3RH8B

Crystal structure of the light-state dimer of fungal blue-light photoreceptor vivid
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
148
structure length
148
Chain Sequence
HTLYAPGGYDIMGYLIQIMNRPNPQVELGPVDTSCALILCDLKQKDTPIVYASEAFLYMTGYSNAEVLGRNCRFLQSPDGMVKPKSTRKYVDSNTINTIRKAIDRNAEVQVEVVNFKKNGQRFVNFLTIIPVRDETGEYRYSMGFQCE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a Light-Activated LOV Protein Dimer That Regulates Transcription.
pubmed doi rcsb
source organism Neurospora crassa
molecule tags Circadian clock protein
molecule keywords Vivid PAS protein VVD
total genus 34
structure length 148
sequence length 148
chains with identical sequence D
ec nomenclature
pdb deposition date 2011-04-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13426 PAS_9 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3rh8B00
5HWVA 2WKPA 3F1PA 1LSVA 2INWA 3FC7A 5G4ZA 2VV6A 3MJQA 3NOUC 2D01A 3RH8B 1F98A 2V1AA 1TS7A 3UMDA 4B9OA 3E4OA 4NXBA 1TS6A 3UB7A 4WLAA 3IS2A 3LUQA 3IBRA 1ODVA 3FG8A 4GS9B 4I3AA 2V0UA 4JGQA 2A24A 2JHEA 4I5SA 2QKPA 4L9FA 4HJ3A 2VLGA 1WA9A 2B02A 1DP8A 3NOPC 4BBVA 3CLOA 4I38A 3PHYA 3HJKA 4WN5A 5EFWA 2YKHA 1N9LA 2HV1A 3A0SA 3VE3A 3LIEA 2QHKA 3SW1A 5F5YA 1OJ5A 4L9EA 3VOLA 4HHDA 3LIBA 1XJ3A 5TBMA 2OWJA 2L4RA 4NXGA 4EETB 2PR5A 3E4QA 2PHYA 4JGPA 4GW9A 5HD3A 1OTAA 4GHIA 1S1YA 3BWLA 5AVEA 4PKYG 2KX6A 3P7NA 4GS9A 2PD8A 1P97A 4RQ9A 3UB8A 1LSWA 5DKLA 4BBUA 5J4EA 2PDRA 2GJ3A 3H82B 1UWPX 4EW7A 4F3LA 4DJ2A 2V9AA 3KX0X 1EW0A 4KQDA 1OTIA 3LIAA 4LRZE 5F68A 5J7EA 1D06A 1S66L 3LYXA 3NJAA 3H7WA 5AVFA 2YKFA 5G4YA 4EESA 4MN6A 2A24B 2PD7A 2ZOHA 1V9ZA 5HSQA 1NWZA 2L1MA 3A0RA 1OTEA 3F1NB 3H82A 4M4XA 5HDCA 2Z6DA 2K7SA 4H6JA 4F3LB 3C8CA 3RTYA 5HDDA 4I39A 4HNBA 1XJ2A 3UB9A 1P0ZA 4DJ3A 1N9NA 3EWKA 4K08A 1JNUA 3LICA 2BASA 2M1CA 3G6OA 5J3WA 4KUKA 1G28A 2PYRA 1T1BA 1GSVA 2R78A 3EEHA 3MFXA 5DJUA 4EEUA 1MZUA 3F1OB 4HP4A 4NXFA 2V0WA 1Y28A 2Z6CA 1LSXA 3ZQ5A 1DP6A 3BY8A 3HJIA 4EERA 1VB6A 2PYPA 2QWSA 5HD5A 5IU1A 3VE4A 1T1AA 3BY9A 1LL8A 4I3IA 4E04A 5HWTA 1OT6A 4WL9A 3H9WA 1KOUA 1T18A 1D7EA 3F1NA 2L0WA 2ZBBA 4HI4A 2ZOIA 4HQAA 4HIAA 4MN5A 3GECA 1DP9A 3NHQA 3F1OA 2VV8A 3LIDA 1DRMA 2J80A 2I9VA 3MR0A 2KDKA 4LLOB 4R38A 3B33A 1XFQA 1XJ4A 3C2WA 4PKYA 5TBMB 1X0OA 2OWHA 2W0NA 5HDSA 2WKQA 4KUOA 3T50A 5KIZA 5IS1A 3D72A 3LI8A 2CMNA 3OLOA 4L9GA 3GDIA 4JGOA 4LRYC 1OJGA 4R6LA 4WF0A 4BBTA 2VEAA 1GSWA 2WKRA 3MQQA 3MXQA 1GSXA 1F9IA 4R70A 5I5LA 2V1BA 5A8BA 5HWWA 4HH2A 4LRXC 1S1ZA 1LT0A 4NXEA 4HOIA 2VV7A 4EEPA 3MQOA 4HJ6A 3ICYA 1S67L 1T19A 4HH3A 4HP9A 3LI9A 2P7JA 4LPZA 2QJ5A 2OOLA 5DJTA 1BYWA 4H6JB 1S4SA 1XJ6A 3UB6A 1TS8A 4YWZA 4EQ1A 3E4PA 1OT9A 4EXOA 1OTBA 3UMEA 3K3DA 3PYPA 1S4RA 4R3AA 4GCZA 2PR6A 3LIFA 2W27A 3NOTC 2EA9A 4JGRA 4HY8A 1V9YA 3A0VA 3CWFA 5F69A 3UE6A 1N9OA 2D02A 1XFNA 5HZHA 4XT2B 3IS2B 1TS0A 1UWNX 2H28A 5F6AA 3K3CA 4I3JA 3ULFA 2QJ7A 2JN7A 4HJ4A 3CAXA 1UGUA 1T1CA 4WUJA 4GHIB 5DKKA 4XT2A 3H7WB 3F1PB 1OTDA
chains in the Genus database with same CATH superfamily
2VV6A 1ESUA 3UB7A 4Y7PA 4KZ8A 2PBYA 1ODVA 4MEZA 3C4OA 3TE8A 1VEUA 3VP0A 4BBVA 4CQHA 1AWIA 3LIEA 2WKHA 5F5YA 3PBOA 1EI5A 3M2JA 4WZ4A 3P01A 4GHIA 4GD8A 3VOZA 3O5YA 5JYOA 3CG5A 3H82B 3LR0A 5FA7A 1EW0A 1MXOA 2B18A 2XDMA 1SKOA 5EE8A 2Z6DA 2BG1A 4H8RA 3RTYA 5HDDA 1DP6A 2XRNA 1LL8A 1TVFA 3VFHA 4WM9A 4E04A 3H9WA 2L0WA 4U0TA 2HGVA 3B47A 2KDKA 3OZHA 2A2LA 4B4XA 3G35A 4EBLA 3LI8A 3BFCA 4L9GA 1JWVA 4M3KA 1L0FA 4EWFA 4GNUA 2WGVA 3AGEA 3ZCZA 1XP4A 3BW6A 4ID4A 3A3JA 2IA2A 4EXOA 4OPZA 3DTKA 4S2NA 5E43A 1MWUA 5HZHA 2JN7A 2KLIA 1YM1A 1SCWA 3ISGA 5C5KA 2PBDP 1OTDA 3N4IA 5TJJA 3EGDC 1G68A 4EQIA 4BL2A 3LUQA 2Y4AA 3L9KA 4N9KA 3NOPC 3CLOA 1WYBA 3PHYA 1BUEA 3IF6B 5AJGA 4GZBA 2WYXA 1XXMA 3WRTA 3SS4A 2L4RA 1I2SA 1PWGA 1S1YA 3UPOA 3PR6A 1K54A 3P7NA 4OQGA 3B3XA 1UWPX 4OQIA 3LIAA 2QYBA 5EM1A 4EBNA 1YSPA 4JXWA 2XR0A 2ZQ8A 2ZOHA 4P6ZM 2PT7A 5FQMA 1YMXA 2BASA 3VOYA 3C5AA 4X68A 5DJUA 3QP8A 1KOUA 1D7EA 3NHQA 2VV8A 4LLOB 1DRMA 3SZTA 4Y0TA 2W0NA 2R9WA 2Y2OA 4WZ5A 4R0QA 1YLPA 2JKTI 1GSXA 2OLUA 4LENA 2VV7A 3A3IA 1FOFA 4UHUA 2HPBA 1W5DA 5FQ9A 3WS5A 1XJ6A 3UB6A 4EQ1A 3D4FA 1FILA 2Y2KA 1LL9A 3LR4A 3UB5P 4HY8A 1Y54A 3UE6A 4N9LA 5CHUA 4S2NC 2H28A 1KE0A 4IBXA 4NKPA 3D9YA 4NG2A 5A90A 5DKKA 1GHIA 1FSYA 1KGFA 3CJMA 2I72A 3NC8A 4ZJ2A 3IXGA 5M18A 4R23A 3VP3A 3ZVWA 2V0UA 1NLZA 4PM6A 5E2EA 3V39A 3V3SA 5BOHA 5FASA 4WMCA 3I7JA 3VFFA 3PAGA 4OOLA 3ITBA 4F94A 5HD3A 2KX6A 3UPNA 1NZOA 3MFDA 5CEDA 2LB5A 2W3DA 1XA7A 3E2LA 3CUEA 3M2KA 4KZ5A 4D60A 5F1FA 1MC0A 3OC2A 4JKTA 3LEZA 2GDNA 3C38A 5CECA 1YMSA 4P6ZS 1MKIA 1T1BA 4OP8A 2HP5A 3S1YA 4LCLA 2W3GA 4OONA 3CPTB 1H3QA 2ZQAA 1OT6A 2BLSA 1Y4OA 4UEYA 2P74A 4CLCE 3C2WA 3IWOA 3OLOA 3ZG9B 4R6LA 1PIOA 3SH9A 2JKFA 3MSHA 4KG2A 3VV4A 5GLAA 4S2OA 3DBAA 2H0YA 4X69A 3NOTC 4ZBEA 2Q0OA 3PBQA 3A0VA 2JC7A 1HVBA 3V50A 2UWXA 4EV4A 4PPRA 4XT2B 1YQSA 5L2FA 2QJ7A 3KYZA 1Q2PA 4GDBA 3S4XA 1K57C 1FIKA 1N4OA 4DKIA 3UE3A 2W3HA 1W8YA 4N92A 3MXSA 5CHMA 1WA9A 4PM5A 2YKHA 3KSFA 4KZ6A 1W79A 2H10A 5DFXA 3FPWA 3LIBA 1DJCA 4GS9A 1PYYA 4RQ9A 5FAOA 4BWIA 2J9PA 5G4YA 2A24B 4M4XA 4D2OA 3IWIA 5FSRA 5HFOA 1NRFA 5EVIB 2K31A 4OOYA 3G34A 3NI9A 3Q7VA 4FTXA 5DTTA 2Y2MA 2OWHA 1YLYA 4LV1A 5CHJA 4HBUA 3S7OA 4LRXC 2H5SA 1VETA 4HP9A 5FDHA 4MCWA 3HLBA 2E8IA 5IHVA 3E4PA 3SH8A 3MZFA 3LIFA 4Y5FA 5F69A 2K2NA 1ZTUA 3ZG7B 2Y55A 2XD5A 1BLPA 1IFQA 4O0PA 4XT2A 1ACFA 2WGIA 1W8QA 2XFSA 3CI6A 1PW8A 2EX6A 2Y2NA 4QY6A 2ZQCA 4OLGA 1SDEA 4X1MA 4CLCB 5FI7A 2XSSA 4Y2FA 3MMHA 4ZRRA 3BFFA 3BFGA 2HZ5A 4UAAA 5AQ7A 3A0SA 5FEGA 5FQJA 3C30A 3VOLA 1XJ3A 1YPRA 4S2KA 5TBMA 3ZDJA 2HDSA 2PHYA 4CPKA 3WWXA 5AVEA 2Y8HA 4FOFA 4F3LA 2XFTA 3DWKA 3NJAA 1K56A 3NULA 4E6XA 3T4JA 4I39A 1STZA 3WS2A 2W3FA 1G28A 3Q7ZA 3A3DA 1GHPA 1T1AA 2XK1A 3BEBA 4JPMA 2J80A 2CC1A 2WZXA 5HDSA 4KUOA 3T50A 4OPQA 3ZNTA 1NYYA 4IVKA 2VEAA 3GQZA 5A92A 4GLQA 5HWWA 2WUQA 1LT0A 2PU2A 1ONGA 2P7JA 1TS8A 2ZQ7A 3TW8A 2XA7M 3IHBA 1V9YA 2HJEA 1FR6A 4X25A 1ES5A 2OAQ1 5F6AA 2ZC7A 4R3JA 3PAEA 4CJNA 4UA9A 5FAPA 2Y59A 3HLEA 4R1GA 3FC7A 4C3QA 1I2WA 1QMEA 2V1AA 3UMDA 4QY5A 1O7EA 5KSHA 4HEFA 1MWTA 2FH5A 1TF1A 1N9LA 2R9XA 4WBGA 2J3WA 1KE4A 2P9VA 5EUAA 3U4LP 4L9EA 1GA9A 4RVAA 5TR7A 1LI0A 2PD8A 3UB8A 4DXCA 5J4EA 5DF7A 2GJ3A 3KX0X 4IBRA 3Q82A 3LYXA 4BMWA 3T4KA 1V9ZA 5DTKA 2L1MA 1NXYA 3H82A 1NRJA 3BLMA 4WEJA 3EWKA 3KSGA 1ES4A 4DF6A 3EEAA 2JKRM 4U0XA 3ZQ5A 2QWSA 5HD5A 3VE4A 1ESIA 2E8JA 5HWTA 2X71A 3L7HA 1FQGA 3LIDA 2I9VA 3T1RA 5DTSA 4K0XA 5FEFA 2O9BA 2DMWA 3QP1A 2ZC6B 3ZNYA 1F9IA 2WAEA 3MXRA 2WGWB 1G5UA 4HJ6A 1S67L 1T19A 5KMWA 3LI9A 2EXAA 2G7UA 2VJWA 3SS3A 3PYPA 4R3AA 4EUZA 2ZQDA 1RGZA 1YSQA 5LBRA 3A3EA 4G3WA 3WRZA 1YLZA 1YLWA 4HJ4A 5HWVA 3FKWA 2NUPC 2XROA 2IWCA 3GRJA 5DF9A 2FZ0A 4X56A 5DF8A 1RGYA 3EOIA 1BLCA 2IWDA 1IYPA 2ZJ9A 2QHKA 4ARZA 1OJ5A 3R7WB 1GA0A 4NXGA 5MC7A 4O01A 2JKRI 4GOGA 1H8YA 4R4RA 4GN2A 3BLSA 5F68A 4EESA 2HDRA 1IELA 1XX2A 3P98A 2OV5A 4PM9A 4RYEA 1ONHA 2V8CA 3T4QA 2ZL1A 2J7VA 2UV0E 4GKUA 1YT4A 3RFBA 2Y2LA 3G6OA 2VZWA 4N1HA 2ZM0A 4PM7A 3F1OB 4IEDA 4DRTA 4I3IA 4R38A 2B5RA 4KZ4A 4MBFA 4B88A 2PAVP 3B33A 1XJ4A 1X0OA 2RL3A 3HREA 3HUMA 5A93A 2X02A 4HH2A 3HLCA 5DFYA 3M6BA 2A49A 4LPZA 1S4SA 1NY0A 3UDIA 2ACGA 4HESA 3U2AA 2PRFA 1PWCA 1ZC2A 1O07A 1UGUA 3GSGA 4OOMA 4YNRA 2INWA 1TS7A 5K5BA 4FUWA 3UPPA 1TD5A 3DAVA 4GS9B 1F2KA 1DP8A 3KO6A 2XEPA 1CQAA 3LR3A 4Q0IA 1SHVA 1FSWA 3NIAA 1HD8A 3BQ8A 3T4TA 5E2HA 4KZ9A 2V9AA 4MN7A 2ZQ9A 4DXBA 4GJ4A 3T1QB 4RX3A 4ME4A 4E3NA 3T4LA 5FAQA 3UB9A 5E2GA 1TDLA 5AQAA 2R78A 3HL9A 4HP4A 2C6WB 3HJIA 4A5RA 2Y2QA 4ZJ3A 4NK3A 1F5MA 1DP9A 2J3TD 1JWZA 1QMFA 3PBRA 1H5XA 5IS1A 3GDIA 4G3KA 2V20A 4P6BA 2ZC4B 2Y2IA 5IT5A 3V3RA 4UA6A 1KGEA 4GB7A 2PU4A 3MZDA 1E25A 4BL3A 4X6TA 3KSIA 4OKPA 1BZAA 3V67A 1YAXA 3KYEA 1WE4A 2EA9A 3LCEA 4RX2A 3HLWA 4JXVA 3UDXA 4JXSA 2EX9A 2WZZA 3CAXA 5EOEA 4KQQA 3F1PA 3T4SA 3NOUC 5EVID 4LV2A 4OLDA 3E4OA 1YLJA 2RCXA 3IS2A 4YINA 4I3AA 1E3UA 1H0MA 2VLGA 1M6KA 3RXXA 4I38A 3HJKA 3IX4A 3VE3A 3PBSA 2G2UA 1Q2QA 2HP9A 4JF6A 1K55A 2PR5A 3IF6C 2ZMVA 4OPRA 5F82A 5GHXA 4FH2A 1DY6A 2ZMAA 5L10A 2ZLYA 3HLGA 1BULA 1C3BA 4Y15A 1PWDA 4KQDA 3QHYA 4X55A 4MN6A 5DVAA 5HSQA 3QP4A 4JF5A 2VK3A 2VGLM 4C75A 3BJNA 3C8CA 1CI8A 2EWWA 4EBPA 3S7PA 1MKMA 1GSVA 4Z1WA 1MZUA 5L09A 4WEKA 5HAQA 1IKIA 3CPTA 4IHQA 3OOVA 5GLCA 3TOIA 4MN5A 2ZBBA 1ZG6A 1ES2A 2A3UA 4Q0HA 1RCJA 1BTLA 1G6AA 1HZOA 3JPUA 4JLFA 1SDNA 4CLCC 4GDNA 4DDSA 4OP5A 3AGFA 5EECA 4BBTA 4BLMA 1GSWA 5I5LA 3IF6A 2V1BA 3FKVA 2Z2MB 1NYMA 3SH7A 4OPYA 1W7FA 1BYWA 2DRWA 2ZMFA 3QNCA 4LV0A 3CITA 4MNRA 1OT9A 1S4RA 2Z2LB 2W27A 2HDUA 5FI2A 4WYYA 3T12B 4I3JA 5CX7A 3G32A 4IUKA 3LR5A 5G4ZA 4S2IA 1MWSA 4KZ3A 3VP4A 3W4OA 2ZM8A 3CMZA 4KG6A 3WS1A 5EOOA 3VP2A 2X01A 3OBFA 3OPHA 4JXGA 3E0YA 3AGDA 3RJUA 5M19A 1SKFA 3HLFA 3UNWA 2JE5A 3UO9A 3ZVTA 3E4QA 1P97A 2EXBA 2J3TC 3O3VA 4PHTA 2PDRA 4E3OA 3EGXC 5FQIA 5FATA 3W4PA 1OPXA 1IKGA 5L07A 4JBFA 1K6SA 1CEGA 2K7SA 3IX3A 4MLLA 4F3LB 1KE3A 4ZAMA 2EWVA 2M1CA 4WMCD 5J3WA 4OVDA 3EEHA 4EEUA 3IWQA 3IH8A 2WKIA 1K25A 1LSXA 4EERA 1IEMA 3SS5A 2W3EA 3TSGA 3FV7A 4ETXA 4PKYG 1I5QA 3MQ0A 3HBRA 5EVIC 1XFQA 3NCKA 1WYCA 4YOFA 1PZOA 4ARZB 4R70A 3ZHHA 3G2YA 1VETB 3MQOA 3VP1A 2VA0A 4MBKA 4WZ5C 3UMEA 3HCYA 3K3DA 4GCZA 3S22A 1PI5A 2EX8A 3Q81A 4JF4A 1UWNX 1K55C 3IT9A 3VSLA 3HVFA 2VKSA 4GHIB 4E3IA 1N9BA 4E3LA 1ZHHB 1KDWA 4MDZA 5KSCA 1PNEA 4JGQA 5CERA 1DJAA 2B95A 1CJFA 2JKTM 1SKOB 3UY6A 3UN7A 4UQIM 1XGIA 3SW1A 3Q07A 5G18A 5HAIA 2OLVA 1K56D 4LGWA 5HL6A 2XQZA 4GW9A 2M7UA 4UA7A 3IF5A 2P9VB 2J8YA 1BT5A 4DJ2A 3ZGAB 4KQRA 3IHAA 4LRZE 5J7EA 1ZG4A 5EVEA 5TFQA 1XGJA 2VGJA 3FWLA 4HNBA 1P0ZA 4DJ3A 1N9NA 2HJ9C 4KUKA 3MFXA 4KENB 4NXFA 4DMZA 1FR1A 4L0LA 2V0WA 1Y28A 3E2KA 2Q9NA 2BTFP 4KQOA 4C6YA 3F1NA 2WADA 4ESPA 1PZPA 5CRFA 5U47A 3ITAA 1M40A 3ZFZA 2GNXA 4WF0A 5GHZA 1P9WA 2XF3A 1CF0A 3ICYA 4U3TA 2WAFA 2OOLA 4YWZA 1J9MA 2XLNA 2WGWA 1N9OA 5J8XA 1TS0A 1CI9A 3OPRA 4X1LA 1JWPA 1Z6FA 4Y0OA 4WELA 4QJGA 3NBLA 3NECA 4E3MA 3MJQA 1F98A 3JVVA 4FH4A 4QD4A 4BQMA 4DE2A 3C4PA 2QKPA 4KZAA 3HUOA 4Y0UA 4E6WA 5EFWA 2ZM2A 5AQ9A 1LLBA 4MBHA 4QWOA 5F1GA 1PFLA 1H8MA 3O87A 2G2WA 1NJ4A 3LY4A 1LSWA 3JVUA 4BBUA 3R7WA 3DTEA 3G2ZA 4Q0JA 2YKFA 3M6HA 3PTEA 1NWZA 3IBJA 4LFUA 1NZUA 4K08A 1JNUA 2IWBA 1EWZA 1K0KA 3DW0A 4RA7A 2PYPA 5IU1A 3BY9A 2O0YA 1L0EA 2J9OA 1BLSA 4HQAA 3F1OA 2OSUA 1IYSA 3G4PA 3W4QA 2VX8A 4BD0A 3MXQA 4ZDXA 3IXHA 5A8BA 4NXEA 4EEPA 5F83A 2QJ5A 5DJTA 3LGOA 4II7A 3B42A 3ZG5A 4B93A 3WS4A 5A91A 1LHYA 2JKGA 2MJ6A 2KOIA 5FQKA 1ERQA 3T1XA 3IS2B 2FFFB 4O7DA 3BQAA 1VHMA 3BM6A 3QP2A 1P9RA 1S6RA 3HLDA 2O99A 4HBTA 4X53A 3Q7VB 4WUJA 3UDFA 2WKPA 5GLDA 3DTMA 4NXBA 1TS6A 4WLAA 2OAP1 5GL9A 4MMNA 2JHEA 5CTNA 4L9FA 4HJ3A 2ZD8A 2B02A 1FCMA 3IQAA 4O8GA 4IUHA 3RXWA 4ETZA 2HV1A 4QU3A 1G6OA 1KGGA 2OWJA 3NDEA 1JTGA 4QHCA 3IH9A 1OTAA 3GMWA 4EUVA 4Y13A 2W1RA 3LO7A 3QP5A 4S2JA 1XA1A 1Z09A 3EQUA 3OPPA 2XH9A 2ZC3B 3C7VA 4KG5A 1K38A 3UE0A 1GCEA 5FL3A 4XUZA 4G3VA 3LICA 3NY4A 4ZTKA 1ALQA 5GLBA 4GD6A 4LV3A 1EROA 4HI4A 3N8RA 2ZOIA 3CHWP 3CZDA 5EVLA 3MR0A 3MKEA 5TBMB 5KIZA 3IX8A 1PW1A 4OQ0A 2W1TB 1CK3A 2LB9A 1OJGA 2ZL1B 2WKRA 3MQQA 1AXBA 4DE3A 4FSFA 3MZEA 3N8LA 3IXDA 3TG9A 5EPHA 5FDSA 1OTBA 1LL5A 2PR6A 2HF6A 3T4OA 1PRQA 2Q9MA 3MBZA 1L3LA 2M7VA 3GTCA 5E2FA 3LEQA 3W8KA 4N1XA 2EFXA 1T1CA 1K4FA 1A0KA 3VSKA 3H7WB 4P0MA 4KZBA 4CLCD 4B9OA 1KDSA 1GHMA 2A24A 4XUXA 5TGFA 3ZYTA 1OMEA 4QPRA 2FFYA 4WN5A 3R4KA 3S7NA 3OCNA 1FCOA 5CGWA 1IYQA 2JCHA 3LY3A 4EETB 4JGPA 3BWLA 4NETA 1VM1A 4PAUA 1YKDA 3GR2A 5DKLA 1YLTA 4Z9QA 1D1JA 1OTIA 1D06A 2Y2HA 2P08A 3FPVA 5AVFA 4S2PA 2PD7A 2WK0A 4P87A 4OH0A 1KVLA 4OQHA 5EVIA 5CTMA 4R4SA 3BY8A 5FI6A 5HPFA 3GV9A 1MY8A 3BECA 4WL9A 3A3FA 4Q8IA 1JTDA 4YFMA 4PKYA 4QB8A 3OCLA 4JGOA 5CXWA 4K0WA 3C7UA 2NUTC 4E3KA 2VGKA 5L8MA 1S1ZA 2V8FA 2EFUA 4HH3A 2WKEA 2Y91A 3ZG0A 3TJZC 3E98A 4BJPA 3MS6A 3CWFA 2D02A 1U60A 3T1SA 3K2NA 1L2SA 3ULFA 2GX5A 3F1PB 2Y2JA 1MBLA 3G31A 2W1TA 1PI4A 1CEFA 3G30A 5KZHA 1TEMA 3FG8A 5D3OA 4XXRA 3IXBA 1KVMA 1BSGA 3BRMA 4LCMA 3VMAA 2Y2GA 3LFVA 4HHDA 5HAPA 5I94A 2EX2A 4DDYA 1FCNA 3FZCA 4Y17A 3SOIA 2GZAA 4BENA 5HPIA 2AVXA 4IJGA 2VGLS 4BD1A 3H7WA 3FYZA 3A0RA 3F1NB 4H6JA 3PBNA 2DCFA 1XJ2A 3PBTA 5CGXA 1IOUA 1ES3A 3V5MA 4AFIA 3Q1FA 1VB6A 2P04A 4HIAA 5HARA 3GECA 4EU0A 4DE1A 3P09A 3QP6A 3N7WA 2V2FF 2WKQA 1DJBA 3D72A 2CMNA 5EV0A 4R3BA 4K91A 2XGNA 1H8ZA 1S0WA 3UE1A 1VEUB 2V1ZA 4FD8A 2H0TA 4E3JA 1MWRA 2XD1A 3KYQA 2DNSA 4JGRA 3MF0A 3S7QA 1TDGA 1K4EA 4B4ZA 2XA7S 1HTZA 2O9CA 2HP6A 1LI9A 4CLCA 1K54C 1LSVA 5EM0A 3JYIA 2D01A 3RH8B 1RP5A 2QZ6A 3BFEA 3IBRA 1MPLA 1ERMA 4I5SA 1IYOA 3MKFA 5JYPA 3O86A 4DN0A 2JBFA 2ZC5B 3BFDA 4Y3IA 1E3UD 2Y2PA 5HX9A 3OPLA 4FCFA 4NEED 4UQIS 4EW7A 4P85A 1HLUP 3NDGA 1S66L 3N8SA 1K6RA 3GVBA 5AQBA 1XKZA 3W2ZA 5M1AA 1W63Q 1OTEA 2QMIA 4S2MA 5HDCA 1E4DA 1JVJA 1SZVA 5FQQA 3D3OA 2PYRA 2O9AA 5HL1A 2Z6CA 3PXPA 1J3WA 1T18A 3DTIA 3KSHA 5HW3A 2C5WB 3EQVA 2HDQA 3BYDA 5CEBA 1W63M 3DWZA 4LRYC 1XPBA 1BLHA 4HOIA 3CUEC 2QPNA 1K57A 1VQQA 3WS0A 4KZ7A 4H6JB 2Y79A 3N6IA 1NLYA 4S2LA 3HUNA 3QNBA 1XFNA 3ZG8B 1L0DA 4DE0A 4IVIA 3TRCA 1ZKJA 3K3CA 5GHYA 3O88A 1L0GA 4PMAA 4PM8A 4ZJ1A 5CGSA
chains in the Genus database with same CATH topology
2WKPA 3F1PA 3T4SA 2VV6A 3NOUC 3E4OA 4NXBA 1TS6A 3UB7A 4CLCB 4WLAA 2OAP1 4MMNA 2XSSA 3IS2A 4Y2FA 3MMHA 1ODVA 4I3AA 4ZRRA 2JHEA 4L9FA 4HJ3A 2VLGA 3TE8A 2B02A 4O8GA 4CQHA 4BBVA 4I38A 3HJKA 4IUHA 4ETZA 2HV1A 3A0SA 3VE3A 3LIEA 1G6OA 3PBSA 5F5YA 3PBOA 3C30A 3VOLA 1XJ3A 5TBMA 2OWJA 2PR5A 2PHYA 3P01A 1OTAA 2ZMVA 4GHIA 5AVEA 4EUVA 2W1RA 3O5YA 2Y8HA 4FOFA 3H82B 3LR0A 4F3LA 1EW0A 3EQUA 4KQDA 3NJAA 4MN6A 2B18A 5HSQA 2VGLM 2Z6DA 5FL3A 3BJNA 3C8CA 3RTYA 5HDDA 3T4JA 4I39A 2EWWA 4G3VA 1STZA 3LICA 2W3FA 3S7PA 1G28A 1MKMA 1GSVA 4Z1WA 1MZUA 4WEKA 1DP6A 2XRNA 4IHQA 3OOVA 1T1AA 1LL8A 4E04A 3H9WA 4MN5A 4HI4A 2L0WA 2ZBBA 2ZOIA 2HGVA 3B47A 2J80A 3MR0A 2KDKA 4Q0HA 2A2LA 4CLCC 5TBMB 5HDSA 5KIZA 4KUOA 3T50A 3LI8A 2W1TB 4L9GA 2LB9A 1OJGA 4BBTA 2VEAA 1GSWA 2WKRA 3MQQA 5I5LA 4GLQA 5HWWA 2V1BA 1LT0A 4FSFA 2P7JA 1BYWA 2ZMFA 3BW6A 3CITA 1TS8A 2IA2A 1OT9A 4EXOA 1OTBA 3TW8A 1S4RA 2PR6A 2W27A 2XA7M 1V9YA 2HJEA 5HZHA 2HF6A 3T4OA 2OAQ1 5F6AA 4I3JA 2M7VA 2JN7A 2KLIA 1T1CA 5CX7A 3H7WB 5C5KA 1OTDA 4CLCD 5TJJA 3EGDC 3FC7A 3LR5A 4IUKA 5G4ZA 4B9OA 2V1AA 3UMDA 3LUQA 5KSHA 2A24A 3ZYTA 3NOPC 3OBFA 2FH5A 1TF1A 3CLOA 3E0YA 3PHYA 4QPRA 4WN5A 1N9LA 3R4KA 5AJGA 3S7NA 2J3WA 3OCNA 4L9EA 2L4RA 4EETB 3E4QA 4JGPA 1S1YA 3BWLA 3PR6A 3P7NA 2PD8A 1P97A 4PAUA 1YKDA 3UB8A 2J3TC 5DKLA 5J4EA 4PHTA 2PDRA 2GJ3A 1UWPX 3EGXC 3KX0X 1OTIA 3LIAA 2QYBA 1D06A 3LYXA 2P08A 3FPVA 5AVFA 4BMWA 3T4KA 2PD7A 1YSPA 2ZOHA 1V9ZA 1OPXA 2L1MA 3H82A 2K7SA 4F3LB 4P6ZM 2PT7A 1NRJA 4WEJA 3EWKA 2EWVA 2BASA 2M1CA 3KSGA 5J3WA 5DJUA 3EEHA 4EEUA 3EEAA 2JKRM 1LSXA 3ZQ5A 3BY8A 4EERA 5HPFA 2QWSA 5HD5A 3VE4A 2W3EA 5HWTA 4WL9A 4ETXA 1KOUA 1D7EA 4PKYG 3MQ0A 3NHQA 2VV8A 3LIDA 1DRMA 4LLOB 2I9VA 1XFQA 4PKYA 2W0NA 4YOFA 2O9BA 3OCLA 2DMWA 4JGOA 2JKTI 4ARZB 4R70A 1GSXA 1F9IA 2NUTC 5L8MA 1S1ZA 2VV7A 3MQOA 4HJ6A 4HH3A 1S67L 1T19A 3LI9A 2VA0A 2G7UA 1XJ6A 3UB6A 4EQ1A 2VJWA 3TJZC 3E98A 3UMEA 3HCYA 3K3DA 3PYPA 4R3AA 4GCZA 4BJPA 3LR4A 4HY8A 3CWFA 3UE6A 2D02A 1YSQA 5LBRA 4G3WA 1UWNX 2H28A 3K2NA 4NKPA 3ULFA 2VKSA 4HJ4A 2GX5A 4GHIB 5DKKA 3F1PB 5HWVA 2NUPC 2XROA 2W1TA 1ZHHB 2FZ0A 5DF9A 4MDZA 3FG8A 4JGQA 2V0UA 2JKTM 3EOIA 1NLZA 4UQIM 2QHKA 4ARZA 3SW1A 1OJ5A 3R7WB 3LFVA 4HHDA 4OOLA 4NXGA 5MC7A 5HL6A 4GW9A 4O01A 5HD3A 2M7UA 2KX6A 2JKRI 2GZAA 5HPIA 4DJ2A 2LB5A 4LRZE 5F68A 2W3DA 2VGLS 4IJGA 4EESA 5J7EA 3H7WA 3CUEA 1MC0A 3OC2A 3A0RA 3F1NB 3T4QA 4H6JA 3PBNA 3C38A 4HNBA 1XJ2A 1P0ZA 3PBTA 4DJ3A 1N9NA 4P6ZS 3RFBA 1IOUA 2HJ9C 3G6OA 4KUKA 1T1BA 2VZWA 3MFXA 3F1OB 4AFIA 4NXFA 4DMZA 4L0LA 2V0WA 1Y28A 2W3GA 1VB6A 1H3QA 4KQOA 4I3IA 1OT6A 4R38A 3F1NA 2P04A 4UEYA 4HIAA 3GECA 4EU0A 4CLCE 3B33A 1XJ4A 3C2WA 1X0OA 2WKQA 3D72A 3OLOA 2CMNA 2GNXA 4WF0A 4R6LA 1P9WA 4HH2A 5DFYA 3VV4A 3ICYA 4LPZA 2OOLA 3DBAA 1S4SA 4YWZA 3KYQA 3NOTC 4JGRA 3PBQA 3MF0A 3A0VA 3U2AA 3S7QA 1N9OA 4XT2B 1TS0A 2XA7S 2O9CA 2QJ7A 3KYZA 4CLCA 1UGUA 4WELA 4OOMA 4YNRA 1LSVA 2INWA 3MJQA 2D01A 2W3HA 1F98A 3JVVA 1TS7A 3RH8B 3UE3A 5K5BA 1TD5A 3IBRA 4GS9B 4I5SA 2QKPA 1WA9A 1DP8A 3KO6A 5EFWA 2YKHA 3KSFA 5DFXA 3FPWA 3LR3A 4Q0IA 3LIBA 4DN0A 1H8MA 4Y3IA 4GS9A 3BQ8A 4RQ9A 3T4TA 1LSWA 3JVUA 4NEED 4UQIS 3R7WA 4BBUA 4EW7A 2V9AA 4MN7A 4BWIA 4Q0JA 1S66L 2YKFA 4GJ4A 5G4YA 2A24B 4ME4A 3T4LA 1NWZA 3W2ZA 1W63Q 1OTEA 4M4XA 5HDCA 3IBJA 3UB9A 4K08A 1JNUA 3D3OA 2PYRA 2R78A 2O9AA 2K31A 4HP4A 2Z6CA 3HJIA 2PYPA 5IU1A 3BY9A 3PXPA 2O0YA 1T18A 3KSHA 1F5MA 4HQAA 1DP9A 3F1OA 2J3TD 3EQVA 3PBRA 5IS1A 2OWHA 1W63M 3GDIA 4LRYC 4G3KA 2VX8A 3MXQA 5A8BA 3S7OA 5IT5A 4LRXC 4NXEA 4EEPA 4HOIA 4HP9A 3CUEC 4MCWA 2QJ5A 5DJTA 4H6JB 2Y79A 4II7A 3B42A 3E4PA 4B93A 1NLYA 3KSIA 3V67A 1YAXA 3LIFA 4Y5FA 2EA9A 2MJ6A 5F69A 2KOIA 1XFNA 2K2NA 1ZTUA 3IS2B 3TRCA 3BQAA 1VHMA 3K3CA 1P9RA 3CAXA 2O99A 1IFQA 4WUJA 4O0PA 4XT2A 3CI6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HWV A;  2WKP A;  3F1P A;  1LSV A;  2INW A;  3FC7 A;  5G4Z A;  2VV6 A;  3MJQ A;  3NOU C;  2D01 A;  3RH8 B;  1F98 A;  2V1A A;  1TS7 A;  3UMD A;  4B9O A;  3E4O A;  4NXB A;  1TS6 A;  3UB7 A;  4WLA A;  3IS2 A;  3LUQ A;  3IBR A;  1ODV A;  3FG8 A;  4GS9 B;  4I3A A;  2V0U A;  4JGQ A;  2A24 A;  2JHE A;  4I5S A;  2QKP A;  4L9F A;  4HJ3 A;  2VLG A;  1WA9 A;  2B02 A;  1DP8 A;  3NOP C;  4BBV A;  3CLO A;  4I38 A;  3PHY A;  3HJK A;  4WN5 A;  5EFW A;  2YKH A;  1N9L A;  2HV1 A;  3A0S A;  3VE3 A;  3LIE A;  2QHK A;  3SW1 A;  5F5Y A;  1OJ5 A;  4L9E A;  3VOL A;  4HHD A;  3LIB A;  1XJ3 A;  5TBM A;  2OWJ A;  2L4R A;  4NXG A;  4EET B;  2PR5 A;  3E4Q A;  2PHY A;  4JGP A;  4GW9 A;  5HD3 A;  1OTA A;  4GHI A;  1S1Y A;  3BWL A;  5AVE A;  4PKY G;  2KX6 A;  3P7N A;  4GS9 A;  2PD8 A;  1P97 A;  4RQ9 A;  3UB8 A;  1LSW A;  5DKL A;  4BBU A;  5J4E A;  2PDR A;  2GJ3 A;  3H82 B;  1UWP X;  4EW7 A;  4F3L A;  4DJ2 A;  2V9A A;  3KX0 X;  1EW0 A;  4KQD A;  1OTI A;  3LIA A;  4LRZ E;  5F68 A;  5J7E A;  1D06 A;  1S66 L;  3LYX A;  3NJA A;  3H7W A;  5AVF A;  2YKF A;  5G4Y A;  4EES A;  4MN6 A;  2A24 B;  2PD7 A;  2ZOH A;  1V9Z A;  5HSQ A;  1NWZ A;  2L1M A;  3A0R A;  1OTE A;  3F1N B;  3H82 A;  4M4X A;  5HDC A;  2Z6D A;  2K7S A;  4H6J A;  4F3L B;  3C8C A;  3RTY A;  5HDD A;  4I39 A;  4HNB A;  1XJ2 A;  3UB9 A;  1P0Z A;  4DJ3 A;  1N9N A;  3EWK A;  4K08 A;  1JNU A;  3LIC A;  2BAS A;  2M1C A;  3G6O A;  5J3W A;  4KUK A;  1G28 A;  2PYR A;  1T1B A;  1GSV A;  2R78 A;  3EEH A;  3MFX A;  5DJU A;  4EEU A;  1MZU A;  3F1O B;  4HP4 A;  4NXF A;  2V0W A;  1Y28 A;  2Z6C A;  1LSX A;  3ZQ5 A;  1DP6 A;  3BY8 A;  3HJI A;  4EER A;  1VB6 A;  2PYP A;  2QWS A;  5HD5 A;  5IU1 A;  3VE4 A;  1T1A A;  3BY9 A;  1LL8 A;  4I3I A;  4E04 A;  5HWT A;  1OT6 A;  4WL9 A;  3H9W A;  1KOU A;  1T18 A;  1D7E A;  3F1N A;  2L0W A;  2ZBB A;  4HI4 A;  2ZOI A;  4HQA A;  4HIA A;  4MN5 A;  3GEC A;  1DP9 A;  3NHQ A;  3F1O A;  2VV8 A;  3LID A;  1DRM A;  2J80 A;  2I9V A;  3MR0 A;  2KDK A;  4LLO B;  4R38 A;  3B33 A;  1XFQ A;  1XJ4 A;  3C2W A;  4PKY A;  5TBM B;  1X0O A;  2OWH A;  2W0N A;  5HDS A;  2WKQ A;  4KUO A;  3T50 A;  5KIZ A;  5IS1 A;  3D72 A;  3LI8 A;  2CMN A;  3OLO A;  4L9G A;  3GDI A;  4JGO A;  4LRY C;  1OJG A;  4R6L A;  4WF0 A;  4BBT A;  2VEA A;  1GSW A;  2WKR A;  3MQQ A;  3MXQ A;  1GSX A;  1F9I A;  4R70 A;  5I5L A;  2V1B A;  5A8B A;  5HWW A;  4HH2 A;  4LRX C;  1S1Z A;  1LT0 A;  4NXE A;  4HOI A;  2VV7 A;  4EEP A;  3MQO A;  4HJ6 A;  3ICY A;  1S67 L;  1T19 A;  4HH3 A;  4HP9 A;  3LI9 A;  2P7J A;  4LPZ A;  2QJ5 A;  2OOL A;  5DJT A;  1BYW A;  4H6J B;  1S4S A;  1XJ6 A;  3UB6 A;  1TS8 A;  4YWZ A;  4EQ1 A;  3E4P A;  1OT9 A;  4EXO A;  1OTB A;  3UME A;  3K3D A;  3PYP A;  1S4R A;  4R3A A;  4GCZ A;  2PR6 A;  3LIF A;  2W27 A;  3NOT C;  2EA9 A;  4JGR A;  4HY8 A;  1V9Y A;  3A0V A;  3CWF A;  5F69 A;  3UE6 A;  1N9O A;  2D02 A;  1XFN A;  5HZH A;  4XT2 B;  3IS2 B;  1TS0 A;  1UWN X;  2H28 A;  5F6A A;  3K3C A;  4I3J A;  3ULF A;  2QJ7 A;  2JN7 A;  4HJ4 A;  3CAX A;  1UGU A;  1T1C A;  4WUJ A;  4GHI B;  5DKK A;  4XT2 A;  3H7W B;  3F1P B;  1OTD A; 
#chains in the Genus database with same CATH topology
 2VV6 A;  1ESU A;  3UB7 A;  4Y7P A;  4KZ8 A;  2PBY A;  1ODV A;  4MEZ A;  3C4O A;  3TE8 A;  1VEU A;  3VP0 A;  4BBV A;  4CQH A;  1AWI A;  3LIE A;  2WKH A;  5F5Y A;  3PBO A;  1EI5 A;  3M2J A;  4WZ4 A;  3P01 A;  4GHI A;  4GD8 A;  3VOZ A;  3O5Y A;  5JYO A;  3CG5 A;  3H82 B;  3LR0 A;  5FA7 A;  1EW0 A;  1MXO A;  2B18 A;  2XDM A;  1SKO A;  5EE8 A;  2Z6D A;  2BG1 A;  4H8R A;  3RTY A;  5HDD A;  1DP6 A;  2XRN A;  1LL8 A;  1TVF A;  3VFH A;  4WM9 A;  4E04 A;  3H9W A;  2L0W A;  4U0T A;  2HGV A;  3B47 A;  2KDK A;  3OZH A;  2A2L A;  4B4X A;  3G35 A;  4EBL A;  3LI8 A;  3BFC A;  4L9G A;  1JWV A;  4M3K A;  1L0F A;  4EWF A;  4GNU A;  2WGV A;  3AGE A;  3ZCZ A;  1XP4 A;  3BW6 A;  4ID4 A;  3A3J A;  2IA2 A;  4EXO A;  4OPZ A;  3DTK A;  4S2N A;  5E43 A;  1MWU A;  5HZH A;  2JN7 A;  2KLI A;  1YM1 A;  1SCW A;  3ISG A;  5C5K A;  2PBD P;  1OTD A;  3N4I A;  5TJJ A;  3EGD C;  1G68 A;  4EQI A;  4BL2 A;  3LUQ A;  2Y4A A;  3L9K A;  4N9K A;  3NOP C;  3CLO A;  1WYB A;  3PHY A;  1BUE A;  3IF6 B;  5AJG A;  4GZB A;  2WYX A;  1XXM A;  3WRT A;  3SS4 A;  2L4R A;  1I2S A;  1PWG A;  1S1Y A;  3UPO A;  3PR6 A;  1K54 A;  3P7N A;  4OQG A;  3B3X A;  1UWP X;  4OQI A;  3LIA A;  2QYB A;  5EM1 A;  4EBN A;  1YSP A;  4JXW A;  2XR0 A;  2ZQ8 A;  2ZOH A;  4P6Z M;  2PT7 A;  5FQM A;  1YMX A;  2BAS A;  3VOY A;  3C5A A;  4X68 A;  5DJU A;  3QP8 A;  1KOU A;  1D7E A;  3NHQ A;  2VV8 A;  4LLO B;  1DRM A;  3SZT A;  4Y0T A;  2W0N A;  2R9W A;  2Y2O A;  4WZ5 A;  4R0Q A;  1YLP A;  2JKT I;  1GSX A;  2OLU A;  4LEN A;  2VV7 A;  3A3I A;  1FOF A;  4UHU A;  2HPB A;  1W5D A;  5FQ9 A;  3WS5 A;  1XJ6 A;  3UB6 A;  4EQ1 A;  3D4F A;  1FIL A;  2Y2K A;  1LL9 A;  3LR4 A;  3UB5 P;  4HY8 A;  1Y54 A;  3UE6 A;  4N9L A;  5CHU A;  4S2N C;  2H28 A;  1KE0 A;  4IBX A;  4NKP A;  3D9Y A;  4NG2 A;  5A90 A;  5DKK A;  1GHI A;  1FSY A;  1KGF A;  3CJM A;  2I72 A;  3NC8 A;  4ZJ2 A;  3IXG A;  5M18 A;  4R23 A;  3VP3 A;  3ZVW A;  2V0U A;  1NLZ A;  4PM6 A;  5E2E A;  3V39 A;  3V3S A;  5BOH A;  5FAS A;  4WMC A;  3I7J A;  3VFF A;  3PAG A;  4OOL A;  3ITB A;  4F94 A;  5HD3 A;  2KX6 A;  3UPN A;  1NZO A;  3MFD A;  5CED A;  2LB5 A;  2W3D A;  1XA7 A;  3E2L A;  3CUE A;  3M2K A;  4KZ5 A;  4D60 A;  5F1F A;  1MC0 A;  3OC2 A;  4JKT A;  3LEZ A;  2GDN A;  3C38 A;  5CEC A;  1YMS A;  4P6Z S;  1MKI A;  1T1B A;  4OP8 A;  2HP5 A;  3S1Y A;  4LCL A;  2W3G A;  4OON A;  3CPT B;  1H3Q A;  2ZQA A;  1OT6 A;  2BLS A;  1Y4O A;  4UEY A;  2P74 A;  4CLC E;  3C2W A;  3IWO A;  3OLO A;  3ZG9 B;  4R6L A;  1PIO A;  3SH9 A;  2JKF A;  3MSH A;  4KG2 A;  3VV4 A;  5GLA A;  4S2O A;  3DBA A;  2H0Y A;  4X69 A;  3NOT C;  4ZBE A;  2Q0O A;  3PBQ A;  3A0V A;  2JC7 A;  1HVB A;  3V50 A;  2UWX A;  4EV4 A;  4PPR A;  4XT2 B;  1YQS A;  5L2F A;  2QJ7 A;  3KYZ A;  1Q2P A;  4GDB A;  3S4X A;  1K57 C;  1FIK A;  1N4O A;  4DKI A;  3UE3 A;  2W3H A;  1W8Y A;  4N92 A;  3MXS A;  5CHM A;  1WA9 A;  4PM5 A;  2YKH A;  3KSF A;  4KZ6 A;  1W79 A;  2H10 A;  5DFX A;  3FPW A;  3LIB A;  1DJC A;  4GS9 A;  1PYY A;  4RQ9 A;  5FAO A;  4BWI A;  2J9P A;  5G4Y A;  2A24 B;  4M4X A;  4D2O A;  3IWI A;  5FSR A;  5HFO A;  1NRF A;  5EVI B;  2K31 A;  4OOY A;  3G34 A;  3NI9 A;  3Q7V A;  4FTX A;  5DTT A;  2Y2M A;  2OWH A;  1YLY A;  4LV1 A;  5CHJ A;  4HBU A;  3S7O A;  4LRX C;  2H5S A;  1VET A;  4HP9 A;  5FDH A;  4MCW A;  3HLB A;  2E8I A;  5IHV A;  3E4P A;  3SH8 A;  3MZF A;  3LIF A;  4Y5F A;  5F69 A;  2K2N A;  1ZTU A;  3ZG7 B;  2Y55 A;  2XD5 A;  1BLP A;  1IFQ A;  4O0P A;  4XT2 A;  1ACF A;  2WGI A;  1W8Q A;  2XFS A;  3CI6 A;  1PW8 A;  2EX6 A;  2Y2N A;  4QY6 A;  2ZQC A;  4OLG A;  1SDE A;  4X1M A;  4CLC B;  5FI7 A;  2XSS A;  4Y2F A;  3MMH A;  4ZRR A;  3BFF A;  3BFG A;  2HZ5 A;  4UAA A;  5AQ7 A;  3A0S A;  5FEG A;  5FQJ A;  3C30 A;  3VOL A;  1XJ3 A;  1YPR A;  4S2K A;  5TBM A;  3ZDJ A;  2HDS A;  2PHY A;  4CPK A;  3WWX A;  5AVE A;  2Y8H A;  4FOF A;  4F3L A;  2XFT A;  3DWK A;  3NJA A;  1K56 A;  3NUL A;  4E6X A;  3T4J A;  4I39 A;  1STZ A;  3WS2 A;  2W3F A;  1G28 A;  3Q7Z A;  3A3D A;  1GHP A;  1T1A A;  2XK1 A;  3BEB A;  4JPM A;  2J80 A;  2CC1 A;  2WZX A;  5HDS A;  4KUO A;  3T50 A;  4OPQ A;  3ZNT A;  1NYY A;  4IVK A;  2VEA A;  3GQZ A;  5A92 A;  4GLQ A;  5HWW A;  2WUQ A;  1LT0 A;  2PU2 A;  1ONG A;  2P7J A;  1TS8 A;  2ZQ7 A;  3TW8 A;  2XA7 M;  3IHB A;  1V9Y A;  2HJE A;  1FR6 A;  4X25 A;  1ES5 A;  2OAQ 1;  5F6A A;  2ZC7 A;  4R3J A;  3PAE A;  4CJN A;  4UA9 A;  5FAP A;  2Y59 A;  3HLE A;  4R1G A;  3FC7 A;  4C3Q A;  1I2W A;  1QME A;  2V1A A;  3UMD A;  4QY5 A;  1O7E A;  5KSH A;  4HEF A;  1MWT A;  2FH5 A;  1TF1 A;  1N9L A;  2R9X A;  4WBG A;  2J3W A;  1KE4 A;  2P9V A;  5EUA A;  3U4L P;  4L9E A;  1GA9 A;  4RVA A;  5TR7 A;  1LI0 A;  2PD8 A;  3UB8 A;  4DXC A;  5J4E A;  5DF7 A;  2GJ3 A;  3KX0 X;  4IBR A;  3Q82 A;  3LYX A;  4BMW A;  3T4K A;  1V9Z A;  5DTK A;  2L1M A;  1NXY A;  3H82 A;  1NRJ A;  3BLM A;  4WEJ A;  3EWK A;  3KSG A;  1ES4 A;  4DF6 A;  3EEA A;  2JKR M;  4U0X A;  3ZQ5 A;  2QWS A;  5HD5 A;  3VE4 A;  1ESI A;  2E8J A;  5HWT A;  2X71 A;  3L7H A;  1FQG A;  3LID A;  2I9V A;  3T1R A;  5DTS A;  4K0X A;  5FEF A;  2O9B A;  2DMW A;  3QP1 A;  2ZC6 B;  3ZNY A;  1F9I A;  2WAE A;  3MXR A;  2WGW B;  1G5U A;  4HJ6 A;  1S67 L;  1T19 A;  5KMW A;  3LI9 A;  2EXA A;  2G7U A;  2VJW A;  3SS3 A;  3PYP A;  4R3A A;  4EUZ A;  2ZQD A;  1RGZ A;  1YSQ A;  5LBR A;  3A3E A;  4G3W A;  3WRZ A;  1YLZ A;  1YLW A;  4HJ4 A;  5HWV A;  3FKW A;  2NUP C;  2XRO A;  2IWC A;  3GRJ A;  5DF9 A;  2FZ0 A;  4X56 A;  5DF8 A;  1RGY A;  3EOI A;  1BLC A;  2IWD A;  1IYP A;  2ZJ9 A;  2QHK A;  4ARZ A;  1OJ5 A;  3R7W B;  1GA0 A;  4NXG A;  5MC7 A;  4O01 A;  2JKR I;  4GOG A;  1H8Y A;  4R4R A;  4GN2 A;  3BLS A;  5F68 A;  4EES A;  2HDR A;  1IEL A;  1XX2 A;  3P98 A;  2OV5 A;  4PM9 A;  4RYE A;  1ONH A;  2V8C A;  3T4Q A;  2ZL1 A;  2J7V A;  2UV0 E;  4GKU A;  1YT4 A;  3RFB A;  2Y2L A;  3G6O A;  2VZW A;  4N1H A;  2ZM0 A;  4PM7 A;  3F1O B;  4IED A;  4DRT A;  4I3I A;  4R38 A;  2B5R A;  4KZ4 A;  4MBF A;  4B88 A;  2PAV P;  3B33 A;  1XJ4 A;  1X0O A;  2RL3 A;  3HRE A;  3HUM A;  5A93 A;  2X02 A;  4HH2 A;  3HLC A;  5DFY A;  3M6B A;  2A49 A;  4LPZ A;  1S4S A;  1NY0 A;  3UDI A;  2ACG A;  4HES A;  3U2A A;  2PRF A;  1PWC A;  1ZC2 A;  1O07 A;  1UGU A;  3GSG A;  4OOM A;  4YNR A;  2INW A;  1TS7 A;  5K5B A;  4FUW A;  3UPP A;  1TD5 A;  3DAV A;  4GS9 B;  1F2K A;  1DP8 A;  3KO6 A;  2XEP A;  1CQA A;  3LR3 A;  4Q0I A;  1SHV A;  1FSW A;  3NIA A;  1HD8 A;  3BQ8 A;  3T4T A;  5E2H A;  4KZ9 A;  2V9A A;  4MN7 A;  2ZQ9 A;  4DXB A;  4GJ4 A;  3T1Q B;  4RX3 A;  4ME4 A;  4E3N A;  3T4L A;  5FAQ A;  3UB9 A;  5E2G A;  1TDL A;  5AQA A;  2R78 A;  3HL9 A;  4HP4 A;  2C6W B;  3HJI A;  4A5R A;  2Y2Q A;  4ZJ3 A;  4NK3 A;  1F5M A;  1DP9 A;  2J3T D;  1JWZ A;  1QMF A;  3PBR A;  1H5X A;  5IS1 A;  3GDI A;  4G3K A;  2V20 A;  4P6B A;  2ZC4 B;  2Y2I A;  5IT5 A;  3V3R A;  4UA6 A;  1KGE A;  4GB7 A;  2PU4 A;  3MZD A;  1E25 A;  4BL3 A;  4X6T A;  3KSI A;  4OKP A;  1BZA A;  3V67 A;  1YAX A;  3KYE A;  1WE4 A;  2EA9 A;  3LCE A;  4RX2 A;  3HLW A;  4JXV A;  3UDX A;  4JXS A;  2EX9 A;  2WZZ A;  3CAX A;  5EOE A;  4KQQ A;  3F1P A;  3T4S A;  3NOU C;  5EVI D;  4LV2 A;  4OLD A;  3E4O A;  1YLJ A;  2RCX A;  3IS2 A;  4YIN A;  4I3A A;  1E3U A;  1H0M A;  2VLG A;  1M6K A;  3RXX A;  4I38 A;  3HJK A;  3IX4 A;  3VE3 A;  3PBS A;  2G2U A;  1Q2Q A;  2HP9 A;  4JF6 A;  1K55 A;  2PR5 A;  3IF6 C;  2ZMV A;  4OPR A;  5F82 A;  5GHX A;  4FH2 A;  1DY6 A;  2ZMA A;  5L10 A;  2ZLY A;  3HLG A;  1BUL A;  1C3B A;  4Y15 A;  1PWD A;  4KQD A;  3QHY A;  4X55 A;  4MN6 A;  5DVA A;  5HSQ A;  3QP4 A;  4JF5 A;  2VK3 A;  2VGL M;  4C75 A;  3BJN A;  3C8C A;  1CI8 A;  2EWW A;  4EBP A;  3S7P A;  1MKM A;  1GSV A;  4Z1W A;  1MZU A;  5L09 A;  4WEK A;  5HAQ A;  1IKI A;  3CPT A;  4IHQ A;  3OOV A;  5GLC A;  3TOI A;  4MN5 A;  2ZBB A;  1ZG6 A;  1ES2 A;  2A3U A;  4Q0H A;  1RCJ A;  1BTL A;  1G6A A;  1HZO A;  3JPU A;  4JLF A;  1SDN A;  4CLC C;  4GDN A;  4DDS A;  4OP5 A;  3AGF A;  5EEC A;  4BBT A;  4BLM A;  1GSW A;  5I5L A;  3IF6 A;  2V1B A;  3FKV A;  2Z2M B;  1NYM A;  3SH7 A;  4OPY A;  1W7F A;  1BYW A;  2DRW A;  2ZMF A;  3QNC A;  4LV0 A;  3CIT A;  4MNR A;  1OT9 A;  1S4R A;  2Z2L B;  2W27 A;  2HDU A;  5FI2 A;  4WYY A;  3T12 B;  4I3J A;  5CX7 A;  3G32 A;  4IUK A;  3LR5 A;  5G4Z A;  4S2I A;  1MWS A;  4KZ3 A;  3VP4 A;  3W4O A;  2ZM8 A;  3CMZ A;  4KG6 A;  3WS1 A;  5EOO A;  3VP2 A;  2X01 A;  3OBF A;  3OPH A;  4JXG A;  3E0Y A;  3AGD A;  3RJU A;  5M19 A;  1SKF A;  3HLF A;  3UNW A;  2JE5 A;  3UO9 A;  3ZVT A;  3E4Q A;  1P97 A;  2EXB A;  2J3T C;  3O3V A;  4PHT A;  2PDR A;  4E3O A;  3EGX C;  5FQI A;  5FAT A;  3W4P A;  1OPX A;  1IKG A;  5L07 A;  4JBF A;  1K6S A;  1CEG A;  2K7S A;  3IX3 A;  4MLL A;  4F3L B;  1KE3 A;  4ZAM A;  2EWV A;  2M1C A;  4WMC D;  5J3W A;  4OVD A;  3EEH A;  4EEU A;  3IWQ A;  3IH8 A;  2WKI A;  1K25 A;  1LSX A;  4EER A;  1IEM A;  3SS5 A;  2W3E A;  3TSG A;  3FV7 A;  4ETX A;  4PKY G;  1I5Q A;  3MQ0 A;  3HBR A;  5EVI C;  1XFQ A;  3NCK A;  1WYC A;  4YOF A;  1PZO A;  4ARZ B;  4R70 A;  3ZHH A;  3G2Y A;  1VET B;  3MQO A;  3VP1 A;  2VA0 A;  4MBK A;  4WZ5 C;  3UME A;  3HCY A;  3K3D A;  4GCZ A;  3S22 A;  1PI5 A;  2EX8 A;  3Q81 A;  4JF4 A;  1UWN X;  1K55 C;  3IT9 A;  3VSL A;  3HVF A;  2VKS A;  4GHI B;  4E3I A;  1N9B A;  4E3L A;  1ZHH B;  1KDW A;  4MDZ A;  5KSC A;  1PNE A;  4JGQ A;  5CER A;  1DJA A;  2B95 A;  1CJF A;  2JKT M;  1SKO B;  3UY6 A;  3UN7 A;  4UQI M;  1XGI A;  3SW1 A;  3Q07 A;  5G18 A;  5HAI A;  2OLV A;  1K56 D;  4LGW A;  5HL6 A;  2XQZ A;  4GW9 A;  2M7U A;  4UA7 A;  3IF5 A;  2P9V B;  2J8Y A;  1BT5 A;  4DJ2 A;  3ZGA B;  4KQR A;  3IHA A;  4LRZ E;  5J7E A;  1ZG4 A;  5EVE A;  5TFQ A;  1XGJ A;  2VGJ A;  3FWL A;  4HNB A;  1P0Z A;  4DJ3 A;  1N9N A;  2HJ9 C;  4KUK A;  3MFX A;  4KEN B;  4NXF A;  4DMZ A;  1FR1 A;  4L0L A;  2V0W A;  1Y28 A;  3E2K A;  2Q9N A;  2BTF P;  4KQO A;  4C6Y A;  3F1N A;  2WAD A;  4ESP A;  1PZP A;  5CRF A;  5U47 A;  3ITA A;  1M40 A;  3ZFZ A;  2GNX A;  4WF0 A;  5GHZ A;  1P9W A;  2XF3 A;  1CF0 A;  3ICY A;  4U3T A;  2WAF A;  2OOL A;  4YWZ A;  1J9M A;  2XLN A;  2WGW A;  1N9O A;  5J8X A;  1TS0 A;  1CI9 A;  3OPR A;  4X1L A;  1JWP A;  1Z6F A;  4Y0O A;  4WEL A;  4QJG A;  3NBL A;  3NEC A;  4E3M A;  3MJQ A;  1F98 A;  3JVV A;  4FH4 A;  4QD4 A;  4BQM A;  4DE2 A;  3C4P A;  2QKP A;  4KZA A;  3HUO A;  4Y0U A;  4E6W A;  5EFW A;  2ZM2 A;  5AQ9 A;  1LLB A;  4MBH A;  4QWO A;  5F1G A;  1PFL A;  1H8M A;  3O87 A;  2G2W A;  1NJ4 A;  3LY4 A;  1LSW A;  3JVU A;  4BBU A;  3R7W A;  3DTE A;  3G2Z A;  4Q0J A;  2YKF A;  3M6H A;  3PTE A;  1NWZ A;  3IBJ A;  4LFU A;  1NZU A;  4K08 A;  1JNU A;  2IWB A;  1EWZ A;  1K0K A;  3DW0 A;  4RA7 A;  2PYP A;  5IU1 A;  3BY9 A;  2O0Y A;  1L0E A;  2J9O A;  1BLS A;  4HQA A;  3F1O A;  2OSU A;  1IYS A;  3G4P A;  3W4Q A;  2VX8 A;  4BD0 A;  3MXQ A;  4ZDX A;  3IXH A;  5A8B A;  4NXE A;  4EEP A;  5F83 A;  2QJ5 A;  5DJT A;  3LGO A;  4II7 A;  3B42 A;  3ZG5 A;  4B93 A;  3WS4 A;  5A91 A;  1LHY A;  2JKG A;  2MJ6 A;  2KOI A;  5FQK A;  1ERQ A;  3T1X A;  3IS2 B;  2FFF B;  4O7D A;  3BQA A;  1VHM A;  3BM6 A;  3QP2 A;  1P9R A;  1S6R A;  3HLD A;  2O99 A;  4HBT A;  4X53 A;  3Q7V B;  4WUJ A;  3UDF A;  2WKP A;  5GLD A;  3DTM A;  4NXB A;  1TS6 A;  4WLA A;  2OAP 1;  5GL9 A;  4MMN A;  2JHE A;  5CTN A;  4L9F A;  4HJ3 A;  2ZD8 A;  2B02 A;  1FCM A;  3IQA A;  4O8G A;  4IUH A;  3RXW A;  4ETZ A;  2HV1 A;  4QU3 A;  1G6O A;  1KGG A;  2OWJ A;  3NDE A;  1JTG A;  4QHC A;  3IH9 A;  1OTA A;  3GMW A;  4EUV A;  4Y13 A;  2W1R A;  3LO7 A;  3QP5 A;  4S2J A;  1XA1 A;  1Z09 A;  3EQU A;  3OPP A;  2XH9 A;  2ZC3 B;  3C7V A;  4KG5 A;  1K38 A;  3UE0 A;  1GCE A;  5FL3 A;  4XUZ A;  4G3V A;  3LIC A;  3NY4 A;  4ZTK A;  1ALQ A;  5GLB A;  4GD6 A;  4LV3 A;  1ERO A;  4HI4 A;  3N8R A;  2ZOI A;  3CHW P;  3CZD A;  5EVL A;  3MR0 A;  3MKE A;  5TBM B;  5KIZ A;  3IX8 A;  1PW1 A;  4OQ0 A;  2W1T B;  1CK3 A;  2LB9 A;  1OJG A;  2ZL1 B;  2WKR A;  3MQQ A;  1AXB A;  4DE3 A;  4FSF A;  3MZE A;  3N8L A;  3IXD A;  3TG9 A;  5EPH A;  5FDS A;  1OTB A;  1LL5 A;  2PR6 A;  2HF6 A;  3T4O A;  1PRQ A;  2Q9M A;  3MBZ A;  1L3L A;  2M7V A;  3GTC A;  5E2F A;  3LEQ A;  3W8K A;  4N1X A;  2EFX A;  1T1C A;  1K4F A;  1A0K A;  3VSK A;  3H7W B;  4P0M A;  4KZB A;  4CLC D;  4B9O A;  1KDS A;  1GHM A;  2A24 A;  4XUX A;  5TGF A;  3ZYT A;  1OME A;  4QPR A;  2FFY A;  4WN5 A;  3R4K A;  3S7N A;  3OCN A;  1FCO A;  5CGW A;  1IYQ A;  2JCH A;  3LY3 A;  4EET B;  4JGP A;  3BWL A;  4NET A;  1VM1 A;  4PAU A;  1YKD A;  3GR2 A;  5DKL A;  1YLT A;  4Z9Q A;  1D1J A;  1OTI A;  1D06 A;  2Y2H A;  2P08 A;  3FPV A;  5AVF A;  4S2P A;  2PD7 A;  2WK0 A;  4P87 A;  4OH0 A;  1KVL A;  4OQH A;  5EVI A;  5CTM A;  4R4S A;  3BY8 A;  5FI6 A;  5HPF A;  3GV9 A;  1MY8 A;  3BEC A;  4WL9 A;  3A3F A;  4Q8I A;  1JTD A;  4YFM A;  4PKY A;  4QB8 A;  3OCL A;  4JGO A;  5CXW A;  4K0W A;  3C7U A;  2NUT C;  4E3K A;  2VGK A;  5L8M A;  1S1Z A;  2V8F A;  2EFU A;  4HH3 A;  2WKE A;  2Y91 A;  3ZG0 A;  3TJZ C;  3E98 A;  4BJP A;  3MS6 A;  3CWF A;  2D02 A;  1U60 A;  3T1S A;  3K2N A;  1L2S A;  3ULF A;  2GX5 A;  3F1P B;  2Y2J A;  1MBL A;  3G31 A;  2W1T A;  1PI4 A;  1CEF A;  3G30 A;  5KZH A;  1TEM A;  3FG8 A;  5D3O A;  4XXR A;  3IXB A;  1KVM A;  1BSG A;  3BRM A;  4LCM A;  3VMA A;  2Y2G A;  3LFV A;  4HHD A;  5HAP A;  5I94 A;  2EX2 A;  4DDY A;  1FCN A;  3FZC A;  4Y17 A;  3SOI A;  2GZA A;  4BEN A;  5HPI A;  2AVX A;  4IJG A;  2VGL S;  4BD1 A;  3H7W A;  3FYZ A;  3A0R A;  3F1N B;  4H6J A;  3PBN A;  2DCF A;  1XJ2 A;  3PBT A;  5CGX A;  1IOU A;  1ES3 A;  3V5M A;  4AFI A;  3Q1F A;  1VB6 A;  2P04 A;  4HIA A;  5HAR A;  3GEC A;  4EU0 A;  4DE1 A;  3P09 A;  3QP6 A;  3N7W A;  2V2F F;  2WKQ A;  1DJB A;  3D72 A;  2CMN A;  5EV0 A;  4R3B A;  4K91 A;  2XGN A;  1H8Z A;  1S0W A;  3UE1 A;  1VEU B;  2V1Z A;  4FD8 A;  2H0T A;  4E3J A;  1MWR A;  2XD1 A;  3KYQ A;  2DNS A;  4JGR A;  3MF0 A;  3S7Q A;  1TDG A;  1K4E A;  4B4Z A;  2XA7 S;  1HTZ A;  2O9C A;  2HP6 A;  1LI9 A;  4CLC A;  1K54 C;  1LSV A;  5EM0 A;  3JYI A;  2D01 A;  3RH8 B;  1RP5 A;  2QZ6 A;  3BFE A;  3IBR A;  1MPL A;  1ERM A;  4I5S A;  1IYO A;  3MKF A;  5JYP A;  3O86 A;  4DN0 A;  2JBF A;  2ZC5 B;  3BFD A;  4Y3I A;  1E3U D;  2Y2P A;  5HX9 A;  3OPL A;  4FCF A;  4NEE D;  4UQI S;  4EW7 A;  4P85 A;  1HLU P;  3NDG A;  1S66 L;  3N8S A;  1K6R A;  3GVB A;  5AQB A;  1XKZ A;  3W2Z A;  5M1A A;  1W63 Q;  1OTE A;  2QMI A;  4S2M A;  5HDC A;  1E4D A;  1JVJ A;  1SZV A;  5FQQ A;  3D3O A;  2PYR A;  2O9A A;  5HL1 A;  2Z6C A;  3PXP A;  1J3W A;  1T18 A;  3DTI A;  3KSH A;  5HW3 A;  2C5W B;  3EQV A;  2HDQ A;  3BYD A;  5CEB A;  1W63 M;  3DWZ A;  4LRY C;  1XPB A;  1BLH A;  4HOI A;  3CUE C;  2QPN A;  1K57 A;  1VQQ A;  3WS0 A;  4KZ7 A;  4H6J B;  2Y79 A;  3N6I A;  1NLY A;  4S2L A;  3HUN A;  3QNB A;  1XFN A;  3ZG8 B;  1L0D A;  4DE0 A;  4IVI A;  3TRC A;  1ZKJ A;  3K3C A;  5GHY A;  3O88 A;  1L0G A;  4PMA A;  4PM8 A;  4ZJ1 A;  5CGS A; 
#chains in the Genus database with same CATH homology
 2WKP A;  3F1P A;  3T4S A;  2VV6 A;  3NOU C;  3E4O A;  4NXB A;  1TS6 A;  3UB7 A;  4CLC B;  4WLA A;  2OAP 1;  4MMN A;  2XSS A;  3IS2 A;  4Y2F A;  3MMH A;  1ODV A;  4I3A A;  4ZRR A;  2JHE A;  4L9F A;  4HJ3 A;  2VLG A;  3TE8 A;  2B02 A;  4O8G A;  4CQH A;  4BBV A;  4I38 A;  3HJK A;  4IUH A;  4ETZ A;  2HV1 A;  3A0S A;  3VE3 A;  3LIE A;  1G6O A;  3PBS A;  5F5Y A;  3PBO A;  3C30 A;  3VOL A;  1XJ3 A;  5TBM A;  2OWJ A;  2PR5 A;  2PHY A;  3P01 A;  1OTA A;  2ZMV A;  4GHI A;  5AVE A;  4EUV A;  2W1R A;  3O5Y A;  2Y8H A;  4FOF A;  3H82 B;  3LR0 A;  4F3L A;  1EW0 A;  3EQU A;  4KQD A;  3NJA A;  4MN6 A;  2B18 A;  5HSQ A;  2VGL M;  2Z6D A;  5FL3 A;  3BJN A;  3C8C A;  3RTY A;  5HDD A;  3T4J A;  4I39 A;  2EWW A;  4G3V A;  1STZ A;  3LIC A;  2W3F A;  3S7P A;  1G28 A;  1MKM A;  1GSV A;  4Z1W A;  1MZU A;  4WEK A;  1DP6 A;  2XRN A;  4IHQ A;  3OOV A;  1T1A A;  1LL8 A;  4E04 A;  3H9W A;  4MN5 A;  4HI4 A;  2L0W A;  2ZBB A;  2ZOI A;  2HGV A;  3B47 A;  2J80 A;  3MR0 A;  2KDK A;  4Q0H A;  2A2L A;  4CLC C;  5TBM B;  5HDS A;  5KIZ A;  4KUO A;  3T50 A;  3LI8 A;  2W1T B;  4L9G A;  2LB9 A;  1OJG A;  4BBT A;  2VEA A;  1GSW A;  2WKR A;  3MQQ A;  5I5L A;  4GLQ A;  5HWW A;  2V1B A;  1LT0 A;  4FSF A;  2P7J A;  1BYW A;  2ZMF A;  3BW6 A;  3CIT A;  1TS8 A;  2IA2 A;  1OT9 A;  4EXO A;  1OTB A;  3TW8 A;  1S4R A;  2PR6 A;  2W27 A;  2XA7 M;  1V9Y A;  2HJE A;  5HZH A;  2HF6 A;  3T4O A;  2OAQ 1;  5F6A A;  4I3J A;  2M7V A;  2JN7 A;  2KLI A;  1T1C A;  5CX7 A;  3H7W B;  5C5K A;  1OTD A;  4CLC D;  5TJJ A;  3EGD C;  3FC7 A;  3LR5 A;  4IUK A;  5G4Z A;  4B9O A;  2V1A A;  3UMD A;  3LUQ A;  5KSH A;  2A24 A;  3ZYT A;  3NOP C;  3OBF A;  2FH5 A;  1TF1 A;  3CLO A;  3E0Y A;  3PHY A;  4QPR A;  4WN5 A;  1N9L A;  3R4K A;  5AJG A;  3S7N A;  2J3W A;  3OCN A;  4L9E A;  2L4R A;  4EET B;  3E4Q A;  4JGP A;  1S1Y A;  3BWL A;  3PR6 A;  3P7N A;  2PD8 A;  1P97 A;  4PAU A;  1YKD A;  3UB8 A;  2J3T C;  5DKL A;  5J4E A;  4PHT A;  2PDR A;  2GJ3 A;  1UWP X;  3EGX C;  3KX0 X;  1OTI A;  3LIA A;  2QYB A;  1D06 A;  3LYX A;  2P08 A;  3FPV A;  5AVF A;  4BMW A;  3T4K A;  2PD7 A;  1YSP A;  2ZOH A;  1V9Z A;  1OPX A;  2L1M A;  3H82 A;  2K7S A;  4F3L B;  4P6Z M;  2PT7 A;  1NRJ A;  4WEJ A;  3EWK A;  2EWV A;  2BAS A;  2M1C A;  3KSG A;  5J3W A;  5DJU A;  3EEH A;  4EEU A;  3EEA A;  2JKR M;  1LSX A;  3ZQ5 A;  3BY8 A;  4EER A;  5HPF A;  2QWS A;  5HD5 A;  3VE4 A;  2W3E A;  5HWT A;  4WL9 A;  4ETX A;  1KOU A;  1D7E A;  4PKY G;  3MQ0 A;  3NHQ A;  2VV8 A;  3LID A;  1DRM A;  4LLO B;  2I9V A;  1XFQ A;  4PKY A;  2W0N A;  4YOF A;  2O9B A;  3OCL A;  2DMW A;  4JGO A;  2JKT I;  4ARZ B;  4R70 A;  1GSX A;  1F9I A;  2NUT C;  5L8M A;  1S1Z A;  2VV7 A;  3MQO A;  4HJ6 A;  4HH3 A;  1S67 L;  1T19 A;  3LI9 A;  2VA0 A;  2G7U A;  1XJ6 A;  3UB6 A;  4EQ1 A;  2VJW A;  3TJZ C;  3E98 A;  3UME A;  3HCY A;  3K3D A;  3PYP A;  4R3A A;  4GCZ A;  4BJP A;  3LR4 A;  4HY8 A;  3CWF A;  3UE6 A;  2D02 A;  1YSQ A;  5LBR A;  4G3W A;  1UWN X;  2H28 A;  3K2N A;  4NKP A;  3ULF A;  2VKS A;  4HJ4 A;  2GX5 A;  4GHI B;  5DKK A;  3F1P B;  5HWV A;  2NUP C;  2XRO A;  2W1T A;  1ZHH B;  2FZ0 A;  5DF9 A;  4MDZ A;  3FG8 A;  4JGQ A;  2V0U A;  2JKT M;  3EOI A;  1NLZ A;  4UQI M;  2QHK A;  4ARZ A;  3SW1 A;  1OJ5 A;  3R7W B;  3LFV A;  4HHD A;  4OOL A;  4NXG A;  5MC7 A;  5HL6 A;  4GW9 A;  4O01 A;  5HD3 A;  2M7U A;  2KX6 A;  2JKR I;  2GZA A;  5HPI A;  4DJ2 A;  2LB5 A;  4LRZ E;  5F68 A;  2W3D A;  2VGL S;  4IJG A;  4EES A;  5J7E A;  3H7W A;  3CUE A;  1MC0 A;  3OC2 A;  3A0R A;  3F1N B;  3T4Q A;  4H6J A;  3PBN A;  3C38 A;  4HNB A;  1XJ2 A;  1P0Z A;  3PBT A;  4DJ3 A;  1N9N A;  4P6Z S;  3RFB A;  1IOU A;  2HJ9 C;  3G6O A;  4KUK A;  1T1B A;  2VZW A;  3MFX A;  3F1O B;  4AFI A;  4NXF A;  4DMZ A;  4L0L A;  2V0W A;  1Y28 A;  2W3G A;  1VB6 A;  1H3Q A;  4KQO A;  4I3I A;  1OT6 A;  4R38 A;  3F1N A;  2P04 A;  4UEY A;  4HIA A;  3GEC A;  4EU0 A;  4CLC E;  3B33 A;  1XJ4 A;  3C2W A;  1X0O A;  2WKQ A;  3D72 A;  3OLO A;  2CMN A;  2GNX A;  4WF0 A;  4R6L A;  1P9W A;  4HH2 A;  5DFY A;  3VV4 A;  3ICY A;  4LPZ A;  2OOL A;  3DBA A;  1S4S A;  4YWZ A;  3KYQ A;  3NOT C;  4JGR A;  3PBQ A;  3MF0 A;  3A0V A;  3U2A A;  3S7Q A;  1N9O A;  4XT2 B;  1TS0 A;  2XA7 S;  2O9C A;  2QJ7 A;  3KYZ A;  4CLC A;  1UGU A;  4WEL A;  4OOM A;  4YNR A;  1LSV A;  2INW A;  3MJQ A;  2D01 A;  2W3H A;  1F98 A;  3JVV A;  1TS7 A;  3RH8 B;  3UE3 A;  5K5B A;  1TD5 A;  3IBR A;  4GS9 B;  4I5S A;  2QKP A;  1WA9 A;  1DP8 A;  3KO6 A;  5EFW A;  2YKH A;  3KSF A;  5DFX A;  3FPW A;  3LR3 A;  4Q0I A;  3LIB A;  4DN0 A;  1H8M A;  4Y3I A;  4GS9 A;  3BQ8 A;  4RQ9 A;  3T4T A;  1LSW A;  3JVU A;  4NEE D;  4UQI S;  3R7W A;  4BBU A;  4EW7 A;  2V9A A;  4MN7 A;  4BWI A;  4Q0J A;  1S66 L;  2YKF A;  4GJ4 A;  5G4Y A;  2A24 B;  4ME4 A;  3T4L A;  1NWZ A;  3W2Z A;  1W63 Q;  1OTE A;  4M4X A;  5HDC A;  3IBJ A;  3UB9 A;  4K08 A;  1JNU A;  3D3O A;  2PYR A;  2R78 A;  2O9A A;  2K31 A;  4HP4 A;  2Z6C A;  3HJI A;  2PYP A;  5IU1 A;  3BY9 A;  3PXP A;  2O0Y A;  1T18 A;  3KSH A;  1F5M A;  4HQA A;  1DP9 A;  3F1O A;  2J3T D;  3EQV A;  3PBR A;  5IS1 A;  2OWH A;  1W63 M;  3GDI A;  4LRY C;  4G3K A;  2VX8 A;  3MXQ A;  5A8B A;  3S7O A;  5IT5 A;  4LRX C;  4NXE A;  4EEP A;  4HOI A;  4HP9 A;  3CUE C;  4MCW A;  2QJ5 A;  5DJT A;  4H6J B;  2Y79 A;  4II7 A;  3B42 A;  3E4P A;  4B93 A;  1NLY A;  3KSI A;  3V67 A;  1YAX A;  3LIF A;  4Y5F A;  2EA9 A;  2MJ6 A;  5F69 A;  2KOI A;  1XFN A;  2K2N A;  1ZTU A;  3IS2 B;  3TRC A;  3BQA A;  1VHM A;  3K3C A;  1P9R A;  3CAX A;  2O99 A;  1IFQ A;  4WUJ A;  4O0P A;  4XT2 A;  3CI6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...