 A;  1ES5 A;  1LL8 A;  3GVB A;  4RQ9 A;  1L0E A;  3CPT B;  4AFI A;  1PRQ A;  3TSG A;  4KZB A;  1CJF A;  2XQZ A;  3V39 A;  4R38 A;  4ZJ3 A;  4WLA A;  1VET A;  4NEE D;  1K55 C;  3F1P B;  5FI6 A;  2WGI A;  1O07 A;  4QU3 A;  2QJ7 A;  3NDG A;  3HL9 A;  3S7Q A;  5DFX A;  2YKF A;  3MFD A;  3T4S A;  3VV4 A;  4ZRR A;  3GV9 A;  3PBO A;  4Q8I A;  4X55 A;  1L2S A;  4X6T A;  4MCW A;  2QWS A;  3UPN A;  3KYQ A;  4WM9 A;  3G6O A;  2Y8H A;  2PDR A;  3UO9 A;  2WKQ A;  3GDI A;  1SCW A;  3R7W A;  3HUN A;  2DNS A;  1KE3 A;  1G5U A;  2WUQ A;  3FG8 A;  5FQK A;  2A49 A;  2ZL1 B;  4K08 A;  1TS7 A;  2Y2G A;  5FEG A;  3Q1F A;  1XJ3 A;  4OPY A;  2FH5 A;  1K57 C;  4LPZ A;  5EVI C;  4KEN B;  3UN7 A;  2K2N A;  3G2Y A;  1K57 A;  5EVI A;  4WEL A;  2EA9 A;  2XLN A;  3G34 A;  3KO6 A;  1GA0 A;  5J7E A;  2V9A A;  2JKT I;  4ID4 A;  1D06 A;  3MMH A;  4HP9 A;  3IHA A;  5KSH A;  3E0Y A;  2QPN A;  4JXV A;  3UB7 A;  1FSY A;  4HJ3 A;  5FQI A;  1MWT A;  3MZE A;  5HAI A;  1NWZ A;  1W63 M;  2GJ3 A;  1S4S A;  3B3X A;  3VE4 A;  4KZ3 A;  1FIK A;  3DW0 A;  2KLI A;  3ZCZ A;  3P01 A;  5EM1 A;  4B88 A;  4EU0 A;  3HBR A;  1S0W A;  1QME A;  5GHZ A;  3JYI A;  1JNU A;  5AVE A;  2XFS A;  1W7F A;  4GW9 A;  3HLG A;  3PBR A;  4R23 A;  1P0Z A;  5IU1 A;  5CED A;  3TW8 A;  1I2W A;  3H9W A;  2MJ6 A;  4OPZ A;  3LIE A;  3O5Y A;  4UA9 A;  3WRZ A;  3E2L A;  2ZOI A;  1S4R A;  4M3K A;  2LB9 A;  3C30 A;  2A2L A;  1L0G A;  1CF0 A;  1AXB A;  4Z1W A;  4PKY A;  2WKE A;  4XUZ A;  1CI8 A;  2Y2P A;  3A0R A;  3F1N B;  4IBX A;  3MF0 A;  4E3O A;  2JKT M;  2P08 A;  1AWI A;  2J7V A;  2DMW A;  3HUM A;  4UA7 A;  4ARZ A;  5LBR A;  3T50 A;  4E3N A;  5L09 A;  1WYB A;  1WE4 A;  2J3T C;  2VGK A;  2W27 A;  5FQ9 A;  1S6R A;  4B9O A;  4BBT A;  4LV2 A;  5DJT A;  4IBR A;  3IH9 A;  4Q0I A;  3ZHH A;  1G6O A;  3GEC A;  5CX7 A;  2XH9 A;  1XJ4 A;  1I2S A;  5IS1 A;  1K56 D;  2A3U A;  3K3D A;  2LB5 A;  2XR0 A;  4MLL A;  4F3L B;  3LUQ A;  3H7W B;  4PPR A;  5F82 A;  1K6S A;  2ZC7 A;  5L07 A;  4BQM A;  4FTX A;  4E3I A;  3E4P A;  3VSL A;  3VP2 A;  3BLM A;  3UB8 A;  3CIT A;  3CPT A;  4C6Y A;  4ZBE A;  3LEQ A;  1L0D A;  2PAV P;  4K0X A;  4P85 A;  3IWI A;  4EQ1 A;  3A3E A;  5D3O A;  4HBT A;  3MFX A;  1KE0 A;  1MKM A;  3NBL A;  3VOL A;  1BTL A;  3WS0 A;  2XFT A;  3O88 A;  4EBL A;  1DP8 A;  1VB6 A;  3UE1 A;  2M7V A;  3IXG A;  3S7O A;  3KSG A;  4HHD A;  3DTI A;  4KZ4 A;  2R9W A;  1NRJ A;  1N9O A;  3RXW A;  1JTD A;  1EWZ A;  4C3Q A;  2BG1 A;  3O87 A;  4HNB A;  3UMD A;  5DF8 A;  5HWW A;  1W63 Q;  4FD8 A;  4JF5 A;  3BY8 A;  1K54 A;  4JGP A;  3MSH A;  3QP1 A;  2QHK A;  2Z6D A;  2UWX A;  4U0X A;  4ZAM A;  2Y2H A;  3N6I A;  1KGE A;  1ERQ A;  5AQA A;  4H8R A;  3QP4 A;  1NY0 A;  2R9X A;  3NJA A;  1KE4 A;  5FI2 A;  1MZU A;  3RTY A;  1XXM A;  2V1Z A;  4OOM A;  1OJG A;  2V1A A;  1TS8 A;  4IUH A;  3O3V A;  1NYM A;  4OOL A;  3V50 A;  2ZM0 A;  2ZMF A;  5AQB A;  2Y59 A;  4KG2 A;  1G6A A;  5FAP A;  3SZT A;  3RJU A;  1ES4 A;  2ZQ9 A;  3BFC A;  1XA1 A;  5FAS A;  1OTE A;  4EV4 A;  4QPR A;  3BM6 A;  5DF9 A;  3MKF A;  1ESU A;  3T4L A;  3IBR A;  2GNX A;  3N4I A;  4N92 A;  1IKG A;  2WZX A;  5L8M A;  3ULF A;  1PYY A;  4XXR A;  3BY9 A;  2HJE A;  3BQA A;  1PWD A;  2E8I A;  4HEF A;  1Z09 A;  3N8L A;  4NXE A;  3LID A;  3PAE A;  4R3B A;  3BFG A;  3NI9 A;  4MN6 A;  2WKI A;  4KZ9 A;  5I94 A;  1NZO A;  1LLB A;  3PBT A;  4EW7 A;  1A0K A;  1K0K A;  1SHV A;  3EGD C;  4HI4 A;  3WS2 A;  4KZA A;  1OJ5 A;  2JHE A;  4GLQ A;  4BWI A;  1Y4O A;  5EFW A;  4S2O A;  4FH4 A;  2G2U A;  4PMA A;  1IYP A;  2PBY A;  1ZG6 A;  2ACG A;  1NZU A;  3Q7V A;  1OT6 A;  1VEU A;  4EES A;  1PNE A;  1O7E A;  4OQI A;  4OQH A;  4UAA A;  4JKT A;  5EE8 A;  3S1Y A;  3WRT A;  1BLH A;  3IX3 A;  3N8R A;  2WKP A;  4LV3 A;  1FR6 A;  2HJ9 C;  5HX9 A;  4ME4 A;  2O9B A;  1TS0 A;  3WWX A;  4B93 A;  1F9I A;  1TD5 A;  2V0W A;  1IKI A;  3OPR A;  5GLD A;  2UV0 E;  3IQA A;  1IOU A;  4EUZ A;  4GDB A;  5IT5 A;  2WK0 A;  3H82 A;  4S2L A;  2VV7 A;  2FFY A;  3MXS A;  2ZD8 A;  3CI6 A;  2ZOH A;  1LHY A;  1YPR A;  1GHI A;  5J8X A;  3QP8 A;  4JGO A;  2C5W B;  2X01 A;  3GR2 A;  1N9B A;  4QHC A;  1UWN X;  2BAS A;  4KQQ A;  4IUK A;  1DY6 A;  2HDR A;  4IVI A;  3SH9 A;  3W4P A;  4IJG A;  2O0Y A;  4CPK A;  3SOI A;  1OTB A;  3T1R A;  4S2M A;  3O86 A;  3BQ8 A;  2ZMV A;  2PYR A;  3VFH A;  4L9F A;  3UB6 A;  4PM6 A;  4RX3 A;  2I72 A;  4HH2 A;  4LLO B;  4QY5 A;  4DN0 A;  2ZJ9 A;  2ZM2 A;  1DRM A;  1LSX A;  2INW A;  1IFQ A;  1K4F A;  2JN7 A;  3LI8 A;  3C2W A;  2HGV A;  3LGO A;  3SH8 A;  3JVU A;  2ZL1 A;  1BUL A;  3LY3 A;  3N7W A;  2XRO A;  4DE0 A;  3VSK A;  3DWK A;  2EWW A;  3HLC A;  2NUT C;  2Q0O A;  5DVA A;  3S7N A;  3R7W B;  5EV0 A;  2ZC5 B;  1FCM A;  3PTE A;  1TDL A;  3HLD A;  4BL2 A;  2WAD A;  2BLS A;  1E4D A;  4P6Z S;  3GSG A;  3OOV A;  2W3D A;  3EGX C;  3HUO A;  3T4T A;  4I38 A;  4LEN A;  1TEM A;  3UME A;  4WF0 A;  3IF5 A;  5KSC A;  4O0P A;  2B18 A;  5AQ7 A;  3RH8 B;  1CEF A;  3IWO A;  4ETZ A;  4Y0U A;  4X53 A;  5FQM A;  2HZ5 A;  1BYW A;  4ZJ1 A;  1YLZ A;  1PZO A;  4P6Z M;  1T1B A;  2GZA A;  5FL3 A;  2EFX A;  1XA7 A;  1HD8 A;  1GCE A;  3OLO A;  3OPP A;  1F2K A;  2WGW B;  3LIB A;  3ZG0 A;  2PD7 A;  3ZG8 B;  1CQA A;  5HPF A;  4MN5 A;  2JKR I;  3HLW A;  5EEC A;  4BL3 A;  4EEP A;  3G30 A;  5HFO A;  4MN7 A;  4CLC A;  2HP6 A;  3UY6 A;  4DDY A;  3NC8 A;  2CC1 A;  4GD8 A;  4Q0H A;  2OOL A;  3OBF A;  3AGF A;  4WMC A;  2W1T A;  2IWB A;  1RP5 A;  3LFV A;  4XT2 A;  1XKZ A;  3BFF A;  5EOO A;  3QP2 A;  1BLS A;  1Y28 A;  4JXW A;  2Q9M A;  1RCJ A;  1MXO A;  1LSW A;  3M2J A;  1D1J A;  5TR7 A;  1L0F A;  3PXP A;  3VP1 A;  1EW0 A;  1ESI A;  3Q81 A;  3BLS A;  2Z2M B;  4NXF A;  5HD5 A;  4BD1 A;  4X56 A;  3LO7 A;  2P74 A;  4GN2 A;  3V3S A;  4EBP A;  4KZ5 A;  2EX6 A;  3TRC A;  5HZH A;  4X1L A;  4GHI A;  1RGZ A;  3EQV A;  1K54 C;  3GTC A;  1VQQ A;  3ICY A;  5DTS A;  4FCF A;  1LT0 A;  4HY8 A;  4MNR A;  1LL9 A;  1ZC2 A;  5G4Y A;  4LRY C;  5FQJ A;  3SS5 A;  1YLP A;  3CHW P;  3MBZ A;  1DJB A;  1DJA A;  1HZO A;  4YNR A;  1Z6F A;  4MBF A;  5EOE A;  4S2I A;  3IF6 C;  4I3A A;  4F94 A;  1M6K A;  2RL3 A;  2V1B A;  3LYX A;  4PM7 A;  1X0O A;  2GX5 A;  1XFN A;  2JCH A;  3TOI A;  4X25 A;  1KDW A;  1OTA A;  4DXB A;  1UGU A;  3W2Z A;  4YWZ A;  3VFF A;  1PWG A;  1XX2 A;  2VA0 A;  2XGN A;  3HLF A;  4DF6 A;  4GZB A;  3KSH A;  2Q9N A;  1TVF A;  5JYP A;  5GLA A;  2NUP C;  1YSP A;  2M7U A;  1TS6 A;  3IHB A;  4KZ7 A;  1V9Z A;  4WEK A;  4DMZ A;  5HWV A;  1YLT A;  2X02 A;  4ARZ B;  2VKS A;  3G2Z A;  3CUE A;  2PU4 A;  4LFU A;  4QY6 A;  3IX8 A;  3PBN A;  3FPW A;  3K2N A;  3PBS A;  3QP6 A;  5GLC A;  4DE1 A;  3G31 A;  2W3E A;  5EVE A;  2W0N A;  2WAF A;  4UQI S;  2OLU A;  3HCY A;  4S2N C;  1KVM A;  3FKV A;  4I3J A;  4HOI A;  3MQO A;  5FDS A;  2OWJ A;  3LR3 A;  1NRF A;  2A24 B;  2ZC3 B;  1DP6 A;  2H0T A;  4A5R A;  2HV1 A;  3BYD A;  2W1T B;  2H0Y A;  3TE8 A;  3T12 B;  3C5A A;  3LR5 A;  3MKE A;  3KYZ A;  4OQG A;  1N9L A;  3A0V A;  4WZ4 A;  3BFD A;  3OPH A;  2R78 A;  4UQI M;  2K31 A;  1CEG A;  3VP0 A;  5F83 A;  1MKI A;  3KX0 X;  4JPM A;  3C7U A;  5HDD A;  3PR6 A;  1YKD A;  4DXC A;  3CG5 A;  3UDI A;  2Y2O A;  4OQ0 A;  4X1M A;  4Y3I A;  3OC2 A;  2H28 A;  4N1H A;  4JXS A;  2QKP A;  3P7N A;  5F6A A;  4WL9 A;  4CJN A;  2Y4A A;  5AVF A;  2Z2L B;  1OPX A;  1LSV A;  1H5X A;  5CRF A;  1YM1 A;  1CK3 A;  5HAP A;  1GHP A;  1IYO A;  5AJG A;  3NCK A;  4HH3 A;  3LI9 A;  2ZQD A;  2ZMA A;  1JWP A;  3VOZ A;  3B47 A;  2WKH A;  5L10 A;  1G28 A;  4OLD A;  2HDU A;  2XDM A;  3AGD A;  2WZZ A;  4C75 A;  5C5K A;  1S1Z A;  3F1O B;  3M6B A;  2WAE A;  4Y0T A;  3NOP C;  1T19 A;  1KGG A;  4GJ4 A;  2J8Y A;  4D60 A;  2DCF A;  4Z9Q A;  3V5M A;  1S67 L;  4EXO A;  2JKR M;  2DRW A;  3Q07 A;  4B4X A;  2OV5 A;  1KGF A;  1J3W A;  1OT9 A;  4R1G A;  3DTE A;  4R6L A;  3FV7 A;  1VET B;  3LIC A;  2WGV A;  2Y91 A;  4RA7 A;  4BD0 A;  3UPP A;  1ZHH B;  3VP4 A;  1MY8 A;  3RXX A;  4K91 A;  1BLC A;  3BRM A;  3VMA A;  1LL5 A;  1NXY A;  5F68 A;  2IA2 A;  1E3U A;  5FDH A;  3W8K A;  1P9R A;  3N8S A;  4GCZ A;  1YQS A;  1ONH A;  5M1A A;  1N4O A;  1K6R A;  2ZQ7 A;  3U4L P;  1ES2 A;  5JYO A;  1OTD A;  2KOI A;  1LI9 A;  2OAQ 1;  4JF4 A;  4EER A;  1PI4 A;  4HIA A;  4E6W A;  1F98 A;  4H6J B;  2B02 A;  1ACF A;  1YSQ A;  1KDS A;  4EUV A;  4PM5 A;  2PRF A;  4DDS A;  3G35 A;  2XA7 M;  5HAQ A;  4LGW A;  4QJG A;  2WKR A;  3IX4 A;  4S2P A; 
#chains in the Genus database with same CATH homology
 4IJG A;  2O0Y A;  4K08 A;  1TS7 A;  4DJ2 A;  3IS2 A;  1OTB A;  4PAU A;  3BQ8 A;  2ZMV A;  2PYR A;  5DKL A;  2L0W A;  4L9F A;  1XJ3 A;  3E4O A;  3HJK A;  3UB6 A;  4BJP A;  4HH2 A;  2FH5 A;  4LLO B;  4DN0 A;  4LPZ A;  3PYP A;  2PT7 A;  1DRM A;  2K2N A;  1LSX A;  2INW A;  1IFQ A;  2JN7 A;  3LI8 A;  4WEL A;  2EA9 A;  2VZW A;  3C2W A;  4FSF A;  2HGV A;  3IS2 B;  3JVU A;  3KO6 A;  4Q0J A;  5J7E A;  2V9A A;  2JKT I;  1DP9 A;  2YKH A;  1D06 A;  3MMH A;  1ZTU A;  2XRO A;  4HP9 A;  5I5L A;  2EWW A;  5KSH A;  2NUT C;  5MC7 A;  3E0Y A;  3UB7 A;  4HJ3 A;  4CLC E;  3JVV A;  3S7N A;  3R7W B;  3RFB A;  3ZQ5 A;  1NWZ A;  1W63 M;  3EQU A;  2HF6 A;  2G7U A;  3LIF A;  2GJ3 A;  3F1P A;  3FC7 A;  5DFY A;  1XJ6 A;  1S4S A;  3C38 A;  4P6Z S;  3VE4 A;  3OOV A;  2W3D A;  3EGX C;  1H8M A;  3T4T A;  2KLI A;  2PR6 A;  3P01 A;  4I38 A;  4KQO A;  4EEU A;  4EU0 A;  2K7S A;  3UME A;  4WF0 A;  4O0P A;  1P97 A;  1JNU A;  2B18 A;  5AVE A;  4GW9 A;  3RH8 B;  3PBR A;  4GS9 B;  4ETZ A;  3T4O A;  2D02 A;  5TJJ A;  5F5Y A;  1P0Z A;  5IU1 A;  1BYW A;  4FOF A;  4H6J A;  3TW8 A;  3VE3 A;  2VGL S;  3H9W A;  2MJ6 A;  4P6Z M;  1T1B A;  2GZA A;  3LIE A;  4CLC D;  5FL3 A;  1WA9 A;  3ZYT A;  4HQA A;  3O5Y A;  3MR0 A;  3HJI A;  3OLO A;  2ZOI A;  1S4R A;  4ETX A;  2LB9 A;  2W1R A;  3C30 A;  4O8G A;  4L9E A;  2A2L A;  2M1C A;  4Z1W A;  4PKY A;  3C8C A;  1ODV A;  3S7P A;  3LIB A;  5J3W A;  2PD8 A;  3A0R A;  3F1N B;  2PD7 A;  3MF0 A;  5HPF A;  2Y79 A;  2JKT M;  2P08 A;  4MN5 A;  3CWF A;  2KDK A;  2DMW A;  2JKR I;  3FPV A;  3U2A A;  3OCN A;  4ARZ A;  2PHY A;  2Z6C A;  4EEP A;  5J4E A;  5HL6 A;  2FZ0 A;  4MN7 A;  5LBR A;  3T50 A;  3PBQ A;  4DJ3 A;  4CLC A;  4II7 A;  4PHT A;  2A24 A;  3BW6 A;  4GS9 A;  3EOI A;  2OOL A;  4NXB A;  2J3T C;  3OBF A;  4Q0H A;  5A8B A;  2W27 A;  4G3K A;  4B9O A;  4BBT A;  5KIZ A;  2QJ5 A;  4R3A A;  5DJT A;  2W1T A;  4PKY G;  4Q0I A;  3LFV A;  4XT2 A;  3NHQ A;  1G6O A;  1GSV A;  2PYP A;  3GEC A;  4LRZ E;  5CX7 A;  4WEJ A;  2W3G A;  3B42 A;  1XJ4 A;  3CAX A;  3E98 A;  4NKP A;  1Y28 A;  5IS1 A;  2W3F A;  2VEA A;  3SW1 A;  1LSW A;  1OTI A;  3K3D A;  2LB5 A;  3UB9 A;  3CLO A;  3PXP A;  1EW0 A;  3PHY A;  4BBV A;  4F3L B;  3LUQ A;  3H7W B;  3MJQ A;  4NXF A;  5HD5 A;  1P9W A;  3OCL A;  3E4P A;  3KSI A;  3TRC A;  5HZH A;  3NOT C;  4GHI A;  3EQV A;  3UB8 A;  2CMN A;  3ICY A;  2O9A A;  2XRN A;  3CIT A;  4L0L A;  1LT0 A;  4HY8 A;  5HPI A;  5G4Y A;  4LRY C;  4KQD A;  4EQ1 A;  4KUK A;  3MFX A;  4YNR A;  4HJ4 A;  1MKM A;  4I3A A;  3VOL A;  5G4Z A;  4E04 A;  1V9Y A;  3K3C A;  3LYX A;  2V1B A;  2I9V A;  1X0O A;  1YAX A;  2GX5 A;  1DP8 A;  1VB6 A;  4HP4 A;  1XFN A;  2O99 A;  2M7V A;  3KSF A;  1OTA A;  3DBA A;  3S7O A;  1UGU A;  3W2Z A;  4YWZ A;  4CQH A;  2VA0 A;  3KSG A;  2VX8 A;  4HHD A;  2L4R A;  1GSW A;  3KSH A;  4MDZ A;  2OAP 1;  3LR4 A;  4GHI B;  1NRJ A;  1N9O A;  2NUP C;  1YSP A;  2M7U A;  1TS6 A;  4WEK A;  1V9Z A;  4HNB A;  3UMD A;  4DMZ A;  5HWV A;  1T1A A;  5HWW A;  5TBM B;  4ARZ B;  2VKS A;  3CUE A;  1W63 Q;  2PR5 A;  2VGL M;  1TF1 A;  3BY8 A;  3CUE C;  4JGP A;  2J3T D;  4WUJ A;  4Y5F A;  3PBN A;  2QHK A;  3FPW A;  3K2N A;  3PBS A;  4LRX C;  1XJ2 A;  5HWT A;  2Z6D A;  2W3E A;  4JGR A;  4F3L A;  2W0N A;  4UQI S;  5DJU A;  3HCY A;  2J3W A;  1H3Q A;  2D01 A;  5HDC A;  4I3J A;  4HOI A;  3MQO A;  2OWJ A;  3LR3 A;  3NJA A;  2A24 B;  1MZU A;  4L9G A;  3RTY A;  1DP6 A;  4OOM A;  1OJG A;  4BBU A;  2V1A A;  4BMW A;  1TS8 A;  4IUH A;  5F69 A;  5HSQ A;  2HV1 A;  2W1T B;  3TE8 A;  3LR5 A;  4OOL A;  2QYB A;  3KYZ A;  3MXQ A;  1MC0 A;  2ZMF A;  1N9L A;  3A0V A;  4I3I A;  2R78 A;  4UQI M;  2VJW A;  2K31 A;  1OTE A;  3BWL A;  4QPR A;  1STZ A;  1NLZ A;  5DF9 A;  2V0U A;  3T4L A;  2OWH A;  3A0S A;  3LR0 A;  3H7W A;  3IBR A;  2VLG A;  4NXG A;  2GNX A;  3KX0 X;  5HDD A;  3PR6 A;  2KX6 A;  1YKD A;  4G3W A;  5L8M A;  3ULF A;  3UE3 A;  5HDS A;  4CLC C;  1T1C A;  3BY9 A;  2HJE A;  3BQA A;  2VV6 A;  4IHQ A;  4Y3I A;  3OC2 A;  3NOU C;  5HD3 A;  2H28 A;  4NXE A;  4G3V A;  3LID A;  2QKP A;  3P7N A;  4HJ6 A;  5F6A A;  3EEA A;  4WL9 A;  3F1O A;  5AVF A;  4YOF A;  4O01 A;  3F1N A;  2J80 A;  3MQ0 A;  1OPX A;  4MN6 A;  4Y2F A;  1LSV A;  3IBJ A;  3PBT A;  3D3O A;  4EW7 A;  5AJG A;  4HH3 A;  4MMN A;  3LI9 A;  1N9N A;  1T18 A;  3EGD C;  4HI4 A;  3BJN A;  4M4X A;  3B47 A;  1OJ5 A;  2JHE A;  4CLC B;  4GLQ A;  4BWI A;  1S66 L;  5TBM A;  1G28 A;  5EFW A;  2ZBB A;  1F5M A;  4JGQ A;  3V67 A;  2L1M A;  4EET B;  5C5K A;  1S1Z A;  3F1O B;  1XFQ A;  5K5B A;  3NOP C;  1T19 A;  1OT6 A;  4EES A;  3B33 A;  2VV8 A;  4KUO A;  4GJ4 A;  1S1Y A;  1S67 L;  4EXO A;  1NLY A;  4XT2 B;  2JKR M;  3LIA A;  1KOU A;  2XSS A;  2WKP A;  3R4K A;  3UE6 A;  3T4K A;  2HJ9 C;  1LL8 A;  4RQ9 A;  4ME4 A;  3MQQ A;  4AFI A;  2O9B A;  1TS0 A;  5DKK A;  4B93 A;  2XA7 S;  3T4J A;  1F9I A;  1TD5 A;  4UEY A;  2V0W A;  4R38 A;  1OT9 A;  4WLA A;  4R6L A;  2P7J A;  3E4Q A;  3LIC A;  4NEE D;  1VHM A;  1IOU A;  3F1P B;  3EWK A;  1ZHH B;  2QJ7 A;  2O9C A;  5IT5 A;  3H82 A;  3S7Q A;  5DFX A;  2YKF A;  3T4S A;  3TJZ C;  3VV4 A;  2W3H A;  5F68 A;  4ZRR A;  2IA2 A;  2VV7 A;  3PBO A;  2EWV A;  4I5S A;  1P9R A;  1UWP X;  4MCW A;  4GCZ A;  1GSX A;  2QWS A;  3D72 A;  1D7E A;  3CI6 A;  3KYQ A;  2ZOH A;  3G6O A;  2Y8H A;  2PDR A;  4JGO A;  1OTD A;  2KOI A;  2WKQ A;  3GDI A;  2P04 A;  2OAQ 1;  4EER A;  4R70 A;  4HIA A;  3R7W A;  1F98 A;  4H6J B;  1UWN X;  2B02 A;  1YSQ A;  2BAS A;  4IUK A;  4EUV A;  3EEH A;  3T4Q A;  2XA7 M;  4I39 A;  3FG8 A;  3H82 B;  4WN5 A;  2WKR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...