3RH8B

Crystal structure of the light-state dimer of fungal blue-light photoreceptor vivid
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
148
structure length
148
Chain Sequence
HTLYAPGGYDIMGYLIQIMNRPNPQVELGPVDTSCALILCDLKQKDTPIVYASEAFLYMTGYSNAEVLGRNCRFLQSPDGMVKPKSTRKYVDSNTINTIRKAIDRNAEVQVEVVNFKKNGQRFVNFLTIIPVRDETGEYRYSMGFQCE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Circadian clock protein
molecule keywords Vivid PAS protein VVD
publication title Structure of a Light-Activated LOV Protein Dimer That Regulates Transcription.
pubmed doi rcsb
source organism Neurospora crassa
total genus 34
structure length 148
sequence length 148
chains with identical sequence D
ec nomenclature
pdb deposition date 2011-04-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13426 PAS_9 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3rh8B00
4GS9B 2A24A 3LIDA 5G4YA 1S1ZA 3UE6A 3G6OA 1GSVA 3H7WB 5DJUA 5KIZA 3KX0X 3EWKA 5AVEA 4L9FA 4BBVA 3VE4A 4L9GA 1VB6A 4EESA 4HNBA 2VV8A 4WLAA 2VEAA 5HD3A 1DP6A 2L1MA 4R3AA 2VV7A 1D06A 3MJQA 4BBUA 2YKFA 3P7NA 4K08A 2INWA 3LIEA 4EEPA 3LIFA 4I39A 5HWWA 3CWFA 1T19A 1UGUA 3BY8A 4KUKA 3H82A 4NXBA 2I9VA 5HDDA 4H6JA 3UMEA 3LI8A 4HOIA 5F6AA 1OTDA 4F3LB 4PKYG 3ICYA 1JNUA 2VV6A 3F1OB 1XJ4A 2D02A 2HV1A 3MFXA 1GSXA 4JGRA 4GS9A 4HH2A 2Z6DA 1N9NA 1D7EA 2OOLA 3IS2A 1TS8A 4GCZA 1V9ZA 4H6JB 2J80A 5DJTA 3H7WA 1P0ZA 3MQQA 1S67L 3UB9A 4HJ4A 3B33A 2PR5A 4LLOB 2B02A 3BY9A 2PDRA 3LUQA 2K7SA 3RH8B 1OTEA 2PYPA 5A8BA 3PYPA 3IS2B 4NXFA 5TBMB 1UWNX 4I3AA 3MQOA 3LIBA 1T1AA 4I3IA 3LI9A 1N9OA 5HWTA 3NOTC 5G4ZA 4MN5A 2WKRA 4LPZA 3UB6A 3UB8A 1Y28A 1X0OA 3VOLA 3F1NB 2GJ3A 5IU1A 2BASA 5IS1A 3E4OA 1LT0A 1S4SA 4F3LA 3SW1A 2PHYA 2VLGA 3F1OA 4GHIB 2V1BA 4HHDA 5J4EA 2QJ5A 2ZOIA 2D01A 4I38A 1OTBA 4HJ3A 4EXOA 3NJAA 3VE3A 2PD7A 5DKKA 3LYXA 5AVFA 1TS6A 3FC7A 4NXEA 2QHKA 4I5SA 2PD8A 4HI4A 3ULFA 3T50A 1TS0A 3C8CA 4E04A 1NWZA 4WF0A 1F98A 1V9YA 1ODVA 1GSWA 2EA9A 2V0WA 5F5YA 2P7JA 3C2WA 1WA9A 3HJKA 4BBTA 3OLOA 3LIAA 1OT6A 3GDIA 4R70A 2WKPA 3D72A 4HP4A 3K3CA 5J3WA 1T18A 1S1YA 1OT9A 5TBMA 4R38A 3PHYA 1LL8A 1DP8A 3MXQA 1UWPX 4EW7A 3EEHA 3NHQA 2OWJA 4MN6A 4EEUA 4LRXC 3K3DA 3UMDA 4GW9A 4JGPA 3NOUC 4LRZE 3F1NA 2H28A 5J7EA 3HJIA 2ZBBA 4HH3A 1BYWA 3A0RA 4GHIA 1XJ6A 3ZQ5A 5F69A 1F9IA 3IBRA 3F1PB 1KOUA 2WKQA 4WL9A 1T1BA 1S66L 2W27A 1G28A 2W0NA 4HIAA 1OJGA 1XFNA 3UB7A 4XT2B 1XFQA 4KUOA 3NOPC 2Z6CA 3E4PA 5HZHA 5HDCA 4I3JA 4M4XA 4NXGA 3BWLA 4L9EA 3A0VA 3CAXA 1LSVA 4B9OA 4HQAA 5EFWA 1S4RA 3CLOA 4PKYA 2A24B 5HWVA 1P97A 1LSXA 1XJ3A 1EW0A 4YWZA 2JHEA 2KDKA 3RTYA 1T1CA 2R78A 5HD5A 1LSWA 4WUJA 2L0WA 2V1AA 2L4RA 4KQDA 5I5LA 4EERA 2PR6A 4RQ9A 3MR0A 1TS7A 1OJ5A 4R6LA 4DJ3A 2CMNA 3LICA 2YKHA 5DKLA 4EETB 2KX6A 4JGQA 1DP9A 4JGOA 2M1CA 2JN7A 5F68A 3F1PA 4LRYC 3E4QA 4DJ2A 1OTAA 2QKPA 3H9WA 2OWHA 1N9LA 1DRMA 4HP9A 3H82B 4XT2A 3FG8A 5HSQA 4WN5A 2QWSA 2V9AA 3A0SA 1OTIA 1XJ2A 2ZOHA 1MZUA 4EQ1A 3GECA 2V0UA 2PYRA 5HDSA 4HY8A 2QJ7A 4HJ6A
chains in the Genus database with same CATH superfamily
3LIDA 4BJPA 4U0XA 3M2JA 5G4YA 3IXBA 5GLBA 3ZG0A 4BMWA 2P9VB 3UNWA 4FTXA 1J3WA 2V8CA 1QMFA 4HBTA 2M7UA 5DJUA 1PI5A 4H8RA 5AVEA 1GA0A 4BBVA 3GTCA 3SH9A 1CK3A 4Y7PA 1FIKA 1SDNA 4L9GA 5FAOA 1W7FA 4Q0IA 4QJGA 2P04A 3HLDA 4HNBA 2HJEA 1ESIA 3V39A 4WLAA 4ETZA 2L1MA 2Z2LB 5EVEA 3PBQA 2YKFA 3G32A 1VM1A 4Z9QA 4B4ZA 1DJAA 3B3XA 4N1HA 3DAVA 5FATA 3S7OA 4MEZA 1KDWA 2PBDP 2E8IA 1L3LA 1MBLA 3NCKA 4KUKA 2H5SA 3PBTA 4NXBA 1FSYA 2I9VA 3UE1A 1L2SA 1YKDA 1ERMA 2HDUA 4S2IA 1HTZA 2IA2A 3LI8A 2ZM2A 3DWZA 3BM6A 1BLCA 4GNUA 4OP5A 3UPNA 4BD1A 4OLGA 2XH9A 4E3NA 1K4EA 2D02A 3BLSA 3MFXA 1GSXA 3BFEA 1YLTA 1N9NA 4R4RA 2DNSA 3IS2A 1TS8A 1S0WA 1VETB 2P9VA 5FQJA 4ARZB 3ZNYA 4PPRA 4Y13A 1PW1A 2WGVA 3MQQA 1K56D 4LLOB 2ZC4B 2B02A 2KOIA 2J7VA 3PBSA 3MXSA 4RX3A 1OTEA 4R1GA 1YLYA 1XGIA 2K2NA 3PYPA 3VV4A 4WZ4A 5FSRA 4UA9A 1IELA 2ZQCA 2H0YA 2WK0A 4IUKA 4S2LA 3LI9A 3ZCZA 1NLZA 1SHVA 2WKRA 3V3RA 1TEMA 3EQVA 5HFOA 5L07A 3UB8A 3MZFA 1ZHHB 1CQAA 4DE1A 1NYMA 4E6WA 4JF4A 4PM8A 1K0KA 1LT0A 1MWUA 1ZKJA 3SW1A 1K55C 3IX3A 2XROA 4QY6A 5FQQA 4C75A 2V1BA 4HHDA 5J4EA 2ZOIA 2D01A 3N8SA 3VP3A 4EXOA 3NJAA 2PD7A 3HLEA 1FQGA 3M2KA 1VETA 4ARZA 1RCJA 3WS2A 1O7EA 1U60A 4BLMA 4I5SA 1MPLA 3T1QB 4HI4A 2VX8A 5EPHA 2HGVA 3C8CA 4OPRA 3ZNTA 3HVFA 2G7UA 5HAPA 1F98A 1V9YA 3V50A 3WRZA 5DF7A 1OT6A 5KMWA 4EUVA 4S2PA 4QD4A 4N9LA 2WKPA 2VKSA 1CEFA 3LR4A 5A90A 3QP5A 5A91A 4NKPA 4R38A 4MBFA 1HVBA 3G2ZA 5AQ9A 1UWPX 5EM1A 2RCXA 3NDEA 4LFUA 3HL9A 4C3QA 1CJFA 4MN6A 4GOGA 4EEUA 1N4OA 4LRXC 4O8GA 2A49A 4P0MA 4ZDXA 1KGGA 1PWGA 5HW3A 5J7EA 3IF5A 2ZBBA 3T1RA 2XK1A 1EWZA 5A92A 2ZC6B 3A0RA 4EU0A 3IWQA 3Q07A 5A93A 2ZJ9A 1BT5A 5F69A 3IBRA 1W63M 2PAVP 3KYZA 2WKQA 5TFQA 2Y2KA 4E3MA 4P6ZS 1ACFA 2W27A 2DMWA 3LY3A 4KUOA 3NOPC 4S2NC 1KVLA 3QP8A 4OQ0A 5F82A 3HUMA 1I2WA 2FFFB 3CJMA 3HLCA 2W1TB 4N9KA 3PBRA 4HBUA 1ES5A 3UPPA 1SDEA 4OOYA 3W4QA 4WEJA 4BL3A 2GDNA 2IWDA 2RL3A 3CAXA 5FDHA 2JC7A 4DRTA 2EXBA 4PKYA 1BLPA 3MS6A 5HX9A 3NIAA 3T4JA 1WYBA 2DCFA 3HUNA 1H8MA 2QYBA 4WMCD 4E3JA 3W4PA 2JKRM 1LSWA 3E2LA 1W63Q 4N1XA 4E3OA 4G3KA 2HDSA 4EERA 4RQ9A 3MR0A 4KENB 1TS7A 5L10A 4WZ5A 4FOFA 1PW8A 2HP5A 1PNEA 1DY6A 3W4OA 5EV0A 2YKHA 5DKLA 4GN2A 4EETB 3GV9A 1MWTA 2XGNA 4LCMA 4LV1A 3SH7A 4LRYC 5FASA 3LR0A 1RGZA 2V20A 3ITBA 4F94A 2QKPA 2OWHA 1DRMA 2J3TD 3BRMA 4DKIA 4Y2FA 3H82B 1AXBA 4WN5A 2B18A 3DTEA 2V9AA 4JXWA 1SKOA 5CRFA 2WKEA 1OTIA 2ZMVA 2W1TA 3E2KA 2ZM0A 3OOVA 4RVAA 1MZUA 4EQ1A 3KSFA 2G2WA 4DDSA 1PWDA 2PYRA 4RYEA 4KQRA 2NUPC 4HY8A 1JTDA 5M19A 1YMSA 1G5UA 3LR5A 2H10A 4GS9B 1SKFA 2HP6A 2JKGA 1YLJA 1YLWA 1P9RA 4ZBEA 3DBAA 3EWKA 2ZMFA 4JXSA 4CQHA 1MKMA 2A3UA 2XF3A 3NC8A 4EESA 1Y4OA 2Y2OA 2VEAA 1DP6A 1C3BA 1AWIA 4R3AA 4EUZA 3HLWA 2VV7A 3FWLA 3C38A 2JKTM 3LFVA 3HCYA 3HUOA 4KZAA 5IT5A 1YSQA 5MC7A 3LIFA 4IVIA 5AQBA 1CF0A 1MKIA 1GHPA 1ALQA 1VQQA 4XUZA 4XUXA 4OQGA 3N6IA 3H82A 2X02A 3T1XA 3LR3A 5L09A 3UB5P 1NRJA 4KG6A 3KSGA 4MNRA 4HESA 5F6AA 3LEZA 2J9PA 1I2SA 3WS1A 2IWBA 3M6BA 3ICYA 3ZFZA 3F1OB 4QB8A 4X1LA 4OP8A 1LI9A 4IEDA 5TR7A 3VP0A 1LL9A 4GS9A 4HH2A 1K54A 3QP1A 1BZAA 3PAEA 2AVXA 3T4SA 3BFCA 3T4TA 2OSUA 1LL5A 3D4FA 4KG5A 1STZA 1V9ZA 2J80A 3KSIA 1BSGA 4MCWA 2V8FA 5CTNA 4FCFA 4P6ZM 1S67L 1G6OA 3UB9A 4HJ4A 3B33A 3O87A 2PR5A 3EEAA 4OPQA 3A3IA 4KG2A 5TJJA 2K7SA 2WADA 5CGSA 1KE3A 2OAP1 5HL6A 1PYYA 3RXXA 3WS4A 4JXVA 3S22A 5CHMA 3MZEA 3IS2B 4I3AA 3CI6A 2O99A 4R4SA 3FZCA 3HLGA 5G4ZA 1K57C 3T12B 1XXMA 3EOIA 4GKUA 3TW8A 1CI8A 2W3HA 3F1NB 5E2EA 2ZM8A 4NK3A 4OOMA 1RP5A 2VLGA 3F1OA 4GHIB 4K0WA 1NY0A 4B4XA 3MQ0A 4IJGA 4Y0TA 1OTBA 4DN0A 4HJ3A 3P98A 4DF6A 4G3VA 5DKKA 3SZTA 3C7UA 2Y2GA 3LYXA 3UE3A 3E0YA 4CLCC 3UY6A 5LBRA 5F83A 4S2KA 3NDGA 3IF6C 1XPBA 1TS0A 2Y2QA 3O3VA 3RXWA 4E04A 3L9KA 2O9AA 5FA7A 4WF0A 2EX9A 2WZZA 1ODVA 1GSWA 2EA9A 3TSGA 3VP4A 2HDRA 3NULA 2K31A 3OLOA 5E2FA 2XEPA 4R70A 4UA6A 4YNRA 4II7A 1YMXA 4UAAA 1M40A 3K3CA 3WS0A 3UPOA 5J3WA 1T18A 1OT9A 3PHYA 3HLBA 1NYYA 3NHQA 2JKFA 3HLFA 3S7QA 5KSCA 1WYCA 5CERA 3IQAA 3K3DA 4DMZA 3UMDA 1MWRA 1XX2A 1Q2QA 4E3KA 3W8KA 3F1NA 5EE8A 3HJIA 4R3JA 4D2OA 3FPVA 2Q0OA 1GHMA 3CZDA 4GHIA 3O86A 3T1SA 3GQZA 2XRNA 4Q8IA 5M18A 3F1PB 5FI6A 4BQMA 1KOUA 4ZRRA 3PBNA 3C5AA 4KQOA 3JVVA 3UDFA 3I7JA 5F1GA 3LCEA 1Z09A 3WWXA 2Z6CA 2VGKA 5GLDA 3E4PA 5HZHA 3GR2A 2DRWA 3IHBA 4M4XA 4FD8A 3UDIA 4NXGA 4LENA 5FL3A 4QHCA 3A0VA 3VOYA 1E3UA 1FCNA 1O07A 1ZG4A 3MF0A 4AFIA 1LSVA 4PMAA 3IH8A 5FAQA 2A24B 4IBXA 3FKWA 1P97A 2WKIA 1NJ4A 1MXOA 3A3FA 1E4DA 3VP1A 1EW0A 5GHYA 5HPFA 1K55A 3JYIA 5CGXA 3EQUA 3C4OA 3ZVWA 3K2NA 2Y2HA 5AQAA 3RTYA 2EWVA 1FCMA 5HD5A 2L0WA 2VZWA 1L0FA 4KQDA 2JE5A 5DTSA 3VOZA 5GLCA 4R0QA 1PZPA 2Q9MA 3QP6A 4X53A 2Y55A 4FH2A 2CMNA 2UWXA 3LEQA 4IHQA 1CEGA 4PM7A 1IYSA 3LO7A 3HBRA 4JGQA 3LGOA 5HAIA 4ESPA 3P09A 4O0PA 3JPUA 1L0EA 5F68A 3F1PA 2JKRI 4PM6A 3ZG5A 1GA9A 1OTAA 1BLHA 4L0LA 1N9LA 4HP9A 2P74A 4S2OA 3GRJA 4DE0A 2OLUA 1NRFA 3OBFA 4B93A 4YINA 5HARA 2ZQ8A 5EOOA 1BTLA 5EVIC 2CC1A 4ZJ2A 2W3DA 4GD6A 2Y2PA 4OQIA 1ZG6A 1E25A 4XXRA 1KGEA 4PHTA 1K4FA 4OQHA 2A24A 4OKPA 1YT4A 1PRQA 1S1ZA 3UE6A 5I94A 3CMZA 3VSLA 3MFDA 4QWOA 1IYOA 1SKOB 2MJ6A 3H7WB 3KX0X 4Q0JA 1A0KA 2GNXA 1G68A 2WGWA 2VGJA 3OC2A 4X68A 1VB6A 2FH5A 2W1RA 3G2YA 3CG5A 3MBZA 2VV8A 5FQ9A 5FQKA 1YM1A 1D06A 3FKVA 4GD8A 4S2NA 2PBYA 4EBPA 2Y4AA 3V3SA 3C30A 3IH9A 4FSFA 4K08A 3RFBA 2INWA 5TGFA 4I39A 1YLPA 1FCOA 5FAPA 1OMEA 1XGJA 2W3GA 4IVKA 2Y79A 2Z2MB 4Y0OA 3PTEA 2XFTA 4DDYA 5KSHA 4G3WA 1UGUA 1W8YA 3M6HA 2PU4A 5AJGA 3UO9A 5HDDA 4JPMA 4H6JA 2JKTI 4GDBA 2XA7S 3UMEA 3IXHA 4KZBA 3IWIA 5CHUA 3MKEA 4HOIA 4KZ4A 1OTDA 2R9XA 5JYPA 1DJCA 1JNUA 2VV6A 2HV1A 3CPTB 1ERQA 2V1ZA 3MSHA 1IYPA 2B95A 3IXDA 1FSWA 1D7EA 1H8YA 2OOLA 1W8QA 2XD5A 3Q82A 3N8RA 4BENA 1LHYA 2EX6A 5CEDA 5F1FA 1KGFA 3H7WA 3KSHA 2EX8A 2KLIA 2P08A 4A5RA 1BULA 2HDQA 4GB7A 2W3EA 1FR1A 1MWSA 3T4LA 4S2MA 4OPZA 3A3DA 1IEMA 3G34A 3LUQA 3RH8B 2J3WA 4JF5A 5E2HA 1VHMA 2Y59A 4GLQA 2PYPA 2XFSA 3MKFA 5G18A 4CJNA 5FI2A 1NLYA 5GLAA 1K38A 2ZQ7A 3IX4A 4NXFA 2W3FA 1UWNX 3ZYTA 3MQOA 3UN7A 1F5MA 5FI7A 2XSSA 3S1YA 3LIBA 3B42A 1GCEA 1T1AA 4I3IA 3AGFA 1JWPA 3Q1FA 5CX7A 4Y0UA 1K25A 3NOTC 4FH4A 4MN5A 4DE3A 3OPLA 4LPZA 3UB6A 1XP4A 3WS5A 4GDNA 1Y28A 3HREA 1X0OA 2GZAA 3VMAA 5DF9A 2BASA 5DTTA 5IS1A 2O9CA 2PHYA 2E8JA 3C7VA 2QJ5A 3CPTA 4KQQA 4I38A 1K6RA 1JWZA 3G35A 3VE3A 3JVUA 3T4QA 2XLNA 3PR6A 3W2ZA 2EFXA 1NXYA 4IBRA 2Y2LA 2GX5A 4OOLA 5AVFA 1TS6A 1I5QA 2PU2A 3DTMA 3BFFA 1W79A 3BYDA 5GL9A 2X01A 5K5BA 3ULFA 4KZ5A 2PRFA 3QNBA 3N7WA 1JWVA 5L2FA 4DXBA 4WM9A 5F5YA 2V0WA 2P7JA 1BLSA 1WA9A 2J8YA 3C2WA 3HJKA 4BBTA 4R23A 3O88A 3MXRA 3KYQA 3G4PA 3OCLA 4Y15A 4EQIA 2ZC7A 1IFQA 1HZOA 1LL8A 4OLDA 4E6XA 3Q7ZA 5JYOA 4EW7A 1DJBA 4E3LA 4KZ8A 3VP2A 2LB5A 1PZOA 4GW9A 5C5KA 2OAQ1 4UQIS 4LRZE 4CLCD 2WAEA 4HH3A 4CLCB 5U47A 5M1AA 1XKZA 2WZXA 3ZQ5A 3IF6B 4WEKA 1F9IA 2ZLYA 1H0MA 1NZOA 4OPYA 1T1BA 3Q7VB 3QNCA 1S66L 1KE0A 1G28A 1OJGA 1WE4A 4ZJ1A 4JXGA 2PT7A 3UB7A 1XA1A 2JCHA 1XFQA 3DWKA 4JLFA 2HZ5A 3OZHA 4K0XA 3BW6A 5IHVA 4M3KA 1QMEA 2I72A 5HDCA 2VK3A 4X1MA 4I3JA 5GHXA 3BFGA 4Q0HA 2ZL1B 4EBNA 5E43A 3G31A 3ZHHA 3R7WB 1ZC2A 2XA7M 4X69A 1K57A 2ZQ9A 4B9OA 4HQAA 2X71A 2ZD8A 5HWVA 2XDMA 2C5WB 3MZDA 5CECA 1L0GA 4EBLA 3PXPA 2Y8HA 3NI9A 2JHEA 2KDKA 2QPNA 4ETXA 1T1CA 2R78A 4WUJA 1E3UD 2L4RA 5I5LA 3ZVTA 4E3IA 1TVFA 2O0YA 2PR6A 2ZC3B 1OJ5A 4C6YA 1KDSA 4R6LA 4MBHA 1TDGA 2HPBA 4CLCA 3S7PA 5FQMA 1DP9A 4U3TA 4JGOA 3IF6A 4N92A 2M1CA 4RX2A 2JN7A 4PM9A 2ZQAA 4UA7A 4WELA 5D3OA 4NG2A 1TF1A 3Q7VA 4ZTKA 3H9WA 2EFUA 2V2FF 2Y91A 4NEED 4R3BA 2WKHA 3MMHA 3FG8A 5DFYA 3A0SA 1Y54A 2BG1A 5CEBA 1ES3A 3P01A 2ZOHA 2NUTC 3EGDC 3NECA 2ZL1A 2HJ9C 5DFXA 4GJ4A 1F2KA 1KE4A 3R7WA 3OPRA 5HDSA 2EWWA 1LLBA 2XR0A 3A3JA 3ISGA 1FR6A 2M7VA 4HJ6A 4K91A 4ZAMA 3NBLA 2O9BA 3G6OA 3QP4A 1VEUB 1GSVA 3IT9A 1Q2PA 1YAXA 2C6WB 4P6BA 5KIZA 4L9FA 3IX8A 3TG9A 3VE4A 2XD1A 3PAGA 3OPHA 2OV5A 5CTMA 3CITA 4O01A 5HD3A 3Q81A 1M6KA 2VGLS 1YSPA 4NETA 2ZQDA 3MJQA 2BLSA 4BBUA 3N8LA 5DVAA 3P7NA 5EVID 3LIEA 2WAFA 4X55A 4EEPA 3CHWP 5EVIB 2QZ6A 5HAQA 5HWWA 2JBFA 5FEGA 4CPKA 2WGWB 2Y2JA 1IKIA 3CWFA 1T19A 3UE0A 3BY8A 3S4XA 2LB9A 3V5MA 3A3EA 1YLZA 2FZ0A 1FILA 3E98A 2A2LA 1ZTUA 1Z6FA 1IKGA 3BEBA 3KYEA 4YOFA 3IHAA 1RGYA 3BFDA 4F3LB 5CGWA 4PAUA 2UV0E 4CLCE 3R4KA 4PKYG 1XJ4A 4UQIM 1K56A 5HPIA 4B88A 4O7DA 4JGRA 4Y5FA 3GVBA 2Z6DA 3S7NA 3T4OA 5HL1A 1N9BA 4GCZA 1VEUA 1XA7A 4H6JB 5DJTA 4KZ6A 1PWCA 3AGEA 1P0ZA 2OLVA 1PI4A 3N4IA 5DTKA 1MC0A 5AQ7A 3BY9A 2PDRA 3NY4A 5J8XA 4LV3A 4Z1WA 3DW0A 1L0DA 3L7HA 5A8BA 3VSKA 3V67A 4MBKA 5CXWA 1FOFA 1SZVA 5TBMB 3IXGA 3ZG9B 5EVIA 4P87A 3SS4A 4KZ3A 3SOIA 1NZUA 4MN7A 4ME4A 2VA0A 1K6SA 1YPRA 1N9OA 4KZ9A 5HWTA 4MMNA 4UEYA 2Q9NA 5EM0A 3O5YA 1HLUP 3VOLA 4S2JA 2GJ3A 4FUWA 5IU1A 4RA7A 3E4OA 1S4SA 2FFYA 4F3LA 2BTFP 4JKTA 5FEFA 3U2AA 3U4LP 3FPWA 2J9OA 3VFFA 3G30A 4PM5A 3D3OA 1TDLA 2H0TA 3GMWA 4U0TA 4WZ5C 2WUQA 3C4PA 3TJZC 4EWFA 4NXEA 3FC7A 4ID4A 4X25A 3T4KA 2QHKA 1KVMA 2PD8A 1YQSA 4LCLA 4EV4A 3IWOA 3T50A 1S6RA 1NWZA 4JF6A 5BOHA 4WBGA 3ZG8B 1EI5A 1LI0A 3LIAA 3BLMA 2Y2MA 5CHJA 3GDIA 3BJNA 3AGDA 1ES4A 3D72A 4HP4A 1JTGA 3FV7A 1S1YA 5TBMA 4YFMA 3D9YA 2ZC5B 4DXCA 1JVJA 1J9MA 1BUEA 1DP8A 5GHZA 4OVDA 3MXQA 3DTIA 1CI9A 3B47A 3EEHA 4D60A 2OWJA 2IWCA 1P9WA 4BL2A 3CUEC 2B5RA 1OPXA 4JGPA 3NOUC 2XQZA 3BECA 3QP2A 2H28A 4P85A 5EOEA 5FDSA 3SS3A 1BYWA 1SCWA 1XJ6A 3WRTA 3TRCA 3GSGA 4OONA 1ONGA 4Y17A 2VGLM 1ES2A 2ACGA 4WL9A 3CUEA 4MDZA 2WGIA 3IBJA 2QMIA 2W0NA 4HIAA 1XFNA 4XT2B 4IUHA 5EECA 4QU3A 2EXAA 3ITAA 1PIOA 3ZG7B 2ZMAA 2G2UA 3TOIA 3DTKA 4QPRA 4WMCA 2HF6A 3PBOA 3BWLA 4L9EA 1ESUA 3BQ8A 1GHIA 4KZ7A 3EGXC 1EROA 3LY4A 2HP9A 2VJWA 5EFWA 4DE2A 1S4RA 3CLOA 2J3TC 1D1JA 1LSXA 4OH0A 3TE8A 1XJ3A 2WYXA 4LGWA 5E2GA 1IYQA 3RJUA 5KZHA 4JBFA 4MLLA 4UHUA 3QHYA 1PFLA 4BD0A 4YWZA 4LV2A 3FYZA 3SH8A 2V1AA 1ONHA 3BQAA 1HD8A 1H8ZA 5FQIA 1K54C 5DF8A 3ZDJA 2Y2NA 4DJ3A 4X56A 3LICA 3OPPA 4WYYA 3ZGAB 2EX2A 1G6AA 4X6TA 3OCNA 2KX6A 1W5DA 4HEFA 4BWIA 4QY5A 3E4QA 4DJ2A 2Y2IA 4GZBA 3UDXA 2R9WA 4XT2A 5EVLA 5HSQA 2QWSA 4Y3IA 1XJ2A 1H3QA 3SS5A 1IOUA 1MY8A 3GECA 4ZJ3A 5EUAA 1H5XA 4LV0A 1TD5A 2V0UA 3VFHA 3KO6A 2QJ7A 5L8MA
chains in the Genus database with same CATH topology
4GS9B 2A24A 3LIDA 4BJPA 5G4YA 1S1ZA 3UE6A 2O9BA 3G6OA 1P9RA 4BMWA 1GSVA 3DBAA 1YAXA 2MJ6A 3H7WB 5DJUA 2M7UA 5KIZA 3KX0X 4Q0JA 3EWKA 2ZMFA 5AVEA 2GNXA 4L9FA 4BBVA 4CQHA 1MKMA 3VE4A 4L9GA 3OC2A 1VB6A 2FH5A 4Q0IA 4EESA 2W1RA 2P04A 4HNBA 2HJEA 3CITA 4O01A 2VV8A 4WLAA 2VEAA 5HD3A 4ETZA 1DP6A 2L1MA 4R3AA 2VGLS 1D06A 2VV7A 1YSPA 3PBQA 3C38A 2JKTM 3MJQA 3LFVA 3HCYA 4BBUA 2YKFA 3C30A 5IT5A 3P7NA 1YSQA 4FSFA 4K08A 3RFBA 2INWA 3LIEA 5MC7A 4EEPA 3LIFA 4I39A 5HWWA 3S7OA 2W3GA 2Y79A 5KSHA 3CWFA 1T19A 4G3WA 1UGUA 3BY8A 4KUKA 3H82A 2LB9A 3PBTA 4NXBA 2FZ0A 5AJGA 2I9VA 5HDDA 3E98A 2A2LA 4H6JA 1YKDA 1ZTUA 2JKTI 3LR3A 2XA7S 2IA2A 1NRJA 3UMEA 4YOFA 3KSGA 3LI8A 4HOIA 5F6AA 1OTDA 4F3LB 4PAUA 4CLCE 3R4KA 3ICYA 4PKYG 1JNUA 2VV6A 3F1OB 1XJ4A 2D02A 4UQIM 5HPIA 2HV1A 3MFXA 1GSXA 4JGRA 4GS9A 4Y5FA 4HH2A 2Z6DA 1N9NA 1D7EA 2OOLA 3S7NA 3IS2A 3T4OA 1TS8A 3T4SA 3T4TA 4GCZA 4ARZB 1STZA 1V9ZA 2J80A 4H6JB 5DJTA 3H7WA 3KSIA 3KSHA 4MCWA 1P0ZA 2KLIA 2P08A 3MQQA 4P6ZM 1S67L 1G6OA 3UB9A 4HJ4A 2W3EA 3B33A 3T4LA 1MC0A 2PR5A 3EEAA 4LLOB 2B02A 2KOIA 3BY9A 2PDRA 5TJJA 3LUQA 3PBSA 2K7SA 3RH8B 2J3WA 2OAP1 1OTEA 5HL6A 4Z1WA 1VHMA 4GLQA 2PYPA 5A8BA 2K2NA 3PYPA 3VV4A 3V67A 3IS2B 1NLYA 4NXFA 2W3FA 5TBMB 1UWNX 4I3AA 3ZYTA 3MQOA 1F5MA 2XSSA 3CI6A 3LIBA 3B42A 1T1AA 4I3IA 2O99A 4MN7A 4IUKA 4ME4A 2VA0A 3LI9A 5CX7A 1NLZA 1N9OA 5HWTA 3NOTC 5G4ZA 4MN5A 2WKRA 3EQVA 4LPZA 4MMNA 4UEYA 3UB6A 3UB8A 1ZHHB 1Y28A 3EOIA 3O5YA 3TW8A 1X0OA 2GZAA 2W3HA 3VOLA 3F1NB 2GJ3A 5DF9A 5IU1A 2BASA 5IS1A 3E4OA 2O9CA 4OOMA 1LT0A 1S4SA 4F3LA 3SW1A 2PHYA 2VLGA 3F1OA 4GHIB 2XROA 3U2AA 2V1BA 4HHDA 5J4EA 2QJ5A 2ZOIA 3MQ0A 2D01A 4IJGA 3FPWA 4I38A 1OTBA 4DN0A 4HJ3A 4EXOA 3NJAA 3VE3A 2PD7A 3D3OA 3JVUA 4G3VA 3T4QA 3PR6A 5DKKA 3W2ZA 3LYXA 2GX5A 4OOLA 3UE3A 5AVFA 3E0YA 3TJZC 1TS6A 3FC7A 4NXEA 4ARZA 4CLCC 3T4KA 2QHKA 4I5SA 5LBRA 2PD8A 5K5BA 4HI4A 2VX8A 3ULFA 3T50A 2HGVA 1TS0A 3C8CA 2G7UA 4E04A 1NWZA 2O9AA 4WF0A 1F98A 1V9YA 1ODVA 1GSWA 2EA9A 2V0WA 5F5YA 2P7JA 3C2WA 1WA9A 2K31A 3HJKA 4BBTA 3OLOA 3LIAA 1OT6A 4EUVA 3KYQA 3GDIA 4R70A 3BJNA 4YNRA 4II7A 2WKPA 3D72A 2VKSA 3OCLA 4HP4A 3K3CA 3LR4A 5J3WA 1T18A 1S1YA 1OT9A 5TBMA 1IFQA 4NKPA 4R38A 3PHYA 1LL8A 1DP8A 3MXQA 1UWPX 4EW7A 3B47A 3EEHA 3NHQA 2OWJA 4MN6A 4EEUA 1P9WA 3S7QA 4LRXC 2LB5A 4O8GA 3K3DA 4DMZA 3CUEC 3UMDA 4GW9A 1OPXA 5C5KA 2OAQ1 4JGPA 3NOUC 4UQIS 4LRZE 4CLCD 3F1NA 2H28A 5J7EA 3HJIA 2ZBBA 4HH3A 4CLCB 3FPVA 1BYWA 3A0RA 4GHIA 1XJ6A 3TRCA 3ZQ5A 4EU0A 2XRNA 4WEKA 5F69A 1F9IA 2VGLM 3IBRA 1W63M 3F1PB 3KYZA 1KOUA 4ZRRA 2WKQA 4WL9A 3CUEA 4MDZA 3PBNA 3IBJA 4KQOA 3JVVA 1T1BA 1S66L 4P6ZS 2W27A 2DMWA 1G28A 2W0NA 4HIAA 1OJGA 1XFNA 2PT7A 3UB7A 4XT2B 4IUHA 1XFQA 4KUOA 3NOPC 2Z6CA 3BW6A 3E4PA 5HZHA 2W1TB 5HDCA 3PBRA 4I3JA 4Q0HA 4M4XA 4QPRA 4WEJA 2HF6A 4NXGA 3PBOA 5FL3A 3BWLA 4L9EA 3BQ8A 3R7WB 3A0VA 2XA7M 3MF0A 3EGXC 3CAXA 4AFIA 1LSVA 2VJWA 4HQAA 5EFWA 4B9OA 1S4RA 3CLOA 4PKYA 2A24B 5HWVA 2J3TC 1P97A 1LSXA 3TE8A 1XJ3A 3T4JA 3PXPA 1EW0A 2Y8HA 5HPFA 3EQUA 1H8MA 4YWZA 2JHEA 2QYBA 2KDKA 4ETXA 3K2NA 1T1CA 3RTYA 2EWVA 2JKRM 2R78A 5HD5A 2M7VA 1LSWA 4WUJA 2L0WA 2V1AA 2VZWA 2L4RA 1W63Q 3BQAA 4KQDA 5I5LA 4G3KA 4EERA 2O0YA 2PR6A 4RQ9A 3MR0A 1TS7A 1OJ5A 4FOFA 4R6LA 4DJ3A 2CMNA 3LICA 4CLCA 2YKHA 5DKLA 3S7PA 4IHQA 4EETB 3OCNA 2KX6A 4JGQA 1DP9A 4JGOA 2M1CA 2JN7A 4BWIA 4O0PA 5F68A 3F1PA 4LRYC 4WELA 2JKRI 3LR0A 3E4QA 1TF1A 4DJ2A 1OTAA 2QKPA 3H9WA 2OWHA 4L0LA 1N9LA 4NEED 1DRMA 2J3TD 4HP9A 3MMHA 4Y2FA 3H82B 4XT2A 3FG8A 5HSQA 4WN5A 2QWSA 5DFYA 2B18A 2V9AA 3A0SA 4Y3IA 1OTIA 1XJ2A 1H3QA 2ZMVA 3P01A 3OBFA 2W1TA 4B93A 2ZOHA 3OOVA 2NUTC 3EGDC 1IOUA 2HJ9C 1MZUA 5DFXA 4EQ1A 3GECA 4GJ4A 3KSFA 2W3DA 1TD5A 2V0UA 2PYRA 3KO6A 3R7WA 5HDSA 2NUPC 4HY8A 4PHTA 2EWWA 2QJ7A 5L8MA 3LR5A 4HJ6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GS9 B;  2A24 A;  3LID A;  5G4Y A;  1S1Z A;  3UE6 A;  3G6O A;  1GSV A;  3H7W B;  5DJU A;  5KIZ A;  3KX0 X;  3EWK A;  5AVE A;  4L9F A;  4BBV A;  3VE4 A;  4L9G A;  1VB6 A;  4EES A;  4HNB A;  2VV8 A;  4WLA A;  2VEA A;  5HD3 A;  1DP6 A;  2L1M A;  4R3A A;  2VV7 A;  1D06 A;  3MJQ A;  4BBU A;  2YKF A;  3P7N A;  4K08 A;  2INW A;  3LIE A;  4EEP A;  3LIF A;  4I39 A;  5HWW A;  3CWF A;  1T19 A;  1UGU A;  3BY8 A;  4KUK A;  3H82 A;  4NXB A;  2I9V A;  5HDD A;  4H6J A;  3UME A;  3LI8 A;  4HOI A;  5F6A A;  1OTD A;  4F3L B;  4PKY G;  3ICY A;  1JNU A;  2VV6 A;  3F1O B;  1XJ4 A;  2D02 A;  2HV1 A;  3MFX A;  1GSX A;  4JGR A;  4GS9 A;  4HH2 A;  2Z6D A;  1N9N A;  1D7E A;  2OOL A;  3IS2 A;  1TS8 A;  4GCZ A;  1V9Z A;  4H6J B;  2J80 A;  5DJT A;  3H7W A;  1P0Z A;  3MQQ A;  1S67 L;  3UB9 A;  4HJ4 A;  3B33 A;  2PR5 A;  4LLO B;  2B02 A;  3BY9 A;  2PDR A;  3LUQ A;  2K7S A;  3RH8 B;  1OTE A;  2PYP A;  5A8B A;  3PYP A;  3IS2 B;  4NXF A;  5TBM B;  1UWN X;  4I3A A;  3MQO A;  3LIB A;  1T1A A;  4I3I A;  3LI9 A;  1N9O A;  5HWT A;  3NOT C;  5G4Z A;  4MN5 A;  2WKR A;  4LPZ A;  3UB6 A;  3UB8 A;  1Y28 A;  1X0O A;  3VOL A;  3F1N B;  2GJ3 A;  5IU1 A;  2BAS A;  5IS1 A;  3E4O A;  1LT0 A;  1S4S A;  4F3L A;  3SW1 A;  2PHY A;  2VLG A;  3F1O A;  4GHI B;  2V1B A;  4HHD A;  5J4E A;  2QJ5 A;  2ZOI A;  2D01 A;  4I38 A;  1OTB A;  4HJ3 A;  4EXO A;  3NJA A;  3VE3 A;  2PD7 A;  5DKK A;  3LYX A;  5AVF A;  1TS6 A;  3FC7 A;  4NXE A;  2QHK A;  4I5S A;  2PD8 A;  4HI4 A;  3ULF A;  3T50 A;  1TS0 A;  3C8C A;  4E04 A;  1NWZ A;  4WF0 A;  1F98 A;  1V9Y A;  1ODV A;  1GSW A;  2EA9 A;  2V0W A;  5F5Y A;  2P7J A;  3C2W A;  1WA9 A;  3HJK A;  4BBT A;  3OLO A;  3LIA A;  1OT6 A;  3GDI A;  4R70 A;  2WKP A;  3D72 A;  4HP4 A;  3K3C A;  5J3W A;  1T18 A;  1S1Y A;  1OT9 A;  5TBM A;  4R38 A;  3PHY A;  1LL8 A;  1DP8 A;  3MXQ A;  1UWP X;  4EW7 A;  3EEH A;  3NHQ A;  2OWJ A;  4MN6 A;  4EEU A;  4LRX C;  3K3D A;  3UMD A;  4GW9 A;  4JGP A;  3NOU C;  4LRZ E;  3F1N A;  2H28 A;  5J7E A;  3HJI A;  2ZBB A;  4HH3 A;  1BYW A;  3A0R A;  4GHI A;  1XJ6 A;  3ZQ5 A;  5F69 A;  1F9I A;  3IBR A;  3F1P B;  1KOU A;  2WKQ A;  4WL9 A;  1T1B A;  1S66 L;  2W27 A;  1G28 A;  2W0N A;  4HIA A;  1OJG A;  1XFN A;  3UB7 A;  4XT2 B;  1XFQ A;  4KUO A;  3NOP C;  2Z6C A;  3E4P A;  5HZH A;  5HDC A;  4I3J A;  4M4X A;  4NXG A;  3BWL A;  4L9E A;  3A0V A;  3CAX A;  1LSV A;  4B9O A;  4HQA A;  5EFW A;  1S4R A;  3CLO A;  4PKY A;  2A24 B;  5HWV A;  1P97 A;  1LSX A;  1XJ3 A;  1EW0 A;  4YWZ A;  2JHE A;  2KDK A;  3RTY A;  1T1C A;  2R78 A;  5HD5 A;  1LSW A;  4WUJ A;  2L0W A;  2V1A A;  2L4R A;  4KQD A;  5I5L A;  4EER A;  2PR6 A;  4RQ9 A;  3MR0 A;  1TS7 A;  1OJ5 A;  4R6L A;  4DJ3 A;  2CMN A;  3LIC A;  2YKH A;  5DKL A;  4EET B;  2KX6 A;  4JGQ A;  1DP9 A;  4JGO A;  2M1C A;  2JN7 A;  5F68 A;  3F1P A;  4LRY C;  3E4Q A;  4DJ2 A;  1OTA A;  2QKP A;  3H9W A;  2OWH A;  1N9L A;  1DRM A;  4HP9 A;  3H82 B;  4XT2 A;  3FG8 A;  5HSQ A;  4WN5 A;  2QWS A;  2V9A A;  3A0S A;  1OTI A;  1XJ2 A;  2ZOH A;  1MZU A;  4EQ1 A;  3GEC A;  2V0U A;  2PYR A;  5HDS A;  4HY8 A;  2QJ7 A;  4HJ6 A; 
#chains in the Genus database with same CATH topology
 3LID A;  4BJP A;  4U0X A;  3M2J A;  5G4Y A;  3IXB A;  5GLB A;  3ZG0 A;  4BMW A;  2P9V B;  3UNW A;  4FTX A;  1J3W A;  2V8C A;  1QMF A;  4HBT A;  2M7U A;  5DJU A;  1PI5 A;  4H8R A;  5AVE A;  1GA0 A;  4BBV A;  3GTC A;  3SH9 A;  1CK3 A;  4Y7P A;  1FIK A;  1SDN A;  4L9G A;  5FAO A;  1W7F A;  4Q0I A;  4QJG A;  2P04 A;  3HLD A;  4HNB A;  2HJE A;  1ESI A;  3V39 A;  4WLA A;  4ETZ A;  2L1M A;  2Z2L B;  5EVE A;  3PBQ A;  2YKF A;  3G32 A;  1VM1 A;  4Z9Q A;  4B4Z A;  1DJA A;  3B3X A;  4N1H A;  3DAV A;  5FAT A;  3S7O A;  4MEZ A;  1KDW A;  2PBD P;  2E8I A;  1L3L A;  1MBL A;  3NCK A;  4KUK A;  2H5S A;  3PBT A;  4NXB A;  1FSY A;  2I9V A;  3UE1 A;  1L2S A;  1YKD A;  1ERM A;  2HDU A;  4S2I A;  1HTZ A;  2IA2 A;  3LI8 A;  2ZM2 A;  3DWZ A;  3BM6 A;  1BLC A;  4GNU A;  4OP5 A;  3UPN A;  4BD1 A;  4OLG A;  2XH9 A;  4E3N A;  1K4E A;  2D02 A;  3BLS A;  3MFX A;  1GSX A;  3BFE A;  1YLT A;  1N9N A;  4R4R A;  2DNS A;  3IS2 A;  1TS8 A;  1S0W A;  1VET B;  2P9V A;  5FQJ A;  4ARZ B;  3ZNY A;  4PPR A;  4Y13 A;  1PW1 A;  2WGV A;  3MQQ A;  1K56 D;  4LLO B;  2ZC4 B;  2B02 A;  2KOI A;  2J7V A;  3PBS A;  3MXS A;  4RX3 A;  1OTE A;  4R1G A;  1YLY A;  1XGI A;  2K2N A;  3PYP A;  3VV4 A;  4WZ4 A;  5FSR A;  4UA9 A;  1IEL A;  2ZQC A;  2H0Y A;  2WK0 A;  4IUK A;  4S2L A;  3LI9 A;  3ZCZ A;  1NLZ A;  1SHV A;  2WKR A;  3V3R A;  1TEM A;  3EQV A;  5HFO A;  5L07 A;  3UB8 A;  3MZF A;  1ZHH B;  1CQA A;  4DE1 A;  1NYM A;  4E6W A;  4JF4 A;  4PM8 A;  1K0K A;  1LT0 A;  1MWU A;  1ZKJ A;  3SW1 A;  1K55 C;  3IX3 A;  2XRO A;  4QY6 A;  5FQQ A;  4C75 A;  2V1B A;  4HHD A;  5J4E A;  2ZOI A;  2D01 A;  3N8S A;  3VP3 A;  4EXO A;  3NJA A;  2PD7 A;  3HLE A;  1FQG A;  3M2K A;  1VET A;  4ARZ A;  1RCJ A;  3WS2 A;  1O7E A;  1U60 A;  4BLM A;  4I5S A;  1MPL A;  3T1Q B;  4HI4 A;  2VX8 A;  5EPH A;  2HGV A;  3C8C A;  4OPR A;  3ZNT A;  3HVF A;  2G7U A;  5HAP A;  1F98 A;  1V9Y A;  3V50 A;  3WRZ A;  5DF7 A;  1OT6 A;  5KMW A;  4EUV A;  4S2P A;  4QD4 A;  4N9L A;  2WKP A;  2VKS A;  1CEF A;  3LR4 A;  5A90 A;  3QP5 A;  5A91 A;  4NKP A;  4R38 A;  4MBF A;  1HVB A;  3G2Z A;  5AQ9 A;  1UWP X;  5EM1 A;  2RCX A;  3NDE A;  4LFU A;  3HL9 A;  4C3Q A;  1CJF A;  4MN6 A;  4GOG A;  4EEU A;  1N4O A;  4LRX C;  4O8G A;  2A49 A;  4P0M A;  4ZDX A;  1KGG A;  1PWG A;  5HW3 A;  5J7E A;  3IF5 A;  2ZBB A;  3T1R A;  2XK1 A;  1EWZ A;  5A92 A;  2ZC6 B;  3A0R A;  4EU0 A;  3IWQ A;  3Q07 A;  5A93 A;  2ZJ9 A;  1BT5 A;  5F69 A;  3IBR A;  1W63 M;  2PAV P;  3KYZ A;  2WKQ A;  5TFQ A;  2Y2K A;  4E3M A;  4P6Z S;  1ACF A;  2W27 A;  2DMW A;  3LY3 A;  4KUO A;  3NOP C;  4S2N C;  1KVL A;  3QP8 A;  4OQ0 A;  5F82 A;  3HUM A;  1I2W A;  2FFF B;  3CJM A;  3HLC A;  2W1T B;  4N9K A;  3PBR A;  4HBU A;  1ES5 A;  3UPP A;  1SDE A;  4OOY A;  3W4Q A;  4WEJ A;  4BL3 A;  2GDN A;  2IWD A;  2RL3 A;  3CAX A;  5FDH A;  2JC7 A;  4DRT A;  2EXB A;  4PKY A;  1BLP A;  3MS6 A;  5HX9 A;  3NIA A;  3T4J A;  1WYB A;  2DCF A;  3HUN A;  1H8M A;  2QYB A;  4WMC D;  4E3J A;  3W4P A;  2JKR M;  1LSW A;  3E2L A;  1W63 Q;  4N1X A;  4E3O A;  4G3K A;  2HDS A;  4EER A;  4RQ9 A;  3MR0 A;  4KEN B;  1TS7 A;  5L10 A;  4WZ5 A;  4FOF A;  1PW8 A;  2HP5 A;  1PNE A;  1DY6 A;  3W4O A;  5EV0 A;  2YKH A;  5DKL A;  4GN2 A;  4EET B;  3GV9 A;  1MWT A;  2XGN A;  4LCM A;  4LV1 A;  3SH7 A;  4LRY C;  5FAS A;  3LR0 A;  1RGZ A;  2V20 A;  3ITB A;  4F94 A;  2QKP A;  2OWH A;  1DRM A;  2J3T D;  3BRM A;  4DKI A;  4Y2F A;  3H82 B;  1AXB A;  4WN5 A;  2B18 A;  3DTE A;  2V9A A;  4JXW A;  1SKO A;  5CRF A;  2WKE A;  1OTI A;  2ZMV A;  2W1T A;  3E2K A;  2ZM0 A;  3OOV A;  4RVA A;  1MZU A;  4EQ1 A;  3KSF A;  2G2W A;  4DDS A;  1PWD A;  2PYR A;  4RYE A;  4KQR A;  2NUP C;  4HY8 A;  1JTD A;  5M19 A;  1YMS A;  1G5U A;  3LR5 A;  2H10 A;  4GS9 B;  1SKF A;  2HP6 A;  2JKG A;  1YLJ A;  1YLW A;  1P9R A;  4ZBE A;  3DBA A;  3EWK A;  2ZMF A;  4JXS A;  4CQH A;  1MKM A;  2A3U A;  2XF3 A;  3NC8 A;  4EES A;  1Y4O A;  2Y2O A;  2VEA A;  1DP6 A;  1C3B A;  1AWI A;  4R3A A;  4EUZ A;  3HLW A;  2VV7 A;  3FWL A;  3C38 A;  2JKT M;  3LFV A;  3HCY A;  3HUO A;  4KZA A;  5IT5 A;  1YSQ A;  5MC7 A;  3LIF A;  4IVI A;  5AQB A;  1CF0 A;  1MKI A;  1GHP A;  1ALQ A;  1VQQ A;  4XUZ A;  4XUX A;  4OQG A;  3N6I A;  3H82 A;  2X02 A;  3T1X A;  3LR3 A;  5L09 A;  3UB5 P;  1NRJ A;  4KG6 A;  3KSG A;  4MNR A;  4HES A;  5F6A A;  3LEZ A;  2J9P A;  1I2S A;  3WS1 A;  2IWB A;  3M6B A;  3ICY A;  3ZFZ A;  3F1O B;  4QB8 A;  4X1L A;  4OP8 A;  1LI9 A;  4IED A;  5TR7 A;  3VP0 A;  1LL9 A;  4GS9 A;  4HH2 A;  1K54 A;  3QP1 A;  1BZA A;  3PAE A;  2AVX A;  3T4S A;  3BFC A;  3T4T A;  2OSU A;  1LL5 A;  3D4F A;  4KG5 A;  1STZ A;  1V9Z A;  2J80 A;  3KSI A;  1BSG A;  4MCW A;  2V8F A;  5CTN A;  4FCF A;  4P6Z M;  1S67 L;  1G6O A;  3UB9 A;  4HJ4 A;  3B33 A;  3O87 A;  2PR5 A;  3EEA A;  4OPQ A;  3A3I A;  4KG2 A;  5TJJ A;  2K7S A;  2WAD A;  5CGS A;  1KE3 A;  2OAP 1;  5HL6 A;  1PYY A;  3RXX A;  3WS4 A;  4JXV A;  3S22 A;  5CHM A;  3MZE A;  3IS2 B;  4I3A A;  3CI6 A;  2O99 A;  4R4S A;  3FZC A;  3HLG A;  5G4Z A;  1K57 C;  3T12 B;  1XXM A;  3EOI A;  4GKU A;  3TW8 A;  1CI8 A;  2W3H A;  3F1N B;  5E2E A;  2ZM8 A;  4NK3 A;  4OOM A;  1RP5 A;  2VLG A;  3F1O A;  4GHI B;  4K0W A;  1NY0 A;  4B4X A;  3MQ0 A;  4IJG A;  4Y0T A;  1OTB A;  4DN0 A;  4HJ3 A;  3P98 A;  4DF6 A;  4G3V A;  5DKK A;  3SZT A;  3C7U A;  2Y2G A;  3LYX A;  3UE3 A;  3E0Y A;  4CLC C;  3UY6 A;  5LBR A;  5F83 A;  4S2K A;  3NDG A;  3IF6 C;  1XPB A;  1TS0 A;  2Y2Q A;  3O3V A;  3RXW A;  4E04 A;  3L9K A;  2O9A A;  5FA7 A;  4WF0 A;  2EX9 A;  2WZZ A;  1ODV A;  1GSW A;  2EA9 A;  3TSG A;  3VP4 A;  2HDR A;  3NUL A;  2K31 A;  3OLO A;  5E2F A;  2XEP A;  4R70 A;  4UA6 A;  4YNR A;  4II7 A;  1YMX A;  4UAA A;  1M40 A;  3K3C A;  3WS0 A;  3UPO A;  5J3W A;  1T18 A;  1OT9 A;  3PHY A;  3HLB A;  1NYY A;  3NHQ A;  2JKF A;  3HLF A;  3S7Q A;  5KSC A;  1WYC A;  5CER A;  3IQA A;  3K3D A;  4DMZ A;  3UMD A;  1MWR A;  1XX2 A;  1Q2Q A;  4E3K A;  3W8K A;  3F1N A;  5EE8 A;  3HJI A;  4R3J A;  4D2O A;  3FPV A;  2Q0O A;  1GHM A;  3CZD A;  4GHI A;  3O86 A;  3T1S A;  3GQZ A;  2XRN A;  4Q8I A;  5M18 A;  3F1P B;  5FI6 A;  4BQM A;  1KOU A;  4ZRR A;  3PBN A;  3C5A A;  4KQO A;  3JVV A;  3UDF A;  3I7J A;  5F1G A;  3LCE A;  1Z09 A;  3WWX A;  2Z6C A;  2VGK A;  5GLD A;  3E4P A;  5HZH A;  3GR2 A;  2DRW A;  3IHB A;  4M4X A;  4FD8 A;  3UDI A;  4NXG A;  4LEN A;  5FL3 A;  4QHC A;  3A0V A;  3VOY A;  1E3U A;  1FCN A;  1O07 A;  1ZG4 A;  3MF0 A;  4AFI A;  1LSV A;  4PMA A;  3IH8 A;  5FAQ A;  2A24 B;  4IBX A;  3FKW A;  1P97 A;  2WKI A;  1NJ4 A;  1MXO A;  3A3F A;  1E4D A;  3VP1 A;  1EW0 A;  5GHY A;  5HPF A;  1K55 A;  3JYI A;  5CGX A;  3EQU A;  3C4O A;  3ZVW A;  3K2N A;  2Y2H A;  5AQA A;  3RTY A;  2EWV A;  1FCM A;  5HD5 A;  2L0W A;  2VZW A;  1L0F A;  4KQD A;  2JE5 A;  5DTS A;  3VOZ A;  5GLC A;  4R0Q A;  1PZP A;  2Q9M A;  3QP6 A;  4X53 A;  2Y55 A;  4FH2 A;  2CMN A;  2UWX A;  3LEQ A;  4IHQ A;  1CEG A;  4PM7 A;  1IYS A;  3LO7 A;  3HBR A;  4JGQ A;  3LGO A;  5HAI A;  4ESP A;  3P09 A;  4O0P A;  3JPU A;  1L0E A;  5F68 A;  3F1P A;  2JKR I;  4PM6 A;  3ZG5 A;  1GA9 A;  1OTA A;  1BLH A;  4L0L A;  1N9L A;  4HP9 A;  2P74 A;  4S2O A;  3GRJ A;  4DE0 A;  2OLU A;  1NRF A;  3OBF A;  4B93 A;  4YIN A;  5HAR A;  2ZQ8 A;  5EOO A;  1BTL A;  5EVI C;  2CC1 A;  4ZJ2 A;  2W3D A;  4GD6 A;  2Y2P A;  4OQI A;  1ZG6 A;  1E25 A;  4XXR A;  1KGE A;  4PHT A;  1K4F A;  4OQH A;  2A24 A;  4OKP A;  1YT4 A;  1PRQ A;  1S1Z A;  3UE6 A;  5I94 A;  3CMZ A;  3VSL A;  3MFD A;  4QWO A;  1IYO A;  1SKO B;  2MJ6 A;  3H7W B;  3KX0 X;  4Q0J A;  1A0K A;  2GNX A;  1G68 A;  2WGW A;  2VGJ A;  3OC2 A;  4X68 A;  1VB6 A;  2FH5 A;  2W1R A;  3G2Y A;  3CG5 A;  3MBZ A;  2VV8 A;  5FQ9 A;  5FQK A;  1YM1 A;  1D06 A;  3FKV A;  4GD8 A;  4S2N A;  2PBY A;  4EBP A;  2Y4A A;  3V3S A;  3C30 A;  3IH9 A;  4FSF A;  4K08 A;  3RFB A;  2INW A;  5TGF A;  4I39 A;  1YLP A;  1FCO A;  5FAP A;  1OME A;  1XGJ A;  2W3G A;  4IVK A;  2Y79 A;  2Z2M B;  4Y0O A;  3PTE A;  2XFT A;  4DDY A;  5KSH A;  4G3W A;  1UGU A;  1W8Y A;  3M6H A;  2PU4 A;  5AJG A;  3UO9 A;  5HDD A;  4JPM A;  4H6J A;  2JKT I;  4GDB A;  2XA7 S;  3UME A;  3IXH A;  4KZB A;  3IWI A;  5CHU A;  3MKE A;  4HOI A;  4KZ4 A;  1OTD A;  2R9X A;  5JYP A;  1DJC A;  1JNU A;  2VV6 A;  2HV1 A;  3CPT B;  1ERQ A;  2V1Z A;  3MSH A;  1IYP A;  2B95 A;  3IXD A;  1FSW A;  1D7E A;  1H8Y A;  2OOL A;  1W8Q A;  2XD5 A;  3Q82 A;  3N8R A;  4BEN A;  1LHY A;  2EX6 A;  5CED A;  5F1F A;  1KGF A;  3H7W A;  3KSH A;  2EX8 A;  2KLI A;  2P08 A;  4A5R A;  1BUL A;  2HDQ A;  4GB7 A;  2W3E A;  1FR1 A;  1MWS A;  3T4L A;  4S2M A;  4OPZ A;  3A3D A;  1IEM A;  3G34 A;  3LUQ A;  3RH8 B;  2J3W A;  4JF5 A;  5E2H A;  1VHM A;  2Y59 A;  4GLQ A;  2PYP A;  2XFS A;  3MKF A;  5G18 A;  4CJN A;  5FI2 A;  1NLY A;  5GLA A;  1K38 A;  2ZQ7 A;  3IX4 A;  4NXF A;  2W3F A;  1UWN X;  3ZYT A;  3MQO A;  3UN7 A;  1F5M A;  5FI7 A;  2XSS A;  3S1Y A;  3LIB A;  3B42 A;  1GCE A;  1T1A A;  4I3I A;  3AGF A;  1JWP A;  3Q1F A;  5CX7 A;  4Y0U A;  1K25 A;  3NOT C;  4FH4 A;  4MN5 A;  4DE3 A;  3OPL A;  4LPZ A;  3UB6 A;  1XP4 A;  3WS5 A;  4GDN A;  1Y28 A;  3HRE A;  1X0O A;  2GZA A;  3VMA A;  5DF9 A;  2BAS A;  5DTT A;  5IS1 A;  2O9C A;  2PHY A;  2E8J A;  3C7V A;  2QJ5 A;  3CPT A;  4KQQ A;  4I38 A;  1K6R A;  1JWZ A;  3G35 A;  3VE3 A;  3JVU A;  3T4Q A;  2XLN A;  3PR6 A;  3W2Z A;  2EFX A;  1NXY A;  4IBR A;  2Y2L A;  2GX5 A;  4OOL A;  5AVF A;  1TS6 A;  1I5Q A;  2PU2 A;  3DTM A;  3BFF A;  1W79 A;  3BYD A;  5GL9 A;  2X01 A;  5K5B A;  3ULF A;  4KZ5 A;  2PRF A;  3QNB A;  3N7W A;  1JWV A;  5L2F A;  4DXB A;  4WM9 A;  5F5Y A;  2V0W A;  2P7J A;  1BLS A;  1WA9 A;  2J8Y A;  3C2W A;  3HJK A;  4BBT A;  4R23 A;  3O88 A;  3MXR A;  3KYQ A;  3G4P A;  3OCL A;  4Y15 A;  4EQI A;  2ZC7 A;  1IFQ A;  1HZO A;  1LL8 A;  4OLD A;  4E6X A;  3Q7Z A;  5JYO A;  4EW7 A;  1DJB A;  4E3L A;  4KZ8 A;  3VP2 A;  2LB5 A;  1PZO A;  4GW9 A;  5C5K A;  2OAQ 1;  4UQI S;  4LRZ E;  4CLC D;  2WAE A;  4HH3 A;  4CLC B;  5U47 A;  5M1A A;  1XKZ A;  2WZX A;  3ZQ5 A;  3IF6 B;  4WEK A;  1F9I A;  2ZLY A;  1H0M A;  1NZO A;  4OPY A;  1T1B A;  3Q7V B;  3QNC A;  1S66 L;  1KE0 A;  1G28 A;  1OJG A;  1WE4 A;  4ZJ1 A;  4JXG A;  2PT7 A;  3UB7 A;  1XA1 A;  2JCH A;  1XFQ A;  3DWK A;  4JLF A;  2HZ5 A;  3OZH A;  4K0X A;  3BW6 A;  5IHV A;  4M3K A;  1QME A;  2I72 A;  5HDC A;  2VK3 A;  4X1M A;  4I3J A;  5GHX A;  3BFG A;  4Q0H A;  2ZL1 B;  4EBN A;  5E43 A;  3G31 A;  3ZHH A;  3R7W B;  1ZC2 A;  2XA7 M;  4X69 A;  1K57 A;  2ZQ9 A;  4B9O A;  4HQA A;  2X71 A;  2ZD8 A;  5HWV A;  2XDM A;  2C5W B;  3MZD A;  5CEC A;  1L0G A;  4EBL A;  3PXP A;  2Y8H A;  3NI9 A;  2JHE A;  2KDK A;  2QPN A;  4ETX A;  1T1C A;  2R78 A;  4WUJ A;  1E3U D;  2L4R A;  5I5L A;  3ZVT A;  4E3I A;  1TVF A;  2O0Y A;  2PR6 A;  2ZC3 B;  1OJ5 A;  4C6Y A;  1KDS A;  4R6L A;  4MBH A;  1TDG A;  2HPB A;  4CLC A;  3S7P A;  5FQM A;  1DP9 A;  4U3T A;  4JGO A;  3IF6 A;  4N92 A;  2M1C A;  4RX2 A;  2JN7 A;  4PM9 A;  2ZQA A;  4UA7 A;  4WEL A;  5D3O A;  4NG2 A;  1TF1 A;  3Q7V A;  4ZTK A;  3H9W A;  2EFU A;  2V2F F;  2Y91 A;  4NEE D;  4R3B A;  2WKH A;  3MMH A;  3FG8 A;  5DFY A;  3A0S A;  1Y54 A;  2BG1 A;  5CEB A;  1ES3 A;  3P01 A;  2ZOH A;  2NUT C;  3EGD C;  3NEC A;  2ZL1 A;  2HJ9 C;  5DFX A;  4GJ4 A;  1F2K A;  1KE4 A;  3R7W A;  3OPR A;  5HDS A;  2EWW A;  1LLB A;  2XR0 A;  3A3J A;  3ISG A;  1FR6 A;  2M7V A;  4HJ6 A;  4K91 A;  4ZAM A;  3NBL A;  2O9B A;  3G6O A;  3QP4 A;  1VEU B;  1GSV A;  3IT9 A;  1Q2P A;  1YAX A;  2C6W B;  4P6B A;  5KIZ A;  4L9F A;  3IX8 A;  3TG9 A;  3VE4 A;  2XD1 A;  3PAG A;  3OPH A;  2OV5 A;  5CTM A;  3CIT A;  4O01 A;  5HD3 A;  3Q81 A;  1M6K A;  2VGL S;  1YSP A;  4NET A;  2ZQD A;  3MJQ A;  2BLS A;  4BBU A;  3N8L A;  5DVA A;  3P7N A;  5EVI D;  3LIE A;  2WAF A;  4X55 A;  4EEP A;  3CHW P;  5EVI B;  2QZ6 A;  5HAQ A;  5HWW A;  2JBF A;  5FEG A;  4CPK A;  2WGW B;  2Y2J A;  1IKI A;  3CWF A;  1T19 A;  3UE0 A;  3BY8 A;  3S4X A;  2LB9 A;  3V5M A;  3A3E A;  1YLZ A;  2FZ0 A;  1FIL A;  3E98 A;  2A2L A;  1ZTU A;  1Z6F A;  1IKG A;  3BEB A;  3KYE A;  4YOF A;  3IHA A;  1RGY A;  3BFD A;  4F3L B;  5CGW A;  4PAU A;  2UV0 E;  4CLC E;  3R4K A;  4PKY G;  1XJ4 A;  4UQI M;  1K56 A;  5HPI A;  4B88 A;  4O7D A;  4JGR A;  4Y5F A;  3GVB A;  2Z6D A;  3S7N A;  3T4O A;  5HL1 A;  1N9B A;  4GCZ A;  1VEU A;  1XA7 A;  4H6J B;  5DJT A;  4KZ6 A;  1PWC A;  3AGE A;  1P0Z A;  2OLV A;  1PI4 A;  3N4I A;  5DTK A;  1MC0 A;  5AQ7 A;  3BY9 A;  2PDR A;  3NY4 A;  5J8X A;  4LV3 A;  4Z1W A;  3DW0 A;  1L0D A;  3L7H A;  5A8B A;  3VSK A;  3V67 A;  4MBK A;  5CXW A;  1FOF A;  1SZV A;  5TBM B;  3IXG A;  3ZG9 B;  5EVI A;  4P87 A;  3SS4 A;  4KZ3 A;  3SOI A;  1NZU A;  4MN7 A;  4ME4 A;  2VA0 A;  1K6S A;  1YPR A;  1N9O A;  4KZ9 A;  5HWT A;  4MMN A;  4UEY A;  2Q9N A;  5EM0 A;  3O5Y A;  1HLU P;  3VOL A;  4S2J A;  2GJ3 A;  4FUW A;  5IU1 A;  4RA7 A;  3E4O A;  1S4S A;  2FFY A;  4F3L A;  2BTF P;  4JKT A;  5FEF A;  3U2A A;  3U4L P;  3FPW A;  2J9O A;  3VFF A;  3G30 A;  4PM5 A;  3D3O A;  1TDL A;  2H0T A;  3GMW A;  4U0T A;  4WZ5 C;  2WUQ A;  3C4P A;  3TJZ C;  4EWF A;  4NXE A;  3FC7 A;  4ID4 A;  4X25 A;  3T4K A;  2QHK A;  1KVM A;  2PD8 A;  1YQS A;  4LCL A;  4EV4 A;  3IWO A;  3T50 A;  1S6R A;  1NWZ A;  4JF6 A;  5BOH A;  4WBG A;  3ZG8 B;  1EI5 A;  1LI0 A;  3LIA A;  3BLM A;  2Y2M A;  5CHJ A;  3GDI A;  3BJN A;  3AGD A;  1ES4 A;  3D72 A;  4HP4 A;  1JTG A;  3FV7 A;  1S1Y A;  5TBM A;  4YFM A;  3D9Y A;  2ZC5 B;  4DXC A;  1JVJ A;  1J9M A;  1BUE A;  1DP8 A;  5GHZ A;  4OVD A;  3MXQ A;  3DTI A;  1CI9 A;  3B47 A;  3EEH A;  4D60 A;  2OWJ A;  2IWC A;  1P9W A;  4BL2 A;  3CUE C;  2B5R A;  1OPX A;  4JGP A;  3NOU C;  2XQZ A;  3BEC A;  3QP2 A;  2H28 A;  4P85 A;  5EOE A;  5FDS A;  3SS3 A;  1BYW A;  1SCW A;  1XJ6 A;  3WRT A;  3TRC A;  3GSG A;  4OON A;  1ONG A;  4Y17 A;  2VGL M;  1ES2 A;  2ACG A;  4WL9 A;  3CUE A;  4MDZ A;  2WGI A;  3IBJ A;  2QMI A;  2W0N A;  4HIA A;  1XFN A;  4XT2 B;  4IUH A;  5EEC A;  4QU3 A;  2EXA A;  3ITA A;  1PIO A;  3ZG7 B;  2ZMA A;  2G2U A;  3TOI A;  3DTK A;  4QPR A;  4WMC A;  2HF6 A;  3PBO A;  3BWL A;  4L9E A;  1ESU A;  3BQ8 A;  1GHI A;  4KZ7 A;  3EGX C;  1ERO A;  3LY4 A;  2HP9 A;  2VJW A;  5EFW A;  4DE2 A;  1S4R A;  3CLO A;  2J3T C;  1D1J A;  1LSX A;  4OH0 A;  3TE8 A;  1XJ3 A;  2WYX A;  4LGW A;  5E2G A;  1IYQ A;  3RJU A;  5KZH A;  4JBF A;  4MLL A;  4UHU A;  3QHY A;  1PFL A;  4BD0 A;  4YWZ A;  4LV2 A;  3FYZ A;  3SH8 A;  2V1A A;  1ONH A;  3BQA A;  1HD8 A;  1H8Z A;  5FQI A;  1K54 C;  5DF8 A;  3ZDJ A;  2Y2N A;  4DJ3 A;  4X56 A;  3LIC A;  3OPP A;  4WYY A;  3ZGA B;  2EX2 A;  1G6A A;  4X6T A;  3OCN A;  2KX6 A;  1W5D A;  4HEF A;  4BWI A;  4QY5 A;  3E4Q A;  4DJ2 A;  2Y2I A;  4GZB A;  3UDX A;  2R9W A;  4XT2 A;  5EVL A;  5HSQ A;  2QWS A;  4Y3I A;  1XJ2 A;  1H3Q A;  3SS5 A;  1IOU A;  1MY8 A;  3GEC A;  4ZJ3 A;  5EUA A;  1H5X A;  4LV0 A;  1TD5 A;  2V0U A;  3VFH A;  3KO6 A;  2QJ7 A;  5L8M A; 
#chains in the Genus database with same CATH homology
 4GS9 B;  2A24 A;  3LID A;  4BJP A;  5G4Y A;  1S1Z A;  3UE6 A;  2O9B A;  3G6O A;  1P9R A;  4BMW A;  1GSV A;  3DBA A;  1YAX A;  2MJ6 A;  3H7W B;  5DJU A;  2M7U A;  5KIZ A;  3KX0 X;  4Q0J A;  3EWK A;  2ZMF A;  5AVE A;  2GNX A;  4L9F A;  4BBV A;  4CQH A;  1MKM A;  3VE4 A;  4L9G A;  3OC2 A;  1VB6 A;  2FH5 A;  4Q0I A;  4EES A;  2W1R A;  2P04 A;  4HNB A;  2HJE A;  3CIT A;  4O01 A;  2VV8 A;  4WLA A;  2VEA A;  5HD3 A;  4ETZ A;  1DP6 A;  2L1M A;  4R3A A;  2VGL S;  1D06 A;  2VV7 A;  1YSP A;  3PBQ A;  3C38 A;  2JKT M;  3MJQ A;  3LFV A;  3HCY A;  4BBU A;  2YKF A;  3C30 A;  5IT5 A;  3P7N A;  1YSQ A;  4FSF A;  4K08 A;  3RFB A;  2INW A;  3LIE A;  5MC7 A;  4EEP A;  3LIF A;  4I39 A;  5HWW A;  3S7O A;  2W3G A;  2Y79 A;  5KSH A;  3CWF A;  1T19 A;  4G3W A;  1UGU A;  3BY8 A;  4KUK A;  3H82 A;  2LB9 A;  3PBT A;  4NXB A;  2FZ0 A;  5AJG A;  2I9V A;  5HDD A;  3E98 A;  2A2L A;  4H6J A;  1YKD A;  1ZTU A;  2JKT I;  3LR3 A;  2XA7 S;  2IA2 A;  1NRJ A;  3UME A;  4YOF A;  3KSG A;  3LI8 A;  4HOI A;  5F6A A;  1OTD A;  4F3L B;  4PAU A;  4CLC E;  3R4K A;  3ICY A;  4PKY G;  1JNU A;  2VV6 A;  3F1O B;  1XJ4 A;  2D02 A;  4UQI M;  5HPI A;  2HV1 A;  3MFX A;  1GSX A;  4JGR A;  4GS9 A;  4Y5F A;  4HH2 A;  2Z6D A;  1N9N A;  1D7E A;  2OOL A;  3S7N A;  3IS2 A;  3T4O A;  1TS8 A;  3T4S A;  3T4T A;  4GCZ A;  4ARZ B;  1STZ A;  1V9Z A;  2J80 A;  4H6J B;  5DJT A;  3H7W A;  3KSI A;  3KSH A;  4MCW A;  1P0Z A;  2KLI A;  2P08 A;  3MQQ A;  4P6Z M;  1S67 L;  1G6O A;  3UB9 A;  4HJ4 A;  2W3E A;  3B33 A;  3T4L A;  1MC0 A;  2PR5 A;  3EEA A;  4LLO B;  2B02 A;  2KOI A;  3BY9 A;  2PDR A;  5TJJ A;  3LUQ A;  3PBS A;  2K7S A;  3RH8 B;  2J3W A;  2OAP 1;  1OTE A;  5HL6 A;  4Z1W A;  1VHM A;  4GLQ A;  2PYP A;  5A8B A;  2K2N A;  3PYP A;  3VV4 A;  3V67 A;  3IS2 B;  1NLY A;  4NXF A;  2W3F A;  5TBM B;  1UWN X;  4I3A A;  3ZYT A;  3MQO A;  1F5M A;  2XSS A;  3CI6 A;  3LIB A;  3B42 A;  1T1A A;  4I3I A;  2O99 A;  4MN7 A;  4IUK A;  4ME4 A;  2VA0 A;  3LI9 A;  5CX7 A;  1NLZ A;  1N9O A;  5HWT A;  3NOT C;  5G4Z A;  4MN5 A;  2WKR A;  3EQV A;  4LPZ A;  4MMN A;  4UEY A;  3UB6 A;  3UB8 A;  1ZHH B;  1Y28 A;  3EOI A;  3O5Y A;  3TW8 A;  1X0O A;  2GZA A;  2W3H A;  3VOL A;  3F1N B;  2GJ3 A;  5DF9 A;  5IU1 A;  2BAS A;  5IS1 A;  3E4O A;  2O9C A;  4OOM A;  1LT0 A;  1S4S A;  4F3L A;  3SW1 A;  2PHY A;  2VLG A;  3F1O A;  4GHI B;  2XRO A;  3U2A A;  2V1B A;  4HHD A;  5J4E A;  2QJ5 A;  2ZOI A;  3MQ0 A;  2D01 A;  4IJG A;  3FPW A;  4I38 A;  1OTB A;  4DN0 A;  4HJ3 A;  4EXO A;  3NJA A;  3VE3 A;  2PD7 A;  3D3O A;  3JVU A;  4G3V A;  3T4Q A;  3PR6 A;  5DKK A;  3W2Z A;  3LYX A;  2GX5 A;  4OOL A;  3UE3 A;  5AVF A;  3E0Y A;  3TJZ C;  1TS6 A;  3FC7 A;  4NXE A;  4ARZ A;  4CLC C;  3T4K A;  2QHK A;  4I5S A;  5LBR A;  2PD8 A;  5K5B A;  4HI4 A;  2VX8 A;  3ULF A;  3T50 A;  2HGV A;  1TS0 A;  3C8C A;  2G7U A;  4E04 A;  1NWZ A;  2O9A A;  4WF0 A;  1F98 A;  1V9Y A;  1ODV A;  1GSW A;  2EA9 A;  2V0W A;  5F5Y A;  2P7J A;  3C2W A;  1WA9 A;  2K31 A;  3HJK A;  4BBT A;  3OLO A;  3LIA A;  1OT6 A;  4EUV A;  3KYQ A;  3GDI A;  4R70 A;  3BJN A;  4YNR A;  4II7 A;  2WKP A;  3D72 A;  2VKS A;  3OCL A;  4HP4 A;  3K3C A;  3LR4 A;  5J3W A;  1T18 A;  1S1Y A;  1OT9 A;  5TBM A;  1IFQ A;  4NKP A;  4R38 A;  3PHY A;  1LL8 A;  1DP8 A;  3MXQ A;  1UWP X;  4EW7 A;  3B47 A;  3EEH A;  3NHQ A;  2OWJ A;  4MN6 A;  4EEU A;  1P9W A;  3S7Q A;  4LRX C;  2LB5 A;  4O8G A;  3K3D A;  4DMZ A;  3CUE C;  3UMD A;  4GW9 A;  1OPX A;  5C5K A;  2OAQ 1;  4JGP A;  3NOU C;  4UQI S;  4LRZ E;  4CLC D;  3F1N A;  2H28 A;  5J7E A;  3HJI A;  2ZBB A;  4HH3 A;  4CLC B;  3FPV A;  1BYW A;  3A0R A;  4GHI A;  1XJ6 A;  3TRC A;  3ZQ5 A;  4EU0 A;  2XRN A;  4WEK A;  5F69 A;  1F9I A;  2VGL M;  3IBR A;  1W63 M;  3F1P B;  3KYZ A;  1KOU A;  4ZRR A;  2WKQ A;  4WL9 A;  3CUE A;  4MDZ A;  3PBN A;  3IBJ A;  4KQO A;  3JVV A;  1T1B A;  1S66 L;  4P6Z S;  2W27 A;  2DMW A;  1G28 A;  2W0N A;  4HIA A;  1OJG A;  1XFN A;  2PT7 A;  3UB7 A;  4XT2 B;  4IUH A;  1XFQ A;  4KUO A;  3NOP C;  2Z6C A;  3BW6 A;  3E4P A;  5HZH A;  2W1T B;  5HDC A;  3PBR A;  4I3J A;  4Q0H A;  4M4X A;  4QPR A;  4WEJ A;  2HF6 A;  4NXG A;  3PBO A;  5FL3 A;  3BWL A;  4L9E A;  3BQ8 A;  3R7W B;  3A0V A;  2XA7 M;  3MF0 A;  3EGX C;  3CAX A;  4AFI A;  1LSV A;  2VJW A;  4HQA A;  5EFW A;  4B9O A;  1S4R A;  3CLO A;  4PKY A;  2A24 B;  5HWV A;  2J3T C;  1P97 A;  1LSX A;  3TE8 A;  1XJ3 A;  3T4J A;  3PXP A;  1EW0 A;  2Y8H A;  5HPF A;  3EQU A;  1H8M A;  4YWZ A;  2JHE A;  2QYB A;  2KDK A;  4ETX A;  3K2N A;  1T1C A;  3RTY A;  2EWV A;  2JKR M;  2R78 A;  5HD5 A;  2M7V A;  1LSW A;  4WUJ A;  2L0W A;  2V1A A;  2VZW A;  2L4R A;  1W63 Q;  3BQA A;  4KQD A;  5I5L A;  4G3K A;  4EER A;  2O0Y A;  2PR6 A;  4RQ9 A;  3MR0 A;  1TS7 A;  1OJ5 A;  4FOF A;  4R6L A;  4DJ3 A;  2CMN A;  3LIC A;  4CLC A;  2YKH A;  5DKL A;  3S7P A;  4IHQ A;  4EET B;  3OCN A;  2KX6 A;  4JGQ A;  1DP9 A;  4JGO A;  2M1C A;  2JN7 A;  4BWI A;  4O0P A;  5F68 A;  3F1P A;  4LRY C;  4WEL A;  2JKR I;  3LR0 A;  3E4Q A;  1TF1 A;  4DJ2 A;  1OTA A;  2QKP A;  3H9W A;  2OWH A;  4L0L A;  1N9L A;  4NEE D;  1DRM A;  2J3T D;  4HP9 A;  3MMH A;  4Y2F A;  3H82 B;  4XT2 A;  3FG8 A;  5HSQ A;  4WN5 A;  2QWS A;  5DFY A;  2B18 A;  2V9A A;  3A0S A;  4Y3I A;  1OTI A;  1XJ2 A;  1H3Q A;  2ZMV A;  3P01 A;  3OBF A;  2W1T A;  4B93 A;  2ZOH A;  3OOV A;  2NUT C;  3EGD C;  1IOU A;  2HJ9 C;  1MZU A;  5DFX A;  4EQ1 A;  3GEC A;  4GJ4 A;  3KSF A;  2W3D A;  1TD5 A;  2V0U A;  2PYR A;  3KO6 A;  3R7W A;  5HDS A;  2NUP C;  4HY8 A;  4PHT A;  2EWW A;  2QJ7 A;  5L8M A;  3LR5 A;  4HJ6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...