3RH8B

Crystal structure of the light-state dimer of fungal blue-light photoreceptor vivid
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
148
structure length
148
Chain Sequence
HTLYAPGGYDIMGYLIQIMNRPNPQVELGPVDTSCALILCDLKQKDTPIVYASEAFLYMTGYSNAEVLGRNCRFLQSPDGMVKPKSTRKYVDSNTINTIRKAIDRNAEVQVEVVNFKKNGQRFVNFLTIIPVRDETGEYRYSMGFQCE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Vivid PAS protein VVD
publication title Structure of a Light-Activated LOV Protein Dimer That Regulates Transcription.
pubmed doi rcsb
source organism Neurospora crassa
molecule tags Circadian clock protein
total genus 34
structure length 148
sequence length 148
chains with identical sequence D
ec nomenclature
pdb deposition date 2011-04-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13426 PAS_9 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3rh8B00
5DJTA 2A24A 5TBMB 2PR5A 2K7SA 1NWZA 3FG8A 1OT6A 4BBUA 4HI4A 3VOLA 4H6JB 1V9ZA 2V1BA 5IS1A 2PDRA 2W0NA 4EEUA 3LI8A 3LICA 3NHQA 1OTIA 1T1AA 1LSVA 4I3JA 1T1BA 1UWNX 1ODVA 1XJ4A 3H7WB 2WKPA 1X0OA 3EEHA 3PHYA 1UGUA 4F3LA 4EXOA 4XT2B 3G6OA 3F1PA 4WL9A 5AVEA 4WN5A 1EW0A 4WUJA 1VB6A 1OTBA 4NXFA 3ZQ5A 3LIEA 4HNBA 4K08A 3FC7A 1KOUA 1GSWA 4MN6A 3H82B 3LIDA 4R38A 1S1YA 2JHEA 3MQQA 3UB8A 1MZUA 2PYRA 5HDSA 2I9VA 5F6AA 3NOTC 5HWVA 4EEPA 2ZOIA 1OTEA 3D72A 4JGQA 4L9EA 4B9OA 3ICYA 3MR0A 1UWPX 5G4YA 4H6JA 2V1AA 3UE6A 4NXEA 4M4XA 4WLAA 4JGOA 2VV6A 2PD7A 4MN5A 4WF0A 1OT9A 3B33A 5EFWA 4HJ3A 2WKQA 4I5SA 2JN7A 3PYPA 3F1NB 3H7WA 3CLOA 2OWHA 2VLGA 1WA9A 1XJ2A 4XT2A 5J7EA 2QKPA 3LIBA 4R3AA 4EERA 5HWWA 4JGRA 3MQOA 1F98A 4LRYC 3MJQA 2WKRA 2YKFA 4PKYG 1XFNA 1T19A 1P0ZA 5IU1A 2QWSA 2ZOHA 1LT0A 5HDDA 3A0SA 1N9OA 3RTYA 2QHKA 3A0RA 5HD5A 4EESA 1V9YA 1D7EA 3C8CA 3F1NA 3EWKA 3NOPC 4I39A 4LLOB 4HH3A 4HH2A 3T50A 4GW9A 2V0WA 4I38A 3BY9A 1P97A 5HZHA 2Z6DA 3MXQA 3H9WA 4KQDA 2KDKA 4L9FA 1GSXA 5I5LA 5TBMA 3F1OB 4HP4A 4NXBA 4BBVA 2P7JA 5J4EA 5F5YA 4I3AA 2ZBBA 3E4PA 5F69A 1S4SA 2M1CA 4EQ1A 2VEAA 4E04A 2R78A 1OTAA 1TS6A 3GDIA 3UMDA 3HJIA 3LUQA 3KX0X 3SW1A 3OLOA 5A8BA 5HSQA 3A0VA 1S66L 4HQAA 2PR6A 1Y28A 3GECA 4DJ3A 1XJ6A 1GSVA 4F3LB 1TS0A 3NOUC 3H82A 3F1PB 4HIAA 2QJ5A 3E4OA 2W27A 5KIZA 4NXGA 4R6LA 3LI9A 1OTDA 2H28A 2J80A 3UMEA 4PKYA 2V9AA 3F1OA 5HDCA 2V0UA 3LYXA 4LRXC 4R70A 4HP9A 3UB9A 5G4ZA 1S4RA 4GS9B 1OJ5A 4I3IA 2EA9A 3LIFA 4EW7A 2INWA 1N9NA 1XFQA 1OJGA 3VE3A 1N9LA 5HD3A 2GJ3A 1XJ3A 4RQ9A 2Z6CA 3P7NA 5DKKA 4HOIA 1F9IA 4HY8A 2BASA 4GHIB 2VV7A 3BWLA 4LPZA 1JNUA 3IS2B 5AVFA 5J3WA 3UB7A 3K3CA 1DP9A 3CWFA 1TS8A 3E4QA 3ULFA 4HJ6A 3UB6A 2A24B 3K3DA 3VE4A 2OWJA 2CMNA 1S67L 2YKHA 2PYPA 4HJ4A 2L0WA 1T18A 4L9GA 4GS9A 1DRMA 3HJKA 2KX6A 1S1ZA 3IBRA 1G28A 2HV1A 4YWZA 1BYWA 1D06A 2L1MA 3BY8A 2L4RA 4JGPA 4KUKA 4BBTA 5F68A 4LRZE 3RH8B 4DJ2A 2PHYA 2OOLA 2B02A 2D01A 1LSXA 4GCZA 1TS7A 2PD8A 3NJAA 4HHDA 1DP6A 4GHIA 3CAXA 3MFXA 4KUOA 5HWTA 3C2WA 5DKLA 3IS2A 2D02A 3LIAA 1T1CA 1LL8A 2QJ7A 2VV8A 1LSWA 1DP8A 5DJUA 4EETB
chains in the Genus database with same CATH superfamily
2J9OA 5DJTA 5FAOA 1VETA 2K7SA 3HLGA 1NY0A 2P9VB 1O7EA 1OT6A 4DE3A 1K6RA 3IXBA 3N4IA 2ZD8A 4Y0TA 4N9LA 4H6JB 1TDLA 1L2SA 3VMAA 2A2LA 1NLYA 4R4RA 2VGLM 2K2NA 4Y0UA 3BW6A 4LENA 3LI8A 4LFUA 3NECA 3BQ8A 4I3JA 5EM0A 1BZAA 1VHMA 2ZC5B 3W8KA 1T1BA 2Y59A 3H7WB 1X0OA 3SS5A 3V3SA 4ZJ1A 5KMWA 3GQZA 2ZC3B 4XT2B 2DNSA 1EW0A 2Y4AA 1VB6A 4NXFA 2ZL1A 3ZQ5A 3EGDC 4K08A 5FDHA 3GMWA 1KOUA 3WRTA 1GSWA 4MN6A 2V1ZA 3LIDA 1L3LA 2XFSA 4RYEA 3UB8A 5L09A 1M40A 5E2GA 5F6AA 5F83A 3NOTC 2J3TD 5HWVA 3PBOA 2PBDP 2ZMAA 4RVAA 3ZNTA 3BLSA 3PBRA 3PAGA 1XX2A 3M2KA 5DVAA 2EX6A 3AGEA 4B4XA 3MR0A 1S6RA 4CLCD 3PBTA 3E0YA 1EI5A 4U3TA 1M6KA 3CI6A 4L0LA 2WK0A 1P9RA 3BFCA 5DFXA 2EFXA 1FIKA 2HDSA 3O86A 2HP5A 3PBQA 3MF0A 3CUEC 1BT5A 2OWHA 1VEUA 2XGNA 5EVIA 1WA9A 4KQQA 1W63Q 3NIAA 1IYPA 1JWZA 3LIBA 1ES2A 2J3WA 2J7VA 3NI9A 2OAQ1 3UO9A 4R3AA 4FSFA 1BULA 1YQSA 1WYBA 4OLGA 2XD1A 3IT9A 3ITBA 2C6WB 3HLCA 4OP8A 4LRYC 3O87A 2Z2LB 3LY3A 1XFNA 5IU1A 2OAP1 2QWSA 2KLIA 5HDDA 1CF0A 3TOIA 4N1HA 3FYZA 3IHAA 2VX8A 1J3WA 4XUZA 3MKEA 1AXBA 3DTEA 1YLTA 2X01A 4DE2A 2Y2JA 3KYZA 4BL3A 2W3EA 3HLBA 2PRFA 4ZRRA 2C5WB 3Q81A 3M2JA 3B47A 1SHVA 3ZCZA 3PAEA 4LLOB 1DJBA 2PAVP 2LB9A 1ONHA 3T50A 3BFDA 2Z6DA 2O0YA 2JKFA 3HLWA 3CZDA 1YSPA 2KDKA 3HVFA 4II7A 2XRNA 3BQAA 2OV5A 5TBMA 4LV3A 2HDQA 4DDYA 4QJGA 2P7JA 3WRZA 4ZTKA 3FKWA 3IX8A 5J4EA 1BTLA 5F5YA 2ZBBA 2HP9A 3E4PA 5F69A 2RL3A 5HAIA 1ERQA 2UWXA 2Y91A 1SKOA 4JBFA 3JVUA 2W3HA 1TS6A 2ZC6B 4GN2A 1STZA 3S4XA 3CITA 4Y17A 5DFYA 3M6HA 1ZKJA 4PAUA 3GDIA 1KVMA 3MKFA 4DXCA 3LUQA 4EUZA 3A3IA 3K2NA 3KSHA 3Q7VA 1RGYA 4S2PA 2W3DA 1Q2PA 1L0EA 1S66L 5MC7A 2J3TC 2PR6A 2ZQ8A 5I94A 1Y28A 3KO6A 1IKGA 4DJ3A 1XJ6A 3KSGA 3P98A 3NOUC 4JF6A 3V50A 3QP8A 3EQVA 4CLCC 1KGEA 1MWRA 3E4OA 1TD5A 3G35A 1OTDA 4U0TA 1A0KA 2J80A 3LR5A 3F1OA 4HEFA 3BFGA 4NETA 5IT5A 3CPTA 4UA6A 4Q0HA 4Q0IA 1MWTA 4E3IA 1WYCA 2H10A 2H0YA 3QNBA 4R70A 4HP9A 3BRMA 5FQJA 2ZM2A 1KE4A 4I3IA 1W5DA 3LIFA 3ZG9B 1D1JA 2A3UA 2EXAA 4ARZB 1OJGA 1N4OA 3BECA 3VE3A 2X71A 5CTNA 1VQQA 1FR1A 4X1MA 5GL9A 1SDEA 3Q82A 5F1GA 4HOIA 4KZ8A 2XFTA 4P6ZM 1MPLA 2M7VA 1CJFA 3BWLA 2VGKA 2Y2GA 3CUEA 1SZVA 1TS8A 3E4QA 3FKVA 4Y15A 4O7DA 1YM1A 2A24B 2WKIA 3K3DA 3VE4A 2CMNA 4MMNA 1S67L 1PWCA 5DTSA 5CRFA 4L9GA 4S2KA 1DRMA 4OPRA 4OH0A 3QP4A 2KX6A 1Y54A 3BFEA 3LFVA 5HAQA 3ZG0A 1ES4A 2HZ5A 2EX9A 1K56A 5EECA 2ZQ7A 3GSGA 3TJZC 3RH8B 1XA7A 2PHYA 4Y2FA 2OOLA 3PR6A 3MXSA 1KDWA 2JKRM 2D01A 3G2YA 2PD8A 2V2FF 3OPRA 4HHDA 1DP6A 1W79A 4GHIA 4EU0A 4E3LA 1Q2QA 4OQIA 4OQGA 5DKLA 5M18A 2V8FA 1GHPA 3LIAA 2QJ7A 2VV8A 2GZAA 2EFUA 2HF6A 3IH9A 1GA0A 2VK3A 3ZG5A 1MWUA 4QD4A 3T12B 5FASA 3MBZA 2PR5A 3RJUA 4BBUA 3R7WB 3PBSA 2EXBA 5FQIA 2XD5A 3VOLA 2H0TA 2Y55A 3OCNA 1HD8A 4GNUA 1V9ZA 1XGJA 3HCYA 5IS1A 2PDRA 3N8SA 3NHQA 4FCFA 5EE8A 4O0PA 4MNRA 4KZ7A 3VP4A 4MCWA 5DTKA 1ESUA 4UAAA 3C4PA 1UWNX 4E6WA 1XKZA 4GD8A 4F3LA 1Z6FA 2Y2LA 3G6OA 4WUJA 3IHBA 1YLJA 3V39A 3N7WA 3LIEA 3VSLA 4G3VA 4UA7A 5E2EA 4OLDA 4R38A 1MZUA 3UDIA 3GVBA 1MXOA 2ZOIA 3IF6B 5CGWA 4CLCA 4JGQA 4L9EA 2P9VA 4S2JA 1IKIA 3ZHHA 4LV0A 4H6JA 4JXWA 4P6BA 1PRQA 4M4XA 1TF1A 4GDNA 2NUPC 1IYSA 2AVXA 3SS4A 4GOGA 3EQUA 5AQBA 2O9AA 4K0WA 3S7QA 2PD7A 2Y2MA 4E6XA 1EROA 2M7UA 1OT9A 3B33A 3IWQA 2HDRA 1K55C 3LY4A 2EX8A 4IEDA 4HJ3A 4JXSA 4Z9QA 4OOYA 3IXDA 4ESPA 2QPNA 5GLAA 1XGIA 2BG1A 3PYPA 3IXGA 2Y2KA 3VP0A 5FQ9A 5DTTA 4QPRA 3H7WA 1W8QA 3P01A 2Y2IA 3D4FA 2ZLYA 2ZQDA 4ZJ2A 4XT2A 5J7EA 5FI2A 1IOUA 3MZDA 5HFOA 3ISGA 5A92A 2HPBA 1NZUA 3MQOA 1F98A 1ACFA 2W1TB 5HX9A 4IUKA 1YKDA 3BEBA 4PKYG 5DF9A 3RXXA 5DF8A 4IVIA 1DJAA 3HL9A 2J9PA 4G3KA 4MBFA 2FFFB 3IX3A 3RXWA 3A0SA 1H8ZA 2A49A 3E2LA 3G31A 4C6YA 3AGFA 1N9OA 5A93A 3TW8A 3RTYA 2QHKA 5EVEA 3M6BA 4MDZA 2PT7A 4OOLA 5HD5A 4MBHA 5HPIA 3S7NA 3AGDA 4KZ5A 2O99A 4R4SA 5FATA 3EWKA 3NOPC 2ACGA 4KZ4A 5AQ7A 3B3XA 5A91A 4KG5A 2WGWB 5EV0A 5FSRA 3BY9A 5CHJA 2JCHA 2GNXA 4FH4A 1BLPA 4C3QA 2JKRI 4OPYA 2W3GA 2ZC4B 2OLUA 1PWGA 4HP4A 4GD6A 4NXBA 5DF7A 4PM8A 5CEBA 4KG6A 4I3AA 4C75A 3O3VA 3MSHA 1VETB 4O8GA 4CQHA 3HREA 5C5KA 2VEAA 4OONA 2KOIA 4N9KA 2Y79A 3C38A 3MMHA 4CLCE 3O5YA 1FSYA 2VA0A 2JE5A 3HJIA 3T4SA 4KZ6A 1YPRA 1ZG6A 3KX0X 3OLOA 4IUHA 3G2ZA 2WKEA 4HQAA 4DE1A 1PI5A 4U0XA 3KYEA 4EBPA 4DE0A 1RCJA 1TS0A 1JVJA 3T1XA 3H82A 4DRTA 1EWZA 5FAQA 3P09A 4IBXA 4KZAA 2QJ5A 4UA9A 2ZL1B 4P6ZS 4NXGA 1PNEA 3LI9A 2GDNA 2H28A 1Y4OA 4JKTA 2XK1A 4X1LA 2R9WA 1GHMA 5CX7A 4OQHA 2V0UA 1LI0A 4LRXC 1G68A 2WADA 5FEFA 1E25A 5L07A 4GS9B 2Z2MB 5AQ9A 5CERA 4QU3A 2EA9A 3G32A 1PI4A 1K25A 4QY6A 1N9LA 5HD3A 2XSSA 3DTKA 2GJ3A 5GHXA 5FDSA 2B5RA 5M19A 3IH8A 1ZHHB 4PM7A 1E3UD 2ZMVA 2BLSA 2Z6CA 3MXRA 1XXMA 3P7NA 3A3DA 5TJJA 4ZDXA 1MKMA 1ZC2A 2BASA 1K55A 4X53A 1VEUB 2VV7A 1LLBA 1JNUA 2WKHA 3IF6C 2Q0OA 4UEYA 1K57C 1SKFA 3UB6A 4X69A 1NJ4A 4KQOA 1L0DA 3SOIA 2YKHA 2ZC7A 2PYPA 1KE0A 1T18A 1N9BA 1XA1A 3FPWA 3IBRA 2QYBA 2GX5A 4ARZA 3IWOA 3KYQA 1BYWA 3WS4A 5A90A 3CMZA 3LEZA 4KQRA 4F94A 5HL1A 4DJ2A 4PMAA 3WS5A 5FA7A 4ZBEA 1FSWA 3OPHA 5LBRA 2IA2A 1YLPA 4HESA 4OP5A 3MFDA 3FZCA 3MFXA 5EPHA 3ZYTA 2WZZA 1NZOA 3VFHA 3QP1A 1DP8A 4S2MA 5CHMA 3G4PA 3IF5A 4EETB 4OKPA 2EWWA 3T4KA 2A24A 3TE8A 5TBMB 2W3FA 2Y2QA 3LCEA 1G6OA 1NWZA 3FG8A 5EOEA 2XA7M 1L0GA 1DY6A 3W2ZA 1OMEA 2ZQCA 4HI4A 4EUVA 3ZFZA 3PXPA 5AJGA 3L9KA 4S2NC 1G5UA 4LCMA 5CGXA 3MS6A 4IJGA 4CJNA 2FFYA 3C4OA 1XP4A 1I2WA 1NRJA 3WS2A 1LSVA 3UB5P 1JTGA 1FILA 4BENA 4PM5A 1LHYA 4GJ4A 1XJ4A 3FPVA 3PHYA 1I2SA 1BUEA 1FCMA 3F1PA 4BD0A 4WL9A 1HVBA 4WN5A 2P08A 1OTBA 1PW1A 4WMCD 4HNBA 4JF5A 2Q9MA 3DAVA 5GHYA 1H8MA 2J8YA 1PFLA 4R0QA 2WGIA 4BJPA 1MWSA 2JHEA 1MKIA 2ZMFA 3MQQA 2PYRA 1LL9A 4N1XA 4WEKA 3BM6A 3ZDJA 4ME4A 1QMFA 4EEPA 2Y8HA 3U2AA 1OTEA 3ZG8B 3RFBA 1YMSA 3D72A 3FV7A 4IHQA 1K0KA 3R7WA 2PBYA 3ICYA 3DTMA 3OBFA 5G4YA 3UE6A 4WLAA 3T1RA 3CHWP 4JGOA 3NDGA 1YSQA 4FTXA 2VGJA 5TGFA 4WYYA 2VV6A 3L7HA 4KZBA 2VGLS 2JKTM 4MN5A 4WF0A 5EUAA 4JLFA 5EFWA 3V67A 4DXBA 4R23A 3F1NB 3JVVA 4MEZA 1K4EA 2MJ6A 3T4QA 3CLOA 2VLGA 1PYYA 4EERA 3BLMA 4BWIA 3C5AA 3GV9A 2ZM8A 2EX2A 3G30A 4YINA 5HWWA 3MJQA 2WKRA 4S2LA 3N8RA 5EM1A 4Z1WA 3UNWA 2ZQ9A 2WAFA 1P0ZA 3IF6A 2ZOHA 2Y2OA 5U47A 4R3BA 4ZJ3A 3S22A 1KGGA 1K57A 1LT0A 3MQ0A 2HP6A 1K54C 1KVLA 5BOHA 4E3JA 2IWDA 3S7OA 2VKSA 1GA9A 1HZOA 4ETZA 4Y3IA 4EESA 1ALQA 4MBKA 3C8CA 3VP1A 3SH7A 4QY5A 3TG9A 3V5MA 4GW9A 2V0WA 5HZHA 2HGVA 2IWCA 3MXQA 3H9WA 4KQDA 1YAXA 5JYPA 4BD1A 3A3EA 5EOOA 2V8CA 2W1TA 1GSXA 5I5LA 5HL6A 2WUQA 1QMEA 3MZEA 4OOMA 5CTMA 1ZTUA 4BBVA 3LO7A 3QP6A 1TVFA 3OPPA 2QMIA 2DCFA 3JYIA 5GLDA 1FR6A 4NG2A 3NY4A 4E3KA 2M1CA 1BSGA 4EQ1A 3LGOA 2G2WA 3VV4A 4E04A 1I5QA 2R78A 1OTAA 3ZVTA 3SH8A 1BLHA 3D3OA 3PTEA 5EVLA 3T1SA 1SCWA 3UMDA 2JBFA 4LGWA 1YLWA 3WWXA 4UHUA 1G6AA 3LR4A 3NC8A 3T1QB 4OPQA 4FH2A 4CPKA 5A8BA 4S2NA 5HSQA 3ZGAB 4KENB 5HAPA 1GSVA 2ZM0A 1FCNA 4F3LB 4P0MA 3UPNA 2W27A 2G2UA 3Q1FA 3UMEA 1YLZA 4NK3A 4ETXA 1IEMA 5HDCA 1F5MA 2WAEA 3LR0A 1W63M 4EBLA 3GR2A 1S4RA 3UY6A 5TR7A 4CLCB 1OJ5A 4N92A 3UE1A 3U4LP 2V20A 2INWA 4IBRA 3UPPA 4QB8A 5TFQA 4ID4A 2X02A 1CI9A 1ES3A 1RP5A 1FOFA 1E3UA 1XJ3A 2ZQAA 3OOVA 2B95A 4RQ9A 5GLCA 3UDFA 5DKKA 4X68A 3N8LA 4B4ZA 2K31A 4HY8A 4WZ4A 5KZHA 2JKTI 1O07A 1TDGA 5L8MA 3MZFA 3IS2B 2BTFP 3UB7A 4M3KA 2XEPA 3CWFA 3IWIA 1CEGA 1DJCA 3ULFA 4BMWA 3DW0A 2E8IA 3IX4A 3Q7ZA 4PM6A 2H5SA 2L0WA 4GS9A 1MY8A 2G7UA 4DN0A 1G28A 2HV1A 1VM1A 3B42A 3W4OA 4YWZA 4FUWA 1IYOA 2XA7S 1D06A 3BY8A 3UE3A 5E2FA 1CI8A 1MC0A 4BBTA 4P87A 1K54A 1TEMA 4PPRA 4KG2A 5F68A 4LRZE 4GLQA 2XF3A 3E2KA 4JF4A 1CK3A 3UPOA 1LSXA 5M1AA 3NJAA 5FQMA 2WZXA 4UQIM 1L0FA 3JPUA 4KUOA 3T4TA 3C2WA 4E3OA 2VZWA 1CEFA 3DBAA 3ITAA 1T1CA 1LL8A 5FL3A 3NBLA 3WS1A 4MN7A 3DWZA 3HBRA 3HLEA 4K91A 4HBUA 1NLZA 1NYYA 3SZTA 4JPMA 3EGXC 4MLLA 1YLYA 2OLVA 3GTCA 3VOZA 2P04A 5FI7A 2Q9NA 4X6TA 4WM9A 1S0WA 3R4KA 4WBGA 3TRCA 5CXWA 2V1BA 2W0NA 4EEUA 3C7UA 3LICA 1OTIA 1T1AA 1H3QA 3DTIA 4LV2A 1H8YA 3TSGA 4DDSA 4X56A 1ODVA 4R1GA 2WKPA 2DMWA 3EEHA 1UGUA 4WMCA 4EXOA 5EVIB 3BJNA 4B93A 5AVEA 4EBNA 3EEAA 4P85A 1CQAA 3UN7A 2R9XA 4WZ5C 3FC7A 5E2HA 4YFMA 3H82B 4O01A 3IQAA 1S1YA 3N6IA 5HDSA 3A3JA 2I9VA 1IFQA 3EOIA 3C30A 4QHCA 3E98A 2UV0E 3OCLA 4WEJA 1XPBA 4B9OA 3PBNA 4Y13A 3HUNA 1H0MA 1UWPX 4GDBA 5J8XA 2V1AA 4NXEA 4BLMA 5FQKA 4ZAMA 5KSHA 3T4JA 1GHIA 3VSKA 2ZJ9A 1C3BA 2HJEA 3GRJA 2WKQA 2XH9A 4I5SA 2VJWA 5FI6A 2JN7A 4RA7A 2JKGA 3CG5A 1ZG4A 4NKPA 1XJ2A 5E43A 2QKPA 2FZ0A 5HARA 5EVID 4Q0JA 1K6SA 1NRFA 3HLFA 5IHVA 1U60A 1W8YA 4JGRA 4JXGA 1WE4A 1MBLA 4WELA 2YKFA 1BLCA 3D9YA 3A3FA 4LV1A 4QWOA 1T19A 1IYQA 4S2IA 2NUTC 5KSCA 2E8JA 1BLSA 1KDSA 4X55A 2JC7A 5K5BA 1F2KA 1SKOB 1YMXA 5CHUA 2QZ6A 3A0RA 1GCEA 2RCXA 3WS0A 1PW8A 1V9YA 2OSUA 3C7VA 1D7EA 3Q7VB 3F1NA 4NEED 4I39A 3VFFA 1PZOA 1NXYA 4HH3A 4HH2A 2O9CA 2I72A 4Y7PA 1LI9A 1ESIA 2B18A 3BYDA 4I38A 1P97A 4RX3A 1PWDA 5FEGA 3BFFA 1IELA 3KSIA 5F1FA 5F82A 3QP2A 3W4PA 2CC1A 3S7PA 3LEQA 4FOFA 4KZ3A 3G34A 4L9FA 1H5XA 4BQMA 4S2OA 3KSFA 4OVDA 3F1OB 3CPTB 4EWFA 4EQIA 4DKIA 3ZVWA 2WYXA 1S4SA 3QHYA 4JXVA 2HJ9C 3IBJA 4OQ0A 1PZPA 1FCOA 4GB7A 1K4FA 5FQQA 3T4LA 1KE3A 2Y2PA 4PM9A 2XDMA 3OC2A 4X25A 3QP5A 4B88A 3SW1A 3UE0A 3A0VA 4Q8IA 3V3RA 3GECA 4FD8A 3SH9A 3HUMA 1E4DA 3F1PB 3VP3A 5D3OA 4HIAA 5L2FA 5KIZA 3DWKA 1ERMA 4R6LA 5CECA 2XR0A 3T4OA 1ONGA 4EV4A 2DRWA 4PKYA 2V9AA 3FWLA 3ZNYA 3IXHA 2PU2A 3LYXA 4H8RA 4WZ5A 3Q07A 1SDNA 5GHZA 5HW3A 3UB9A 5G4ZA 5FAPA 1J9MA 1NYMA 3W4QA 1Z09A 4EW7A 3ZG7B 4IVKA 1N9NA 1XFQA 4RX2A 1YT4A 5EVIC 3VOYA 4R3JA 5G18A 2XQZA 4K0XA 1ES5A 2O9BA 5CGSA 3QNCA 5CEDA 1F9IA 3VP2A 4GHIB 4DF6A 4BL2A 1PIOA 4Y0OA 2HDUA 4LPZA 4XXRA 5AVFA 5J3WA 2P74A 4KZ9A 1JTDA 4OPZA 4LCLA 4Y5FA 3K3CA 2EWVA 1DP9A 4UQIS 4HJ6A 3LR3A 5JYOA 1JWVA 1FQGA 2IWBA 2FH5A 1W7FA 1HTZA 3HUOA 3NDEA 3OZHA 2OWJA 2Y2NA 4XUXA 4YNRA 1JWPA 2PU4A 3UDXA 3CJMA 4D2OA 4HJ4A 4G3WA 1HLUP 5L10A 3HLDA 3OPLA 4PHTA 3HJKA 3NCKA 1S1ZA 3S1YA 4A5RA 1P9WA 4E3MA 4D60A 2WGVA 2L1MA 4AFIA 2XLNA 2L4RA 4JGPA 2W1RA 3I7JA 4KUKA 4GZBA 3O88A 5AQAA 3SS3A 4E3NA 4DMZA 5GLBA 1LL5A 1K56D 2B02A 2WGWA 1K38A 1AWIA 4GCZA 1TS7A 4HBTA 5HPFA 4GKUA 2Y2HA 3CAXA 5HWTA 2LB5A 3IS2A 2D02A 1RGZA 1LSWA 3NULA 1OPXA 4YOFA 5DJUA 2XROA 1KGFA
chains in the Genus database with same CATH topology
2EWWA 5DJTA 3T4KA 2A24A 1NLZA 3TE8A 5TBMB 2W3FA 2PR5A 2K7SA 1G6OA 1NWZA 1OT6A 3FG8A 4BBUA 2XA7M 3EGXC 3R7WB 3PBSA 3W2ZA 2P04A 4HI4A 3VOLA 4H6JB 4EUVA 3R4KA 2A2LA 3OCNA 1NLYA 3PXPA 5AJGA 1V9ZA 3TRCA 2VGLM 2K2NA 3HCYA 2V1BA 5IS1A 3BW6A 4IJGA 2PDRA 2W0NA 4EEUA 3LI8A 3LICA 3NHQA 1OTIA 1T1AA 4O0PA 1NRJA 1H3QA 1LSVA 4MCWA 3BQ8A 4I3JA 1VHMA 1T1BA 1UWNX 1ODVA 4GJ4A 1XJ4A 3H7WB 2WKPA 2DMWA 1X0OA 3EEHA 3FPVA 3PHYA 1UGUA 4F3LA 4EXOA 3BJNA 4XT2B 3G6OA 3F1PA 4WL9A 4B93A 5AVEA 4WN5A 3EEAA 1EW0A 4WUJA 1VB6A 2P08A 1OTBA 4NXFA 3ZQ5A 3EGDC 3LIEA 4HNBA 4K08A 4G3VA 3FC7A 1KOUA 1GSWA 1H8MA 4MN6A 3H82B 3LIDA 4O01A 4R38A 1S1YA 4BJPA 2JHEA 2ZMFA 3MQQA 3UB8A 1MZUA 2PYRA 5HDSA 2I9VA 1IFQA 4WEKA 4ME4A 5F6AA 3NOTC 2J3TD 3EOIA 5HWVA 3PBOA 4EEPA 2Y8HA 2ZOIA 3U2AA 1OTEA 3C30A 3RFBA 4CLCA 3PBRA 3D72A 3E98A 4JGQA 3OCLA 4L9EA 4WEJA 4B9OA 3PBNA 4IHQA 3R7WA 3ICYA 3MR0A 1UWPX 3OBFA 5G4YA 4CLCD 4H6JA 2V1AA 3PBTA 3UE6A 3E0YA 4NXEA 4M4XA 1TF1A 4WLAA 2NUPC 4JGOA 3CI6A 1YSQA 3EQUA 4L0LA 5KSHA 3T4JA 2O9AA 2VV6A 3S7QA 2PD7A 2VGLS 2JKTM 4MN5A 1P9RA 4WF0A 2M7UA 1OT9A 3B33A 2HJEA 5DFXA 5EFWA 4HJ3A 2WKQA 4I5SA 3V67A 2VJWA 2JN7A 3PYPA 3F1NB 3JVVA 4QPRA 3H7WA 3PBQA 2MJ6A 3MF0A 3CUEC 3P01A 4NKPA 3T4QA 3CLOA 2OWHA 2VLGA 1WA9A 1XJ2A 1W63Q 4XT2A 5J7EA 2QKPA 3LIBA 2FZ0A 2J3WA 1IOUA 2OAQ1 4R3AA 4EERA 4FSFA 4BWIA 4Q0JA 5HWWA 4JGRA 3MQOA 1F98A 4LRYC 2W1TB 3MJQA 2WKRA 4IUKA 1YKDA 4WELA 2YKFA 4Z1WA 4PKYG 5DF9A 1XFNA 1T19A 1P0ZA 5IU1A 2OAP1 2QWSA 2ZOHA 2NUTC 2KLIA 4G3KA 5K5BA 1LT0A 5HDDA 3MQ0A 3A0SA 2VX8A 1N9OA 3TW8A 3RTYA 2QHKA 3S7OA 2VKSA 3KYZA 3A0RA 4MDZA 2PT7A 4OOLA 5HD5A 4ETZA 2W3EA 4Y3IA 4EESA 5HPIA 3S7NA 1V9YA 4ZRRA 1D7EA 3C8CA 2O99A 3F1NA 3EWKA 4NEED 3NOPC 3B47A 4I39A 4LLOB 2LB9A 4HH3A 4HH2A 2O9CA 3T50A 2B18A 4GW9A 2V0WA 4I38A 3BY9A 1P97A 5HZHA 2Z6DA 2HGVA 2O0YA 3MXQA 2GNXA 3KSIA 3H9WA 4KQDA 1YAXA 3S7PA 4FOFA 1YSPA 2JKRI 2KDKA 4II7A 2XRNA 3BQAA 2W3GA 2W1TA 4L9FA 1GSXA 5I5LA 5TBMA 5HL6A 3KSFA 4OOMA 3F1OB 4HP4A 1ZTUA 4NXBA 4BBVA 2P7JA 5J4EA 5F5YA 4I3AA 2ZBBA 3E4PA 5F69A 1S4SA 4O8GA 4CQHA 2M1CA 5C5KA 4EQ1A 2VEAA 2HJ9C 3IBJA 3VV4A 2KOIA 3JVUA 4E04A 2R78A 2W3HA 1OTAA 2Y79A 3C38A 1TS6A 1STZA 3D3OA 3CITA 3MMHA 4CLCE 5DFYA 3T4LA 3O5YA 4PAUA 3GDIA 2VA0A 3UMDA 3HJIA 3OC2A 3LUQA 3T4SA 3LR4A 3K2NA 3KSHA 3KX0X 3SW1A 3OLOA 5A8BA 4IUHA 5HSQA 2W3DA 3A0VA 1S66L 4HQAA 5MC7A 2J3TC 2PR6A 1Y28A 3GECA 3KO6A 4DJ3A 1XJ6A 3KSGA 1GSVA 4F3LB 1TS0A 3NOUC 3H82A 3F1PB 3EQVA 4CLCC 4HIAA 2QJ5A 3E4OA 2W27A 1TD5A 4P6ZS 5KIZA 4NXGA 4R6LA 3LI9A 1OTDA 2H28A 3T4OA 2J80A 3UMEA 4PKYA 2V9AA 3LR5A 3F1OA 5IT5A 4ETXA 5CX7A 5HDCA 4Q0HA 4Q0IA 2V0UA 3LYXA 1F5MA 3LR0A 4LRXC 1W63M 4R70A 4HP9A 3UB9A 5G4ZA 1S4RA 4GS9B 4CLCB 1OJ5A 4I3IA 2EA9A 3LIFA 4EW7A 2INWA 1N9NA 1XFQA 4ARZB 1OJGA 3VE3A 1N9LA 5HD3A 2XSSA 2GJ3A 1XJ3A 3OOVA 2O9BA 1ZHHB 4RQ9A 2ZMVA 2Z6CA 3P7NA 5DKKA 4HOIA 2K31A 1F9IA 4HY8A 5TJJA 2JKTI 1MKMA 4P6ZM 2BASA 4GHIB 2VV7A 2M7VA 3BWLA 5L8MA 4LPZA 1JNUA 3IS2B 5AVFA 5J3WA 3UB7A 4Y5FA 3K3CA 3CUEA 2EWVA 1DP9A 4UEYA 4UQIS 3CWFA 1TS8A 3E4QA 3ULFA 4BMWA 4HJ6A 3LR3A 3UB6A 2A24B 3K3DA 2FH5A 4KQOA 3VE4A 2OWJA 2CMNA 4MMNA 4YNRA 1S67L 2YKHA 2PYPA 4HJ4A 4G3WA 2L0WA 1T18A 4L9GA 3FPWA 4GS9A 1DRMA 2G7UA 4PHTA 3HJKA 4DN0A 2KX6A 1S1ZA 3IBRA 3LFVA 1G28A 2HV1A 3B42A 4YWZA 2QYBA 2XA7S 2GX5A 4ARZA 1P9WA 3KYQA 1BYWA 1D06A 2L1MA 3BY8A 4AFIA 3UE3A 2L4RA 4JGPA 2W1RA 1MC0A 4KUKA 4BBTA 3TJZC 5F68A 4LRZE 3RH8B 4DJ2A 4DMZA 4GLQA 2PHYA 4Y2FA 2OOLA 3PR6A 2B02A 2JKRM 2D01A 1LSXA 4GCZA 5LBRA 1TS7A 2IA2A 2PD8A 3NJAA 5HPFA 4UQIM 4HHDA 1DP6A 4GHIA 3CAXA 3MFXA 4KUOA 5HWTA 3T4TA 3C2WA 4EU0A 2LB5A 2VZWA 5DKLA 3IS2A 2D02A 3DBAA 3ZYTA 3LIAA 1T1CA 1LL8A 5FL3A 2QJ7A 2VV8A 1LSWA 1DP8A 2GZAA 1OPXA 2HF6A 4YOFA 5DJUA 2XROA 4MN7A 4EETB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DJT A;  2A24 A;  5TBM B;  2PR5 A;  2K7S A;  1NWZ A;  3FG8 A;  1OT6 A;  4BBU A;  4HI4 A;  3VOL A;  4H6J B;  1V9Z A;  2V1B A;  5IS1 A;  2PDR A;  2W0N A;  4EEU A;  3LI8 A;  3LIC A;  3NHQ A;  1OTI A;  1T1A A;  1LSV A;  4I3J A;  1T1B A;  1UWN X;  1ODV A;  1XJ4 A;  3H7W B;  2WKP A;  1X0O A;  3EEH A;  3PHY A;  1UGU A;  4F3L A;  4EXO A;  4XT2 B;  3G6O A;  3F1P A;  4WL9 A;  5AVE A;  4WN5 A;  1EW0 A;  4WUJ A;  1VB6 A;  1OTB A;  4NXF A;  3ZQ5 A;  3LIE A;  4HNB A;  4K08 A;  3FC7 A;  1KOU A;  1GSW A;  4MN6 A;  3H82 B;  3LID A;  4R38 A;  1S1Y A;  2JHE A;  3MQQ A;  3UB8 A;  1MZU A;  2PYR A;  5HDS A;  2I9V A;  5F6A A;  3NOT C;  5HWV A;  4EEP A;  2ZOI A;  1OTE A;  3D72 A;  4JGQ A;  4L9E A;  4B9O A;  3ICY A;  3MR0 A;  1UWP X;  5G4Y A;  4H6J A;  2V1A A;  3UE6 A;  4NXE A;  4M4X A;  4WLA A;  4JGO A;  2VV6 A;  2PD7 A;  4MN5 A;  4WF0 A;  1OT9 A;  3B33 A;  5EFW A;  4HJ3 A;  2WKQ A;  4I5S A;  2JN7 A;  3PYP A;  3F1N B;  3H7W A;  3CLO A;  2OWH A;  2VLG A;  1WA9 A;  1XJ2 A;  4XT2 A;  5J7E A;  2QKP A;  3LIB A;  4R3A A;  4EER A;  5HWW A;  4JGR A;  3MQO A;  1F98 A;  4LRY C;  3MJQ A;  2WKR A;  2YKF A;  4PKY G;  1XFN A;  1T19 A;  1P0Z A;  5IU1 A;  2QWS A;  2ZOH A;  1LT0 A;  5HDD A;  3A0S A;  1N9O A;  3RTY A;  2QHK A;  3A0R A;  5HD5 A;  4EES A;  1V9Y A;  1D7E A;  3C8C A;  3F1N A;  3EWK A;  3NOP C;  4I39 A;  4LLO B;  4HH3 A;  4HH2 A;  3T50 A;  4GW9 A;  2V0W A;  4I38 A;  3BY9 A;  1P97 A;  5HZH A;  2Z6D A;  3MXQ A;  3H9W A;  4KQD A;  2KDK A;  4L9F A;  1GSX A;  5I5L A;  5TBM A;  3F1O B;  4HP4 A;  4NXB A;  4BBV A;  2P7J A;  5J4E A;  5F5Y A;  4I3A A;  2ZBB A;  3E4P A;  5F69 A;  1S4S A;  2M1C A;  4EQ1 A;  2VEA A;  4E04 A;  2R78 A;  1OTA A;  1TS6 A;  3GDI A;  3UMD A;  3HJI A;  3LUQ A;  3KX0 X;  3SW1 A;  3OLO A;  5A8B A;  5HSQ A;  3A0V A;  1S66 L;  4HQA A;  2PR6 A;  1Y28 A;  3GEC A;  4DJ3 A;  1XJ6 A;  1GSV A;  4F3L B;  1TS0 A;  3NOU C;  3H82 A;  3F1P B;  4HIA A;  2QJ5 A;  3E4O A;  2W27 A;  5KIZ A;  4NXG A;  4R6L A;  3LI9 A;  1OTD A;  2H28 A;  2J80 A;  3UME A;  4PKY A;  2V9A A;  3F1O A;  5HDC A;  2V0U A;  3LYX A;  4LRX C;  4R70 A;  4HP9 A;  3UB9 A;  5G4Z A;  1S4R A;  4GS9 B;  1OJ5 A;  4I3I A;  2EA9 A;  3LIF A;  4EW7 A;  2INW A;  1N9N A;  1XFQ A;  1OJG A;  3VE3 A;  1N9L A;  5HD3 A;  2GJ3 A;  1XJ3 A;  4RQ9 A;  2Z6C A;  3P7N A;  5DKK A;  4HOI A;  1F9I A;  4HY8 A;  2BAS A;  4GHI B;  2VV7 A;  3BWL A;  4LPZ A;  1JNU A;  3IS2 B;  5AVF A;  5J3W A;  3UB7 A;  3K3C A;  1DP9 A;  3CWF A;  1TS8 A;  3E4Q A;  3ULF A;  4HJ6 A;  3UB6 A;  2A24 B;  3K3D A;  3VE4 A;  2OWJ A;  2CMN A;  1S67 L;  2YKH A;  2PYP A;  4HJ4 A;  2L0W A;  1T18 A;  4L9G A;  4GS9 A;  1DRM A;  3HJK A;  2KX6 A;  1S1Z A;  3IBR A;  1G28 A;  2HV1 A;  4YWZ A;  1BYW A;  1D06 A;  2L1M A;  3BY8 A;  2L4R A;  4JGP A;  4KUK A;  4BBT A;  5F68 A;  4LRZ E;  3RH8 B;  4DJ2 A;  2PHY A;  2OOL A;  2B02 A;  2D01 A;  1LSX A;  4GCZ A;  1TS7 A;  2PD8 A;  3NJA A;  4HHD A;  1DP6 A;  4GHI A;  3CAX A;  3MFX A;  4KUO A;  5HWT A;  3C2W A;  5DKL A;  3IS2 A;  2D02 A;  3LIA A;  1T1C A;  1LL8 A;  2QJ7 A;  2VV8 A;  1LSW A;  1DP8 A;  5DJU A;  4EET B; 
#chains in the Genus database with same CATH topology
 2J9O A;  5DJT A;  5FAO A;  1VET A;  2K7S A;  3HLG A;  1NY0 A;  2P9V B;  1O7E A;  1OT6 A;  4DE3 A;  1K6R A;  3IXB A;  3N4I A;  2ZD8 A;  4Y0T A;  4N9L A;  4H6J B;  1TDL A;  1L2S A;  3VMA A;  2A2L A;  1NLY A;  4R4R A;  2VGL M;  2K2N A;  4Y0U A;  3BW6 A;  4LEN A;  3LI8 A;  4LFU A;  3NEC A;  3BQ8 A;  4I3J A;  5EM0 A;  1BZA A;  1VHM A;  2ZC5 B;  3W8K A;  1T1B A;  2Y59 A;  3H7W B;  1X0O A;  3SS5 A;  3V3S A;  4ZJ1 A;  5KMW A;  3GQZ A;  2ZC3 B;  4XT2 B;  2DNS A;  1EW0 A;  2Y4A A;  1VB6 A;  4NXF A;  2ZL1 A;  3ZQ5 A;  3EGD C;  4K08 A;  5FDH A;  3GMW A;  1KOU A;  3WRT A;  1GSW A;  4MN6 A;  2V1Z A;  3LID A;  1L3L A;  2XFS A;  4RYE A;  3UB8 A;  5L09 A;  1M40 A;  5E2G A;  5F6A A;  5F83 A;  3NOT C;  2J3T D;  5HWV A;  3PBO A;  2PBD P;  2ZMA A;  4RVA A;  3ZNT A;  3BLS A;  3PBR A;  3PAG A;  1XX2 A;  3M2K A;  5DVA A;  2EX6 A;  3AGE A;  4B4X A;  3MR0 A;  1S6R A;  4CLC D;  3PBT A;  3E0Y A;  1EI5 A;  4U3T A;  1M6K A;  3CI6 A;  4L0L A;  2WK0 A;  1P9R A;  3BFC A;  5DFX A;  2EFX A;  1FIK A;  2HDS A;  3O86 A;  2HP5 A;  3PBQ A;  3MF0 A;  3CUE C;  1BT5 A;  2OWH A;  1VEU A;  2XGN A;  5EVI A;  1WA9 A;  4KQQ A;  1W63 Q;  3NIA A;  1IYP A;  1JWZ A;  3LIB A;  1ES2 A;  2J3W A;  2J7V A;  3NI9 A;  2OAQ 1;  3UO9 A;  4R3A A;  4FSF A;  1BUL A;  1YQS A;  1WYB A;  4OLG A;  2XD1 A;  3IT9 A;  3ITB A;  2C6W B;  3HLC A;  4OP8 A;  4LRY C;  3O87 A;  2Z2L B;  3LY3 A;  1XFN A;  5IU1 A;  2OAP 1;  2QWS A;  2KLI A;  5HDD A;  1CF0 A;  3TOI A;  4N1H A;  3FYZ A;  3IHA A;  2VX8 A;  1J3W A;  4XUZ A;  3MKE A;  1AXB A;  3DTE A;  1YLT A;  2X01 A;  4DE2 A;  2Y2J A;  3KYZ A;  4BL3 A;  2W3E A;  3HLB A;  2PRF A;  4ZRR A;  2C5W B;  3Q81 A;  3M2J A;  3B47 A;  1SHV A;  3ZCZ A;  3PAE A;  4LLO B;  1DJB A;  2PAV P;  2LB9 A;  1ONH A;  3T50 A;  3BFD A;  2Z6D A;  2O0Y A;  2JKF A;  3HLW A;  3CZD A;  1YSP A;  2KDK A;  3HVF A;  4II7 A;  2XRN A;  3BQA A;  2OV5 A;  5TBM A;  4LV3 A;  2HDQ A;  4DDY A;  4QJG A;  2P7J A;  3WRZ A;  4ZTK A;  3FKW A;  3IX8 A;  5J4E A;  1BTL A;  5F5Y A;  2ZBB A;  2HP9 A;  3E4P A;  5F69 A;  2RL3 A;  5HAI A;  1ERQ A;  2UWX A;  2Y91 A;  1SKO A;  4JBF A;  3JVU A;  2W3H A;  1TS6 A;  2ZC6 B;  4GN2 A;  1STZ A;  3S4X A;  3CIT A;  4Y17 A;  5DFY A;  3M6H A;  1ZKJ A;  4PAU A;  3GDI A;  1KVM A;  3MKF A;  4DXC A;  3LUQ A;  4EUZ A;  3A3I A;  3K2N A;  3KSH A;  3Q7V A;  1RGY A;  4S2P A;  2W3D A;  1Q2P A;  1L0E A;  1S66 L;  5MC7 A;  2J3T C;  2PR6 A;  2ZQ8 A;  5I94 A;  1Y28 A;  3KO6 A;  1IKG A;  4DJ3 A;  1XJ6 A;  3KSG A;  3P98 A;  3NOU C;  4JF6 A;  3V50 A;  3QP8 A;  3EQV A;  4CLC C;  1KGE A;  1MWR A;  3E4O A;  1TD5 A;  3G35 A;  1OTD A;  4U0T A;  1A0K A;  2J80 A;  3LR5 A;  3F1O A;  4HEF A;  3BFG A;  4NET A;  5IT5 A;  3CPT A;  4UA6 A;  4Q0H A;  4Q0I A;  1MWT A;  4E3I A;  1WYC A;  2H10 A;  2H0Y A;  3QNB A;  4R70 A;  4HP9 A;  3BRM A;  5FQJ A;  2ZM2 A;  1KE4 A;  4I3I A;  1W5D A;  3LIF A;  3ZG9 B;  1D1J A;  2A3U A;  2EXA A;  4ARZ B;  1OJG A;  1N4O A;  3BEC A;  3VE3 A;  2X71 A;  5CTN A;  1VQQ A;  1FR1 A;  4X1M A;  5GL9 A;  1SDE A;  3Q82 A;  5F1G A;  4HOI A;  4KZ8 A;  2XFT A;  4P6Z M;  1MPL A;  2M7V A;  1CJF A;  3BWL A;  2VGK A;  2Y2G A;  3CUE A;  1SZV A;  1TS8 A;  3E4Q A;  3FKV A;  4Y15 A;  4O7D A;  1YM1 A;  2A24 B;  2WKI A;  3K3D A;  3VE4 A;  2CMN A;  4MMN A;  1S67 L;  1PWC A;  5DTS A;  5CRF A;  4L9G A;  4S2K A;  1DRM A;  4OPR A;  4OH0 A;  3QP4 A;  2KX6 A;  1Y54 A;  3BFE A;  3LFV A;  5HAQ A;  3ZG0 A;  1ES4 A;  2HZ5 A;  2EX9 A;  1K56 A;  5EEC A;  2ZQ7 A;  3GSG A;  3TJZ C;  3RH8 B;  1XA7 A;  2PHY A;  4Y2F A;  2OOL A;  3PR6 A;  3MXS A;  1KDW A;  2JKR M;  2D01 A;  3G2Y A;  2PD8 A;  2V2F F;  3OPR A;  4HHD A;  1DP6 A;  1W79 A;  4GHI A;  4EU0 A;  4E3L A;  1Q2Q A;  4OQI A;  4OQG A;  5DKL A;  5M18 A;  2V8F A;  1GHP A;  3LIA A;  2QJ7 A;  2VV8 A;  2GZA A;  2EFU A;  2HF6 A;  3IH9 A;  1GA0 A;  2VK3 A;  3ZG5 A;  1MWU A;  4QD4 A;  3T12 B;  5FAS A;  3MBZ A;  2PR5 A;  3RJU A;  4BBU A;  3R7W B;  3PBS A;  2EXB A;  5FQI A;  2XD5 A;  3VOL A;  2H0T A;  2Y55 A;  3OCN A;  1HD8 A;  4GNU A;  1V9Z A;  1XGJ A;  3HCY A;  5IS1 A;  2PDR A;  3N8S A;  3NHQ A;  4FCF A;  5EE8 A;  4O0P A;  4MNR A;  4KZ7 A;  3VP4 A;  4MCW A;  5DTK A;  1ESU A;  4UAA A;  3C4P A;  1UWN X;  4E6W A;  1XKZ A;  4GD8 A;  4F3L A;  1Z6F A;  2Y2L A;  3G6O A;  4WUJ A;  3IHB A;  1YLJ A;  3V39 A;  3N7W A;  3LIE A;  3VSL A;  4G3V A;  4UA7 A;  5E2E A;  4OLD A;  4R38 A;  1MZU A;  3UDI A;  3GVB A;  1MXO A;  2ZOI A;  3IF6 B;  5CGW A;  4CLC A;  4JGQ A;  4L9E A;  2P9V A;  4S2J A;  1IKI A;  3ZHH A;  4LV0 A;  4H6J A;  4JXW A;  4P6B A;  1PRQ A;  4M4X A;  1TF1 A;  4GDN A;  2NUP C;  1IYS A;  2AVX A;  3SS4 A;  4GOG A;  3EQU A;  5AQB A;  2O9A A;  4K0W A;  3S7Q A;  2PD7 A;  2Y2M A;  4E6X A;  1ERO A;  2M7U A;  1OT9 A;  3B33 A;  3IWQ A;  2HDR A;  1K55 C;  3LY4 A;  2EX8 A;  4IED A;  4HJ3 A;  4JXS A;  4Z9Q A;  4OOY A;  3IXD A;  4ESP A;  2QPN A;  5GLA A;  1XGI A;  2BG1 A;  3PYP A;  3IXG A;  2Y2K A;  3VP0 A;  5FQ9 A;  5DTT A;  4QPR A;  3H7W A;  1W8Q A;  3P01 A;  2Y2I A;  3D4F A;  2ZLY A;  2ZQD A;  4ZJ2 A;  4XT2 A;  5J7E A;  5FI2 A;  1IOU A;  3MZD A;  5HFO A;  3ISG A;  5A92 A;  2HPB A;  1NZU A;  3MQO A;  1F98 A;  1ACF A;  2W1T B;  5HX9 A;  4IUK A;  1YKD A;  3BEB A;  4PKY G;  5DF9 A;  3RXX A;  5DF8 A;  4IVI A;  1DJA A;  3HL9 A;  2J9P A;  4G3K A;  4MBF A;  2FFF B;  3IX3 A;  3RXW A;  3A0S A;  1H8Z A;  2A49 A;  3E2L A;  3G31 A;  4C6Y A;  3AGF A;  1N9O A;  5A93 A;  3TW8 A;  3RTY A;  2QHK A;  5EVE A;  3M6B A;  4MDZ A;  2PT7 A;  4OOL A;  5HD5 A;  4MBH A;  5HPI A;  3S7N A;  3AGD A;  4KZ5 A;  2O99 A;  4R4S A;  5FAT A;  3EWK A;  3NOP C;  2ACG A;  4KZ4 A;  5AQ7 A;  3B3X A;  5A91 A;  4KG5 A;  2WGW B;  5EV0 A;  5FSR A;  3BY9 A;  5CHJ A;  2JCH A;  2GNX A;  4FH4 A;  1BLP A;  4C3Q A;  2JKR I;  4OPY A;  2W3G A;  2ZC4 B;  2OLU A;  1PWG A;  4HP4 A;  4GD6 A;  4NXB A;  5DF7 A;  4PM8 A;  5CEB A;  4KG6 A;  4I3A A;  4C75 A;  3O3V A;  3MSH A;  1VET B;  4O8G A;  4CQH A;  3HRE A;  5C5K A;  2VEA A;  4OON A;  2KOI A;  4N9K A;  2Y79 A;  3C38 A;  3MMH A;  4CLC E;  3O5Y A;  1FSY A;  2VA0 A;  2JE5 A;  3HJI A;  3T4S A;  4KZ6 A;  1YPR A;  1ZG6 A;  3KX0 X;  3OLO A;  4IUH A;  3G2Z A;  2WKE A;  4HQA A;  4DE1 A;  1PI5 A;  4U0X A;  3KYE A;  4EBP A;  4DE0 A;  1RCJ A;  1TS0 A;  1JVJ A;  3T1X A;  3H82 A;  4DRT A;  1EWZ A;  5FAQ A;  3P09 A;  4IBX A;  4KZA A;  2QJ5 A;  4UA9 A;  2ZL1 B;  4P6Z S;  4NXG A;  1PNE A;  3LI9 A;  2GDN A;  2H28 A;  1Y4O A;  4JKT A;  2XK1 A;  4X1L A;  2R9W A;  1GHM A;  5CX7 A;  4OQH A;  2V0U A;  1LI0 A;  4LRX C;  1G68 A;  2WAD A;  5FEF A;  1E25 A;  5L07 A;  4GS9 B;  2Z2M B;  5AQ9 A;  5CER A;  4QU3 A;  2EA9 A;  3G32 A;  1PI4 A;  1K25 A;  4QY6 A;  1N9L A;  5HD3 A;  2XSS A;  3DTK A;  2GJ3 A;  5GHX A;  5FDS A;  2B5R A;  5M19 A;  3IH8 A;  1ZHH B;  4PM7 A;  1E3U D;  2ZMV A;  2BLS A;  2Z6C A;  3MXR A;  1XXM A;  3P7N A;  3A3D A;  5TJJ A;  4ZDX A;  1MKM A;  1ZC2 A;  2BAS A;  1K55 A;  4X53 A;  1VEU B;  2VV7 A;  1LLB A;  1JNU A;  2WKH A;  3IF6 C;  2Q0O A;  4UEY A;  1K57 C;  1SKF A;  3UB6 A;  4X69 A;  1NJ4 A;  4KQO A;  1L0D A;  3SOI A;  2YKH A;  2ZC7 A;  2PYP A;  1KE0 A;  1T18 A;  1N9B A;  1XA1 A;  3FPW A;  3IBR A;  2QYB A;  2GX5 A;  4ARZ A;  3IWO A;  3KYQ A;  1BYW A;  3WS4 A;  5A90 A;  3CMZ A;  3LEZ A;  4KQR A;  4F94 A;  5HL1 A;  4DJ2 A;  4PMA A;  3WS5 A;  5FA7 A;  4ZBE A;  1FSW A;  3OPH A;  5LBR A;  2IA2 A;  1YLP A;  4HES A;  4OP5 A;  3MFD A;  3FZC A;  3MFX A;  5EPH A;  3ZYT A;  2WZZ A;  1NZO A;  3VFH A;  3QP1 A;  1DP8 A;  4S2M A;  5CHM A;  3G4P A;  3IF5 A;  4EET B;  4OKP A;  2EWW A;  3T4K A;  2A24 A;  3TE8 A;  5TBM B;  2W3F A;  2Y2Q A;  3LCE A;  1G6O A;  1NWZ A;  3FG8 A;  5EOE A;  2XA7 M;  1L0G A;  1DY6 A;  3W2Z A;  1OME A;  2ZQC A;  4HI4 A;  4EUV A;  3ZFZ A;  3PXP A;  5AJG A;  3L9K A;  4S2N C;  1G5U A;  4LCM A;  5CGX A;  3MS6 A;  4IJG A;  4CJN A;  2FFY A;  3C4O A;  1XP4 A;  1I2W A;  1NRJ A;  3WS2 A;  1LSV A;  3UB5 P;  1JTG A;  1FIL A;  4BEN A;  4PM5 A;  1LHY A;  4GJ4 A;  1XJ4 A;  3FPV A;  3PHY A;  1I2S A;  1BUE A;  1FCM A;  3F1P A;  4BD0 A;  4WL9 A;  1HVB A;  4WN5 A;  2P08 A;  1OTB A;  1PW1 A;  4WMC D;  4HNB A;  4JF5 A;  2Q9M A;  3DAV A;  5GHY A;  1H8M A;  2J8Y A;  1PFL A;  4R0Q A;  2WGI A;  4BJP A;  1MWS A;  2JHE A;  1MKI A;  2ZMF A;  3MQQ A;  2PYR A;  1LL9 A;  4N1X A;  4WEK A;  3BM6 A;  3ZDJ A;  4ME4 A;  1QMF A;  4EEP A;  2Y8H A;  3U2A A;  1OTE A;  3ZG8 B;  3RFB A;  1YMS A;  3D72 A;  3FV7 A;  4IHQ A;  1K0K A;  3R7W A;  2PBY A;  3ICY A;  3DTM A;  3OBF A;  5G4Y A;  3UE6 A;  4WLA A;  3T1R A;  3CHW P;  4JGO A;  3NDG A;  1YSQ A;  4FTX A;  2VGJ A;  5TGF A;  4WYY A;  2VV6 A;  3L7H A;  4KZB A;  2VGL S;  2JKT M;  4MN5 A;  4WF0 A;  5EUA A;  4JLF A;  5EFW A;  3V67 A;  4DXB A;  4R23 A;  3F1N B;  3JVV A;  4MEZ A;  1K4E A;  2MJ6 A;  3T4Q A;  3CLO A;  2VLG A;  1PYY A;  4EER A;  3BLM A;  4BWI A;  3C5A A;  3GV9 A;  2ZM8 A;  2EX2 A;  3G30 A;  4YIN A;  5HWW A;  3MJQ A;  2WKR A;  4S2L A;  3N8R A;  5EM1 A;  4Z1W A;  3UNW A;  2ZQ9 A;  2WAF A;  1P0Z A;  3IF6 A;  2ZOH A;  2Y2O A;  5U47 A;  4R3B A;  4ZJ3 A;  3S22 A;  1KGG A;  1K57 A;  1LT0 A;  3MQ0 A;  2HP6 A;  1K54 C;  1KVL A;  5BOH A;  4E3J A;  2IWD A;  3S7O A;  2VKS A;  1GA9 A;  1HZO A;  4ETZ A;  4Y3I A;  4EES A;  1ALQ A;  4MBK A;  3C8C A;  3VP1 A;  3SH7 A;  4QY5 A;  3TG9 A;  3V5M A;  4GW9 A;  2V0W A;  5HZH A;  2HGV A;  2IWC A;  3MXQ A;  3H9W A;  4KQD A;  1YAX A;  5JYP A;  4BD1 A;  3A3E A;  5EOO A;  2V8C A;  2W1T A;  1GSX A;  5I5L A;  5HL6 A;  2WUQ A;  1QME A;  3MZE A;  4OOM A;  5CTM A;  1ZTU A;  4BBV A;  3LO7 A;  3QP6 A;  1TVF A;  3OPP A;  2QMI A;  2DCF A;  3JYI A;  5GLD A;  1FR6 A;  4NG2 A;  3NY4 A;  4E3K A;  2M1C A;  1BSG A;  4EQ1 A;  3LGO A;  2G2W A;  3VV4 A;  4E04 A;  1I5Q A;  2R78 A;  1OTA A;  3ZVT A;  3SH8 A;  1BLH A;  3D3O A;  3PTE A;  5EVL A;  3T1S A;  1SCW A;  3UMD A;  2JBF A;  4LGW A;  1YLW A;  3WWX A;  4UHU A;  1G6A A;  3LR4 A;  3NC8 A;  3T1Q B;  4OPQ A;  4FH2 A;  4CPK A;  5A8B A;  4S2N A;  5HSQ A;  3ZGA B;  4KEN B;  5HAP A;  1GSV A;  2ZM0 A;  1FCN A;  4F3L B;  4P0M A;  3UPN A;  2W27 A;  2G2U A;  3Q1F A;  3UME A;  1YLZ A;  4NK3 A;  4ETX A;  1IEM A;  5HDC A;  1F5M A;  2WAE A;  3LR0 A;  1W63 M;  4EBL A;  3GR2 A;  1S4R A;  3UY6 A;  5TR7 A;  4CLC B;  1OJ5 A;  4N92 A;  3UE1 A;  3U4L P;  2V20 A;  2INW A;  4IBR A;  3UPP A;  4QB8 A;  5TFQ A;  4ID4 A;  2X02 A;  1CI9 A;  1ES3 A;  1RP5 A;  1FOF A;  1E3U A;  1XJ3 A;  2ZQA A;  3OOV A;  2B95 A;  4RQ9 A;  5GLC A;  3UDF A;  5DKK A;  4X68 A;  3N8L A;  4B4Z A;  2K31 A;  4HY8 A;  4WZ4 A;  5KZH A;  2JKT I;  1O07 A;  1TDG A;  5L8M A;  3MZF A;  3IS2 B;  2BTF P;  3UB7 A;  4M3K A;  2XEP A;  3CWF A;  3IWI A;  1CEG A;  1DJC A;  3ULF A;  4BMW A;  3DW0 A;  2E8I A;  3IX4 A;  3Q7Z A;  4PM6 A;  2H5S A;  2L0W A;  4GS9 A;  1MY8 A;  2G7U A;  4DN0 A;  1G28 A;  2HV1 A;  1VM1 A;  3B42 A;  3W4O A;  4YWZ A;  4FUW A;  1IYO A;  2XA7 S;  1D06 A;  3BY8 A;  3UE3 A;  5E2F A;  1CI8 A;  1MC0 A;  4BBT A;  4P87 A;  1K54 A;  1TEM A;  4PPR A;  4KG2 A;  5F68 A;  4LRZ E;  4GLQ A;  2XF3 A;  3E2K A;  4JF4 A;  1CK3 A;  3UPO A;  1LSX A;  5M1A A;  3NJA A;  5FQM A;  2WZX A;  4UQI M;  1L0F A;  3JPU A;  4KUO A;  3T4T A;  3C2W A;  4E3O A;  2VZW A;  1CEF A;  3DBA A;  3ITA A;  1T1C A;  1LL8 A;  5FL3 A;  3NBL A;  3WS1 A;  4MN7 A;  3DWZ A;  3HBR A;  3HLE A;  4K91 A;  4HBU A;  1NLZ A;  1NYY A;  3SZT A;  4JPM A;  3EGX C;  4MLL A;  1YLY A;  2OLV A;  3GTC A;  3VOZ A;  2P04 A;  5FI7 A;  2Q9N A;  4X6T A;  4WM9 A;  1S0W A;  3R4K A;  4WBG A;  3TRC A;  5CXW A;  2V1B A;  2W0N A;  4EEU A;  3C7U A;  3LIC A;  1OTI A;  1T1A A;  1H3Q A;  3DTI A;  4LV2 A;  1H8Y A;  3TSG A;  4DDS A;  4X56 A;  1ODV A;  4R1G A;  2WKP A;  2DMW A;  3EEH A;  1UGU A;  4WMC A;  4EXO A;  5EVI B;  3BJN A;  4B93 A;  5AVE A;  4EBN A;  3EEA A;  4P85 A;  1CQA A;  3UN7 A;  2R9X A;  4WZ5 C;  3FC7 A;  5E2H A;  4YFM A;  3H82 B;  4O01 A;  3IQA A;  1S1Y A;  3N6I A;  5HDS A;  3A3J A;  2I9V A;  1IFQ A;  3EOI A;  3C30 A;  4QHC A;  3E98 A;  2UV0 E;  3OCL A;  4WEJ A;  1XPB A;  4B9O A;  3PBN A;  4Y13 A;  3HUN A;  1H0M A;  1UWP X;  4GDB A;  5J8X A;  2V1A A;  4NXE A;  4BLM A;  5FQK A;  4ZAM A;  5KSH A;  3T4J A;  1GHI A;  3VSK A;  2ZJ9 A;  1C3B A;  2HJE A;  3GRJ A;  2WKQ A;  2XH9 A;  4I5S A;  2VJW A;  5FI6 A;  2JN7 A;  4RA7 A;  2JKG A;  3CG5 A;  1ZG4 A;  4NKP A;  1XJ2 A;  5E43 A;  2QKP A;  2FZ0 A;  5HAR A;  5EVI D;  4Q0J A;  1K6S A;  1NRF A;  3HLF A;  5IHV A;  1U60 A;  1W8Y A;  4JGR A;  4JXG A;  1WE4 A;  1MBL A;  4WEL A;  2YKF A;  1BLC A;  3D9Y A;  3A3F A;  4LV1 A;  4QWO A;  1T19 A;  1IYQ A;  4S2I A;  2NUT C;  5KSC A;  2E8J A;  1BLS A;  1KDS A;  4X55 A;  2JC7 A;  5K5B A;  1F2K A;  1SKO B;  1YMX A;  5CHU A;  2QZ6 A;  3A0R A;  1GCE A;  2RCX A;  3WS0 A;  1PW8 A;  1V9Y A;  2OSU A;  3C7V A;  1D7E A;  3Q7V B;  3F1N A;  4NEE D;  4I39 A;  3VFF A;  1PZO A;  1NXY A;  4HH3 A;  4HH2 A;  2O9C A;  2I72 A;  4Y7P A;  1LI9 A;  1ESI A;  2B18 A;  3BYD A;  4I38 A;  1P97 A;  4RX3 A;  1PWD A;  5FEG A;  3BFF A;  1IEL A;  3KSI A;  5F1F A;  5F82 A;  3QP2 A;  3W4P A;  2CC1 A;  3S7P A;  3LEQ A;  4FOF A;  4KZ3 A;  3G34 A;  4L9F A;  1H5X A;  4BQM A;  4S2O A;  3KSF A;  4OVD A;  3F1O B;  3CPT B;  4EWF A;  4EQI A;  4DKI A;  3ZVW A;  2WYX A;  1S4S A;  3QHY A;  4JXV A;  2HJ9 C;  3IBJ A;  4OQ0 A;  1PZP A;  1FCO A;  4GB7 A;  1K4F A;  5FQQ A;  3T4L A;  1KE3 A;  2Y2P A;  4PM9 A;  2XDM A;  3OC2 A;  4X25 A;  3QP5 A;  4B88 A;  3SW1 A;  3UE0 A;  3A0V A;  4Q8I A;  3V3R A;  3GEC A;  4FD8 A;  3SH9 A;  3HUM A;  1E4D A;  3F1P B;  3VP3 A;  5D3O A;  4HIA A;  5L2F A;  5KIZ A;  3DWK A;  1ERM A;  4R6L A;  5CEC A;  2XR0 A;  3T4O A;  1ONG A;  4EV4 A;  2DRW A;  4PKY A;  2V9A A;  3FWL A;  3ZNY A;  3IXH A;  2PU2 A;  3LYX A;  4H8R A;  4WZ5 A;  3Q07 A;  1SDN A;  5GHZ A;  5HW3 A;  3UB9 A;  5G4Z A;  5FAP A;  1J9M A;  1NYM A;  3W4Q A;  1Z09 A;  4EW7 A;  3ZG7 B;  4IVK A;  1N9N A;  1XFQ A;  4RX2 A;  1YT4 A;  5EVI C;  3VOY A;  4R3J A;  5G18 A;  2XQZ A;  4K0X A;  1ES5 A;  2O9B A;  5CGS A;  3QNC A;  5CED A;  1F9I A;  3VP2 A;  4GHI B;  4DF6 A;  4BL2 A;  1PIO A;  4Y0O A;  2HDU A;  4LPZ A;  4XXR A;  5AVF A;  5J3W A;  2P74 A;  4KZ9 A;  1JTD A;  4OPZ A;  4LCL A;  4Y5F A;  3K3C A;  2EWV A;  1DP9 A;  4UQI S;  4HJ6 A;  3LR3 A;  5JYO A;  1JWV A;  1FQG A;  2IWB A;  2FH5 A;  1W7F A;  1HTZ A;  3HUO A;  3NDE A;  3OZH A;  2OWJ A;  2Y2N A;  4XUX A;  4YNR A;  1JWP A;  2PU4 A;  3UDX A;  3CJM A;  4D2O A;  4HJ4 A;  4G3W A;  1HLU P;  5L10 A;  3HLD A;  3OPL A;  4PHT A;  3HJK A;  3NCK A;  1S1Z A;  3S1Y A;  4A5R A;  1P9W A;  4E3M A;  4D60 A;  2WGV A;  2L1M A;  4AFI A;  2XLN A;  2L4R A;  4JGP A;  2W1R A;  3I7J A;  4KUK A;  4GZB A;  3O88 A;  5AQA A;  3SS3 A;  4E3N A;  4DMZ A;  5GLB A;  1LL5 A;  1K56 D;  2B02 A;  2WGW A;  1K38 A;  1AWI A;  4GCZ A;  1TS7 A;  4HBT A;  5HPF A;  4GKU A;  2Y2H A;  3CAX A;  5HWT A;  2LB5 A;  3IS2 A;  2D02 A;  1RGZ A;  1LSW A;  3NUL A;  1OPX A;  4YOF A;  5DJU A;  2XRO A;  1KGF A; 
#chains in the Genus database with same CATH homology
 2EWW A;  5DJT A;  3T4K A;  2A24 A;  1NLZ A;  3TE8 A;  5TBM B;  2W3F A;  2PR5 A;  2K7S A;  1G6O A;  1NWZ A;  1OT6 A;  3FG8 A;  4BBU A;  2XA7 M;  3EGX C;  3R7W B;  3PBS A;  3W2Z A;  2P04 A;  4HI4 A;  3VOL A;  4H6J B;  4EUV A;  3R4K A;  2A2L A;  3OCN A;  1NLY A;  3PXP A;  5AJG A;  1V9Z A;  3TRC A;  2VGL M;  2K2N A;  3HCY A;  2V1B A;  5IS1 A;  3BW6 A;  4IJG A;  2PDR A;  2W0N A;  4EEU A;  3LI8 A;  3LIC A;  3NHQ A;  1OTI A;  1T1A A;  4O0P A;  1NRJ A;  1H3Q A;  1LSV A;  4MCW A;  3BQ8 A;  4I3J A;  1VHM A;  1T1B A;  1UWN X;  1ODV A;  4GJ4 A;  1XJ4 A;  3H7W B;  2WKP A;  2DMW A;  1X0O A;  3EEH A;  3FPV A;  3PHY A;  1UGU A;  4F3L A;  4EXO A;  3BJN A;  4XT2 B;  3G6O A;  3F1P A;  4WL9 A;  4B93 A;  5AVE A;  4WN5 A;  3EEA A;  1EW0 A;  4WUJ A;  1VB6 A;  2P08 A;  1OTB A;  4NXF A;  3ZQ5 A;  3EGD C;  3LIE A;  4HNB A;  4K08 A;  4G3V A;  3FC7 A;  1KOU A;  1GSW A;  1H8M A;  4MN6 A;  3H82 B;  3LID A;  4O01 A;  4R38 A;  1S1Y A;  4BJP A;  2JHE A;  2ZMF A;  3MQQ A;  3UB8 A;  1MZU A;  2PYR A;  5HDS A;  2I9V A;  1IFQ A;  4WEK A;  4ME4 A;  5F6A A;  3NOT C;  2J3T D;  3EOI A;  5HWV A;  3PBO A;  4EEP A;  2Y8H A;  2ZOI A;  3U2A A;  1OTE A;  3C30 A;  3RFB A;  4CLC A;  3PBR A;  3D72 A;  3E98 A;  4JGQ A;  3OCL A;  4L9E A;  4WEJ A;  4B9O A;  3PBN A;  4IHQ A;  3R7W A;  3ICY A;  3MR0 A;  1UWP X;  3OBF A;  5G4Y A;  4CLC D;  4H6J A;  2V1A A;  3PBT A;  3UE6 A;  3E0Y A;  4NXE A;  4M4X A;  1TF1 A;  4WLA A;  2NUP C;  4JGO A;  3CI6 A;  1YSQ A;  3EQU A;  4L0L A;  5KSH A;  3T4J A;  2O9A A;  2VV6 A;  3S7Q A;  2PD7 A;  2VGL S;  2JKT M;  4MN5 A;  1P9R A;  4WF0 A;  2M7U A;  1OT9 A;  3B33 A;  2HJE A;  5DFX A;  5EFW A;  4HJ3 A;  2WKQ A;  4I5S A;  3V67 A;  2VJW A;  2JN7 A;  3PYP A;  3F1N B;  3JVV A;  4QPR A;  3H7W A;  3PBQ A;  2MJ6 A;  3MF0 A;  3CUE C;  3P01 A;  4NKP A;  3T4Q A;  3CLO A;  2OWH A;  2VLG A;  1WA9 A;  1XJ2 A;  1W63 Q;  4XT2 A;  5J7E A;  2QKP A;  3LIB A;  2FZ0 A;  2J3W A;  1IOU A;  2OAQ 1;  4R3A A;  4EER A;  4FSF A;  4BWI A;  4Q0J A;  5HWW A;  4JGR A;  3MQO A;  1F98 A;  4LRY C;  2W1T B;  3MJQ A;  2WKR A;  4IUK A;  1YKD A;  4WEL A;  2YKF A;  4Z1W A;  4PKY G;  5DF9 A;  1XFN A;  1T19 A;  1P0Z A;  5IU1 A;  2OAP 1;  2QWS A;  2ZOH A;  2NUT C;  2KLI A;  4G3K A;  5K5B A;  1LT0 A;  5HDD A;  3MQ0 A;  3A0S A;  2VX8 A;  1N9O A;  3TW8 A;  3RTY A;  2QHK A;  3S7O A;  2VKS A;  3KYZ A;  3A0R A;  4MDZ A;  2PT7 A;  4OOL A;  5HD5 A;  4ETZ A;  2W3E A;  4Y3I A;  4EES A;  5HPI A;  3S7N A;  1V9Y A;  4ZRR A;  1D7E A;  3C8C A;  2O99 A;  3F1N A;  3EWK A;  4NEE D;  3NOP C;  3B47 A;  4I39 A;  4LLO B;  2LB9 A;  4HH3 A;  4HH2 A;  2O9C A;  3T50 A;  2B18 A;  4GW9 A;  2V0W A;  4I38 A;  3BY9 A;  1P97 A;  5HZH A;  2Z6D A;  2HGV A;  2O0Y A;  3MXQ A;  2GNX A;  3KSI A;  3H9W A;  4KQD A;  1YAX A;  3S7P A;  4FOF A;  1YSP A;  2JKR I;  2KDK A;  4II7 A;  2XRN A;  3BQA A;  2W3G A;  2W1T A;  4L9F A;  1GSX A;  5I5L A;  5TBM A;  5HL6 A;  3KSF A;  4OOM A;  3F1O B;  4HP4 A;  1ZTU A;  4NXB A;  4BBV A;  2P7J A;  5J4E A;  5F5Y A;  4I3A A;  2ZBB A;  3E4P A;  5F69 A;  1S4S A;  4O8G A;  4CQH A;  2M1C A;  5C5K A;  4EQ1 A;  2VEA A;  2HJ9 C;  3IBJ A;  3VV4 A;  2KOI A;  3JVU A;  4E04 A;  2R78 A;  2W3H A;  1OTA A;  2Y79 A;  3C38 A;  1TS6 A;  1STZ A;  3D3O A;  3CIT A;  3MMH A;  4CLC E;  5DFY A;  3T4L A;  3O5Y A;  4PAU A;  3GDI A;  2VA0 A;  3UMD A;  3HJI A;  3OC2 A;  3LUQ A;  3T4S A;  3LR4 A;  3K2N A;  3KSH A;  3KX0 X;  3SW1 A;  3OLO A;  5A8B A;  4IUH A;  5HSQ A;  2W3D A;  3A0V A;  1S66 L;  4HQA A;  5MC7 A;  2J3T C;  2PR6 A;  1Y28 A;  3GEC A;  3KO6 A;  4DJ3 A;  1XJ6 A;  3KSG A;  1GSV A;  4F3L B;  1TS0 A;  3NOU C;  3H82 A;  3F1P B;  3EQV A;  4CLC C;  4HIA A;  2QJ5 A;  3E4O A;  2W27 A;  1TD5 A;  4P6Z S;  5KIZ A;  4NXG A;  4R6L A;  3LI9 A;  1OTD A;  2H28 A;  3T4O A;  2J80 A;  3UME A;  4PKY A;  2V9A A;  3LR5 A;  3F1O A;  5IT5 A;  4ETX A;  5CX7 A;  5HDC A;  4Q0H A;  4Q0I A;  2V0U A;  3LYX A;  1F5M A;  3LR0 A;  4LRX C;  1W63 M;  4R70 A;  4HP9 A;  3UB9 A;  5G4Z A;  1S4R A;  4GS9 B;  4CLC B;  1OJ5 A;  4I3I A;  2EA9 A;  3LIF A;  4EW7 A;  2INW A;  1N9N A;  1XFQ A;  4ARZ B;  1OJG A;  3VE3 A;  1N9L A;  5HD3 A;  2XSS A;  2GJ3 A;  1XJ3 A;  3OOV A;  2O9B A;  1ZHH B;  4RQ9 A;  2ZMV A;  2Z6C A;  3P7N A;  5DKK A;  4HOI A;  2K31 A;  1F9I A;  4HY8 A;  5TJJ A;  2JKT I;  1MKM A;  4P6Z M;  2BAS A;  4GHI B;  2VV7 A;  2M7V A;  3BWL A;  5L8M A;  4LPZ A;  1JNU A;  3IS2 B;  5AVF A;  5J3W A;  3UB7 A;  4Y5F A;  3K3C A;  3CUE A;  2EWV A;  1DP9 A;  4UEY A;  4UQI S;  3CWF A;  1TS8 A;  3E4Q A;  3ULF A;  4BMW A;  4HJ6 A;  3LR3 A;  3UB6 A;  2A24 B;  3K3D A;  2FH5 A;  4KQO A;  3VE4 A;  2OWJ A;  2CMN A;  4MMN A;  4YNR A;  1S67 L;  2YKH A;  2PYP A;  4HJ4 A;  4G3W A;  2L0W A;  1T18 A;  4L9G A;  3FPW A;  4GS9 A;  1DRM A;  2G7U A;  4PHT A;  3HJK A;  4DN0 A;  2KX6 A;  1S1Z A;  3IBR A;  3LFV A;  1G28 A;  2HV1 A;  3B42 A;  4YWZ A;  2QYB A;  2XA7 S;  2GX5 A;  4ARZ A;  1P9W A;  3KYQ A;  1BYW A;  1D06 A;  2L1M A;  3BY8 A;  4AFI A;  3UE3 A;  2L4R A;  4JGP A;  2W1R A;  1MC0 A;  4KUK A;  4BBT A;  3TJZ C;  5F68 A;  4LRZ E;  3RH8 B;  4DJ2 A;  4DMZ A;  4GLQ A;  2PHY A;  4Y2F A;  2OOL A;  3PR6 A;  2B02 A;  2JKR M;  2D01 A;  1LSX A;  4GCZ A;  5LBR A;  1TS7 A;  2IA2 A;  2PD8 A;  3NJA A;  5HPF A;  4UQI M;  4HHD A;  1DP6 A;  4GHI A;  3CAX A;  3MFX A;  4KUO A;  5HWT A;  3T4T A;  3C2W A;  4EU0 A;  2LB5 A;  2VZW A;  5DKL A;  3IS2 A;  2D02 A;  3DBA A;  3ZYT A;  3LIA A;  1T1C A;  1LL8 A;  5FL3 A;  2QJ7 A;  2VV8 A;  1LSW A;  1DP8 A;  2GZA A;  1OPX A;  2HF6 A;  4YOF A;  5DJU A;  2XRO A;  4MN7 A;  4EET B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...