2BTFP

The structure of crystalline profilin-beta-actin
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
139
structure length
139
Chain Sequence
AGWNAYIDNLMADGTCQDAAIVGYKDSPSVWAAVPGKTFVNITPAEVGILVGKDRSSFFVNGLTLGGQKCSVIRDSLLQDGEFTMDLRTKSTGGAPTFNITVTMTAKTLVLLMGKEGVHGGMINKKCYEMASHLRRSQY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA-ACTIN
publication title The structure of crystalline profilin-beta-actin.
pubmed doi rcsb
source organism Bos taurus
molecule tags Acetylation and actin-binding
total genus 34
structure length 139
sequence length 139
ec nomenclature
pdb deposition date 1994-01-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF00235 Profilin Profilin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.30 Alpha Beta 2-Layer Sandwich Beta-Lactamase Dynein light chain 2a, cytoplasmic 2btfP00
1SZVA 1Y4OA 1CQAA 1Z09A 2ACGA 4X1MA 1K0KA 4FUWA 5FEGA 2PRFA 1VETB 3T1QB 3NULA 2HZ5A 3LGOA 3T1RA 2PBDP 3CPTB 1SKOA 1SKOB 3MS6A 2VK3A 3D9YA 3T12B 5EVEA 1D1JA 3T1SA 2E8JA 1F2KA 5FDSA 3DAVA 2JKFA 3L9KA 3CHWP 1PRQA 1VEUA 2ZL1A 2ZL1B 3MSHA 1YPRA 3NECA 4QWOA 2BTFP 4ESPA 4X1LA 2PAVP 3U4LP 3L7HA 1HLUP 1J3WA 4D60A 5EM0A 5FEFA 1FIKA 2V8FA 2V8CA 1PNEA 1G5UA 2B95A 1CJFA 4X25A 3KYEA 1VEUB 4FTXA 3UB5P 5EV0A 1CF0A 1ACFA 1VETA 1PFLA 5EM1A 2JKGA 1FILA 3T1XA 1AWIA 1A0KA 3LEQA 3CPTA
chains in the Genus database with same CATH superfamily
4OQGA 3S7NA 1TEMA 3C4OA 5CXWA 5J3WA 1IYPA 1K55A 5G18A 5KIZA 1T1BA 3P7NA 3DTMA 5AVEA 1UWNX 3N4IA 4JF6A 2XD5A 1DJBA 5DTSA 2PD8A 3HJKA 3HL9A 4KZAA 1IELA 1WYCA 4JF5A 5J7EA 4BLMA 4Q0IA 2NUTC 1ZG4A 1D1JA 3OZHA 3K2NA 3ZYTA 5CHMA 5E43A 4WYYA 4Z9QA 5G4YA 1KGGA 1GHIA 4LRYC 1FOFA 3BWLA 4H6JA 3MSHA 2M7UA 5TGFA 4E3JA 1K4FA 3VSLA 3L7HA 2ZMFA 1KVMA 5HAPA 2V0UA 3UNWA 1J3WA 2Y2KA 4WZ5C 4YWZA 1PI5A 2EX6A 1HVBA 2QYBA 4U0XA 1W8QA 4II7A 3NBLA 5FQ9A 2M7VA 3LIEA 1FQGA 4X69A 2PYRA 2V20A 3LI8A 2RL3A 1W63M 3TE8A 1ACFA 1VETA 4G3WA 5L07A 4NXBA 5F69A 4D2OA 5EVLA 2QZ6A 1T1AA 1JWVA 1LL5A 3BEBA 4QU3A 3IWOA 1H8ZA 2W1TB 1CEGA 3WS1A 3MQQA 4P6ZM 5HL6A 3VP4A 4X1MA 1U60A 2H0TA 2Q0OA 3V50A 5A91A 3VE4A 5L09A 2OLUA 1PW1A 3IXBA 3CPTB 4E3LA 4BMWA 2VK3A 3IHAA 3N7WA 2Y2IA 4MCWA 3NOTC 2VKSA 3M6BA 1TS6A 1KDSA 2J80A 4C75A 3N8LA 1RGZA 2VA0A 3WRTA 2EWWA 1BTLA 4RQ9A 2XROA 2ZL1A 1LT0A 4WZ4A 1BULA 1DJAA 1OTEA 1JWPA 1VB6A 2GJ3A 4EETB 4OQHA 3UPNA 2MJ6A 4A5RA 4GS9B 4CLCD 1PNEA 2OLVA 2B18A 3F1NA 5CECA 4G3VA 4NEED 3PTEA 4S2JA 4S2OA 4P0MA 1Z6FA 4WMCA 4HP9A 4K0XA 3B42A 2ZQ7A 3KYQA 5GHZA 2WKRA 1PFLA 1I2SA 1FILA 4S2KA 3W4QA 1I5QA 1PW8A 3D3OA 1XFQA 4P6BA 3VV4A 5AQ9A 4KQRA 3ZFZA 4N9LA 3CI6A 4IEDA 1YLTA 1H5XA 1K0KA 5FI6A 1XJ6A 5DJUA 1L0EA 1STZA 2VLGA 3RTYA 3MZEA 3GR2A 4P85A 4BENA 4Y3IA 1BUEA 3E4PA 3E2LA 4F94A 3UE6A 1QMFA 4JLFA 4Z1WA 3T12B 1XA7A 3T1SA 5G4ZA 4P6ZS 4HHDA 1MXOA 4MMNA 5FQKA 2WK0A 4EUVA 2Z6CA 4FOFA 1SKFA 2JKRM 5DFXA 5GHYA 2A24B 2P08A 3UE1A 4WELA 1NJ4A 3C38A 2BTFP 4S2LA 3ZVTA 3BFEA 4DE1A 2V8FA 3GTCA 1N9OA 4N1XA 5L10A 1ESIA 1CJFA 1GA9A 5CGWA 1YMXA 3QP8A 4HESA 3G31A 2O9CA 5E2FA 3B33A 3UDIA 4RX3A 1SCWA 3HUMA 2ZD8A 1W8YA 3IS2A 1MKIA 1GSWA 5FAQA 1S66L 3LEQA 1FCMA 3UY6A 1LI0A 2QJ5A 4BL2A 1SZVA 2W3HA 3BFGA 4JGQA 3PR6A 1E3UD 4I3IA 4NG2A 2G7UA 1PI4A 4MN5A 1ONGA 3VSKA 1WE4A 4S2NA 1X0OA 3F1OA 2H10A 1ZC2A 2HGVA 4BWIA 1K57A 3IX3A 3LYXA 3NDGA 1K6SA 5GLBA 1P9WA 1K54C 2XQZA 1KGFA 3BYDA 3FKVA 2DNSA 2L4RA 3CG5A 1YLPA 4Y7PA 4OPYA 3SS3A 3L9KA 3ZNYA 4FSFA 4H6JB 4WBGA 5CX7A 2GDNA 1G68A 1F98A 4X1LA 3B3XA 2PAVP 4C6YA 3BQAA 3A3FA 5EM0A 4CLCA 1FIKA 3OLOA 2OWJA 3BY8A 2V1ZA 1TDLA 2ZBBA 2KLIA 4LV1A 4R38A 1LL8A 4CJNA 1MWSA 4Y17A 5EVIC 4K08A 2Y79A 4LPZA 5HPFA 2UV0E 2ZMVA 3S7PA 4MBHA 1YLJA 2WKEA 1MY8A 4UQIS 2P74A 3U2AA 4ZJ2A 4KG6A 2WGIA 4HH3A 1ZHHB 1EWZA 2XA7S 3FPVA 2O9AA 4QPRA 3IX4A 1Z09A 3EEAA 3UO9A 5F1GA 4XUZA 5HDSA 4R4SA 3O3VA 5GHXA 2XF3A 3BQ8A 3HLFA 3GQZA 3DBAA 1NYYA 2C6WB 4IBRA 3T50A 3UN7A 4JXSA 1N9BA 3T4LA 3W4PA 3ULFA 2EX9A 2PT7A 4EERA 2VGJA 1HTZA 3LR5A 3UPPA 5F82A 1SDNA 1EROA 4GJ4A 2C5WB 2XFTA 4KZ9A 4HH2A 1XP4A 4KZBA 4O7DA 1DP9A 3ITBA 2ZL1B 4ME4A 5E2EA 1T18A 2O9BA 3AGEA 5E2GA 1IOUA 1TD5A 4Y2FA 1YAXA 2D01A 4AFIA 1F5MA 3ZG8B 3HLWA 4GN2A 4GB7A 3LY3A 4HOIA 3PBTA 5HWTA 4Q0JA 3MFDA 2A3UA 4DE2A 5FATA 5CTMA 4OLGA 2G2WA 1BLSA 3MFXA 2INWA 4NKPA 5FQQA 2P9VB 3R7WB 3ZNTA 5IS1A 4WF0A 1A0KA 1S1YA 3ISGA 5KSCA 4PKYA 3H82B 2ZQ8A 5EECA 3E4QA 4YFMA 3TG9A 1E3UA 1ERQA 5TBMA 3Q7VA 3QP5A 4E3MA 4OQIA 2Y4AA 1L0GA 1OJGA 3G4PA 2W3GA 2G2UA 2PBDP 1DP6A 4EBNA 1GHPA 4G3KA 1NWZA 5CGXA 4M4XA 2I9VA 5I94A 4PHTA 3FWLA 4LFUA 1KGEA 4Y15A 2GNXA 3EOIA 2VZWA 4FD8A 1K56D 2IWCA 3A0RA 1GSVA 1DY6A 1YLWA 3G32A 4B9OA 3CHWP 1CI8A 2Q9NA 1YPRA 2Y8HA 3ITAA 1NYMA 4LRXC 2ZOIA 5DF7A 1UWPX 3QNCA 1TS7A 4E3IA 1HD8A 4O01A 5TR7A 3GRJA 2XD1A 1MPLA 1K55C 5AJGA 2V8CA 1JTDA 3HCYA 3ZG7B 5HAQA 3KSHA 1KDWA 2HJ9C 2KOIA 2CC1A 3SH9A 2CMNA 3IF6A 3M6HA 3W4OA 2QPNA 3HLGA 4GHIA 4JF4A 3O86A 5FA7A 4QD4A 3QP4A 2VGKA 1JWZA 4GDBA 4U0TA 4R3BA 1XPBA 4WZ5A 3EGDC 4XT2A 4B93A 3SOIA 4R6LA 1M40A 3A0SA 4IJGA 5HDDA 3G34A 3MR0A 1LSWA 2FFYA 4OOYA 4UA6A 4E6XA 3MBZA 3Q07A 2BLSA 2JKRI 3BECA 5CEDA 5EOOA 3NC8A 2Y2OA 1PWCA 3F1PB 1YM1A 3WS5A 1N9NA 2FH5A 2Y55A 1DJCA 4Y5FA 3OPPA 4DF6A 4R23A 4Y0UA 3VP2A 1WYBA 1K25A 1XFNA 1PWGA 3F1OB 1YLZA 3MMHA 2WAEA 4NETA 3T4TA 4CPKA 3TOIA 4I38A 3Q82A 4EU0A 1QMEA 4I3AA 1D7EA 3S7OA 4EEUA 3PBRA 5U47A 1VM1A 4HJ6A 1ALQA 4E3OA 3PBQA 4ZTKA 1PRQA 5GLDA 3C30A 5EVIB 2B02A 2Z2LB 1OT9A 1J9MA 4KZ8A 2EX2A 3GVBA 4NXEA 2XRNA 3SS5A 2VV6A 2Y2MA 5A8BA 5FEFA 4KZ5A 1L0FA 1AXBA 3UB9A 4DJ3A 4UA7A 2ZQDA 4F3LB 3FYZA 1K4EA 1Y54A 5DJTA 3QP2A 3KSIA 5KSHA 3CMZA 3IH9A 3JVVA 1EW0A 1Q2QA 3ZG9B 2J8YA 4H8RA 4PPRA 3NIAA 3SW1A 2QKPA 2HDRA 2A49A 5JYOA 2WGWB 2XSSA 5FI2A 4PM9A 3FG8A 2ZQ9A 3KO6A 4HEFA 4KG2A 5J8XA 3LFVA 2P7JA 3MQ0A 4LLOB 4PM6A 5CEBA 3AGFA 5KMWA 4E3KA 3Q81A 4U3TA 3G2YA 3PXPA 5M18A 2J9OA 4CLCE 1YKDA 3T4KA 3T1RA 3H7WB 4ARZB 1SKOA 3ZCZA 2ZC5B 1BLHA 2HP6A 3D9YA 3S22A 5C5KA 3O87A 1BYWA 3VE3A 4B4XA 3LCEA 3EEHA 2HP5A 3CLOA 1K56A 4KUOA 2XR0A 4Y0TA 4KENB 4EBLA 5HSQA 2OAQ1 3LR0A 2OAP1 4DDSA 1ZG6A 1V9YA 5I5LA 3S4XA 3UDFA 1MZUA 4R1GA 3MXSA 2XEPA 3HBRA 2KDKA 3NJAA 4I5SA 2ZM8A 1KE0A 4KQQA 1XJ3A 4YOFA 4WL9A 1TDGA 1OTIA 2Y59A 4IVKA 3Q1FA 3VP0A 2DRWA 3VMAA 3V67A 1OT6A 1H3QA 3LUQA 4ZAMA 1VEUB 1DP8A 4X6TA 4R70A 2EX8A 5HD3A 1KVLA 3C7VA 4GD6A 4GZBA 4KUKA 3D4FA 2JE5A 4WUJA 4N1HA 5EV0A 5HPIA 2WUQA 3RXXA 1CEFA 4OH0A 4X53A 5EE8A 5DKLA 1WA9A 3DW0A 1NY0A 2B5RA 3GV9A 1ODVA 3FC7A 4P87A 4OONA 4X68A 5MC7A 1K6RA 1S1ZA 4OP5A 3CWFA 2Y2LA 3LEZA 1BT5A 1O07A 3R4KA 3VFHA 3IH8A 1LI9A 5FEGA 4HBTA 3NI9A 3WS0A 2R9WA 4NXGA 4B88A 3T4JA 5E2HA 4M3KA 3BLSA 5TFQA 2XK1A 4DE0A 4WN5A 2WGVA 5FL3A 1P9RA 3C4PA 5HX9A 4MBFA 2L0WA 1C3BA 1TF1A 4JGPA 1MBLA 1H8YA 5A93A 5HZHA 5L2FA 1IKIA 2ZQAA 5HL1A 2JKFA 2PR6A 3V5MA 4ETZA 3C2WA 2X01A 4OVDA 3PAEA 4GD8A 4C3QA 1VHMA 4HJ4A 3CJMA 4N9KA 1IFQA 1SHVA 3BJNA 4BBUA 5F1FA 4JXWA 1KE3A 2JBFA 2W1TA 1NZOA 1XXMA 3HLDA 4R4RA 1O7EA 3BFCA 3NOPC 1K57C 5EPHA 2PU4A 3BFFA 4KZ4A 1IYOA 3OOVA 1ESUA 4GOGA 1YSQA 4MN6A 1ZTUA 1FCNA 2W27A 2JN7A 4K91A 3HLBA 3E98A 5FQIA 3MXRA 3WRZA 3OCLA 4R3AA 3UMEA 3CPTA 3TJZC 3ZVWA 4OOMA 1Y4OA 2JHEA 3EQVA 1CQAA 3LIAA 1JTGA 4KZ7A 3OBFA 4OKPA 1L0DA 2JCHA 1GSXA 1TS8A 1S4SA 3EQUA 1VETB 4CLCC 4EBPA 4MNRA 3VP1A 2J7VA 3NULA 1FSWA 4EV4A 2HDSA 2WADA 2Z2MB 2W3DA 1KE4A 5F5YA 2OWHA 1ZKJA 3FPWA 2ZC4B 2D02A 4HJ3A 4HI4A 1L3LA 2QHKA 1OTAA 1W79A 3WWXA 2V1BA 2UWXA 5DKKA 1W63Q 2EA9A 4BD0A 2HJEA 3ICYA 4E3NA 3HUNA 3UE3A 4LV3A 2KX6A 5IHVA 5J4EA 3BM6A 1YSPA 5LBRA 2ZM0A 1ES3A 3RXWA 4OQ0A 1P0ZA 2JKTM 3E4OA 2PYPA 2W3FA 3KSGA 4OOLA 3PBOA 3N8SA 2VX8A 3B47A 3VOLA 5FQJA 4R3JA 4YINA 4UA9A 4DJ2A 1FSYA 4O0PA 1DRMA 5M19A 2QJ7A 5GLCA 3F1NB 3CAXA 2M1CA 3HVFA 1RP5A 2XFSA 3V39A 3V3RA 5HWWA 4ETXA 3QP1A 5CRFA 4OPZA 4S2PA 2EWVA 4MLLA 2PHYA 2ZOHA 4HIAA 3WS4A 3QP6A 4JGRA 4FUWA 4EXOA 1PIOA 2ZC3B 5FAPA 3Q7ZA 3T1QB 4DDYA 1XKZA 3ZHHA 2A24A 2OSUA 3LGOA 3NY4A 3G2ZA 5HDCA 3LIFA 1SKOB 5IU1A 2X02A 3IWQA 1NRJA 2L1MA 5AVFA 4QHCA 3ZQ5A 3W2ZA 1NXYA 4OPRA 2FZ0A 3IXDA 3UPOA 5F6AA 3SS4A 1F2KA 3VOYA 3HJIA 2W3EA 2XLNA 2ZC7A 2YKHA 2O0YA 2LB5A 1OJ5A 2HP9A 4DMZA 5HWVA 1G28A 4WMCD 3S1YA 3CUEC 4EW7A 3NECA 1YMSA 4GKUA 3QHYA 3LIBA 4UEYA 5AQBA 4ESPA 4MDZA 3A3EA 5GL9A 2V1AA 2V9AA 2H5SA 1ES2A 4EUZA 3DTIA 2VJWA 3PHYA 1N4OA 3DWZA 5CTNA 2J9PA 2O99A 1IYSA 3MKFA 4X25A 1XJ2A 5F68A 3KYEA 4QY6A 4NXFA 5HW3A 3E2KA 1E25A 3KYZA 3UB5P 3T4SA 2W1RA 2PR5A 4MEZA 4DRTA 4E04A 3IF5A 4KQDA 4LGWA 3CITA 4FH4A 2JKGA 1K38A 3O88A 5CHJA 4EQ1A 1RCJA 3G35A 3IX8A 1PZOA 2WZZA 3NHQA 2K2NA 5EUAA 3OPRA 4BQMA 3P09A 3MXQA 4PM5A 3ZDJA 1VQQA 2DCFA 2HDUA 3PYPA 1LLBA 3IS2B 3VFFA 4Y0OA 1MWRA 3IF6C 3RH8B 4Q8IA 3VOZA 3O5YA 5EVEA 4NK3A 5IT5A 2BASA 4JGOA 5KZHA 2QMIA 2EFUA 4HNBA 2WKQA 3A0VA 1ES5A 2ZLYA 4JXGA 2WKIA 2E8IA 3CZDA 3LO7A 3U4LP 1LL9A 2XH9A 1BZAA 2NUPC 5A92A 3MF0A 3LR3A 3GMWA 1P97A 2ZJ9A 3FZCA 5FAOA 3EGXC 2IWBA 2R78A 3ZG5A 3MQOA 4FTXA 1OTBA 5DTKA 4OLDA 5FI7A 2IWDA 3MJQA 5AQAA 3UB7A 2PU2A 4CLCB 1JNUA 3M2KA 3AGDA 3T4QA 1NZUA 5D3OA 4GDNA 3SH8A 2HDQA 3N8RA 4BL3A 4I39A 2AVXA 1T19A 1TVFA 4HQAA 4Q0HA 4EEPA 2J3TC 3UB8A 5CGSA 2Y91A 4HY8A 2V0WA 2H0YA 1NLYA 1S6RA 1Q2PA 5EVID 4HBUA 3IXGA 1ONHA 2HPBA 3IQAA 1TS0A 3E0YA 1UGUA 4LRZE 1HZOA 3D72A 2K7SA 3IBRA 1V9ZA 2ZM2A 4JKTA 4HP4A 4DXCA 5GLAA 1SDEA 3BFDA 4OPQA 4PKYG 3W8KA 3OPLA 3PAGA 3UB6A 1I2WA 3BW6A 4QWOA 5FSRA 2J3WA 4JXVA 5CERA 3UDXA 3LR4A 3ZG0A 2YKFA 4RX2A 4D60A 4KG5A 3A3IA 4EWFA 4BBTA 2P9VA 2FFFB 2V2FF 3R7WA 2B95A 4BBVA 4BD1A 1NLZA 5AQ7A 3MZFA 3HUOA 3H82A 1PZPA 3GECA 4ZJ1A 1S67L 2VGLM 2Y2PA 3SZTA 2A2LA 2VV8A 4DE3A 3G30A 1OPXA 1W7FA 5EM1A 1MWTA 1F9IA 1AWIA 2ZC6B 4KZ3A 2XGNA 4EQIA 4IBXA 4ID4A 1OMEA 3PBSA 3DTEA 4WM9A 5FASA 1CK3A 3HREA 1S4RA 3ZGAB 3FKWA 2PRFA 4UHUA 5HFOA 1YT4A 4ZBEA 3V3SA 1GA0A 3OC2A 3NOUC 3MS6A 3T4OA 4WLAA 2I72A 2JKTI 2VEAA 3JYIA 4L9EA 3IT9A 1ES4A 3PBNA 5TBMB 3TSGA 3Q7VB 4UQIM 4L9FA 1H0MA 4EESA 2E8JA 2JC7A 1RGYA 3C5AA 3HLEA 2XA7M 4RA7A 3GSGA 3LY4A 2DMWA 2EFXA 4GLQA 1IEMA 3NDEA 3DTKA 4IHQA 2WZXA 4GCZA 1EI5A 3TRCA 1FR1A 1LSVA 5DVAA 5M1AA 5DTTA 1IYQA 3BLMA 3BY9A 4LCLA 4DXBA 4LCMA 5FQMA 1H8MA 2OV5A 3UE0A 2BG1A 4IUHA 1K54A 2LB9A 1IKGA 2HF6A 3A3JA 3OCNA 4N92A 3F1PA 2Y2JA 4LV0A 1XX2A 2QWSA 3IXHA 4O8GA 1BLPA 5K5BA 1E4DA 4LENA 4S2NC 1ERMA 4JPMA 3IF6B 3RJUA 3IWIA 2PD7A 2P04A 4GHIB 4ZRRA 1BSGA 2ZMAA 1JVJA 2ACGA 3FV7A 4DKIA 2VGLS 3SH7A 4OP8A 2OOLA 4XT2B 1OTDA 5BOHA 4Y13A 4X55A 3M2JA 2EXAA 1Y28A 2HZ5A 4QB8A 1PYYA 1MKMA 5JYPA 5HAIA 3LIDA 5EVIA 2H28A 4L9GA 5EOEA 2W0NA 3EWKA 2IA2A 1MC0A 2GZAA 4GNUA 3C8CA 1FR6A 3BRMA 2GX5A 3N6IA 1GCEA 4FH2A 2XDMA 5DF8A 1XJ4A 5FDSA 3DAVA 3JPUA 4F3LA 4XXRA 3A3DA 3I7JA 2K31A 3MZDA 1M6KA 4GW9A 3LI9A 1T1CA 2R9XA 1NRFA 5A90A 4E6WA 4QJGA 3G6OA 1LHYA 1MWUA 1HLUP 4RYEA 5FDHA 4IUKA 3S7QA 3TW8A 4GS9A 2HV1A 1G5UA 4ZDXA 1S0WA 4CQHA 4S2MA 2WGWA 5CHUA 3H9WA 5HARA 4WEKA 2PDRA 1CI9A 2RCXA 3C7UA 3K3DA 4PMAA 1FCOA 1W5DA 4LV2A 1CF0A 3KX0X 2WAFA 2WKHA 2ZQCA 1XA1A 1YLYA 1XGIA 4R0QA 3H7WA 4ARZA 3P01A 4DN0A 4PAUA 2Q9MA 3P98A 1YQSA 4S2IA 3K3CA 5DFYA 2Y2HA 1XGJA 4YNRA 3JVUA 4FCFA 4I3JA 2Y2QA 3OPHA 3QNBA 2Y2NA 4JBFA 2VV7A 2EXBA 3RFBA 4PM8A 2J3TD 1LSXA 4X56A 2Y2GA 3IHBA 4WEJA 2X71A 3DWKA 1VEUA 4B4ZA 5EFWA 3WS2A 2Z6DA 1KOUA 5F83A 5DF9A 3HLCA 4QY5A 1L2SA 3LICA 3VP3A 2WKPA 4KQOA 4K0WA 1N9LA 5L8MA 4UAAA 5TJJA 1GHMA 5HD5A 3CUEA 3MKEA 3GDIA 1PWDA 2PBYA 2WYXA 4MN7A 3IBJA 1BLCA 4XUXA 3KSFA 1D06A 4MBKA 3NCKA 3T1XA 4L0LA 1G6AA 3UMDA 4ZJ3A 4IVIA 1G6OA 4RVAA 4KZ6A 4BJPA 4PM7A
chains in the Genus database with same CATH topology
1SZVA 1Y4OA 1CQAA 1Z09A 2ACGA 4X1MA 1K0KA 4FUWA 5FEGA 2PRFA 1VETB 3T1QB 3NULA 2HZ5A 3LGOA 3T1RA 2PBDP 3CPTB 1SKOA 1SKOB 3MS6A 2VK3A 3D9YA 3T12B 5EVEA 1D1JA 3T1SA 2E8JA 1F2KA 5FDSA 3DAVA 2JKFA 3L9KA 3CHWP 1PRQA 1VEUA 2ZL1A 2ZL1B 3MSHA 1YPRA 3NECA 4QWOA 2BTFP 4ESPA 4X1LA 2PAVP 3U4LP 3L7HA 1HLUP 1J3WA 4D60A 5EM0A 5FEFA 1FIKA 2V8FA 2V8CA 1PNEA 1G5UA 2B95A 1CJFA 4X25A 3KYEA 1VEUB 4FTXA 3UB5P 5EV0A 1CF0A 1ACFA 1VETA 1PFLA 5EM1A 2JKGA 1FILA 3T1XA 1AWIA 1A0KA 3LEQA 3CPTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SZV A;  1Y4O A;  1CQA A;  1Z09 A;  2ACG A;  4X1M A;  1K0K A;  4FUW A;  5FEG A;  2PRF A;  1VET B;  3T1Q B;  3NUL A;  2HZ5 A;  3LGO A;  3T1R A;  2PBD P;  3CPT B;  1SKO A;  1SKO B;  3MS6 A;  2VK3 A;  3D9Y A;  3T12 B;  5EVE A;  1D1J A;  3T1S A;  2E8J A;  1F2K A;  5FDS A;  3DAV A;  2JKF A;  3L9K A;  3CHW P;  1PRQ A;  1VEU A;  2ZL1 A;  2ZL1 B;  3MSH A;  1YPR A;  3NEC A;  4QWO A;  2BTF P;  4ESP A;  4X1L A;  2PAV P;  3U4L P;  3L7H A;  1HLU P;  1J3W A;  4D60 A;  5EM0 A;  5FEF A;  1FIK A;  2V8F A;  2V8C A;  1PNE A;  1G5U A;  2B95 A;  1CJF A;  4X25 A;  3KYE A;  1VEU B;  4FTX A;  3UB5 P;  5EV0 A;  1CF0 A;  1ACF A;  1VET A;  1PFL A;  5EM1 A;  2JKG A;  1FIL A;  3T1X A;  1AWI A;  1A0K A;  3LEQ A;  3CPT A; 
#chains in the Genus database with same CATH topology
 4OQG A;  3S7N A;  1TEM A;  3C4O A;  5CXW A;  5J3W A;  1IYP A;  1K55 A;  5G18 A;  5KIZ A;  1T1B A;  3P7N A;  3DTM A;  5AVE A;  1UWN X;  3N4I A;  4JF6 A;  2XD5 A;  1DJB A;  5DTS A;  2PD8 A;  3HJK A;  3HL9 A;  4KZA A;  1IEL A;  1WYC A;  4JF5 A;  5J7E A;  4BLM A;  4Q0I A;  2NUT C;  1ZG4 A;  1D1J A;  3OZH A;  3K2N A;  3ZYT A;  5CHM A;  5E43 A;  4WYY A;  4Z9Q A;  5G4Y A;  1KGG A;  1GHI A;  4LRY C;  1FOF A;  3BWL A;  4H6J A;  3MSH A;  2M7U A;  5TGF A;  4E3J A;  1K4F A;  3VSL A;  3L7H A;  2ZMF A;  1KVM A;  5HAP A;  2V0U A;  3UNW A;  1J3W A;  2Y2K A;  4WZ5 C;  4YWZ A;  1PI5 A;  2EX6 A;  1HVB A;  2QYB A;  4U0X A;  1W8Q A;  4II7 A;  3NBL A;  5FQ9 A;  2M7V A;  3LIE A;  1FQG A;  4X69 A;  2PYR A;  2V20 A;  3LI8 A;  2RL3 A;  1W63 M;  3TE8 A;  1ACF A;  1VET A;  4G3W A;  5L07 A;  4NXB A;  5F69 A;  4D2O A;  5EVL A;  2QZ6 A;  1T1A A;  1JWV A;  1LL5 A;  3BEB A;  4QU3 A;  3IWO A;  1H8Z A;  2W1T B;  1CEG A;  3WS1 A;  3MQQ A;  4P6Z M;  5HL6 A;  3VP4 A;  4X1M A;  1U60 A;  2H0T A;  2Q0O A;  3V50 A;  5A91 A;  3VE4 A;  5L09 A;  2OLU A;  1PW1 A;  3IXB A;  3CPT B;  4E3L A;  4BMW A;  2VK3 A;  3IHA A;  3N7W A;  2Y2I A;  4MCW A;  3NOT C;  2VKS A;  3M6B A;  1TS6 A;  1KDS A;  2J80 A;  4C75 A;  3N8L A;  1RGZ A;  2VA0 A;  3WRT A;  2EWW A;  1BTL A;  4RQ9 A;  2XRO A;  2ZL1 A;  1LT0 A;  4WZ4 A;  1BUL A;  1DJA A;  1OTE A;  1JWP A;  1VB6 A;  2GJ3 A;  4EET B;  4OQH A;  3UPN A;  2MJ6 A;  4A5R A;  4GS9 B;  4CLC D;  1PNE A;  2OLV A;  2B18 A;  3F1N A;  5CEC A;  4G3V A;  4NEE D;  3PTE A;  4S2J A;  4S2O A;  4P0M A;  1Z6F A;  4WMC A;  4HP9 A;  4K0X A;  3B42 A;  2ZQ7 A;  3KYQ A;  5GHZ A;  2WKR A;  1PFL A;  1I2S A;  1FIL A;  4S2K A;  3W4Q A;  1I5Q A;  1PW8 A;  3D3O A;  1XFQ A;  4P6B A;  3VV4 A;  5AQ9 A;  4KQR A;  3ZFZ A;  4N9L A;  3CI6 A;  4IED A;  1YLT A;  1H5X A;  1K0K A;  5FI6 A;  1XJ6 A;  5DJU A;  1L0E A;  1STZ A;  2VLG A;  3RTY A;  3MZE A;  3GR2 A;  4P85 A;  4BEN A;  4Y3I A;  1BUE A;  3E4P A;  3E2L A;  4F94 A;  3UE6 A;  1QMF A;  4JLF A;  4Z1W A;  3T12 B;  1XA7 A;  3T1S A;  5G4Z A;  4P6Z S;  4HHD A;  1MXO A;  4MMN A;  5FQK A;  2WK0 A;  4EUV A;  2Z6C A;  4FOF A;  1SKF A;  2JKR M;  5DFX A;  5GHY A;  2A24 B;  2P08 A;  3UE1 A;  4WEL A;  1NJ4 A;  3C38 A;  2BTF P;  4S2L A;  3ZVT A;  3BFE A;  4DE1 A;  2V8F A;  3GTC A;  1N9O A;  4N1X A;  5L10 A;  1ESI A;  1CJF A;  1GA9 A;  5CGW A;  1YMX A;  3QP8 A;  4HES A;  3G31 A;  2O9C A;  5E2F A;  3B33 A;  3UDI A;  4RX3 A;  1SCW A;  3HUM A;  2ZD8 A;  1W8Y A;  3IS2 A;  1MKI A;  1GSW A;  5FAQ A;  1S66 L;  3LEQ A;  1FCM A;  3UY6 A;  1LI0 A;  2QJ5 A;  4BL2 A;  1SZV A;  2W3H A;  3BFG A;  4JGQ A;  3PR6 A;  1E3U D;  4I3I A;  4NG2 A;  2G7U A;  1PI4 A;  4MN5 A;  1ONG A;  3VSK A;  1WE4 A;  4S2N A;  1X0O A;  3F1O A;  2H10 A;  1ZC2 A;  2HGV A;  4BWI A;  1K57 A;  3IX3 A;  3LYX A;  3NDG A;  1K6S A;  5GLB A;  1P9W A;  1K54 C;  2XQZ A;  1KGF A;  3BYD A;  3FKV A;  2DNS A;  2L4R A;  3CG5 A;  1YLP A;  4Y7P A;  4OPY A;  3SS3 A;  3L9K A;  3ZNY A;  4FSF A;  4H6J B;  4WBG A;  5CX7 A;  2GDN A;  1G68 A;  1F98 A;  4X1L A;  3B3X A;  2PAV P;  4C6Y A;  3BQA A;  3A3F A;  5EM0 A;  4CLC A;  1FIK A;  3OLO A;  2OWJ A;  3BY8 A;  2V1Z A;  1TDL A;  2ZBB A;  2KLI A;  4LV1 A;  4R38 A;  1LL8 A;  4CJN A;  1MWS A;  4Y17 A;  5EVI C;  4K08 A;  2Y79 A;  4LPZ A;  5HPF A;  2UV0 E;  2ZMV A;  3S7P A;  4MBH A;  1YLJ A;  2WKE A;  1MY8 A;  4UQI S;  2P74 A;  3U2A A;  4ZJ2 A;  4KG6 A;  2WGI A;  4HH3 A;  1ZHH B;  1EWZ A;  2XA7 S;  3FPV A;  2O9A A;  4QPR A;  3IX4 A;  1Z09 A;  3EEA A;  3UO9 A;  5F1G A;  4XUZ A;  5HDS A;  4R4S A;  3O3V A;  5GHX A;  2XF3 A;  3BQ8 A;  3HLF A;  3GQZ A;  3DBA A;  1NYY A;  2C6W B;  4IBR A;  3T50 A;  3UN7 A;  4JXS A;  1N9B A;  3T4L A;  3W4P A;  3ULF A;  2EX9 A;  2PT7 A;  4EER A;  2VGJ A;  1HTZ A;  3LR5 A;  3UPP A;  5F82 A;  1SDN A;  1ERO A;  4GJ4 A;  2C5W B;  2XFT A;  4KZ9 A;  4HH2 A;  1XP4 A;  4KZB A;  4O7D A;  1DP9 A;  3ITB A;  2ZL1 B;  4ME4 A;  5E2E A;  1T18 A;  2O9B A;  3AGE A;  5E2G A;  1IOU A;  1TD5 A;  4Y2F A;  1YAX A;  2D01 A;  4AFI A;  1F5M A;  3ZG8 B;  3HLW A;  4GN2 A;  4GB7 A;  3LY3 A;  4HOI A;  3PBT A;  5HWT A;  4Q0J A;  3MFD A;  2A3U A;  4DE2 A;  5FAT A;  5CTM A;  4OLG A;  2G2W A;  1BLS A;  3MFX A;  2INW A;  4NKP A;  5FQQ A;  2P9V B;  3R7W B;  3ZNT A;  5IS1 A;  4WF0 A;  1A0K A;  1S1Y A;  3ISG A;  5KSC A;  4PKY A;  3H82 B;  2ZQ8 A;  5EEC A;  3E4Q A;  4YFM A;  3TG9 A;  1E3U A;  1ERQ A;  5TBM A;  3Q7V A;  3QP5 A;  4E3M A;  4OQI A;  2Y4A A;  1L0G A;  1OJG A;  3G4P A;  2W3G A;  2G2U A;  2PBD P;  1DP6 A;  4EBN A;  1GHP A;  4G3K A;  1NWZ A;  5CGX A;  4M4X A;  2I9V A;  5I94 A;  4PHT A;  3FWL A;  4LFU A;  1KGE A;  4Y15 A;  2GNX A;  3EOI A;  2VZW A;  4FD8 A;  1K56 D;  2IWC A;  3A0R A;  1GSV A;  1DY6 A;  1YLW A;  3G32 A;  4B9O A;  3CHW P;  1CI8 A;  2Q9N A;  1YPR A;  2Y8H A;  3ITA A;  1NYM A;  4LRX C;  2ZOI A;  5DF7 A;  1UWP X;  3QNC A;  1TS7 A;  4E3I A;  1HD8 A;  4O01 A;  5TR7 A;  3GRJ A;  2XD1 A;  1MPL A;  1K55 C;  5AJG A;  2V8C A;  1JTD A;  3HCY A;  3ZG7 B;  5HAQ A;  3KSH A;  1KDW A;  2HJ9 C;  2KOI A;  2CC1 A;  3SH9 A;  2CMN A;  3IF6 A;  3M6H A;  3W4O A;  2QPN A;  3HLG A;  4GHI A;  4JF4 A;  3O86 A;  5FA7 A;  4QD4 A;  3QP4 A;  2VGK A;  1JWZ A;  4GDB A;  4U0T A;  4R3B A;  1XPB A;  4WZ5 A;  3EGD C;  4XT2 A;  4B93 A;  3SOI A;  4R6L A;  1M40 A;  3A0S A;  4IJG A;  5HDD A;  3G34 A;  3MR0 A;  1LSW A;  2FFY A;  4OOY A;  4UA6 A;  4E6X A;  3MBZ A;  3Q07 A;  2BLS A;  2JKR I;  3BEC A;  5CED A;  5EOO A;  3NC8 A;  2Y2O A;  1PWC A;  3F1P B;  1YM1 A;  3WS5 A;  1N9N A;  2FH5 A;  2Y55 A;  1DJC A;  4Y5F A;  3OPP A;  4DF6 A;  4R23 A;  4Y0U A;  3VP2 A;  1WYB A;  1K25 A;  1XFN A;  1PWG A;  3F1O B;  1YLZ A;  3MMH A;  2WAE A;  4NET A;  3T4T A;  4CPK A;  3TOI A;  4I38 A;  3Q82 A;  4EU0 A;  1QME A;  4I3A A;  1D7E A;  3S7O A;  4EEU A;  3PBR A;  5U47 A;  1VM1 A;  4HJ6 A;  1ALQ A;  4E3O A;  3PBQ A;  4ZTK A;  1PRQ A;  5GLD A;  3C30 A;  5EVI B;  2B02 A;  2Z2L B;  1OT9 A;  1J9M A;  4KZ8 A;  2EX2 A;  3GVB A;  4NXE A;  2XRN A;  3SS5 A;  2VV6 A;  2Y2M A;  5A8B A;  5FEF A;  4KZ5 A;  1L0F A;  1AXB A;  3UB9 A;  4DJ3 A;  4UA7 A;  2ZQD A;  4F3L B;  3FYZ A;  1K4E A;  1Y54 A;  5DJT A;  3QP2 A;  3KSI A;  5KSH A;  3CMZ A;  3IH9 A;  3JVV A;  1EW0 A;  1Q2Q A;  3ZG9 B;  2J8Y A;  4H8R A;  4PPR A;  3NIA A;  3SW1 A;  2QKP A;  2HDR A;  2A49 A;  5JYO A;  2WGW B;  2XSS A;  5FI2 A;  4PM9 A;  3FG8 A;  2ZQ9 A;  3KO6 A;  4HEF A;  4KG2 A;  5J8X A;  3LFV A;  2P7J A;  3MQ0 A;  4LLO B;  4PM6 A;  5CEB A;  3AGF A;  5KMW A;  4E3K A;  3Q81 A;  4U3T A;  3G2Y A;  3PXP A;  5M18 A;  2J9O A;  4CLC E;  1YKD A;  3T4K A;  3T1R A;  3H7W B;  4ARZ B;  1SKO A;  3ZCZ A;  2ZC5 B;  1BLH A;  2HP6 A;  3D9Y A;  3S22 A;  5C5K A;  3O87 A;  1BYW A;  3VE3 A;  4B4X A;  3LCE A;  3EEH A;  2HP5 A;  3CLO A;  1K56 A;  4KUO A;  2XR0 A;  4Y0T A;  4KEN B;  4EBL A;  5HSQ A;  2OAQ 1;  3LR0 A;  2OAP 1;  4DDS A;  1ZG6 A;  1V9Y A;  5I5L A;  3S4X A;  3UDF A;  1MZU A;  4R1G A;  3MXS A;  2XEP A;  3HBR A;  2KDK A;  3NJA A;  4I5S A;  2ZM8 A;  1KE0 A;  4KQQ A;  1XJ3 A;  4YOF A;  4WL9 A;  1TDG A;  1OTI A;  2Y59 A;  4IVK A;  3Q1F A;  3VP0 A;  2DRW A;  3VMA A;  3V67 A;  1OT6 A;  1H3Q A;  3LUQ A;  4ZAM A;  1VEU B;  1DP8 A;  4X6T A;  4R70 A;  2EX8 A;  5HD3 A;  1KVL A;  3C7V A;  4GD6 A;  4GZB A;  4KUK A;  3D4F A;  2JE5 A;  4WUJ A;  4N1H A;  5EV0 A;  5HPI A;  2WUQ A;  3RXX A;  1CEF A;  4OH0 A;  4X53 A;  5EE8 A;  5DKL A;  1WA9 A;  3DW0 A;  1NY0 A;  2B5R A;  3GV9 A;  1ODV A;  3FC7 A;  4P87 A;  4OON A;  4X68 A;  5MC7 A;  1K6R A;  1S1Z A;  4OP5 A;  3CWF A;  2Y2L A;  3LEZ A;  1BT5 A;  1O07 A;  3R4K A;  3VFH A;  3IH8 A;  1LI9 A;  5FEG A;  4HBT A;  3NI9 A;  3WS0 A;  2R9W A;  4NXG A;  4B88 A;  3T4J A;  5E2H A;  4M3K A;  3BLS A;  5TFQ A;  2XK1 A;  4DE0 A;  4WN5 A;  2WGV A;  5FL3 A;  1P9R A;  3C4P A;  5HX9 A;  4MBF A;  2L0W A;  1C3B A;  1TF1 A;  4JGP A;  1MBL A;  1H8Y A;  5A93 A;  5HZH A;  5L2F A;  1IKI A;  2ZQA A;  5HL1 A;  2JKF A;  2PR6 A;  3V5M A;  4ETZ A;  3C2W A;  2X01 A;  4OVD A;  3PAE A;  4GD8 A;  4C3Q A;  1VHM A;  4HJ4 A;  3CJM A;  4N9K A;  1IFQ A;  1SHV A;  3BJN A;  4BBU A;  5F1F A;  4JXW A;  1KE3 A;  2JBF A;  2W1T A;  1NZO A;  1XXM A;  3HLD A;  4R4R A;  1O7E A;  3BFC A;  3NOP C;  1K57 C;  5EPH A;  2PU4 A;  3BFF A;  4KZ4 A;  1IYO A;  3OOV A;  1ESU A;  4GOG A;  1YSQ A;  4MN6 A;  1ZTU A;  1FCN A;  2W27 A;  2JN7 A;  4K91 A;  3HLB A;  3E98 A;  5FQI A;  3MXR A;  3WRZ A;  3OCL A;  4R3A A;  3UME A;  3CPT A;  3TJZ C;  3ZVW A;  4OOM A;  1Y4O A;  2JHE A;  3EQV A;  1CQA A;  3LIA A;  1JTG A;  4KZ7 A;  3OBF A;  4OKP A;  1L0D A;  2JCH A;  1GSX A;  1TS8 A;  1S4S A;  3EQU A;  1VET B;  4CLC C;  4EBP A;  4MNR A;  3VP1 A;  2J7V A;  3NUL A;  1FSW A;  4EV4 A;  2HDS A;  2WAD A;  2Z2M B;  2W3D A;  1KE4 A;  5F5Y A;  2OWH A;  1ZKJ A;  3FPW A;  2ZC4 B;  2D02 A;  4HJ3 A;  4HI4 A;  1L3L A;  2QHK A;  1OTA A;  1W79 A;  3WWX A;  2V1B A;  2UWX A;  5DKK A;  1W63 Q;  2EA9 A;  4BD0 A;  2HJE A;  3ICY A;  4E3N A;  3HUN A;  3UE3 A;  4LV3 A;  2KX6 A;  5IHV A;  5J4E A;  3BM6 A;  1YSP A;  5LBR A;  2ZM0 A;  1ES3 A;  3RXW A;  4OQ0 A;  1P0Z A;  2JKT M;  3E4O A;  2PYP A;  2W3F A;  3KSG A;  4OOL A;  3PBO A;  3N8S A;  2VX8 A;  3B47 A;  3VOL A;  5FQJ A;  4R3J A;  4YIN A;  4UA9 A;  4DJ2 A;  1FSY A;  4O0P A;  1DRM A;  5M19 A;  2QJ7 A;  5GLC A;  3F1N B;  3CAX A;  2M1C A;  3HVF A;  1RP5 A;  2XFS A;  3V39 A;  3V3R A;  5HWW A;  4ETX A;  3QP1 A;  5CRF A;  4OPZ A;  4S2P A;  2EWV A;  4MLL A;  2PHY A;  2ZOH A;  4HIA A;  3WS4 A;  3QP6 A;  4JGR A;  4FUW A;  4EXO A;  1PIO A;  2ZC3 B;  5FAP A;  3Q7Z A;  3T1Q B;  4DDY A;  1XKZ A;  3ZHH A;  2A24 A;  2OSU A;  3LGO A;  3NY4 A;  3G2Z A;  5HDC A;  3LIF A;  1SKO B;  5IU1 A;  2X02 A;  3IWQ A;  1NRJ A;  2L1M A;  5AVF A;  4QHC A;  3ZQ5 A;  3W2Z A;  1NXY A;  4OPR A;  2FZ0 A;  3IXD A;  3UPO A;  5F6A A;  3SS4 A;  1F2K A;  3VOY A;  3HJI A;  2W3E A;  2XLN A;  2ZC7 A;  2YKH A;  2O0Y A;  2LB5 A;  1OJ5 A;  2HP9 A;  4DMZ A;  5HWV A;  1G28 A;  4WMC D;  3S1Y A;  3CUE C;  4EW7 A;  3NEC A;  1YMS A;  4GKU A;  3QHY A;  3LIB A;  4UEY A;  5AQB A;  4ESP A;  4MDZ A;  3A3E A;  5GL9 A;  2V1A A;  2V9A A;  2H5S A;  1ES2 A;  4EUZ A;  3DTI A;  2VJW A;  3PHY A;  1N4O A;  3DWZ A;  5CTN A;  2J9P A;  2O99 A;  1IYS A;  3MKF A;  4X25 A;  1XJ2 A;  5F68 A;  3KYE A;  4QY6 A;  4NXF A;  5HW3 A;  3E2K A;  1E25 A;  3KYZ A;  3UB5 P;  3T4S A;  2W1R A;  2PR5 A;  4MEZ A;  4DRT A;  4E04 A;  3IF5 A;  4KQD A;  4LGW A;  3CIT A;  4FH4 A;  2JKG A;  1K38 A;  3O88 A;  5CHJ A;  4EQ1 A;  1RCJ A;  3G35 A;  3IX8 A;  1PZO A;  2WZZ A;  3NHQ A;  2K2N A;  5EUA A;  3OPR A;  4BQM A;  3P09 A;  3MXQ A;  4PM5 A;  3ZDJ A;  1VQQ A;  2DCF A;  2HDU A;  3PYP A;  1LLB A;  3IS2 B;  3VFF A;  4Y0O A;  1MWR A;  3IF6 C;  3RH8 B;  4Q8I A;  3VOZ A;  3O5Y A;  5EVE A;  4NK3 A;  5IT5 A;  2BAS A;  4JGO A;  5KZH A;  2QMI A;  2EFU A;  4HNB A;  2WKQ A;  3A0V A;  1ES5 A;  2ZLY A;  4JXG A;  2WKI A;  2E8I A;  3CZD A;  3LO7 A;  3U4L P;  1LL9 A;  2XH9 A;  1BZA A;  2NUP C;  5A92 A;  3MF0 A;  3LR3 A;  3GMW A;  1P97 A;  2ZJ9 A;  3FZC A;  5FAO A;  3EGX C;  2IWB A;  2R78 A;  3ZG5 A;  3MQO A;  4FTX A;  1OTB A;  5DTK A;  4OLD A;  5FI7 A;  2IWD A;  3MJQ A;  5AQA A;  3UB7 A;  2PU2 A;  4CLC B;  1JNU A;  3M2K A;  3AGD A;  3T4Q A;  1NZU A;  5D3O A;  4GDN A;  3SH8 A;  2HDQ A;  3N8R A;  4BL3 A;  4I39 A;  2AVX A;  1T19 A;  1TVF A;  4HQA A;  4Q0H A;  4EEP A;  2J3T C;  3UB8 A;  5CGS A;  2Y91 A;  4HY8 A;  2V0W A;  2H0Y A;  1NLY A;  1S6R A;  1Q2P A;  5EVI D;  4HBU A;  3IXG A;  1ONH A;  2HPB A;  3IQA A;  1TS0 A;  3E0Y A;  1UGU A;  4LRZ E;  1HZO A;  3D72 A;  2K7S A;  3IBR A;  1V9Z A;  2ZM2 A;  4JKT A;  4HP4 A;  4DXC A;  5GLA A;  1SDE A;  3BFD A;  4OPQ A;  4PKY G;  3W8K A;  3OPL A;  3PAG A;  3UB6 A;  1I2W A;  3BW6 A;  4QWO A;  5FSR A;  2J3W A;  4JXV A;  5CER A;  3UDX A;  3LR4 A;  3ZG0 A;  2YKF A;  4RX2 A;  4D60 A;  4KG5 A;  3A3I A;  4EWF A;  4BBT A;  2P9V A;  2FFF B;  2V2F F;  3R7W A;  2B95 A;  4BBV A;  4BD1 A;  1NLZ A;  5AQ7 A;  3MZF A;  3HUO A;  3H82 A;  1PZP A;  3GEC A;  4ZJ1 A;  1S67 L;  2VGL M;  2Y2P A;  3SZT A;  2A2L A;  2VV8 A;  4DE3 A;  3G30 A;  1OPX A;  1W7F A;  5EM1 A;  1MWT A;  1F9I A;  1AWI A;  2ZC6 B;  4KZ3 A;  2XGN A;  4EQI A;  4IBX A;  4ID4 A;  1OME A;  3PBS A;  3DTE A;  4WM9 A;  5FAS A;  1CK3 A;  3HRE A;  1S4R A;  3ZGA B;  3FKW A;  2PRF A;  4UHU A;  5HFO A;  1YT4 A;  4ZBE A;  3V3S A;  1GA0 A;  3OC2 A;  3NOU C;  3MS6 A;  3T4O A;  4WLA A;  2I72 A;  2JKT I;  2VEA A;  3JYI A;  4L9E A;  3IT9 A;  1ES4 A;  3PBN A;  5TBM B;  3TSG A;  3Q7V B;  4UQI M;  4L9F A;  1H0M A;  4EES A;  2E8J A;  2JC7 A;  1RGY A;  3C5A A;  3HLE A;  2XA7 M;  4RA7 A;  3GSG A;  3LY4 A;  2DMW A;  2EFX A;  4GLQ A;  1IEM A;  3NDE A;  3DTK A;  4IHQ A;  2WZX A;  4GCZ A;  1EI5 A;  3TRC A;  1FR1 A;  1LSV A;  5DVA A;  5M1A A;  5DTT A;  1IYQ A;  3BLM A;  3BY9 A;  4LCL A;  4DXB A;  4LCM A;  5FQM A;  1H8M A;  2OV5 A;  3UE0 A;  2BG1 A;  4IUH A;  1K54 A;  2LB9 A;  1IKG A;  2HF6 A;  3A3J A;  3OCN A;  4N92 A;  3F1P A;  2Y2J A;  4LV0 A;  1XX2 A;  2QWS A;  3IXH A;  4O8G A;  1BLP A;  5K5B A;  1E4D A;  4LEN A;  4S2N C;  1ERM A;  4JPM A;  3IF6 B;  3RJU A;  3IWI A;  2PD7 A;  2P04 A;  4GHI B;  4ZRR A;  1BSG A;  2ZMA A;  1JVJ A;  2ACG A;  3FV7 A;  4DKI A;  2VGL S;  3SH7 A;  4OP8 A;  2OOL A;  4XT2 B;  1OTD A;  5BOH A;  4Y13 A;  4X55 A;  3M2J A;  2EXA A;  1Y28 A;  2HZ5 A;  4QB8 A;  1PYY A;  1MKM A;  5JYP A;  5HAI A;  3LID A;  5EVI A;  2H28 A;  4L9G A;  5EOE A;  2W0N A;  3EWK A;  2IA2 A;  1MC0 A;  2GZA A;  4GNU A;  3C8C A;  1FR6 A;  3BRM A;  2GX5 A;  3N6I A;  1GCE A;  4FH2 A;  2XDM A;  5DF8 A;  1XJ4 A;  5FDS A;  3DAV A;  3JPU A;  4F3L A;  4XXR A;  3A3D A;  3I7J A;  2K31 A;  3MZD A;  1M6K A;  4GW9 A;  3LI9 A;  1T1C A;  2R9X A;  1NRF A;  5A90 A;  4E6W A;  4QJG A;  3G6O A;  1LHY A;  1MWU A;  1HLU P;  4RYE A;  5FDH A;  4IUK A;  3S7Q A;  3TW8 A;  4GS9 A;  2HV1 A;  1G5U A;  4ZDX A;  1S0W A;  4CQH A;  4S2M A;  2WGW A;  5CHU A;  3H9W A;  5HAR A;  4WEK A;  2PDR A;  1CI9 A;  2RCX A;  3C7U A;  3K3D A;  4PMA A;  1FCO A;  1W5D A;  4LV2 A;  1CF0 A;  3KX0 X;  2WAF A;  2WKH A;  2ZQC A;  1XA1 A;  1YLY A;  1XGI A;  4R0Q A;  3H7W A;  4ARZ A;  3P01 A;  4DN0 A;  4PAU A;  2Q9M A;  3P98 A;  1YQS A;  4S2I A;  3K3C A;  5DFY A;  2Y2H A;  1XGJ A;  4YNR A;  3JVU A;  4FCF A;  4I3J A;  2Y2Q A;  3OPH A;  3QNB A;  2Y2N A;  4JBF A;  2VV7 A;  2EXB A;  3RFB A;  4PM8 A;  2J3T D;  1LSX A;  4X56 A;  2Y2G A;  3IHB A;  4WEJ A;  2X71 A;  3DWK A;  1VEU A;  4B4Z A;  5EFW A;  3WS2 A;  2Z6D A;  1KOU A;  5F83 A;  5DF9 A;  3HLC A;  4QY5 A;  1L2S A;  3LIC A;  3VP3 A;  2WKP A;  4KQO A;  4K0W A;  1N9L A;  5L8M A;  4UAA A;  5TJJ A;  1GHM A;  5HD5 A;  3CUE A;  3MKE A;  3GDI A;  1PWD A;  2PBY A;  2WYX A;  4MN7 A;  3IBJ A;  1BLC A;  4XUX A;  3KSF A;  1D06 A;  4MBK A;  3NCK A;  3T1X A;  4L0L A;  1G6A A;  3UMD A;  4ZJ3 A;  4IVI A;  1G6O A;  4RVA A;  4KZ6 A;  4BJP A;  4PM7 A; 
#chains in the Genus database with same CATH homology
 1SZV A;  1Y4O A;  1CQA A;  1Z09 A;  2ACG A;  4X1M A;  1K0K A;  4FUW A;  5FEG A;  2PRF A;  1VET B;  3T1Q B;  3NUL A;  2HZ5 A;  3LGO A;  3T1R A;  2PBD P;  3CPT B;  1SKO A;  1SKO B;  3MS6 A;  2VK3 A;  3D9Y A;  3T12 B;  5EVE A;  1D1J A;  3T1S A;  2E8J A;  1F2K A;  5FDS A;  3DAV A;  2JKF A;  3L9K A;  3CHW P;  1PRQ A;  1VEU A;  2ZL1 A;  2ZL1 B;  3MSH A;  1YPR A;  3NEC A;  4QWO A;  2BTF P;  4ESP A;  4X1L A;  2PAV P;  3U4L P;  3L7H A;  1HLU P;  1J3W A;  4D60 A;  5EM0 A;  5FEF A;  1FIK A;  2V8F A;  2V8C A;  1PNE A;  1G5U A;  2B95 A;  1CJF A;  4X25 A;  3KYE A;  1VEU B;  4FTX A;  3UB5 P;  5EV0 A;  1CF0 A;  1ACF A;  1VET A;  1PFL A;  5EM1 A;  2JKG A;  1FIL A;  3T1X A;  1AWI A;  1A0K A;  3LEQ A;  3CPT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...