2BTFP

The structure of crystalline profilin-beta-actin
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
139
structure length
139
Chain Sequence
AGWNAYIDNLMADGTCQDAAIVGYKDSPSVWAAVPGKTFVNITPAEVGILVGKDRSSFFVNGLTLGGQKCSVIRDSLLQDGEFTMDLRTKSTGGAPTFNITVTMTAKTLVLLMGKEGVHGGMINKKCYEMASHLRRSQY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure of crystalline profilin-beta-actin.
pubmed doi rcsb
source organism Bos taurus
molecule tags Acetylation and actin-binding
molecule keywords BETA-ACTIN
total genus 34
structure length 139
sequence length 139
ec nomenclature
pdb deposition date 1994-01-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF00235 Profilin Profilin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.30 Alpha Beta 2-Layer Sandwich Beta-Lactamase Dynein light chain 2a, cytoplasmic 2btfP00
1SZVA 1PNEA 3KYEA 1VEUA 1YPRA 5EVEA 1D1JA 2ZL1B 2BTFP 1SKOB 1K0KA 3CHWP 2VK3A 3D9YA 3LGOA 2HZ5A 2JKFA 1A0KA 1FILA 3CPTB 1G5UA 3T1QB 3T12B 1Z09A 2V8FA 3CPTA 4D60A 2ACGA 1HLUP 3NECA 1FIKA 3T1RA 3L9KA 4ESPA 2B95A 1AWIA 2PBDP 1ACFA 1SKOA 1J3WA 2ZL1A 2V8CA 4X25A 3T1XA 1VETA 2E8JA 3NULA 1CJFA 1VETB 1PFLA 2JKGA 3DAVA 3LEQA 3MSHA 4X1LA 5EM1A 3U4LP 1PRQA 5EV0A 1VEUB 1Y4OA 3T1SA 2PAVP 3MS6A 3L7HA 1CQAA 5FEGA 5FEFA 3UB5P 2PRFA 5EM0A 5FDSA 4FTXA 1F2KA 4X1MA 4QWOA 4FUWA 1CF0A
chains in the Genus database with same CATH superfamily
4OQHA 5CTNA 1RP5A 3P98A 3A3DA 3SS5A 3JYIA 4OP5A 2C6WB 3V3SA 4CJNA 1BLSA 5HFOA 4NETA 4KG2A 2L4RA 3M6HA 5EV0A 3QP8A 3R7WB 2K31A 1DJAA 2VV7A 4CLCB 2KX6A 1NZOA 2YKFA 3BY9A 5FQKA 4ARZB 2EFUA 3FV7A 1ONHA 5E2GA 1W8YA 1P9WA 5M19A 1Q2QA 1PIOA 4MN6A 3EEAA 5TFQA 4BENA 3DTEA 2ZM8A 2VA0A 4CLCD 3OBFA 4WUJA 4IUHA 2JKFA 3S4XA 3GR2A 2PT7A 5F1GA 1L0GA 1FIKA 2JKTI 1SDEA 3N8RA 4Y17A 4P87A 1V9YA 1WA9A 4HP4A 5EM0A 4DDYA 5HPIA 1SZVA 3TRCA 1E3UA 3ZFZA 2PU4A 1V9ZA 2PYPA 4LGWA 5MC7A 1CI8A 4U0TA 1WYBA 3ZVWA 3DW0A 3RXXA 4IEDA 1DY6A 3LO7A 3VSKA 5HAIA 3F1OA 4WEKA 4UAAA 1N4OA 4JXSA 3TG9A 2W0NA 3HL9A 5GLAA 4MLLA 1Y28A 2INWA 4IUKA 4K0XA 1K25A 3MQOA 4HESA 4O01A 4WLAA 2V9AA 2R78A 4GB7A 5GLCA 2Y2HA 4Q0HA 4O0PA 1H0MA 4N9KA 4OOLA 1HTZA 2WGIA 4MBFA 1D1JA 1OT9A 3ZGAB 3OOVA 3T50A 2FH5A 1ERMA 3Q07A 4ME4A 3M6BA 5TBMA 3C5AA 1YLZA 2WK0A 2W27A 2ZMAA 5IS1A 4EQIA 1MPLA 3KYEA 4MCWA 4FSFA 3VSLA 3PR6A 4YINA 1GA9A 2IWBA 4HOIA 4OVDA 3A0SA 4EUVA 2J80A 1LSXA 2LB5A 4CLCA 4KUKA 4NG2A 4KQQA 2Y2LA 2PD8A 2NUTC 5L8MA 2PRFA 1XJ4A 3O5YA 2PR5A 1SKFA 3MKFA 3V50A 1SHVA 1H3QA 5HPFA 5G4ZA 3TE8A 1KVMA 5IHVA 2VGLS 4OPZA 3SH7A 3BFFA 4I3IA 2ZM2A 3A3FA 1IOUA 4FH4A 3MS6A 5CERA 2XFTA 2Z2LB 2P9VA 3VFFA 5DVAA 5HL6A 1XX2A 4GD6A 4WEJA 1A0KA 1F98A 3F1NB 1BT5A 2HDUA 1XKZA 4EQ1A 3KSHA 3DTIA 4DE0A 1ZKJA 5CHMA 3IWQA 1PNEA 4UA9A 3PAGA 5AVFA 5HWWA 5FQMA 5J7EA 4WZ4A 4UQIM 2DMWA 4BWIA 4R3AA 4A5RA 3JVUA 4H6JB 4S2NC 5GHZA 1OTBA 2J9PA 4K0WA 2JKGA 3UPOA 1Y4OA 3T1SA 3FKVA 4R1GA 2OWHA 2G2UA 1DP9A 5FI6A 2EX2A 3TW8A 3ZHHA 3SH9A 5TBMB 2XROA 3IXDA 2HV1A 1GA0A 4HJ4A 3LIEA 5D3OA 2B5RA 1N9LA 2R9XA 3NC8A 4X25A 4G3KA 1T19A 4LCMA 1H8ZA 2UWXA 3SOIA 4NEED 5M18A 1TD5A 2P08A 5CHJA 5EPHA 3BFGA 3HVFA 1W8QA 3KYZA 5KZHA 2H10A 2Y2GA 4UA7A 1PI4A 2XGNA 3N8LA 3FPVA 3NULA 3PAEA 3DAVA 4II7A 3UDXA 5DF9A 1TDLA 1G6AA 4F94A 3C30A 5DTTA 1H5XA 4GCZA 2Y2NA 1Q2PA 1XP4A 3QP5A 5EVEA 1W63Q 4P6BA 2OSUA 4GHIB 4HP9A 3C2WA 1KOUA 3E4QA 3GMWA 4PM9A 1PZOA 2GDNA 4KUOA 3G32A 5JYOA 2V2FF 3KSFA 1BLHA 3N6IA 2E8IA 1NY0A 3VV4A 1YQSA 4BLMA 3OC2A 3V3RA 4HBUA 1OJGA 3C7VA 1N9OA 1LL8A 4OPQA 1L3LA 3FPWA 4CLCE 1S1YA 2EXBA 1FCMA 4I3AA 4LV3A 3BECA 4X56A 4Y0TA 1P97A 1VQQA 2J3TD 2W3GA 4LRZE 3HLEA 2GX5A 4LV0A 3MBZA 4R38A 1HD8A 1YMXA 3E2LA 3IS2A 3QP2A 5EFWA 1TF1A 5A91A 5HZHA 1W7FA 4B93A 2P9VB 3IXHA 1IYPA 1K57C 3GECA 5C5KA 3OCLA 1CF0A 1VB6A 3ULFA 5AJGA 5DJTA 5FI2A 2W3FA 3IF5A 4H6JA 4OLDA 3T4OA 4JXWA 2CMNA 4OPYA 3A3EA 2ZC7A 1LL9A 2WKPA 5HWTA 3Q82A 3C8CA 4MN7A 4BBUA 3LR4A 2IA2A 3BYDA 5CGWA 4BJPA 4WF0A 4RX2A 3IT9A 1YLJA 4KG5A 4PM6A 5I5LA 3IXBA 3ZG0A 4DRTA 3PXPA 5CECA 5L07A 2OAP1 2Y8HA 1KVLA 5CGXA 1K54A 1J3WA 5F68A 3L7HA 4R23A 3B42A 3C7UA 4PM8A 3D9YA 4JGPA 1PI5A 1BZAA 2J8YA 2WYXA 3SS3A 3PTEA 1T1CA 3UDIA 2EX6A 4NXGA 3D4FA 4QY6A 1FSYA 1MKIA 3EQVA 1S1ZA 3HREA 1TS7A 4X1MA 4X69A 4EBNA 1MWUA 3EQUA 2VX8A 5HDCA 1NRJA 1E3UD 3F1PB 3MFXA 2XA7M 5FQIA 2HZ5A 4OPRA 2XD5A 4HQAA 5EE8A 3MXRA 1K55C 4FCFA 1M40A 2XLNA 4X1LA 3DTMA 1M6KA 1XGIA 4P0MA 1ZG6A 4XXRA 3S1YA 5HW3A 4NK3A 2XD1A 1YLWA 4QWOA 3RXWA 4Y15A 4H8RA 2WAFA 2P04A 3BM6A 1KE0A 3PHYA 2V8FA 1BUEA 2ZC4B 1AWIA 1NLYA 1BLCA 4BD1A 2X02A 3TSGA 1UWNX 4KZ3A 3VOYA 1W63M 2PU2A 4GN2A 5CX7A 2VEAA 4Y5FA 5FQQA 3VFHA 4Y3IA 4MN5A 3HUOA 4O7DA 4KZ7A 4E04A 3P01A 3LYXA 3LY3A 3BY8A 3OPRA 2WZXA 3PBTA 4IBRA 3NCKA 3IWOA 3F1OB 3T4JA 3KX0X 4WZ5A 5HARA 4FOFA 1G5UA 5FATA 1Z09A 4HI4A 2WKQA 3EOIA 2WKEA 3H7WA 1X0OA 4KZ6A 3LUQA 3SW1A 2A2LA 4GJ4A 1OTAA 4N1HA 3G2YA 1ES3A 3H9WA 2ZQAA 2PR6A 3UY6A 1XGJA 2VLGA 1S66L 4OLGA 3PBRA 1KE3A 4P6ZM 5KSCA 2XF3A 4PKYA 1PW8A 4RVAA 3FZCA 4DJ3A 2ZOHA 2HP9A 4FH2A 1ZHHB 3MXQA 1BSGA 4C75A 5HDSA 4HBTA 1F5MA 3S22A 1VETB 2I72A 1TVFA 3WRTA 3UE0A 1N9NA 2H0YA 1MWSA 2X71A 1KGEA 1TDGA 3T1XA 1QMFA 5GLBA 2ZD8A 5A93A 4MEZA 4GD8A 3NY4A 4PM7A 1FOFA 4QJGA 5G4YA 2ZQ7A 1S4SA 4WZ5C 4IVIA 5CEDA 2ZM0A 2BLSA 4M3KA 3LICA 1XA1A 2FFYA 3IH9A 2WAEA 1PYYA 4GDBA 3WRZA 2D02A 4JXVA 1JVJA 2Q9NA 1CEGA 3V67A 3O3VA 4BL3A 5DKLA 3BRMA 2ZJ9A 4RA7A 3ZG7B 3FWLA 4Q8IA 3EGDC 3T1RA 2JCHA 3LR0A 2M7VA 4XT2B 2DCFA 2E8JA 4HJ3A 4CLCC 2Y2KA 5AQBA 3V39A 4P85A 4E3JA 1CQAA 4QD4A 2G7UA 2WGWA 2V20A 1Y54A 4JPMA 3W2ZA 1NXYA 3MMHA 3KSIA 3C4PA 1XXMA 4X68A 3T4KA 3Q1FA 1BULA 4ZDXA 1CK3A 3VOLA 2H28A 1GSXA 4L0LA 4JXGA 5A92A 2OLUA 5AQAA 3AGDA 3QNCA 2J9OA 4KZ9A 3LIFA 2BTFP 1LI0A 2FFFB 2V1AA 2ZC3B 1I5QA 2GNXA 3Q7VB 5G18A 2JKRM 4ZJ1A 4WN5A 1LHYA 3NOTC 5HL1A 5DFYA 4F3LB 4MNRA 2J7VA 5KMWA 1ZG4A 4L9FA 3LI8A 4GLQA 4JGRA 4YNRA 3F1NA 3V5MA 1HVBA 4Y2FA 2PBDP 3LCEA 4YOFA 2V0UA 5EM1A 3C4OA 4WMCD 3IX8A 1IYOA 1DRMA 5FQJA 3CI6A 2PD7A 3NDEA 1MWRA 2VK3A 3PYPA 3WS1A 1K55A 4MBKA 5CXWA 4K08A 3NI9A 2QJ5A 4KQOA 4S2PA 4R4RA 4HIAA 3VP0A 3K3CA 1S67L 4DN0A 3UE6A 3RTYA 5FAQA 3LEZA 3T4QA 3CHWP 3VMAA 3H7WB 3T1QB 4Z9QA 4RQ9A 3UE3A 1P0ZA 5I94A 3DWZA 4L9EA 3SS4A 4DXBA 3NJAA 3MZFA 2Y55A 3BWLA 4KQRA 2Y2QA 4X53A 4EU0A 1F9IA 4OOMA 3OZHA 1STZA 3ISGA 3MQ0A 4LPZA 4U3TA 4PM5A 4PPRA 1LSVA 1TEMA 5A8BA 1SKOA 4MDZA 3ZG9B 3P09A 4JLFA 4R6LA 3LFVA 4O8GA 2HDSA 1S4RA 4C3QA 2RL3A 1MY8A 5GLDA 4E6WA 1CEFA 4KZAA 1JTGA 4ARZA 4EERA 1G6OA 1SCWA 2ACGA 5FAOA 2O9CA 3E4OA 1ACFA 4JBFA 2ZLYA 2XR0A 2QMIA 4C6YA 3ZNTA 2JHEA 2K7SA 3RH8B 1IFQA 1IEMA 3GSGA 4Q0IA 4IHQA 5E2FA 2ZBBA 3I7JA 2Y2JA 3BFDA 3BJNA 2DNSA 1YLYA 4S2JA 4WMCA 2OV5A 4BMWA 1VHMA 1LSWA 3DBAA 3IWIA 5J8XA 1S6RA 5M1AA 2HJEA 4GKUA 4X6TA 5HAPA 1FSWA 5F6AA 3IX4A 3UMEA 1J9MA 2JKTM 4DF6A 4BBTA 3MJQA 3NDGA 5KIZA 1GHMA 2Y4AA 2RCXA 1N9BA 2O9BA 1WE4A 3HCYA 4RYEA 2X01A 5F82A 5DKKA 5FQ9A 4PMAA 3IX3A 4F3LA 5GHYA 4E6XA 1FR6A 4UA6A 3BW6A 4K91A 3WWXA 2ZQ8A 4B9OA 5AVEA 3QHYA 3Q7ZA 5CEBA 1K56D 5CTMA 5TGFA 5E2EA 3HLCA 3G2ZA 3ZG8B 3MQQA 3IH8A 1YKDA 1U60A 3VE4A 2Z6CA 1NJ4A 4E3NA 4LCLA 5L2FA 1IKIA 3WS5A 4M4XA 5F5YA 3VP3A 3SH8A 1QMEA 4PHTA 4S2NA 4GS9B 1I2WA 5J4EA 3DTKA 3CG5A 3E2KA 3T4SA 4I39A 2Y2PA 2GZAA 1LL5A 2O99A 3NOUC 1E4DA 4BL2A 4R70A 4ID4A 3VP1A 3HJKA 2WUQA 3OPPA 4X55A 1Z6FA 2O0YA 4EEPA 2ZOIA 1ESIA 4Y0OA 4EEUA 2ZC6B 1EW0A 3WS2A 4JF6A 1NZUA 1C3BA 2EA9A 1GCEA 2V0WA 1ZTUA 2PAVP 5FDSA 1OPXA 3ZQ5A 2XSSA 1BYWA 3QNBA 4OH0A 4GDNA 3GDIA 1XFNA 2WKRA 3VE3A 1LLBA 1OJ5A 1NYMA 2ZMVA 1PWDA 2WGVA 3IF6A 4OP8A 4Y13A 1EROA 1XA7A 1OTIA 3ZG5A 3N7WA 3ZCZA 3W8KA 4MBHA 5DFXA 2OOLA 1PWCA 4GNUA 1FQGA 4UHUA 1HLUP 3UPPA 2XRNA 3E98A 4YFMA 4GW9A 3N4IA 3BFCA 5FDHA 3EEHA 3RFBA 5HDDA 1DP6A 2PYRA 1KE4A 3HLGA 1MXOA 2FZ0A 2OWJA 1K4FA 3NHQA 3A0VA 3DWKA 5HAQA 4OOYA 2QJ7A 5LBRA 4ETZA 3T12B 2JN7A 4HEFA 5FI7A 2HDRA 4CQHA 1PFLA 1RGYA 2VV6A 1YLTA 1TS0A 1E25A 2WZZA 2VZWA 3UB5P 2Q9MA 1G28A 1UWPX 3LGOA 3U2AA 1YSPA 2W3DA 1MC0A 4GS9A 1DJBA 2ZMFA 2CC1A 2XDMA 3ZDJA 4QPRA 3LIDA 3CPTA 1T18A 4EWFA 3HUMA 3IBJA 3IF6C 1IYSA 3IQAA 2V8CA 2JKRI 3MSHA 4EESA 3PBSA 4ZJ2A 2HP5A 4WM9A 2LB9A 3R4KA 3IHBA 1ES4A 5FEGA 2MJ6A 3S7OA 5EVIA 1DJCA 2ZL1B 3UB6A 2WKHA 1MKMA 3G35A 3UO9A 3HBRA 2VGKA 2EWWA 2VKSA 4AFIA 4KG6A 2A3UA 2EX8A 2B18A 3LY4A 4MMNA 2BASA 1OMEA 1TS8A 3K2NA 1K0KA 4G3WA 4KZ5A 5FAPA 4FD8A 5EVLA 2KOIA 3VP2A 2XFSA 1XJ2A 1JWPA 4ZJ3A 1H8YA 1NRFA 4R3BA 5F69A 3UPNA 4S2MA 3CZDA 2Q0OA 4S2IA 4EW7A 4EXOA 3FYZA 2Y2OA 3VP4A 3CAXA 4LRYC 5FASA 4OKPA 4DE3A 3UE1A 3EGXC 1FILA 4NXBA 4EBLA 4DJ2A 1FCNA 2A49A 2G2WA 4ZAMA 1L0EA 1O7EA 3AGFA 5FSRA 4WELA 5TR7A 1VEUB 4OQ0A 2QZ6A 3MZDA 4DMZA 2IWCA 1YPRA 1XPBA 1AXBA 3M2JA 1EWZA 3T4LA 2VGJA 3QP4A 2QHKA 5TJJA 3CLOA 2M1CA 4ETXA 2W1RA 2GJ3A 2B95A 1RCJA 2VV8A 3R7WA 4JKTA 3ITBA 2Z6DA 3K3DA 1OTDA 2W1TB 3BLMA 3UDFA 2C5WB 3ZVTA 1MWTA 5F83A 3HLBA 4JGOA 2K2NA 3ITAA 3MXSA 3NECA 3OPHA 3G34A 1G68A 1K38A 2EFXA 1JTDA 3PBNA 3UN7A 3ICYA 2PDRA 1ESUA 4JF4A 3LR5A 1ODVA 3HJIA 1T1BA 2PBYA 3P7NA 3CPTB 4L9GA 4BQMA 3EWKA 4ESPA 2UV0E 1XJ6A 2W3EA 1IYQA 3B33A 3ZNYA 3KSGA 1BTLA 5F1FA 1KGGA 4LENA 1F2KA 4EBPA 2J3TC 1OTEA 4UQIS 4E3MA 3PBQA 1IELA 4JF5A 4HY8A 3H82A 4NXFA 4DE2A 1MBLA 3NOPC 3MKEA 2R9WA 3E4PA 3Q81A 1ES5A 3JVVA 3IXGA 2Y2IA 3BLSA 1K6SA 1JWZA 3UNWA 5GL9A 4HH3A 5DJUA 1K56A 2AVXA 4B4XA 3IF6B 3WS0A 1JWVA 3G31A 4QU3A 4LLOB 1YSQA 2ZC5B 3IBRA 4RX3A 1W79A 2XK1A 3GQZA 4WYYA 5DTKA 4Y7PA 3OLOA 5CHUA 4CPKA 1P9RA 3S7PA 3CITA 4LV1A 4ZTKA 3Q7VA 1NYYA 2M7UA 4I5SA 2OLVA 4QY5A 4EETB 4IJGA 3SZTA 3S7NA 5EOOA 4UEYA 4KZ4A 3G4PA 1D06A 1YT4A 5HD3A 3G30A 4HJ6A 5U47A 1L0DA 2Z2MB 5E43A 4KENB 3IHAA 5IT5A 3NBLA 2L1MA 3GV9A 3LIBA 3A3JA 4LRXC 1TS6A 3U4LP 4S2OA 4DE1A 2EX9A 2QKPA 2VJWA 4EV4A 3ZYTA 2NUPC 5KSHA 3T4TA 2W3HA 2HPBA 1XJ3A 3MR0A 2Y79A 1K6RA 3BQ8A 3LI9A 3CWFA 5GHXA 1BLPA 2WADA 2JC7A 4QB8A 3UB8A 3CMZA 3PBOA 4QHCA 1SDNA 3FG8A 2YKHA 4BBVA 3W4QA 3N8SA 3QP1A 3BEBA 1UGUA 5DF7A 4KZ8A 2HDQA 5JYPA 1KGFA 1YMSA 1ALQA 2ZQ9A 4XUXA 5J3WA 1OT6A 1S0WA 3UB9A 5CRFA 4NXEA 3LR3A 5L10A 4I3JA 3A0RA 3CUEA 3UB7A 1O07A 2KDKA 2P74A 2A24A 1ONGA 1DP8A 1KDWA 1L2SA 4PKYG 1VETA 1FCOA 1EI5A 2J3WA 3O87A 3BQAA 3LIAA 1FR1A 4E3OA 3NIAA 2H5SA 2ZQDA 3CUEC 3S7QA 4LV2A 2O9AA 2HGVA 3FKWA 4R0QA 2D01A 1KDSA 4DKIA 1RGZA 5EVID 5EOEA 4N92A 1ES2A 1T1AA 2XEPA 4HNBA 1ERQA 2QYBA 1YM1A 4B4ZA 5HWVA 5FL3A 4OQIA 2EXAA 5DF8A 1GHIA 4JGQA 2OAQ1 1WYCA 5AQ7A 1VM1A 4ZBEA 2DRWA 3MFDA 5EVIC 1PZPA 2XH9A 1K57A 1SKOB 3OPLA 2Y59A 4IBXA 3JPUA 4EUZA 1D7EA 1H8MA 4OONA 4D2OA 4N9LA 1PWGA 1CJFA 4LFUA 4I38A 1K4EA 3HUNA 4HH2A 3OCNA 5HD5A 1LT0A 2V1BA 5FA7A 3W4OA 4WBGA 1VEUA 4HHDA 1YLPA 3RJUA 2I9VA 4GZBA 3KO6A 4Z1WA 4KQDA 3VOZA 3MF0A 3TJZC 1PRQA 1NLZA 5AQ9A 3MZEA 3HLFA 2P7JA 4FTXA 4FUWA 4PAUA 1GSWA 2HJ9C 4Y0UA 5DTSA 5IU1A 4S2LA 1ZC2A 1W5DA 2Y91A 1L0FA 3FC7A 3UMDA 1GHPA 3KYQA 2XQZA 5K5BA 1JNUA 4E3KA 2QPNA 2BG1A 2Y2MA 3W4PA 4G3VA 4R3JA 4P6ZS 2L0WA 1I2SA 3TOIA 1PW1A 5E2HA 3D72A 3HLWA 5EECA 3B3XA 4N1XA 5CGSA 2KLIA 2JBFA 2QWSA 4KZBA 4GOGA 3M2KA 4OQGA 2H0TA 4U0XA 5EVIB 1CI9A 2PHYA 1GSVA 2HP6A 4YWZA 2B02A 3GVBA 3IS2B 5BOHA 4Q0JA 2A24B 4GHIA 5L09A 1K54C 2HF6A 1MZUA 2V1ZA 2XA7S 3BFEA 4WL9A 3O86A 1YAXA 3CJMA 3F1PA 3LEQA 1XFQA 4E3IA 5EUAA 2WKIA 3AGEA 2EWVA 3H82B 2VGLM 1HZOA 3O88A 3C38A 4D60A 3WS4A 3L9KA 3HLDA 4DXCA 3D3OA 2ZL1A 4BD0A 4B88A 2IWDA 4S2KA 3GRJA 3GTCA 4NKPA 2W1TA 5FEFA 5HSQA 1IKGA 4DDSA 4IVKA 4XUZA 4XT2A 1NWZA 4R4SA 2ZQCA 4ZRRA 3G6OA 3A3IA 2JE5A 5A90A 2WGWB 5HX9A 3B47A 1LI9A 3E0YA 4E3LA 3QP6A
chains in the Genus database with same CATH topology
1SZVA 1PNEA 3KYEA 1VEUA 1YPRA 5EVEA 1D1JA 2ZL1B 2BTFP 1SKOB 1K0KA 3CHWP 2VK3A 3D9YA 3LGOA 2HZ5A 2JKFA 1A0KA 1FILA 3CPTB 1G5UA 3T1QB 3T12B 1Z09A 2V8FA 3CPTA 4D60A 2ACGA 1HLUP 3NECA 1FIKA 3T1RA 3L9KA 4ESPA 2B95A 1AWIA 2PBDP 1ACFA 1SKOA 1J3WA 2ZL1A 2V8CA 4X25A 3T1XA 1VETA 2E8JA 3NULA 1CJFA 1VETB 1PFLA 2JKGA 3DAVA 3LEQA 3MSHA 4X1LA 5EM1A 3U4LP 1PRQA 5EV0A 1VEUB 1Y4OA 3T1SA 2PAVP 3MS6A 3L7HA 1CQAA 5FEGA 5FEFA 3UB5P 2PRFA 5EM0A 5FDSA 4FTXA 1F2KA 4X1MA 4QWOA 4FUWA 1CF0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SZV A;  1PNE A;  3KYE A;  1VEU A;  1YPR A;  5EVE A;  1D1J A;  2ZL1 B;  2BTF P;  1SKO B;  1K0K A;  3CHW P;  2VK3 A;  3D9Y A;  3LGO A;  2HZ5 A;  2JKF A;  1A0K A;  1FIL A;  3CPT B;  1G5U A;  3T1Q B;  3T12 B;  1Z09 A;  2V8F A;  3CPT A;  4D60 A;  2ACG A;  1HLU P;  3NEC A;  1FIK A;  3T1R A;  3L9K A;  4ESP A;  2B95 A;  1AWI A;  2PBD P;  1ACF A;  1SKO A;  1J3W A;  2ZL1 A;  2V8C A;  4X25 A;  3T1X A;  1VET A;  2E8J A;  3NUL A;  1CJF A;  1VET B;  1PFL A;  2JKG A;  3DAV A;  3LEQ A;  3MSH A;  4X1L A;  5EM1 A;  3U4L P;  1PRQ A;  5EV0 A;  1VEU B;  1Y4O A;  3T1S A;  2PAV P;  3MS6 A;  3L7H A;  1CQA A;  5FEG A;  5FEF A;  3UB5 P;  2PRF A;  5EM0 A;  5FDS A;  4FTX A;  1F2K A;  4X1M A;  4QWO A;  4FUW A;  1CF0 A; 
#chains in the Genus database with same CATH topology
 4OQH A;  5CTN A;  1RP5 A;  3P98 A;  3A3D A;  3SS5 A;  3JYI A;  4OP5 A;  2C6W B;  3V3S A;  4CJN A;  1BLS A;  5HFO A;  4NET A;  4KG2 A;  2L4R A;  3M6H A;  5EV0 A;  3QP8 A;  3R7W B;  2K31 A;  1DJA A;  2VV7 A;  4CLC B;  2KX6 A;  1NZO A;  2YKF A;  3BY9 A;  5FQK A;  4ARZ B;  2EFU A;  3FV7 A;  1ONH A;  5E2G A;  1W8Y A;  1P9W A;  5M19 A;  1Q2Q A;  1PIO A;  4MN6 A;  3EEA A;  5TFQ A;  4BEN A;  3DTE A;  2ZM8 A;  2VA0 A;  4CLC D;  3OBF A;  4WUJ A;  4IUH A;  2JKF A;  3S4X A;  3GR2 A;  2PT7 A;  5F1G A;  1L0G A;  1FIK A;  2JKT I;  1SDE A;  3N8R A;  4Y17 A;  4P87 A;  1V9Y A;  1WA9 A;  4HP4 A;  5EM0 A;  4DDY A;  5HPI A;  1SZV A;  3TRC A;  1E3U A;  3ZFZ A;  2PU4 A;  1V9Z A;  2PYP A;  4LGW A;  5MC7 A;  1CI8 A;  4U0T A;  1WYB A;  3ZVW A;  3DW0 A;  3RXX A;  4IED A;  1DY6 A;  3LO7 A;  3VSK A;  5HAI A;  3F1O A;  4WEK A;  4UAA A;  1N4O A;  4JXS A;  3TG9 A;  2W0N A;  3HL9 A;  5GLA A;  4MLL A;  1Y28 A;  2INW A;  4IUK A;  4K0X A;  1K25 A;  3MQO A;  4HES A;  4O01 A;  4WLA A;  2V9A A;  2R78 A;  4GB7 A;  5GLC A;  2Y2H A;  4Q0H A;  4O0P A;  1H0M A;  4N9K A;  4OOL A;  1HTZ A;  2WGI A;  4MBF A;  1D1J A;  1OT9 A;  3ZGA B;  3OOV A;  3T50 A;  2FH5 A;  1ERM A;  3Q07 A;  4ME4 A;  3M6B A;  5TBM A;  3C5A A;  1YLZ A;  2WK0 A;  2W27 A;  2ZMA A;  5IS1 A;  4EQI A;  1MPL A;  3KYE A;  4MCW A;  4FSF A;  3VSL A;  3PR6 A;  4YIN A;  1GA9 A;  2IWB A;  4HOI A;  4OVD A;  3A0S A;  4EUV A;  2J80 A;  1LSX A;  2LB5 A;  4CLC A;  4KUK A;  4NG2 A;  4KQQ A;  2Y2L A;  2PD8 A;  2NUT C;  5L8M A;  2PRF A;  1XJ4 A;  3O5Y A;  2PR5 A;  1SKF A;  3MKF A;  3V50 A;  1SHV A;  1H3Q A;  5HPF A;  5G4Z A;  3TE8 A;  1KVM A;  5IHV A;  2VGL S;  4OPZ A;  3SH7 A;  3BFF A;  4I3I A;  2ZM2 A;  3A3F A;  1IOU A;  4FH4 A;  3MS6 A;  5CER A;  2XFT A;  2Z2L B;  2P9V A;  3VFF A;  5DVA A;  5HL6 A;  1XX2 A;  4GD6 A;  4WEJ A;  1A0K A;  1F98 A;  3F1N B;  1BT5 A;  2HDU A;  1XKZ A;  4EQ1 A;  3KSH A;  3DTI A;  4DE0 A;  1ZKJ A;  5CHM A;  3IWQ A;  1PNE A;  4UA9 A;  3PAG A;  5AVF A;  5HWW A;  5FQM A;  5J7E A;  4WZ4 A;  4UQI M;  2DMW A;  4BWI A;  4R3A A;  4A5R A;  3JVU A;  4H6J B;  4S2N C;  5GHZ A;  1OTB A;  2J9P A;  4K0W A;  2JKG A;  3UPO A;  1Y4O A;  3T1S A;  3FKV A;  4R1G A;  2OWH A;  2G2U A;  1DP9 A;  5FI6 A;  2EX2 A;  3TW8 A;  3ZHH A;  3SH9 A;  5TBM B;  2XRO A;  3IXD A;  2HV1 A;  1GA0 A;  4HJ4 A;  3LIE A;  5D3O A;  2B5R A;  1N9L A;  2R9X A;  3NC8 A;  4X25 A;  4G3K A;  1T19 A;  4LCM A;  1H8Z A;  2UWX A;  3SOI A;  4NEE D;  5M18 A;  1TD5 A;  2P08 A;  5CHJ A;  5EPH A;  3BFG A;  3HVF A;  1W8Q A;  3KYZ A;  5KZH A;  2H10 A;  2Y2G A;  4UA7 A;  1PI4 A;  2XGN A;  3N8L A;  3FPV A;  3NUL A;  3PAE A;  3DAV A;  4II7 A;  3UDX A;  5DF9 A;  1TDL A;  1G6A A;  4F94 A;  3C30 A;  5DTT A;  1H5X A;  4GCZ A;  2Y2N A;  1Q2P A;  1XP4 A;  3QP5 A;  5EVE A;  1W63 Q;  4P6B A;  2OSU A;  4GHI B;  4HP9 A;  3C2W A;  1KOU A;  3E4Q A;  3GMW A;  4PM9 A;  1PZO A;  2GDN A;  4KUO A;  3G32 A;  5JYO A;  2V2F F;  3KSF A;  1BLH A;  3N6I A;  2E8I A;  1NY0 A;  3VV4 A;  1YQS A;  4BLM A;  3OC2 A;  3V3R A;  4HBU A;  1OJG A;  3C7V A;  1N9O A;  1LL8 A;  4OPQ A;  1L3L A;  3FPW A;  4CLC E;  1S1Y A;  2EXB A;  1FCM A;  4I3A A;  4LV3 A;  3BEC A;  4X56 A;  4Y0T A;  1P97 A;  1VQQ A;  2J3T D;  2W3G A;  4LRZ E;  3HLE A;  2GX5 A;  4LV0 A;  3MBZ A;  4R38 A;  1HD8 A;  1YMX A;  3E2L A;  3IS2 A;  3QP2 A;  5EFW A;  1TF1 A;  5A91 A;  5HZH A;  1W7F A;  4B93 A;  2P9V B;  3IXH A;  1IYP A;  1K57 C;  3GEC A;  5C5K A;  3OCL A;  1CF0 A;  1VB6 A;  3ULF A;  5AJG A;  5DJT A;  5FI2 A;  2W3F A;  3IF5 A;  4H6J A;  4OLD A;  3T4O A;  4JXW A;  2CMN A;  4OPY A;  3A3E A;  2ZC7 A;  1LL9 A;  2WKP A;  5HWT A;  3Q82 A;  3C8C A;  4MN7 A;  4BBU A;  3LR4 A;  2IA2 A;  3BYD A;  5CGW A;  4BJP A;  4WF0 A;  4RX2 A;  3IT9 A;  1YLJ A;  4KG5 A;  4PM6 A;  5I5L A;  3IXB A;  3ZG0 A;  4DRT A;  3PXP A;  5CEC A;  5L07 A;  2OAP 1;  2Y8H A;  1KVL A;  5CGX A;  1K54 A;  1J3W A;  5F68 A;  3L7H A;  4R23 A;  3B42 A;  3C7U A;  4PM8 A;  3D9Y A;  4JGP A;  1PI5 A;  1BZA A;  2J8Y A;  2WYX A;  3SS3 A;  3PTE A;  1T1C A;  3UDI A;  2EX6 A;  4NXG A;  3D4F A;  4QY6 A;  1FSY A;  1MKI A;  3EQV A;  1S1Z A;  3HRE A;  1TS7 A;  4X1M A;  4X69 A;  4EBN A;  1MWU A;  3EQU A;  2VX8 A;  5HDC A;  1NRJ A;  1E3U D;  3F1P B;  3MFX A;  2XA7 M;  5FQI A;  2HZ5 A;  4OPR A;  2XD5 A;  4HQA A;  5EE8 A;  3MXR A;  1K55 C;  4FCF A;  1M40 A;  2XLN A;  4X1L A;  3DTM A;  1M6K A;  1XGI A;  4P0M A;  1ZG6 A;  4XXR A;  3S1Y A;  5HW3 A;  4NK3 A;  2XD1 A;  1YLW A;  4QWO A;  3RXW A;  4Y15 A;  4H8R A;  2WAF A;  2P04 A;  3BM6 A;  1KE0 A;  3PHY A;  2V8F A;  1BUE A;  2ZC4 B;  1AWI A;  1NLY A;  1BLC A;  4BD1 A;  2X02 A;  3TSG A;  1UWN X;  4KZ3 A;  3VOY A;  1W63 M;  2PU2 A;  4GN2 A;  5CX7 A;  2VEA A;  4Y5F A;  5FQQ A;  3VFH A;  4Y3I A;  4MN5 A;  3HUO A;  4O7D A;  4KZ7 A;  4E04 A;  3P01 A;  3LYX A;  3LY3 A;  3BY8 A;  3OPR A;  2WZX A;  3PBT A;  4IBR A;  3NCK A;  3IWO A;  3F1O B;  3T4J A;  3KX0 X;  4WZ5 A;  5HAR A;  4FOF A;  1G5U A;  5FAT A;  1Z09 A;  4HI4 A;  2WKQ A;  3EOI A;  2WKE A;  3H7W A;  1X0O A;  4KZ6 A;  3LUQ A;  3SW1 A;  2A2L A;  4GJ4 A;  1OTA A;  4N1H A;  3G2Y A;  1ES3 A;  3H9W A;  2ZQA A;  2PR6 A;  3UY6 A;  1XGJ A;  2VLG A;  1S66 L;  4OLG A;  3PBR A;  1KE3 A;  4P6Z M;  5KSC A;  2XF3 A;  4PKY A;  1PW8 A;  4RVA A;  3FZC A;  4DJ3 A;  2ZOH A;  2HP9 A;  4FH2 A;  1ZHH B;  3MXQ A;  1BSG A;  4C75 A;  5HDS A;  4HBT A;  1F5M A;  3S22 A;  1VET B;  2I72 A;  1TVF A;  3WRT A;  3UE0 A;  1N9N A;  2H0Y A;  1MWS A;  2X71 A;  1KGE A;  1TDG A;  3T1X A;  1QMF A;  5GLB A;  2ZD8 A;  5A93 A;  4MEZ A;  4GD8 A;  3NY4 A;  4PM7 A;  1FOF A;  4QJG A;  5G4Y A;  2ZQ7 A;  1S4S A;  4WZ5 C;  4IVI A;  5CED A;  2ZM0 A;  2BLS A;  4M3K A;  3LIC A;  1XA1 A;  2FFY A;  3IH9 A;  2WAE A;  1PYY A;  4GDB A;  3WRZ A;  2D02 A;  4JXV A;  1JVJ A;  2Q9N A;  1CEG A;  3V67 A;  3O3V A;  4BL3 A;  5DKL A;  3BRM A;  2ZJ9 A;  4RA7 A;  3ZG7 B;  3FWL A;  4Q8I A;  3EGD C;  3T1R A;  2JCH A;  3LR0 A;  2M7V A;  4XT2 B;  2DCF A;  2E8J A;  4HJ3 A;  4CLC C;  2Y2K A;  5AQB A;  3V39 A;  4P85 A;  4E3J A;  1CQA A;  4QD4 A;  2G7U A;  2WGW A;  2V20 A;  1Y54 A;  4JPM A;  3W2Z A;  1NXY A;  3MMH A;  3KSI A;  3C4P A;  1XXM A;  4X68 A;  3T4K A;  3Q1F A;  1BUL A;  4ZDX A;  1CK3 A;  3VOL A;  2H28 A;  1GSX A;  4L0L A;  4JXG A;  5A92 A;  2OLU A;  5AQA A;  3AGD A;  3QNC A;  2J9O A;  4KZ9 A;  3LIF A;  2BTF P;  1LI0 A;  2FFF B;  2V1A A;  2ZC3 B;  1I5Q A;  2GNX A;  3Q7V B;  5G18 A;  2JKR M;  4ZJ1 A;  4WN5 A;  1LHY A;  3NOT C;  5HL1 A;  5DFY A;  4F3L B;  4MNR A;  2J7V A;  5KMW A;  1ZG4 A;  4L9F A;  3LI8 A;  4GLQ A;  4JGR A;  4YNR A;  3F1N A;  3V5M A;  1HVB A;  4Y2F A;  2PBD P;  3LCE A;  4YOF A;  2V0U A;  5EM1 A;  3C4O A;  4WMC D;  3IX8 A;  1IYO A;  1DRM A;  5FQJ A;  3CI6 A;  2PD7 A;  3NDE A;  1MWR A;  2VK3 A;  3PYP A;  3WS1 A;  1K55 A;  4MBK A;  5CXW A;  4K08 A;  3NI9 A;  2QJ5 A;  4KQO A;  4S2P A;  4R4R A;  4HIA A;  3VP0 A;  3K3C A;  1S67 L;  4DN0 A;  3UE6 A;  3RTY A;  5FAQ A;  3LEZ A;  3T4Q A;  3CHW P;  3VMA A;  3H7W B;  3T1Q B;  4Z9Q A;  4RQ9 A;  3UE3 A;  1P0Z A;  5I94 A;  3DWZ A;  4L9E A;  3SS4 A;  4DXB A;  3NJA A;  3MZF A;  2Y55 A;  3BWL A;  4KQR A;  2Y2Q A;  4X53 A;  4EU0 A;  1F9I A;  4OOM A;  3OZH A;  1STZ A;  3ISG A;  3MQ0 A;  4LPZ A;  4U3T A;  4PM5 A;  4PPR A;  1LSV A;  1TEM A;  5A8B A;  1SKO A;  4MDZ A;  3ZG9 B;  3P09 A;  4JLF A;  4R6L A;  3LFV A;  4O8G A;  2HDS A;  1S4R A;  4C3Q A;  2RL3 A;  1MY8 A;  5GLD A;  4E6W A;  1CEF A;  4KZA A;  1JTG A;  4ARZ A;  4EER A;  1G6O A;  1SCW A;  2ACG A;  5FAO A;  2O9C A;  3E4O A;  1ACF A;  4JBF A;  2ZLY A;  2XR0 A;  2QMI A;  4C6Y A;  3ZNT A;  2JHE A;  2K7S A;  3RH8 B;  1IFQ A;  1IEM A;  3GSG A;  4Q0I A;  4IHQ A;  5E2F A;  2ZBB A;  3I7J A;  2Y2J A;  3BFD A;  3BJN A;  2DNS A;  1YLY A;  4S2J A;  4WMC A;  2OV5 A;  4BMW A;  1VHM A;  1LSW A;  3DBA A;  3IWI A;  5J8X A;  1S6R A;  5M1A A;  2HJE A;  4GKU A;  4X6T A;  5HAP A;  1FSW A;  5F6A A;  3IX4 A;  3UME A;  1J9M A;  2JKT M;  4DF6 A;  4BBT A;  3MJQ A;  3NDG A;  5KIZ A;  1GHM A;  2Y4A A;  2RCX A;  1N9B A;  2O9B A;  1WE4 A;  3HCY A;  4RYE A;  2X01 A;  5F82 A;  5DKK A;  5FQ9 A;  4PMA A;  3IX3 A;  4F3L A;  5GHY A;  4E6X A;  1FR6 A;  4UA6 A;  3BW6 A;  4K91 A;  3WWX A;  2ZQ8 A;  4B9O A;  5AVE A;  3QHY A;  3Q7Z A;  5CEB A;  1K56 D;  5CTM A;  5TGF A;  5E2E A;  3HLC A;  3G2Z A;  3ZG8 B;  3MQQ A;  3IH8 A;  1YKD A;  1U60 A;  3VE4 A;  2Z6C A;  1NJ4 A;  4E3N A;  4LCL A;  5L2F A;  1IKI A;  3WS5 A;  4M4X A;  5F5Y A;  3VP3 A;  3SH8 A;  1QME A;  4PHT A;  4S2N A;  4GS9 B;  1I2W A;  5J4E A;  3DTK A;  3CG5 A;  3E2K A;  3T4S A;  4I39 A;  2Y2P A;  2GZA A;  1LL5 A;  2O99 A;  3NOU C;  1E4D A;  4BL2 A;  4R70 A;  4ID4 A;  3VP1 A;  3HJK A;  2WUQ A;  3OPP A;  4X55 A;  1Z6F A;  2O0Y A;  4EEP A;  2ZOI A;  1ESI A;  4Y0O A;  4EEU A;  2ZC6 B;  1EW0 A;  3WS2 A;  4JF6 A;  1NZU A;  1C3B A;  2EA9 A;  1GCE A;  2V0W A;  1ZTU A;  2PAV P;  5FDS A;  1OPX A;  3ZQ5 A;  2XSS A;  1BYW A;  3QNB A;  4OH0 A;  4GDN A;  3GDI A;  1XFN A;  2WKR A;  3VE3 A;  1LLB A;  1OJ5 A;  1NYM A;  2ZMV A;  1PWD A;  2WGV A;  3IF6 A;  4OP8 A;  4Y13 A;  1ERO A;  1XA7 A;  1OTI A;  3ZG5 A;  3N7W A;  3ZCZ A;  3W8K A;  4MBH A;  5DFX A;  2OOL A;  1PWC A;  4GNU A;  1FQG A;  4UHU A;  1HLU P;  3UPP A;  2XRN A;  3E98 A;  4YFM A;  4GW9 A;  3N4I A;  3BFC A;  5FDH A;  3EEH A;  3RFB A;  5HDD A;  1DP6 A;  2PYR A;  1KE4 A;  3HLG A;  1MXO A;  2FZ0 A;  2OWJ A;  1K4F A;  3NHQ A;  3A0V A;  3DWK A;  5HAQ A;  4OOY A;  2QJ7 A;  5LBR A;  4ETZ A;  3T12 B;  2JN7 A;  4HEF A;  5FI7 A;  2HDR A;  4CQH A;  1PFL A;  1RGY A;  2VV6 A;  1YLT A;  1TS0 A;  1E25 A;  2WZZ A;  2VZW A;  3UB5 P;  2Q9M A;  1G28 A;  1UWP X;  3LGO A;  3U2A A;  1YSP A;  2W3D A;  1MC0 A;  4GS9 A;  1DJB A;  2ZMF A;  2CC1 A;  2XDM A;  3ZDJ A;  4QPR A;  3LID A;  3CPT A;  1T18 A;  4EWF A;  3HUM A;  3IBJ A;  3IF6 C;  1IYS A;  3IQA A;  2V8C A;  2JKR I;  3MSH A;  4EES A;  3PBS A;  4ZJ2 A;  2HP5 A;  4WM9 A;  2LB9 A;  3R4K A;  3IHB A;  1ES4 A;  5FEG A;  2MJ6 A;  3S7O A;  5EVI A;  1DJC A;  2ZL1 B;  3UB6 A;  2WKH A;  1MKM A;  3G35 A;  3UO9 A;  3HBR A;  2VGK A;  2EWW A;  2VKS A;  4AFI A;  4KG6 A;  2A3U A;  2EX8 A;  2B18 A;  3LY4 A;  4MMN A;  2BAS A;  1OME A;  1TS8 A;  3K2N A;  1K0K A;  4G3W A;  4KZ5 A;  5FAP A;  4FD8 A;  5EVL A;  2KOI A;  3VP2 A;  2XFS A;  1XJ2 A;  1JWP A;  4ZJ3 A;  1H8Y A;  1NRF A;  4R3B A;  5F69 A;  3UPN A;  4S2M A;  3CZD A;  2Q0O A;  4S2I A;  4EW7 A;  4EXO A;  3FYZ A;  2Y2O A;  3VP4 A;  3CAX A;  4LRY C;  5FAS A;  4OKP A;  4DE3 A;  3UE1 A;  3EGX C;  1FIL A;  4NXB A;  4EBL A;  4DJ2 A;  1FCN A;  2A49 A;  2G2W A;  4ZAM A;  1L0E A;  1O7E A;  3AGF A;  5FSR A;  4WEL A;  5TR7 A;  1VEU B;  4OQ0 A;  2QZ6 A;  3MZD A;  4DMZ A;  2IWC A;  1YPR A;  1XPB A;  1AXB A;  3M2J A;  1EWZ A;  3T4L A;  2VGJ A;  3QP4 A;  2QHK A;  5TJJ A;  3CLO A;  2M1C A;  4ETX A;  2W1R A;  2GJ3 A;  2B95 A;  1RCJ A;  2VV8 A;  3R7W A;  4JKT A;  3ITB A;  2Z6D A;  3K3D A;  1OTD A;  2W1T B;  3BLM A;  3UDF A;  2C5W B;  3ZVT A;  1MWT A;  5F83 A;  3HLB A;  4JGO A;  2K2N A;  3ITA A;  3MXS A;  3NEC A;  3OPH A;  3G34 A;  1G68 A;  1K38 A;  2EFX A;  1JTD A;  3PBN A;  3UN7 A;  3ICY A;  2PDR A;  1ESU A;  4JF4 A;  3LR5 A;  1ODV A;  3HJI A;  1T1B A;  2PBY A;  3P7N A;  3CPT B;  4L9G A;  4BQM A;  3EWK A;  4ESP A;  2UV0 E;  1XJ6 A;  2W3E A;  1IYQ A;  3B33 A;  3ZNY A;  3KSG A;  1BTL A;  5F1F A;  1KGG A;  4LEN A;  1F2K A;  4EBP A;  2J3T C;  1OTE A;  4UQI S;  4E3M A;  3PBQ A;  1IEL A;  4JF5 A;  4HY8 A;  3H82 A;  4NXF A;  4DE2 A;  1MBL A;  3NOP C;  3MKE A;  2R9W A;  3E4P A;  3Q81 A;  1ES5 A;  3JVV A;  3IXG A;  2Y2I A;  3BLS A;  1K6S A;  1JWZ A;  3UNW A;  5GL9 A;  4HH3 A;  5DJU A;  1K56 A;  2AVX A;  4B4X A;  3IF6 B;  3WS0 A;  1JWV A;  3G31 A;  4QU3 A;  4LLO B;  1YSQ A;  2ZC5 B;  3IBR A;  4RX3 A;  1W79 A;  2XK1 A;  3GQZ A;  4WYY A;  5DTK A;  4Y7P A;  3OLO A;  5CHU A;  4CPK A;  1P9R A;  3S7P A;  3CIT A;  4LV1 A;  4ZTK A;  3Q7V A;  1NYY A;  2M7U A;  4I5S A;  2OLV A;  4QY5 A;  4EET B;  4IJG A;  3SZT A;  3S7N A;  5EOO A;  4UEY A;  4KZ4 A;  3G4P A;  1D06 A;  1YT4 A;  5HD3 A;  3G30 A;  4HJ6 A;  5U47 A;  1L0D A;  2Z2M B;  5E43 A;  4KEN B;  3IHA A;  5IT5 A;  3NBL A;  2L1M A;  3GV9 A;  3LIB A;  3A3J A;  4LRX C;  1TS6 A;  3U4L P;  4S2O A;  4DE1 A;  2EX9 A;  2QKP A;  2VJW A;  4EV4 A;  3ZYT A;  2NUP C;  5KSH A;  3T4T A;  2W3H A;  2HPB A;  1XJ3 A;  3MR0 A;  2Y79 A;  1K6R A;  3BQ8 A;  3LI9 A;  3CWF A;  5GHX A;  1BLP A;  2WAD A;  2JC7 A;  4QB8 A;  3UB8 A;  3CMZ A;  3PBO A;  4QHC A;  1SDN A;  3FG8 A;  2YKH A;  4BBV A;  3W4Q A;  3N8S A;  3QP1 A;  3BEB A;  1UGU A;  5DF7 A;  4KZ8 A;  2HDQ A;  5JYP A;  1KGF A;  1YMS A;  1ALQ A;  2ZQ9 A;  4XUX A;  5J3W A;  1OT6 A;  1S0W A;  3UB9 A;  5CRF A;  4NXE A;  3LR3 A;  5L10 A;  4I3J A;  3A0R A;  3CUE A;  3UB7 A;  1O07 A;  2KDK A;  2P74 A;  2A24 A;  1ONG A;  1DP8 A;  1KDW A;  1L2S A;  4PKY G;  1VET A;  1FCO A;  1EI5 A;  2J3W A;  3O87 A;  3BQA A;  3LIA A;  1FR1 A;  4E3O A;  3NIA A;  2H5S A;  2ZQD A;  3CUE C;  3S7Q A;  4LV2 A;  2O9A A;  2HGV A;  3FKW A;  4R0Q A;  2D01 A;  1KDS A;  4DKI A;  1RGZ A;  5EVI D;  5EOE A;  4N92 A;  1ES2 A;  1T1A A;  2XEP A;  4HNB A;  1ERQ A;  2QYB A;  1YM1 A;  4B4Z A;  5HWV A;  5FL3 A;  4OQI A;  2EXA A;  5DF8 A;  1GHI A;  4JGQ A;  2OAQ 1;  1WYC A;  5AQ7 A;  1VM1 A;  4ZBE A;  2DRW A;  3MFD A;  5EVI C;  1PZP A;  2XH9 A;  1K57 A;  1SKO B;  3OPL A;  2Y59 A;  4IBX A;  3JPU A;  4EUZ A;  1D7E A;  1H8M A;  4OON A;  4D2O A;  4N9L A;  1PWG A;  1CJF A;  4LFU A;  4I38 A;  1K4E A;  3HUN A;  4HH2 A;  3OCN A;  5HD5 A;  1LT0 A;  2V1B A;  5FA7 A;  3W4O A;  4WBG A;  1VEU A;  4HHD A;  1YLP A;  3RJU A;  2I9V A;  4GZB A;  3KO6 A;  4Z1W A;  4KQD A;  3VOZ A;  3MF0 A;  3TJZ C;  1PRQ A;  1NLZ A;  5AQ9 A;  3MZE A;  3HLF A;  2P7J A;  4FTX A;  4FUW A;  4PAU A;  1GSW A;  2HJ9 C;  4Y0U A;  5DTS A;  5IU1 A;  4S2L A;  1ZC2 A;  1W5D A;  2Y91 A;  1L0F A;  3FC7 A;  3UMD A;  1GHP A;  3KYQ A;  2XQZ A;  5K5B A;  1JNU A;  4E3K A;  2QPN A;  2BG1 A;  2Y2M A;  3W4P A;  4G3V A;  4R3J A;  4P6Z S;  2L0W A;  1I2S A;  3TOI A;  1PW1 A;  5E2H A;  3D72 A;  3HLW A;  5EEC A;  3B3X A;  4N1X A;  5CGS A;  2KLI A;  2JBF A;  2QWS A;  4KZB A;  4GOG A;  3M2K A;  4OQG A;  2H0T A;  4U0X A;  5EVI B;  1CI9 A;  2PHY A;  1GSV A;  2HP6 A;  4YWZ A;  2B02 A;  3GVB A;  3IS2 B;  5BOH A;  4Q0J A;  2A24 B;  4GHI A;  5L09 A;  1K54 C;  2HF6 A;  1MZU A;  2V1Z A;  2XA7 S;  3BFE A;  4WL9 A;  3O86 A;  1YAX A;  3CJM A;  3F1P A;  3LEQ A;  1XFQ A;  4E3I A;  5EUA A;  2WKI A;  3AGE A;  2EWV A;  3H82 B;  2VGL M;  1HZO A;  3O88 A;  3C38 A;  4D60 A;  3WS4 A;  3L9K A;  3HLD A;  4DXC A;  3D3O A;  2ZL1 A;  4BD0 A;  4B88 A;  2IWD A;  4S2K A;  3GRJ A;  3GTC A;  4NKP A;  2W1T A;  5FEF A;  5HSQ A;  1IKG A;  4DDS A;  4IVK A;  4XUZ A;  4XT2 A;  1NWZ A;  4R4S A;  2ZQC A;  4ZRR A;  3G6O A;  3A3I A;  2JE5 A;  5A90 A;  2WGW B;  5HX9 A;  3B47 A;  1LI9 A;  3E0Y A;  4E3L A;  3QP6 A; 
#chains in the Genus database with same CATH homology
 1SZV A;  1PNE A;  3KYE A;  1VEU A;  1YPR A;  5EVE A;  1D1J A;  2ZL1 B;  2BTF P;  1SKO B;  1K0K A;  3CHW P;  2VK3 A;  3D9Y A;  3LGO A;  2HZ5 A;  2JKF A;  1A0K A;  1FIL A;  3CPT B;  1G5U A;  3T1Q B;  3T12 B;  1Z09 A;  2V8F A;  3CPT A;  4D60 A;  2ACG A;  1HLU P;  3NEC A;  1FIK A;  3T1R A;  3L9K A;  4ESP A;  2B95 A;  1AWI A;  2PBD P;  1ACF A;  1SKO A;  1J3W A;  2ZL1 A;  2V8C A;  4X25 A;  3T1X A;  1VET A;  2E8J A;  3NUL A;  1CJF A;  1VET B;  1PFL A;  2JKG A;  3DAV A;  3LEQ A;  3MSH A;  4X1L A;  5EM1 A;  3U4L P;  1PRQ A;  5EV0 A;  1VEU B;  1Y4O A;  3T1S A;  2PAV P;  3MS6 A;  3L7H A;  1CQA A;  5FEG A;  5FEF A;  3UB5 P;  2PRF A;  5EM0 A;  5FDS A;  4FTX A;  1F2K A;  4X1M A;  4QWO A;  4FUW A;  1CF0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...