1I5QA

Crystal structure of the e. coli ampc beta-lactamase mutant n152a covalently acylated with the inhibitory beta-lactam, moxalactam
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
358
structure length
356
Chain Sequence
APQQINDIVHRTITPLIEQQKIPGMAVAVIYQGKPYYFTWGYADIAKKQPVTQQTLFELGSVSKTFTGVLGGDAIARGEIKLSDPTTKYWPELTAKQWNGITLLHLATYTAGGLPLQVPDEVKSSSDLLRFYQNWQPAWAPGTQRLYAASSIGLFGALAVKPSGLSFEQAMQTRVFQPLKLNHTWINVPPAEEKNYAWGYREGKAVHVSPGALDAEAYGVKSTIEDMARWVQSNLKPLDINEKTLQQGIQLAQSRYWQTGDMYQGLGWEMLDWPVNPDSIIGDNKIALAARPVKAITPPTPAVRASWVHKTGATGGFGSYVAFIPEKELGIVMLANKNYPNPARVDAAWQILNALQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA-LACTAMASE
publication title Inhibition of AmpC beta-lactamase through a destabilizing interaction in the active site.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 114
structure length 356
sequence length 358
chains with identical sequence B
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2001-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00144 Beta-lactamase Beta-lactamase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 1i5qA00
3W4QA 4IBRA 5GLBA 2P9VB 5D3OA 4RYEA 4JXVA 2WUQA 3HLBA 5A92A 4DE2A 3BFCA 1J9MA 3NCKA 4F94A 1C3BA 4S2PA 3UDIA 4GB7A 1QMFA 1LLBA 5M1AA 3HLFA 1W5DA 4MBFA 5KSCA 3ZNTA 2R9WA 4OLGA 2J8YA 2UWXA 1NXYA 4WZ5C 3VSLA 4HBTA 5L2FA 2XK1A 2WGVA 3MZDA 5EPHA 2P9VA 2XD5A 3DWKA 3ZVWA 3MXRA 1JVJA 4OOLA 2XQZA 5F82A 3BECA 4GD6A 4H8RA 3WS1A 2XFTA 4DF6A 1IYSA 4OVDA 3MFDA 5DTKA 1E4DA 1K55A 3OPRA 2WZXA 4E3OA 1XA1A 1MWRA 1JWZA 4U0TA 5EOEA 4ZJ3A 5CHUA 3N6IA 2EX2A 1CEGA 3PBNA 5F83A 1EI5A 3C7VA 3G32A 3DWZA 4QD4A 3NIAA 1O07A 3FKWA 1AXBA 4EUZA 5A93A 5EVID 1KVMA 1OMEA 3TSGA 1M6KA 4RVAA 4JXGA 3RJUA 4JF4A 4ZJ2A 2ZM2A 4B4XA 4S2MA 3A3FA 4JXSA 5U47A 1KE0A 4WYYA 2XLNA 4OQ0A 4JKTA 4S2IA 1PWCA 1FSYA 1BLHA 2ZLYA 3Q82A 3HVFA 3LEZA 2J9PA 3PTEA 4WELA 2XR0A 4ZDXA 2G2WA 1MWUA 4DKIA 4S2NA 2WAEA 3PBSA 5FQMA 3IH8A 3UO9A 4OKPA 1HZOA 2WGIA 3LY3A 2JE5A 1SCWA 5AQBA 4LV2A 2Z2MB 5GHYA 5EVIB 3WS4A 1HD8A 4OPYA 2V2FF 1K6SA 1PI4A 2QZ6A 4E3MA 2Y59A 1XXMA 4FCFA 4WM9A 1CI9A 2HDQA 3IXGA 2Y2HA 1BLSA 2Z2LB 1W7FA 3OPPA 3GV9A 1RP5A 1G68A 4GOGA 4QJGA 5HW3A 3FWLA 1FOFA 1LHYA 2PBYA 4GN2A 2HP6A 1ZG4A 3ITBA 2RCXA 3ITAA 4X56A 5FQJA 3ZVTA 5EVIA 5FQIA 1H8YA 4IBXA 3BFFA 3OC2A 2OV5A 1TDLA 3OZHA 1N9BA 3AGDA 4BLMA 1YLTA 1I2SA 1NY0A 4KZ9A 4E6WA 2HDSA 3BM6A 4KG5A 4UAAA 3UDFA 1GHMA 3V3RA 4JF5A 3IF6B 3N8RA 5AQ7A 2QMIA 3M6HA 4ZAMA 2C5WB 4XUZA 4OP5A 2WZZA 4UHUA 3UE3A 4HEFA 4K0XA 4PMAA 2DRWA 5CGXA 3A3JA 4UA9A 4OPQA 4S2LA 1W8QA 2ZM8A 3S4XA 3UY6A 4LENA 5DF8A 3VP3A 1S0WA 1IKGA 3HREA 3ZFZA 4X6TA 5FQQA 2V1ZA 3ZDJA 1E3UD 4X55A 3WS5A 4E3JA 3SH9A 1TVFA 5CHJA 3C7UA 4E3IA 3IF6A 4DE0A 2HP5A 3EQVA 1IEMA 3QNBA 5CEDA 1IELA 3P98A 5FI6A 5GHZA 5J8XA 4OONA 2ZQ9A 3PBQA 2IWCA 3Q81A 4IVIA 3M2JA 4KZ4A 3HLGA 1PWDA 1YLZA 2JCHA 5CERA 1K4FA 4R0QA 5CTMA 1KE3A 4FSFA 1FR6A 4MBHA 2JC7A 5JYPA 2ZQ7A 3G30A 2EXAA 4DXCA 4OH0A 2EX9A 1PYYA 1K56D 4GDNA 4R3BA 3C4OA 1I2WA 4BENA 2ZQAA 4WEKA 2ZD8A 5DTSA 3NY4A 3N4IA 3IH9A 2EFUA 4PM9A 3QHYA 2P74A 1XGIA 2RL3A 4YINA 2XF3A 4XXRA 1SHVA 1YM1A 3NI9A 1KE4A 1KGEA 4LCLA 5FATA 4KZBA 4P85A 1ESIA 4NETA 1KGFA 2XDMA 3SS4A 1Z6FA 3O3VA 2X01A 4ZJ1A 2VGKA 4E6XA 4E3LA 2IWDA 1VM1A 3N8SA 2CC1A 1E3UA 2Y2IA 1DJCA 5FI2A 4N1HA 3CG5A 4KZ6A 3ZCZA 4HBUA 3TOIA 4GDBA 5EECA 1XPBA 1K54A 2Y2MA 3AGEA 3GMWA 5EE8A 5FQKA 4WZ4A 2XD1A 4K91A 1WYBA 1GA0A 3W4OA 2ZMAA 3A3IA 1FQGA 3PAEA 1I5QA 4DDSA 3WWXA 1CI8A 4S2KA 2WYXA 5CGWA 3BLSA 1ESUA 2J9OA 4N9LA 4RX3A 5FSRA 3ZG8B 4BD0A 1K57C 2H0TA 4E3KA 2FFYA 4DDYA 4PM8A 3O88A 3SOIA 1MPLA 1XX2A 3ZG5A 1YT4A 4X68A 4IVKA 1MWTA 3D4FA 1YLPA 1NZOA 4P0MA 3GSGA 2QPNA 1MKIA 5CRFA 2C6WB 2XFSA 2Y2PA 3M2KA 3M6BA 1ONGA 1YMXA 4BD1A 1ES2A 4FH4A 3SH7A 1K55C 5FQ9A 3VFHA 1K38A 3ZGAB 1MY8A 1JTDA 5E2HA 2OLVA 3G4PA 1LL9A 2Y2QA 2X02A 2ZC4B 1Q2QA 5EVLA 3ZNYA 5FASA 1U60A 3BRMA 3MZEA 2Y2GA 3AGFA 3IT9A 5E43A 1ALQA 5TR7A 4BQMA 3GR2A 4R4SA 3O86A 3UPNA 1RGYA 1FR1A 4MNRA 4KZ5A 2H5SA 2ZM0A 4UA7A 4EBLA 5HARA 3HLEA 4KQOA 3HLCA 4KQQA 1DJBA 1IYOA 3SS5A 3NBLA 4Y0TA 1H8ZA 1NJ4A 2I72A 3GTCA 5G18A 1WYCA 3DW0A 4Q8IA 1NYYA 1XP4A 2EX8A 2WKHA 4PPRA 5AQAA 1K25A 4EQIA 4KG6A 3UPPA 2DNSA 3IXHA 5F1GA 5HAIA 2WGWB 4D2OA 5CXWA 2ZC3B 3OCLA 2Y4AA 1DJAA 4OQGA 3V39A 4GKUA 4OPRA 4OPZA 3MKFA 1ZKJA 1YLYA 4YFMA 3VP4A 3P09A 1IYPA 1IYQA 5CEBA 3CZDA 4U0XA 2IWBA 5EUAA 1Y54A 1HTZA 4C3QA 1L2SA 5GL9A 1BT5A 1N4OA 1PW1A 3BFGA 4N92A 5TGFA 1PWGA 2Y2NA 3Q1FA 2XGNA 3GVBA 1ZC2A 4IEDA 4WBGA 2WGWA 2PU4A 1HVBA 3LCEA 1XKZA 5FAPA 4OP8A 1NZUA 3G2YA 4OOYA 2ZC7A 5GHXA 1ERQA 1L0FA 1O7EA 2XEPA 3QNCA 1MBLA 4CPKA 5CHMA 4Y0UA 5HL1A 4X69A 1JWPA 1YLJA 1GCEA 3HUMA 1Q2PA 3LO7A 3OCNA 4Y7PA 4PM6A 4QY6A 3TG9A 4A5RA 3UNWA 2EX6A 3N7WA 4DXBA 1BUEA 1L0DA 2VGJA 4B88A 4CJNA 3IWOA 1YLWA 3GRJA 4JF6A 4WZ5A 4FH2A 3G2ZA 3UPOA 4R23A 5KZHA 3VP1A 3RXXA 3HLDA 2HPBA 2ZJ9A 3OPLA 1K6RA 1G6AA 4KG2A 2ZC6B 1PZOA 5DTTA 3CMZA 3MBZA 3BEBA 3VP2A 3W4PA 3ZG0A 4EBNA 3E2KA 1FCNA 2WADA 1K4EA 3ZHHA 1BTLA 3PBRA 3MZFA 3Q7VA 5FA7A 1W79A 3BLMA 3UE1A 5F1FA 3OPHA 3ISGA 1BLPA 1YMSA 3S1YA 3IF6C 3W8KA 1NYMA 5I94A 1KDWA 1MWSA 4K0WA 1XGJA 1SDNA 4JBFA 4EWFA 1GA9A 3PBTA 4OOMA 3UDXA 3UE0A 3B3XA 4ZBEA 2A3UA 2V20A 5E2FA 1GHPA 1SKFA 1K57A 4UA6A 4GZBA 3HUOA 3VMAA 4WEJA 4S2OA 4MBKA 1NRFA 5HX9A 1TEMA 2HP9A 2R9XA 4R4RA 5AQ9A 2ZQDA 2PU2A 4PM5A 3G31A 1ES3A 1SDEA 1TDGA 2BG1A 3VOYA 1ERMA 3A3DA 1K56A 3RXWA 4HESA 2WKIA 4N9KA 3EQUA 3VSKA 5CECA 2ZQCA 2Y91A 3IWIA 3A3EA 1PI5A 4GD8A 1RCJA 4LV1A 1QMEA 5FI7A 5DF9A 4WMCD 4B4ZA 1KDSA 3I7JA 4JXWA 1XA7A 1ZG6A 4Z9QA 2H0YA 4BL2A 2Q9MA 3FKVA 4P6BA 3ZG7B 4EV4A 3C4PA 3PAGA 3WRTA 3FV7A 1CK3A 5E2EA 2Q9NA 4M3KA 5CTNA 2HDRA 1K54C 3JYIA 5DVAA 2ZC5B 1E25A 3HLWA 3IHAA 1H5XA 5IHVA 4R3JA 4O7DA 3IWQA 5A91A 1CEFA 4QY5A 3VFFA 2Y2LA 5M18A 3MKEA 2Y2OA 3IQAA 1ES4A 3CJMA 3WS2A 4QB8A 4DE1A 1S6RA 5HAPA 1LI0A 2BLSA 4JLFA 4PM7A 3IXDA 2WKEA 1PW8A 5HFOA 1EWZA 2B5RA 5FDHA 4E3NA 3N8LA 3O87A 2EXBA 4LCMA 4X53A 4OQIA 4KZAA 3BFEA 4QHCA 1L0EA 5TFQA 1PIOA 4LV0A 3V50A 3LY4A 5EOOA 4S2NC 1L0GA 5BOHA 3BYDA 4C6YA 4ID4A 1ONHA 2X71A 1PZPA 3S22A 4WMCA 4OQHA 4MEZA 1GHIA 3G35A 4FD8A 3DTMA 4Y0OA 5E2GA 4C75A 3Q07A 3FZCA 4L0LA 3IF5A 4KZ8A 4QU3A 2H10A 4ZTKA 3SS3A 3C5AA 4KQRA 1W8YA 1BZAA 3WS0A 4R1GA 2OSUA 5GLAA 5GLCA 3SH8A 1ES5A 4LV3A 1BLCA 3WRZA 2ZQ8A 2JBFA 4N1XA 3PBOA 4JPMA 5EVIC 2OLUA 2E8IA 1BSGA 4OLDA 2Y55A 5KSHA 3G34A 3BFDA 3HL9A 3Q7ZA 3IHBA 1M40A 2HDUA 2G2UA 2Y2JA 2EFXA 1VQQA 4KZ3A 3Q7VB 3IXBA 4S2JA 5FAQA 5A90A 1MXOA 1JWVA 1RGZA 5HAQA 2WAFA 5FAOA 1YQSA 4GNUA 1LL5A 4KZ7A 2DCFA 1BULA 1FCMA 1DY6A 4P87A 3VP0A 3MXSA 4KENB 3VOZA 3ZG9B 2J7VA 3V3SA 2XH9A 3NC8A 4NK3A 4U3TA 4XUXA 2Y2KA 1IKIA 5M19A 1KVLA 5DF7A 1KGGA 1LI9A 3V5MA 4BL3A 4BJPA 1WE4A 3NDGA 4RA7A 5KMWA 2WK0A 3E2LA 2A49A 2GDNA 3HUNA 3UN7A 4DE3A 1EROA 4DRTA 1JTGA 4EBPA 5CGSA 4MLLA 5GLDA 4RX2A 3NDEA 3GQZA 3FYZA 3HBRA 1FCOA 1FSWA 2FFFB 5JYOA
chains in the Genus database with same CATH superfamily
3W4QA 1LL8A 4L9FA 5D3OA 5HDCA 1OTDA 4DE2A 4EETB 2W3FA 1J9MA 3JVVA 3NCKA 4F94A 1LLBA 3HLFA 4MBFA 2VLGA 3ZNTA 1YKDA 2R9WA 2J8YA 4JGPA 2XK1A 5EPHA 4KUOA 2P9VA 3MXRA 4H8RA 1H0MA 1E4DA 1K55A 4ZJ3A 2EX2A 3PBNA 3T1SA 3C7VA 2HZ5A 3G32A 3FKWA 1P9RA 1YSQA 5A93A 3EEAA 3TSGA 3RJUA 4B4XA 1KE0A 3CITA 3LIAA 4JKTA 2L0WA 3D3OA 4ZDXA 4LFUA 4L9GA 3LY3A 2JE5A 5AQBA 1PI4A 5AVEA 1XXMA 4WM9A 1CI9A 3MJQA 2Y2HA 1RP5A 4QJGA 2HP6A 3ITBA 3ITAA 5FQJA 3GECA 2XA7S 3AGDA 4BLMA 1NY0A 3GDIA 3UDFA 3V3RA 4JF5A 3IF6B 3N8RA 1CJFA 2ZL1A 4UHUA 5EVEA 4HEFA 1NLYA 3RTYA 3CHWP 3IBJA 4OPQA 2ZMFA 2ZM8A 3DAVA 5MC7A 4LENA 4R6LA 1IKGA 3HREA 2V1ZA 3H9WA 1S4SA 4D60A 5CHJA 4DE0A 1XJ2A 5CEDA 5GHZA 1A0KA 2ZQ9A 3Q81A 2JKGA 2NUTC 3F1OA 4F3LB 1YLZA 4GS9A 4R0QA 3S7PA 2O9AA 5DFYA 2EXAA 4OH0A 2EX9A 1PYYA 4GDNA 4R3BA 2ZQAA 1G28A 3ZQ5A 1LSXA 4XXRA 1SHVA 1YM1A 2PDRA 1KGEA 1KGFA 2HV1A 2X01A 1XFQA 1VM1A 2Y2IA 4N1HA 5EECA 2XD1A 3V67A 2VGLS 1WYBA 2PAVP 1VETA 2YKHA 3A0RA 1KOUA 1ESUA 2HGVA 2J9OA 4QPRA 1OT9A 2H0TA 4HP9A 5I5LA 3JPUA 3NOPC 1YT4A 4X68A 1MWTA 3D4FA 1YLPA 1NZOA 4P0MA 3GSGA 4CLCC 1W63M 3M6BA 4HJ4A 1ONGA 4HIAA 1K38A 3G4PA 4K08A 5FASA 3O86A 3LIFA 1TS6A 4Y13A 3BW6A 4II7A 5DFXA 1TF1A 1H8ZA 5F69A 3LUQA 4WL9A 1WYCA 5G18A 2WKHA 5HD3A 1S67L 4KG6A 3IXHA 5HAIA 3OCLA 3C2WA 3V39A 1LT0A 1ZKJA 1YLYA 3T4JA 1IYPA 2V1BA 3CZDA 3LR3A 5A8BA 4U0XA 1HTZA 4MCWA 5GL9A 5G4YA 3U4LP 2W0NA 2XGNA 3QP1A 2WGWA 1Y4OA 3U2AA 3KX0X 4OOYA 1ERQA 1L0FA 1O7EA 4Y0UA 3HUMA 1YLJA 1GCEA 3LO7A 4ARZA 4PM6A 4A5RA 4PAUA 4GLQA 3C38A 4CLCD 3N7WA 1BUEA 3T1RA 1L0DA 1VEUB 4WZ5A 2ZJ9A 1K6RA 4EEUA 4KG2A 3T12B 4EBNA 3CMZA 5FEFA 2V0UA 3ZHHA 2WADA 3PHYA 1BTLA 2W1RA 3PBRA 3LYXA 2KLIA 1S1YA 1W79A 3BLMA 1MZUA 4HH2A 3FPVA 1T18A 5I94A 1MWSA 4EWFA 1GA9A 3UE0A 3B3XA 4BBTA 3H82B 3FG8A 1GHPA 3LGOA 1F2KA 2AVXA 1NRFA 5HX9A 1TEMA 5DJUA 3FC7A 4CLCA 1ES3A 1SDEA 1TDGA 3DBAA 3VOYA 3A3DA 1K56A 1VB6A 5CECA 2ZQCA 5EM1A 4GD8A 2ZMVA 4HY8A 2GNXA 3F1NB 4LV1A 5DF9A 4WMCD 5FI7A 5L10A 1XFNA 3B33A 3I7JA 4JXWA 1T1BA 4YWZA 3FKVA 5E2EA 4NKPA 1K54C 5IHVA 4R3JA 3P01A 4QY5A 5M18A 3CJMA 5HAPA 2EWWA 2WKEA 2K7SA 3ULFA 1PW8A 1EWZA 5FDHA 4OQIA 4QHCA 1PIOA 5HPIA 4C6YA 3L9KA 3CPTA 1PZPA 4WMCA 4I3IA 4OQHA 1GHIA 3G35A 4FD8A 4Y0OA 3FZCA 4L0LA 4ZTKA 2V9AA 3SS3A 3C5AA 1W8YA 4Y15A 1BZAA 3WS0A 4ARZB 3LICA 5GLAA 3KO6A 3WRZA 3OBFA 3MS6A 4RQ9A 4JPMA 2E8IA 1BSGA 2ACGA 2JKTI 2Y55A 3G34A 1T1CA 3G6OA 1ODVA 2PBDP 2DMWA 1JWVA 5HAQA 1YQSA 4GNUA 4KZ7A 3VOZA 3V3SA 3NC8A 4UEYA 1IOUA 5M19A 2OOLA 1KGGA 4BL3A 2B95A 4Y5FA 3NDGA 4JGOA 2WK0A 3E2LA 1EROA 4EBPA 3MXQA 5CGSA 1UWNX 3NDEA 3GQZA 3PXPA 4MN5A 4H6JB 2FFFB 4CLCB 4IBRA 2WUQA 1V9ZA 2HJ9C 4Z1WA 3QP2A 3R7WB 3MMHA 4S2PA 4GB7A 1QMFA 5KSCA 5J7EA 3IX4A 2HJEA 5HL6A 2H28A 2VKSA 1NXYA 5L2FA 4HBTA 2WGVA 3MZDA 3UB5P 5HDDA 3UB6A 3NJAA 4IUHA 3DWKA 3ZVWA 4OOLA 2XQZA 4GD6A 3WS1A 4DF6A 4R38A 3OPRA 4E3OA 5HWTA 5CHUA 3N6IA 5F83A 2MJ6A 3NIAA 1O07A 1AXBA 4EUZA 1KVMA 1M6KA 2D02A 5HD5A 1V9YA 4HP4A 5U47A 1K0KA 4WYYA 5L09A 4S2IA 1FSYA 3HVFA 3PTEA 4WELA 2W3GA 2M7UA 2G2WA 1MWUA 4DKIA 3PBSA 4XT2B 2WGIA 5HWVA 2Z2MB 5EVIB 2VV7A 2V2FF 2QZ6A 4E3MA 2Y59A 4FCFA 2HDQA 1MKMA 1BLSA 2Z2LB 2Y8HA 4EEPA 3GV9A 1G68A 5HW3A 1LHYA 3PR6A 1ZG4A 4X56A 4P6ZS 1Z09A 3BY8A 1YLTA 3A0SA 4KZ9A 4E6WA 3RFBA 1ZTUA 2B02A 4YOFA 3LIDA 2QMIA 2C5WB 4OP5A 2W3HA 4K0XA 4PMAA 2DRWA 3S4XA 2I9VA 5DF8A 3KYZA 3ZFZA 3ZDJA 4UQIM 2M7VA 3WS5A 4E3JA 3SH9A 1TVFA 3L7HA 3IF6A 3LEQA 3P98A 5FI6A 1J3WA 4IVIA 4X25A 2PR6A 4O01A 2XSSA 2JCHA 2ZQ7A 3G30A 2V1AA 3C4OA 1I2WA 2ZD8A 3BQAA 3N4IA 3IH9A 3QHYA 4F3LA 2P74A 1XGIA 2RL3A 3F1PB 3NI9A 1KE4A 4KZBA 2XDMA 5AJGA 2KDKA 2L4RA 3O3VA 4ZJ1A 3LIEA 4KZ6A 3TOIA 1XPBA 3E4PA 4WZ4A 3W4OA 2W1TB 1CI8A 1FILA 4S2KA 2CMNA 4RX3A 2QJ7A 4E3KA 2FFYA 4DDYA 3KSHA 5L07A 1DP8A 2QPNA 2Z6DA 1YMXA 4LRXC 1ES2A 1VHMA 3T4KA 1LL9A 1Q2QA 5EVLA 5K5BA 1U60A 3BRMA 3MZEA 5E43A 4BQMA 3IT9A 4ME4A 4DJ2A 4R4SA 1TS7A 4LRYC 2O9BA 1RGYA 4MNRA 3MF0A 4KZ5A 2H5SA 2A24B 3HLEA 3HLCA 1NJ4A 3GTCA 2PHYA 1P9WA 4Q8IA 2EX8A 2JN7A 5CXWA 4OQGA 4WUJA 4GKUA 3TW8A 3P09A 1OPXA 3C30A 4C3QA 1Y54A 1BT5A 1PW1A 3BFGA 5TGFA 4HI4A 2Y2NA 3Q1FA 3GVBA 1NLZA 2PU4A 1HVBA 5DJTA 4B93A 2ZC7A 4I3AA 5GHXA 2EWVA 2XEPA 2VK3A 5CHMA 1PFLA 3OCNA 3TG9A 2KX6A 5F5YA 4DXBA 3BJNA 3LR5A 4B88A 1YLWA 5FDSA 3E98A 3UPOA 5KZHA 1S4RA 4R3AA 3R4KA 2ZC6B 3W4PA 3MBZA 3VP2A 3E2KA 3MZFA 3UE1A 1VEUA 1BLPA 5EFWA 3W8KA 4GJ4A 3OLOA 3PBTA 4OOMA 3UDXA 4ZBEA 2A3UA 5E2FA 2WKQA 1SKFA 4YNRA 2P7JA 5AQ9A 2OAQ1 2PU2A 3G31A 3BQ8A 2BG1A 3H82A 2OAP1 2XA7M 3IWIA 3A3EA 4JGRA 1RCJA 1XA7A 4P6BA 3C4PA 1IFQA 3FV7A 2Q9NA 5LBRA 2HDRA 4Q0IA 3JYIA 1BYWA 3IWQA 3VFFA 3F1NA 4DE1A 4QB8A 1HLUP 3LR0A 1LI0A 4PM7A 3IXDA 4L9EA 4X53A 2W3EA 5TFQA 4LV0A 3HJKA 3LY4A 5EOOA 1L0GA 2J3TC 4ID4A 1F98A 1ONHA 2BTFP 3T1XA 3E0YA 4MEZA 3DTMA 5E2GA 4KZ8A 4ZRRA 4KQRA 2L1MA 2OSUA 1ES5A 1STZA 1BLCA 2ZQ8A 4PKYG 4NXGA 4ETZA 4N1XA 5EVIC 1CF0A 1H3QA 3Q7ZA 3IHBA 1UWPX 2EFXA 2VGLM 5TBMB 4KZ3A 3KSIA 4S2JA 1RGZA 2LB5A 1LL5A 5J4EA 1FCMA 4P87A 1DY6A 2J80A 3MXSA 4NK3A 1XJ3A 3TE8A 5DF7A 1LI9A 2R78A 4BJPA 1WE4A 2QYBA 4BBUA 3HUNA 4WLAA 4RX2A 4IJGA 3FYZA 3HBRA 5CTMA 3CAXA 5GLBA 4RYEA 5A92A 2K2NA 4MN6A 3BFCA 1C3BA 3UDIA 4AFIA 2IA2A 4IUKA 2O9CA 3VSLA 4H6JA 4EU0A 1JVJA 5F82A 3R7WA 3BECA 4GCZA 2XFTA 1IYSA 3MFDA 5DTKA 2WZXA 1XA1A 1MWRA 1JWZA 4U0TA 1EI5A 2B18A 4NEED 4DJ3A 5EVID 2KOIA 1OMEA 4JF4A 4ZJ2A 2ZM2A 4S2MA 4LPZA 3H7WB 2XLNA 4OQ0A 1PWCA 1BLHA 2ZLYA 3Q82A 3LEZA 4HJ3A 2GJ3A 1ACFA 3RH8B 3JVUA 2PD7A 4KQDA 3UO9A 1HZOA 1SCWA 4LV2A 5HDSA 3TRCA 1GSWA 3WS4A 4OPYA 1K6SA 2VX8A 1G5UA 3SZTA 3IXGA 1XJ4A 2XRNA 1W7FA 1XJ6A 3E4OA 3EWKA 4XT2A 1FOFA 2PBYA 4PKYA 4GN2A 2PRFA 1TS8A 1OJ5A 4NXEA 5EVIA 4IBXA 3OC2A 2OV5A 1TDLA 4NG2A 2HDSA 2FZ0A 3NOUC 3BM6A 3VV4A 4KG5A 5CX7A 4UAAA 5AQ7A 2JKRI 4ZAMA 3BWLA 2UV0E 3UE3A 3P7NA 5CGXA 4UA9A 4S2LA 4EXOA 1W8QA 3VP3A 3UY6A 4HHDA 1S0WA 4X6TA 5FQQA 4EW7A 1E3UD 3C7UA 1IEMA 3QNBA 1IELA 5J8XA 5L8MA 4OONA 3PBQA 2IWCA 4KZ4A 3HLGA 1PWDA 5CERA 1K4FA 1X0OA 5HPFA 1FR6A 4MBHA 2JC7A 5JYPA 4MMNA 4DXCA 2G7UA 4BENA 4WEKA 3NY4A 3W2ZA 3ICYA 4EQ1A 1YPRA 4IHQA 4KUKA 2PD8A 4NETA 3SS4A 4E3LA 2VGKA 4E6XA 2IWDA 3N8SA 1E3UA 1DJCA 5FI2A 4B9OA 3CG5A 3ZCZA 2PYPA 2JKFA 4EERA 1CQAA 1K54A 2Y2MA 3F1PA 3GMWA 4PHTA 5EE8A 1GA0A 1FQGA 3WWXA 2WYXA 3B42A 3ZG8B 4BD0A 1K57C 4CLCE 4PM8A 3O88A 1XX2A 3ZG5A 4IVKA 2W1TA 1MKIA 2C6WB 2XFSA 2Y2PA 3M2KA 4BD1A 2M1CA 2OWHA 1K55C 5FQ9A 3VFHA 1MY8A 5E2HA 3UE6A 2X02A 2ZC4B 4LLOB 5J3WA 3ZNYA 5TR7A 3AGFA 1ALQA 3MFXA 5HWWA 1T19A 4UA7A 4EBLA 5HARA 1DJBA 3SS5A 3T1QB 4Y0TA 1OTIA 3DW0A 1NYYA 5FL3A 3SW1A 1AWIA 1NRJA 3UPPA 2DNSA 5F1GA 2W27A 1JNUA 2A24A 3VP4A 3LI8A 2IWBA 5EUAA 3NHQA 1L2SA 3IS2B 4HH3A 4G3WA 1XKZA 4OP8A 3PYPA 1NZUA 4LGWA 1S66L 3QNCA 4JGQA 1MBLA 5F6AA 4CPKA 4G3VA 1JWPA 4QY6A 1MC0A 4ETXA 4GHIB 2VGJA 3S7QA 4CJNA 3GRJA 4JF6A 3FPWA 3NOTC 4FH2A 4R23A 3RXXA 3HLDA 2HPBA 4WN5A 1PZOA 5DTTA 3BEBA 3Q7VA 4I38A 5IT5A 5FA7A 3IBRA 1L3LA 3OPHA 1YMSA 3S1YA 1NYMA 3LIBA 2LB9A 4I39A 1XGJA 4JBFA 2V20A 5DKKA 1TD5A 1K57A 3K2NA 5G4ZA 3HUOA 4WEJA 2D01A 2HP9A 3MR0A 2R9XA 4R4RA 3T4LA 4PM5A 1ERMA 4P6ZM 4BMWA 4N9KA 3VSKA 3DTEA 1QMEA 2Q0OA 4R70A 1KDSA 2A2LA 2Q9MA 3PAGA 1CK3A 4M3KA 2ZC5B 4E04A 1H5XA 2FH5A 4ESPA 5A91A 1CEFA 3MKEA 2VEAA 1ES4A 3WS2A 1S6RA 1OTAA 4E3NA 2VV8A 3N8LA 2EXBA 2QKPA 4KZAA 2ZOIA 3BFEA 3S7NA 3MSHA 2XROA 3DTKA 3MQ0A 3V50A 4S2NC 2WKPA 3S22A 3Q07A 4QU3A 2H10A 1SKOB 2VA0A 3SH8A 4BBVA 2O0YA 4OLDA 2WKRA 3HL9A 3S7OA 2HDUA 2Y2JA 3CUEC 3Q7VB 3IXBA 3NULA 1T1AA 5FAQA 5A90A 5FAOA 2QWSA 4Q0HA 4I3JA 3VP0A 2J7VA 4U3TA 2Y2KA 1PRQA 3HJIA 3V5MA 5TBMA 1D06A 3KSGA 1N9NA 3ZYTA 5KMWA 3E4QA 4DE3A 3UN7A 4DRTA 4MLLA 5EV0A 5GLDA 1FSWA 3CI6A 5JYOA 2P9VB 3IX3A 4JXVA 3HLBA 5FEGA 2V8FA 5M1AA 1W5DA 3KYEA 4OLGA 1WA9A 2UWXA 4WZ5C 2PT7A 2PYRA 2XD5A 3LR4A 2NUPC 4OVDA 2YKFA 5EOEA 1CEGA 3UB9A 1EW0A 3DWZA 4QD4A 2J3WA 3UB7A 1S1ZA 1DP9A 4RVAA 4DN0A 4JXGA 3A3FA 4JXSA 1OT6A 4Y2FA 1OTEA 3VE4A 2J9PA 2XR0A 4QWOA 4S2NA 2WAEA 4O8GA 5FQMA 4EESA 3UMDA 3IH8A 4OKPA 1ZHHB 3H7WA 5GHYA 1HD8A 5C5KA 2OWJA 2Y79A 2P04A 3OPPA 3CWFA 3UB8A 4GOGA 1YSPA 3FWLA 3K3DA 3ZVTA 2RCXA 2ZL1B 4HJ6A 1H8YA 5FQIA 3BFFA 4X1MA 3OZHA 1LSWA 1N9BA 1I2SA 3CUEA 3EGDC 4MN7A 2BASA 3LFVA 4HOIA 1GHMA 4NXFA 3M6HA 4XUZA 2WZZA 3HCYA 3A3JA 3F1OB 4GS9B 4I5SA 1YAXA 4X55A 4E3IA 2HP5A 3EQVA 2Z6CA 2VZWA 3M2JA 3K3CA 1KE3A 4FSFA 1LSVA 1NWZA 1K56D 1W63Q 1DRMA 5DTSA 2EFUA 4MDZA 4PM9A 3EEHA 4YINA 2XF3A 2J3TD 5FATA 4LCLA 4P85A 1ESIA 1VETB 1Z6FA 3NECA 2CC1A 4BWIA 4M4XA 4HBUA 4Y3IA 4GDBA 3DTIA 2V8CA 3AGEA 4X1LA 5FQKA 4K91A 1DP6A 4NXBA 2ZMAA 3A3IA 3PAEA 1I5QA 4DDSA 3D72A 5CGWA 3BLSA 4N9LA 3TJZC 5FSRA 1SZVA 3T4TA 4WF0A 3SOIA 1F9IA 5AVFA 3KSFA 1MPLA 1H8MA 1P0ZA 5CRFA 2VJWA 4Q0JA 2QJ5A 4FH4A 1Y28A 3SH7A 3ZGAB 1JTDA 2OLVA 2Y2QA 3B47A 2Y2GA 3GR2A 3BY9A 2GZAA 3A0VA 3UPNA 1FR1A 2QHKA 3VE3A 3C8CA 2ZM0A 1TS0A 4KQOA 4KQQA 1IYOA 2JHEA 3NBLA 2I72A 1XP4A 4PPRA 5AQAA 1K25A 4EQIA 2P08A 2WGWB 4D2OA 2ZC3B 5EM0A 2Y4AA 1DJAA 4OPRA 4OPZA 4YFMA 3MKFA 1IYQA 3UMEA 5CEBA 4GW9A 1N4OA 4N92A 1PWGA 1N9OA 1ZC2A 4IEDA 4WBGA 2HF6A 3LCEA 5FAPA 3QP4A 4LRZE 2JKRM 3G2YA 2JKTM 5HL1A 4X69A 1Q2PA 3IS2A 4Y7PA 3D9YA 1PNEA 3UNWA 2EX6A 2VV6A 4Y17A 3IWOA 3G2ZA 3VP1A 3OPLA 1G6AA 3KYQA 4EUVA 3ZG0A 1FCNA 1K4EA 4GHIA 1OJGA 5F1FA 3ISGA 3IF6C 5KIZA 1KDWA 4K0WA 1SDNA 2EA9A 3CLOA 3QP5A 4UA6A 4GZBA 3VMAA 4S2OA 3T4OA 3QP6A 4MBKA 5TJJA 4UQIS 2ZQDA 2E8JA 3RXWA 4HESA 2WKIA 3EQUA 2Y91A 2PR5A 1PI5A 1P97A 5F68A 4B4ZA 2INWA 4G3KA 3VOLA 1ZG6A 4Z9QA 2H0YA 4BL2A 3ZG7B 4EV4A 3WRTA 4FOFA 5CTNA 5IU1A 5HZHA 5DVAA 3HLWA 1E25A 3IHAA 4O7DA 3LI9A 3MQQA 2Y2LA 2Y2OA 3IQAA 3CPTB 2BLSA 4JLFA 4FUWA 5IS1A 1D1JA 5HFOA 2B5RA 4HNBA 1GSXA 3O87A 4LCMA 3T4SA 1L0EA 3T50A 5BOHA 3BYDA 3QP8A 2X71A 3T4QA 3MQOA 3IX8A 5DKLA 2O99A 1G6OA 4C75A 1GSVA 4O0PA 2GX5A 3IF5A 3OOVA 1N9LA 4FTXA 1UGUA 3EGXC 2ZOHA 4DMZA 4R1GA 5GLCA 4LV3A 5HSQA 2JBFA 3PBOA 2OLUA 5KSHA 1OTBA 2W3DA 3BFDA 4HQAA 1SKOA 1M40A 2ZBBA 2G2UA 1VQQA 2K31A 4CQHA 1MXOA 2WAFA 3EOIA 1BULA 2DCFA 2V0WA 3ZG9B 4KENB 2XH9A 4XUXA 3O5YA 1IKIA 1KVLA 1FIKA 1D7EA 4RA7A 2A49A 2GDNA 1JTGA 1F5MA 1FCOA
chains in the Genus database with same CATH topology
3W4QA 4IBRA 5GLBA 2P9VB 5D3OA 4RYEA 4JXVA 2WUQA 3HLBA 5A92A 4DE2A 3BFCA 1J9MA 3NCKA 4F94A 1C3BA 4S2PA 3UDIA 4GB7A 1QMFA 1LLBA 5M1AA 3HLFA 1W5DA 4MBFA 5KSCA 3ZNTA 2R9WA 4OLGA 2J8YA 2UWXA 1NXYA 4WZ5C 3VSLA 4HBTA 5L2FA 2XK1A 2WGVA 3MZDA 5EPHA 2P9VA 2XD5A 3DWKA 3ZVWA 3MXRA 1JVJA 4OOLA 2XQZA 5F82A 3BECA 4GD6A 4H8RA 3WS1A 2XFTA 4DF6A 1IYSA 4OVDA 3MFDA 5DTKA 1E4DA 1K55A 3OPRA 2WZXA 4E3OA 1XA1A 1MWRA 1JWZA 4U0TA 5EOEA 4ZJ3A 5CHUA 3N6IA 2EX2A 1CEGA 3PBNA 5F83A 1EI5A 3C7VA 3G32A 3DWZA 4QD4A 3NIAA 1O07A 3FKWA 1AXBA 4EUZA 5A93A 5EVID 1KVMA 1OMEA 3TSGA 1M6KA 4RVAA 4JXGA 3RJUA 4JF4A 4ZJ2A 2ZM2A 4B4XA 4S2MA 3A3FA 4JXSA 5U47A 1KE0A 4WYYA 2XLNA 4OQ0A 4JKTA 4S2IA 1PWCA 1FSYA 1BLHA 2ZLYA 3Q82A 3HVFA 3LEZA 2J9PA 3PTEA 4WELA 2XR0A 4ZDXA 2G2WA 1MWUA 4DKIA 4S2NA 2WAEA 3PBSA 5FQMA 3IH8A 3UO9A 4OKPA 1HZOA 2WGIA 3LY3A 2JE5A 1SCWA 5AQBA 4LV2A 2Z2MB 5GHYA 5EVIB 3WS4A 1HD8A 4OPYA 2V2FF 1K6SA 1PI4A 2QZ6A 4E3MA 2Y59A 1XXMA 4FCFA 4WM9A 1CI9A 2HDQA 3IXGA 2Y2HA 1BLSA 2Z2LB 1W7FA 3OPPA 3GV9A 1RP5A 1G68A 4GOGA 4QJGA 5HW3A 3FWLA 1FOFA 1LHYA 2PBYA 4GN2A 2HP6A 1ZG4A 3ITBA 2RCXA 3ITAA 4X56A 5FQJA 3ZVTA 5EVIA 5FQIA 1H8YA 4IBXA 3BFFA 3OC2A 2OV5A 1TDLA 3OZHA 1N9BA 3AGDA 4BLMA 1YLTA 1I2SA 1NY0A 4KZ9A 4E6WA 2HDSA 3BM6A 4KG5A 4UAAA 3UDFA 1GHMA 3V3RA 4JF5A 3IF6B 3N8RA 5AQ7A 2QMIA 3M6HA 4ZAMA 2C5WB 4XUZA 4OP5A 2WZZA 4UHUA 3UE3A 4HEFA 4K0XA 4PMAA 2DRWA 5CGXA 3A3JA 4UA9A 4OPQA 4S2LA 1W8QA 2ZM8A 3S4XA 3UY6A 4LENA 5DF8A 3VP3A 1S0WA 1IKGA 3HREA 3ZFZA 4X6TA 5FQQA 2V1ZA 3ZDJA 1E3UD 4X55A 3WS5A 4E3JA 3SH9A 1TVFA 5CHJA 3C7UA 4E3IA 3IF6A 4DE0A 2HP5A 3EQVA 1IEMA 3QNBA 5CEDA 1IELA 3P98A 5FI6A 5GHZA 5J8XA 4OONA 2ZQ9A 3PBQA 2IWCA 3Q81A 4IVIA 3M2JA 4KZ4A 3HLGA 1PWDA 1YLZA 2JCHA 5CERA 1K4FA 4R0QA 5CTMA 1KE3A 4FSFA 1FR6A 4MBHA 2JC7A 5JYPA 2ZQ7A 3G30A 2EXAA 4DXCA 4OH0A 2EX9A 1PYYA 1K56D 4GDNA 4R3BA 3C4OA 1I2WA 4BENA 2ZQAA 4WEKA 2ZD8A 5DTSA 3NY4A 3N4IA 3IH9A 2EFUA 4PM9A 3QHYA 2P74A 1XGIA 2RL3A 4YINA 2XF3A 4XXRA 1SHVA 1YM1A 3NI9A 1KE4A 1KGEA 4LCLA 5FATA 4KZBA 4P85A 1ESIA 4NETA 1KGFA 2XDMA 3SS4A 1Z6FA 3O3VA 2X01A 4ZJ1A 2VGKA 4E6XA 4E3LA 2IWDA 1VM1A 3N8SA 2CC1A 1E3UA 2Y2IA 1DJCA 5FI2A 4N1HA 3CG5A 4KZ6A 3ZCZA 4HBUA 3TOIA 4GDBA 5EECA 1XPBA 1K54A 2Y2MA 3AGEA 3GMWA 5EE8A 5FQKA 4WZ4A 2XD1A 4K91A 1WYBA 1GA0A 3W4OA 2ZMAA 3A3IA 1FQGA 3PAEA 1I5QA 4DDSA 3WWXA 1CI8A 4S2KA 2WYXA 5CGWA 3BLSA 1ESUA 2J9OA 4N9LA 4RX3A 5FSRA 3ZG8B 4BD0A 1K57C 2H0TA 4E3KA 2FFYA 4DDYA 4PM8A 3O88A 3SOIA 1MPLA 1XX2A 3ZG5A 1YT4A 4X68A 4IVKA 1MWTA 3D4FA 1YLPA 1NZOA 4P0MA 3GSGA 2QPNA 1MKIA 5CRFA 2C6WB 2XFSA 2Y2PA 3M2KA 3M6BA 1ONGA 1YMXA 4BD1A 1ES2A 4FH4A 3SH7A 1K55C 5FQ9A 3VFHA 1K38A 3ZGAB 1MY8A 1JTDA 5E2HA 2OLVA 3G4PA 1LL9A 2Y2QA 2X02A 2ZC4B 1Q2QA 5EVLA 3ZNYA 5FASA 1U60A 3BRMA 3MZEA 2Y2GA 3AGFA 3IT9A 5E43A 1ALQA 5TR7A 4BQMA 3GR2A 4R4SA 3O86A 3UPNA 1RGYA 1FR1A 4MNRA 4KZ5A 2H5SA 2ZM0A 4UA7A 4EBLA 5HARA 3HLEA 4KQOA 3HLCA 4KQQA 1DJBA 1IYOA 3SS5A 3NBLA 4Y0TA 1H8ZA 1NJ4A 2I72A 3GTCA 5G18A 1WYCA 3DW0A 4Q8IA 1NYYA 1XP4A 2EX8A 2WKHA 4PPRA 5AQAA 1K25A 4EQIA 4KG6A 3UPPA 2DNSA 3IXHA 5F1GA 5HAIA 2WGWB 4D2OA 5CXWA 2ZC3B 3OCLA 2Y4AA 1DJAA 4OQGA 3V39A 4GKUA 4OPRA 4OPZA 3MKFA 1ZKJA 1YLYA 4YFMA 3VP4A 3P09A 1IYPA 1IYQA 5CEBA 3CZDA 4U0XA 2IWBA 5EUAA 1Y54A 1HTZA 4C3QA 1L2SA 5GL9A 1BT5A 1N4OA 1PW1A 3BFGA 4N92A 5TGFA 1PWGA 2Y2NA 3Q1FA 2XGNA 3GVBA 1ZC2A 4IEDA 4WBGA 2WGWA 2PU4A 1HVBA 3LCEA 1XKZA 5FAPA 4OP8A 1NZUA 3G2YA 4OOYA 2ZC7A 5GHXA 1ERQA 1L0FA 1O7EA 2XEPA 3QNCA 1MBLA 4CPKA 5CHMA 4Y0UA 5HL1A 4X69A 1JWPA 1YLJA 1GCEA 3HUMA 1Q2PA 3LO7A 3OCNA 4Y7PA 4PM6A 4QY6A 3TG9A 4A5RA 3UNWA 2EX6A 3N7WA 4DXBA 1BUEA 1L0DA 2VGJA 4B88A 4CJNA 3IWOA 1YLWA 3GRJA 4JF6A 4WZ5A 4FH2A 3G2ZA 3UPOA 4R23A 5KZHA 3VP1A 3RXXA 3HLDA 2HPBA 2ZJ9A 3OPLA 1K6RA 1G6AA 4KG2A 2ZC6B 1PZOA 5DTTA 3CMZA 3MBZA 3BEBA 3VP2A 3W4PA 3ZG0A 4EBNA 3E2KA 1FCNA 2WADA 1K4EA 3ZHHA 1BTLA 3PBRA 3MZFA 3Q7VA 5FA7A 1W79A 3BLMA 3UE1A 5F1FA 3OPHA 3ISGA 1BLPA 1YMSA 3S1YA 3IF6C 3W8KA 1NYMA 5I94A 1KDWA 1MWSA 4K0WA 1XGJA 1SDNA 4JBFA 4EWFA 1GA9A 3PBTA 4OOMA 3UDXA 3UE0A 3B3XA 4ZBEA 2A3UA 2V20A 5E2FA 1GHPA 1SKFA 1K57A 4UA6A 4GZBA 3HUOA 3VMAA 4WEJA 4S2OA 4MBKA 1NRFA 5HX9A 1TEMA 2HP9A 2R9XA 4R4RA 5AQ9A 2ZQDA 2PU2A 4PM5A 3G31A 1ES3A 1SDEA 1TDGA 2BG1A 3VOYA 1ERMA 3A3DA 1K56A 3RXWA 4HESA 2WKIA 4N9KA 3EQUA 3VSKA 5CECA 2ZQCA 2Y91A 3IWIA 3A3EA 1PI5A 4GD8A 1RCJA 4LV1A 1QMEA 5FI7A 5DF9A 4WMCD 4B4ZA 1KDSA 3I7JA 4JXWA 1XA7A 1ZG6A 4Z9QA 2H0YA 4BL2A 2Q9MA 3FKVA 4P6BA 3ZG7B 4EV4A 3C4PA 3PAGA 3WRTA 3FV7A 1CK3A 5E2EA 2Q9NA 4M3KA 5CTNA 2HDRA 1K54C 3JYIA 5DVAA 2ZC5B 1E25A 3HLWA 3IHAA 1H5XA 5IHVA 4R3JA 4O7DA 3IWQA 5A91A 1CEFA 4QY5A 3VFFA 2Y2LA 5M18A 3MKEA 2Y2OA 3IQAA 1ES4A 3CJMA 3WS2A 4QB8A 4DE1A 1S6RA 5HAPA 1LI0A 2BLSA 4JLFA 4PM7A 3IXDA 2WKEA 1PW8A 5HFOA 1EWZA 2B5RA 5FDHA 4E3NA 3N8LA 3O87A 2EXBA 4LCMA 4X53A 4OQIA 4KZAA 3BFEA 4QHCA 1L0EA 5TFQA 1PIOA 4LV0A 3V50A 3LY4A 5EOOA 4S2NC 1L0GA 5BOHA 3BYDA 4C6YA 4ID4A 1ONHA 2X71A 1PZPA 3S22A 4WMCA 4OQHA 4MEZA 1GHIA 3G35A 4FD8A 3DTMA 4Y0OA 5E2GA 4C75A 3Q07A 3FZCA 4L0LA 3IF5A 4KZ8A 4QU3A 2H10A 4ZTKA 3SS3A 3C5AA 4KQRA 1W8YA 1BZAA 3WS0A 4R1GA 2OSUA 5GLAA 5GLCA 3SH8A 1ES5A 4LV3A 1BLCA 3WRZA 2ZQ8A 2JBFA 4N1XA 3PBOA 4JPMA 5EVIC 2OLUA 2E8IA 1BSGA 4OLDA 2Y55A 5KSHA 3G34A 3BFDA 3HL9A 3Q7ZA 3IHBA 1M40A 2HDUA 2G2UA 2Y2JA 2EFXA 1VQQA 4KZ3A 3Q7VB 3IXBA 4S2JA 5FAQA 5A90A 1MXOA 1JWVA 1RGZA 5HAQA 2WAFA 5FAOA 1YQSA 4GNUA 1LL5A 4KZ7A 2DCFA 1BULA 1FCMA 1DY6A 4P87A 3VP0A 3MXSA 4KENB 3VOZA 3ZG9B 2J7VA 3V3SA 2XH9A 3NC8A 4NK3A 4U3TA 4XUXA 2Y2KA 1IKIA 5M19A 1KVLA 5DF7A 1KGGA 1LI9A 3V5MA 4BL3A 4BJPA 1WE4A 3NDGA 4RA7A 5KMWA 2WK0A 3E2LA 2A49A 2GDNA 3HUNA 3UN7A 4DE3A 1EROA 4DRTA 1JTGA 4EBPA 5CGSA 4MLLA 5GLDA 4RX2A 3NDEA 3GQZA 3FYZA 3HBRA 1FCOA 1FSWA 2FFFB 5JYOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3W4Q A;  4IBR A;  5GLB A;  2P9V B;  5D3O A;  4RYE A;  4JXV A;  2WUQ A;  3HLB A;  5A92 A;  4DE2 A;  3BFC A;  1J9M A;  3NCK A;  4F94 A;  1C3B A;  4S2P A;  3UDI A;  4GB7 A;  1QMF A;  1LLB A;  5M1A A;  3HLF A;  1W5D A;  4MBF A;  5KSC A;  3ZNT A;  2R9W A;  4OLG A;  2J8Y A;  2UWX A;  1NXY A;  4WZ5 C;  3VSL A;  4HBT A;  5L2F A;  2XK1 A;  2WGV A;  3MZD A;  5EPH A;  2P9V A;  2XD5 A;  3DWK A;  3ZVW A;  3MXR A;  1JVJ A;  4OOL A;  2XQZ A;  5F82 A;  3BEC A;  4GD6 A;  4H8R A;  3WS1 A;  2XFT A;  4DF6 A;  1IYS A;  4OVD A;  3MFD A;  5DTK A;  1E4D A;  1K55 A;  3OPR A;  2WZX A;  4E3O A;  1XA1 A;  1MWR A;  1JWZ A;  4U0T A;  5EOE A;  4ZJ3 A;  5CHU A;  3N6I A;  2EX2 A;  1CEG A;  3PBN A;  5F83 A;  1EI5 A;  3C7V A;  3G32 A;  3DWZ A;  4QD4 A;  3NIA A;  1O07 A;  3FKW A;  1AXB A;  4EUZ A;  5A93 A;  5EVI D;  1KVM A;  1OME A;  3TSG A;  1M6K A;  4RVA A;  4JXG A;  3RJU A;  4JF4 A;  4ZJ2 A;  2ZM2 A;  4B4X A;  4S2M A;  3A3F A;  4JXS A;  5U47 A;  1KE0 A;  4WYY A;  2XLN A;  4OQ0 A;  4JKT A;  4S2I A;  1PWC A;  1FSY A;  1BLH A;  2ZLY A;  3Q82 A;  3HVF A;  3LEZ A;  2J9P A;  3PTE A;  4WEL A;  2XR0 A;  4ZDX A;  2G2W A;  1MWU A;  4DKI A;  4S2N A;  2WAE A;  3PBS A;  5FQM A;  3IH8 A;  3UO9 A;  4OKP A;  1HZO A;  2WGI A;  3LY3 A;  2JE5 A;  1SCW A;  5AQB A;  4LV2 A;  2Z2M B;  5GHY A;  5EVI B;  3WS4 A;  1HD8 A;  4OPY A;  2V2F F;  1K6S A;  1PI4 A;  2QZ6 A;  4E3M A;  2Y59 A;  1XXM A;  4FCF A;  4WM9 A;  1CI9 A;  2HDQ A;  3IXG A;  2Y2H A;  1BLS A;  2Z2L B;  1W7F A;  3OPP A;  3GV9 A;  1RP5 A;  1G68 A;  4GOG A;  4QJG A;  5HW3 A;  3FWL A;  1FOF A;  1LHY A;  2PBY A;  4GN2 A;  2HP6 A;  1ZG4 A;  3ITB A;  2RCX A;  3ITA A;  4X56 A;  5FQJ A;  3ZVT A;  5EVI A;  5FQI A;  1H8Y A;  4IBX A;  3BFF A;  3OC2 A;  2OV5 A;  1TDL A;  3OZH A;  1N9B A;  3AGD A;  4BLM A;  1YLT A;  1I2S A;  1NY0 A;  4KZ9 A;  4E6W A;  2HDS A;  3BM6 A;  4KG5 A;  4UAA A;  3UDF A;  1GHM A;  3V3R A;  4JF5 A;  3IF6 B;  3N8R A;  5AQ7 A;  2QMI A;  3M6H A;  4ZAM A;  2C5W B;  4XUZ A;  4OP5 A;  2WZZ A;  4UHU A;  3UE3 A;  4HEF A;  4K0X A;  4PMA A;  2DRW A;  5CGX A;  3A3J A;  4UA9 A;  4OPQ A;  4S2L A;  1W8Q A;  2ZM8 A;  3S4X A;  3UY6 A;  4LEN A;  5DF8 A;  3VP3 A;  1S0W A;  1IKG A;  3HRE A;  3ZFZ A;  4X6T A;  5FQQ A;  2V1Z A;  3ZDJ A;  1E3U D;  4X55 A;  3WS5 A;  4E3J A;  3SH9 A;  1TVF A;  5CHJ A;  3C7U A;  4E3I A;  3IF6 A;  4DE0 A;  2HP5 A;  3EQV A;  1IEM A;  3QNB A;  5CED A;  1IEL A;  3P98 A;  5FI6 A;  5GHZ A;  5J8X A;  4OON A;  2ZQ9 A;  3PBQ A;  2IWC A;  3Q81 A;  4IVI A;  3M2J A;  4KZ4 A;  3HLG A;  1PWD A;  1YLZ A;  2JCH A;  5CER A;  1K4F A;  4R0Q A;  5CTM A;  1KE3 A;  4FSF A;  1FR6 A;  4MBH A;  2JC7 A;  5JYP A;  2ZQ7 A;  3G30 A;  2EXA A;  4DXC A;  4OH0 A;  2EX9 A;  1PYY A;  1K56 D;  4GDN A;  4R3B A;  3C4O A;  1I2W A;  4BEN A;  2ZQA A;  4WEK A;  2ZD8 A;  5DTS A;  3NY4 A;  3N4I A;  3IH9 A;  2EFU A;  4PM9 A;  3QHY A;  2P74 A;  1XGI A;  2RL3 A;  4YIN A;  2XF3 A;  4XXR A;  1SHV A;  1YM1 A;  3NI9 A;  1KE4 A;  1KGE A;  4LCL A;  5FAT A;  4KZB A;  4P85 A;  1ESI A;  4NET A;  1KGF A;  2XDM A;  3SS4 A;  1Z6F A;  3O3V A;  2X01 A;  4ZJ1 A;  2VGK A;  4E6X A;  4E3L A;  2IWD A;  1VM1 A;  3N8S A;  2CC1 A;  1E3U A;  2Y2I A;  1DJC A;  5FI2 A;  4N1H A;  3CG5 A;  4KZ6 A;  3ZCZ A;  4HBU A;  3TOI A;  4GDB A;  5EEC A;  1XPB A;  1K54 A;  2Y2M A;  3AGE A;  3GMW A;  5EE8 A;  5FQK A;  4WZ4 A;  2XD1 A;  4K91 A;  1WYB A;  1GA0 A;  3W4O A;  2ZMA A;  3A3I A;  1FQG A;  3PAE A;  1I5Q A;  4DDS A;  3WWX A;  1CI8 A;  4S2K A;  2WYX A;  5CGW A;  3BLS A;  1ESU A;  2J9O A;  4N9L A;  4RX3 A;  5FSR A;  3ZG8 B;  4BD0 A;  1K57 C;  2H0T A;  4E3K A;  2FFY A;  4DDY A;  4PM8 A;  3O88 A;  3SOI A;  1MPL A;  1XX2 A;  3ZG5 A;  1YT4 A;  4X68 A;  4IVK A;  1MWT A;  3D4F A;  1YLP A;  1NZO A;  4P0M A;  3GSG A;  2QPN A;  1MKI A;  5CRF A;  2C6W B;  2XFS A;  2Y2P A;  3M2K A;  3M6B A;  1ONG A;  1YMX A;  4BD1 A;  1ES2 A;  4FH4 A;  3SH7 A;  1K55 C;  5FQ9 A;  3VFH A;  1K38 A;  3ZGA B;  1MY8 A;  1JTD A;  5E2H A;  2OLV A;  3G4P A;  1LL9 A;  2Y2Q A;  2X02 A;  2ZC4 B;  1Q2Q A;  5EVL A;  3ZNY A;  5FAS A;  1U60 A;  3BRM A;  3MZE A;  2Y2G A;  3AGF A;  3IT9 A;  5E43 A;  1ALQ A;  5TR7 A;  4BQM A;  3GR2 A;  4R4S A;  3O86 A;  3UPN A;  1RGY A;  1FR1 A;  4MNR A;  4KZ5 A;  2H5S A;  2ZM0 A;  4UA7 A;  4EBL A;  5HAR A;  3HLE A;  4KQO A;  3HLC A;  4KQQ A;  1DJB A;  1IYO A;  3SS5 A;  3NBL A;  4Y0T A;  1H8Z A;  1NJ4 A;  2I72 A;  3GTC A;  5G18 A;  1WYC A;  3DW0 A;  4Q8I A;  1NYY A;  1XP4 A;  2EX8 A;  2WKH A;  4PPR A;  5AQA A;  1K25 A;  4EQI A;  4KG6 A;  3UPP A;  2DNS A;  3IXH A;  5F1G A;  5HAI A;  2WGW B;  4D2O A;  5CXW A;  2ZC3 B;  3OCL A;  2Y4A A;  1DJA A;  4OQG A;  3V39 A;  4GKU A;  4OPR A;  4OPZ A;  3MKF A;  1ZKJ A;  1YLY A;  4YFM A;  3VP4 A;  3P09 A;  1IYP A;  1IYQ A;  5CEB A;  3CZD A;  4U0X A;  2IWB A;  5EUA A;  1Y54 A;  1HTZ A;  4C3Q A;  1L2S A;  5GL9 A;  1BT5 A;  1N4O A;  1PW1 A;  3BFG A;  4N92 A;  5TGF A;  1PWG A;  2Y2N A;  3Q1F A;  2XGN A;  3GVB A;  1ZC2 A;  4IED A;  4WBG A;  2WGW A;  2PU4 A;  1HVB A;  3LCE A;  1XKZ A;  5FAP A;  4OP8 A;  1NZU A;  3G2Y A;  4OOY A;  2ZC7 A;  5GHX A;  1ERQ A;  1L0F A;  1O7E A;  2XEP A;  3QNC A;  1MBL A;  4CPK A;  5CHM A;  4Y0U A;  5HL1 A;  4X69 A;  1JWP A;  1YLJ A;  1GCE A;  3HUM A;  1Q2P A;  3LO7 A;  3OCN A;  4Y7P A;  4PM6 A;  4QY6 A;  3TG9 A;  4A5R A;  3UNW A;  2EX6 A;  3N7W A;  4DXB A;  1BUE A;  1L0D A;  2VGJ A;  4B88 A;  4CJN A;  3IWO A;  1YLW A;  3GRJ A;  4JF6 A;  4WZ5 A;  4FH2 A;  3G2Z A;  3UPO A;  4R23 A;  5KZH A;  3VP1 A;  3RXX A;  3HLD A;  2HPB A;  2ZJ9 A;  3OPL A;  1K6R A;  1G6A A;  4KG2 A;  2ZC6 B;  1PZO A;  5DTT A;  3CMZ A;  3MBZ A;  3BEB A;  3VP2 A;  3W4P A;  3ZG0 A;  4EBN A;  3E2K A;  1FCN A;  2WAD A;  1K4E A;  3ZHH A;  1BTL A;  3PBR A;  3MZF A;  3Q7V A;  5FA7 A;  1W79 A;  3BLM A;  3UE1 A;  5F1F A;  3OPH A;  3ISG A;  1BLP A;  1YMS A;  3S1Y A;  3IF6 C;  3W8K A;  1NYM A;  5I94 A;  1KDW A;  1MWS A;  4K0W A;  1XGJ A;  1SDN A;  4JBF A;  4EWF A;  1GA9 A;  3PBT A;  4OOM A;  3UDX A;  3UE0 A;  3B3X A;  4ZBE A;  2A3U A;  2V20 A;  5E2F A;  1GHP A;  1SKF A;  1K57 A;  4UA6 A;  4GZB A;  3HUO A;  3VMA A;  4WEJ A;  4S2O A;  4MBK A;  1NRF A;  5HX9 A;  1TEM A;  2HP9 A;  2R9X A;  4R4R A;  5AQ9 A;  2ZQD A;  2PU2 A;  4PM5 A;  3G31 A;  1ES3 A;  1SDE A;  1TDG A;  2BG1 A;  3VOY A;  1ERM A;  3A3D A;  1K56 A;  3RXW A;  4HES A;  2WKI A;  4N9K A;  3EQU A;  3VSK A;  5CEC A;  2ZQC A;  2Y91 A;  3IWI A;  3A3E A;  1PI5 A;  4GD8 A;  1RCJ A;  4LV1 A;  1QME A;  5FI7 A;  5DF9 A;  4WMC D;  4B4Z A;  1KDS A;  3I7J A;  4JXW A;  1XA7 A;  1ZG6 A;  4Z9Q A;  2H0Y A;  4BL2 A;  2Q9M A;  3FKV A;  4P6B A;  3ZG7 B;  4EV4 A;  3C4P A;  3PAG A;  3WRT A;  3FV7 A;  1CK3 A;  5E2E A;  2Q9N A;  4M3K A;  5CTN A;  2HDR A;  1K54 C;  3JYI A;  5DVA A;  2ZC5 B;  1E25 A;  3HLW A;  3IHA A;  1H5X A;  5IHV A;  4R3J A;  4O7D A;  3IWQ A;  5A91 A;  1CEF A;  4QY5 A;  3VFF A;  2Y2L A;  5M18 A;  3MKE A;  2Y2O A;  3IQA A;  1ES4 A;  3CJM A;  3WS2 A;  4QB8 A;  4DE1 A;  1S6R A;  5HAP A;  1LI0 A;  2BLS A;  4JLF A;  4PM7 A;  3IXD A;  2WKE A;  1PW8 A;  5HFO A;  1EWZ A;  2B5R A;  5FDH A;  4E3N A;  3N8L A;  3O87 A;  2EXB A;  4LCM A;  4X53 A;  4OQI A;  4KZA A;  3BFE A;  4QHC A;  1L0E A;  5TFQ A;  1PIO A;  4LV0 A;  3V50 A;  3LY4 A;  5EOO A;  4S2N C;  1L0G A;  5BOH A;  3BYD A;  4C6Y A;  4ID4 A;  1ONH A;  2X71 A;  1PZP A;  3S22 A;  4WMC A;  4OQH A;  4MEZ A;  1GHI A;  3G35 A;  4FD8 A;  3DTM A;  4Y0O A;  5E2G A;  4C75 A;  3Q07 A;  3FZC A;  4L0L A;  3IF5 A;  4KZ8 A;  4QU3 A;  2H10 A;  4ZTK A;  3SS3 A;  3C5A A;  4KQR A;  1W8Y A;  1BZA A;  3WS0 A;  4R1G A;  2OSU A;  5GLA A;  5GLC A;  3SH8 A;  1ES5 A;  4LV3 A;  1BLC A;  3WRZ A;  2ZQ8 A;  2JBF A;  4N1X A;  3PBO A;  4JPM A;  5EVI C;  2OLU A;  2E8I A;  1BSG A;  4OLD A;  2Y55 A;  5KSH A;  3G34 A;  3BFD A;  3HL9 A;  3Q7Z A;  3IHB A;  1M40 A;  2HDU A;  2G2U A;  2Y2J A;  2EFX A;  1VQQ A;  4KZ3 A;  3Q7V B;  3IXB A;  4S2J A;  5FAQ A;  5A90 A;  1MXO A;  1JWV A;  1RGZ A;  5HAQ A;  2WAF A;  5FAO A;  1YQS A;  4GNU A;  1LL5 A;  4KZ7 A;  2DCF A;  1BUL A;  1FCM A;  1DY6 A;  4P87 A;  3VP0 A;  3MXS A;  4KEN B;  3VOZ A;  3ZG9 B;  2J7V A;  3V3S A;  2XH9 A;  3NC8 A;  4NK3 A;  4U3T A;  4XUX A;  2Y2K A;  1IKI A;  5M19 A;  1KVL A;  5DF7 A;  1KGG A;  1LI9 A;  3V5M A;  4BL3 A;  4BJP A;  1WE4 A;  3NDG A;  4RA7 A;  5KMW A;  2WK0 A;  3E2L A;  2A49 A;  2GDN A;  3HUN A;  3UN7 A;  4DE3 A;  1ERO A;  4DRT A;  1JTG A;  4EBP A;  5CGS A;  4MLL A;  5GLD A;  4RX2 A;  3NDE A;  3GQZ A;  3FYZ A;  3HBR A;  1FCO A;  1FSW A;  2FFF B;  5JYO A; 
#chains in the Genus database with same CATH topology
 3W4Q A;  1LL8 A;  4L9F A;  5D3O A;  5HDC A;  1OTD A;  4DE2 A;  4EET B;  2W3F A;  1J9M A;  3JVV A;  3NCK A;  4F94 A;  1LLB A;  3HLF A;  4MBF A;  2VLG A;  3ZNT A;  1YKD A;  2R9W A;  2J8Y A;  4JGP A;  2XK1 A;  5EPH A;  4KUO A;  2P9V A;  3MXR A;  4H8R A;  1H0M A;  1E4D A;  1K55 A;  4ZJ3 A;  2EX2 A;  3PBN A;  3T1S A;  3C7V A;  2HZ5 A;  3G32 A;  3FKW A;  1P9R A;  1YSQ A;  5A93 A;  3EEA A;  3TSG A;  3RJU A;  4B4X A;  1KE0 A;  3CIT A;  3LIA A;  4JKT A;  2L0W A;  3D3O A;  4ZDX A;  4LFU A;  4L9G A;  3LY3 A;  2JE5 A;  5AQB A;  1PI4 A;  5AVE A;  1XXM A;  4WM9 A;  1CI9 A;  3MJQ A;  2Y2H A;  1RP5 A;  4QJG A;  2HP6 A;  3ITB A;  3ITA A;  5FQJ A;  3GEC A;  2XA7 S;  3AGD A;  4BLM A;  1NY0 A;  3GDI A;  3UDF A;  3V3R A;  4JF5 A;  3IF6 B;  3N8R A;  1CJF A;  2ZL1 A;  4UHU A;  5EVE A;  4HEF A;  1NLY A;  3RTY A;  3CHW P;  3IBJ A;  4OPQ A;  2ZMF A;  2ZM8 A;  3DAV A;  5MC7 A;  4LEN A;  4R6L A;  1IKG A;  3HRE A;  2V1Z A;  3H9W A;  1S4S A;  4D60 A;  5CHJ A;  4DE0 A;  1XJ2 A;  5CED A;  5GHZ A;  1A0K A;  2ZQ9 A;  3Q81 A;  2JKG A;  2NUT C;  3F1O A;  4F3L B;  1YLZ A;  4GS9 A;  4R0Q A;  3S7P A;  2O9A A;  5DFY A;  2EXA A;  4OH0 A;  2EX9 A;  1PYY A;  4GDN A;  4R3B A;  2ZQA A;  1G28 A;  3ZQ5 A;  1LSX A;  4XXR A;  1SHV A;  1YM1 A;  2PDR A;  1KGE A;  1KGF A;  2HV1 A;  2X01 A;  1XFQ A;  1VM1 A;  2Y2I A;  4N1H A;  5EEC A;  2XD1 A;  3V67 A;  2VGL S;  1WYB A;  2PAV P;  1VET A;  2YKH A;  3A0R A;  1KOU A;  1ESU A;  2HGV A;  2J9O A;  4QPR A;  1OT9 A;  2H0T A;  4HP9 A;  5I5L A;  3JPU A;  3NOP C;  1YT4 A;  4X68 A;  1MWT A;  3D4F A;  1YLP A;  1NZO A;  4P0M A;  3GSG A;  4CLC C;  1W63 M;  3M6B A;  4HJ4 A;  1ONG A;  4HIA A;  1K38 A;  3G4P A;  4K08 A;  5FAS A;  3O86 A;  3LIF A;  1TS6 A;  4Y13 A;  3BW6 A;  4II7 A;  5DFX A;  1TF1 A;  1H8Z A;  5F69 A;  3LUQ A;  4WL9 A;  1WYC A;  5G18 A;  2WKH A;  5HD3 A;  1S67 L;  4KG6 A;  3IXH A;  5HAI A;  3OCL A;  3C2W A;  3V39 A;  1LT0 A;  1ZKJ A;  1YLY A;  3T4J A;  1IYP A;  2V1B A;  3CZD A;  3LR3 A;  5A8B A;  4U0X A;  1HTZ A;  4MCW A;  5GL9 A;  5G4Y A;  3U4L P;  2W0N A;  2XGN A;  3QP1 A;  2WGW A;  1Y4O A;  3U2A A;  3KX0 X;  4OOY A;  1ERQ A;  1L0F A;  1O7E A;  4Y0U A;  3HUM A;  1YLJ A;  1GCE A;  3LO7 A;  4ARZ A;  4PM6 A;  4A5R A;  4PAU A;  4GLQ A;  3C38 A;  4CLC D;  3N7W A;  1BUE A;  3T1R A;  1L0D A;  1VEU B;  4WZ5 A;  2ZJ9 A;  1K6R A;  4EEU A;  4KG2 A;  3T12 B;  4EBN A;  3CMZ A;  5FEF A;  2V0U A;  3ZHH A;  2WAD A;  3PHY A;  1BTL A;  2W1R A;  3PBR A;  3LYX A;  2KLI A;  1S1Y A;  1W79 A;  3BLM A;  1MZU A;  4HH2 A;  3FPV A;  1T18 A;  5I94 A;  1MWS A;  4EWF A;  1GA9 A;  3UE0 A;  3B3X A;  4BBT A;  3H82 B;  3FG8 A;  1GHP A;  3LGO A;  1F2K A;  2AVX A;  1NRF A;  5HX9 A;  1TEM A;  5DJU A;  3FC7 A;  4CLC A;  1ES3 A;  1SDE A;  1TDG A;  3DBA A;  3VOY A;  3A3D A;  1K56 A;  1VB6 A;  5CEC A;  2ZQC A;  5EM1 A;  4GD8 A;  2ZMV A;  4HY8 A;  2GNX A;  3F1N B;  4LV1 A;  5DF9 A;  4WMC D;  5FI7 A;  5L10 A;  1XFN A;  3B33 A;  3I7J A;  4JXW A;  1T1B A;  4YWZ A;  3FKV A;  5E2E A;  4NKP A;  1K54 C;  5IHV A;  4R3J A;  3P01 A;  4QY5 A;  5M18 A;  3CJM A;  5HAP A;  2EWW A;  2WKE A;  2K7S A;  3ULF A;  1PW8 A;  1EWZ A;  5FDH A;  4OQI A;  4QHC A;  1PIO A;  5HPI A;  4C6Y A;  3L9K A;  3CPT A;  1PZP A;  4WMC A;  4I3I A;  4OQH A;  1GHI A;  3G35 A;  4FD8 A;  4Y0O A;  3FZC A;  4L0L A;  4ZTK A;  2V9A A;  3SS3 A;  3C5A A;  1W8Y A;  4Y15 A;  1BZA A;  3WS0 A;  4ARZ B;  3LIC A;  5GLA A;  3KO6 A;  3WRZ A;  3OBF A;  3MS6 A;  4RQ9 A;  4JPM A;  2E8I A;  1BSG A;  2ACG A;  2JKT I;  2Y55 A;  3G34 A;  1T1C A;  3G6O A;  1ODV A;  2PBD P;  2DMW A;  1JWV A;  5HAQ A;  1YQS A;  4GNU A;  4KZ7 A;  3VOZ A;  3V3S A;  3NC8 A;  4UEY A;  1IOU A;  5M19 A;  2OOL A;  1KGG A;  4BL3 A;  2B95 A;  4Y5F A;  3NDG A;  4JGO A;  2WK0 A;  3E2L A;  1ERO A;  4EBP A;  3MXQ A;  5CGS A;  1UWN X;  3NDE A;  3GQZ A;  3PXP A;  4MN5 A;  4H6J B;  2FFF B;  4CLC B;  4IBR A;  2WUQ A;  1V9Z A;  2HJ9 C;  4Z1W A;  3QP2 A;  3R7W B;  3MMH A;  4S2P A;  4GB7 A;  1QMF A;  5KSC A;  5J7E A;  3IX4 A;  2HJE A;  5HL6 A;  2H28 A;  2VKS A;  1NXY A;  5L2F A;  4HBT A;  2WGV A;  3MZD A;  3UB5 P;  5HDD A;  3UB6 A;  3NJA A;  4IUH A;  3DWK A;  3ZVW A;  4OOL A;  2XQZ A;  4GD6 A;  3WS1 A;  4DF6 A;  4R38 A;  3OPR A;  4E3O A;  5HWT A;  5CHU A;  3N6I A;  5F83 A;  2MJ6 A;  3NIA A;  1O07 A;  1AXB A;  4EUZ A;  1KVM A;  1M6K A;  2D02 A;  5HD5 A;  1V9Y A;  4HP4 A;  5U47 A;  1K0K A;  4WYY A;  5L09 A;  4S2I A;  1FSY A;  3HVF A;  3PTE A;  4WEL A;  2W3G A;  2M7U A;  2G2W A;  1MWU A;  4DKI A;  3PBS A;  4XT2 B;  2WGI A;  5HWV A;  2Z2M B;  5EVI B;  2VV7 A;  2V2F F;  2QZ6 A;  4E3M A;  2Y59 A;  4FCF A;  2HDQ A;  1MKM A;  1BLS A;  2Z2L B;  2Y8H A;  4EEP A;  3GV9 A;  1G68 A;  5HW3 A;  1LHY A;  3PR6 A;  1ZG4 A;  4X56 A;  4P6Z S;  1Z09 A;  3BY8 A;  1YLT A;  3A0S A;  4KZ9 A;  4E6W A;  3RFB A;  1ZTU A;  2B02 A;  4YOF A;  3LID A;  2QMI A;  2C5W B;  4OP5 A;  2W3H A;  4K0X A;  4PMA A;  2DRW A;  3S4X A;  2I9V A;  5DF8 A;  3KYZ A;  3ZFZ A;  3ZDJ A;  4UQI M;  2M7V A;  3WS5 A;  4E3J A;  3SH9 A;  1TVF A;  3L7H A;  3IF6 A;  3LEQ A;  3P98 A;  5FI6 A;  1J3W A;  4IVI A;  4X25 A;  2PR6 A;  4O01 A;  2XSS A;  2JCH A;  2ZQ7 A;  3G30 A;  2V1A A;  3C4O A;  1I2W A;  2ZD8 A;  3BQA A;  3N4I A;  3IH9 A;  3QHY A;  4F3L A;  2P74 A;  1XGI A;  2RL3 A;  3F1P B;  3NI9 A;  1KE4 A;  4KZB A;  2XDM A;  5AJG A;  2KDK A;  2L4R A;  3O3V A;  4ZJ1 A;  3LIE A;  4KZ6 A;  3TOI A;  1XPB A;  3E4P A;  4WZ4 A;  3W4O A;  2W1T B;  1CI8 A;  1FIL A;  4S2K A;  2CMN A;  4RX3 A;  2QJ7 A;  4E3K A;  2FFY A;  4DDY A;  3KSH A;  5L07 A;  1DP8 A;  2QPN A;  2Z6D A;  1YMX A;  4LRX C;  1ES2 A;  1VHM A;  3T4K A;  1LL9 A;  1Q2Q A;  5EVL A;  5K5B A;  1U60 A;  3BRM A;  3MZE A;  5E43 A;  4BQM A;  3IT9 A;  4ME4 A;  4DJ2 A;  4R4S A;  1TS7 A;  4LRY C;  2O9B A;  1RGY A;  4MNR A;  3MF0 A;  4KZ5 A;  2H5S A;  2A24 B;  3HLE A;  3HLC A;  1NJ4 A;  3GTC A;  2PHY A;  1P9W A;  4Q8I A;  2EX8 A;  2JN7 A;  5CXW A;  4OQG A;  4WUJ A;  4GKU A;  3TW8 A;  3P09 A;  1OPX A;  3C30 A;  4C3Q A;  1Y54 A;  1BT5 A;  1PW1 A;  3BFG A;  5TGF A;  4HI4 A;  2Y2N A;  3Q1F A;  3GVB A;  1NLZ A;  2PU4 A;  1HVB A;  5DJT A;  4B93 A;  2ZC7 A;  4I3A A;  5GHX A;  2EWV A;  2XEP A;  2VK3 A;  5CHM A;  1PFL A;  3OCN A;  3TG9 A;  2KX6 A;  5F5Y A;  4DXB A;  3BJN A;  3LR5 A;  4B88 A;  1YLW A;  5FDS A;  3E98 A;  3UPO A;  5KZH A;  1S4R A;  4R3A A;  3R4K A;  2ZC6 B;  3W4P A;  3MBZ A;  3VP2 A;  3E2K A;  3MZF A;  3UE1 A;  1VEU A;  1BLP A;  5EFW A;  3W8K A;  4GJ4 A;  3OLO A;  3PBT A;  4OOM A;  3UDX A;  4ZBE A;  2A3U A;  5E2F A;  2WKQ A;  1SKF A;  4YNR A;  2P7J A;  5AQ9 A;  2OAQ 1;  2PU2 A;  3G31 A;  3BQ8 A;  2BG1 A;  3H82 A;  2OAP 1;  2XA7 M;  3IWI A;  3A3E A;  4JGR A;  1RCJ A;  1XA7 A;  4P6B A;  3C4P A;  1IFQ A;  3FV7 A;  2Q9N A;  5LBR A;  2HDR A;  4Q0I A;  3JYI A;  1BYW A;  3IWQ A;  3VFF A;  3F1N A;  4DE1 A;  4QB8 A;  1HLU P;  3LR0 A;  1LI0 A;  4PM7 A;  3IXD A;  4L9E A;  4X53 A;  2W3E A;  5TFQ A;  4LV0 A;  3HJK A;  3LY4 A;  5EOO A;  1L0G A;  2J3T C;  4ID4 A;  1F98 A;  1ONH A;  2BTF P;  3T1X A;  3E0Y A;  4MEZ A;  3DTM A;  5E2G A;  4KZ8 A;  4ZRR A;  4KQR A;  2L1M A;  2OSU A;  1ES5 A;  1STZ A;  1BLC A;  2ZQ8 A;  4PKY G;  4NXG A;  4ETZ A;  4N1X A;  5EVI C;  1CF0 A;  1H3Q A;  3Q7Z A;  3IHB A;  1UWP X;  2EFX A;  2VGL M;  5TBM B;  4KZ3 A;  3KSI A;  4S2J A;  1RGZ A;  2LB5 A;  1LL5 A;  5J4E A;  1FCM A;  4P87 A;  1DY6 A;  2J80 A;  3MXS A;  4NK3 A;  1XJ3 A;  3TE8 A;  5DF7 A;  1LI9 A;  2R78 A;  4BJP A;  1WE4 A;  2QYB A;  4BBU A;  3HUN A;  4WLA A;  4RX2 A;  4IJG A;  3FYZ A;  3HBR A;  5CTM A;  3CAX A;  5GLB A;  4RYE A;  5A92 A;  2K2N A;  4MN6 A;  3BFC A;  1C3B A;  3UDI A;  4AFI A;  2IA2 A;  4IUK A;  2O9C A;  3VSL A;  4H6J A;  4EU0 A;  1JVJ A;  5F82 A;  3R7W A;  3BEC A;  4GCZ A;  2XFT A;  1IYS A;  3MFD A;  5DTK A;  2WZX A;  1XA1 A;  1MWR A;  1JWZ A;  4U0T A;  1EI5 A;  2B18 A;  4NEE D;  4DJ3 A;  5EVI D;  2KOI A;  1OME A;  4JF4 A;  4ZJ2 A;  2ZM2 A;  4S2M A;  4LPZ A;  3H7W B;  2XLN A;  4OQ0 A;  1PWC A;  1BLH A;  2ZLY A;  3Q82 A;  3LEZ A;  4HJ3 A;  2GJ3 A;  1ACF A;  3RH8 B;  3JVU A;  2PD7 A;  4KQD A;  3UO9 A;  1HZO A;  1SCW A;  4LV2 A;  5HDS A;  3TRC A;  1GSW A;  3WS4 A;  4OPY A;  1K6S A;  2VX8 A;  1G5U A;  3SZT A;  3IXG A;  1XJ4 A;  2XRN A;  1W7F A;  1XJ6 A;  3E4O A;  3EWK A;  4XT2 A;  1FOF A;  2PBY A;  4PKY A;  4GN2 A;  2PRF A;  1TS8 A;  1OJ5 A;  4NXE A;  5EVI A;  4IBX A;  3OC2 A;  2OV5 A;  1TDL A;  4NG2 A;  2HDS A;  2FZ0 A;  3NOU C;  3BM6 A;  3VV4 A;  4KG5 A;  5CX7 A;  4UAA A;  5AQ7 A;  2JKR I;  4ZAM A;  3BWL A;  2UV0 E;  3UE3 A;  3P7N A;  5CGX A;  4UA9 A;  4S2L A;  4EXO A;  1W8Q A;  3VP3 A;  3UY6 A;  4HHD A;  1S0W A;  4X6T A;  5FQQ A;  4EW7 A;  1E3U D;  3C7U A;  1IEM A;  3QNB A;  1IEL A;  5J8X A;  5L8M A;  4OON A;  3PBQ A;  2IWC A;  4KZ4 A;  3HLG A;  1PWD A;  5CER A;  1K4F A;  1X0O A;  5HPF A;  1FR6 A;  4MBH A;  2JC7 A;  5JYP A;  4MMN A;  4DXC A;  2G7U A;  4BEN A;  4WEK A;  3NY4 A;  3W2Z A;  3ICY A;  4EQ1 A;  1YPR A;  4IHQ A;  4KUK A;  2PD8 A;  4NET A;  3SS4 A;  4E3L A;  2VGK A;  4E6X A;  2IWD A;  3N8S A;  1E3U A;  1DJC A;  5FI2 A;  4B9O A;  3CG5 A;  3ZCZ A;  2PYP A;  2JKF A;  4EER A;  1CQA A;  1K54 A;  2Y2M A;  3F1P A;  3GMW A;  4PHT A;  5EE8 A;  1GA0 A;  1FQG A;  3WWX A;  2WYX A;  3B42 A;  3ZG8 B;  4BD0 A;  1K57 C;  4CLC E;  4PM8 A;  3O88 A;  1XX2 A;  3ZG5 A;  4IVK A;  2W1T A;  1MKI A;  2C6W B;  2XFS A;  2Y2P A;  3M2K A;  4BD1 A;  2M1C A;  2OWH A;  1K55 C;  5FQ9 A;  3VFH A;  1MY8 A;  5E2H A;  3UE6 A;  2X02 A;  2ZC4 B;  4LLO B;  5J3W A;  3ZNY A;  5TR7 A;  3AGF A;  1ALQ A;  3MFX A;  5HWW A;  1T19 A;  4UA7 A;  4EBL A;  5HAR A;  1DJB A;  3SS5 A;  3T1Q B;  4Y0T A;  1OTI A;  3DW0 A;  1NYY A;  5FL3 A;  3SW1 A;  1AWI A;  1NRJ A;  3UPP A;  2DNS A;  5F1G A;  2W27 A;  1JNU A;  2A24 A;  3VP4 A;  3LI8 A;  2IWB A;  5EUA A;  3NHQ A;  1L2S A;  3IS2 B;  4HH3 A;  4G3W A;  1XKZ A;  4OP8 A;  3PYP A;  1NZU A;  4LGW A;  1S66 L;  3QNC A;  4JGQ A;  1MBL A;  5F6A A;  4CPK A;  4G3V A;  1JWP A;  4QY6 A;  1MC0 A;  4ETX A;  4GHI B;  2VGJ A;  3S7Q A;  4CJN A;  3GRJ A;  4JF6 A;  3FPW A;  3NOT C;  4FH2 A;  4R23 A;  3RXX A;  3HLD A;  2HPB A;  4WN5 A;  1PZO A;  5DTT A;  3BEB A;  3Q7V A;  4I38 A;  5IT5 A;  5FA7 A;  3IBR A;  1L3L A;  3OPH A;  1YMS A;  3S1Y A;  1NYM A;  3LIB A;  2LB9 A;  4I39 A;  1XGJ A;  4JBF A;  2V20 A;  5DKK A;  1TD5 A;  1K57 A;  3K2N A;  5G4Z A;  3HUO A;  4WEJ A;  2D01 A;  2HP9 A;  3MR0 A;  2R9X A;  4R4R A;  3T4L A;  4PM5 A;  1ERM A;  4P6Z M;  4BMW A;  4N9K A;  3VSK A;  3DTE A;  1QME A;  2Q0O A;  4R70 A;  1KDS A;  2A2L A;  2Q9M A;  3PAG A;  1CK3 A;  4M3K A;  2ZC5 B;  4E04 A;  1H5X A;  2FH5 A;  4ESP A;  5A91 A;  1CEF A;  3MKE A;  2VEA A;  1ES4 A;  3WS2 A;  1S6R A;  1OTA A;  4E3N A;  2VV8 A;  3N8L A;  2EXB A;  2QKP A;  4KZA A;  2ZOI A;  3BFE A;  3S7N A;  3MSH A;  2XRO A;  3DTK A;  3MQ0 A;  3V50 A;  4S2N C;  2WKP A;  3S22 A;  3Q07 A;  4QU3 A;  2H10 A;  1SKO B;  2VA0 A;  3SH8 A;  4BBV A;  2O0Y A;  4OLD A;  2WKR A;  3HL9 A;  3S7O A;  2HDU A;  2Y2J A;  3CUE C;  3Q7V B;  3IXB A;  3NUL A;  1T1A A;  5FAQ A;  5A90 A;  5FAO A;  2QWS A;  4Q0H A;  4I3J A;  3VP0 A;  2J7V A;  4U3T A;  2Y2K A;  1PRQ A;  3HJI A;  3V5M A;  5TBM A;  1D06 A;  3KSG A;  1N9N A;  3ZYT A;  5KMW A;  3E4Q A;  4DE3 A;  3UN7 A;  4DRT A;  4MLL A;  5EV0 A;  5GLD A;  1FSW A;  3CI6 A;  5JYO A;  2P9V B;  3IX3 A;  4JXV A;  3HLB A;  5FEG A;  2V8F A;  5M1A A;  1W5D A;  3KYE A;  4OLG A;  1WA9 A;  2UWX A;  4WZ5 C;  2PT7 A;  2PYR A;  2XD5 A;  3LR4 A;  2NUP C;  4OVD A;  2YKF A;  5EOE A;  1CEG A;  3UB9 A;  1EW0 A;  3DWZ A;  4QD4 A;  2J3W A;  3UB7 A;  1S1Z A;  1DP9 A;  4RVA A;  4DN0 A;  4JXG A;  3A3F A;  4JXS A;  1OT6 A;  4Y2F A;  1OTE A;  3VE4 A;  2J9P A;  2XR0 A;  4QWO A;  4S2N A;  2WAE A;  4O8G A;  5FQM A;  4EES A;  3UMD A;  3IH8 A;  4OKP A;  1ZHH B;  3H7W A;  5GHY A;  1HD8 A;  5C5K A;  2OWJ A;  2Y79 A;  2P04 A;  3OPP A;  3CWF A;  3UB8 A;  4GOG A;  1YSP A;  3FWL A;  3K3D A;  3ZVT A;  2RCX A;  2ZL1 B;  4HJ6 A;  1H8Y A;  5FQI A;  3BFF A;  4X1M A;  3OZH A;  1LSW A;  1N9B A;  1I2S A;  3CUE A;  3EGD C;  4MN7 A;  2BAS A;  3LFV A;  4HOI A;  1GHM A;  4NXF A;  3M6H A;  4XUZ A;  2WZZ A;  3HCY A;  3A3J A;  3F1O B;  4GS9 B;  4I5S A;  1YAX A;  4X55 A;  4E3I A;  2HP5 A;  3EQV A;  2Z6C A;  2VZW A;  3M2J A;  3K3C A;  1KE3 A;  4FSF A;  1LSV A;  1NWZ A;  1K56 D;  1W63 Q;  1DRM A;  5DTS A;  2EFU A;  4MDZ A;  4PM9 A;  3EEH A;  4YIN A;  2XF3 A;  2J3T D;  5FAT A;  4LCL A;  4P85 A;  1ESI A;  1VET B;  1Z6F A;  3NEC A;  2CC1 A;  4BWI A;  4M4X A;  4HBU A;  4Y3I A;  4GDB A;  3DTI A;  2V8C A;  3AGE A;  4X1L A;  5FQK A;  4K91 A;  1DP6 A;  4NXB A;  2ZMA A;  3A3I A;  3PAE A;  1I5Q A;  4DDS A;  3D72 A;  5CGW A;  3BLS A;  4N9L A;  3TJZ C;  5FSR A;  1SZV A;  3T4T A;  4WF0 A;  3SOI A;  1F9I A;  5AVF A;  3KSF A;  1MPL A;  1H8M A;  1P0Z A;  5CRF A;  2VJW A;  4Q0J A;  2QJ5 A;  4FH4 A;  1Y28 A;  3SH7 A;  3ZGA B;  1JTD A;  2OLV A;  2Y2Q A;  3B47 A;  2Y2G A;  3GR2 A;  3BY9 A;  2GZA A;  3A0V A;  3UPN A;  1FR1 A;  2QHK A;  3VE3 A;  3C8C A;  2ZM0 A;  1TS0 A;  4KQO A;  4KQQ A;  1IYO A;  2JHE A;  3NBL A;  2I72 A;  1XP4 A;  4PPR A;  5AQA A;  1K25 A;  4EQI A;  2P08 A;  2WGW B;  4D2O A;  2ZC3 B;  5EM0 A;  2Y4A A;  1DJA A;  4OPR A;  4OPZ A;  4YFM A;  3MKF A;  1IYQ A;  3UME A;  5CEB A;  4GW9 A;  1N4O A;  4N92 A;  1PWG A;  1N9O A;  1ZC2 A;  4IED A;  4WBG A;  2HF6 A;  3LCE A;  5FAP A;  3QP4 A;  4LRZ E;  2JKR M;  3G2Y A;  2JKT M;  5HL1 A;  4X69 A;  1Q2P A;  3IS2 A;  4Y7P A;  3D9Y A;  1PNE A;  3UNW A;  2EX6 A;  2VV6 A;  4Y17 A;  3IWO A;  3G2Z A;  3VP1 A;  3OPL A;  1G6A A;  3KYQ A;  4EUV A;  3ZG0 A;  1FCN A;  1K4E A;  4GHI A;  1OJG A;  5F1F A;  3ISG A;  3IF6 C;  5KIZ A;  1KDW A;  4K0W A;  1SDN A;  2EA9 A;  3CLO A;  3QP5 A;  4UA6 A;  4GZB A;  3VMA A;  4S2O A;  3T4O A;  3QP6 A;  4MBK A;  5TJJ A;  4UQI S;  2ZQD A;  2E8J A;  3RXW A;  4HES A;  2WKI A;  3EQU A;  2Y91 A;  2PR5 A;  1PI5 A;  1P97 A;  5F68 A;  4B4Z A;  2INW A;  4G3K A;  3VOL A;  1ZG6 A;  4Z9Q A;  2H0Y A;  4BL2 A;  3ZG7 B;  4EV4 A;  3WRT A;  4FOF A;  5CTN A;  5IU1 A;  5HZH A;  5DVA A;  3HLW A;  1E25 A;  3IHA A;  4O7D A;  3LI9 A;  3MQQ A;  2Y2L A;  2Y2O A;  3IQA A;  3CPT B;  2BLS A;  4JLF A;  4FUW A;  5IS1 A;  1D1J A;  5HFO A;  2B5R A;  4HNB A;  1GSX A;  3O87 A;  4LCM A;  3T4S A;  1L0E A;  3T50 A;  5BOH A;  3BYD A;  3QP8 A;  2X71 A;  3T4Q A;  3MQO A;  3IX8 A;  5DKL A;  2O99 A;  1G6O A;  4C75 A;  1GSV A;  4O0P A;  2GX5 A;  3IF5 A;  3OOV A;  1N9L A;  4FTX A;  1UGU A;  3EGX C;  2ZOH A;  4DMZ A;  4R1G A;  5GLC A;  4LV3 A;  5HSQ A;  2JBF A;  3PBO A;  2OLU A;  5KSH A;  1OTB A;  2W3D A;  3BFD A;  4HQA A;  1SKO A;  1M40 A;  2ZBB A;  2G2U A;  1VQQ A;  2K31 A;  4CQH A;  1MXO A;  2WAF A;  3EOI A;  1BUL A;  2DCF A;  2V0W A;  3ZG9 B;  4KEN B;  2XH9 A;  4XUX A;  3O5Y A;  1IKI A;  1KVL A;  1FIK A;  1D7E A;  4RA7 A;  2A49 A;  2GDN A;  1JTG A;  1F5M A;  1FCO A; 
#chains in the Genus database with same CATH homology
 3W4Q A;  4IBR A;  5GLB A;  2P9V B;  5D3O A;  4RYE A;  4JXV A;  2WUQ A;  3HLB A;  5A92 A;  4DE2 A;  3BFC A;  1J9M A;  3NCK A;  4F94 A;  1C3B A;  4S2P A;  3UDI A;  4GB7 A;  1QMF A;  1LLB A;  5M1A A;  3HLF A;  1W5D A;  4MBF A;  5KSC A;  3ZNT A;  2R9W A;  4OLG A;  2J8Y A;  2UWX A;  1NXY A;  4WZ5 C;  3VSL A;  4HBT A;  5L2F A;  2XK1 A;  2WGV A;  3MZD A;  5EPH A;  2P9V A;  2XD5 A;  3DWK A;  3ZVW A;  3MXR A;  1JVJ A;  4OOL A;  2XQZ A;  5F82 A;  3BEC A;  4GD6 A;  4H8R A;  3WS1 A;  2XFT A;  4DF6 A;  1IYS A;  4OVD A;  3MFD A;  5DTK A;  1E4D A;  1K55 A;  3OPR A;  2WZX A;  4E3O A;  1XA1 A;  1MWR A;  1JWZ A;  4U0T A;  5EOE A;  4ZJ3 A;  5CHU A;  3N6I A;  2EX2 A;  1CEG A;  3PBN A;  5F83 A;  1EI5 A;  3C7V A;  3G32 A;  3DWZ A;  4QD4 A;  3NIA A;  1O07 A;  3FKW A;  1AXB A;  4EUZ A;  5A93 A;  5EVI D;  1KVM A;  1OME A;  3TSG A;  1M6K A;  4RVA A;  4JXG A;  3RJU A;  4JF4 A;  4ZJ2 A;  2ZM2 A;  4B4X A;  4S2M A;  3A3F A;  4JXS A;  5U47 A;  1KE0 A;  4WYY A;  2XLN A;  4OQ0 A;  4JKT A;  4S2I A;  1PWC A;  1FSY A;  1BLH A;  2ZLY A;  3Q82 A;  3HVF A;  3LEZ A;  2J9P A;  3PTE A;  4WEL A;  2XR0 A;  4ZDX A;  2G2W A;  1MWU A;  4DKI A;  4S2N A;  2WAE A;  3PBS A;  5FQM A;  3IH8 A;  3UO9 A;  4OKP A;  1HZO A;  2WGI A;  3LY3 A;  2JE5 A;  1SCW A;  5AQB A;  4LV2 A;  2Z2M B;  5GHY A;  5EVI B;  3WS4 A;  1HD8 A;  4OPY A;  2V2F F;  1K6S A;  1PI4 A;  2QZ6 A;  4E3M A;  2Y59 A;  1XXM A;  4FCF A;  4WM9 A;  1CI9 A;  2HDQ A;  3IXG A;  2Y2H A;  1BLS A;  2Z2L B;  1W7F A;  3OPP A;  3GV9 A;  1RP5 A;  1G68 A;  4GOG A;  4QJG A;  5HW3 A;  3FWL A;  1FOF A;  1LHY A;  2PBY A;  4GN2 A;  2HP6 A;  1ZG4 A;  3ITB A;  2RCX A;  3ITA A;  4X56 A;  5FQJ A;  3ZVT A;  5EVI A;  5FQI A;  1H8Y A;  4IBX A;  3BFF A;  3OC2 A;  2OV5 A;  1TDL A;  3OZH A;  1N9B A;  3AGD A;  4BLM A;  1YLT A;  1I2S A;  1NY0 A;  4KZ9 A;  4E6W A;  2HDS A;  3BM6 A;  4KG5 A;  4UAA A;  3UDF A;  1GHM A;  3V3R A;  4JF5 A;  3IF6 B;  3N8R A;  5AQ7 A;  2QMI A;  3M6H A;  4ZAM A;  2C5W B;  4XUZ A;  4OP5 A;  2WZZ A;  4UHU A;  3UE3 A;  4HEF A;  4K0X A;  4PMA A;  2DRW A;  5CGX A;  3A3J A;  4UA9 A;  4OPQ A;  4S2L A;  1W8Q A;  2ZM8 A;  3S4X A;  3UY6 A;  4LEN A;  5DF8 A;  3VP3 A;  1S0W A;  1IKG A;  3HRE A;  3ZFZ A;  4X6T A;  5FQQ A;  2V1Z A;  3ZDJ A;  1E3U D;  4X55 A;  3WS5 A;  4E3J A;  3SH9 A;  1TVF A;  5CHJ A;  3C7U A;  4E3I A;  3IF6 A;  4DE0 A;  2HP5 A;  3EQV A;  1IEM A;  3QNB A;  5CED A;  1IEL A;  3P98 A;  5FI6 A;  5GHZ A;  5J8X A;  4OON A;  2ZQ9 A;  3PBQ A;  2IWC A;  3Q81 A;  4IVI A;  3M2J A;  4KZ4 A;  3HLG A;  1PWD A;  1YLZ A;  2JCH A;  5CER A;  1K4F A;  4R0Q A;  5CTM A;  1KE3 A;  4FSF A;  1FR6 A;  4MBH A;  2JC7 A;  5JYP A;  2ZQ7 A;  3G30 A;  2EXA A;  4DXC A;  4OH0 A;  2EX9 A;  1PYY A;  1K56 D;  4GDN A;  4R3B A;  3C4O A;  1I2W A;  4BEN A;  2ZQA A;  4WEK A;  2ZD8 A;  5DTS A;  3NY4 A;  3N4I A;  3IH9 A;  2EFU A;  4PM9 A;  3QHY A;  2P74 A;  1XGI A;  2RL3 A;  4YIN A;  2XF3 A;  4XXR A;  1SHV A;  1YM1 A;  3NI9 A;  1KE4 A;  1KGE A;  4LCL A;  5FAT A;  4KZB A;  4P85 A;  1ESI A;  4NET A;  1KGF A;  2XDM A;  3SS4 A;  1Z6F A;  3O3V A;  2X01 A;  4ZJ1 A;  2VGK A;  4E6X A;  4E3L A;  2IWD A;  1VM1 A;  3N8S A;  2CC1 A;  1E3U A;  2Y2I A;  1DJC A;  5FI2 A;  4N1H A;  3CG5 A;  4KZ6 A;  3ZCZ A;  4HBU A;  3TOI A;  4GDB A;  5EEC A;  1XPB A;  1K54 A;  2Y2M A;  3AGE A;  3GMW A;  5EE8 A;  5FQK A;  4WZ4 A;  2XD1 A;  4K91 A;  1WYB A;  1GA0 A;  3W4O A;  2ZMA A;  3A3I A;  1FQG A;  3PAE A;  1I5Q A;  4DDS A;  3WWX A;  1CI8 A;  4S2K A;  2WYX A;  5CGW A;  3BLS A;  1ESU A;  2J9O A;  4N9L A;  4RX3 A;  5FSR A;  3ZG8 B;  4BD0 A;  1K57 C;  2H0T A;  4E3K A;  2FFY A;  4DDY A;  4PM8 A;  3O88 A;  3SOI A;  1MPL A;  1XX2 A;  3ZG5 A;  1YT4 A;  4X68 A;  4IVK A;  1MWT A;  3D4F A;  1YLP A;  1NZO A;  4P0M A;  3GSG A;  2QPN A;  1MKI A;  5CRF A;  2C6W B;  2XFS A;  2Y2P A;  3M2K A;  3M6B A;  1ONG A;  1YMX A;  4BD1 A;  1ES2 A;  4FH4 A;  3SH7 A;  1K55 C;  5FQ9 A;  3VFH A;  1K38 A;  3ZGA B;  1MY8 A;  1JTD A;  5E2H A;  2OLV A;  3G4P A;  1LL9 A;  2Y2Q A;  2X02 A;  2ZC4 B;  1Q2Q A;  5EVL A;  3ZNY A;  5FAS A;  1U60 A;  3BRM A;  3MZE A;  2Y2G A;  3AGF A;  3IT9 A;  5E43 A;  1ALQ A;  5TR7 A;  4BQM A;  3GR2 A;  4R4S A;  3O86 A;  3UPN A;  1RGY A;  1FR1 A;  4MNR A;  4KZ5 A;  2H5S A;  2ZM0 A;  4UA7 A;  4EBL A;  5HAR A;  3HLE A;  4KQO A;  3HLC A;  4KQQ A;  1DJB A;  1IYO A;  3SS5 A;  3NBL A;  4Y0T A;  1H8Z A;  1NJ4 A;  2I72 A;  3GTC A;  5G18 A;  1WYC A;  3DW0 A;  4Q8I A;  1NYY A;  1XP4 A;  2EX8 A;  2WKH A;  4PPR A;  5AQA A;  1K25 A;  4EQI A;  4KG6 A;  3UPP A;  2DNS A;  3IXH A;  5F1G A;  5HAI A;  2WGW B;  4D2O A;  5CXW A;  2ZC3 B;  3OCL A;  2Y4A A;  1DJA A;  4OQG A;  3V39 A;  4GKU A;  4OPR A;  4OPZ A;  3MKF A;  1ZKJ A;  1YLY A;  4YFM A;  3VP4 A;  3P09 A;  1IYP A;  1IYQ A;  5CEB A;  3CZD A;  4U0X A;  2IWB A;  5EUA A;  1Y54 A;  1HTZ A;  4C3Q A;  1L2S A;  5GL9 A;  1BT5 A;  1N4O A;  1PW1 A;  3BFG A;  4N92 A;  5TGF A;  1PWG A;  2Y2N A;  3Q1F A;  2XGN A;  3GVB A;  1ZC2 A;  4IED A;  4WBG A;  2WGW A;  2PU4 A;  1HVB A;  3LCE A;  1XKZ A;  5FAP A;  4OP8 A;  1NZU A;  3G2Y A;  4OOY A;  2ZC7 A;  5GHX A;  1ERQ A;  1L0F A;  1O7E A;  2XEP A;  3QNC A;  1MBL A;  4CPK A;  5CHM A;  4Y0U A;  5HL1 A;  4X69 A;  1JWP A;  1YLJ A;  1GCE A;  3HUM A;  1Q2P A;  3LO7 A;  3OCN A;  4Y7P A;  4PM6 A;  4QY6 A;  3TG9 A;  4A5R A;  3UNW A;  2EX6 A;  3N7W A;  4DXB A;  1BUE A;  1L0D A;  2VGJ A;  4B88 A;  4CJN A;  3IWO A;  1YLW A;  3GRJ A;  4JF6 A;  4WZ5 A;  4FH2 A;  3G2Z A;  3UPO A;  4R23 A;  5KZH A;  3VP1 A;  3RXX A;  3HLD A;  2HPB A;  2ZJ9 A;  3OPL A;  1K6R A;  1G6A A;  4KG2 A;  2ZC6 B;  1PZO A;  5DTT A;  3CMZ A;  3MBZ A;  3BEB A;  3VP2 A;  3W4P A;  3ZG0 A;  4EBN A;  3E2K A;  1FCN A;  2WAD A;  1K4E A;  3ZHH A;  1BTL A;  3PBR A;  3MZF A;  3Q7V A;  5FA7 A;  1W79 A;  3BLM A;  3UE1 A;  5F1F A;  3OPH A;  3ISG A;  1BLP A;  1YMS A;  3S1Y A;  3IF6 C;  3W8K A;  1NYM A;  5I94 A;  1KDW A;  1MWS A;  4K0W A;  1XGJ A;  1SDN A;  4JBF A;  4EWF A;  1GA9 A;  3PBT A;  4OOM A;  3UDX A;  3UE0 A;  3B3X A;  4ZBE A;  2A3U A;  2V20 A;  5E2F A;  1GHP A;  1SKF A;  1K57 A;  4UA6 A;  4GZB A;  3HUO A;  3VMA A;  4WEJ A;  4S2O A;  4MBK A;  1NRF A;  5HX9 A;  1TEM A;  2HP9 A;  2R9X A;  4R4R A;  5AQ9 A;  2ZQD A;  2PU2 A;  4PM5 A;  3G31 A;  1ES3 A;  1SDE A;  1TDG A;  2BG1 A;  3VOY A;  1ERM A;  3A3D A;  1K56 A;  3RXW A;  4HES A;  2WKI A;  4N9K A;  3EQU A;  3VSK A;  5CEC A;  2ZQC A;  2Y91 A;  3IWI A;  3A3E A;  1PI5 A;  4GD8 A;  1RCJ A;  4LV1 A;  1QME A;  5FI7 A;  5DF9 A;  4WMC D;  4B4Z A;  1KDS A;  3I7J A;  4JXW A;  1XA7 A;  1ZG6 A;  4Z9Q A;  2H0Y A;  4BL2 A;  2Q9M A;  3FKV A;  4P6B A;  3ZG7 B;  4EV4 A;  3C4P A;  3PAG A;  3WRT A;  3FV7 A;  1CK3 A;  5E2E A;  2Q9N A;  4M3K A;  5CTN A;  2HDR A;  1K54 C;  3JYI A;  5DVA A;  2ZC5 B;  1E25 A;  3HLW A;  3IHA A;  1H5X A;  5IHV A;  4R3J A;  4O7D A;  3IWQ A;  5A91 A;  1CEF A;  4QY5 A;  3VFF A;  2Y2L A;  5M18 A;  3MKE A;  2Y2O A;  3IQA A;  1ES4 A;  3CJM A;  3WS2 A;  4QB8 A;  4DE1 A;  1S6R A;  5HAP A;  1LI0 A;  2BLS A;  4JLF A;  4PM7 A;  3IXD A;  2WKE A;  1PW8 A;  5HFO A;  1EWZ A;  2B5R A;  5FDH A;  4E3N A;  3N8L A;  3O87 A;  2EXB A;  4LCM A;  4X53 A;  4OQI A;  4KZA A;  3BFE A;  4QHC A;  1L0E A;  5TFQ A;  1PIO A;  4LV0 A;  3V50 A;  3LY4 A;  5EOO A;  4S2N C;  1L0G A;  5BOH A;  3BYD A;  4C6Y A;  4ID4 A;  1ONH A;  2X71 A;  1PZP A;  3S22 A;  4WMC A;  4OQH A;  4MEZ A;  1GHI A;  3G35 A;  4FD8 A;  3DTM A;  4Y0O A;  5E2G A;  4C75 A;  3Q07 A;  3FZC A;  4L0L A;  3IF5 A;  4KZ8 A;  4QU3 A;  2H10 A;  4ZTK A;  3SS3 A;  3C5A A;  4KQR A;  1W8Y A;  1BZA A;  3WS0 A;  4R1G A;  2OSU A;  5GLA A;  5GLC A;  3SH8 A;  1ES5 A;  4LV3 A;  1BLC A;  3WRZ A;  2ZQ8 A;  2JBF A;  4N1X A;  3PBO A;  4JPM A;  5EVI C;  2OLU A;  2E8I A;  1BSG A;  4OLD A;  2Y55 A;  5KSH A;  3G34 A;  3BFD A;  3HL9 A;  3Q7Z A;  3IHB A;  1M40 A;  2HDU A;  2G2U A;  2Y2J A;  2EFX A;  1VQQ A;  4KZ3 A;  3Q7V B;  3IXB A;  4S2J A;  5FAQ A;  5A90 A;  1MXO A;  1JWV A;  1RGZ A;  5HAQ A;  2WAF A;  5FAO A;  1YQS A;  4GNU A;  1LL5 A;  4KZ7 A;  2DCF A;  1BUL A;  1FCM A;  1DY6 A;  4P87 A;  3VP0 A;  3MXS A;  4KEN B;  3VOZ A;  3ZG9 B;  2J7V A;  3V3S A;  2XH9 A;  3NC8 A;  4NK3 A;  4U3T A;  4XUX A;  2Y2K A;  1IKI A;  5M19 A;  1KVL A;  5DF7 A;  1KGG A;  1LI9 A;  3V5M A;  4BL3 A;  4BJP A;  1WE4 A;  3NDG A;  4RA7 A;  5KMW A;  2WK0 A;  3E2L A;  2A49 A;  2GDN A;  3HUN A;  3UN7 A;  4DE3 A;  1ERO A;  4DRT A;  1JTG A;  4EBP A;  5CGS A;  4MLL A;  5GLD A;  4RX2 A;  3NDE A;  3GQZ A;  3FYZ A;  3HBR A;  1FCO A;  1FSW A;  2FFF B;  5JYO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...