1I5QA

Crystal structure of the e. coli ampc beta-lactamase mutant n152a covalently acylated with the inhibitory beta-lactam, moxalactam
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
358
structure length
356
Chain Sequence
APQQINDIVHRTITPLIEQQKIPGMAVAVIYQGKPYYFTWGYADIAKKQPVTQQTLFELGSVSKTFTGVLGGDAIARGEIKLSDPTTKYWPELTAKQWNGITLLHLATYTAGGLPLQVPDEVKSSSDLLRFYQNWQPAWAPGTQRLYAASSIGLFGALAVKPSGLSFEQAMQTRVFQPLKLNHTWINVPPAEEKNYAWGYREGKAVHVSPGALDAEAYGVKSTIEDMARWVQSNLKPLDINEKTLQQGIQLAQSRYWQTGDMYQGLGWEMLDWPVNPDSIIGDNKIALAARPVKAITPPTPAVRASWVHKTGATGGFGSYVAFIPEKELGIVMLANKNYPNPARVDAAWQILNALQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords BETA-LACTAMASE
publication title Inhibition of AmpC beta-lactamase through a destabilizing interaction in the active site.
pubmed doi rcsb
source organism Escherichia coli
total genus 114
structure length 356
sequence length 358
chains with identical sequence B
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2001-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00144 Beta-lactamase Beta-lactamase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 1i5qA00
2X02A 2XEPA 2ZC6B 5IHVA 2RCXA 1LL5A 4KZ7A 1O7EA 1XGJA 2X01A 2ZQDA 3Q82A 3ZG9B 4CPKA 2XD1A 3MZFA 1YQSA 5FQMA 3SH9A 5DF9A 5A92A 5GHYA 4OPQA 2A49A 5FAPA 3PBSA 4PM8A 3FYZA 4UAAA 1VM1A 2Q9MA 1L0GA 3PBOA 5CGXA 4Y0TA 2OLVA 3LY4A 5TFQA 1EWZA 2Y2MA 4PPRA 4ZDXA 3HVFA 3VP3A 1YM1A 2CC1A 1DJAA 4B4XA 2ZQ7A 3PBTA 3G4PA 2ZC5B 1NYMA 1PW1A 3IHBA 3OPPA 1OMEA 3HREA 2Y2OA 5FQKA 5GLBA 1Z6FA 4BD0A 4HBTA 3BLSA 1K57C 4IEDA 5EE8A 3GVBA 2PU4A 3HLDA 3V3RA 2G2WA 2ZJ9A 3IF6B 4MLLA 5CHMA 5HW3A 3DTMA 2WKHA 4OPZA 4BL3A 2WAEA 5FSRA 1W8QA 2BG1A 2FFYA 1IYQA 1FQGA 3V50A 2GDNA 1PWDA 5HARA 4Y0UA 4LENA 3G34A 3O88A 3UPPA 4F94A 4R4SA 3BFFA 3FKWA 1GCEA 4QY6A 5JYPA 2EXAA 4R1GA 5EVIC 1PWGA 3GMWA 4KZ8A 1MWSA 2IWBA 3W4QA 3NDGA 1HTZA 1KGEA 4M3KA 4DDSA 3IXGA 3PTEA 4FH4A 3VSKA 4S2LA 4QHCA 3P09A 1WYCA 4S2JA 4LCMA 1L0EA 2UWXA 4ZJ3A 2HP6A 1JWZA 3DW0A 2XGNA 4S2KA 4E3KA 4DRTA 2HDQA 1BLSA 3A3JA 4PM6A 2ZM0A 5A93A 2ZC7A 3UDFA 1RGZA 3CMZA 1KVLA 1YLZA 2WZXA 3Q7VA 4FH2A 4RVAA 3M6HA 1MKIA 1IYPA 1E3UD 5CEBA 1ES4A 3VOZA 1SKFA 3Q7VB 1J9MA 4MBFA 3O3VA 3G31A 3VOYA 3A3IA 4LV3A 4Y0OA 1DY6A 2XD5A 2WKEA 4EBLA 3I7JA 3HUNA 1I5QA 3OC2A 3MZEA 3QHYA 4R3JA 5EOEA 5DVAA 5DTSA 5CGSA 5F83A 3WWXA 2EXBA 1ERMA 1BSGA 1CEGA 1CI8A 1NY0A 1FR1A 3GTCA 4QJGA 1QMEA 3RXXA 1K55A 1G6AA 1LI9A 3N8SA 4JLFA 3IWIA 1K56D 4GNUA 2Y2LA 1ZC2A 3BFGA 5HX9A 2EX2A 3C7VA 4WMCA 3MXRA 3UNWA 4KZ3A 5E2HA 1DJCA 3PAGA 2Q9NA 5EVLA 1H5XA 2J9PA 2ZQ9A 4ZJ2A 3V5MA 1YLWA 4OOYA 3G2ZA 3OPRA 4UA9A 5CTMA 1SCWA 1MY8A 3LY3A 3SS5A 1SDEA 3MXSA 1BZAA 1TDLA 1E25A 5M1AA 1NJ4A 3WS0A 5EECA 1GHIA 3VFFA 3M2KA 3GSGA 2P9VA 2VGJA 4K0WA 5DTKA 3OPHA 3ZDJA 4OP8A 5TGFA 1KDSA 3HUMA 2P9VB 5CEDA 4S2OA 1BLPA 3SS3A 4P0MA 3VP2A 3C5AA 1RP5A 3GV9A 4ZTKA 3S1YA 1IYOA 3BLMA 5E2EA 5E43A 2HDSA 1XPBA 4GOGA 3M2JA 4GD6A 2X71A 2EX6A 2XQZA 2Y2HA 1JTGA 3IXHA 5FATA 2XH9A 4R0QA 2G2UA 3SOIA 3IXDA 4KZ4A 3UY6A 2EX8A 3ZVWA 1BT5A 1GA9A 4S2NA 2WYXA 1G68A 2WKIA 3Q7ZA 4HESA 5FA7A 4JF4A 4CJNA 3B3XA 2QPNA 1XP4A 3NDEA 1IEMA 1ZKJA 4N9KA 3O86A 4K91A 5G18A 2RL3A 4QD4A 5CECA 1TDGA 3CZDA 3N7WA 1TVFA 1KE0A 4GN2A 3UDXA 1GA0A 1W7FA 3UPNA 4EQIA 5KSHA 2E8IA 4KG5A 1NYYA 5FDHA 5GLAA 3SH7A 1MXOA 3PAEA 3OCNA 4DE0A 4E3LA 2V20A 4RX3A 4FCFA 1JWVA 3BM6A 4U0XA 4WELA 2XK1A 2Y2PA 3MFDA 2ZQAA 4PM7A 2ZQCA 1HD8A 1S0WA 5DF8A 4KZ9A 1K4EA 4KQOA 1XKZA 3V3SA 4OOMA 2Y91A 4DE3A 4WYYA 1E3UA 1K55C 3RXWA 4LCLA 4WZ5A 5CERA 3E2LA 3Q81A 5FQQA 4JXGA 4MNRA 3ZNYA 4E6WA 2IWDA 4JXVA 2EFXA 4WM9A 3NIAA 1ZG4A 4JPMA 5FQIA 3VMAA 4WZ4A 1ES3A 3TG9A 1JTDA 2H5SA 4DXBA 1MWRA 1LI0A 3ITAA 4Z9QA 3TOIA 4GKUA 2IWCA 1BLHA 5KMWA 1RGYA 1IKGA 4OH0A 4R3BA 5HAIA 3N8LA 1YT4A 2Y2NA 4GB7A 3SS4A 1EI5A 2VGKA 2XDMA 1K56A 4WEJA 1FCOA 3HL9A 3UE0A 4MBKA 1CI9A 4B88A 5I94A 2XFTA 4OP5A 2Y2QA 4OPYA 2ZD8A 3UPOA 2Y2JA 4IBXA 1ES5A 3HBRA 1MBLA 2A3UA 4KZ6A 2OLUA 4E3MA 1IKIA 1K25A 4O7DA 1KGGA 1W5DA 2I72A 4H8RA 4OKPA 4PMAA 4Q8IA 3N6IA 4NETA 1HZOA 3MKFA 5CHUA 4KG2A 5GLCA 4LV0A 3ZNTA 2Y59A 1EROA 1L2SA 1XGIA 1IELA 3ITBA 3S22A 1RCJA 2C6WB 1M40A 1AXBA 4D2OA 3A3EA 4P85A 2J8YA 1ERQA 1K38A 3WRZA 4UA7A 4R4RA 3BFDA 1YMSA 1PI5A 1ONHA 3A3FA 4JKTA 4UA6A 3GR2A 3S4XA 5JYOA 4L0LA 5BOHA 3CJMA 1PWCA 4BENA 1NXYA 1Q2QA 3BEBA 3Q07A 4S2NC 3FKVA 4E3OA 4QU3A 2H0TA 1K4FA 4DDYA 1S6RA 1MWTA 3LO7A 3UE3A 3JYIA 3VP4A 5U47A 3GRJA 3C7UA 1W8YA 4C6YA 2EFUA 4U0TA 1U60A 4S2MA 2DNSA 2OV5A 4KQRA 2Z2MB 2Z2LB 2DRWA 4N9LA 5E2GA 1K54A 2HDUA 4B4ZA 1KGFA 3WS1A 5EPHA 1TEMA 1W79A 3BFEA 4EWFA 4OQ0A 4PM9A 2V2FF 4QB8A 1YLTA 4P87A 1C3BA 4GDNA 2WZZA 4U3TA 2EX9A 3NI9A 4HEFA 3WS2A 4P6BA 4DXCA 1PYYA 3ZG7B 1XA1A 3SH8A 1CK3A 4OQHA 4C3QA 3BFCA 4EV4A 1I2WA 4WZ5C 3Q1FA 2ZQ8A 3O87A 4S2IA 4OVDA 5GHZA 1WE4A 5FI7A 4S2PA 4LV1A 3WRTA 3ZG5A 3FZCA 3IXBA 5AQBA 1L0DA 4XXRA 5F1FA 3BRMA 2R9XA 3TSGA 1YMXA 3QNCA 2B5RA 4OONA 4UHUA 1N4OA 1ZG6A 1FSWA 1ONGA 1PZPA 3FWLA 1PI4A 3ISGA 4OQGA 3LCEA 4RX2A 3IT9A 5AQAA 5EVID 5TR7A 4BQMA 1FCMA 3G32A 3VSLA 2ZM8A 1NZOA 4X53A 1PIOA 4BLMA 2Y4AA 2FFFB 4OQIA 4DKIA 3PBNA 5DTTA 4PM5A 2PU2A 3OPLA 1KE3A 2WAFA 4A5RA 5F82A 4E3IA 5M18A 4ZBEA 1H8ZA 3ZG0A 1SHVA 4BJPA 1XXMA 4LV2A 4HBUA 3AGEA 2QZ6A 1K6SA 2XF3A 3N4IA 4KENB 4DE2A 3IHAA 1K6RA 2JE5A 3M6BA 4X55A 5DF7A 5GL9A 3VP1A 2XFSA 2J7VA 4N1HA 2Y2IA 2XR0A 4EBPA 1LHYA 1BTLA 3VFHA 5GLDA 4YFMA 2WK0A 1QMFA 5KSCA 1DJBA 4DE1A 1MWUA 1N9BA 3HUOA 3ZGAB 2ZLYA 4X68A 1XA7A 5HFOA 4OLDA 1WYBA 5M19A 3UDIA 3IF6A 4X69A 1BLCA 2JC7A 4X56A 5FQJA 1GHPA 3N8RA 5HL1A 5FI6A 3OZHA 4IVKA 1CEFA 4Y7PA 4DF6A 5D3OA 1ALQA 3MKEA 4IBRA 2ZC4B 4GZBA 3EQVA 2JBFA 3HLFA 3ZFZA 3W8KA 3FV7A 1I2SA 4XUXA 3PBQA 4JBFA 2ZMAA 3WS4A 1K54C 3W4OA 4KZAA 3ZVTA 2ZC3B 3NBLA 4JF5A 1NRFA 5CRFA 1LLBA 5FASA 4KG6A 2WADA 3UO9A 4E3NA 3BECA 2P74A 2WGVA 3IWOA 4N1XA 2PBYA 2WUQA 2Y55A 3HLCA 1IYSA 4FSFA 5FAQA 3IF5A 1L0FA 2OSUA 1ES2A 3IWQA 1VQQA 2WGWA 3NC8A 4ZJ1A 1JVJA 3UE1A 5CXWA 4E3JA 4YINA 3D4FA 5AQ9A 5HAQA 1Y54A 1PZOA 3AGFA 1Q2PA 3G30A 3IH9A 3DWZA 1KDWA 2WGWB 3DWKA 3EQUA 4R23A 3V39A 5A90A 5CTNA 4OLGA 3NY4A 1BULA 1BUEA 4EBNA 2H0YA 2HDRA 4OPRA 2BLSA 4JXWA 3HLBA 4MBHA 3G2YA 3WS5A 4NK3A 1K57A 1SDNA 2C5WB 2R9WA 4FD8A 3VP0A 4C75A 1JWPA 3QNBA 4WEKA 4KQQA 3AGDA 4X6TA 2H10A 2HP5A 1XX2A 1MPLA 3IQAA 4K0XA 2V1ZA 4MEZA 4JF6A 3W4PA 3ZHHA 2Y2GA 1KE4A 4QY5A 1GHMA 2QMIA 3MBZA 4WBGA 2JCHA 3C4PA 4KZ5A 3HLWA 5CGWA 3OCLA 1HVBA 2J9OA 1FOFA 1E4DA 5EOOA 3UN7A 5L2FA 3IH8A 3GQZA 3PBRA 4GDBA 4ID4A 5A91A 4EUZA 1YLPA 2WGIA 2DCFA 5EVIA 4E6XA 3ZCZA 3A3DA 4OOLA 1FCNA 4BD1A 3C4OA 2Y2KA 4JXSA 5AQ7A 4RYEA 5EVIB 5J8XA 4IVIA 3RJUA 1ESIA 2HP9A 3BYDA 5CHJA 1M6KA 3CG5A 2ZM2A 3P98A 3G35A 1FSYA 3NCKA 1ESUA 3HLGA 3E2KA 4ZAMA 5KZHA 3IF6C 1O07A 3ZG8B 1PW8A 5FI2A 5FQ9A 1YLJA 5FAOA 1NZUA 4KZBA 4N92A 5F1GA 4BL2A 1KVMA 5GHXA 4RA7A 4XUZA 3LEZA 1LL9A 2HPBA 4GD8A 1H8YA 2XLNA 3HLEA 5HAPA 4WMCD 5EUAA 5E2FA 3MZDA 1FR6A 1YLYA
chains in the Genus database with same CATH superfamily
4P6ZS 2XEPA 2ZC6B 4HOIA 5LBRA 2RCXA 1O7EA 2ZQDA 3SH9A 2VX8A 4PM8A 2W0NA 1VM1A 2Q9MA 2MJ6A 4Y0TA 4BBUA 1EWZA 2R78A 3K3CA 4MCWA 4B4XA 5K5BA 4JGPA 1PW1A 3ICYA 3HLDA 4NKPA 3IF6B 5CHMA 1TD5A 3DTMA 2ZBBA 5FSRA 1FQGA 1PWDA 5HARA 4Y0UA 3MQOA 2EXAA 2A2LA 2IWBA 3W4QA 1FIKA 4IJGA 1KGEA 3IXGA 1VETB 3F1OB 2UWXA 3E0YA 2ZOIA 4DRTA 2ZC7A 4M4XA 1YLZA 2WZXA 4RVAA 3M6HA 1MKIA 1IYPA 4O01A 1MKMA 5J4EA 4WUJA 1SKFA 1TS8A 3IX8A 3Q7VB 1AWIA 5A8BA 3A3IA 4LV3A 2XD5A 4EEUA 3HUNA 1I5QA 1ZTUA 3G6OA 3OC2A 5DJTA 2V1AA 2KDKA 5F83A 3WWXA 2EXBA 1BSGA 1NY0A 2ZMFA 3RXXA 2YKHA 4IHQA 4NXGA 4LLOB 1K0KA 5HX9A 3OOVA 4EUVA 1N9LA 1LT0A 3PR6A 1DJCA 2Q9NA 2VEAA 3S7PA 3EEHA 1SCWA 1MY8A 3GDIA 1TDLA 3T1RA 4K0WA 5HPFA 3OPHA 3ZDJA 2ZL1B 4KUKA 5KIZA 4S2OA 1LSWA 3KYEA 3E4OA 4HIAA 2HDSA 3M2JA 2X71A 2EX6A 5FATA 4II7A 2G2UA 3UY6A 2W1TA 2EX8A 1VEUB 1G68A 5FA7A 1XP4A 1TS6A 3NDEA 1S4RA 4N9KA 5G18A 4FTXA 3CZDA 3LIAA 3N7WA 4GN2A 3SH7A 1NYYA 5GLAA 2CMNA 1MXOA 3PAEA 3T4JA 4E3LA 1ZHHB 3IBJA 4FCFA 3BM6A 3MQ0A 4WELA 2XK1A 3MFDA 3RTYA 4PM7A 2WKQA 1K4EA 5F69A 3V3SA 2AVXA 4WYYA 1E3UA 4LCLA 4WM9A 1W63Q 5MC7A 3VMAA 2JN7A 1JTDA 4DXBA 1MWRA 3JVVA 3VE3A 1OT9A 5TBMA 3TOIA 2Y8HA 1BLHA 5KMWA 1RGYA 4R3BA 4KUOA 4CLCE 2VGKA 3DBAA 4MBKA 5I94A 1UWPX 3UPOA 2Y2JA 4KZ6A 1OTAA 1K25A 4PMAA 1KGGA 4OKPA 4XT2B 3TJZC 3QP4A 1XGIA 1IELA 1RCJA 2LB9A 2VV6A 1AXBA 1PRQA 3A3EA 3T4QA 4P85A 2HJ9C 4UA7A 1YMSA 4JKTA 5HDSA 1PWCA 1N9NA 3FKVA 3LUQA 2H0TA 3FG8A 3LR4A 3QP6A 1HLUP 1W8YA 4U0TA 1U60A 5G4YA 2OV5A 2Z2MB 2Z2LB 4N9LA 4B4ZA 4HP9A 3WS1A 1W79A 1YLTA 2PT7A 2WZZA 2EX9A 3NI9A 3WS2A 4GS9B 1V9YA 1CK3A 4OQHA 4C3QA 4MDZA 5CX7A 3O87A 3K3DA 4XXRA 5F1FA 3IS2B 4UHUA 5CGSA 3IT9A 3G32A 1DP9A 2Y4AA 4OQIA 2O99A 2EA9A 4UQIM 2PU2A 3JVUA 3MXQA 3ZG0A 1SHVA 4LV2A 3B33A 4WN5A 3M6BA 1W63M 3VP1A 5DF7A 4LGWA 2XR0A 4EBPA 1BTLA 1S4SA 3NECA 1QMFA 4JGRA 3ZGAB 5HFOA 3HJKA 4X69A 1BLCA 4QPRA 1G6OA 3UMDA 1ALQA 5FEFA 4IBRA 3EQVA 3HLFA 3FV7A 5AVFA 2OOLA 1OPXA 4LRYC 1K54C 4KZAA 5CRFA 3RH8B 2P74A 4N1XA 4ETZA 2WUQA 2Y55A 3HLCA 5FAQA 3IWQA 2PD8A 3NC8A 3UE1A 1D06A 2W3DA 2GZAA 3D4FA 1Y54A 4P6ZM 3DWZA 3DWKA 5A90A 4R3AA 2BLSA 4NK3A 2XROA 2ACGA 4FD8A 4C75A 1JWPA 4KQQA 1XX2A 4K0XA 3ZHHA 2V1ZA 2D01A 2PYPA 4QY5A 2QMIA 2JCHA 3C4PA 3LI8A 1E4DA 5EOOA 3EOIA 3LIEA 1YLPA 2WGIA 5EVIA 3ZCZA 2HV1A 3A3DA 2HJEA 2Y2KA 3C4OA 4JXSA 1T19A 2HP9A 4L9FA 3NCKA 4ZAMA 3IF6C 2VA0A 3NOUC 1LL9A 2HPBA 1H8YA 3HLEA 2B18A 5HAPA 4K08A 3MFXA 5FDHA 2Y79A 1LL5A 3CITA 4D60A 3BW6A 2X01A 3TW8A 3ZG9B 4CPKA 4DN0A 3IX3A 4NXFA 3MZFA 2PRFA 5A92A 5GHYA 3E98A 3MMHA 5FAPA 3FYZA 3CHWP 3PBOA 5CGXA 1XFQA 5TFQA 4ZDXA 1YM1A 3U2AA 2VKSA 2L0WA 2Y2OA 5GLBA 1Z6FA 4HBTA 3QP8A 3BLSA 1K57C 2OWHA 5FDSA 4BMWA 4R70A 3V3RA 2G2WA 5FL3A 5HW3A 2QHKA 1W8QA 1IYQA 3V50A 1YAXA 3O88A 4F94A 2P04A 2BTFP 2J3WA 2LB5A 5JYPA 1SKOB 2PYRA 2B02A 3GMWA 1MWSA 1VETA 3KYZA 3F1OA 4S2LA 3P09A 1WYCA 4S2JA 4LCMA 4I3IA 2W3GA 2HP6A 1JWZA 4LRZE 3T50A 2HDQA 1BLSA 3T1QB 1KVLA 3Q7VA 3VOLA 5CEBA 1ES4A 5TJJA 4H6JB 3G31A 5F6AA 1EW0A 1DY6A 2V9AA 4R3JA 2H28A 3MQQA 1TS7A 1CEGA 2NUTC 1CI8A 4QJGA 1FR1A 1K55A 1LI9A 4JLFA 4Y3IA 4EW7A 2JKRM 3IWIA 3LIBA 3BFGA 4Z1WA 3LI9A 5E2HA 4IUKA 5EVLA 4ZJ2A 4UA9A 5CTMA 3LY3A 5G4ZA 1MZUA 4QWOA 1E25A 5F68A 1GHIA 2A24B 3GSGA 2QKPA 2ZL1A 2PHYA 4I3AA 4ESPA 1KDSA 2P9VB 2J3TD 1BLPA 4WLAA 3SS3A 4NXEA 3VP2A 3C5AA 1FILA 2JKTI 3O5YA 4GOGA 4GD6A 2XQZA 1VEUA 4KZ4A 1PNEA 3ZVWA 1BT5A 4S2NA 2WYXA 3Q7ZA 1VB6A 1ZKJA 3BWLA 4FUWA 2RL3A 4QD4A 3UDXA 3UPNA 5KSHA 3UMEA 4CLCB 1YSQA 4BWIA 2ZQAA 3A0SA 1HD8A 5DF8A 4KZ9A 1CF0A 4KQOA 1XKZA 4GHIA 1YSPA 2VK3A 4WZ5A 4JXGA 4MNRA 2IWDA 4JXVA 2EFXA 3MF0A 3NIAA 3P01A 2H5SA 4Z9QA 2UV0E 5IU1A 4Y15A 2IWCA 5HDCA 5HAIA 1L3LA 2Y2NA 4GB7A 2V8FA 1FCOA 3D3OA 4B88A 4OP5A 1LL8A 4XT2A 4IBXA 1ES5A 1MBLA 1KOUA 4E3MA 1P97A 3NOPC 3CWFA 2I72A 4H8RA 3N6IA 4NETA 3MKFA 5CHUA 3C30A 3S22A 2C6WB 4D2OA 1WA9A 2J8YA 3WRZA 5HZHA 3CJMA 4BENA 1Q2QA 3BEBA 3CI6A 2PR6A 1TS0A 1F2KA 4DDYA 1MWTA 5HD5A 3UE3A 3UB7A 2GX5A 4S2MA 2DRWA 3BFEA 2ZMVA 4OQ0A 2V2FF 4QB8A 1OTDA 4P87A 1C3BA 5HD3A 4GS9A 1JNUA 3T4OA 4HEFA 2I9VA 4DXCA 4CQHA 1H3QA 3A0VA 3H7WB 3BFCA 4EV4A 1GSXA 4HI4A 4JGQA 2ZQ8A 1OTEA 4EXOA 4S2IA 3IS2A 3LICA 3H82B 1P9RA 3WRTA 4Y17A 2L4RA 1L0DA 2B5RA 3VV4A 3ISGA 1PI4A 3CPTA 3LCEA 4NG2A 1FCMA 4X53A 1PIOA 5IT5A 1DRMA 2FFFB 3KSIA 4GJ4A 3PBNA 1KE3A 5DFYA 1PFLA 1XFNA 2W3FA 2XF3A 1S66L 4DE2A 3JPUA 1K6RA 3T4TA 4X55A 2Y2IA 2XRNA 4YFMA 4HJ6A 4I5SA 3GECA 5KSCA 3HUOA 4X68A 2V0WA 4GHIB 1D7EA 2GNXA 2JC7A 4KQDA 5HL1A 5FI6A 3OZHA 4IVKA 4YNRA 4Y7PA 4DF6A 2KX6A 2JBFA 4JBFA 3LEQA 2ZMAA 3W4OA 3ZVTA 3CUEA 2ZC3B 3BECA 3IWOA 2WGVA 1S1YA 1IYSA 3QP5A 1N9OA 3IF5A 2OSUA 1ES2A 5EVEA 4YINA 4MN6A 5AQ9A 3EGDC 1Q2PA 4ARZB 2WGWB 3EQUA 3V39A 5CTNA 3UB6A 3R4KA 4OLGA 2XA7S 2VV8A 3OLOA 2H0YA 4EESA 4MBHA 3HLBA 3G2YA 2O0YA 1SDNA 4R6LA 4WEKA 4X6TA 2HP5A 4MEZA 2K31A 2QJ7A 3D72A 1GHMA 4E04A 4KZ5A 2FZ0A 2J9OA 3KX0X 3LFVA 3IH8A 3PBRA 4EUZA 3HJIA 4E6XA 3B42A 1FCNA 4BD1A 2PAVP 3KYQA 4RYEA 3RJUA 1ESIA 3TRCA 1XJ4A 1Y4OA 3BYDA 3CG5A 1UGUA 3HLGA 1F5MA 5FQ9A 5FAOA 1NZUA 5F1GA 1KVMA 2QYBA 5GHXA 4ME4A 4RA7A 3UB5P 4XUZA 3DTEA 4WMCD 2M1CA 3MZDA 4PPRA 3CPTB 4AFIA 2K7SA 4KZ7A 1XGJA 5I5LA 3Q82A 2XD1A 2JKGA 1YQSA 3BY8A 5HWWA 4OPQA 2A49A 3PBSA 3TE8A 3LY4A 2Y2MA 3HVFA 3VP3A 3PBTA 4I38A 4DJ2A 2ZC5B 1NYMA 3OPPA 1OMEA 3HREA 2BASA 1GSWA 3QP2A 4MN7A 5FQKA 1S1ZA 4F3LB 4MLLA 1SZVA 2VV7A 3T1SA 2BG1A 1SKOA 2GDNA 3IX4A 4LENA 4R4SA 3BFFA 4WL9A 1YKDA 4R1GA 5DKKA 5EVIC 4GCZA 4X1LA 3NDGA 4DDSA 1NRJA 3PTEA 4FH4A 1L0EA 4Q0HA 4ZJ3A 2O9AA 3DW0A 4S2KA 4E3KA 1BYWA 1G5UA 2ZM0A 2O9BA 4FH2A 4H6JA 5HSQA 3VOZA 3PXPA 1J9MA 3MZEA 5DVAA 3GTCA 1T1BA 5J7EA 1QMEA 3EWKA 1G6AA 2V1BA 1F9IA 1K56D 2HF6A 2W3EA 4GNUA 2Y2LA 3E4QA 1ZC2A 2EX2A 3C7VA 2PDRA 3MXRA 1H5XA 1YLWA 3OPRA 1OJ5A 1SDEA 2A24A 5EV0A 5M1AA 5EECA 2PBDP 2WKPA 4HJ3A 3M2KA 2P9VA 2VGJA 4EETB 3A0RA 4ETXA 3SW1A 3T4KA 1RP5A 3GV9A 3D9YA 3S1YA 3KSGA 5E2EA 1JTGA 2XH9A 4R0QA 3IXDA 2VJWA 4B9OA 4HESA 1P9WA 5J3WA 4JF4A 4CJNA 3B3XA 4BBTA 4Y5FA 1F98A 2O9CA 4K91A 1NWZA 5CECA 1TDGA 5IS1A 1KE0A 4CLCA 3C8CA 4DE0A 1CJFA 2NUPC 3F1NB 3QP1A 1S0WA 2E8JA 4PAUA 1TF1A 3RFBA 4OOMA 2Y91A 4ZRRA 4DE3A 1K55C 3RXWA 5CERA 3E2LA 5FQQA 3ZNYA 4DJ3A 5FQIA 3ZYTA 4WZ4A 1ES3A 5DFXA 1XJ3A 3ITAA 1H0MA 3FPVA 4IUHA 4MN5A 3F1PB 3OBFA 2L1MA 4O8GA 3NULA 3N8LA 1YT4A 3SS4A 4WF0A 3HL9A 3UE0A 1CI9A 4GLQA 2ZD8A 4RQ9A 3HBRA 2A3UA 2OLUA 1IKIA 1W5DA 4Q8IA 1HZOA 4YOFA 3ZNTA 5DJUA 1EROA 1L2SA 3ITBA 1M40A 4PHTA 1ERQA 3DAVA 1S67L 3BFDA 1ONHA 3A3FA 4UA6A 3GR2A 3S4XA 4B93A 4L0LA 1NXYA 4S2NC 4E3OA 4QU3A 1K4FA 1S6RA 2W3HA 3LO7A 4HY8A 3C7UA 4C6YA 2EFUA 2PR5A 4HH2A 2KLIA 5E2GA 2HDUA 1KGFA 4EWFA 5EPHA 1TEMA 4PM9A 4GDNA 3H7WA 1XA1A 3H82A 4WZ5C 3Q1FA 2JKTM 5GHZA 1WE4A 4S2PA 3CLOA 3BJNA 4LV1A 3ZG5A 3H9WA 3IXBA 3MSHA 5AQBA 3BRMA 3TSGA 1YMXA 3L9KA 1ZG6A 1FSWA 1ONGA 1PZPA 5AQAA 4OQGA 5TR7A 4RX2A 2K2NA 4LFUA 3VE4A 2ZM8A 3W2ZA 3OPLA 5M18A 2ZOHA 1LSVA 3LGOA 1H8ZA 2XA7M 4BJPA 3AGEA 1K6SA 3IHAA 2JE5A 5GL9A 4N1HA 2J7VA 1LHYA 1A0KA 4DE1A 2ZLYA 1XA7A 4Y13A 4OLDA 1WYBA 2J80A 3UDIA 5HPIA 1CQAA 4X56A 5L09A 1GHPA 3N8RA 4PKYA 5D3OA 4NXBA 3W8KA 4HHDA 1I2SA 2VGLS 3WS4A 2DMWA 3NBLA 4JF5A 5FASA 2WADA 1D1JA 3UO9A 4E3NA 4JGOA 1IOUA 4ARZA 1VQQA 2WGWA 4ZJ1A 4E3JA 1PZOA 4R23A 3IH9A 5HWTA 1KDWA 3ULFA 4G3WA 1BULA 4EQ1A 1BUEA 3C38A 4EBNA 4OPRA 1LSXA 2R9WA 3VP0A 3R7WB 4Q0IA 3W4PA 1KE4A 3MBZA 1YPRA 3HLWA 5CGWA 3OCLA 1ODVA 4DMZA 4L9GA 3T1XA 1HVBA 3T4SA 1FOFA 1T1AA 3HCYA 5F5YA 1STZA 3GQZA 4GDBA 5A91A 4ID4A 4OOLA 5EM0A 4G3VA 2HZ5A 4IVIA 3CAXA 4HNBA 2OWJA 2IA2A 4HQAA 4LRXC 1M6KA 1FSYA 1ESUA 1VHMA 3E2KA 5KZHA 3ZG8B 1PW8A 5FI2A 2W1RA 1YLJA 4KZBA 4N92A 2OAQ1 5L10A 4UEYA 3LEZA 1Y28A 4GD8A 2XLNA 1X0OA 5E2FA 1YLYA 2X02A 5IHVA 3CUEC 3EGXC 4GW9A 5FQMA 5DF9A 3KSHA 3L7HA 4UAAA 1L0GA 2OLVA 2XSSA 3LR0A 2CC1A 1DJAA 2ZQ7A 3MS6A 3KO6A 4F3LA 3IBRA 3G4PA 3IHBA 4BD0A 3NOTC 4IEDA 5EE8A 3GVBA 4EU0A 2PU4A 2ZJ9A 3MR0A 2WKHA 4OPZA 4BL3A 2WAEA 1G28A 2FFYA 2V0UA 3G34A 3UPPA 3FKWA 1GCEA 1GSVA 4QY6A 1H8MA 4LPZA 1PWGA 1UWNX 4KZ8A 1HTZA 4M3KA 3VSKA 4QHCA 2B95A 3UB9A 2XGNA 1OTIA 3A3JA 4PM6A 5A93A 1Z09A 3UDFA 1RGZA 3CMZA 1E3UD 5HWVA 3VOYA 4MBFA 3O3VA 1T18A 4Y0OA 2WKEA 4EBLA 3I7JA 1T1CA 4O0PA 3QHYA 5EOEA 5DTSA 1ERMA 3S7OA 4L9EA 2OAP1 3V67A 3N8SA 2V8CA 1OJGA 2WKRA 4WMCA 5EM1A 3UNWA 4KZ3A 3PAGA 3V5MA 2J9PA 2ZQ9A 4OOYA 3G2ZA 3T4LA 4HH3A 2W27A 3SS5A 3NJAA 2QJ5A 3MXSA 1BZAA 1NJ4A 3WS0A 3VFFA 4G3KA 5DTKA 3LYXA 4OP8A 5L07A 5AVEA 5TGFA 3HUMA 4R38A 5CEDA 1P0ZA 4P0MA 1J3WA 4FOFA 4ZTKA 1IYOA 3BLMA 3KSFA 5E43A 1XPBA 4X1MA 2Y2HA 3IXHA 2EWVA 2QWSA 3SOIA 1ACFA 1GA9A 4Q0JA 4PKYG 2WKIA 2W1TB 2QPNA 1IEMA 1IFQA 3O86A 2JHEA 3EEAA 1V9ZA 1TVFA 1GA0A 1W7FA 4EERA 4EQIA 1DP6A 2E8IA 3LR3A 3F1NA 4KG5A 3OCNA 2VZWA 2V20A 4RX3A 2Q0OA 1JWVA 4U0XA 5DKLA 2Y2PA 2ZQCA 4EEPA 3BQAA 3PYPA 2P7JA 3B47A 2G7UA 3Q81A 4E6WA 3DTIA 1NLYA 1ZG4A 4JPMA 4NEED 4HJ4A 3F1PA 3TG9A 1XJ2A 1LI0A 4GKUA 3PHYA 2JKFA 1IKGA 4OH0A 2Z6CA 5TBMB 3U4LP 2PD7A 1EI5A 2XDMA 1K56A 4WEJA 2XFTA 2Y2QA 4OPYA 3E4PA 1MC0A 4O7DA 4KG2A 5GLCA 4LV0A 2Y59A 2EWWA 3FPWA 4YWZA 2P08A 2VLGA 1K38A 4R4RA 1OTBA 1PI5A 3LIDA 5JYOA 5BOHA 3Q07A 3JYIA 3VP4A 5U47A 3S7QA 3GRJA 3NHQA 4CLCC 5HL6A 2DNSA 4KQRA 1K54A 4MMNA 2INWA 3MJQA 4U3TA 4P6BA 3P7NA 1PYYA 1DP8A 3ZG7B 3LIFA 3SH8A 1I2WA 2VGLM 4OVDA 4I3JA 5FI7A 3FZCA 4Y2FA 2R9XA 4I39A 3QNCA 4OONA 1N4OA 3FWLA 5EVID 4BQMA 3VSLA 3SZTA 3FC7A 1NZOA 4BLMA 4DKIA 5DTTA 4PM5A 2WAFA 4A5RA 3C2WA 5F82A 5C5KA 4E3IA 4ZBEA 3K2NA 1XXMA 3DTKA 4HBUA 2QZ6A 3N4IA 4KENB 3UE6A 2XFSA 3VFHA 5GLDA 2WK0A 1DJBA 1MWUA 1N9BA 5M19A 5AJGA 2D02A 5HDDA 3IF6A 5FQJA 2J3TC 2KOIA 1CEFA 3MKEA 2ZC4B 4GZBA 3ZFZA 2Z6DA 3PBQA 4XUXA 2M7VA 5EFWA 1NRFA 2FH5A 1LLBA 4HP4A 4CLCD 4KG6A 2HGVA 2PBYA 2YKFA 4FSFA 1L0FA 1JVJA 5CXWA 4X25A 5HAQA 4UQIS 3AGFA 3G30A 5L8MA 3NY4A 2HDRA 1OT6A 4JXWA 4BBVA 3WS5A 3R7WA 3T12B 5FEGA 3ZQ5A 1K57A 2C5WB 3QNBA 3AGDA 3LR5A 2H10A 3IQAA 1MPLA 4JF6A 2Y2GA 4WBGA 3UB8A 1NLZA 3BY9A 3UN7A 5L2FA 2JKRI 2M7UA 2DCFA 1XJ6A 2GJ3A 5AQ7A 5EVIB 5J8XA 5CHJA 3S7NA 2ZM2A 3P98A 3G35A 3BQ8A 1O07A 4BL2A 5EUAA 1FR6A
chains in the Genus database with same CATH topology
2X02A 2XEPA 2ZC6B 5IHVA 2RCXA 1LL5A 4KZ7A 1O7EA 1XGJA 2X01A 2ZQDA 3Q82A 3ZG9B 4CPKA 2XD1A 3MZFA 1YQSA 5FQMA 3SH9A 5DF9A 5A92A 5GHYA 4OPQA 2A49A 5FAPA 3PBSA 4PM8A 3FYZA 4UAAA 1VM1A 2Q9MA 1L0GA 3PBOA 5CGXA 4Y0TA 2OLVA 3LY4A 5TFQA 1EWZA 2Y2MA 4PPRA 4ZDXA 3HVFA 3VP3A 1YM1A 2CC1A 1DJAA 4B4XA 2ZQ7A 3PBTA 3G4PA 2ZC5B 1NYMA 1PW1A 3IHBA 3OPPA 1OMEA 3HREA 2Y2OA 5FQKA 5GLBA 1Z6FA 4BD0A 4HBTA 3BLSA 1K57C 4IEDA 5EE8A 3GVBA 2PU4A 3HLDA 3V3RA 2G2WA 2ZJ9A 3IF6B 4MLLA 5CHMA 5HW3A 3DTMA 2WKHA 4OPZA 4BL3A 2WAEA 5FSRA 1W8QA 2BG1A 2FFYA 1IYQA 1FQGA 3V50A 2GDNA 1PWDA 5HARA 4Y0UA 4LENA 3G34A 3O88A 3UPPA 4F94A 4R4SA 3BFFA 3FKWA 1GCEA 4QY6A 5JYPA 2EXAA 4R1GA 5EVIC 1PWGA 3GMWA 4KZ8A 1MWSA 2IWBA 3W4QA 3NDGA 1HTZA 1KGEA 4M3KA 4DDSA 3IXGA 3PTEA 4FH4A 3VSKA 4S2LA 4QHCA 3P09A 1WYCA 4S2JA 4LCMA 1L0EA 2UWXA 4ZJ3A 2HP6A 1JWZA 3DW0A 2XGNA 4S2KA 4E3KA 4DRTA 2HDQA 1BLSA 3A3JA 4PM6A 2ZM0A 5A93A 2ZC7A 3UDFA 1RGZA 3CMZA 1KVLA 1YLZA 2WZXA 3Q7VA 4FH2A 4RVAA 3M6HA 1MKIA 1IYPA 1E3UD 5CEBA 1ES4A 3VOZA 1SKFA 3Q7VB 1J9MA 4MBFA 3O3VA 3G31A 3VOYA 3A3IA 4LV3A 4Y0OA 1DY6A 2XD5A 2WKEA 4EBLA 3I7JA 3HUNA 1I5QA 3OC2A 3MZEA 3QHYA 4R3JA 5EOEA 5DVAA 5DTSA 5CGSA 5F83A 3WWXA 2EXBA 1ERMA 1BSGA 1CEGA 1CI8A 1NY0A 1FR1A 3GTCA 4QJGA 1QMEA 3RXXA 1K55A 1G6AA 1LI9A 3N8SA 4JLFA 3IWIA 1K56D 4GNUA 2Y2LA 1ZC2A 3BFGA 5HX9A 2EX2A 3C7VA 4WMCA 3MXRA 3UNWA 4KZ3A 5E2HA 1DJCA 3PAGA 2Q9NA 5EVLA 1H5XA 2J9PA 2ZQ9A 4ZJ2A 3V5MA 1YLWA 4OOYA 3G2ZA 3OPRA 4UA9A 5CTMA 1SCWA 1MY8A 3LY3A 3SS5A 1SDEA 3MXSA 1BZAA 1TDLA 1E25A 5M1AA 1NJ4A 3WS0A 5EECA 1GHIA 3VFFA 3M2KA 3GSGA 2P9VA 2VGJA 4K0WA 5DTKA 3OPHA 3ZDJA 4OP8A 5TGFA 1KDSA 3HUMA 2P9VB 5CEDA 4S2OA 1BLPA 3SS3A 4P0MA 3VP2A 3C5AA 1RP5A 3GV9A 4ZTKA 3S1YA 1IYOA 3BLMA 5E2EA 5E43A 2HDSA 1XPBA 4GOGA 3M2JA 4GD6A 2X71A 2EX6A 2XQZA 2Y2HA 1JTGA 3IXHA 5FATA 2XH9A 4R0QA 2G2UA 3SOIA 3IXDA 4KZ4A 3UY6A 2EX8A 3ZVWA 1BT5A 1GA9A 4S2NA 2WYXA 1G68A 2WKIA 3Q7ZA 4HESA 5FA7A 4JF4A 4CJNA 3B3XA 2QPNA 1XP4A 3NDEA 1IEMA 1ZKJA 4N9KA 3O86A 4K91A 5G18A 2RL3A 4QD4A 5CECA 1TDGA 3CZDA 3N7WA 1TVFA 1KE0A 4GN2A 3UDXA 1GA0A 1W7FA 3UPNA 4EQIA 5KSHA 2E8IA 4KG5A 1NYYA 5FDHA 5GLAA 3SH7A 1MXOA 3PAEA 3OCNA 4DE0A 4E3LA 2V20A 4RX3A 4FCFA 1JWVA 3BM6A 4U0XA 4WELA 2XK1A 2Y2PA 3MFDA 2ZQAA 4PM7A 2ZQCA 1HD8A 1S0WA 5DF8A 4KZ9A 1K4EA 4KQOA 1XKZA 3V3SA 4OOMA 2Y91A 4DE3A 4WYYA 1E3UA 1K55C 3RXWA 4LCLA 4WZ5A 5CERA 3E2LA 3Q81A 5FQQA 4JXGA 4MNRA 3ZNYA 4E6WA 2IWDA 4JXVA 2EFXA 4WM9A 3NIAA 1ZG4A 4JPMA 5FQIA 3VMAA 4WZ4A 1ES3A 3TG9A 1JTDA 2H5SA 4DXBA 1MWRA 1LI0A 3ITAA 4Z9QA 3TOIA 4GKUA 2IWCA 1BLHA 5KMWA 1RGYA 1IKGA 4OH0A 4R3BA 5HAIA 3N8LA 1YT4A 2Y2NA 4GB7A 3SS4A 1EI5A 2VGKA 2XDMA 1K56A 4WEJA 1FCOA 3HL9A 3UE0A 4MBKA 1CI9A 4B88A 5I94A 2XFTA 4OP5A 2Y2QA 4OPYA 2ZD8A 3UPOA 2Y2JA 4IBXA 1ES5A 3HBRA 1MBLA 2A3UA 4KZ6A 2OLUA 4E3MA 1IKIA 1K25A 4O7DA 1KGGA 1W5DA 2I72A 4H8RA 4OKPA 4PMAA 4Q8IA 3N6IA 4NETA 1HZOA 3MKFA 5CHUA 4KG2A 5GLCA 4LV0A 3ZNTA 2Y59A 1EROA 1L2SA 1XGIA 1IELA 3ITBA 3S22A 1RCJA 2C6WB 1M40A 1AXBA 4D2OA 3A3EA 4P85A 2J8YA 1ERQA 1K38A 3WRZA 4UA7A 4R4RA 3BFDA 1YMSA 1PI5A 1ONHA 3A3FA 4JKTA 4UA6A 3GR2A 3S4XA 5JYOA 4L0LA 5BOHA 3CJMA 1PWCA 4BENA 1NXYA 1Q2QA 3BEBA 3Q07A 4S2NC 3FKVA 4E3OA 4QU3A 2H0TA 1K4FA 4DDYA 1S6RA 1MWTA 3LO7A 3UE3A 3JYIA 3VP4A 5U47A 3GRJA 3C7UA 1W8YA 4C6YA 2EFUA 4U0TA 1U60A 4S2MA 2DNSA 2OV5A 4KQRA 2Z2MB 2Z2LB 2DRWA 4N9LA 5E2GA 1K54A 2HDUA 4B4ZA 1KGFA 3WS1A 5EPHA 1TEMA 1W79A 3BFEA 4EWFA 4OQ0A 4PM9A 2V2FF 4QB8A 1YLTA 4P87A 1C3BA 4GDNA 2WZZA 4U3TA 2EX9A 3NI9A 4HEFA 3WS2A 4P6BA 4DXCA 1PYYA 3ZG7B 1XA1A 3SH8A 1CK3A 4OQHA 4C3QA 3BFCA 4EV4A 1I2WA 4WZ5C 3Q1FA 2ZQ8A 3O87A 4S2IA 4OVDA 5GHZA 1WE4A 5FI7A 4S2PA 4LV1A 3WRTA 3ZG5A 3FZCA 3IXBA 5AQBA 1L0DA 4XXRA 5F1FA 3BRMA 2R9XA 3TSGA 1YMXA 3QNCA 2B5RA 4OONA 4UHUA 1N4OA 1ZG6A 1FSWA 1ONGA 1PZPA 3FWLA 1PI4A 3ISGA 4OQGA 3LCEA 4RX2A 3IT9A 5AQAA 5EVID 5TR7A 4BQMA 1FCMA 3G32A 3VSLA 2ZM8A 1NZOA 4X53A 1PIOA 4BLMA 2Y4AA 2FFFB 4OQIA 4DKIA 3PBNA 5DTTA 4PM5A 2PU2A 3OPLA 1KE3A 2WAFA 4A5RA 5F82A 4E3IA 5M18A 4ZBEA 1H8ZA 3ZG0A 1SHVA 4BJPA 1XXMA 4LV2A 4HBUA 3AGEA 2QZ6A 1K6SA 2XF3A 3N4IA 4KENB 4DE2A 3IHAA 1K6RA 2JE5A 3M6BA 4X55A 5DF7A 5GL9A 3VP1A 2XFSA 2J7VA 4N1HA 2Y2IA 2XR0A 4EBPA 1LHYA 1BTLA 3VFHA 5GLDA 4YFMA 2WK0A 1QMFA 5KSCA 1DJBA 4DE1A 1MWUA 1N9BA 3HUOA 3ZGAB 2ZLYA 4X68A 1XA7A 5HFOA 4OLDA 1WYBA 5M19A 3UDIA 3IF6A 4X69A 1BLCA 2JC7A 4X56A 5FQJA 1GHPA 3N8RA 5HL1A 5FI6A 3OZHA 4IVKA 1CEFA 4Y7PA 4DF6A 5D3OA 1ALQA 3MKEA 4IBRA 2ZC4B 4GZBA 3EQVA 2JBFA 3HLFA 3ZFZA 3W8KA 3FV7A 1I2SA 4XUXA 3PBQA 4JBFA 2ZMAA 3WS4A 1K54C 3W4OA 4KZAA 3ZVTA 2ZC3B 3NBLA 4JF5A 1NRFA 5CRFA 1LLBA 5FASA 4KG6A 2WADA 3UO9A 4E3NA 3BECA 2P74A 2WGVA 3IWOA 4N1XA 2PBYA 2WUQA 2Y55A 3HLCA 1IYSA 4FSFA 5FAQA 3IF5A 1L0FA 2OSUA 1ES2A 3IWQA 1VQQA 2WGWA 3NC8A 4ZJ1A 1JVJA 3UE1A 5CXWA 4E3JA 4YINA 3D4FA 5AQ9A 5HAQA 1Y54A 1PZOA 3AGFA 1Q2PA 3G30A 3IH9A 3DWZA 1KDWA 2WGWB 3DWKA 3EQUA 4R23A 3V39A 5A90A 5CTNA 4OLGA 3NY4A 1BULA 1BUEA 4EBNA 2H0YA 2HDRA 4OPRA 2BLSA 4JXWA 3HLBA 4MBHA 3G2YA 3WS5A 4NK3A 1K57A 1SDNA 2C5WB 2R9WA 4FD8A 3VP0A 4C75A 1JWPA 3QNBA 4WEKA 4KQQA 3AGDA 4X6TA 2H10A 2HP5A 1XX2A 1MPLA 3IQAA 4K0XA 2V1ZA 4MEZA 4JF6A 3W4PA 3ZHHA 2Y2GA 1KE4A 4QY5A 1GHMA 2QMIA 3MBZA 4WBGA 2JCHA 3C4PA 4KZ5A 3HLWA 5CGWA 3OCLA 1HVBA 2J9OA 1FOFA 1E4DA 5EOOA 3UN7A 5L2FA 3IH8A 3GQZA 3PBRA 4GDBA 4ID4A 5A91A 4EUZA 1YLPA 2WGIA 2DCFA 5EVIA 4E6XA 3ZCZA 3A3DA 4OOLA 1FCNA 4BD1A 3C4OA 2Y2KA 4JXSA 5AQ7A 4RYEA 5EVIB 5J8XA 4IVIA 3RJUA 1ESIA 2HP9A 3BYDA 5CHJA 1M6KA 3CG5A 2ZM2A 3P98A 3G35A 1FSYA 3NCKA 1ESUA 3HLGA 3E2KA 4ZAMA 5KZHA 3IF6C 1O07A 3ZG8B 1PW8A 5FI2A 5FQ9A 1YLJA 5FAOA 1NZUA 4KZBA 4N92A 5F1GA 4BL2A 1KVMA 5GHXA 4RA7A 4XUZA 3LEZA 1LL9A 2HPBA 4GD8A 1H8YA 2XLNA 3HLEA 5HAPA 4WMCD 5EUAA 5E2FA 3MZDA 1FR6A 1YLYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2X02 A;  2XEP A;  2ZC6 B;  5IHV A;  2RCX A;  1LL5 A;  4KZ7 A;  1O7E A;  1XGJ A;  2X01 A;  2ZQD A;  3Q82 A;  3ZG9 B;  4CPK A;  2XD1 A;  3MZF A;  1YQS A;  5FQM A;  3SH9 A;  5DF9 A;  5A92 A;  5GHY A;  4OPQ A;  2A49 A;  5FAP A;  3PBS A;  4PM8 A;  3FYZ A;  4UAA A;  1VM1 A;  2Q9M A;  1L0G A;  3PBO A;  5CGX A;  4Y0T A;  2OLV A;  3LY4 A;  5TFQ A;  1EWZ A;  2Y2M A;  4PPR A;  4ZDX A;  3HVF A;  3VP3 A;  1YM1 A;  2CC1 A;  1DJA A;  4B4X A;  2ZQ7 A;  3PBT A;  3G4P A;  2ZC5 B;  1NYM A;  1PW1 A;  3IHB A;  3OPP A;  1OME A;  3HRE A;  2Y2O A;  5FQK A;  5GLB A;  1Z6F A;  4BD0 A;  4HBT A;  3BLS A;  1K57 C;  4IED A;  5EE8 A;  3GVB A;  2PU4 A;  3HLD A;  3V3R A;  2G2W A;  2ZJ9 A;  3IF6 B;  4MLL A;  5CHM A;  5HW3 A;  3DTM A;  2WKH A;  4OPZ A;  4BL3 A;  2WAE A;  5FSR A;  1W8Q A;  2BG1 A;  2FFY A;  1IYQ A;  1FQG A;  3V50 A;  2GDN A;  1PWD A;  5HAR A;  4Y0U A;  4LEN A;  3G34 A;  3O88 A;  3UPP A;  4F94 A;  4R4S A;  3BFF A;  3FKW A;  1GCE A;  4QY6 A;  5JYP A;  2EXA A;  4R1G A;  5EVI C;  1PWG A;  3GMW A;  4KZ8 A;  1MWS A;  2IWB A;  3W4Q A;  3NDG A;  1HTZ A;  1KGE A;  4M3K A;  4DDS A;  3IXG A;  3PTE A;  4FH4 A;  3VSK A;  4S2L A;  4QHC A;  3P09 A;  1WYC A;  4S2J A;  4LCM A;  1L0E A;  2UWX A;  4ZJ3 A;  2HP6 A;  1JWZ A;  3DW0 A;  2XGN A;  4S2K A;  4E3K A;  4DRT A;  2HDQ A;  1BLS A;  3A3J A;  4PM6 A;  2ZM0 A;  5A93 A;  2ZC7 A;  3UDF A;  1RGZ A;  3CMZ A;  1KVL A;  1YLZ A;  2WZX A;  3Q7V A;  4FH2 A;  4RVA A;  3M6H A;  1MKI A;  1IYP A;  1E3U D;  5CEB A;  1ES4 A;  3VOZ A;  1SKF A;  3Q7V B;  1J9M A;  4MBF A;  3O3V A;  3G31 A;  3VOY A;  3A3I A;  4LV3 A;  4Y0O A;  1DY6 A;  2XD5 A;  2WKE A;  4EBL A;  3I7J A;  3HUN A;  1I5Q A;  3OC2 A;  3MZE A;  3QHY A;  4R3J A;  5EOE A;  5DVA A;  5DTS A;  5CGS A;  5F83 A;  3WWX A;  2EXB A;  1ERM A;  1BSG A;  1CEG A;  1CI8 A;  1NY0 A;  1FR1 A;  3GTC A;  4QJG A;  1QME A;  3RXX A;  1K55 A;  1G6A A;  1LI9 A;  3N8S A;  4JLF A;  3IWI A;  1K56 D;  4GNU A;  2Y2L A;  1ZC2 A;  3BFG A;  5HX9 A;  2EX2 A;  3C7V A;  4WMC A;  3MXR A;  3UNW A;  4KZ3 A;  5E2H A;  1DJC A;  3PAG A;  2Q9N A;  5EVL A;  1H5X A;  2J9P A;  2ZQ9 A;  4ZJ2 A;  3V5M A;  1YLW A;  4OOY A;  3G2Z A;  3OPR A;  4UA9 A;  5CTM A;  1SCW A;  1MY8 A;  3LY3 A;  3SS5 A;  1SDE A;  3MXS A;  1BZA A;  1TDL A;  1E25 A;  5M1A A;  1NJ4 A;  3WS0 A;  5EEC A;  1GHI A;  3VFF A;  3M2K A;  3GSG A;  2P9V A;  2VGJ A;  4K0W A;  5DTK A;  3OPH A;  3ZDJ A;  4OP8 A;  5TGF A;  1KDS A;  3HUM A;  2P9V B;  5CED A;  4S2O A;  1BLP A;  3SS3 A;  4P0M A;  3VP2 A;  3C5A A;  1RP5 A;  3GV9 A;  4ZTK A;  3S1Y A;  1IYO A;  3BLM A;  5E2E A;  5E43 A;  2HDS A;  1XPB A;  4GOG A;  3M2J A;  4GD6 A;  2X71 A;  2EX6 A;  2XQZ A;  2Y2H A;  1JTG A;  3IXH A;  5FAT A;  2XH9 A;  4R0Q A;  2G2U A;  3SOI A;  3IXD A;  4KZ4 A;  3UY6 A;  2EX8 A;  3ZVW A;  1BT5 A;  1GA9 A;  4S2N A;  2WYX A;  1G68 A;  2WKI A;  3Q7Z A;  4HES A;  5FA7 A;  4JF4 A;  4CJN A;  3B3X A;  2QPN A;  1XP4 A;  3NDE A;  1IEM A;  1ZKJ A;  4N9K A;  3O86 A;  4K91 A;  5G18 A;  2RL3 A;  4QD4 A;  5CEC A;  1TDG A;  3CZD A;  3N7W A;  1TVF A;  1KE0 A;  4GN2 A;  3UDX A;  1GA0 A;  1W7F A;  3UPN A;  4EQI A;  5KSH A;  2E8I A;  4KG5 A;  1NYY A;  5FDH A;  5GLA A;  3SH7 A;  1MXO A;  3PAE A;  3OCN A;  4DE0 A;  4E3L A;  2V20 A;  4RX3 A;  4FCF A;  1JWV A;  3BM6 A;  4U0X A;  4WEL A;  2XK1 A;  2Y2P A;  3MFD A;  2ZQA A;  4PM7 A;  2ZQC A;  1HD8 A;  1S0W A;  5DF8 A;  4KZ9 A;  1K4E A;  4KQO A;  1XKZ A;  3V3S A;  4OOM A;  2Y91 A;  4DE3 A;  4WYY A;  1E3U A;  1K55 C;  3RXW A;  4LCL A;  4WZ5 A;  5CER A;  3E2L A;  3Q81 A;  5FQQ A;  4JXG A;  4MNR A;  3ZNY A;  4E6W A;  2IWD A;  4JXV A;  2EFX A;  4WM9 A;  3NIA A;  1ZG4 A;  4JPM A;  5FQI A;  3VMA A;  4WZ4 A;  1ES3 A;  3TG9 A;  1JTD A;  2H5S A;  4DXB A;  1MWR A;  1LI0 A;  3ITA A;  4Z9Q A;  3TOI A;  4GKU A;  2IWC A;  1BLH A;  5KMW A;  1RGY A;  1IKG A;  4OH0 A;  4R3B A;  5HAI A;  3N8L A;  1YT4 A;  2Y2N A;  4GB7 A;  3SS4 A;  1EI5 A;  2VGK A;  2XDM A;  1K56 A;  4WEJ A;  1FCO A;  3HL9 A;  3UE0 A;  4MBK A;  1CI9 A;  4B88 A;  5I94 A;  2XFT A;  4OP5 A;  2Y2Q A;  4OPY A;  2ZD8 A;  3UPO A;  2Y2J A;  4IBX A;  1ES5 A;  3HBR A;  1MBL A;  2A3U A;  4KZ6 A;  2OLU A;  4E3M A;  1IKI A;  1K25 A;  4O7D A;  1KGG A;  1W5D A;  2I72 A;  4H8R A;  4OKP A;  4PMA A;  4Q8I A;  3N6I A;  4NET A;  1HZO A;  3MKF A;  5CHU A;  4KG2 A;  5GLC A;  4LV0 A;  3ZNT A;  2Y59 A;  1ERO A;  1L2S A;  1XGI A;  1IEL A;  3ITB A;  3S22 A;  1RCJ A;  2C6W B;  1M40 A;  1AXB A;  4D2O A;  3A3E A;  4P85 A;  2J8Y A;  1ERQ A;  1K38 A;  3WRZ A;  4UA7 A;  4R4R A;  3BFD A;  1YMS A;  1PI5 A;  1ONH A;  3A3F A;  4JKT A;  4UA6 A;  3GR2 A;  3S4X A;  5JYO A;  4L0L A;  5BOH A;  3CJM A;  1PWC A;  4BEN A;  1NXY A;  1Q2Q A;  3BEB A;  3Q07 A;  4S2N C;  3FKV A;  4E3O A;  4QU3 A;  2H0T A;  1K4F A;  4DDY A;  1S6R A;  1MWT A;  3LO7 A;  3UE3 A;  3JYI A;  3VP4 A;  5U47 A;  3GRJ A;  3C7U A;  1W8Y A;  4C6Y A;  2EFU A;  4U0T A;  1U60 A;  4S2M A;  2DNS A;  2OV5 A;  4KQR A;  2Z2M B;  2Z2L B;  2DRW A;  4N9L A;  5E2G A;  1K54 A;  2HDU A;  4B4Z A;  1KGF A;  3WS1 A;  5EPH A;  1TEM A;  1W79 A;  3BFE A;  4EWF A;  4OQ0 A;  4PM9 A;  2V2F F;  4QB8 A;  1YLT A;  4P87 A;  1C3B A;  4GDN A;  2WZZ A;  4U3T A;  2EX9 A;  3NI9 A;  4HEF A;  3WS2 A;  4P6B A;  4DXC A;  1PYY A;  3ZG7 B;  1XA1 A;  3SH8 A;  1CK3 A;  4OQH A;  4C3Q A;  3BFC A;  4EV4 A;  1I2W A;  4WZ5 C;  3Q1F A;  2ZQ8 A;  3O87 A;  4S2I A;  4OVD A;  5GHZ A;  1WE4 A;  5FI7 A;  4S2P A;  4LV1 A;  3WRT A;  3ZG5 A;  3FZC A;  3IXB A;  5AQB A;  1L0D A;  4XXR A;  5F1F A;  3BRM A;  2R9X A;  3TSG A;  1YMX A;  3QNC A;  2B5R A;  4OON A;  4UHU A;  1N4O A;  1ZG6 A;  1FSW A;  1ONG A;  1PZP A;  3FWL A;  1PI4 A;  3ISG A;  4OQG A;  3LCE A;  4RX2 A;  3IT9 A;  5AQA A;  5EVI D;  5TR7 A;  4BQM A;  1FCM A;  3G32 A;  3VSL A;  2ZM8 A;  1NZO A;  4X53 A;  1PIO A;  4BLM A;  2Y4A A;  2FFF B;  4OQI A;  4DKI A;  3PBN A;  5DTT A;  4PM5 A;  2PU2 A;  3OPL A;  1KE3 A;  2WAF A;  4A5R A;  5F82 A;  4E3I A;  5M18 A;  4ZBE A;  1H8Z A;  3ZG0 A;  1SHV A;  4BJP A;  1XXM A;  4LV2 A;  4HBU A;  3AGE A;  2QZ6 A;  1K6S A;  2XF3 A;  3N4I A;  4KEN B;  4DE2 A;  3IHA A;  1K6R A;  2JE5 A;  3M6B A;  4X55 A;  5DF7 A;  5GL9 A;  3VP1 A;  2XFS A;  2J7V A;  4N1H A;  2Y2I A;  2XR0 A;  4EBP A;  1LHY A;  1BTL A;  3VFH A;  5GLD A;  4YFM A;  2WK0 A;  1QMF A;  5KSC A;  1DJB A;  4DE1 A;  1MWU A;  1N9B A;  3HUO A;  3ZGA B;  2ZLY A;  4X68 A;  1XA7 A;  5HFO A;  4OLD A;  1WYB A;  5M19 A;  3UDI A;  3IF6 A;  4X69 A;  1BLC A;  2JC7 A;  4X56 A;  5FQJ A;  1GHP A;  3N8R A;  5HL1 A;  5FI6 A;  3OZH A;  4IVK A;  1CEF A;  4Y7P A;  4DF6 A;  5D3O A;  1ALQ A;  3MKE A;  4IBR A;  2ZC4 B;  4GZB A;  3EQV A;  2JBF A;  3HLF A;  3ZFZ A;  3W8K A;  3FV7 A;  1I2S A;  4XUX A;  3PBQ A;  4JBF A;  2ZMA A;  3WS4 A;  1K54 C;  3W4O A;  4KZA A;  3ZVT A;  2ZC3 B;  3NBL A;  4JF5 A;  1NRF A;  5CRF A;  1LLB A;  5FAS A;  4KG6 A;  2WAD A;  3UO9 A;  4E3N A;  3BEC A;  2P74 A;  2WGV A;  3IWO A;  4N1X A;  2PBY A;  2WUQ A;  2Y55 A;  3HLC A;  1IYS A;  4FSF A;  5FAQ A;  3IF5 A;  1L0F A;  2OSU A;  1ES2 A;  3IWQ A;  1VQQ A;  2WGW A;  3NC8 A;  4ZJ1 A;  1JVJ A;  3UE1 A;  5CXW A;  4E3J A;  4YIN A;  3D4F A;  5AQ9 A;  5HAQ A;  1Y54 A;  1PZO A;  3AGF A;  1Q2P A;  3G30 A;  3IH9 A;  3DWZ A;  1KDW A;  2WGW B;  3DWK A;  3EQU A;  4R23 A;  3V39 A;  5A90 A;  5CTN A;  4OLG A;  3NY4 A;  1BUL A;  1BUE A;  4EBN A;  2H0Y A;  2HDR A;  4OPR A;  2BLS A;  4JXW A;  3HLB A;  4MBH A;  3G2Y A;  3WS5 A;  4NK3 A;  1K57 A;  1SDN A;  2C5W B;  2R9W A;  4FD8 A;  3VP0 A;  4C75 A;  1JWP A;  3QNB A;  4WEK A;  4KQQ A;  3AGD A;  4X6T A;  2H10 A;  2HP5 A;  1XX2 A;  1MPL A;  3IQA A;  4K0X A;  2V1Z A;  4MEZ A;  4JF6 A;  3W4P A;  3ZHH A;  2Y2G A;  1KE4 A;  4QY5 A;  1GHM A;  2QMI A;  3MBZ A;  4WBG A;  2JCH A;  3C4P A;  4KZ5 A;  3HLW A;  5CGW A;  3OCL A;  1HVB A;  2J9O A;  1FOF A;  1E4D A;  5EOO A;  3UN7 A;  5L2F A;  3IH8 A;  3GQZ A;  3PBR A;  4GDB A;  4ID4 A;  5A91 A;  4EUZ A;  1YLP A;  2WGI A;  2DCF A;  5EVI A;  4E6X A;  3ZCZ A;  3A3D A;  4OOL A;  1FCN A;  4BD1 A;  3C4O A;  2Y2K A;  4JXS A;  5AQ7 A;  4RYE A;  5EVI B;  5J8X A;  4IVI A;  3RJU A;  1ESI A;  2HP9 A;  3BYD A;  5CHJ A;  1M6K A;  3CG5 A;  2ZM2 A;  3P98 A;  3G35 A;  1FSY A;  3NCK A;  1ESU A;  3HLG A;  3E2K A;  4ZAM A;  5KZH A;  3IF6 C;  1O07 A;  3ZG8 B;  1PW8 A;  5FI2 A;  5FQ9 A;  1YLJ A;  5FAO A;  1NZU A;  4KZB A;  4N92 A;  5F1G A;  4BL2 A;  1KVM A;  5GHX A;  4RA7 A;  4XUZ A;  3LEZ A;  1LL9 A;  2HPB A;  4GD8 A;  1H8Y A;  2XLN A;  3HLE A;  5HAP A;  4WMC D;  5EUA A;  5E2F A;  3MZD A;  1FR6 A;  1YLY A; 
#chains in the Genus database with same CATH topology
 4P6Z S;  2XEP A;  2ZC6 B;  4HOI A;  5LBR A;  2RCX A;  1O7E A;  2ZQD A;  3SH9 A;  2VX8 A;  4PM8 A;  2W0N A;  1VM1 A;  2Q9M A;  2MJ6 A;  4Y0T A;  4BBU A;  1EWZ A;  2R78 A;  3K3C A;  4MCW A;  4B4X A;  5K5B A;  4JGP A;  1PW1 A;  3ICY A;  3HLD A;  4NKP A;  3IF6 B;  5CHM A;  1TD5 A;  3DTM A;  2ZBB A;  5FSR A;  1FQG A;  1PWD A;  5HAR A;  4Y0U A;  3MQO A;  2EXA A;  2A2L A;  2IWB A;  3W4Q A;  1FIK A;  4IJG A;  1KGE A;  3IXG A;  1VET B;  3F1O B;  2UWX A;  3E0Y A;  2ZOI A;  4DRT A;  2ZC7 A;  4M4X A;  1YLZ A;  2WZX A;  4RVA A;  3M6H A;  1MKI A;  1IYP A;  4O01 A;  1MKM A;  5J4E A;  4WUJ A;  1SKF A;  1TS8 A;  3IX8 A;  3Q7V B;  1AWI A;  5A8B A;  3A3I A;  4LV3 A;  2XD5 A;  4EEU A;  3HUN A;  1I5Q A;  1ZTU A;  3G6O A;  3OC2 A;  5DJT A;  2V1A A;  2KDK A;  5F83 A;  3WWX A;  2EXB A;  1BSG A;  1NY0 A;  2ZMF A;  3RXX A;  2YKH A;  4IHQ A;  4NXG A;  4LLO B;  1K0K A;  5HX9 A;  3OOV A;  4EUV A;  1N9L A;  1LT0 A;  3PR6 A;  1DJC A;  2Q9N A;  2VEA A;  3S7P A;  3EEH A;  1SCW A;  1MY8 A;  3GDI A;  1TDL A;  3T1R A;  4K0W A;  5HPF A;  3OPH A;  3ZDJ A;  2ZL1 B;  4KUK A;  5KIZ A;  4S2O A;  1LSW A;  3KYE A;  3E4O A;  4HIA A;  2HDS A;  3M2J A;  2X71 A;  2EX6 A;  5FAT A;  4II7 A;  2G2U A;  3UY6 A;  2W1T A;  2EX8 A;  1VEU B;  1G68 A;  5FA7 A;  1XP4 A;  1TS6 A;  3NDE A;  1S4R A;  4N9K A;  5G18 A;  4FTX A;  3CZD A;  3LIA A;  3N7W A;  4GN2 A;  3SH7 A;  1NYY A;  5GLA A;  2CMN A;  1MXO A;  3PAE A;  3T4J A;  4E3L A;  1ZHH B;  3IBJ A;  4FCF A;  3BM6 A;  3MQ0 A;  4WEL A;  2XK1 A;  3MFD A;  3RTY A;  4PM7 A;  2WKQ A;  1K4E A;  5F69 A;  3V3S A;  2AVX A;  4WYY A;  1E3U A;  4LCL A;  4WM9 A;  1W63 Q;  5MC7 A;  3VMA A;  2JN7 A;  1JTD A;  4DXB A;  1MWR A;  3JVV A;  3VE3 A;  1OT9 A;  5TBM A;  3TOI A;  2Y8H A;  1BLH A;  5KMW A;  1RGY A;  4R3B A;  4KUO A;  4CLC E;  2VGK A;  3DBA A;  4MBK A;  5I94 A;  1UWP X;  3UPO A;  2Y2J A;  4KZ6 A;  1OTA A;  1K25 A;  4PMA A;  1KGG A;  4OKP A;  4XT2 B;  3TJZ C;  3QP4 A;  1XGI A;  1IEL A;  1RCJ A;  2LB9 A;  2VV6 A;  1AXB A;  1PRQ A;  3A3E A;  3T4Q A;  4P85 A;  2HJ9 C;  4UA7 A;  1YMS A;  4JKT A;  5HDS A;  1PWC A;  1N9N A;  3FKV A;  3LUQ A;  2H0T A;  3FG8 A;  3LR4 A;  3QP6 A;  1HLU P;  1W8Y A;  4U0T A;  1U60 A;  5G4Y A;  2OV5 A;  2Z2M B;  2Z2L B;  4N9L A;  4B4Z A;  4HP9 A;  3WS1 A;  1W79 A;  1YLT A;  2PT7 A;  2WZZ A;  2EX9 A;  3NI9 A;  3WS2 A;  4GS9 B;  1V9Y A;  1CK3 A;  4OQH A;  4C3Q A;  4MDZ A;  5CX7 A;  3O87 A;  3K3D A;  4XXR A;  5F1F A;  3IS2 B;  4UHU A;  5CGS A;  3IT9 A;  3G32 A;  1DP9 A;  2Y4A A;  4OQI A;  2O99 A;  2EA9 A;  4UQI M;  2PU2 A;  3JVU A;  3MXQ A;  3ZG0 A;  1SHV A;  4LV2 A;  3B33 A;  4WN5 A;  3M6B A;  1W63 M;  3VP1 A;  5DF7 A;  4LGW A;  2XR0 A;  4EBP A;  1BTL A;  1S4S A;  3NEC A;  1QMF A;  4JGR A;  3ZGA B;  5HFO A;  3HJK A;  4X69 A;  1BLC A;  4QPR A;  1G6O A;  3UMD A;  1ALQ A;  5FEF A;  4IBR A;  3EQV A;  3HLF A;  3FV7 A;  5AVF A;  2OOL A;  1OPX A;  4LRY C;  1K54 C;  4KZA A;  5CRF A;  3RH8 B;  2P74 A;  4N1X A;  4ETZ A;  2WUQ A;  2Y55 A;  3HLC A;  5FAQ A;  3IWQ A;  2PD8 A;  3NC8 A;  3UE1 A;  1D06 A;  2W3D A;  2GZA A;  3D4F A;  1Y54 A;  4P6Z M;  3DWZ A;  3DWK A;  5A90 A;  4R3A A;  2BLS A;  4NK3 A;  2XRO A;  2ACG A;  4FD8 A;  4C75 A;  1JWP A;  4KQQ A;  1XX2 A;  4K0X A;  3ZHH A;  2V1Z A;  2D01 A;  2PYP A;  4QY5 A;  2QMI A;  2JCH A;  3C4P A;  3LI8 A;  1E4D A;  5EOO A;  3EOI A;  3LIE A;  1YLP A;  2WGI A;  5EVI A;  3ZCZ A;  2HV1 A;  3A3D A;  2HJE A;  2Y2K A;  3C4O A;  4JXS A;  1T19 A;  2HP9 A;  4L9F A;  3NCK A;  4ZAM A;  3IF6 C;  2VA0 A;  3NOU C;  1LL9 A;  2HPB A;  1H8Y A;  3HLE A;  2B18 A;  5HAP A;  4K08 A;  3MFX A;  5FDH A;  2Y79 A;  1LL5 A;  3CIT A;  4D60 A;  3BW6 A;  2X01 A;  3TW8 A;  3ZG9 B;  4CPK A;  4DN0 A;  3IX3 A;  4NXF A;  3MZF A;  2PRF A;  5A92 A;  5GHY A;  3E98 A;  3MMH A;  5FAP A;  3FYZ A;  3CHW P;  3PBO A;  5CGX A;  1XFQ A;  5TFQ A;  4ZDX A;  1YM1 A;  3U2A A;  2VKS A;  2L0W A;  2Y2O A;  5GLB A;  1Z6F A;  4HBT A;  3QP8 A;  3BLS A;  1K57 C;  2OWH A;  5FDS A;  4BMW A;  4R70 A;  3V3R A;  2G2W A;  5FL3 A;  5HW3 A;  2QHK A;  1W8Q A;  1IYQ A;  3V50 A;  1YAX A;  3O88 A;  4F94 A;  2P04 A;  2BTF P;  2J3W A;  2LB5 A;  5JYP A;  1SKO B;  2PYR A;  2B02 A;  3GMW A;  1MWS A;  1VET A;  3KYZ A;  3F1O A;  4S2L A;  3P09 A;  1WYC A;  4S2J A;  4LCM A;  4I3I A;  2W3G A;  2HP6 A;  1JWZ A;  4LRZ E;  3T50 A;  2HDQ A;  1BLS A;  3T1Q B;  1KVL A;  3Q7V A;  3VOL A;  5CEB A;  1ES4 A;  5TJJ A;  4H6J B;  3G31 A;  5F6A A;  1EW0 A;  1DY6 A;  2V9A A;  4R3J A;  2H28 A;  3MQQ A;  1TS7 A;  1CEG A;  2NUT C;  1CI8 A;  4QJG A;  1FR1 A;  1K55 A;  1LI9 A;  4JLF A;  4Y3I A;  4EW7 A;  2JKR M;  3IWI A;  3LIB A;  3BFG A;  4Z1W A;  3LI9 A;  5E2H A;  4IUK A;  5EVL A;  4ZJ2 A;  4UA9 A;  5CTM A;  3LY3 A;  5G4Z A;  1MZU A;  4QWO A;  1E25 A;  5F68 A;  1GHI A;  2A24 B;  3GSG A;  2QKP A;  2ZL1 A;  2PHY A;  4I3A A;  4ESP A;  1KDS A;  2P9V B;  2J3T D;  1BLP A;  4WLA A;  3SS3 A;  4NXE A;  3VP2 A;  3C5A A;  1FIL A;  2JKT I;  3O5Y A;  4GOG A;  4GD6 A;  2XQZ A;  1VEU A;  4KZ4 A;  1PNE A;  3ZVW A;  1BT5 A;  4S2N A;  2WYX A;  3Q7Z A;  1VB6 A;  1ZKJ A;  3BWL A;  4FUW A;  2RL3 A;  4QD4 A;  3UDX A;  3UPN A;  5KSH A;  3UME A;  4CLC B;  1YSQ A;  4BWI A;  2ZQA A;  3A0S A;  1HD8 A;  5DF8 A;  4KZ9 A;  1CF0 A;  4KQO A;  1XKZ A;  4GHI A;  1YSP A;  2VK3 A;  4WZ5 A;  4JXG A;  4MNR A;  2IWD A;  4JXV A;  2EFX A;  3MF0 A;  3NIA A;  3P01 A;  2H5S A;  4Z9Q A;  2UV0 E;  5IU1 A;  4Y15 A;  2IWC A;  5HDC A;  5HAI A;  1L3L A;  2Y2N A;  4GB7 A;  2V8F A;  1FCO A;  3D3O A;  4B88 A;  4OP5 A;  1LL8 A;  4XT2 A;  4IBX A;  1ES5 A;  1MBL A;  1KOU A;  4E3M A;  1P97 A;  3NOP C;  3CWF A;  2I72 A;  4H8R A;  3N6I A;  4NET A;  3MKF A;  5CHU A;  3C30 A;  3S22 A;  2C6W B;  4D2O A;  1WA9 A;  2J8Y A;  3WRZ A;  5HZH A;  3CJM A;  4BEN A;  1Q2Q A;  3BEB A;  3CI6 A;  2PR6 A;  1TS0 A;  1F2K A;  4DDY A;  1MWT A;  5HD5 A;  3UE3 A;  3UB7 A;  2GX5 A;  4S2M A;  2DRW A;  3BFE A;  2ZMV A;  4OQ0 A;  2V2F F;  4QB8 A;  1OTD A;  4P87 A;  1C3B A;  5HD3 A;  4GS9 A;  1JNU A;  3T4O A;  4HEF A;  2I9V A;  4DXC A;  4CQH A;  1H3Q A;  3A0V A;  3H7W B;  3BFC A;  4EV4 A;  1GSX A;  4HI4 A;  4JGQ A;  2ZQ8 A;  1OTE A;  4EXO A;  4S2I A;  3IS2 A;  3LIC A;  3H82 B;  1P9R A;  3WRT A;  4Y17 A;  2L4R A;  1L0D A;  2B5R A;  3VV4 A;  3ISG A;  1PI4 A;  3CPT A;  3LCE A;  4NG2 A;  1FCM A;  4X53 A;  1PIO A;  5IT5 A;  1DRM A;  2FFF B;  3KSI A;  4GJ4 A;  3PBN A;  1KE3 A;  5DFY A;  1PFL A;  1XFN A;  2W3F A;  2XF3 A;  1S66 L;  4DE2 A;  3JPU A;  1K6R A;  3T4T A;  4X55 A;  2Y2I A;  2XRN A;  4YFM A;  4HJ6 A;  4I5S A;  3GEC A;  5KSC A;  3HUO A;  4X68 A;  2V0W A;  4GHI B;  1D7E A;  2GNX A;  2JC7 A;  4KQD A;  5HL1 A;  5FI6 A;  3OZH A;  4IVK A;  4YNR A;  4Y7P A;  4DF6 A;  2KX6 A;  2JBF A;  4JBF A;  3LEQ A;  2ZMA A;  3W4O A;  3ZVT A;  3CUE A;  2ZC3 B;  3BEC A;  3IWO A;  2WGV A;  1S1Y A;  1IYS A;  3QP5 A;  1N9O A;  3IF5 A;  2OSU A;  1ES2 A;  5EVE A;  4YIN A;  4MN6 A;  5AQ9 A;  3EGD C;  1Q2P A;  4ARZ B;  2WGW B;  3EQU A;  3V39 A;  5CTN A;  3UB6 A;  3R4K A;  4OLG A;  2XA7 S;  2VV8 A;  3OLO A;  2H0Y A;  4EES A;  4MBH A;  3HLB A;  3G2Y A;  2O0Y A;  1SDN A;  4R6L A;  4WEK A;  4X6T A;  2HP5 A;  4MEZ A;  2K31 A;  2QJ7 A;  3D72 A;  1GHM A;  4E04 A;  4KZ5 A;  2FZ0 A;  2J9O A;  3KX0 X;  3LFV A;  3IH8 A;  3PBR A;  4EUZ A;  3HJI A;  4E6X A;  3B42 A;  1FCN A;  4BD1 A;  2PAV P;  3KYQ A;  4RYE A;  3RJU A;  1ESI A;  3TRC A;  1XJ4 A;  1Y4O A;  3BYD A;  3CG5 A;  1UGU A;  3HLG A;  1F5M A;  5FQ9 A;  5FAO A;  1NZU A;  5F1G A;  1KVM A;  2QYB A;  5GHX A;  4ME4 A;  4RA7 A;  3UB5 P;  4XUZ A;  3DTE A;  4WMC D;  2M1C A;  3MZD A;  4PPR A;  3CPT B;  4AFI A;  2K7S A;  4KZ7 A;  1XGJ A;  5I5L A;  3Q82 A;  2XD1 A;  2JKG A;  1YQS A;  3BY8 A;  5HWW A;  4OPQ A;  2A49 A;  3PBS A;  3TE8 A;  3LY4 A;  2Y2M A;  3HVF A;  3VP3 A;  3PBT A;  4I38 A;  4DJ2 A;  2ZC5 B;  1NYM A;  3OPP A;  1OME A;  3HRE A;  2BAS A;  1GSW A;  3QP2 A;  4MN7 A;  5FQK A;  1S1Z A;  4F3L B;  4MLL A;  1SZV A;  2VV7 A;  3T1S A;  2BG1 A;  1SKO A;  2GDN A;  3IX4 A;  4LEN A;  4R4S A;  3BFF A;  4WL9 A;  1YKD A;  4R1G A;  5DKK A;  5EVI C;  4GCZ A;  4X1L A;  3NDG A;  4DDS A;  1NRJ A;  3PTE A;  4FH4 A;  1L0E A;  4Q0H A;  4ZJ3 A;  2O9A A;  3DW0 A;  4S2K A;  4E3K A;  1BYW A;  1G5U A;  2ZM0 A;  2O9B A;  4FH2 A;  4H6J A;  5HSQ A;  3VOZ A;  3PXP A;  1J9M A;  3MZE A;  5DVA A;  3GTC A;  1T1B A;  5J7E A;  1QME A;  3EWK A;  1G6A A;  2V1B A;  1F9I A;  1K56 D;  2HF6 A;  2W3E A;  4GNU A;  2Y2L A;  3E4Q A;  1ZC2 A;  2EX2 A;  3C7V A;  2PDR A;  3MXR A;  1H5X A;  1YLW A;  3OPR A;  1OJ5 A;  1SDE A;  2A24 A;  5EV0 A;  5M1A A;  5EEC A;  2PBD P;  2WKP A;  4HJ3 A;  3M2K A;  2P9V A;  2VGJ A;  4EET B;  3A0R A;  4ETX A;  3SW1 A;  3T4K A;  1RP5 A;  3GV9 A;  3D9Y A;  3S1Y A;  3KSG A;  5E2E A;  1JTG A;  2XH9 A;  4R0Q A;  3IXD A;  2VJW A;  4B9O A;  4HES A;  1P9W A;  5J3W A;  4JF4 A;  4CJN A;  3B3X A;  4BBT A;  4Y5F A;  1F98 A;  2O9C A;  4K91 A;  1NWZ A;  5CEC A;  1TDG A;  5IS1 A;  1KE0 A;  4CLC A;  3C8C A;  4DE0 A;  1CJF A;  2NUP C;  3F1N B;  3QP1 A;  1S0W A;  2E8J A;  4PAU A;  1TF1 A;  3RFB A;  4OOM A;  2Y91 A;  4ZRR A;  4DE3 A;  1K55 C;  3RXW A;  5CER A;  3E2L A;  5FQQ A;  3ZNY A;  4DJ3 A;  5FQI A;  3ZYT A;  4WZ4 A;  1ES3 A;  5DFX A;  1XJ3 A;  3ITA A;  1H0M A;  3FPV A;  4IUH A;  4MN5 A;  3F1P B;  3OBF A;  2L1M A;  4O8G A;  3NUL A;  3N8L A;  1YT4 A;  3SS4 A;  4WF0 A;  3HL9 A;  3UE0 A;  1CI9 A;  4GLQ A;  2ZD8 A;  4RQ9 A;  3HBR A;  2A3U A;  2OLU A;  1IKI A;  1W5D A;  4Q8I A;  1HZO A;  4YOF A;  3ZNT A;  5DJU A;  1ERO A;  1L2S A;  3ITB A;  1M40 A;  4PHT A;  1ERQ A;  3DAV A;  1S67 L;  3BFD A;  1ONH A;  3A3F A;  4UA6 A;  3GR2 A;  3S4X A;  4B93 A;  4L0L A;  1NXY A;  4S2N C;  4E3O A;  4QU3 A;  1K4F A;  1S6R A;  2W3H A;  3LO7 A;  4HY8 A;  3C7U A;  4C6Y A;  2EFU A;  2PR5 A;  4HH2 A;  2KLI A;  5E2G A;  2HDU A;  1KGF A;  4EWF A;  5EPH A;  1TEM A;  4PM9 A;  4GDN A;  3H7W A;  1XA1 A;  3H82 A;  4WZ5 C;  3Q1F A;  2JKT M;  5GHZ A;  1WE4 A;  4S2P A;  3CLO A;  3BJN A;  4LV1 A;  3ZG5 A;  3H9W A;  3IXB A;  3MSH A;  5AQB A;  3BRM A;  3TSG A;  1YMX A;  3L9K A;  1ZG6 A;  1FSW A;  1ONG A;  1PZP A;  5AQA A;  4OQG A;  5TR7 A;  4RX2 A;  2K2N A;  4LFU A;  3VE4 A;  2ZM8 A;  3W2Z A;  3OPL A;  5M18 A;  2ZOH A;  1LSV A;  3LGO A;  1H8Z A;  2XA7 M;  4BJP A;  3AGE A;  1K6S A;  3IHA A;  2JE5 A;  5GL9 A;  4N1H A;  2J7V A;  1LHY A;  1A0K A;  4DE1 A;  2ZLY A;  1XA7 A;  4Y13 A;  4OLD A;  1WYB A;  2J80 A;  3UDI A;  5HPI A;  1CQA A;  4X56 A;  5L09 A;  1GHP A;  3N8R A;  4PKY A;  5D3O A;  4NXB A;  3W8K A;  4HHD A;  1I2S A;  2VGL S;  3WS4 A;  2DMW A;  3NBL A;  4JF5 A;  5FAS A;  2WAD A;  1D1J A;  3UO9 A;  4E3N A;  4JGO A;  1IOU A;  4ARZ A;  1VQQ A;  2WGW A;  4ZJ1 A;  4E3J A;  1PZO A;  4R23 A;  3IH9 A;  5HWT A;  1KDW A;  3ULF A;  4G3W A;  1BUL A;  4EQ1 A;  1BUE A;  3C38 A;  4EBN A;  4OPR A;  1LSX A;  2R9W A;  3VP0 A;  3R7W B;  4Q0I A;  3W4P A;  1KE4 A;  3MBZ A;  1YPR A;  3HLW A;  5CGW A;  3OCL A;  1ODV A;  4DMZ A;  4L9G A;  3T1X A;  1HVB A;  3T4S A;  1FOF A;  1T1A A;  3HCY A;  5F5Y A;  1STZ A;  3GQZ A;  4GDB A;  5A91 A;  4ID4 A;  4OOL A;  5EM0 A;  4G3V A;  2HZ5 A;  4IVI A;  3CAX A;  4HNB A;  2OWJ A;  2IA2 A;  4HQA A;  4LRX C;  1M6K A;  1FSY A;  1ESU A;  1VHM A;  3E2K A;  5KZH A;  3ZG8 B;  1PW8 A;  5FI2 A;  2W1R A;  1YLJ A;  4KZB A;  4N92 A;  2OAQ 1;  5L10 A;  4UEY A;  3LEZ A;  1Y28 A;  4GD8 A;  2XLN A;  1X0O A;  5E2F A;  1YLY A;  2X02 A;  5IHV A;  3CUE C;  3EGX C;  4GW9 A;  5FQM A;  5DF9 A;  3KSH A;  3L7H A;  4UAA A;  1L0G A;  2OLV A;  2XSS A;  3LR0 A;  2CC1 A;  1DJA A;  2ZQ7 A;  3MS6 A;  3KO6 A;  4F3L A;  3IBR A;  3G4P A;  3IHB A;  4BD0 A;  3NOT C;  4IED A;  5EE8 A;  3GVB A;  4EU0 A;  2PU4 A;  2ZJ9 A;  3MR0 A;  2WKH A;  4OPZ A;  4BL3 A;  2WAE A;  1G28 A;  2FFY A;  2V0U A;  3G34 A;  3UPP A;  3FKW A;  1GCE A;  1GSV A;  4QY6 A;  1H8M A;  4LPZ A;  1PWG A;  1UWN X;  4KZ8 A;  1HTZ A;  4M3K A;  3VSK A;  4QHC A;  2B95 A;  3UB9 A;  2XGN A;  1OTI A;  3A3J A;  4PM6 A;  5A93 A;  1Z09 A;  3UDF A;  1RGZ A;  3CMZ A;  1E3U D;  5HWV A;  3VOY A;  4MBF A;  3O3V A;  1T18 A;  4Y0O A;  2WKE A;  4EBL A;  3I7J A;  1T1C A;  4O0P A;  3QHY A;  5EOE A;  5DTS A;  1ERM A;  3S7O A;  4L9E A;  2OAP 1;  3V67 A;  3N8S A;  2V8C A;  1OJG A;  2WKR A;  4WMC A;  5EM1 A;  3UNW A;  4KZ3 A;  3PAG A;  3V5M A;  2J9P A;  2ZQ9 A;  4OOY A;  3G2Z A;  3T4L A;  4HH3 A;  2W27 A;  3SS5 A;  3NJA A;  2QJ5 A;  3MXS A;  1BZA A;  1NJ4 A;  3WS0 A;  3VFF A;  4G3K A;  5DTK A;  3LYX A;  4OP8 A;  5L07 A;  5AVE A;  5TGF A;  3HUM A;  4R38 A;  5CED A;  1P0Z A;  4P0M A;  1J3W A;  4FOF A;  4ZTK A;  1IYO A;  3BLM A;  3KSF A;  5E43 A;  1XPB A;  4X1M A;  2Y2H A;  3IXH A;  2EWV A;  2QWS A;  3SOI A;  1ACF A;  1GA9 A;  4Q0J A;  4PKY G;  2WKI A;  2W1T B;  2QPN A;  1IEM A;  1IFQ A;  3O86 A;  2JHE A;  3EEA A;  1V9Z A;  1TVF A;  1GA0 A;  1W7F A;  4EER A;  4EQI A;  1DP6 A;  2E8I A;  3LR3 A;  3F1N A;  4KG5 A;  3OCN A;  2VZW A;  2V20 A;  4RX3 A;  2Q0O A;  1JWV A;  4U0X A;  5DKL A;  2Y2P A;  2ZQC A;  4EEP A;  3BQA A;  3PYP A;  2P7J A;  3B47 A;  2G7U A;  3Q81 A;  4E6W A;  3DTI A;  1NLY A;  1ZG4 A;  4JPM A;  4NEE D;  4HJ4 A;  3F1P A;  3TG9 A;  1XJ2 A;  1LI0 A;  4GKU A;  3PHY A;  2JKF A;  1IKG A;  4OH0 A;  2Z6C A;  5TBM B;  3U4L P;  2PD7 A;  1EI5 A;  2XDM A;  1K56 A;  4WEJ A;  2XFT A;  2Y2Q A;  4OPY A;  3E4P A;  1MC0 A;  4O7D A;  4KG2 A;  5GLC A;  4LV0 A;  2Y59 A;  2EWW A;  3FPW A;  4YWZ A;  2P08 A;  2VLG A;  1K38 A;  4R4R A;  1OTB A;  1PI5 A;  3LID A;  5JYO A;  5BOH A;  3Q07 A;  3JYI A;  3VP4 A;  5U47 A;  3S7Q A;  3GRJ A;  3NHQ A;  4CLC C;  5HL6 A;  2DNS A;  4KQR A;  1K54 A;  4MMN A;  2INW A;  3MJQ A;  4U3T A;  4P6B A;  3P7N A;  1PYY A;  1DP8 A;  3ZG7 B;  3LIF A;  3SH8 A;  1I2W A;  2VGL M;  4OVD A;  4I3J A;  5FI7 A;  3FZC A;  4Y2F A;  2R9X A;  4I39 A;  3QNC A;  4OON A;  1N4O A;  3FWL A;  5EVI D;  4BQM A;  3VSL A;  3SZT A;  3FC7 A;  1NZO A;  4BLM A;  4DKI A;  5DTT A;  4PM5 A;  2WAF A;  4A5R A;  3C2W A;  5F82 A;  5C5K A;  4E3I A;  4ZBE A;  3K2N A;  1XXM A;  3DTK A;  4HBU A;  2QZ6 A;  3N4I A;  4KEN B;  3UE6 A;  2XFS A;  3VFH A;  5GLD A;  2WK0 A;  1DJB A;  1MWU A;  1N9B A;  5M19 A;  5AJG A;  2D02 A;  5HDD A;  3IF6 A;  5FQJ A;  2J3T C;  2KOI A;  1CEF A;  3MKE A;  2ZC4 B;  4GZB A;  3ZFZ A;  2Z6D A;  3PBQ A;  4XUX A;  2M7V A;  5EFW A;  1NRF A;  2FH5 A;  1LLB A;  4HP4 A;  4CLC D;  4KG6 A;  2HGV A;  2PBY A;  2YKF A;  4FSF A;  1L0F A;  1JVJ A;  5CXW A;  4X25 A;  5HAQ A;  4UQI S;  3AGF A;  3G30 A;  5L8M A;  3NY4 A;  2HDR A;  1OT6 A;  4JXW A;  4BBV A;  3WS5 A;  3R7W A;  3T12 B;  5FEG A;  3ZQ5 A;  1K57 A;  2C5W B;  3QNB A;  3AGD A;  3LR5 A;  2H10 A;  3IQA A;  1MPL A;  4JF6 A;  2Y2G A;  4WBG A;  3UB8 A;  1NLZ A;  3BY9 A;  3UN7 A;  5L2F A;  2JKR I;  2M7U A;  2DCF A;  1XJ6 A;  2GJ3 A;  5AQ7 A;  5EVI B;  5J8X A;  5CHJ A;  3S7N A;  2ZM2 A;  3P98 A;  3G35 A;  3BQ8 A;  1O07 A;  4BL2 A;  5EUA A;  1FR6 A; 
#chains in the Genus database with same CATH homology
 2X02 A;  2XEP A;  2ZC6 B;  5IHV A;  2RCX A;  1LL5 A;  4KZ7 A;  1O7E A;  1XGJ A;  2X01 A;  2ZQD A;  3Q82 A;  3ZG9 B;  4CPK A;  2XD1 A;  3MZF A;  1YQS A;  5FQM A;  3SH9 A;  5DF9 A;  5A92 A;  5GHY A;  4OPQ A;  2A49 A;  5FAP A;  3PBS A;  4PM8 A;  3FYZ A;  4UAA A;  1VM1 A;  2Q9M A;  1L0G A;  3PBO A;  5CGX A;  4Y0T A;  2OLV A;  3LY4 A;  5TFQ A;  1EWZ A;  2Y2M A;  4PPR A;  4ZDX A;  3HVF A;  3VP3 A;  1YM1 A;  2CC1 A;  1DJA A;  4B4X A;  2ZQ7 A;  3PBT A;  3G4P A;  2ZC5 B;  1NYM A;  1PW1 A;  3IHB A;  3OPP A;  1OME A;  3HRE A;  2Y2O A;  5FQK A;  5GLB A;  1Z6F A;  4BD0 A;  4HBT A;  3BLS A;  1K57 C;  4IED A;  5EE8 A;  3GVB A;  2PU4 A;  3HLD A;  3V3R A;  2G2W A;  2ZJ9 A;  3IF6 B;  4MLL A;  5CHM A;  5HW3 A;  3DTM A;  2WKH A;  4OPZ A;  4BL3 A;  2WAE A;  5FSR A;  1W8Q A;  2BG1 A;  2FFY A;  1IYQ A;  1FQG A;  3V50 A;  2GDN A;  1PWD A;  5HAR A;  4Y0U A;  4LEN A;  3G34 A;  3O88 A;  3UPP A;  4F94 A;  4R4S A;  3BFF A;  3FKW A;  1GCE A;  4QY6 A;  5JYP A;  2EXA A;  4R1G A;  5EVI C;  1PWG A;  3GMW A;  4KZ8 A;  1MWS A;  2IWB A;  3W4Q A;  3NDG A;  1HTZ A;  1KGE A;  4M3K A;  4DDS A;  3IXG A;  3PTE A;  4FH4 A;  3VSK A;  4S2L A;  4QHC A;  3P09 A;  1WYC A;  4S2J A;  4LCM A;  1L0E A;  2UWX A;  4ZJ3 A;  2HP6 A;  1JWZ A;  3DW0 A;  2XGN A;  4S2K A;  4E3K A;  4DRT A;  2HDQ A;  1BLS A;  3A3J A;  4PM6 A;  2ZM0 A;  5A93 A;  2ZC7 A;  3UDF A;  1RGZ A;  3CMZ A;  1KVL A;  1YLZ A;  2WZX A;  3Q7V A;  4FH2 A;  4RVA A;  3M6H A;  1MKI A;  1IYP A;  1E3U D;  5CEB A;  1ES4 A;  3VOZ A;  1SKF A;  3Q7V B;  1J9M A;  4MBF A;  3O3V A;  3G31 A;  3VOY A;  3A3I A;  4LV3 A;  4Y0O A;  1DY6 A;  2XD5 A;  2WKE A;  4EBL A;  3I7J A;  3HUN A;  1I5Q A;  3OC2 A;  3MZE A;  3QHY A;  4R3J A;  5EOE A;  5DVA A;  5DTS A;  5CGS A;  5F83 A;  3WWX A;  2EXB A;  1ERM A;  1BSG A;  1CEG A;  1CI8 A;  1NY0 A;  1FR1 A;  3GTC A;  4QJG A;  1QME A;  3RXX A;  1K55 A;  1G6A A;  1LI9 A;  3N8S A;  4JLF A;  3IWI A;  1K56 D;  4GNU A;  2Y2L A;  1ZC2 A;  3BFG A;  5HX9 A;  2EX2 A;  3C7V A;  4WMC A;  3MXR A;  3UNW A;  4KZ3 A;  5E2H A;  1DJC A;  3PAG A;  2Q9N A;  5EVL A;  1H5X A;  2J9P A;  2ZQ9 A;  4ZJ2 A;  3V5M A;  1YLW A;  4OOY A;  3G2Z A;  3OPR A;  4UA9 A;  5CTM A;  1SCW A;  1MY8 A;  3LY3 A;  3SS5 A;  1SDE A;  3MXS A;  1BZA A;  1TDL A;  1E25 A;  5M1A A;  1NJ4 A;  3WS0 A;  5EEC A;  1GHI A;  3VFF A;  3M2K A;  3GSG A;  2P9V A;  2VGJ A;  4K0W A;  5DTK A;  3OPH A;  3ZDJ A;  4OP8 A;  5TGF A;  1KDS A;  3HUM A;  2P9V B;  5CED A;  4S2O A;  1BLP A;  3SS3 A;  4P0M A;  3VP2 A;  3C5A A;  1RP5 A;  3GV9 A;  4ZTK A;  3S1Y A;  1IYO A;  3BLM A;  5E2E A;  5E43 A;  2HDS A;  1XPB A;  4GOG A;  3M2J A;  4GD6 A;  2X71 A;  2EX6 A;  2XQZ A;  2Y2H A;  1JTG A;  3IXH A;  5FAT A;  2XH9 A;  4R0Q A;  2G2U A;  3SOI A;  3IXD A;  4KZ4 A;  3UY6 A;  2EX8 A;  3ZVW A;  1BT5 A;  1GA9 A;  4S2N A;  2WYX A;  1G68 A;  2WKI A;  3Q7Z A;  4HES A;  5FA7 A;  4JF4 A;  4CJN A;  3B3X A;  2QPN A;  1XP4 A;  3NDE A;  1IEM A;  1ZKJ A;  4N9K A;  3O86 A;  4K91 A;  5G18 A;  2RL3 A;  4QD4 A;  5CEC A;  1TDG A;  3CZD A;  3N7W A;  1TVF A;  1KE0 A;  4GN2 A;  3UDX A;  1GA0 A;  1W7F A;  3UPN A;  4EQI A;  5KSH A;  2E8I A;  4KG5 A;  1NYY A;  5FDH A;  5GLA A;  3SH7 A;  1MXO A;  3PAE A;  3OCN A;  4DE0 A;  4E3L A;  2V20 A;  4RX3 A;  4FCF A;  1JWV A;  3BM6 A;  4U0X A;  4WEL A;  2XK1 A;  2Y2P A;  3MFD A;  2ZQA A;  4PM7 A;  2ZQC A;  1HD8 A;  1S0W A;  5DF8 A;  4KZ9 A;  1K4E A;  4KQO A;  1XKZ A;  3V3S A;  4OOM A;  2Y91 A;  4DE3 A;  4WYY A;  1E3U A;  1K55 C;  3RXW A;  4LCL A;  4WZ5 A;  5CER A;  3E2L A;  3Q81 A;  5FQQ A;  4JXG A;  4MNR A;  3ZNY A;  4E6W A;  2IWD A;  4JXV A;  2EFX A;  4WM9 A;  3NIA A;  1ZG4 A;  4JPM A;  5FQI A;  3VMA A;  4WZ4 A;  1ES3 A;  3TG9 A;  1JTD A;  2H5S A;  4DXB A;  1MWR A;  1LI0 A;  3ITA A;  4Z9Q A;  3TOI A;  4GKU A;  2IWC A;  1BLH A;  5KMW A;  1RGY A;  1IKG A;  4OH0 A;  4R3B A;  5HAI A;  3N8L A;  1YT4 A;  2Y2N A;  4GB7 A;  3SS4 A;  1EI5 A;  2VGK A;  2XDM A;  1K56 A;  4WEJ A;  1FCO A;  3HL9 A;  3UE0 A;  4MBK A;  1CI9 A;  4B88 A;  5I94 A;  2XFT A;  4OP5 A;  2Y2Q A;  4OPY A;  2ZD8 A;  3UPO A;  2Y2J A;  4IBX A;  1ES5 A;  3HBR A;  1MBL A;  2A3U A;  4KZ6 A;  2OLU A;  4E3M A;  1IKI A;  1K25 A;  4O7D A;  1KGG A;  1W5D A;  2I72 A;  4H8R A;  4OKP A;  4PMA A;  4Q8I A;  3N6I A;  4NET A;  1HZO A;  3MKF A;  5CHU A;  4KG2 A;  5GLC A;  4LV0 A;  3ZNT A;  2Y59 A;  1ERO A;  1L2S A;  1XGI A;  1IEL A;  3ITB A;  3S22 A;  1RCJ A;  2C6W B;  1M40 A;  1AXB A;  4D2O A;  3A3E A;  4P85 A;  2J8Y A;  1ERQ A;  1K38 A;  3WRZ A;  4UA7 A;  4R4R A;  3BFD A;  1YMS A;  1PI5 A;  1ONH A;  3A3F A;  4JKT A;  4UA6 A;  3GR2 A;  3S4X A;  5JYO A;  4L0L A;  5BOH A;  3CJM A;  1PWC A;  4BEN A;  1NXY A;  1Q2Q A;  3BEB A;  3Q07 A;  4S2N C;  3FKV A;  4E3O A;  4QU3 A;  2H0T A;  1K4F A;  4DDY A;  1S6R A;  1MWT A;  3LO7 A;  3UE3 A;  3JYI A;  3VP4 A;  5U47 A;  3GRJ A;  3C7U A;  1W8Y A;  4C6Y A;  2EFU A;  4U0T A;  1U60 A;  4S2M A;  2DNS A;  2OV5 A;  4KQR A;  2Z2M B;  2Z2L B;  2DRW A;  4N9L A;  5E2G A;  1K54 A;  2HDU A;  4B4Z A;  1KGF A;  3WS1 A;  5EPH A;  1TEM A;  1W79 A;  3BFE A;  4EWF A;  4OQ0 A;  4PM9 A;  2V2F F;  4QB8 A;  1YLT A;  4P87 A;  1C3B A;  4GDN A;  2WZZ A;  4U3T A;  2EX9 A;  3NI9 A;  4HEF A;  3WS2 A;  4P6B A;  4DXC A;  1PYY A;  3ZG7 B;  1XA1 A;  3SH8 A;  1CK3 A;  4OQH A;  4C3Q A;  3BFC A;  4EV4 A;  1I2W A;  4WZ5 C;  3Q1F A;  2ZQ8 A;  3O87 A;  4S2I A;  4OVD A;  5GHZ A;  1WE4 A;  5FI7 A;  4S2P A;  4LV1 A;  3WRT A;  3ZG5 A;  3FZC A;  3IXB A;  5AQB A;  1L0D A;  4XXR A;  5F1F A;  3BRM A;  2R9X A;  3TSG A;  1YMX A;  3QNC A;  2B5R A;  4OON A;  4UHU A;  1N4O A;  1ZG6 A;  1FSW A;  1ONG A;  1PZP A;  3FWL A;  1PI4 A;  3ISG A;  4OQG A;  3LCE A;  4RX2 A;  3IT9 A;  5AQA A;  5EVI D;  5TR7 A;  4BQM A;  1FCM A;  3G32 A;  3VSL A;  2ZM8 A;  1NZO A;  4X53 A;  1PIO A;  4BLM A;  2Y4A A;  2FFF B;  4OQI A;  4DKI A;  3PBN A;  5DTT A;  4PM5 A;  2PU2 A;  3OPL A;  1KE3 A;  2WAF A;  4A5R A;  5F82 A;  4E3I A;  5M18 A;  4ZBE A;  1H8Z A;  3ZG0 A;  1SHV A;  4BJP A;  1XXM A;  4LV2 A;  4HBU A;  3AGE A;  2QZ6 A;  1K6S A;  2XF3 A;  3N4I A;  4KEN B;  4DE2 A;  3IHA A;  1K6R A;  2JE5 A;  3M6B A;  4X55 A;  5DF7 A;  5GL9 A;  3VP1 A;  2XFS A;  2J7V A;  4N1H A;  2Y2I A;  2XR0 A;  4EBP A;  1LHY A;  1BTL A;  3VFH A;  5GLD A;  4YFM A;  2WK0 A;  1QMF A;  5KSC A;  1DJB A;  4DE1 A;  1MWU A;  1N9B A;  3HUO A;  3ZGA B;  2ZLY A;  4X68 A;  1XA7 A;  5HFO A;  4OLD A;  1WYB A;  5M19 A;  3UDI A;  3IF6 A;  4X69 A;  1BLC A;  2JC7 A;  4X56 A;  5FQJ A;  1GHP A;  3N8R A;  5HL1 A;  5FI6 A;  3OZH A;  4IVK A;  1CEF A;  4Y7P A;  4DF6 A;  5D3O A;  1ALQ A;  3MKE A;  4IBR A;  2ZC4 B;  4GZB A;  3EQV A;  2JBF A;  3HLF A;  3ZFZ A;  3W8K A;  3FV7 A;  1I2S A;  4XUX A;  3PBQ A;  4JBF A;  2ZMA A;  3WS4 A;  1K54 C;  3W4O A;  4KZA A;  3ZVT A;  2ZC3 B;  3NBL A;  4JF5 A;  1NRF A;  5CRF A;  1LLB A;  5FAS A;  4KG6 A;  2WAD A;  3UO9 A;  4E3N A;  3BEC A;  2P74 A;  2WGV A;  3IWO A;  4N1X A;  2PBY A;  2WUQ A;  2Y55 A;  3HLC A;  1IYS A;  4FSF A;  5FAQ A;  3IF5 A;  1L0F A;  2OSU A;  1ES2 A;  3IWQ A;  1VQQ A;  2WGW A;  3NC8 A;  4ZJ1 A;  1JVJ A;  3UE1 A;  5CXW A;  4E3J A;  4YIN A;  3D4F A;  5AQ9 A;  5HAQ A;  1Y54 A;  1PZO A;  3AGF A;  1Q2P A;  3G30 A;  3IH9 A;  3DWZ A;  1KDW A;  2WGW B;  3DWK A;  3EQU A;  4R23 A;  3V39 A;  5A90 A;  5CTN A;  4OLG A;  3NY4 A;  1BUL A;  1BUE A;  4EBN A;  2H0Y A;  2HDR A;  4OPR A;  2BLS A;  4JXW A;  3HLB A;  4MBH A;  3G2Y A;  3WS5 A;  4NK3 A;  1K57 A;  1SDN A;  2C5W B;  2R9W A;  4FD8 A;  3VP0 A;  4C75 A;  1JWP A;  3QNB A;  4WEK A;  4KQQ A;  3AGD A;  4X6T A;  2H10 A;  2HP5 A;  1XX2 A;  1MPL A;  3IQA A;  4K0X A;  2V1Z A;  4MEZ A;  4JF6 A;  3W4P A;  3ZHH A;  2Y2G A;  1KE4 A;  4QY5 A;  1GHM A;  2QMI A;  3MBZ A;  4WBG A;  2JCH A;  3C4P A;  4KZ5 A;  3HLW A;  5CGW A;  3OCL A;  1HVB A;  2J9O A;  1FOF A;  1E4D A;  5EOO A;  3UN7 A;  5L2F A;  3IH8 A;  3GQZ A;  3PBR A;  4GDB A;  4ID4 A;  5A91 A;  4EUZ A;  1YLP A;  2WGI A;  2DCF A;  5EVI A;  4E6X A;  3ZCZ A;  3A3D A;  4OOL A;  1FCN A;  4BD1 A;  3C4O A;  2Y2K A;  4JXS A;  5AQ7 A;  4RYE A;  5EVI B;  5J8X A;  4IVI A;  3RJU A;  1ESI A;  2HP9 A;  3BYD A;  5CHJ A;  1M6K A;  3CG5 A;  2ZM2 A;  3P98 A;  3G35 A;  1FSY A;  3NCK A;  1ESU A;  3HLG A;  3E2K A;  4ZAM A;  5KZH A;  3IF6 C;  1O07 A;  3ZG8 B;  1PW8 A;  5FI2 A;  5FQ9 A;  1YLJ A;  5FAO A;  1NZU A;  4KZB A;  4N92 A;  5F1G A;  4BL2 A;  1KVM A;  5GHX A;  4RA7 A;  4XUZ A;  3LEZ A;  1LL9 A;  2HPB A;  4GD8 A;  1H8Y A;  2XLN A;  3HLE A;  5HAP A;  4WMC D;  5EUA A;  5E2F A;  3MZD A;  1FR6 A;  1YLY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...