2BTFP

The structure of crystalline profilin-beta-actin
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
139
structure length
139
Chain Sequence
AGWNAYIDNLMADGTCQDAAIVGYKDSPSVWAAVPGKTFVNITPAEVGILVGKDRSSFFVNGLTLGGQKCSVIRDSLLQDGEFTMDLRTKSTGGAPTFNITVTMTAKTLVLLMGKEGVHGGMINKKCYEMASHLRRSQY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Acetylation and actin-binding
molecule keywords BETA-ACTIN
publication title The structure of crystalline profilin-beta-actin.
pubmed doi rcsb
source organism Bos taurus
total genus 34
structure length 139
sequence length 139
ec nomenclature
pdb deposition date 1994-01-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF00235 Profilin Profilin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.30 Alpha Beta 2-Layer Sandwich Beta-Lactamase Dynein light chain 2a, cytoplasmic 2btfP00
3UB5P 2PRFA 2B95A 1D1JA 3L9KA 4FTXA 1CQAA 1CJFA 3CPTB 1VEUA 3MSHA 5FEGA 1VETA 2HZ5A 1AWIA 3NECA 4FUWA 1CF0A 3T1RA 2PAVP 4X25A 1G5UA 4X1MA 3U4LP 2E8JA 1PNEA 1K0KA 4X1LA 1SZVA 1F2KA 1SKOB 1Z09A 4D60A 5EV0A 1PRQA 3D9YA 5FEFA 4ESPA 3T1QB 2ZL1B 3CPTA 3LGOA 1A0KA 5EM1A 4QWOA 5EVEA 2VK3A 2PBDP 2V8CA 3T1SA 1YPRA 3L7HA 5EM0A 3T1XA 1PFLA 2BTFP 2V8FA 3CHWP 1SKOA 1FIKA 2JKGA 5FDSA 1J3WA 2ACGA 2JKFA 1ACFA 3T12B 3DAVA 1Y4OA 2ZL1A 1VEUB 1VETB 3LEQA 3NULA 3KYEA 1HLUP 1FILA 3MS6A
chains in the Genus database with same CATH superfamily
1MC0A 1O7EA 2LB5A 3PBOA 2EXAA 2VGLM 2PR5A 4YINA 3CPTB 1T1AA 2O9BA 4CPKA 2XFTA 1OTEA 1GSVA 4LRYC 4GDBA 3LIEA 1IFQA 1YLWA 4X53A 3BQ8A 4HH3A 1Q2QA 4L9FA 3BRMA 4IVIA 2K7SA 3G31A 5A93A 3BLSA 1PNEA 4MBKA 2FFYA 4H8RA 2R9WA 5G4ZA 1XJ2A 2VGLS 2A24A 1LI9A 2J7VA 3OBFA 5HX9A 3LR3A 3D9YA 1N9OA 3UE0A 1IKIA 2Y55A 4S2PA 1RCJA 1HTZA 3T1QB 4MBHA 1PZPA 4GW9A 5EM1A 3NOUC 3M6HA 4GLQA 4II7A 1K6RA 2ZQ7A 5J7EA 2C6WB 5FQ9A 3T1SA 1PZOA 2ZC4B 3LR0A 3SZTA 5FQMA 3BYDA 2JHEA 5G18A 2ZC6B 3BW6A 1YMXA 3IT9A 4GB7A 1P97A 5DFXA 2JBFA 3IBJA 4HQAA 2XDMA 2VX8A 1PWCA 3SH9A 5CHUA 4R4RA 3UE1A 1BYWA 5HAQA 3MS6A 4GS9B 3G4PA 3S7PA 4RX2A 2PDRA 4E3KA 4JBFA 2VGJA 3MSHA 2W3DA 2VZWA 5J8XA 3CAXA 5EOOA 3GDIA 3HLDA 3WWXA 4BD0A 1FCOA 3IF6B 3VOLA 3H82B 3HLWA 2WKEA 2E8IA 4R70A 5KMWA 3BECA 1SKFA 4JXSA 4CLCD 4RA7A 2AVXA 2J8YA 1K4FA 3PYPA 5IHVA 4LLOB 5EVLA 3BY8A 3BQAA 1W79A 5M18A 3OC2A 4IVKA 2Y2GA 5TBMA 4OOYA 2X02A 4I39A 4DE1A 1PWDA 4KQQA 4S2MA 2LB9A 4QD4A 5CGXA 4X55A 5J4EA 3W4PA 4EUVA 1CK3A 3NJAA 4IBRA 4S2NA 4O0PA 1OPXA 5I94A 2H5SA 4UAAA 5HPIA 5FDSA 1XFNA 5E2FA 1D06A 1YM1A 2Q9NA 1K57A 4JPMA 2YKHA 1GHMA 3GMWA 1QMEA 1K6SA 4Q0JA 3UB9A 2RCXA 2ZC5B 3LEQA 3D4FA 3Q7ZA 1DP9A 4ZJ2A 1QMFA 3T4KA 1N4OA 3FV7A 2PRFA 4YWZA 1XJ3A 4LV0A 1D1JA 1K55A 1CJFA 1N9NA 4PM8A 1VETA 4BLMA 5EFWA 3NECA 3OCLA 1W63M 1G6AA 4Y17A 5HW3A 2WUQA 4X25A 3VP4A 1G5UA 2ZJ9A 5HL6A 4NXGA 3O86A 5DJTA 1O07A 4DJ2A 4Q8IA 5A91A 2XGNA 3VP2A 4ME4A 4O01A 5CX7A 1FOFA 3FPWA 5DF7A 3VFHA 4KZ5A 1PRQA 5IT5A 3Q81A 3DTIA 3G30A 4B88A 4P6BA 4EBLA 4WZ4A 5EOEA 1YMSA 2XD1A 2Z6CA 2WZZA 3PBSA 5EE8A 2V1ZA 3ZG0A 2P04A 4E3MA 2J9PA 1DP8A 4GKUA 1JNUA 1IYSA 2W1TB 3T1XA 1PFLA 2HV1A 4HEFA 2EWWA 5CXWA 3T4QA 4Z1WA 1NLZA 2XH9A 4ZTKA 4EEUA 4M4XA 4C75A 3R7WB 1YLZA 2ACGA 1ACFA 3E2LA 3BFDA 1P9RA 3IXGA 3UNWA 4BBTA 5F82A 1S6RA 1EW0A 2V9AA 3Q1FA 5CRFA 3SS5A 1PI4A 2B5RA 1KVMA 4FSFA 1K55C 1FCNA 3MKFA 1E3UD 4JF4A 4I5SA 3KSGA 2HZ5A 4KZ8A 4BD1A 1ODVA 1DP6A 2VV6A 3KSIA 1ZTUA 2PR6A 2PD8A 2WGWB 3W4QA 2EXBA 5CTMA 2Q9MA 1L3LA 5EPHA 1JWVA 2OWJA 2KLIA 5C5KA 1L2SA 5GHXA 2JN7A 4KZBA 1OTIA 3CMZA 1F9IA 3W2ZA 2W3GA 3KYZA 1JVJA 3KO6A 4HJ3A 3N8RA 2OLUA 3C7VA 2EX6A 3HUMA 2W1RA 3KYQA 4Y0TA 4B9OA 1KDWA 1ZC2A 3DWKA 3E4QA 5F1GA 4B93A 3N6IA 4KQDA 5FQIA 2KDKA 1YLTA 4KZ9A 3SS4A 3QHYA 3ZGAB 1FR6A 1DJCA 3IHAA 3UE3A 2QKPA 2NUPC 1PIOA 5HAIA 5DVAA 1OJ5A 4Y13A 3JYIA 2P74A 2IA2A 3IWOA 2Y2PA 3UMDA 1I2WA 3PHYA 1ESUA 1H5XA 3VFFA 3UPNA 4FD8A 3LI8A 1W7FA 1XPBA 2Y4AA 1OTAA 4C3QA 3DW0A 4BBVA 1TVFA 2A2LA 3BEBA 5JYPA 3EQUA 5L10A 5HZHA 3NDEA 5AQAA 4CLCC 4Y0OA 4EBPA 3Q82A 3PAEA 4NKPA 2VGKA 3S1YA 5AQ7A 4OPZA 2XA7M 3WRZA 3V5MA 3FG8A 3R4KA 3QNCA 4Y0UA 4WL9A 5HD5A 4E04A 2EFXA 1TF1A 4JLFA 1KGGA 1V9YA 1TS7A 3RXWA 3MKEA 4F3LA 2GZAA 3BJNA 3HCYA 1BT5A 4OH0A 5E2EA 5FEFA 2XA7S 2H10A 1U60A 1ESIA 4H6JA 2ZOHA 3S4XA 2Y2KA 1PW1A 1EROA 3F1PA 3ZG5A 4L0LA 3P09A 3GRJA 2DCFA 3UDXA 4BJPA 4JF6A 3K2NA 3PXPA 3ITAA 3BFFA 2ZQDA 5DKLA 3ITBA 3LIDA 3TW8A 4E6WA 3HREA 1JWPA 4ZRRA 4WLAA 1H8ZA 1KVLA 5HDSA 1D7EA 2Y2NA 4Y15A 1J9MA 3B42A 1SKOA 1T1BA 4OQHA 2V1BA 2X01A 1HD8A 4IBXA 1IYPA 4LGWA 4PHTA 4MMNA 2ZLYA 3WS4A 1Y28A 3UO9A 2GX5A 2Y79A 2JE5A 4OVDA 1CQAA 2XEPA 1G68A 1NY0A 5AQ9A 3V3RA 4HJ4A 3HUOA 2IWCA 1X0OA 3IX8A 3PTEA 2OSUA 5CEDA 2Y2MA 4OONA 3N8SA 3MJQA 1CI8A 2OOLA 1MY8A 4E3JA 3LICA 4Y5FA 2G7UA 1EI5A 5FI6A 2I9VA 4U0TA 5TJJA 3EEAA 1GSWA 4GNUA 4FH2A 4EBNA 2QYBA 3UPOA 3PAGA 4ESPA 3HUNA 1NYYA 3S7NA 4K0WA 2Z2MB 3MMHA 5JYOA 1EWZA 4EQIA 2ZC3B 2WKQA 5A8BA 5CHJA 4BENA 1KE3A 1NZUA 1TDGA 2M7VA 2ZQ9A 3LIBA 4F94A 3MFXA 3LIAA 3OCNA 2WZXA 3EGDC 4MN6A 2HP9A 4HHDA 1L0FA 2VEAA 4A5RA 4BWIA 4OQIA 4Q0IA 2PT7A 3BFGA 3SH8A 4MCWA 4ZJ3A 1KGFA 3HBRA 1Y4OA 4HI4A 2V1AA 4M3KA 4DDYA 4N9LA 5EUAA 4UA6A 5A92A 3ZNTA 5AQBA 1AWIA 4NG2A 3IQAA 3VSKA 4B4XA 3EOIA 2CMNA 1S1ZA 2J3WA 3O5YA 3W8KA 4R0QA 1MWRA 1YLYA 4CJNA 3QP5A 4P85A 2WAEA 4OPQA 3GVBA 3HLGA 1WYCA 1K0KA 1MKIA 1NZOA 1MPLA 1PI5A 5L07A 5GLDA 4DRTA 4QHCA 3EEHA 4D60A 4I3JA 1S4RA 2PU2A 1RGZA 3LO7A 3T4JA 5EV0A 5CECA 4P0MA 4B4ZA 3RTYA 4XUXA 1ZHHB 3JPUA 3CITA 4IUKA 2O0YA 5F6AA 4E3LA 4GZBA 3MXQA 2V8CA 2W0NA 1H3QA 5GL9A 1L0EA 4YFMA 3T4TA 1YPRA 3DTKA 3CG5A 5EVIC 4QPRA 5A90A 4WUJA 1WE4A 2OWHA 3BM6A 4IHQA 2ZMVA 3LR4A 3NC8A 2JKGA 2ZM0A 2J3TC 3VP1A 3PBTA 4I38A 4OOMA 2BLSA 3C38A 3FYZA 5LBRA 3UB6A 3VP0A 3IXHA 1OT9A 3GTCA 1P9WA 3MZEA 4RYEA 3KYEA 1MWTA 4AFIA 4EU0A 4RX3A 1WYBA 3DBAA 3L9KA 3Q07A 4GCZA 2Y2QA 2IWBA 2QJ7A 3JVVA 2HPBA 3IX3A 5M1AA 3MZFA 4FUWA 3OPLA 4GS9A 1MKMA 3MZDA 1F98A 3O88A 5L09A 2W3EA 2PAVP 1OJGA 4X1MA 4R1GA 1TS0A 2YKFA 5F5YA 4MNRA 3RH8B 2ZMFA 2KX6A 1XGJA 4MBFA 2R9XA 3K3DA 2WKHA 4LENA 3H82A 3HLBA 4LRZE 3P7NA 3H7WB 4MN5A 1OMEA 4XXRA 3S7OA 4GHIA 1BUEA 1YKDA 1YSQA 3WS0A 4N9KA 3QP6A 5EVEA 5F1FA 1BLHA 1IYOA 2WKPA 5CERA 3E0YA 3TG9A 4Q0HA 3N8LA 3C4OA 2VV7A 1PWGA 3A0VA 4PAUA 5KSCA 2V0WA 3T4LA 5E2GA 3ULFA 1FIKA 3VOYA 1SDEA 4HP4A 3LI9A 2HJEA 4NXBA 3BFCA 1K56D 3E2KA 1LL5A 1ERMA 1RGYA 3PBRA 1TS6A 1XXMA 1LSWA 2W3HA 2L1MA 4HP9A 2ZL1A 1VEUB 4WEJA 4QJGA 4GD8A 1IKGA 1VB6A 1IYQA 3A3JA 4YOFA 4DJ3A 3SW1A 1T1CA 4QY5A 3C7UA 2XROA 2XFSA 1H8YA 3HL9A 3IS2A 5FSRA 3VE4A 3AGFA 3NBLA 4GD6A 1GA0A 4O8GA 3O87A 1BLPA 4OOLA 5CHMA 4CLCA 1SZVA 4DN0A 1E4DA 3DTMA 4L9EA 1UWNX 1Z09A 2C5WB 3IF6C 1GA9A 4IJGA 2HDRA 4S2IA 5FL3A 5CGWA 1FSWA 2O99A 1GHPA 2PD7A 4JXVA 1M6KA 3NDGA 4JXWA 3FPVA 1NJ4A 1YQSA 4LV3A 4LCMA 1P0ZA 2K2NA 1FQGA 1Z6FA 2QHKA 4QWOA 2VK3A 4ARZA 1Y54A 3Q7VA 3G2ZA 2Y2IA 4MDZA 4LPZA 1S66L 5EM0A 1BSGA 1T19A 4PM5A 2W3FA 4U0XA 5AVEA 2V8FA 2ZQ8A 3LUQA 4C6YA 3T4SA 3FKVA 2MJ6A 4UA7A 1J3WA 3HVFA 4KG2A 1DJBA 4N1XA 5CEBA 3D72A 3RJUA 1YSPA 1JTDA 4NK3A 5KSHA 5DTSA 3R7WA 1MBLA 2W27A 4UQIS 4E3OA 3DWZA 3C30A 1F5MA 4R6LA 3V39A 3S22A 2Y2HA 4HNBA 5GLBA 1BULA 3F1OB 2VV8A 1BZAA 4LFUA 4X56A 4ETZA 3GQZA 3VOZA 5HFOA 2A49A 2QPNA 3CUEC 5FDHA 2JKTM 4BMWA 3U4LP 1K38A 3D3OA 5HDDA 3NHQA 3RFBA 3CLOA 2NUTC 4WEKA 4UEYA 2DMWA 5HWTA 4I3IA 1F2KA 4Y2FA 3OPRA 5M19A 4PPRA 1SKOB 3TJZC 3UDIA 4OPYA 1XJ6A 3V50A 4GOGA 3A3FA 4K91A 3NIAA 5FAQA 3S7QA 3G35A 3ZFZA 5HAPA 4JGOA 4RQ9A 3LYXA 4IEDA 3ISGA 3ZCZA 3MBZA 2FFFB 3HLCA 5E43A 2ZC7A 1LSXA 4HOIA 3ZYTA 3AGDA 5TFQA 3EGXC 3M6BA 3SH7A 3VMAA 2L0WA 4XUZA 2HP6A 2VA0A 4HH2A 3LFVA 1FSYA 3BFEA 4EXOA 4XT2B 3QNBA 3TOIA 3IH9A 4OQ0A 4PM9A 1GSXA 1M40A 1YLJA 3UN7A 3WS1A 4BL2A 4FH4A 3NI9A 4OLGA 2UWXA 1OT6A 2JKFA 3BLMA 3T12B 1S4SA 2P9VA 3PBQA 3LR5A 3ZDJA 2B95A 4S2KA 3M2JA 3LIFA 4FTXA 4OP5A 1PYYA 4HESA 4I3AA 4WYYA 1JTGA 3WS2A 4Z9QA 3NY4A 5IS1A 4WMCA 2EX8A 5J3WA 3F1NA 2HDUA 2BG1A 4NXEA 1ALQA 2A24B 4CLCE 2RL3A 4KUKA 1W63Q 1ERQA 4CQHA 2WAFA 1TS8A 3GR2A 1PW8A 3KSFA 3T4OA 4QB8A 4X1LA 2DNSA 3A0SA 4WZ5C 4PKYG 1SHVA 2DRWA 3HJIA 3G2YA 2HDSA 4OLDA 4JXGA 3JVUA 3EWKA 4DE2A 2KOIA 1XP4A 1ONGA 4ZBEA 3QP1A 3RXXA 3FKWA 1ZG4A 2XK1A 5D3OA 4X69A 2EFUA 3NOTC 4RVAA 1KE0A 1GHIA 5EECA 1L0DA 2XR0A 3L7HA 2VJWA 1DJAA 3H9WA 2IWDA 3MQ0A 4ETXA 2QJ5A 2QZ6A 1STZA 2OAQ1 1GCEA 4PKYA 4JGRA 4U3TA 1H0MA 3GSGA 3ZG9B 2GJ3A 4LV1A 3ZHHA 4R38A 3LCEA 3UY6A 4S2OA 1LT0A 5EVIA 4QY6A 5G4YA 1HLUP 4WN5A 1KDSA 4K0XA 1XJ4A 2OAP1 2WK0A 3GECA 3C4PA 3MF0A 1JWZA 1NXYA 2ZQAA 4ZAMA 1MWSA 3ZQ5A 5F69A 3UB7A 3SOIA 4E3NA 4LV2A 4HIAA 2E8JA 4G3VA 4R23A 1ES5A 2UV0E 3FZCA 2VKSA 2D01A 3DTEA 1Q2PA 4NEED 3ZVWA 1C3BA 4KZ6A 4Y3IA 4EEPA 3B3XA 1VQQA 3OPHA 2ZM8A 2PYPA 5TBMB 3BY9A 2EX9A 3A3EA 5DFYA 2WKRA 4OP8A 3CPTA 1TD5A 4S2JA 3ZG7B 2WYXA 1I2SA 4HBTA 4MEZA 2PBDP 2P08A 4L9GA 1ES4A 3V3SA 4P87A 3QP4A 1G6OA 5FI2A 5DJUA 3P98A 3ZG8B 2G2WA 2O9CA 4EERA 3UB8A 4HJ6A 3GV9A 1HZOA 3KX0X 4Y7PA 4KQRA 3TSGA 4E6XA 1K54A 3QP8A 3EQVA 4KZAA 5FQQA 4DMZA 2INWA 5L8MA 2Y59A 3A3DA 1V9ZA 3NOPC 4EETB 1S67L 4PM7A 3E4OA 5FA7A 3T50A 4HBUA 1ES3A 3IH8A 1VETB 5HWWA 1FILA 5KIZA 5E2HA 1NLYA 4YNRA 1IEMA 4DDSA 1LL9A 4JF5A 4GHIB 5DF9A 4EV4A 4LRXC 1YAXA 1LLBA 5GLCA 4KZ3A 5HL1A 2JC7A 3G34A 2OV5A 3HLFA 3VP3A 3CI6A 3OZHA 2CC1A 1ZG6A 2XRNA 3ZVTA 4EESA 2J9OA 2PYRA 4WELA 4N1HA 2G2UA 2I72A 2V2FF 1L0GA 5HDCA 1I5QA 4DF6A 3FC7A 4R3AA 1K25A 3CWFA 5IU1A 2XD5A 4N92A 1IELA 1S0WA 5TGFA 3UMEA 4P6ZM 2ZL1B 4IUHA 4KZ7A 5FI7A 3LGOA 3VV4A 1A0KA 4MLLA 1H8MA 1BTLA 3OOVA 1S1YA 5DTTA 3O3VA 1UGUA 3IF6A 4ZDXA 2H0TA 2HDQA 3ICYA 2VLGA 3CJMA 3IS2B 4WM9A 2Y2LA 5U47A 4P6ZS 1W8QA 1K54C 5DTKA 5HSQA 1YT4A 2QWSA 2JCHA 1RP5A 3NCKA 2H28A 3IWQA 4CLCB 4FCFA 4KQOA 4G3KA 4OQGA 5L2FA 3B47A 1ES2A 3UB5P 1CEGA 2ZBBA 4DKIA 1VHMA 3OPPA 1OTBA 2O9AA 2EA9A 2K31A 1VM1A 2ZM2A 2WGVA 4ID4A 5DF8A 4ARZB 3Q7VB 2JKRM 3FWLA 4DE3A 5GLAA 1BLCA 3V67A 1MWUA 3VSLA 5BOHA 4X68A 4HY8A 2JKRI 4WBGA 5GHYA 1FR1A 3UDFA 4R3JA 2B02A 2A3UA 4DXBA 2XSSA 3LEZA 4G3WA 4S2NC 3CUEA 3IHBA 3AGEA 4GDNA 3H7WA 1K57C 2HF6A 2QMIA 4K08A 4GJ4A 2R78A 2PU4A 2ZMAA 2V20A 2BTFP 4PM6A 3CHWP 2XQZA 3LY4A 5AJGA 1SDNA 1KOUA 3CZDA 4EUZA 4OPRA 2Q0OA 3WRTA 5MC7A 2ZOIA 1ZKJA 2Z2LB 1TDLA 1MZUA 2WKIA 3DAVA 4KENB 4JKTA 4DXCA 5FQJA 3G32A 4JGQA 4GN2A 5HPFA 4WMCD 1LHYA 1N9BA 4UQIM 3NULA 3UPPA 1IOUA 4FOFA 2P7JA 3MR0A 2J80A 2ZQCA 5F83A 2Y2JA 4OKPA 3C2WA 5FASA 4PMAA 1UWPX 1VEUA 5FEGA 2W1TA 4UHUA 4D2OA 3T1RA 1CF0A 2GNXA 1HVBA 3PBNA 1AXBA 1W5DA 4NETA 2OLVA 1KGEA 3BWLA 4X6TA 4F3LB 1DY6A 2FZ0A 2M1CA 2H0YA 1N9LA 5CTNA 4H6JB 5KZHA 1W8YA 3F1PB 1NWZA 1E25A 3U2AA 3WS5A 1LL8A 4E3IA 3MQOA 1YLPA 5CGSA 5FQKA 1TEMA 4KUOA 5HWVA 2P9VB 3IXDA 1NRFA 3IF5A 2WGWA 1WA9A 5K5BA 2M7UA 3MXRA 3G6OA 2JKTI 4WZ5A 3W4OA 1XGIA 1OTDA 2HJ9C 1XA1A 2X71A 3HLEA 4EQ1A 2XLNA 2HP5A 5EVID 3A0RA 1DRMA 1K56A 3F1NB 1LSVA 4MN7A 5TR7A 3ZNYA 2WGIA 4KZ4A 1MXOA 2EWVA 2GDNA 2Z6DA 1G28A 2J3TD 4BQMA 4BBUA 1XFQA 3TRCA 3PR6A 1K4EA 2XF3A 2PHYA 1KE4A 3KSHA 5AVFA 3P01A 4EW7A 3MQQA 4EWFA 1BLSA 4BL3A 1CEFA 3TE8A 2BASA 5FAPA 4DE0A 2B18A 3E4PA 4O7DA 3M2KA 4R3BA 3IWIA 4WF0A 1E3UA 3F1OA 3IBRA 3LY3A 3QP2A 3C5AA 1XKZA 2L4RA 5FATA 3VE3A 2PBYA 5HD3A 2EX2A 1NYMA 1CI9A 4KG5A 4ZJ1A 5FAOA 5EVIB 3MXSA 4JGPA 3IXBA 5HARA 1ONHA 2Y91A 3SS3A 5I5LA 3K3CA 2HGVA 4S2LA 3I7JA 4QU3A 5DKKA 4UA9A 3UE6A 2D02A 4R4SA 2V0UA 3IX4A 5GHZA 4KG6A 3N4IA 3E98A 3HJKA 1LI0A 3MFDA 4LCLA 1FCMA 2WADA 3A3IA 2ZD8A 2Y2OA 3N7WA 3OLOA 1XX2A 4NXFA 1T18A 4XT2A 1SCWA 3C8CA 3B33A 1NRJA 2FH5A 2Y8HA 5F68A 1XA7A
chains in the Genus database with same CATH topology
3UB5P 2PRFA 2B95A 1D1JA 3L9KA 4FTXA 1CQAA 1CJFA 3CPTB 1VEUA 3MSHA 5FEGA 1VETA 2HZ5A 1AWIA 3NECA 4FUWA 1CF0A 3T1RA 2PAVP 4X25A 1G5UA 4X1MA 3U4LP 2E8JA 1PNEA 1K0KA 4X1LA 1SZVA 1F2KA 1SKOB 1Z09A 4D60A 5EV0A 1PRQA 3D9YA 5FEFA 4ESPA 3T1QB 2ZL1B 3CPTA 3LGOA 1A0KA 5EM1A 4QWOA 5EVEA 2VK3A 2PBDP 2V8CA 3T1SA 1YPRA 3L7HA 5EM0A 3T1XA 1PFLA 2BTFP 2V8FA 3CHWP 1SKOA 1FIKA 2JKGA 5FDSA 1J3WA 2ACGA 2JKFA 1ACFA 3T12B 3DAVA 1Y4OA 2ZL1A 1VEUB 1VETB 3LEQA 3NULA 3KYEA 1HLUP 1FILA 3MS6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UB5 P;  2PRF A;  2B95 A;  1D1J A;  3L9K A;  4FTX A;  1CQA A;  1CJF A;  3CPT B;  1VEU A;  3MSH A;  5FEG A;  1VET A;  2HZ5 A;  1AWI A;  3NEC A;  4FUW A;  1CF0 A;  3T1R A;  2PAV P;  4X25 A;  1G5U A;  4X1M A;  3U4L P;  2E8J A;  1PNE A;  1K0K A;  4X1L A;  1SZV A;  1F2K A;  1SKO B;  1Z09 A;  4D60 A;  5EV0 A;  1PRQ A;  3D9Y A;  5FEF A;  4ESP A;  3T1Q B;  2ZL1 B;  3CPT A;  3LGO A;  1A0K A;  5EM1 A;  4QWO A;  5EVE A;  2VK3 A;  2PBD P;  2V8C A;  3T1S A;  1YPR A;  3L7H A;  5EM0 A;  3T1X A;  1PFL A;  2BTF P;  2V8F A;  3CHW P;  1SKO A;  1FIK A;  2JKG A;  5FDS A;  1J3W A;  2ACG A;  2JKF A;  1ACF A;  3T12 B;  3DAV A;  1Y4O A;  2ZL1 A;  1VEU B;  1VET B;  3LEQ A;  3NUL A;  3KYE A;  1HLU P;  1FIL A;  3MS6 A; 
#chains in the Genus database with same CATH topology
 1MC0 A;  1O7E A;  2LB5 A;  3PBO A;  2EXA A;  2VGL M;  2PR5 A;  4YIN A;  3CPT B;  1T1A A;  2O9B A;  4CPK A;  2XFT A;  1OTE A;  1GSV A;  4LRY C;  4GDB A;  3LIE A;  1IFQ A;  1YLW A;  4X53 A;  3BQ8 A;  4HH3 A;  1Q2Q A;  4L9F A;  3BRM A;  4IVI A;  2K7S A;  3G31 A;  5A93 A;  3BLS A;  1PNE A;  4MBK A;  2FFY A;  4H8R A;  2R9W A;  5G4Z A;  1XJ2 A;  2VGL S;  2A24 A;  1LI9 A;  2J7V A;  3OBF A;  5HX9 A;  3LR3 A;  3D9Y A;  1N9O A;  3UE0 A;  1IKI A;  2Y55 A;  4S2P A;  1RCJ A;  1HTZ A;  3T1Q B;  4MBH A;  1PZP A;  4GW9 A;  5EM1 A;  3NOU C;  3M6H A;  4GLQ A;  4II7 A;  1K6R A;  2ZQ7 A;  5J7E A;  2C6W B;  5FQ9 A;  3T1S A;  1PZO A;  2ZC4 B;  3LR0 A;  3SZT A;  5FQM A;  3BYD A;  2JHE A;  5G18 A;  2ZC6 B;  3BW6 A;  1YMX A;  3IT9 A;  4GB7 A;  1P97 A;  5DFX A;  2JBF A;  3IBJ A;  4HQA A;  2XDM A;  2VX8 A;  1PWC A;  3SH9 A;  5CHU A;  4R4R A;  3UE1 A;  1BYW A;  5HAQ A;  3MS6 A;  4GS9 B;  3G4P A;  3S7P A;  4RX2 A;  2PDR A;  4E3K A;  4JBF A;  2VGJ A;  3MSH A;  2W3D A;  2VZW A;  5J8X A;  3CAX A;  5EOO A;  3GDI A;  3HLD A;  3WWX A;  4BD0 A;  1FCO A;  3IF6 B;  3VOL A;  3H82 B;  3HLW A;  2WKE A;  2E8I A;  4R70 A;  5KMW A;  3BEC A;  1SKF A;  4JXS A;  4CLC D;  4RA7 A;  2AVX A;  2J8Y A;  1K4F A;  3PYP A;  5IHV A;  4LLO B;  5EVL A;  3BY8 A;  3BQA A;  1W79 A;  5M18 A;  3OC2 A;  4IVK A;  2Y2G A;  5TBM A;  4OOY A;  2X02 A;  4I39 A;  4DE1 A;  1PWD A;  4KQQ A;  4S2M A;  2LB9 A;  4QD4 A;  5CGX A;  4X55 A;  5J4E A;  3W4P A;  4EUV A;  1CK3 A;  3NJA A;  4IBR A;  4S2N A;  4O0P A;  1OPX A;  5I94 A;  2H5S A;  4UAA A;  5HPI A;  5FDS A;  1XFN A;  5E2F A;  1D06 A;  1YM1 A;  2Q9N A;  1K57 A;  4JPM A;  2YKH A;  1GHM A;  3GMW A;  1QME A;  1K6S A;  4Q0J A;  3UB9 A;  2RCX A;  2ZC5 B;  3LEQ A;  3D4F A;  3Q7Z A;  1DP9 A;  4ZJ2 A;  1QMF A;  3T4K A;  1N4O A;  3FV7 A;  2PRF A;  4YWZ A;  1XJ3 A;  4LV0 A;  1D1J A;  1K55 A;  1CJF A;  1N9N A;  4PM8 A;  1VET A;  4BLM A;  5EFW A;  3NEC A;  3OCL A;  1W63 M;  1G6A A;  4Y17 A;  5HW3 A;  2WUQ A;  4X25 A;  3VP4 A;  1G5U A;  2ZJ9 A;  5HL6 A;  4NXG A;  3O86 A;  5DJT A;  1O07 A;  4DJ2 A;  4Q8I A;  5A91 A;  2XGN A;  3VP2 A;  4ME4 A;  4O01 A;  5CX7 A;  1FOF A;  3FPW A;  5DF7 A;  3VFH A;  4KZ5 A;  1PRQ A;  5IT5 A;  3Q81 A;  3DTI A;  3G30 A;  4B88 A;  4P6B A;  4EBL A;  4WZ4 A;  5EOE A;  1YMS A;  2XD1 A;  2Z6C A;  2WZZ A;  3PBS A;  5EE8 A;  2V1Z A;  3ZG0 A;  2P04 A;  4E3M A;  2J9P A;  1DP8 A;  4GKU A;  1JNU A;  1IYS A;  2W1T B;  3T1X A;  1PFL A;  2HV1 A;  4HEF A;  2EWW A;  5CXW A;  3T4Q A;  4Z1W A;  1NLZ A;  2XH9 A;  4ZTK A;  4EEU A;  4M4X A;  4C75 A;  3R7W B;  1YLZ A;  2ACG A;  1ACF A;  3E2L A;  3BFD A;  1P9R A;  3IXG A;  3UNW A;  4BBT A;  5F82 A;  1S6R A;  1EW0 A;  2V9A A;  3Q1F A;  5CRF A;  3SS5 A;  1PI4 A;  2B5R A;  1KVM A;  4FSF A;  1K55 C;  1FCN A;  3MKF A;  1E3U D;  4JF4 A;  4I5S A;  3KSG A;  2HZ5 A;  4KZ8 A;  4BD1 A;  1ODV A;  1DP6 A;  2VV6 A;  3KSI A;  1ZTU A;  2PR6 A;  2PD8 A;  2WGW B;  3W4Q A;  2EXB A;  5CTM A;  2Q9M A;  1L3L A;  5EPH A;  1JWV A;  2OWJ A;  2KLI A;  5C5K A;  1L2S A;  5GHX A;  2JN7 A;  4KZB A;  1OTI A;  3CMZ A;  1F9I A;  3W2Z A;  2W3G A;  3KYZ A;  1JVJ A;  3KO6 A;  4HJ3 A;  3N8R A;  2OLU A;  3C7V A;  2EX6 A;  3HUM A;  2W1R A;  3KYQ A;  4Y0T A;  4B9O A;  1KDW A;  1ZC2 A;  3DWK A;  3E4Q A;  5F1G A;  4B93 A;  3N6I A;  4KQD A;  5FQI A;  2KDK A;  1YLT A;  4KZ9 A;  3SS4 A;  3QHY A;  3ZGA B;  1FR6 A;  1DJC A;  3IHA A;  3UE3 A;  2QKP A;  2NUP C;  1PIO A;  5HAI A;  5DVA A;  1OJ5 A;  4Y13 A;  3JYI A;  2P74 A;  2IA2 A;  3IWO A;  2Y2P A;  3UMD A;  1I2W A;  3PHY A;  1ESU A;  1H5X A;  3VFF A;  3UPN A;  4FD8 A;  3LI8 A;  1W7F A;  1XPB A;  2Y4A A;  1OTA A;  4C3Q A;  3DW0 A;  4BBV A;  1TVF A;  2A2L A;  3BEB A;  5JYP A;  3EQU A;  5L10 A;  5HZH A;  3NDE A;  5AQA A;  4CLC C;  4Y0O A;  4EBP A;  3Q82 A;  3PAE A;  4NKP A;  2VGK A;  3S1Y A;  5AQ7 A;  4OPZ A;  2XA7 M;  3WRZ A;  3V5M A;  3FG8 A;  3R4K A;  3QNC A;  4Y0U A;  4WL9 A;  5HD5 A;  4E04 A;  2EFX A;  1TF1 A;  4JLF A;  1KGG A;  1V9Y A;  1TS7 A;  3RXW A;  3MKE A;  4F3L A;  2GZA A;  3BJN A;  3HCY A;  1BT5 A;  4OH0 A;  5E2E A;  5FEF A;  2XA7 S;  2H10 A;  1U60 A;  1ESI A;  4H6J A;  2ZOH A;  3S4X A;  2Y2K A;  1PW1 A;  1ERO A;  3F1P A;  3ZG5 A;  4L0L A;  3P09 A;  3GRJ A;  2DCF A;  3UDX A;  4BJP A;  4JF6 A;  3K2N A;  3PXP A;  3ITA A;  3BFF A;  2ZQD A;  5DKL A;  3ITB A;  3LID A;  3TW8 A;  4E6W A;  3HRE A;  1JWP A;  4ZRR A;  4WLA A;  1H8Z A;  1KVL A;  5HDS A;  1D7E A;  2Y2N A;  4Y15 A;  1J9M A;  3B42 A;  1SKO A;  1T1B A;  4OQH A;  2V1B A;  2X01 A;  1HD8 A;  4IBX A;  1IYP A;  4LGW A;  4PHT A;  4MMN A;  2ZLY A;  3WS4 A;  1Y28 A;  3UO9 A;  2GX5 A;  2Y79 A;  2JE5 A;  4OVD A;  1CQA A;  2XEP A;  1G68 A;  1NY0 A;  5AQ9 A;  3V3R A;  4HJ4 A;  3HUO A;  2IWC A;  1X0O A;  3IX8 A;  3PTE A;  2OSU A;  5CED A;  2Y2M A;  4OON A;  3N8S A;  3MJQ A;  1CI8 A;  2OOL A;  1MY8 A;  4E3J A;  3LIC A;  4Y5F A;  2G7U A;  1EI5 A;  5FI6 A;  2I9V A;  4U0T A;  5TJJ A;  3EEA A;  1GSW A;  4GNU A;  4FH2 A;  4EBN A;  2QYB A;  3UPO A;  3PAG A;  4ESP A;  3HUN A;  1NYY A;  3S7N A;  4K0W A;  2Z2M B;  3MMH A;  5JYO A;  1EWZ A;  4EQI A;  2ZC3 B;  2WKQ A;  5A8B A;  5CHJ A;  4BEN A;  1KE3 A;  1NZU A;  1TDG A;  2M7V A;  2ZQ9 A;  3LIB A;  4F94 A;  3MFX A;  3LIA A;  3OCN A;  2WZX A;  3EGD C;  4MN6 A;  2HP9 A;  4HHD A;  1L0F A;  2VEA A;  4A5R A;  4BWI A;  4OQI A;  4Q0I A;  2PT7 A;  3BFG A;  3SH8 A;  4MCW A;  4ZJ3 A;  1KGF A;  3HBR A;  1Y4O A;  4HI4 A;  2V1A A;  4M3K A;  4DDY A;  4N9L A;  5EUA A;  4UA6 A;  5A92 A;  3ZNT A;  5AQB A;  1AWI A;  4NG2 A;  3IQA A;  3VSK A;  4B4X A;  3EOI A;  2CMN A;  1S1Z A;  2J3W A;  3O5Y A;  3W8K A;  4R0Q A;  1MWR A;  1YLY A;  4CJN A;  3QP5 A;  4P85 A;  2WAE A;  4OPQ A;  3GVB A;  3HLG A;  1WYC A;  1K0K A;  1MKI A;  1NZO A;  1MPL A;  1PI5 A;  5L07 A;  5GLD A;  4DRT A;  4QHC A;  3EEH A;  4D60 A;  4I3J A;  1S4R A;  2PU2 A;  1RGZ A;  3LO7 A;  3T4J A;  5EV0 A;  5CEC A;  4P0M A;  4B4Z A;  3RTY A;  4XUX A;  1ZHH B;  3JPU A;  3CIT A;  4IUK A;  2O0Y A;  5F6A A;  4E3L A;  4GZB A;  3MXQ A;  2V8C A;  2W0N A;  1H3Q A;  5GL9 A;  1L0E A;  4YFM A;  3T4T A;  1YPR A;  3DTK A;  3CG5 A;  5EVI C;  4QPR A;  5A90 A;  4WUJ A;  1WE4 A;  2OWH A;  3BM6 A;  4IHQ A;  2ZMV A;  3LR4 A;  3NC8 A;  2JKG A;  2ZM0 A;  2J3T C;  3VP1 A;  3PBT A;  4I38 A;  4OOM A;  2BLS A;  3C38 A;  3FYZ A;  5LBR A;  3UB6 A;  3VP0 A;  3IXH A;  1OT9 A;  3GTC A;  1P9W A;  3MZE A;  4RYE A;  3KYE A;  1MWT A;  4AFI A;  4EU0 A;  4RX3 A;  1WYB A;  3DBA A;  3L9K A;  3Q07 A;  4GCZ A;  2Y2Q A;  2IWB A;  2QJ7 A;  3JVV A;  2HPB A;  3IX3 A;  5M1A A;  3MZF A;  4FUW A;  3OPL A;  4GS9 A;  1MKM A;  3MZD A;  1F98 A;  3O88 A;  5L09 A;  2W3E A;  2PAV P;  1OJG A;  4X1M A;  4R1G A;  1TS0 A;  2YKF A;  5F5Y A;  4MNR A;  3RH8 B;  2ZMF A;  2KX6 A;  1XGJ A;  4MBF A;  2R9X A;  3K3D A;  2WKH A;  4LEN A;  3H82 A;  3HLB A;  4LRZ E;  3P7N A;  3H7W B;  4MN5 A;  1OME A;  4XXR A;  3S7O A;  4GHI A;  1BUE A;  1YKD A;  1YSQ A;  3WS0 A;  4N9K A;  3QP6 A;  5EVE A;  5F1F A;  1BLH A;  1IYO A;  2WKP A;  5CER A;  3E0Y A;  3TG9 A;  4Q0H A;  3N8L A;  3C4O A;  2VV7 A;  1PWG A;  3A0V A;  4PAU A;  5KSC A;  2V0W A;  3T4L A;  5E2G A;  3ULF A;  1FIK A;  3VOY A;  1SDE A;  4HP4 A;  3LI9 A;  2HJE A;  4NXB A;  3BFC A;  1K56 D;  3E2K A;  1LL5 A;  1ERM A;  1RGY A;  3PBR A;  1TS6 A;  1XXM A;  1LSW A;  2W3H A;  2L1M A;  4HP9 A;  2ZL1 A;  1VEU B;  4WEJ A;  4QJG A;  4GD8 A;  1IKG A;  1VB6 A;  1IYQ A;  3A3J A;  4YOF A;  4DJ3 A;  3SW1 A;  1T1C A;  4QY5 A;  3C7U A;  2XRO A;  2XFS A;  1H8Y A;  3HL9 A;  3IS2 A;  5FSR A;  3VE4 A;  3AGF A;  3NBL A;  4GD6 A;  1GA0 A;  4O8G A;  3O87 A;  1BLP A;  4OOL A;  5CHM A;  4CLC A;  1SZV A;  4DN0 A;  1E4D A;  3DTM A;  4L9E A;  1UWN X;  1Z09 A;  2C5W B;  3IF6 C;  1GA9 A;  4IJG A;  2HDR A;  4S2I A;  5FL3 A;  5CGW A;  1FSW A;  2O99 A;  1GHP A;  2PD7 A;  4JXV A;  1M6K A;  3NDG A;  4JXW A;  3FPV A;  1NJ4 A;  1YQS A;  4LV3 A;  4LCM A;  1P0Z A;  2K2N A;  1FQG A;  1Z6F A;  2QHK A;  4QWO A;  2VK3 A;  4ARZ A;  1Y54 A;  3Q7V A;  3G2Z A;  2Y2I A;  4MDZ A;  4LPZ A;  1S66 L;  5EM0 A;  1BSG A;  1T19 A;  4PM5 A;  2W3F A;  4U0X A;  5AVE A;  2V8F A;  2ZQ8 A;  3LUQ A;  4C6Y A;  3T4S A;  3FKV A;  2MJ6 A;  4UA7 A;  1J3W A;  3HVF A;  4KG2 A;  1DJB A;  4N1X A;  5CEB A;  3D72 A;  3RJU A;  1YSP A;  1JTD A;  4NK3 A;  5KSH A;  5DTS A;  3R7W A;  1MBL A;  2W27 A;  4UQI S;  4E3O A;  3DWZ A;  3C30 A;  1F5M A;  4R6L A;  3V39 A;  3S22 A;  2Y2H A;  4HNB A;  5GLB A;  1BUL A;  3F1O B;  2VV8 A;  1BZA A;  4LFU A;  4X56 A;  4ETZ A;  3GQZ A;  3VOZ A;  5HFO A;  2A49 A;  2QPN A;  3CUE C;  5FDH A;  2JKT M;  4BMW A;  3U4L P;  1K38 A;  3D3O A;  5HDD A;  3NHQ A;  3RFB A;  3CLO A;  2NUT C;  4WEK A;  4UEY A;  2DMW A;  5HWT A;  4I3I A;  1F2K A;  4Y2F A;  3OPR A;  5M19 A;  4PPR A;  1SKO B;  3TJZ C;  3UDI A;  4OPY A;  1XJ6 A;  3V50 A;  4GOG A;  3A3F A;  4K91 A;  3NIA A;  5FAQ A;  3S7Q A;  3G35 A;  3ZFZ A;  5HAP A;  4JGO A;  4RQ9 A;  3LYX A;  4IED A;  3ISG A;  3ZCZ A;  3MBZ A;  2FFF B;  3HLC A;  5E43 A;  2ZC7 A;  1LSX A;  4HOI A;  3ZYT A;  3AGD A;  5TFQ A;  3EGX C;  3M6B A;  3SH7 A;  3VMA A;  2L0W A;  4XUZ A;  2HP6 A;  2VA0 A;  4HH2 A;  3LFV A;  1FSY A;  3BFE A;  4EXO A;  4XT2 B;  3QNB A;  3TOI A;  3IH9 A;  4OQ0 A;  4PM9 A;  1GSX A;  1M40 A;  1YLJ A;  3UN7 A;  3WS1 A;  4BL2 A;  4FH4 A;  3NI9 A;  4OLG A;  2UWX A;  1OT6 A;  2JKF A;  3BLM A;  3T12 B;  1S4S A;  2P9V A;  3PBQ A;  3LR5 A;  3ZDJ A;  2B95 A;  4S2K A;  3M2J A;  3LIF A;  4FTX A;  4OP5 A;  1PYY A;  4HES A;  4I3A A;  4WYY A;  1JTG A;  3WS2 A;  4Z9Q A;  3NY4 A;  5IS1 A;  4WMC A;  2EX8 A;  5J3W A;  3F1N A;  2HDU A;  2BG1 A;  4NXE A;  1ALQ A;  2A24 B;  4CLC E;  2RL3 A;  4KUK A;  1W63 Q;  1ERQ A;  4CQH A;  2WAF A;  1TS8 A;  3GR2 A;  1PW8 A;  3KSF A;  3T4O A;  4QB8 A;  4X1L A;  2DNS A;  3A0S A;  4WZ5 C;  4PKY G;  1SHV A;  2DRW A;  3HJI A;  3G2Y A;  2HDS A;  4OLD A;  4JXG A;  3JVU A;  3EWK A;  4DE2 A;  2KOI A;  1XP4 A;  1ONG A;  4ZBE A;  3QP1 A;  3RXX A;  3FKW A;  1ZG4 A;  2XK1 A;  5D3O A;  4X69 A;  2EFU A;  3NOT C;  4RVA A;  1KE0 A;  1GHI A;  5EEC A;  1L0D A;  2XR0 A;  3L7H A;  2VJW A;  1DJA A;  3H9W A;  2IWD A;  3MQ0 A;  4ETX A;  2QJ5 A;  2QZ6 A;  1STZ A;  2OAQ 1;  1GCE A;  4PKY A;  4JGR A;  4U3T A;  1H0M A;  3GSG A;  3ZG9 B;  2GJ3 A;  4LV1 A;  3ZHH A;  4R38 A;  3LCE A;  3UY6 A;  4S2O A;  1LT0 A;  5EVI A;  4QY6 A;  5G4Y A;  1HLU P;  4WN5 A;  1KDS A;  4K0X A;  1XJ4 A;  2OAP 1;  2WK0 A;  3GEC A;  3C4P A;  3MF0 A;  1JWZ A;  1NXY A;  2ZQA A;  4ZAM A;  1MWS A;  3ZQ5 A;  5F69 A;  3UB7 A;  3SOI A;  4E3N A;  4LV2 A;  4HIA A;  2E8J A;  4G3V A;  4R23 A;  1ES5 A;  2UV0 E;  3FZC A;  2VKS A;  2D01 A;  3DTE A;  1Q2P A;  4NEE D;  3ZVW A;  1C3B A;  4KZ6 A;  4Y3I A;  4EEP A;  3B3X A;  1VQQ A;  3OPH A;  2ZM8 A;  2PYP A;  5TBM B;  3BY9 A;  2EX9 A;  3A3E A;  5DFY A;  2WKR A;  4OP8 A;  3CPT A;  1TD5 A;  4S2J A;  3ZG7 B;  2WYX A;  1I2S A;  4HBT A;  4MEZ A;  2PBD P;  2P08 A;  4L9G A;  1ES4 A;  3V3S A;  4P87 A;  3QP4 A;  1G6O A;  5FI2 A;  5DJU A;  3P98 A;  3ZG8 B;  2G2W A;  2O9C A;  4EER A;  3UB8 A;  4HJ6 A;  3GV9 A;  1HZO A;  3KX0 X;  4Y7P A;  4KQR A;  3TSG A;  4E6X A;  1K54 A;  3QP8 A;  3EQV A;  4KZA A;  5FQQ A;  4DMZ A;  2INW A;  5L8M A;  2Y59 A;  3A3D A;  1V9Z A;  3NOP C;  4EET B;  1S67 L;  4PM7 A;  3E4O A;  5FA7 A;  3T50 A;  4HBU A;  1ES3 A;  3IH8 A;  1VET B;  5HWW A;  1FIL A;  5KIZ A;  5E2H A;  1NLY A;  4YNR A;  1IEM A;  4DDS A;  1LL9 A;  4JF5 A;  4GHI B;  5DF9 A;  4EV4 A;  4LRX C;  1YAX A;  1LLB A;  5GLC A;  4KZ3 A;  5HL1 A;  2JC7 A;  3G34 A;  2OV5 A;  3HLF A;  3VP3 A;  3CI6 A;  3OZH A;  2CC1 A;  1ZG6 A;  2XRN A;  3ZVT A;  4EES A;  2J9O A;  2PYR A;  4WEL A;  4N1H A;  2G2U A;  2I72 A;  2V2F F;  1L0G A;  5HDC A;  1I5Q A;  4DF6 A;  3FC7 A;  4R3A A;  1K25 A;  3CWF A;  5IU1 A;  2XD5 A;  4N92 A;  1IEL A;  1S0W A;  5TGF A;  3UME A;  4P6Z M;  2ZL1 B;  4IUH A;  4KZ7 A;  5FI7 A;  3LGO A;  3VV4 A;  1A0K A;  4MLL A;  1H8M A;  1BTL A;  3OOV A;  1S1Y A;  5DTT A;  3O3V A;  1UGU A;  3IF6 A;  4ZDX A;  2H0T A;  2HDQ A;  3ICY A;  2VLG A;  3CJM A;  3IS2 B;  4WM9 A;  2Y2L A;  5U47 A;  4P6Z S;  1W8Q A;  1K54 C;  5DTK A;  5HSQ A;  1YT4 A;  2QWS A;  2JCH A;  1RP5 A;  3NCK A;  2H28 A;  3IWQ A;  4CLC B;  4FCF A;  4KQO A;  4G3K A;  4OQG A;  5L2F A;  3B47 A;  1ES2 A;  3UB5 P;  1CEG A;  2ZBB A;  4DKI A;  1VHM A;  3OPP A;  1OTB A;  2O9A A;  2EA9 A;  2K31 A;  1VM1 A;  2ZM2 A;  2WGV A;  4ID4 A;  5DF8 A;  4ARZ B;  3Q7V B;  2JKR M;  3FWL A;  4DE3 A;  5GLA A;  1BLC A;  3V67 A;  1MWU A;  3VSL A;  5BOH A;  4X68 A;  4HY8 A;  2JKR I;  4WBG A;  5GHY A;  1FR1 A;  3UDF A;  4R3J A;  2B02 A;  2A3U A;  4DXB A;  2XSS A;  3LEZ A;  4G3W A;  4S2N C;  3CUE A;  3IHB A;  3AGE A;  4GDN A;  3H7W A;  1K57 C;  2HF6 A;  2QMI A;  4K08 A;  4GJ4 A;  2R78 A;  2PU4 A;  2ZMA A;  2V20 A;  2BTF P;  4PM6 A;  3CHW P;  2XQZ A;  3LY4 A;  5AJG A;  1SDN A;  1KOU A;  3CZD A;  4EUZ A;  4OPR A;  2Q0O A;  3WRT A;  5MC7 A;  2ZOI A;  1ZKJ A;  2Z2L B;  1TDL A;  1MZU A;  2WKI A;  3DAV A;  4KEN B;  4JKT A;  4DXC A;  5FQJ A;  3G32 A;  4JGQ A;  4GN2 A;  5HPF A;  4WMC D;  1LHY A;  1N9B A;  4UQI M;  3NUL A;  3UPP A;  1IOU A;  4FOF A;  2P7J A;  3MR0 A;  2J80 A;  2ZQC A;  5F83 A;  2Y2J A;  4OKP A;  3C2W A;  5FAS A;  4PMA A;  1UWP X;  1VEU A;  5FEG A;  2W1T A;  4UHU A;  4D2O A;  3T1R A;  1CF0 A;  2GNX A;  1HVB A;  3PBN A;  1AXB A;  1W5D A;  4NET A;  2OLV A;  1KGE A;  3BWL A;  4X6T A;  4F3L B;  1DY6 A;  2FZ0 A;  2M1C A;  2H0Y A;  1N9L A;  5CTN A;  4H6J B;  5KZH A;  1W8Y A;  3F1P B;  1NWZ A;  1E25 A;  3U2A A;  3WS5 A;  1LL8 A;  4E3I A;  3MQO A;  1YLP A;  5CGS A;  5FQK A;  1TEM A;  4KUO A;  5HWV A;  2P9V B;  3IXD A;  1NRF A;  3IF5 A;  2WGW A;  1WA9 A;  5K5B A;  2M7U A;  3MXR A;  3G6O A;  2JKT I;  4WZ5 A;  3W4O A;  1XGI A;  1OTD A;  2HJ9 C;  1XA1 A;  2X71 A;  3HLE A;  4EQ1 A;  2XLN A;  2HP5 A;  5EVI D;  3A0R A;  1DRM A;  1K56 A;  3F1N B;  1LSV A;  4MN7 A;  5TR7 A;  3ZNY A;  2WGI A;  4KZ4 A;  1MXO A;  2EWV A;  2GDN A;  2Z6D A;  1G28 A;  2J3T D;  4BQM A;  4BBU A;  1XFQ A;  3TRC A;  3PR6 A;  1K4E A;  2XF3 A;  2PHY A;  1KE4 A;  3KSH A;  5AVF A;  3P01 A;  4EW7 A;  3MQQ A;  4EWF A;  1BLS A;  4BL3 A;  1CEF A;  3TE8 A;  2BAS A;  5FAP A;  4DE0 A;  2B18 A;  3E4P A;  4O7D A;  3M2K A;  4R3B A;  3IWI A;  4WF0 A;  1E3U A;  3F1O A;  3IBR A;  3LY3 A;  3QP2 A;  3C5A A;  1XKZ A;  2L4R A;  5FAT A;  3VE3 A;  2PBY A;  5HD3 A;  2EX2 A;  1NYM A;  1CI9 A;  4KG5 A;  4ZJ1 A;  5FAO A;  5EVI B;  3MXS A;  4JGP A;  3IXB A;  5HAR A;  1ONH A;  2Y91 A;  3SS3 A;  5I5L A;  3K3C A;  2HGV A;  4S2L A;  3I7J A;  4QU3 A;  5DKK A;  4UA9 A;  3UE6 A;  2D02 A;  4R4S A;  2V0U A;  3IX4 A;  5GHZ A;  4KG6 A;  3N4I A;  3E98 A;  3HJK A;  1LI0 A;  3MFD A;  4LCL A;  1FCM A;  2WAD A;  3A3I A;  2ZD8 A;  2Y2O A;  3N7W A;  3OLO A;  1XX2 A;  4NXF A;  1T18 A;  4XT2 A;  1SCW A;  3C8C A;  3B33 A;  1NRJ A;  2FH5 A;  2Y8H A;  5F68 A;  1XA7 A; 
#chains in the Genus database with same CATH homology
 3UB5 P;  2PRF A;  2B95 A;  1D1J A;  3L9K A;  4FTX A;  1CQA A;  1CJF A;  3CPT B;  1VEU A;  3MSH A;  5FEG A;  1VET A;  2HZ5 A;  1AWI A;  3NEC A;  4FUW A;  1CF0 A;  3T1R A;  2PAV P;  4X25 A;  1G5U A;  4X1M A;  3U4L P;  2E8J A;  1PNE A;  1K0K A;  4X1L A;  1SZV A;  1F2K A;  1SKO B;  1Z09 A;  4D60 A;  5EV0 A;  1PRQ A;  3D9Y A;  5FEF A;  4ESP A;  3T1Q B;  2ZL1 B;  3CPT A;  3LGO A;  1A0K A;  5EM1 A;  4QWO A;  5EVE A;  2VK3 A;  2PBD P;  2V8C A;  3T1S A;  1YPR A;  3L7H A;  5EM0 A;  3T1X A;  1PFL A;  2BTF P;  2V8F A;  3CHW P;  1SKO A;  1FIK A;  2JKG A;  5FDS A;  1J3W A;  2ACG A;  2JKF A;  1ACF A;  3T12 B;  3DAV A;  1Y4O A;  2ZL1 A;  1VEU B;  1VET B;  3LEQ A;  3NUL A;  3KYE A;  1HLU P;  1FIL A;  3MS6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...