1I5QA

Crystal structure of the e. coli ampc beta-lactamase mutant n152a covalently acylated with the inhibitory beta-lactam, moxalactam
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
358
structure length
356
Chain Sequence
APQQINDIVHRTITPLIEQQKIPGMAVAVIYQGKPYYFTWGYADIAKKQPVTQQTLFELGSVSKTFTGVLGGDAIARGEIKLSDPTTKYWPELTAKQWNGITLLHLATYTAGGLPLQVPDEVKSSSDLLRFYQNWQPAWAPGTQRLYAASSIGLFGALAVKPSGLSFEQAMQTRVFQPLKLNHTWINVPPAEEKNYAWGYREGKAVHVSPGALDAEAYGVKSTIEDMARWVQSNLKPLDINEKTLQQGIQLAQSRYWQTGDMYQGLGWEMLDWPVNPDSIIGDNKIALAARPVKAITPPTPAVRASWVHKTGATGGFGSYVAFIPEKELGIVMLANKNYPNPARVDAAWQILNALQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA-LACTAMASE
publication title Inhibition of AmpC beta-lactamase through a destabilizing interaction in the active site.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 114
structure length 356
sequence length 358
chains with identical sequence B
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2001-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00144 Beta-lactamase Beta-lactamase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 1i5qA00
4PM7A 2WKHA 3VMAA 3G31A 5F1GA 3VFFA 3HLFA 2C5WB 2Y4AA 3HLBA 4GN2A 4OPYA 4ZDXA 4QD4A 4CPKA 4E3MA 5EVID 2EX2A 2WKEA 4U0TA 3V3SA 1ES2A 1I5QA 2XD1A 2Y2OA 2ZMAA 3ITBA 4FD8A 2QMIA 3EQVA 4RA7A 4WEJA 4KZAA 5FQIA 4WYYA 2Y2GA 1PI4A 1G68A 5FQJA 2HP5A 2EFXA 4QU3A 4S2NC 4JKTA 3SS4A 1E25A 1LI0A 5EE8A 1IELA 1BUEA 2WAEA 3O86A 1PZOA 4WZ4A 2VGKA 4E3LA 2EXBA 3HBRA 3C4PA 2R9WA 3N8LA 1L0GA 3GR2A 4HEFA 1TDLA 4GB7A 1BZAA 3UDIA 3FWLA 4DDYA 1RCJA 3V39A 3VP4A 3W8KA 2DCFA 3NCKA 5EVIA 5DF7A 3VFHA 5AQ9A 4KENB 4KZ3A 4OLDA 5FAPA 3N6IA 5DF9A 3WS5A 3IXBA 3NDEA 1BT5A 2XK1A 4LV0A 1NXYA 4DXBA 1W79A 3ZG9B 1RGZA 3HUNA 4X55A 1WYCA 4PMAA 1PW8A 2HP6A 1PIOA 3FV7A 4BL3A 5FQQA 1XA1A 4JXVA 2Y2NA 2WYXA 3CMZA 4S2MA 4UAAA 5JYOA 3NIAA 3PAGA 5KSHA 1FCOA 1W8QA 3GSGA 4DE2A 4HBTA 2X01A 2WAFA 4GDBA 4B4ZA 4S2OA 5TGFA 5CGXA 4PM9A 2H0YA 5F83A 2XGNA 5DTSA 2XF3A 1KDSA 3Q7VB 5E2GA 4X53A 5AQBA 3IWOA 4JLFA 4ZAMA 1XP4A 1K54C 1ZG6A 1YLJA 2Z2MB 1I2WA 1KVMA 3N7WA 4PPRA 3Q7ZA 2ZM2A 1K25A 4RYEA 1GHPA 1MWTA 3PBRA 2QZ6A 2WADA 2E8IA 3WRZA 3MBZA 4ID4A 3WS1A 2XEPA 1PWCA 4KZ8A 1ES4A 4LCLA 5CGSA 3C7UA 4DDSA 5HAPA 5HL1A 2B5RA 1ES5A 4CJNA 2DRWA 1K55A 3OCNA 4R23A 3G2YA 5GHXA 4FCFA 3GVBA 3DTMA 1KE4A 4D2OA 1NJ4A 4XUZA 5CGWA 5GLCA 1NZOA 5D3OA 4B88A 4X56A 2Q9MA 2ZD8A 3OPLA 1YLWA 1BTLA 4JF5A 4BL2A 3PAEA 1NRFA 2HDUA 3G35A 1KGEA 1MXOA 1PZPA 2EXAA 4IBXA 1ZG4A 4O7DA 5CERA 4JXWA 1YLTA 1TEMA 1MBLA 1TDGA 1SHVA 3NC8A 5F1FA 3OPHA 3NBLA 2XR0A 4WMCD 5HFOA 2P9VB 2H5SA 2JE5A 3E2KA 3M2KA 3P98A 5CXWA 4FH2A 3A3FA 4NK3A 5FQKA 2ZC6B 1XGIA 4MBFA 1L2SA 2Y2HA 3VOZA 2HDRA 3VOYA 1N9BA 2IWDA 3Q82A 3O88A 2Y2KA 2Y2LA 4Y7PA 1HTZA 2WUQA 4OQGA 2OLVA 4OOMA 3QNBA 3ZVWA 1YLYA 4FSFA 3V50A 1FR1A 1QMEA 1CEFA 4QY5A 3FZCA 5A92A 4ZBEA 5GHYA 1PWDA 3E2LA 5HAQA 2HDSA 4P87A 5GHZA 1MWRA 3MXSA 4S2NA 1FCNA 4S2PA 1QMFA 1S0WA 2WGIA 5FI2A 5FAQA 3WS2A 4RX3A 3B3XA 4R4SA 3ZGAB 4RVAA 4OONA 2Y59A 4QJGA 5FQMA 4C75A 5E43A 1K56D 2FFFB 5KMWA 4UA7A 1JWZA 4GKUA 3IWIA 4WMCA 4EQIA 5A93A 1IEMA 1GHMA 1MWUA 1ALQA 4BLMA 2G2UA 5AQ7A 3N8RA 3FYZA 1NY0A 4F94A 3VSLA 2WZZA 4S2IA 4Y0TA 2OSUA 1JVJA 1KGFA 5FA7A 1KGGA 2ZQ9A 3BM6A 3PBNA 1HVBA 1WE4A 4PM6A 1NZUA 1DY6A 3BFEA 2I72A 4ZTKA 2JC7A 5EVIB 4ZJ3A 5E2EA 2EX6A 2HP9A 3V5MA 4JPMA 4P85A 3VP1A 4C3QA 1BLPA 2PU4A 3IQAA 4EBLA 3M6HA 1LL9A 5HARA 2Y91A 1ZKJA 4WZ5C 4E3IA 2DNSA 1JTGA 1K56A 2IWCA 3CG5A 1L0EA 1CEGA 3OC2A 4OP8A 4OLGA 1RGYA 4OVDA 5G18A 1HD8A 3BECA 2XDMA 2C6WB 2WKIA 3IF6C 4S2LA 1LL5A 1YLPA 3IXDA 4U0XA 1AXBA 1PI5A 1LI9A 4R4RA 1PW1A 1I2SA 4M3KA 1CI9A 2H10A 3DWZA 2WK0A 2Q9NA 1K4FA 3HLWA 4UA9A 5M1AA 3WRTA 5CRFA 4JXSA 3BFGA 3W4PA 1K54A 3G30A 5M19A 4K0WA 1FOFA 2A3UA 5GLAA 1N4OA 2RL3A 3IWQA 3MFDA 2Y2QA 3MZDA 3PBTA 2X02A 3BLSA 2ZQ7A 2VGJA 4BD1A 2G2WA 4K91A 5EECA 3OZHA 1O07A 5M18A 2J9PA 3IH8A 1NYMA 3G32A 3V3RA 3GTCA 1K38A 1MPLA 4PM5A 3HL9A 3IH9A 4KQRA 4BD0A 3ZCZA 1EI5A 3NY4A 4FH4A 4K0XA 4ZJ2A 1YQSA 2QPNA 4OQHA 4QB8A 4OKPA 2XFTA 5EVIC 4KQQA 3SH9A 3ZVTA 2WGVA 4OOLA 3VP2A 3MZEA 4DE1A 1W7FA 3UE0A 4RX2A 1EROA 1XGJA 4EUZA 3TOIA 2BG1A 4Q8IA 3IT9A 1XKZA 3UO9A 3TSGA 2J7VA 2XD5A 5E2FA 3ZDJA 2WGWB 4QHCA 1ERMA 1KE3A 4KZ4A 1PWGA 4NETA 5FDHA 4UA6A 1ONHA 3SS3A 4OQIA 2A49A 3D4FA 2H0TA 1Q2PA 4MEZA 5FSRA 2EX9A 4A5RA 3WS4A 3S4XA 4BENA 2PBYA 2J8YA 3WS0A 4X6TA 2Y2JA 2ZQDA 4R3JA 1CI8A 5J8XA 5GL9A 1K4EA 2ZQCA 3PBSA 3IXGA 3HVFA 1E4DA 1ZC2A 3ZG7B 3A3JA 1K57C 2V2FF 1KVLA 3SH8A 5KSCA 1MY8A 1K6RA 3ZG0A 4GD8A 3HLEA 2BLSA 5CEBA 4LCMA 3ZFZA 2PU2A 4DKIA 2ZC7A 3HREA 1LLBA 1E3UD 3ITAA 1LHYA 1MKIA 1SDEA 4Y0UA 4R0QA 4EBPA 4GZBA 3EQUA 4X69A 4GOGA 4XXRA 4KG5A 1YT4A 4LENA 4P0MA 1FSYA 1RP5A 3FKVA 3Q1FA 1SCWA 1XXMA 3QHYA 1W5DA 3GQZA 2OLUA 3LCEA 4XUXA 4N9KA 2ZM8A 4P6BA 1Y54A 3UY6A 3LO7A 3NDGA 3PBQA 3AGDA 3BFDA 3MKFA 4N92A 4S2JA 4YFMA 3C7VA 3GRJA 2UWXA 4L0LA 3OCLA 5A91A 3AGEA 4EBNA 4PM8A 3I7JA 1E3UA 4IVIA 1H8ZA 5KZHA 5CHMA 3O87A 1MWSA 1ERQA 3SS5A 4E3JA 1GCEA 4DXCA 4MLLA 5L2FA 4E3OA 5HW3A 4S2KA 3PBOA 4OPQA 5A90A 2R9XA 1C3BA 3LY4A 1DJCA 1BLSA 1Q2QA 5EOEA 1KE0A 5EVLA 3BFFA 2ZC4B 3IF6A 3HUMA 1IYPA 3UPOA 4GDNA 1M6KA 3M2JA 4QY6A 1BULA 4C6YA 5JYPA 4N1HA 5FAOA 4JF6A 1JTDA 4KQOA 2XLNA 4IEDA 2ZQAA 3OPRA 3HLCA 3Q07A 2EX8A 4ZJ1A 2Y55A 5DF8A 3ZNYA 1FR6A 2HDQA 2RCXA 1Z6FA 1OMEA 1ESUA 3NI9A 2JCHA 3OPPA 4IVKA 3IF5A 2WZXA 2ZM0A 3ZHHA 5DVAA 4DF6A 3LY3A 5IHVA 1KDWA 1FSWA 4BQMA 3CJMA 4EV4A 4E3KA 1XX2A 4Z9QA 1GA9A 4E6XA 5TR7A 3LEZA 1YMXA 4KG6A 2JBFA 5F82A 2CC1A 2ZLYA 4BJPA 5GLBA 3IHAA 4WELA 2ZJ9A 3VSKA 3Q81A 4WZ5A 1H5XA 3BLMA 4OP5A 1HZOA 4JBFA 2GDNA 4E3NA 5FI7A 4N1XA 2FFYA 1M40A 2Y2PA 5FQ9A 3SH7A 3A3DA 3QNCA 3FKWA 5EUAA 5FATA 1NYYA 1YMSA 1YLZA 2ZQ8A 4MBHA 3UPNA 5EOOA 1CK3A 2X71A 4OH0A 3N8SA 3SOIA 5GLDA 1JWPA 5CTNA 5DTKA 4DE0A 2ZC5B 1XPBA 5CHJA 1PYYA 2XQZA 3UN7A 4DE3A 1O7EA 4UHUA 5HAIA 3BEBA 4JXGA 3UDXA 3UE1A 4WEKA 2J9OA 1K6SA 5U47A 4HBUA 3S22A 3BRMA 4DRTA 2Y2MA 5FI6A 4KZ5A 1S6RA 3ZNTA 3RJUA 1ES3A 1ONGA 1U60A 1K57A 4E6WA 4EWFA 3MZFA 4KZBA 4YINA 3AGFA 1FCMA 4KZ9A 1ESIA 5CHUA 4OPRA 4Y0OA 5DTTA 3IXHA 3VP3A 1J9MA 1VQQA 3VP0A 5E2HA 3PTEA 4R3BA 3BFCA 4MNRA 3Q7VA 4GD6A 5EPHA 4X68A 1BLCA 3UNWA 4MBKA 4U3TA 3C4OA 2Z2LB 3IHBA 1DJBA 3C5AA 5CECA 2XFSA 1GHIA 4KZ7A 3MXRA 4WM9A 3ZG5A 2XH9A 2IWBA 3GV9A 4LV3A 3ISGA 3RXWA 1WYBA 1SKFA 1L0DA 1TVFA 1IYQA 2HPBA 3RXXA 5BOHA 1H8YA 4KG2A 1IYOA 1YM1A 2WGWA 3A3EA 4OQ0A 3A3IA 1FQGA 1L0FA 2V20A 1W8YA 3G4PA 5HX9A 3HLGA 3MKEA 4OOYA 4OPZA 5CEDA 1DJAA 3CZDA 3O3VA 3N4IA 1IKGA 1BSGA 3HUOA 3TG9A 2Y2IA 3BYDA 1XA7A 4HESA 5CTMA 1IKIA 3DW0A 4N9LA 5TFQA 1K55C 1VM1A 2ZC3B 2EFUA 3DWKA 1BLHA 5FASA 5I94A 3UDFA 3W4QA 3ZG8B 3G2ZA 1EWZA 4LV1A 3JYIA 1SDNA 4WBGA 5AQAA 3W4OA 1GA0A 4B4XA 1JWVA 4LV2A 2P9VA 4JF4A 3S1YA 3G34A 4H8RA 3UPPA 3P09A 2P74A 3IF6B 4R1GA 3M6BA 4GNUA 4KZ6A 1IYSA 1G6AA 2V1ZA 3WWXA 3UE3A 4IBRA 2OV5A 3GMWA 3HLDA
chains in the Genus database with same CATH superfamily
4EW7A 5F1GA 3R7WA 4D60A 2Y4AA 1PFLA 4CPKA 3KSIA 5EVID 1Z09A 2WKEA 3T12B 3IS2B 4DMZA 2JN7A 3JPUA 4DN0A 3BY8A 4JKTA 3IBRA 1IELA 2VGKA 2W3GA 3N8LA 3ULFA 3GR2A 3UDIA 1RCJA 3VP4A 3W8KA 2DCFA 3MMHA 5DF7A 3VFHA 4KENB 4OLDA 3N6IA 4CQHA 5DF9A 2XSSA 1BT5A 1D1JA 3MQQA 5FEFA 5DJTA 3HUNA 3E4QA 5A8BA 1OTDA 4LFUA 2WYXA 3O5YA 2NUPC 5KSHA 4DE2A 5FL3A 4LRXC 4B4ZA 5TJJA 5TGFA 5DTSA 4X53A 1XFQA 4ZAMA 5L10A 2Z2MB 1I2WA 3N7WA 5DKLA 3Q7ZA 2ZM2A 1LT0A 4RYEA 1MWTA 2E8IA 3LIAA 1OTIA 4K08A 3WRZA 4Y15A 2Q0OA 5CGSA 3C7UA 4NXBA 2JKGA 2B5RA 5HDDA 2DRWA 4R38A 3OCNA 1GSVA 1KE4A 4CLCE 4XUZA 1NZOA 4X56A 2Q9MA 3OPLA 3TJZC 1BTLA 4B9OA 2HDUA 1S67L 2M7VA 1SHVA 1S4SA 2DMWA 2JE5A 3P98A 1S66L 1L2SA 2P08A 2Y2HA 2HDRA 2WUQA 1YLYA 1OT9A 3T4TA 2HDSA 5GHZA 4S2NA 3WS2A 3JVVA 3MXQA 4R4SA 4Y3IA 4RVAA 4QJGA 5KMWA 3RFBA 4WMCA 5A93A 4EERA 2KDKA 2G2UA 2OSUA 3T4QA 1JVJA 1KGFA 3MFXA 1WE4A 3ICYA 1F98A 1NZUA 1DY6A 4GHIB 2PBDP 3F1NA 3V5MA 4P85A 2E8JA 2PU4A 4EBLA 4FTXA 1LL9A 4LRZE 5J7EA 2Y91A 1ZKJA 1JTGA 3CG5A 5A90A 1DP8A 3BECA 3IF6C 1LL5A 3GECA 1YLPA 3IXDA 2XA7S 2B18A 2WK0A 4UA9A 1K4FA 1P97A 3WRTA 4JXSA 4K0WA 2A3UA 5HPIA 3PBTA 3MQOA 2VGJA 2A2LA 3R4KA 1UGUA 1O07A 1NYMA 3K2NA 1MPLA 3ZCZA 2OV5A 4ZJ2A 2WKQA 1LSXA 2QPNA 2XFTA 3ZVTA 4DE1A 1EROA 1XKZA 5E2FA 1DRMA 2W1TB 1KE3A 4NETA 4KUKA 4B93A 1OJ5A 2J8YA 4R3JA 5IU1A 4UEYA 3PBSA 3IXGA 1ZC2A 5HWTA 1K57C 3TRCA 1MY8A 1K6RA 3ZG0A 4BBUA 4HH3A 5CEBA 4NXEA 2ZC7A 4L9FA 3HREA 1E3UD 4BBVA 1SDEA 4EBPA 1PNEA 4GOGA 2L1MA 1RP5A 3BQAA 1VEUA 3PR6A 2OWJA 1PRQA 2ZM8A 4DJ2A 3L9KA 5HWWA 3OCLA 1MKMA 3MF0A 3TE8A 1ERQA 3SS5A 5L2FA 4E3OA 5HW3A 3PBOA 4G3WA 3EEHA 1T18A 3IBJA 5EOEA 3BFFA 4HP9A 4M4XA 3UPOA 4CLCD 1M6KA 1BULA 4C6YA 1OPXA 3W2ZA 1V9ZA 4QWOA 2O9AA 4IVKA 2RCXA 1Z6FA 1ESUA 2WZXA 2ZM0A 3LY3A 4BQMA 4JGRA 1GA9A 4E6XA 4FOFA 2CC1A 4BJPA 4WELA 2ZJ9A 3VSKA 3BLMA 2HF6A 4OP5A 1VHMA 4E3NA 1UWPX 3K3CA 3FKWA 1YLZA 4MBHA 3UPNA 5EOOA 3N8SA 2XRNA 4L9GA 4DE0A 1PYYA 1Y4OA 3QP8A 2XQZA 5AVEA 3B47A 2J80A 4WEKA 4HBUA 3BRMA 2BTFP 5FI6A 4KZBA 3NOPC 1FIKA 3IXHA 3VP3A 4GJ4A 4II7A 3VP0A 4EU0A 4NKPA 3PTEA 2PHYA 4GD6A 1BLCA 3T4JA 4U3TA 3C4OA 5CECA 2K7SA 2QJ5A 4O0PA 3ZG5A 2XH9A 2IWBA 2PYPA 1WYBA 4HNBA 5BOHA 1H8YA 1IYOA 1YM1A 3DAVA 5HX9A 3T1QB 1MC0A 5CEDA 4OPZA 3FPVA 3EEAA 4UQIM 4YOFA 2ZMFA 1K55C 2EFUA 1BLHA 3D9YA 3LICA 1XJ6A 5FASA 2QWSA 3W4QA 1EWZA 3F1OA 1GA0A 3QP5A 2P9VA 3KYQA 3S1YA 3UPPA 4H8RA 4KZ6A 2V1ZA 1XJ4A 4WZ5A 4IBRA 4G3VA 2PD8A 3CHWP 2B95A 3G31A 3VFFA 2VK3A 3HLFA 2C5WB 2P04A 4ZDXA 1VETB 4QD4A 3KX0X 4ZRRA 4U0TA 5DFYA 2XD1A 1G28A 2ZMAA 4WEJA 2PR5A 4WYYA 3VE3A 1G68A 4QU3A 1E25A 5MC7A 1BYWA 4L9EA 1BUEA 1PZOA 2O99A 3C4PA 3QP1A 3FWLA 1A0KA 2Y8HA 3UB9A 3NCKA 1S1ZA 4KZ3A 3KSFA 1F9IA 3WS5A 2XK1A 3NOTC 1PW8A 4JGQA 1PIOA 1XA1A 4JXVA 3CMZA 4S2MA 4UAAA 1FCOA 1W8QA 3GSGA 4HBTA 3H82B 4GDBA 5L09A 4WF0A 5CGXA 4PM9A 5CX7A 5F83A 1CF0A 1XP4A 1K54C 1ZG6A 1YLJA 2ZMVA 3S7PA 1KVMA 2M1CA 4R6LA 4FUWA 2D01A 4ID4A 3WS1A 4YNRA 4KQDA 1KOUA 1G5UA 1ES5A 2ZL1A 3LIEA 4R23A 1NJ4A 5HDSA 4B88A 2GNXA 4GW9A 2ZD8A 4JF5A 2V9AA 3G35A 1PZPA 2JKFA 2EXAA 4JXWA 1YLTA 1TEMA 3NC8A 4IHQA 3NBLA 4ETXA 3CITA 5TBMA 2EWVA 3A3FA 5FQKA 2HGVA 1LSVA 2VX8A 1N9BA 2IWDA 1OJGA 2Y2LA 1LL8A 4OQGA 2HJEA 2OLVA 3ZVWA 3P01A 1FR1A 1QMEA 3IX8A 4QY5A 3CUEC 4ZBEA 4P87A 2J3TC 1MWRA 3MXSA 3UB7A 1S0WA 2WGIA 4RX3A 4LGWA 3B3XA 3ZGAB 2Y59A 2FFFB 4UA7A 1JWZA 4EQIA 1MWUA 1ALQA 5AQ7A 3N8RA 3FYZA 5HD5A 2W0NA 3PBNA 1HVBA 4PM6A 3BFEA 4CLCB 4ZJ3A 2EX6A 2HP9A 4JPMA 3VP1A 4HQAA 3IQAA 3M6HA 1TS7A 3HJIA 2DNSA 2IWCA 1K56A 2OAP1 3OC2A 1CEGA 1RGYA 4EESA 1HD8A 4O8GA 2XDMA 2WKIA 4PHTA 3IS2A 1PI5A 1LI9A 4R4RA 1I2SA 2H10A 3DWZA 4GS9A 1OTAA 5L8MA 5M19A 1W63Q 1FOFA 1N9OA 4Y5FA 2Y2QA 4I3JA 3MZDA 4BBTA 2ZQ7A 4K91A 5EECA 3SZTA 3NHQA 3HL9A 4QB8A 4CLCC 3SH9A 3VP2A 3MZEA 1H0MA 3H7WB 4UQIS 4Q8IA 4JGPA 4I39A 4QHCA 1ERMA 1W63M 5FDHA 4UA6A 3SS3A 1Q2PA 2EX9A 4BENA 5J8XA 1CI8A 1K4EA 5LBRA 1E4DA 3A3JA 5IT5A 3B33A 3E98A 2BLSA 4LCMA 4DKIA 3NULA 3ITAA 3VOLA 1ZTUA 4XXRA 1YT4A 4LENA 4P0MA 1FSYA 3FKVA 3Q1FA 1J3WA 5FEGA 3QP4A 3LCEA 4N9KA 1IFQA 4P6BA 4IUHA 3NDGA 3AGDA 3BFDA 3C38A 4N92A 3GRJA 5A91A 4L0LA 2CMNA 2V0WA 3AGEA 5G4ZA 4PM8A 1T1AA 4IVIA 4Z1WA 1H8ZA 3G6OA 3T1RA 4X1MA 1GCEA 4DXCA 4MLLA 4HH2A 4OPQA 1H8MA 1TF1A 3LY4A 1BLSA 1ODVA 1Q2QA 2JKTI 3S7OA 3IF6A 3OLOA 3HUMA 3LR5A 1IYPA 4QY6A 4N1HA 4JF6A 1JTDA 4ARZA 4I38A 4IEDA 3OPRA 2J3WA 4ZJ1A 5DF8A 2HDQA 3NI9A 3C8CA 5DVAA 3LR4A 3CJMA 2OWHA 3CPTA 1CQAA 1YMXA 4HY8A 4KG6A 2V1AA 2W27A 1H5XA 1JNUA 4GHIA 3LI9A 4JBFA 5FI7A 5F68A 3SH7A 1L3LA 2LB5A 3A3DA 5EUAA 4GCZA 2OAQ1 1CK3A 3SOIA 1YKDA 2KOIA 4HOIA 3UN7A 4UHUA 5HAIA 1OTBA 4JXGA 2J9OA 3S22A 4KZ5A 3ZNTA 5IS1A 1K57A 4F3LB 2J3TD 2UV0E 1FCMA 5CHUA 4OPRA 5DTTA 1OTEA 1J9MA 1VQQA 4MNRA 3Q7VA 3L7HA 4X68A 4MBKA 3C5AA 4WM9A 5F6AA 2VA0A 2W3EA 1TVFA 2PRFA 3EOIA 3RXXA 4HJ3A 4KG2A 2W1TA 1FQGA 1L0FA 4Y2FA 2V20A 1VEUB 3HLGA 2W3HA 3O3VA 1IKGA 3HUOA 3TG9A 3BYDA 1XA7A 2ZOHA 2ZC3B 3U2AA 4Y17A 3LR0A 4EXOA 1SDNA 4B4XA 1JWVA 4LV2A 2M7UA 4JF4A 4XT2B 3UMDA 4GNUA 1IYSA 1G6AA 3WWXA 3GMWA 3HLDA 4PM7A 2WKHA 1IOUA 3HLBA 1ZHHB 2EX2A 4WN5A 2QYBA 1ES2A 1I5QA 2V8FA 2Y2OA 1T1BA 2QMIA 1UWNX 4EEPA 3T4OA 5FQJA 2HP5A 2EFXA 3SS4A 5EE8A 3F1PA 2WAEA 3RTYA 3O86A 4WZ4A 2EXBA 3HBRA 4ESPA 2HV1A 1YPRA 1BZAA 4DDYA 5F69A 2VV6A 5EVIA 5AQ9A 3KSHA 3U4LP 3MS6A 3IXBA 3NDEA 4LV0A 1NXYA 1W79A 3ZG9B 1RGZA 4X55A 1WYCA 4HI4A 4PMAA 3FV7A 2WKPA 1P9WA 2Y2NA 4DJ3A 2X01A 2WAFA 4S2OA 5HZHA 2XGNA 5E2GA 1NLZA 3HCYA 2I9VA 5AJGA 2O9BA 1K25A 5EV0A 3PBRA 2WADA 3MR0A 2XEPA 1PWCA 2GX5A 4KZ8A 2VGLM 4R70A 1ES4A 4LCLA 4DDSA 3A0SA 4MCWA 4CJNA 1GSWA 1K55A 3DTMA 4D2OA 5D3OA 1YLWA 2D02A 5J3WA 3PAEA 1NRFA 1KGEA 1MXOA 5CERA 4WUJA 4O7DA 4Q0IA 1MBLA 1TDGA 5F1FA 4WMCD 5HFOA 2P9VB 3M2KA 3TW8A 5CXWA 4HJ6A 1XGIA 3GDIA 3VOZA 1T1CA 1OT6A 3VOYA 3Q82A 1YAXA 4Y7PA 1HTZA 4QPRA 3V50A 3T4LA 3FZCA 5GHYA 2O9CA 3T4KA 4S2PA 1QMFA 3CLOA 1SKOA 4OONA 4HHDA 5FQMA 4C75A 1NWZA 4GKUA 4BLMA 2MJ6A 2WZZA 4S2IA 4Y0TA 1KGGA 2ZQ9A 3BM6A 2I72A 4ZTKA 2YKHA 5E2EA 4C3QA 1BLPA 5HARA 1VETA 4WZ5C 1L0EA 4OVDA 1HLUP 5G18A 2O0YA 1VB6A 2IA2A 1PW1A 2QHKA 4M3KA 5M1AA 2WKRA 3S7QA 3H9WA 1K54A 3FC7A 5GLAA 1N4OA 3IWQA 3K3DA 3ZYTA 3BLSA 2G2WA 3OZHA 5EM0A 5M18A 2J9PA 1S1YA 1D06A 3IH8A 3GTCA 1K38A 3IH9A 4KQRA 4BD0A 3DTKA 4K0XA 4OQHA 4OKPA 4KQQA 2PT7A 2WGVA 3LIBA 3NECA 1W7FA 3UE0A 4RX2A 3TOIA 2BG1A 4H6JB 4NXGA 3UO9A 3TSGA 2J7VA 2XD5A 3ZDJA 2WGWB 1PWGA 1ONHA 3C2WA 2A49A 3D4FA 4P6ZS 3H82A 4MEZA 3S4XA 3FPWA 2Y2JA 3ZQ5A 3LI8A 3HVFA 3ZG7B 2OOLA 2V2FF 3BW6A 5KSCA 4GD8A 3OOVA 2VV7A 3HLEA 1K0KA 2PU2A 3CUEA 4NG2A 2A24A 1LHYA 1MKIA 4R0QA 3KYZA 4GZBA 1WA9A 4KG5A 3R7WB 4IUKA 3T50A 2OLUA 1T19A 3UY6A 4S2JA 1P0ZA 3C7VA 2UWXA 2BASA 4EBNA 1E3UA 1G6OA 5KZHA 2QKPA 5CHMA 1MWSA 4E3JA 3LR3A 4ETZA 2PR6A 3KSGA 2R9XA 1C3BA 4NEED 1DJCA 5FDSA 3A0VA 4YWZA 5EVLA 3M2JA 5JYPA 5FAOA 2P7JA 4BMWA 2ZQAA 4PAUA 3HLCA 3Q07A 1FR6A 1OMEA 1STZA 3OPPA 2JCHA 3ZHHA 4PKYG 5HDCA 1KDWA 1FSWA 2Z6CA 2W3FA 4GS9B 1XX2A 3LYXA 4EEUA 3LGOA 5F82A 5GLBA 3DTEA 3IHAA 5EM1A 2VGLS 4X1LA 4CLCA 4KUOA 2HJ9C 3MQ0A 5DKKA 1TS0A 5FQ9A 3T1XA 3QNCA 5FATA 1NYYA 5C5KA 4OH0A 2QJ7A 4MDZA 1XPBA 4RQ9A 5CHJA 2Y79A 4HP4A 5AVFA 1O7EA 3CAXA 3UE1A 5U47A 4DRTA 2Y2MA 1S6RA 4E6WA 1ES3A 3EGXC 4EWFA 3E4OA 2ZBBA 3AGFA 4KZ9A 1ESIA 4Y0OA 3E4PA 3RH8B 2W3DA 2FH5A 3BFCA 5EPHA 2VLGA 2Z2LB 1DP9A 3MXRA 3ISGA 3H7WA 1IYQA 3VV4A 1TD5A 2HPBA 3KO6A 3BJNA 5J4EA 4OQ0A 3A3IA 2FZ0A 3PXPA 2XROA 3JVUA 3N4IA 4HESA 5CTMA 3DW0A 4N9LA 5TFQA 3UDFA 3ZG8B 3JYIA 1D7EA 5K5BA 3HJKA 5HL6A 3IF6B 3UE3A 1GSXA 3F1NB 3VMAA 4GN2A 4OPYA 4ARZB 4E3MA 4IJGA 2K2NA 4X25A 2K31A 3V3SA 4MN5A 4RA7A 3ITBA 4FD8A 3B42A 3EQVA 4MN6A 5FQIA 3CPTB 4KZAA 2NUTC 4HJ4A 2Y2GA 1PI4A 2GJ3A 4S2NC 4E04A 4PKYA 1LI0A 2PD7A 4I3AA 3VE4A 2JKTM 1P9RA 4E3LA 3C30A 5DFXA 1L0GA 2R9WA 4HEFA 1TDLA 4GB7A 3LIFA 3SW1A 4EUVA 5HSQA 3V39A 2Z6DA 1YSPA 4HIAA 5FAPA 1F5MA 5EVEA 4DXBA 3T4SA 2HP6A 4BL3A 5FQQA 5HWVA 3D3OA 3KYEA 1XFNA 5JYOA 3NIAA 3PAGA 2B02A 3IX4A 2H0YA 2GZAA 5HD3A 4AFIA 2XF3A 1KDSA 1S4RA 3Q7VB 4Q0HA 3S7NA 5AQBA 3IWOA 4JLFA 1NRJA 1XJ3A 3DTIA 1DP6A 4PPRA 3D72A 1GHPA 2QZ6A 1XJ2A 3MBZA 5HAPA 5HL1A 2R78A 3LIDA 1TS8A 2G7UA 3PHYA 4F3LA 3G2YA 5GHXA 4FCFA 3GVBA 4LPZA 3MSHA 5CGWA 5GLCA 4BL2A 1LSWA 4IBXA 1ZG4A 3OPHA 2KX6A 2XR0A 4MN7A 2H5SA 3E2KA 4FH2A 4NK3A 2ZC6B 4MBFA 2V0UA 4P6ZM 1CJFA 2Y2KA 3O88A 4OOMA 3QNBA 4FSFA 1CEFA 4EETB 5HPFA 5A92A 1PWDA 3BY9A 3E2LA 5HAQA 4LRYC 1FCNA 2EWWA 5FI2A 5FAQA 5E43A 1K56D 3IWIA 3P7NA 1IEMA 1GHMA 1NY0A 3F1PB 4F94A 4WL9A 3VSLA 2L0WA 5FA7A 4XT2A 2L4RA 2JC7A 3FG8A 5EVIB 2V1BA 3UE6A 3NJAA 4E3IA 4OLGA 4OP8A 4S2LA 2C6WB 3UB8A 4U0XA 1AXBA 3QP6A 4I5SA 1CI9A 4BWIA 2Q9NA 3HLWA 1Y28A 5CRFA 5I5LA 3BFGA 3W4PA 2VKSA 3G30A 2RL3A 1V9YA 3MFDA 2X02A 3PYPA 4BD1A 1AWIA 2VEAA 3G32A 3V3RA 3BQ8A 4PM5A 1EI5A 3NY4A 4FH4A 1EW0A 1YQSA 5EVIC 4OOLA 1MZUA 1XGJA 4EUZA 3IT9A 1H3QA 4KZ4A 3LFVA 4OQIA 2H0TA 5FSRA 4A5RA 3WS4A 2PBYA 3WS0A 4X6TA 2ZQDA 5GL9A 2ZQCA 4I3IA 4Q0JA 1ACFA 1KVLA 4WLAA 3SH8A 5G4YA 3UB5P 2YKFA 3ZFZA 3F1OB 2PYRA 1LLBA 2ACGA 3A0RA 4Y0UA 1YSQA 3EQUA 4X69A 2PDRA 1SCWA 1XXMA 3E0YA 3BWLA 3QHYA 1SKOB 1W5DA 2V8CA 3GQZA 4XUXA 1Y54A 3LO7A 3PBQA 3MKFA 4YFMA 3LEQA 3LUQA 1N9LA 3I7JA 1TS6A 5DJUA 3O87A 5L07A 4S2KA 1N9NA 1KE0A 2ZC4B 2EA9A 4GDNA 2AVXA 4KQOA 2XLNA 2INWA 4EQ1A 2EX8A 2Y55A 3ZNYA 1F2KA 2VJWA 4G3KA 3IF5A 3CWFA 3EWKA 4DF6A 5IHVA 1X0OA 4EV4A 4JGOA 4LLOB 4E3KA 2H28A 4Z9QA 5TR7A 3LEZA 3DBAA 2JBFA 2ZOIA 2ZLYA 4MMNA 3Q81A 1HZOA 3OBFA 2GDNA 4N1XA 2FFYA 1M40A 2Y2PA 3UB6A 3CI6A 4ME4A 1YMSA 2LB9A 2ZQ8A 2X71A 2W1RA 5KIZA 5GLDA 1JWPA 5CTNA 5DTKA 2ZC5B 3EGDC 3IX3A 4DE3A 3V67A 1FILA 3QP2A 3BEBA 3UDXA 1K6SA 4O01A 3RJUA 1ONGA 1U60A 2ZL1B 3MZFA 4YINA 3T1SA 2KLIA 4Y13A 5E2HA 1SZVA 2XA7M 4R3BA 3UNWA 3IHBA 1DJBA 2XFSA 1GHIA 4KZ7A 3GV9A 4LV3A 4R3AA 2A24B 3NOUC 5TBMB 1SKFA 1L0DA 3RXWA 4NXFA 4H6JA 2JKRI 2HZ5A 2WGWA 3A3EA 1NLYA 1W8YA 3G4PA 3MKEA 4OOYA 1DJAA 3CZDA 5F5YA 1BSGA 2Y2IA 5EFWA 1IKIA 3UMEA 1VM1A 3DWKA 2JKRM 5I94A 3G2ZA 3MJQA 4LV1A 4WBGA 5AQAA 2VZWA 3W4OA 2VV8A 2PAVP 3G34A 3P09A 2P74A 4R1GA 3M6BA 2JHEA 4GLQA
chains in the Genus database with same CATH topology
4PM7A 2WKHA 3VMAA 3G31A 5F1GA 3VFFA 3HLFA 2C5WB 2Y4AA 3HLBA 4GN2A 4OPYA 4ZDXA 4QD4A 4CPKA 4E3MA 5EVID 2EX2A 2WKEA 4U0TA 3V3SA 1ES2A 1I5QA 2XD1A 2Y2OA 2ZMAA 3ITBA 4FD8A 2QMIA 3EQVA 4RA7A 4WEJA 4KZAA 5FQIA 4WYYA 2Y2GA 1PI4A 1G68A 5FQJA 2HP5A 2EFXA 4QU3A 4S2NC 4JKTA 3SS4A 1E25A 1LI0A 5EE8A 1IELA 1BUEA 2WAEA 3O86A 1PZOA 4WZ4A 2VGKA 4E3LA 2EXBA 3HBRA 3C4PA 2R9WA 3N8LA 1L0GA 3GR2A 4HEFA 1TDLA 4GB7A 1BZAA 3UDIA 3FWLA 4DDYA 1RCJA 3V39A 3VP4A 3W8KA 2DCFA 3NCKA 5EVIA 5DF7A 3VFHA 5AQ9A 4KENB 4KZ3A 4OLDA 5FAPA 3N6IA 5DF9A 3WS5A 3IXBA 3NDEA 1BT5A 2XK1A 4LV0A 1NXYA 4DXBA 1W79A 3ZG9B 1RGZA 3HUNA 4X55A 1WYCA 4PMAA 1PW8A 2HP6A 1PIOA 3FV7A 4BL3A 5FQQA 1XA1A 4JXVA 2Y2NA 2WYXA 3CMZA 4S2MA 4UAAA 5JYOA 3NIAA 3PAGA 5KSHA 1FCOA 1W8QA 3GSGA 4DE2A 4HBTA 2X01A 2WAFA 4GDBA 4B4ZA 4S2OA 5TGFA 5CGXA 4PM9A 2H0YA 5F83A 2XGNA 5DTSA 2XF3A 1KDSA 3Q7VB 5E2GA 4X53A 5AQBA 3IWOA 4JLFA 4ZAMA 1XP4A 1K54C 1ZG6A 1YLJA 2Z2MB 1I2WA 1KVMA 3N7WA 4PPRA 3Q7ZA 2ZM2A 1K25A 4RYEA 1GHPA 1MWTA 3PBRA 2QZ6A 2WADA 2E8IA 3WRZA 3MBZA 4ID4A 3WS1A 2XEPA 1PWCA 4KZ8A 1ES4A 4LCLA 5CGSA 3C7UA 4DDSA 5HAPA 5HL1A 2B5RA 1ES5A 4CJNA 2DRWA 1K55A 3OCNA 4R23A 3G2YA 5GHXA 4FCFA 3GVBA 3DTMA 1KE4A 4D2OA 1NJ4A 4XUZA 5CGWA 5GLCA 1NZOA 5D3OA 4B88A 4X56A 2Q9MA 2ZD8A 3OPLA 1YLWA 1BTLA 4JF5A 4BL2A 3PAEA 1NRFA 2HDUA 3G35A 1KGEA 1MXOA 1PZPA 2EXAA 4IBXA 1ZG4A 4O7DA 5CERA 4JXWA 1YLTA 1TEMA 1MBLA 1TDGA 1SHVA 3NC8A 5F1FA 3OPHA 3NBLA 2XR0A 4WMCD 5HFOA 2P9VB 2H5SA 2JE5A 3E2KA 3M2KA 3P98A 5CXWA 4FH2A 3A3FA 4NK3A 5FQKA 2ZC6B 1XGIA 4MBFA 1L2SA 2Y2HA 3VOZA 2HDRA 3VOYA 1N9BA 2IWDA 3Q82A 3O88A 2Y2KA 2Y2LA 4Y7PA 1HTZA 2WUQA 4OQGA 2OLVA 4OOMA 3QNBA 3ZVWA 1YLYA 4FSFA 3V50A 1FR1A 1QMEA 1CEFA 4QY5A 3FZCA 5A92A 4ZBEA 5GHYA 1PWDA 3E2LA 5HAQA 2HDSA 4P87A 5GHZA 1MWRA 3MXSA 4S2NA 1FCNA 4S2PA 1QMFA 1S0WA 2WGIA 5FI2A 5FAQA 3WS2A 4RX3A 3B3XA 4R4SA 3ZGAB 4RVAA 4OONA 2Y59A 4QJGA 5FQMA 4C75A 5E43A 1K56D 2FFFB 5KMWA 4UA7A 1JWZA 4GKUA 3IWIA 4WMCA 4EQIA 5A93A 1IEMA 1GHMA 1MWUA 1ALQA 4BLMA 2G2UA 5AQ7A 3N8RA 3FYZA 1NY0A 4F94A 3VSLA 2WZZA 4S2IA 4Y0TA 2OSUA 1JVJA 1KGFA 5FA7A 1KGGA 2ZQ9A 3BM6A 3PBNA 1HVBA 1WE4A 4PM6A 1NZUA 1DY6A 3BFEA 2I72A 4ZTKA 2JC7A 5EVIB 4ZJ3A 5E2EA 2EX6A 2HP9A 3V5MA 4JPMA 4P85A 3VP1A 4C3QA 1BLPA 2PU4A 3IQAA 4EBLA 3M6HA 1LL9A 5HARA 2Y91A 1ZKJA 4WZ5C 4E3IA 2DNSA 1JTGA 1K56A 2IWCA 3CG5A 1L0EA 1CEGA 3OC2A 4OP8A 4OLGA 1RGYA 4OVDA 5G18A 1HD8A 3BECA 2XDMA 2C6WB 2WKIA 3IF6C 4S2LA 1LL5A 1YLPA 3IXDA 4U0XA 1AXBA 1PI5A 1LI9A 4R4RA 1PW1A 1I2SA 4M3KA 1CI9A 2H10A 3DWZA 2WK0A 2Q9NA 1K4FA 3HLWA 4UA9A 5M1AA 3WRTA 5CRFA 4JXSA 3BFGA 3W4PA 1K54A 3G30A 5M19A 4K0WA 1FOFA 2A3UA 5GLAA 1N4OA 2RL3A 3IWQA 3MFDA 2Y2QA 3MZDA 3PBTA 2X02A 3BLSA 2ZQ7A 2VGJA 4BD1A 2G2WA 4K91A 5EECA 3OZHA 1O07A 5M18A 2J9PA 3IH8A 1NYMA 3G32A 3V3RA 3GTCA 1K38A 1MPLA 4PM5A 3HL9A 3IH9A 4KQRA 4BD0A 3ZCZA 1EI5A 3NY4A 4FH4A 4K0XA 4ZJ2A 1YQSA 2QPNA 4OQHA 4QB8A 4OKPA 2XFTA 5EVIC 4KQQA 3SH9A 3ZVTA 2WGVA 4OOLA 3VP2A 3MZEA 4DE1A 1W7FA 3UE0A 4RX2A 1EROA 1XGJA 4EUZA 3TOIA 2BG1A 4Q8IA 3IT9A 1XKZA 3UO9A 3TSGA 2J7VA 2XD5A 5E2FA 3ZDJA 2WGWB 4QHCA 1ERMA 1KE3A 4KZ4A 1PWGA 4NETA 5FDHA 4UA6A 1ONHA 3SS3A 4OQIA 2A49A 3D4FA 2H0TA 1Q2PA 4MEZA 5FSRA 2EX9A 4A5RA 3WS4A 3S4XA 4BENA 2PBYA 2J8YA 3WS0A 4X6TA 2Y2JA 2ZQDA 4R3JA 1CI8A 5J8XA 5GL9A 1K4EA 2ZQCA 3PBSA 3IXGA 3HVFA 1E4DA 1ZC2A 3ZG7B 3A3JA 1K57C 2V2FF 1KVLA 3SH8A 5KSCA 1MY8A 1K6RA 3ZG0A 4GD8A 3HLEA 2BLSA 5CEBA 4LCMA 3ZFZA 2PU2A 4DKIA 2ZC7A 3HREA 1LLBA 1E3UD 3ITAA 1LHYA 1MKIA 1SDEA 4Y0UA 4R0QA 4EBPA 4GZBA 3EQUA 4X69A 4GOGA 4XXRA 4KG5A 1YT4A 4LENA 4P0MA 1FSYA 1RP5A 3FKVA 3Q1FA 1SCWA 1XXMA 3QHYA 1W5DA 3GQZA 2OLUA 3LCEA 4XUXA 4N9KA 2ZM8A 4P6BA 1Y54A 3UY6A 3LO7A 3NDGA 3PBQA 3AGDA 3BFDA 3MKFA 4N92A 4S2JA 4YFMA 3C7VA 3GRJA 2UWXA 4L0LA 3OCLA 5A91A 3AGEA 4EBNA 4PM8A 3I7JA 1E3UA 4IVIA 1H8ZA 5KZHA 5CHMA 3O87A 1MWSA 1ERQA 3SS5A 4E3JA 1GCEA 4DXCA 4MLLA 5L2FA 4E3OA 5HW3A 4S2KA 3PBOA 4OPQA 5A90A 2R9XA 1C3BA 3LY4A 1DJCA 1BLSA 1Q2QA 5EOEA 1KE0A 5EVLA 3BFFA 2ZC4B 3IF6A 3HUMA 1IYPA 3UPOA 4GDNA 1M6KA 3M2JA 4QY6A 1BULA 4C6YA 5JYPA 4N1HA 5FAOA 4JF6A 1JTDA 4KQOA 2XLNA 4IEDA 2ZQAA 3OPRA 3HLCA 3Q07A 2EX8A 4ZJ1A 2Y55A 5DF8A 3ZNYA 1FR6A 2HDQA 2RCXA 1Z6FA 1OMEA 1ESUA 3NI9A 2JCHA 3OPPA 4IVKA 3IF5A 2WZXA 2ZM0A 3ZHHA 5DVAA 4DF6A 3LY3A 5IHVA 1KDWA 1FSWA 4BQMA 3CJMA 4EV4A 4E3KA 1XX2A 4Z9QA 1GA9A 4E6XA 5TR7A 3LEZA 1YMXA 4KG6A 2JBFA 5F82A 2CC1A 2ZLYA 4BJPA 5GLBA 3IHAA 4WELA 2ZJ9A 3VSKA 3Q81A 4WZ5A 1H5XA 3BLMA 4OP5A 1HZOA 4JBFA 2GDNA 4E3NA 5FI7A 4N1XA 2FFYA 1M40A 2Y2PA 5FQ9A 3SH7A 3A3DA 3QNCA 3FKWA 5EUAA 5FATA 1NYYA 1YMSA 1YLZA 2ZQ8A 4MBHA 3UPNA 5EOOA 1CK3A 2X71A 4OH0A 3N8SA 3SOIA 5GLDA 1JWPA 5CTNA 5DTKA 4DE0A 2ZC5B 1XPBA 5CHJA 1PYYA 2XQZA 3UN7A 4DE3A 1O7EA 4UHUA 5HAIA 3BEBA 4JXGA 3UDXA 3UE1A 4WEKA 2J9OA 1K6SA 5U47A 4HBUA 3S22A 3BRMA 4DRTA 2Y2MA 5FI6A 4KZ5A 1S6RA 3ZNTA 3RJUA 1ES3A 1ONGA 1U60A 1K57A 4E6WA 4EWFA 3MZFA 4KZBA 4YINA 3AGFA 1FCMA 4KZ9A 1ESIA 5CHUA 4OPRA 4Y0OA 5DTTA 3IXHA 3VP3A 1J9MA 1VQQA 3VP0A 5E2HA 3PTEA 4R3BA 3BFCA 4MNRA 3Q7VA 4GD6A 5EPHA 4X68A 1BLCA 3UNWA 4MBKA 4U3TA 3C4OA 2Z2LB 3IHBA 1DJBA 3C5AA 5CECA 2XFSA 1GHIA 4KZ7A 3MXRA 4WM9A 3ZG5A 2XH9A 2IWBA 3GV9A 4LV3A 3ISGA 3RXWA 1WYBA 1SKFA 1L0DA 1TVFA 1IYQA 2HPBA 3RXXA 5BOHA 1H8YA 4KG2A 1IYOA 1YM1A 2WGWA 3A3EA 4OQ0A 3A3IA 1FQGA 1L0FA 2V20A 1W8YA 3G4PA 5HX9A 3HLGA 3MKEA 4OOYA 4OPZA 5CEDA 1DJAA 3CZDA 3O3VA 3N4IA 1IKGA 1BSGA 3HUOA 3TG9A 2Y2IA 3BYDA 1XA7A 4HESA 5CTMA 1IKIA 3DW0A 4N9LA 5TFQA 1K55C 1VM1A 2ZC3B 2EFUA 3DWKA 1BLHA 5FASA 5I94A 3UDFA 3W4QA 3ZG8B 3G2ZA 1EWZA 4LV1A 3JYIA 1SDNA 4WBGA 5AQAA 3W4OA 1GA0A 4B4XA 1JWVA 4LV2A 2P9VA 4JF4A 3S1YA 3G34A 4H8RA 3UPPA 3P09A 2P74A 3IF6B 4R1GA 3M6BA 4GNUA 4KZ6A 1IYSA 1G6AA 2V1ZA 3WWXA 3UE3A 4IBRA 2OV5A 3GMWA 3HLDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PM7 A;  2WKH A;  3VMA A;  3G31 A;  5F1G A;  3VFF A;  3HLF A;  2C5W B;  2Y4A A;  3HLB A;  4GN2 A;  4OPY A;  4ZDX A;  4QD4 A;  4CPK A;  4E3M A;  5EVI D;  2EX2 A;  2WKE A;  4U0T A;  3V3S A;  1ES2 A;  1I5Q A;  2XD1 A;  2Y2O A;  2ZMA A;  3ITB A;  4FD8 A;  2QMI A;  3EQV A;  4RA7 A;  4WEJ A;  4KZA A;  5FQI A;  4WYY A;  2Y2G A;  1PI4 A;  1G68 A;  5FQJ A;  2HP5 A;  2EFX A;  4QU3 A;  4S2N C;  4JKT A;  3SS4 A;  1E25 A;  1LI0 A;  5EE8 A;  1IEL A;  1BUE A;  2WAE A;  3O86 A;  1PZO A;  4WZ4 A;  2VGK A;  4E3L A;  2EXB A;  3HBR A;  3C4P A;  2R9W A;  3N8L A;  1L0G A;  3GR2 A;  4HEF A;  1TDL A;  4GB7 A;  1BZA A;  3UDI A;  3FWL A;  4DDY A;  1RCJ A;  3V39 A;  3VP4 A;  3W8K A;  2DCF A;  3NCK A;  5EVI A;  5DF7 A;  3VFH A;  5AQ9 A;  4KEN B;  4KZ3 A;  4OLD A;  5FAP A;  3N6I A;  5DF9 A;  3WS5 A;  3IXB A;  3NDE A;  1BT5 A;  2XK1 A;  4LV0 A;  1NXY A;  4DXB A;  1W79 A;  3ZG9 B;  1RGZ A;  3HUN A;  4X55 A;  1WYC A;  4PMA A;  1PW8 A;  2HP6 A;  1PIO A;  3FV7 A;  4BL3 A;  5FQQ A;  1XA1 A;  4JXV A;  2Y2N A;  2WYX A;  3CMZ A;  4S2M A;  4UAA A;  5JYO A;  3NIA A;  3PAG A;  5KSH A;  1FCO A;  1W8Q A;  3GSG A;  4DE2 A;  4HBT A;  2X01 A;  2WAF A;  4GDB A;  4B4Z A;  4S2O A;  5TGF A;  5CGX A;  4PM9 A;  2H0Y A;  5F83 A;  2XGN A;  5DTS A;  2XF3 A;  1KDS A;  3Q7V B;  5E2G A;  4X53 A;  5AQB A;  3IWO A;  4JLF A;  4ZAM A;  1XP4 A;  1K54 C;  1ZG6 A;  1YLJ A;  2Z2M B;  1I2W A;  1KVM A;  3N7W A;  4PPR A;  3Q7Z A;  2ZM2 A;  1K25 A;  4RYE A;  1GHP A;  1MWT A;  3PBR A;  2QZ6 A;  2WAD A;  2E8I A;  3WRZ A;  3MBZ A;  4ID4 A;  3WS1 A;  2XEP A;  1PWC A;  4KZ8 A;  1ES4 A;  4LCL A;  5CGS A;  3C7U A;  4DDS A;  5HAP A;  5HL1 A;  2B5R A;  1ES5 A;  4CJN A;  2DRW A;  1K55 A;  3OCN A;  4R23 A;  3G2Y A;  5GHX A;  4FCF A;  3GVB A;  3DTM A;  1KE4 A;  4D2O A;  1NJ4 A;  4XUZ A;  5CGW A;  5GLC A;  1NZO A;  5D3O A;  4B88 A;  4X56 A;  2Q9M A;  2ZD8 A;  3OPL A;  1YLW A;  1BTL A;  4JF5 A;  4BL2 A;  3PAE A;  1NRF A;  2HDU A;  3G35 A;  1KGE A;  1MXO A;  1PZP A;  2EXA A;  4IBX A;  1ZG4 A;  4O7D A;  5CER A;  4JXW A;  1YLT A;  1TEM A;  1MBL A;  1TDG A;  1SHV A;  3NC8 A;  5F1F A;  3OPH A;  3NBL A;  2XR0 A;  4WMC D;  5HFO A;  2P9V B;  2H5S A;  2JE5 A;  3E2K A;  3M2K A;  3P98 A;  5CXW A;  4FH2 A;  3A3F A;  4NK3 A;  5FQK A;  2ZC6 B;  1XGI A;  4MBF A;  1L2S A;  2Y2H A;  3VOZ A;  2HDR A;  3VOY A;  1N9B A;  2IWD A;  3Q82 A;  3O88 A;  2Y2K A;  2Y2L A;  4Y7P A;  1HTZ A;  2WUQ A;  4OQG A;  2OLV A;  4OOM A;  3QNB A;  3ZVW A;  1YLY A;  4FSF A;  3V50 A;  1FR1 A;  1QME A;  1CEF A;  4QY5 A;  3FZC A;  5A92 A;  4ZBE A;  5GHY A;  1PWD A;  3E2L A;  5HAQ A;  2HDS A;  4P87 A;  5GHZ A;  1MWR A;  3MXS A;  4S2N A;  1FCN A;  4S2P A;  1QMF A;  1S0W A;  2WGI A;  5FI2 A;  5FAQ A;  3WS2 A;  4RX3 A;  3B3X A;  4R4S A;  3ZGA B;  4RVA A;  4OON A;  2Y59 A;  4QJG A;  5FQM A;  4C75 A;  5E43 A;  1K56 D;  2FFF B;  5KMW A;  4UA7 A;  1JWZ A;  4GKU A;  3IWI A;  4WMC A;  4EQI A;  5A93 A;  1IEM A;  1GHM A;  1MWU A;  1ALQ A;  4BLM A;  2G2U A;  5AQ7 A;  3N8R A;  3FYZ A;  1NY0 A;  4F94 A;  3VSL A;  2WZZ A;  4S2I A;  4Y0T A;  2OSU A;  1JVJ A;  1KGF A;  5FA7 A;  1KGG A;  2ZQ9 A;  3BM6 A;  3PBN A;  1HVB A;  1WE4 A;  4PM6 A;  1NZU A;  1DY6 A;  3BFE A;  2I72 A;  4ZTK A;  2JC7 A;  5EVI B;  4ZJ3 A;  5E2E A;  2EX6 A;  2HP9 A;  3V5M A;  4JPM A;  4P85 A;  3VP1 A;  4C3Q A;  1BLP A;  2PU4 A;  3IQA A;  4EBL A;  3M6H A;  1LL9 A;  5HAR A;  2Y91 A;  1ZKJ A;  4WZ5 C;  4E3I A;  2DNS A;  1JTG A;  1K56 A;  2IWC A;  3CG5 A;  1L0E A;  1CEG A;  3OC2 A;  4OP8 A;  4OLG A;  1RGY A;  4OVD A;  5G18 A;  1HD8 A;  3BEC A;  2XDM A;  2C6W B;  2WKI A;  3IF6 C;  4S2L A;  1LL5 A;  1YLP A;  3IXD A;  4U0X A;  1AXB A;  1PI5 A;  1LI9 A;  4R4R A;  1PW1 A;  1I2S A;  4M3K A;  1CI9 A;  2H10 A;  3DWZ A;  2WK0 A;  2Q9N A;  1K4F A;  3HLW A;  4UA9 A;  5M1A A;  3WRT A;  5CRF A;  4JXS A;  3BFG A;  3W4P A;  1K54 A;  3G30 A;  5M19 A;  4K0W A;  1FOF A;  2A3U A;  5GLA A;  1N4O A;  2RL3 A;  3IWQ A;  3MFD A;  2Y2Q A;  3MZD A;  3PBT A;  2X02 A;  3BLS A;  2ZQ7 A;  2VGJ A;  4BD1 A;  2G2W A;  4K91 A;  5EEC A;  3OZH A;  1O07 A;  5M18 A;  2J9P A;  3IH8 A;  1NYM A;  3G32 A;  3V3R A;  3GTC A;  1K38 A;  1MPL A;  4PM5 A;  3HL9 A;  3IH9 A;  4KQR A;  4BD0 A;  3ZCZ A;  1EI5 A;  3NY4 A;  4FH4 A;  4K0X A;  4ZJ2 A;  1YQS A;  2QPN A;  4OQH A;  4QB8 A;  4OKP A;  2XFT A;  5EVI C;  4KQQ A;  3SH9 A;  3ZVT A;  2WGV A;  4OOL A;  3VP2 A;  3MZE A;  4DE1 A;  1W7F A;  3UE0 A;  4RX2 A;  1ERO A;  1XGJ A;  4EUZ A;  3TOI A;  2BG1 A;  4Q8I A;  3IT9 A;  1XKZ A;  3UO9 A;  3TSG A;  2J7V A;  2XD5 A;  5E2F A;  3ZDJ A;  2WGW B;  4QHC A;  1ERM A;  1KE3 A;  4KZ4 A;  1PWG A;  4NET A;  5FDH A;  4UA6 A;  1ONH A;  3SS3 A;  4OQI A;  2A49 A;  3D4F A;  2H0T A;  1Q2P A;  4MEZ A;  5FSR A;  2EX9 A;  4A5R A;  3WS4 A;  3S4X A;  4BEN A;  2PBY A;  2J8Y A;  3WS0 A;  4X6T A;  2Y2J A;  2ZQD A;  4R3J A;  1CI8 A;  5J8X A;  5GL9 A;  1K4E A;  2ZQC A;  3PBS A;  3IXG A;  3HVF A;  1E4D A;  1ZC2 A;  3ZG7 B;  3A3J A;  1K57 C;  2V2F F;  1KVL A;  3SH8 A;  5KSC A;  1MY8 A;  1K6R A;  3ZG0 A;  4GD8 A;  3HLE A;  2BLS A;  5CEB A;  4LCM A;  3ZFZ A;  2PU2 A;  4DKI A;  2ZC7 A;  3HRE A;  1LLB A;  1E3U D;  3ITA A;  1LHY A;  1MKI A;  1SDE A;  4Y0U A;  4R0Q A;  4EBP A;  4GZB A;  3EQU A;  4X69 A;  4GOG A;  4XXR A;  4KG5 A;  1YT4 A;  4LEN A;  4P0M A;  1FSY A;  1RP5 A;  3FKV A;  3Q1F A;  1SCW A;  1XXM A;  3QHY A;  1W5D A;  3GQZ A;  2OLU A;  3LCE A;  4XUX A;  4N9K A;  2ZM8 A;  4P6B A;  1Y54 A;  3UY6 A;  3LO7 A;  3NDG A;  3PBQ A;  3AGD A;  3BFD A;  3MKF A;  4N92 A;  4S2J A;  4YFM A;  3C7V A;  3GRJ A;  2UWX A;  4L0L A;  3OCL A;  5A91 A;  3AGE A;  4EBN A;  4PM8 A;  3I7J A;  1E3U A;  4IVI A;  1H8Z A;  5KZH A;  5CHM A;  3O87 A;  1MWS A;  1ERQ A;  3SS5 A;  4E3J A;  1GCE A;  4DXC A;  4MLL A;  5L2F A;  4E3O A;  5HW3 A;  4S2K A;  3PBO A;  4OPQ A;  5A90 A;  2R9X A;  1C3B A;  3LY4 A;  1DJC A;  1BLS A;  1Q2Q A;  5EOE A;  1KE0 A;  5EVL A;  3BFF A;  2ZC4 B;  3IF6 A;  3HUM A;  1IYP A;  3UPO A;  4GDN A;  1M6K A;  3M2J A;  4QY6 A;  1BUL A;  4C6Y A;  5JYP A;  4N1H A;  5FAO A;  4JF6 A;  1JTD A;  4KQO A;  2XLN A;  4IED A;  2ZQA A;  3OPR A;  3HLC A;  3Q07 A;  2EX8 A;  4ZJ1 A;  2Y55 A;  5DF8 A;  3ZNY A;  1FR6 A;  2HDQ A;  2RCX A;  1Z6F A;  1OME A;  1ESU A;  3NI9 A;  2JCH A;  3OPP A;  4IVK A;  3IF5 A;  2WZX A;  2ZM0 A;  3ZHH A;  5DVA A;  4DF6 A;  3LY3 A;  5IHV A;  1KDW A;  1FSW A;  4BQM A;  3CJM A;  4EV4 A;  4E3K A;  1XX2 A;  4Z9Q A;  1GA9 A;  4E6X A;  5TR7 A;  3LEZ A;  1YMX A;  4KG6 A;  2JBF A;  5F82 A;  2CC1 A;  2ZLY A;  4BJP A;  5GLB A;  3IHA A;  4WEL A;  2ZJ9 A;  3VSK A;  3Q81 A;  4WZ5 A;  1H5X A;  3BLM A;  4OP5 A;  1HZO A;  4JBF A;  2GDN A;  4E3N A;  5FI7 A;  4N1X A;  2FFY A;  1M40 A;  2Y2P A;  5FQ9 A;  3SH7 A;  3A3D A;  3QNC A;  3FKW A;  5EUA A;  5FAT A;  1NYY A;  1YMS A;  1YLZ A;  2ZQ8 A;  4MBH A;  3UPN A;  5EOO A;  1CK3 A;  2X71 A;  4OH0 A;  3N8S A;  3SOI A;  5GLD A;  1JWP A;  5CTN A;  5DTK A;  4DE0 A;  2ZC5 B;  1XPB A;  5CHJ A;  1PYY A;  2XQZ A;  3UN7 A;  4DE3 A;  1O7E A;  4UHU A;  5HAI A;  3BEB A;  4JXG A;  3UDX A;  3UE1 A;  4WEK A;  2J9O A;  1K6S A;  5U47 A;  4HBU A;  3S22 A;  3BRM A;  4DRT A;  2Y2M A;  5FI6 A;  4KZ5 A;  1S6R A;  3ZNT A;  3RJU A;  1ES3 A;  1ONG A;  1U60 A;  1K57 A;  4E6W A;  4EWF A;  3MZF A;  4KZB A;  4YIN A;  3AGF A;  1FCM A;  4KZ9 A;  1ESI A;  5CHU A;  4OPR A;  4Y0O A;  5DTT A;  3IXH A;  3VP3 A;  1J9M A;  1VQQ A;  3VP0 A;  5E2H A;  3PTE A;  4R3B A;  3BFC A;  4MNR A;  3Q7V A;  4GD6 A;  5EPH A;  4X68 A;  1BLC A;  3UNW A;  4MBK A;  4U3T A;  3C4O A;  2Z2L B;  3IHB A;  1DJB A;  3C5A A;  5CEC A;  2XFS A;  1GHI A;  4KZ7 A;  3MXR A;  4WM9 A;  3ZG5 A;  2XH9 A;  2IWB A;  3GV9 A;  4LV3 A;  3ISG A;  3RXW A;  1WYB A;  1SKF A;  1L0D A;  1TVF A;  1IYQ A;  2HPB A;  3RXX A;  5BOH A;  1H8Y A;  4KG2 A;  1IYO A;  1YM1 A;  2WGW A;  3A3E A;  4OQ0 A;  3A3I A;  1FQG A;  1L0F A;  2V20 A;  1W8Y A;  3G4P A;  5HX9 A;  3HLG A;  3MKE A;  4OOY A;  4OPZ A;  5CED A;  1DJA A;  3CZD A;  3O3V A;  3N4I A;  1IKG A;  1BSG A;  3HUO A;  3TG9 A;  2Y2I A;  3BYD A;  1XA7 A;  4HES A;  5CTM A;  1IKI A;  3DW0 A;  4N9L A;  5TFQ A;  1K55 C;  1VM1 A;  2ZC3 B;  2EFU A;  3DWK A;  1BLH A;  5FAS A;  5I94 A;  3UDF A;  3W4Q A;  3ZG8 B;  3G2Z A;  1EWZ A;  4LV1 A;  3JYI A;  1SDN A;  4WBG A;  5AQA A;  3W4O A;  1GA0 A;  4B4X A;  1JWV A;  4LV2 A;  2P9V A;  4JF4 A;  3S1Y A;  3G34 A;  4H8R A;  3UPP A;  3P09 A;  2P74 A;  3IF6 B;  4R1G A;  3M6B A;  4GNU A;  4KZ6 A;  1IYS A;  1G6A A;  2V1Z A;  3WWX A;  3UE3 A;  4IBR A;  2OV5 A;  3GMW A;  3HLD A; 
#chains in the Genus database with same CATH topology
 4EW7 A;  5F1G A;  3R7W A;  4D60 A;  2Y4A A;  1PFL A;  4CPK A;  3KSI A;  5EVI D;  1Z09 A;  2WKE A;  3T12 B;  3IS2 B;  4DMZ A;  2JN7 A;  3JPU A;  4DN0 A;  3BY8 A;  4JKT A;  3IBR A;  1IEL A;  2VGK A;  2W3G A;  3N8L A;  3ULF A;  3GR2 A;  3UDI A;  1RCJ A;  3VP4 A;  3W8K A;  2DCF A;  3MMH A;  5DF7 A;  3VFH A;  4KEN B;  4OLD A;  3N6I A;  4CQH A;  5DF9 A;  2XSS A;  1BT5 A;  1D1J A;  3MQQ A;  5FEF A;  5DJT A;  3HUN A;  3E4Q A;  5A8B A;  1OTD A;  4LFU A;  2WYX A;  3O5Y A;  2NUP C;  5KSH A;  4DE2 A;  5FL3 A;  4LRX C;  4B4Z A;  5TJJ A;  5TGF A;  5DTS A;  4X53 A;  1XFQ A;  4ZAM A;  5L10 A;  2Z2M B;  1I2W A;  3N7W A;  5DKL A;  3Q7Z A;  2ZM2 A;  1LT0 A;  4RYE A;  1MWT A;  2E8I A;  3LIA A;  1OTI A;  4K08 A;  3WRZ A;  4Y15 A;  2Q0O A;  5CGS A;  3C7U A;  4NXB A;  2JKG A;  2B5R A;  5HDD A;  2DRW A;  4R38 A;  3OCN A;  1GSV A;  1KE4 A;  4CLC E;  4XUZ A;  1NZO A;  4X56 A;  2Q9M A;  3OPL A;  3TJZ C;  1BTL A;  4B9O A;  2HDU A;  1S67 L;  2M7V A;  1SHV A;  1S4S A;  2DMW A;  2JE5 A;  3P98 A;  1S66 L;  1L2S A;  2P08 A;  2Y2H A;  2HDR A;  2WUQ A;  1YLY A;  1OT9 A;  3T4T A;  2HDS A;  5GHZ A;  4S2N A;  3WS2 A;  3JVV A;  3MXQ A;  4R4S A;  4Y3I A;  4RVA A;  4QJG A;  5KMW A;  3RFB A;  4WMC A;  5A93 A;  4EER A;  2KDK A;  2G2U A;  2OSU A;  3T4Q A;  1JVJ A;  1KGF A;  3MFX A;  1WE4 A;  3ICY A;  1F98 A;  1NZU A;  1DY6 A;  4GHI B;  2PBD P;  3F1N A;  3V5M A;  4P85 A;  2E8J A;  2PU4 A;  4EBL A;  4FTX A;  1LL9 A;  4LRZ E;  5J7E A;  2Y91 A;  1ZKJ A;  1JTG A;  3CG5 A;  5A90 A;  1DP8 A;  3BEC A;  3IF6 C;  1LL5 A;  3GEC A;  1YLP A;  3IXD A;  2XA7 S;  2B18 A;  2WK0 A;  4UA9 A;  1K4F A;  1P97 A;  3WRT A;  4JXS A;  4K0W A;  2A3U A;  5HPI A;  3PBT A;  3MQO A;  2VGJ A;  2A2L A;  3R4K A;  1UGU A;  1O07 A;  1NYM A;  3K2N A;  1MPL A;  3ZCZ A;  2OV5 A;  4ZJ2 A;  2WKQ A;  1LSX A;  2QPN A;  2XFT A;  3ZVT A;  4DE1 A;  1ERO A;  1XKZ A;  5E2F A;  1DRM A;  2W1T B;  1KE3 A;  4NET A;  4KUK A;  4B93 A;  1OJ5 A;  2J8Y A;  4R3J A;  5IU1 A;  4UEY A;  3PBS A;  3IXG A;  1ZC2 A;  5HWT A;  1K57 C;  3TRC A;  1MY8 A;  1K6R A;  3ZG0 A;  4BBU A;  4HH3 A;  5CEB A;  4NXE A;  2ZC7 A;  4L9F A;  3HRE A;  1E3U D;  4BBV A;  1SDE A;  4EBP A;  1PNE A;  4GOG A;  2L1M A;  1RP5 A;  3BQA A;  1VEU A;  3PR6 A;  2OWJ A;  1PRQ A;  2ZM8 A;  4DJ2 A;  3L9K A;  5HWW A;  3OCL A;  1MKM A;  3MF0 A;  3TE8 A;  1ERQ A;  3SS5 A;  5L2F A;  4E3O A;  5HW3 A;  3PBO A;  4G3W A;  3EEH A;  1T18 A;  3IBJ A;  5EOE A;  3BFF A;  4HP9 A;  4M4X A;  3UPO A;  4CLC D;  1M6K A;  1BUL A;  4C6Y A;  1OPX A;  3W2Z A;  1V9Z A;  4QWO A;  2O9A A;  4IVK A;  2RCX A;  1Z6F A;  1ESU A;  2WZX A;  2ZM0 A;  3LY3 A;  4BQM A;  4JGR A;  1GA9 A;  4E6X A;  4FOF A;  2CC1 A;  4BJP A;  4WEL A;  2ZJ9 A;  3VSK A;  3BLM A;  2HF6 A;  4OP5 A;  1VHM A;  4E3N A;  1UWP X;  3K3C A;  3FKW A;  1YLZ A;  4MBH A;  3UPN A;  5EOO A;  3N8S A;  2XRN A;  4L9G A;  4DE0 A;  1PYY A;  1Y4O A;  3QP8 A;  2XQZ A;  5AVE A;  3B47 A;  2J80 A;  4WEK A;  4HBU A;  3BRM A;  2BTF P;  5FI6 A;  4KZB A;  3NOP C;  1FIK A;  3IXH A;  3VP3 A;  4GJ4 A;  4II7 A;  3VP0 A;  4EU0 A;  4NKP A;  3PTE A;  2PHY A;  4GD6 A;  1BLC A;  3T4J A;  4U3T A;  3C4O A;  5CEC A;  2K7S A;  2QJ5 A;  4O0P A;  3ZG5 A;  2XH9 A;  2IWB A;  2PYP A;  1WYB A;  4HNB A;  5BOH A;  1H8Y A;  1IYO A;  1YM1 A;  3DAV A;  5HX9 A;  3T1Q B;  1MC0 A;  5CED A;  4OPZ A;  3FPV A;  3EEA A;  4UQI M;  4YOF A;  2ZMF A;  1K55 C;  2EFU A;  1BLH A;  3D9Y A;  3LIC A;  1XJ6 A;  5FAS A;  2QWS A;  3W4Q A;  1EWZ A;  3F1O A;  1GA0 A;  3QP5 A;  2P9V A;  3KYQ A;  3S1Y A;  3UPP A;  4H8R A;  4KZ6 A;  2V1Z A;  1XJ4 A;  4WZ5 A;  4IBR A;  4G3V A;  2PD8 A;  3CHW P;  2B95 A;  3G31 A;  3VFF A;  2VK3 A;  3HLF A;  2C5W B;  2P04 A;  4ZDX A;  1VET B;  4QD4 A;  3KX0 X;  4ZRR A;  4U0T A;  5DFY A;  2XD1 A;  1G28 A;  2ZMA A;  4WEJ A;  2PR5 A;  4WYY A;  3VE3 A;  1G68 A;  4QU3 A;  1E25 A;  5MC7 A;  1BYW A;  4L9E A;  1BUE A;  1PZO A;  2O99 A;  3C4P A;  3QP1 A;  3FWL A;  1A0K A;  2Y8H A;  3UB9 A;  3NCK A;  1S1Z A;  4KZ3 A;  3KSF A;  1F9I A;  3WS5 A;  2XK1 A;  3NOT C;  1PW8 A;  4JGQ A;  1PIO A;  1XA1 A;  4JXV A;  3CMZ A;  4S2M A;  4UAA A;  1FCO A;  1W8Q A;  3GSG A;  4HBT A;  3H82 B;  4GDB A;  5L09 A;  4WF0 A;  5CGX A;  4PM9 A;  5CX7 A;  5F83 A;  1CF0 A;  1XP4 A;  1K54 C;  1ZG6 A;  1YLJ A;  2ZMV A;  3S7P A;  1KVM A;  2M1C A;  4R6L A;  4FUW A;  2D01 A;  4ID4 A;  3WS1 A;  4YNR A;  4KQD A;  1KOU A;  1G5U A;  1ES5 A;  2ZL1 A;  3LIE A;  4R23 A;  1NJ4 A;  5HDS A;  4B88 A;  2GNX A;  4GW9 A;  2ZD8 A;  4JF5 A;  2V9A A;  3G35 A;  1PZP A;  2JKF A;  2EXA A;  4JXW A;  1YLT A;  1TEM A;  3NC8 A;  4IHQ A;  3NBL A;  4ETX A;  3CIT A;  5TBM A;  2EWV A;  3A3F A;  5FQK A;  2HGV A;  1LSV A;  2VX8 A;  1N9B A;  2IWD A;  1OJG A;  2Y2L A;  1LL8 A;  4OQG A;  2HJE A;  2OLV A;  3ZVW A;  3P01 A;  1FR1 A;  1QME A;  3IX8 A;  4QY5 A;  3CUE C;  4ZBE A;  4P87 A;  2J3T C;  1MWR A;  3MXS A;  3UB7 A;  1S0W A;  2WGI A;  4RX3 A;  4LGW A;  3B3X A;  3ZGA B;  2Y59 A;  2FFF B;  4UA7 A;  1JWZ A;  4EQI A;  1MWU A;  1ALQ A;  5AQ7 A;  3N8R A;  3FYZ A;  5HD5 A;  2W0N A;  3PBN A;  1HVB A;  4PM6 A;  3BFE A;  4CLC B;  4ZJ3 A;  2EX6 A;  2HP9 A;  4JPM A;  3VP1 A;  4HQA A;  3IQA A;  3M6H A;  1TS7 A;  3HJI A;  2DNS A;  2IWC A;  1K56 A;  2OAP 1;  3OC2 A;  1CEG A;  1RGY A;  4EES A;  1HD8 A;  4O8G A;  2XDM A;  2WKI A;  4PHT A;  3IS2 A;  1PI5 A;  1LI9 A;  4R4R A;  1I2S A;  2H10 A;  3DWZ A;  4GS9 A;  1OTA A;  5L8M A;  5M19 A;  1W63 Q;  1FOF A;  1N9O A;  4Y5F A;  2Y2Q A;  4I3J A;  3MZD A;  4BBT A;  2ZQ7 A;  4K91 A;  5EEC A;  3SZT A;  3NHQ A;  3HL9 A;  4QB8 A;  4CLC C;  3SH9 A;  3VP2 A;  3MZE A;  1H0M A;  3H7W B;  4UQI S;  4Q8I A;  4JGP A;  4I39 A;  4QHC A;  1ERM A;  1W63 M;  5FDH A;  4UA6 A;  3SS3 A;  1Q2P A;  2EX9 A;  4BEN A;  5J8X A;  1CI8 A;  1K4E A;  5LBR A;  1E4D A;  3A3J A;  5IT5 A;  3B33 A;  3E98 A;  2BLS A;  4LCM A;  4DKI A;  3NUL A;  3ITA A;  3VOL A;  1ZTU A;  4XXR A;  1YT4 A;  4LEN A;  4P0M A;  1FSY A;  3FKV A;  3Q1F A;  1J3W A;  5FEG A;  3QP4 A;  3LCE A;  4N9K A;  1IFQ A;  4P6B A;  4IUH A;  3NDG A;  3AGD A;  3BFD A;  3C38 A;  4N92 A;  3GRJ A;  5A91 A;  4L0L A;  2CMN A;  2V0W A;  3AGE A;  5G4Z A;  4PM8 A;  1T1A A;  4IVI A;  4Z1W A;  1H8Z A;  3G6O A;  3T1R A;  4X1M A;  1GCE A;  4DXC A;  4MLL A;  4HH2 A;  4OPQ A;  1H8M A;  1TF1 A;  3LY4 A;  1BLS A;  1ODV A;  1Q2Q A;  2JKT I;  3S7O A;  3IF6 A;  3OLO A;  3HUM A;  3LR5 A;  1IYP A;  4QY6 A;  4N1H A;  4JF6 A;  1JTD A;  4ARZ A;  4I38 A;  4IED A;  3OPR A;  2J3W A;  4ZJ1 A;  5DF8 A;  2HDQ A;  3NI9 A;  3C8C A;  5DVA A;  3LR4 A;  3CJM A;  2OWH A;  3CPT A;  1CQA A;  1YMX A;  4HY8 A;  4KG6 A;  2V1A A;  2W27 A;  1H5X A;  1JNU A;  4GHI A;  3LI9 A;  4JBF A;  5FI7 A;  5F68 A;  3SH7 A;  1L3L A;  2LB5 A;  3A3D A;  5EUA A;  4GCZ A;  2OAQ 1;  1CK3 A;  3SOI A;  1YKD A;  2KOI A;  4HOI A;  3UN7 A;  4UHU A;  5HAI A;  1OTB A;  4JXG A;  2J9O A;  3S22 A;  4KZ5 A;  3ZNT A;  5IS1 A;  1K57 A;  4F3L B;  2J3T D;  2UV0 E;  1FCM A;  5CHU A;  4OPR A;  5DTT A;  1OTE A;  1J9M A;  1VQQ A;  4MNR A;  3Q7V A;  3L7H A;  4X68 A;  4MBK A;  3C5A A;  4WM9 A;  5F6A A;  2VA0 A;  2W3E A;  1TVF A;  2PRF A;  3EOI A;  3RXX A;  4HJ3 A;  4KG2 A;  2W1T A;  1FQG A;  1L0F A;  4Y2F A;  2V20 A;  1VEU B;  3HLG A;  2W3H A;  3O3V A;  1IKG A;  3HUO A;  3TG9 A;  3BYD A;  1XA7 A;  2ZOH A;  2ZC3 B;  3U2A A;  4Y17 A;  3LR0 A;  4EXO A;  1SDN A;  4B4X A;  1JWV A;  4LV2 A;  2M7U A;  4JF4 A;  4XT2 B;  3UMD A;  4GNU A;  1IYS A;  1G6A A;  3WWX A;  3GMW A;  3HLD A;  4PM7 A;  2WKH A;  1IOU A;  3HLB A;  1ZHH B;  2EX2 A;  4WN5 A;  2QYB A;  1ES2 A;  1I5Q A;  2V8F A;  2Y2O A;  1T1B A;  2QMI A;  1UWN X;  4EEP A;  3T4O A;  5FQJ A;  2HP5 A;  2EFX A;  3SS4 A;  5EE8 A;  3F1P A;  2WAE A;  3RTY A;  3O86 A;  4WZ4 A;  2EXB A;  3HBR A;  4ESP A;  2HV1 A;  1YPR A;  1BZA A;  4DDY A;  5F69 A;  2VV6 A;  5EVI A;  5AQ9 A;  3KSH A;  3U4L P;  3MS6 A;  3IXB A;  3NDE A;  4LV0 A;  1NXY A;  1W79 A;  3ZG9 B;  1RGZ A;  4X55 A;  1WYC A;  4HI4 A;  4PMA A;  3FV7 A;  2WKP A;  1P9W A;  2Y2N A;  4DJ3 A;  2X01 A;  2WAF A;  4S2O A;  5HZH A;  2XGN A;  5E2G A;  1NLZ A;  3HCY A;  2I9V A;  5AJG A;  2O9B A;  1K25 A;  5EV0 A;  3PBR A;  2WAD A;  3MR0 A;  2XEP A;  1PWC A;  2GX5 A;  4KZ8 A;  2VGL M;  4R70 A;  1ES4 A;  4LCL A;  4DDS A;  3A0S A;  4MCW A;  4CJN A;  1GSW A;  1K55 A;  3DTM A;  4D2O A;  5D3O A;  1YLW A;  2D02 A;  5J3W A;  3PAE A;  1NRF A;  1KGE A;  1MXO A;  5CER A;  4WUJ A;  4O7D A;  4Q0I A;  1MBL A;  1TDG A;  5F1F A;  4WMC D;  5HFO A;  2P9V B;  3M2K A;  3TW8 A;  5CXW A;  4HJ6 A;  1XGI A;  3GDI A;  3VOZ A;  1T1C A;  1OT6 A;  3VOY A;  3Q82 A;  1YAX A;  4Y7P A;  1HTZ A;  4QPR A;  3V50 A;  3T4L A;  3FZC A;  5GHY A;  2O9C A;  3T4K A;  4S2P A;  1QMF A;  3CLO A;  1SKO A;  4OON A;  4HHD A;  5FQM A;  4C75 A;  1NWZ A;  4GKU A;  4BLM A;  2MJ6 A;  2WZZ A;  4S2I A;  4Y0T A;  1KGG A;  2ZQ9 A;  3BM6 A;  2I72 A;  4ZTK A;  2YKH A;  5E2E A;  4C3Q A;  1BLP A;  5HAR A;  1VET A;  4WZ5 C;  1L0E A;  4OVD A;  1HLU P;  5G18 A;  2O0Y A;  1VB6 A;  2IA2 A;  1PW1 A;  2QHK A;  4M3K A;  5M1A A;  2WKR A;  3S7Q A;  3H9W A;  1K54 A;  3FC7 A;  5GLA A;  1N4O A;  3IWQ A;  3K3D A;  3ZYT A;  3BLS A;  2G2W A;  3OZH A;  5EM0 A;  5M18 A;  2J9P A;  1S1Y A;  1D06 A;  3IH8 A;  3GTC A;  1K38 A;  3IH9 A;  4KQR A;  4BD0 A;  3DTK A;  4K0X A;  4OQH A;  4OKP A;  4KQQ A;  2PT7 A;  2WGV A;  3LIB A;  3NEC A;  1W7F A;  3UE0 A;  4RX2 A;  3TOI A;  2BG1 A;  4H6J B;  4NXG A;  3UO9 A;  3TSG A;  2J7V A;  2XD5 A;  3ZDJ A;  2WGW B;  1PWG A;  1ONH A;  3C2W A;  2A49 A;  3D4F A;  4P6Z S;  3H82 A;  4MEZ A;  3S4X A;  3FPW A;  2Y2J A;  3ZQ5 A;  3LI8 A;  3HVF A;  3ZG7 B;  2OOL A;  2V2F F;  3BW6 A;  5KSC A;  4GD8 A;  3OOV A;  2VV7 A;  3HLE A;  1K0K A;  2PU2 A;  3CUE A;  4NG2 A;  2A24 A;  1LHY A;  1MKI A;  4R0Q A;  3KYZ A;  4GZB A;  1WA9 A;  4KG5 A;  3R7W B;  4IUK A;  3T50 A;  2OLU A;  1T19 A;  3UY6 A;  4S2J A;  1P0Z A;  3C7V A;  2UWX A;  2BAS A;  4EBN A;  1E3U A;  1G6O A;  5KZH A;  2QKP A;  5CHM A;  1MWS A;  4E3J A;  3LR3 A;  4ETZ A;  2PR6 A;  3KSG A;  2R9X A;  1C3B A;  4NEE D;  1DJC A;  5FDS A;  3A0V A;  4YWZ A;  5EVL A;  3M2J A;  5JYP A;  5FAO A;  2P7J A;  4BMW A;  2ZQA A;  4PAU A;  3HLC A;  3Q07 A;  1FR6 A;  1OME A;  1STZ A;  3OPP A;  2JCH A;  3ZHH A;  4PKY G;  5HDC A;  1KDW A;  1FSW A;  2Z6C A;  2W3F A;  4GS9 B;  1XX2 A;  3LYX A;  4EEU A;  3LGO A;  5F82 A;  5GLB A;  3DTE A;  3IHA A;  5EM1 A;  2VGL S;  4X1L A;  4CLC A;  4KUO A;  2HJ9 C;  3MQ0 A;  5DKK A;  1TS0 A;  5FQ9 A;  3T1X A;  3QNC A;  5FAT A;  1NYY A;  5C5K A;  4OH0 A;  2QJ7 A;  4MDZ A;  1XPB A;  4RQ9 A;  5CHJ A;  2Y79 A;  4HP4 A;  5AVF A;  1O7E A;  3CAX A;  3UE1 A;  5U47 A;  4DRT A;  2Y2M A;  1S6R A;  4E6W A;  1ES3 A;  3EGX C;  4EWF A;  3E4O A;  2ZBB A;  3AGF A;  4KZ9 A;  1ESI A;  4Y0O A;  3E4P A;  3RH8 B;  2W3D A;  2FH5 A;  3BFC A;  5EPH A;  2VLG A;  2Z2L B;  1DP9 A;  3MXR A;  3ISG A;  3H7W A;  1IYQ A;  3VV4 A;  1TD5 A;  2HPB A;  3KO6 A;  3BJN A;  5J4E A;  4OQ0 A;  3A3I A;  2FZ0 A;  3PXP A;  2XRO A;  3JVU A;  3N4I A;  4HES A;  5CTM A;  3DW0 A;  4N9L A;  5TFQ A;  3UDF A;  3ZG8 B;  3JYI A;  1D7E A;  5K5B A;  3HJK A;  5HL6 A;  3IF6 B;  3UE3 A;  1GSX A;  3F1N B;  3VMA A;  4GN2 A;  4OPY A;  4ARZ B;  4E3M A;  4IJG A;  2K2N A;  4X25 A;  2K31 A;  3V3S A;  4MN5 A;  4RA7 A;  3ITB A;  4FD8 A;  3B42 A;  3EQV A;  4MN6 A;  5FQI A;  3CPT B;  4KZA A;  2NUT C;  4HJ4 A;  2Y2G A;  1PI4 A;  2GJ3 A;  4S2N C;  4E04 A;  4PKY A;  1LI0 A;  2PD7 A;  4I3A A;  3VE4 A;  2JKT M;  1P9R A;  4E3L A;  3C30 A;  5DFX A;  1L0G A;  2R9W A;  4HEF A;  1TDL A;  4GB7 A;  3LIF A;  3SW1 A;  4EUV A;  5HSQ A;  3V39 A;  2Z6D A;  1YSP A;  4HIA A;  5FAP A;  1F5M A;  5EVE A;  4DXB A;  3T4S A;  2HP6 A;  4BL3 A;  5FQQ A;  5HWV A;  3D3O A;  3KYE A;  1XFN A;  5JYO A;  3NIA A;  3PAG A;  2B02 A;  3IX4 A;  2H0Y A;  2GZA A;  5HD3 A;  4AFI A;  2XF3 A;  1KDS A;  1S4R A;  3Q7V B;  4Q0H A;  3S7N A;  5AQB A;  3IWO A;  4JLF A;  1NRJ A;  1XJ3 A;  3DTI A;  1DP6 A;  4PPR A;  3D72 A;  1GHP A;  2QZ6 A;  1XJ2 A;  3MBZ A;  5HAP A;  5HL1 A;  2R78 A;  3LID A;  1TS8 A;  2G7U A;  3PHY A;  4F3L A;  3G2Y A;  5GHX A;  4FCF A;  3GVB A;  4LPZ A;  3MSH A;  5CGW A;  5GLC A;  4BL2 A;  1LSW A;  4IBX A;  1ZG4 A;  3OPH A;  2KX6 A;  2XR0 A;  4MN7 A;  2H5S A;  3E2K A;  4FH2 A;  4NK3 A;  2ZC6 B;  4MBF A;  2V0U A;  4P6Z M;  1CJF A;  2Y2K A;  3O88 A;  4OOM A;  3QNB A;  4FSF A;  1CEF A;  4EET B;  5HPF A;  5A92 A;  1PWD A;  3BY9 A;  3E2L A;  5HAQ A;  4LRY C;  1FCN A;  2EWW A;  5FI2 A;  5FAQ A;  5E43 A;  1K56 D;  3IWI A;  3P7N A;  1IEM A;  1GHM A;  1NY0 A;  3F1P B;  4F94 A;  4WL9 A;  3VSL A;  2L0W A;  5FA7 A;  4XT2 A;  2L4R A;  2JC7 A;  3FG8 A;  5EVI B;  2V1B A;  3UE6 A;  3NJA A;  4E3I A;  4OLG A;  4OP8 A;  4S2L A;  2C6W B;  3UB8 A;  4U0X A;  1AXB A;  3QP6 A;  4I5S A;  1CI9 A;  4BWI A;  2Q9N A;  3HLW A;  1Y28 A;  5CRF A;  5I5L A;  3BFG A;  3W4P A;  2VKS A;  3G30 A;  2RL3 A;  1V9Y A;  3MFD A;  2X02 A;  3PYP A;  4BD1 A;  1AWI A;  2VEA A;  3G32 A;  3V3R A;  3BQ8 A;  4PM5 A;  1EI5 A;  3NY4 A;  4FH4 A;  1EW0 A;  1YQS A;  5EVI C;  4OOL A;  1MZU A;  1XGJ A;  4EUZ A;  3IT9 A;  1H3Q A;  4KZ4 A;  3LFV A;  4OQI A;  2H0T A;  5FSR A;  4A5R A;  3WS4 A;  2PBY A;  3WS0 A;  4X6T A;  2ZQD A;  5GL9 A;  2ZQC A;  4I3I A;  4Q0J A;  1ACF A;  1KVL A;  4WLA A;  3SH8 A;  5G4Y A;  3UB5 P;  2YKF A;  3ZFZ A;  3F1O B;  2PYR A;  1LLB A;  2ACG A;  3A0R A;  4Y0U A;  1YSQ A;  3EQU A;  4X69 A;  2PDR A;  1SCW A;  1XXM A;  3E0Y A;  3BWL A;  3QHY A;  1SKO B;  1W5D A;  2V8C A;  3GQZ A;  4XUX A;  1Y54 A;  3LO7 A;  3PBQ A;  3MKF A;  4YFM A;  3LEQ A;  3LUQ A;  1N9L A;  3I7J A;  1TS6 A;  5DJU A;  3O87 A;  5L07 A;  4S2K A;  1N9N A;  1KE0 A;  2ZC4 B;  2EA9 A;  4GDN A;  2AVX A;  4KQO A;  2XLN A;  2INW A;  4EQ1 A;  2EX8 A;  2Y55 A;  3ZNY A;  1F2K A;  2VJW A;  4G3K A;  3IF5 A;  3CWF A;  3EWK A;  4DF6 A;  5IHV A;  1X0O A;  4EV4 A;  4JGO A;  4LLO B;  4E3K A;  2H28 A;  4Z9Q A;  5TR7 A;  3LEZ A;  3DBA A;  2JBF A;  2ZOI A;  2ZLY A;  4MMN A;  3Q81 A;  1HZO A;  3OBF A;  2GDN A;  4N1X A;  2FFY A;  1M40 A;  2Y2P A;  3UB6 A;  3CI6 A;  4ME4 A;  1YMS A;  2LB9 A;  2ZQ8 A;  2X71 A;  2W1R A;  5KIZ A;  5GLD A;  1JWP A;  5CTN A;  5DTK A;  2ZC5 B;  3EGD C;  3IX3 A;  4DE3 A;  3V67 A;  1FIL A;  3QP2 A;  3BEB A;  3UDX A;  1K6S A;  4O01 A;  3RJU A;  1ONG A;  1U60 A;  2ZL1 B;  3MZF A;  4YIN A;  3T1S A;  2KLI A;  4Y13 A;  5E2H A;  1SZV A;  2XA7 M;  4R3B A;  3UNW A;  3IHB A;  1DJB A;  2XFS A;  1GHI A;  4KZ7 A;  3GV9 A;  4LV3 A;  4R3A A;  2A24 B;  3NOU C;  5TBM B;  1SKF A;  1L0D A;  3RXW A;  4NXF A;  4H6J A;  2JKR I;  2HZ5 A;  2WGW A;  3A3E A;  1NLY A;  1W8Y A;  3G4P A;  3MKE A;  4OOY A;  1DJA A;  3CZD A;  5F5Y A;  1BSG A;  2Y2I A;  5EFW A;  1IKI A;  3UME A;  1VM1 A;  3DWK A;  2JKR M;  5I94 A;  3G2Z A;  3MJQ A;  4LV1 A;  4WBG A;  5AQA A;  2VZW A;  3W4O A;  2VV8 A;  2PAV P;  3G34 A;  3P09 A;  2P74 A;  4R1G A;  3M6B A;  2JHE A;  4GLQ A; 
#chains in the Genus database with same CATH homology
 4PM7 A;  2WKH A;  3VMA A;  3G31 A;  5F1G A;  3VFF A;  3HLF A;  2C5W B;  2Y4A A;  3HLB A;  4GN2 A;  4OPY A;  4ZDX A;  4QD4 A;  4CPK A;  4E3M A;  5EVI D;  2EX2 A;  2WKE A;  4U0T A;  3V3S A;  1ES2 A;  1I5Q A;  2XD1 A;  2Y2O A;  2ZMA A;  3ITB A;  4FD8 A;  2QMI A;  3EQV A;  4RA7 A;  4WEJ A;  4KZA A;  5FQI A;  4WYY A;  2Y2G A;  1PI4 A;  1G68 A;  5FQJ A;  2HP5 A;  2EFX A;  4QU3 A;  4S2N C;  4JKT A;  3SS4 A;  1E25 A;  1LI0 A;  5EE8 A;  1IEL A;  1BUE A;  2WAE A;  3O86 A;  1PZO A;  4WZ4 A;  2VGK A;  4E3L A;  2EXB A;  3HBR A;  3C4P A;  2R9W A;  3N8L A;  1L0G A;  3GR2 A;  4HEF A;  1TDL A;  4GB7 A;  1BZA A;  3UDI A;  3FWL A;  4DDY A;  1RCJ A;  3V39 A;  3VP4 A;  3W8K A;  2DCF A;  3NCK A;  5EVI A;  5DF7 A;  3VFH A;  5AQ9 A;  4KEN B;  4KZ3 A;  4OLD A;  5FAP A;  3N6I A;  5DF9 A;  3WS5 A;  3IXB A;  3NDE A;  1BT5 A;  2XK1 A;  4LV0 A;  1NXY A;  4DXB A;  1W79 A;  3ZG9 B;  1RGZ A;  3HUN A;  4X55 A;  1WYC A;  4PMA A;  1PW8 A;  2HP6 A;  1PIO A;  3FV7 A;  4BL3 A;  5FQQ A;  1XA1 A;  4JXV A;  2Y2N A;  2WYX A;  3CMZ A;  4S2M A;  4UAA A;  5JYO A;  3NIA A;  3PAG A;  5KSH A;  1FCO A;  1W8Q A;  3GSG A;  4DE2 A;  4HBT A;  2X01 A;  2WAF A;  4GDB A;  4B4Z A;  4S2O A;  5TGF A;  5CGX A;  4PM9 A;  2H0Y A;  5F83 A;  2XGN A;  5DTS A;  2XF3 A;  1KDS A;  3Q7V B;  5E2G A;  4X53 A;  5AQB A;  3IWO A;  4JLF A;  4ZAM A;  1XP4 A;  1K54 C;  1ZG6 A;  1YLJ A;  2Z2M B;  1I2W A;  1KVM A;  3N7W A;  4PPR A;  3Q7Z A;  2ZM2 A;  1K25 A;  4RYE A;  1GHP A;  1MWT A;  3PBR A;  2QZ6 A;  2WAD A;  2E8I A;  3WRZ A;  3MBZ A;  4ID4 A;  3WS1 A;  2XEP A;  1PWC A;  4KZ8 A;  1ES4 A;  4LCL A;  5CGS A;  3C7U A;  4DDS A;  5HAP A;  5HL1 A;  2B5R A;  1ES5 A;  4CJN A;  2DRW A;  1K55 A;  3OCN A;  4R23 A;  3G2Y A;  5GHX A;  4FCF A;  3GVB A;  3DTM A;  1KE4 A;  4D2O A;  1NJ4 A;  4XUZ A;  5CGW A;  5GLC A;  1NZO A;  5D3O A;  4B88 A;  4X56 A;  2Q9M A;  2ZD8 A;  3OPL A;  1YLW A;  1BTL A;  4JF5 A;  4BL2 A;  3PAE A;  1NRF A;  2HDU A;  3G35 A;  1KGE A;  1MXO A;  1PZP A;  2EXA A;  4IBX A;  1ZG4 A;  4O7D A;  5CER A;  4JXW A;  1YLT A;  1TEM A;  1MBL A;  1TDG A;  1SHV A;  3NC8 A;  5F1F A;  3OPH A;  3NBL A;  2XR0 A;  4WMC D;  5HFO A;  2P9V B;  2H5S A;  2JE5 A;  3E2K A;  3M2K A;  3P98 A;  5CXW A;  4FH2 A;  3A3F A;  4NK3 A;  5FQK A;  2ZC6 B;  1XGI A;  4MBF A;  1L2S A;  2Y2H A;  3VOZ A;  2HDR A;  3VOY A;  1N9B A;  2IWD A;  3Q82 A;  3O88 A;  2Y2K A;  2Y2L A;  4Y7P A;  1HTZ A;  2WUQ A;  4OQG A;  2OLV A;  4OOM A;  3QNB A;  3ZVW A;  1YLY A;  4FSF A;  3V50 A;  1FR1 A;  1QME A;  1CEF A;  4QY5 A;  3FZC A;  5A92 A;  4ZBE A;  5GHY A;  1PWD A;  3E2L A;  5HAQ A;  2HDS A;  4P87 A;  5GHZ A;  1MWR A;  3MXS A;  4S2N A;  1FCN A;  4S2P A;  1QMF A;  1S0W A;  2WGI A;  5FI2 A;  5FAQ A;  3WS2 A;  4RX3 A;  3B3X A;  4R4S A;  3ZGA B;  4RVA A;  4OON A;  2Y59 A;  4QJG A;  5FQM A;  4C75 A;  5E43 A;  1K56 D;  2FFF B;  5KMW A;  4UA7 A;  1JWZ A;  4GKU A;  3IWI A;  4WMC A;  4EQI A;  5A93 A;  1IEM A;  1GHM A;  1MWU A;  1ALQ A;  4BLM A;  2G2U A;  5AQ7 A;  3N8R A;  3FYZ A;  1NY0 A;  4F94 A;  3VSL A;  2WZZ A;  4S2I A;  4Y0T A;  2OSU A;  1JVJ A;  1KGF A;  5FA7 A;  1KGG A;  2ZQ9 A;  3BM6 A;  3PBN A;  1HVB A;  1WE4 A;  4PM6 A;  1NZU A;  1DY6 A;  3BFE A;  2I72 A;  4ZTK A;  2JC7 A;  5EVI B;  4ZJ3 A;  5E2E A;  2EX6 A;  2HP9 A;  3V5M A;  4JPM A;  4P85 A;  3VP1 A;  4C3Q A;  1BLP A;  2PU4 A;  3IQA A;  4EBL A;  3M6H A;  1LL9 A;  5HAR A;  2Y91 A;  1ZKJ A;  4WZ5 C;  4E3I A;  2DNS A;  1JTG A;  1K56 A;  2IWC A;  3CG5 A;  1L0E A;  1CEG A;  3OC2 A;  4OP8 A;  4OLG A;  1RGY A;  4OVD A;  5G18 A;  1HD8 A;  3BEC A;  2XDM A;  2C6W B;  2WKI A;  3IF6 C;  4S2L A;  1LL5 A;  1YLP A;  3IXD A;  4U0X A;  1AXB A;  1PI5 A;  1LI9 A;  4R4R A;  1PW1 A;  1I2S A;  4M3K A;  1CI9 A;  2H10 A;  3DWZ A;  2WK0 A;  2Q9N A;  1K4F A;  3HLW A;  4UA9 A;  5M1A A;  3WRT A;  5CRF A;  4JXS A;  3BFG A;  3W4P A;  1K54 A;  3G30 A;  5M19 A;  4K0W A;  1FOF A;  2A3U A;  5GLA A;  1N4O A;  2RL3 A;  3IWQ A;  3MFD A;  2Y2Q A;  3MZD A;  3PBT A;  2X02 A;  3BLS A;  2ZQ7 A;  2VGJ A;  4BD1 A;  2G2W A;  4K91 A;  5EEC A;  3OZH A;  1O07 A;  5M18 A;  2J9P A;  3IH8 A;  1NYM A;  3G32 A;  3V3R A;  3GTC A;  1K38 A;  1MPL A;  4PM5 A;  3HL9 A;  3IH9 A;  4KQR A;  4BD0 A;  3ZCZ A;  1EI5 A;  3NY4 A;  4FH4 A;  4K0X A;  4ZJ2 A;  1YQS A;  2QPN A;  4OQH A;  4QB8 A;  4OKP A;  2XFT A;  5EVI C;  4KQQ A;  3SH9 A;  3ZVT A;  2WGV A;  4OOL A;  3VP2 A;  3MZE A;  4DE1 A;  1W7F A;  3UE0 A;  4RX2 A;  1ERO A;  1XGJ A;  4EUZ A;  3TOI A;  2BG1 A;  4Q8I A;  3IT9 A;  1XKZ A;  3UO9 A;  3TSG A;  2J7V A;  2XD5 A;  5E2F A;  3ZDJ A;  2WGW B;  4QHC A;  1ERM A;  1KE3 A;  4KZ4 A;  1PWG A;  4NET A;  5FDH A;  4UA6 A;  1ONH A;  3SS3 A;  4OQI A;  2A49 A;  3D4F A;  2H0T A;  1Q2P A;  4MEZ A;  5FSR A;  2EX9 A;  4A5R A;  3WS4 A;  3S4X A;  4BEN A;  2PBY A;  2J8Y A;  3WS0 A;  4X6T A;  2Y2J A;  2ZQD A;  4R3J A;  1CI8 A;  5J8X A;  5GL9 A;  1K4E A;  2ZQC A;  3PBS A;  3IXG A;  3HVF A;  1E4D A;  1ZC2 A;  3ZG7 B;  3A3J A;  1K57 C;  2V2F F;  1KVL A;  3SH8 A;  5KSC A;  1MY8 A;  1K6R A;  3ZG0 A;  4GD8 A;  3HLE A;  2BLS A;  5CEB A;  4LCM A;  3ZFZ A;  2PU2 A;  4DKI A;  2ZC7 A;  3HRE A;  1LLB A;  1E3U D;  3ITA A;  1LHY A;  1MKI A;  1SDE A;  4Y0U A;  4R0Q A;  4EBP A;  4GZB A;  3EQU A;  4X69 A;  4GOG A;  4XXR A;  4KG5 A;  1YT4 A;  4LEN A;  4P0M A;  1FSY A;  1RP5 A;  3FKV A;  3Q1F A;  1SCW A;  1XXM A;  3QHY A;  1W5D A;  3GQZ A;  2OLU A;  3LCE A;  4XUX A;  4N9K A;  2ZM8 A;  4P6B A;  1Y54 A;  3UY6 A;  3LO7 A;  3NDG A;  3PBQ A;  3AGD A;  3BFD A;  3MKF A;  4N92 A;  4S2J A;  4YFM A;  3C7V A;  3GRJ A;  2UWX A;  4L0L A;  3OCL A;  5A91 A;  3AGE A;  4EBN A;  4PM8 A;  3I7J A;  1E3U A;  4IVI A;  1H8Z A;  5KZH A;  5CHM A;  3O87 A;  1MWS A;  1ERQ A;  3SS5 A;  4E3J A;  1GCE A;  4DXC A;  4MLL A;  5L2F A;  4E3O A;  5HW3 A;  4S2K A;  3PBO A;  4OPQ A;  5A90 A;  2R9X A;  1C3B A;  3LY4 A;  1DJC A;  1BLS A;  1Q2Q A;  5EOE A;  1KE0 A;  5EVL A;  3BFF A;  2ZC4 B;  3IF6 A;  3HUM A;  1IYP A;  3UPO A;  4GDN A;  1M6K A;  3M2J A;  4QY6 A;  1BUL A;  4C6Y A;  5JYP A;  4N1H A;  5FAO A;  4JF6 A;  1JTD A;  4KQO A;  2XLN A;  4IED A;  2ZQA A;  3OPR A;  3HLC A;  3Q07 A;  2EX8 A;  4ZJ1 A;  2Y55 A;  5DF8 A;  3ZNY A;  1FR6 A;  2HDQ A;  2RCX A;  1Z6F A;  1OME A;  1ESU A;  3NI9 A;  2JCH A;  3OPP A;  4IVK A;  3IF5 A;  2WZX A;  2ZM0 A;  3ZHH A;  5DVA A;  4DF6 A;  3LY3 A;  5IHV A;  1KDW A;  1FSW A;  4BQM A;  3CJM A;  4EV4 A;  4E3K A;  1XX2 A;  4Z9Q A;  1GA9 A;  4E6X A;  5TR7 A;  3LEZ A;  1YMX A;  4KG6 A;  2JBF A;  5F82 A;  2CC1 A;  2ZLY A;  4BJP A;  5GLB A;  3IHA A;  4WEL A;  2ZJ9 A;  3VSK A;  3Q81 A;  4WZ5 A;  1H5X A;  3BLM A;  4OP5 A;  1HZO A;  4JBF A;  2GDN A;  4E3N A;  5FI7 A;  4N1X A;  2FFY A;  1M40 A;  2Y2P A;  5FQ9 A;  3SH7 A;  3A3D A;  3QNC A;  3FKW A;  5EUA A;  5FAT A;  1NYY A;  1YMS A;  1YLZ A;  2ZQ8 A;  4MBH A;  3UPN A;  5EOO A;  1CK3 A;  2X71 A;  4OH0 A;  3N8S A;  3SOI A;  5GLD A;  1JWP A;  5CTN A;  5DTK A;  4DE0 A;  2ZC5 B;  1XPB A;  5CHJ A;  1PYY A;  2XQZ A;  3UN7 A;  4DE3 A;  1O7E A;  4UHU A;  5HAI A;  3BEB A;  4JXG A;  3UDX A;  3UE1 A;  4WEK A;  2J9O A;  1K6S A;  5U47 A;  4HBU A;  3S22 A;  3BRM A;  4DRT A;  2Y2M A;  5FI6 A;  4KZ5 A;  1S6R A;  3ZNT A;  3RJU A;  1ES3 A;  1ONG A;  1U60 A;  1K57 A;  4E6W A;  4EWF A;  3MZF A;  4KZB A;  4YIN A;  3AGF A;  1FCM A;  4KZ9 A;  1ESI A;  5CHU A;  4OPR A;  4Y0O A;  5DTT A;  3IXH A;  3VP3 A;  1J9M A;  1VQQ A;  3VP0 A;  5E2H A;  3PTE A;  4R3B A;  3BFC A;  4MNR A;  3Q7V A;  4GD6 A;  5EPH A;  4X68 A;  1BLC A;  3UNW A;  4MBK A;  4U3T A;  3C4O A;  2Z2L B;  3IHB A;  1DJB A;  3C5A A;  5CEC A;  2XFS A;  1GHI A;  4KZ7 A;  3MXR A;  4WM9 A;  3ZG5 A;  2XH9 A;  2IWB A;  3GV9 A;  4LV3 A;  3ISG A;  3RXW A;  1WYB A;  1SKF A;  1L0D A;  1TVF A;  1IYQ A;  2HPB A;  3RXX A;  5BOH A;  1H8Y A;  4KG2 A;  1IYO A;  1YM1 A;  2WGW A;  3A3E A;  4OQ0 A;  3A3I A;  1FQG A;  1L0F A;  2V20 A;  1W8Y A;  3G4P A;  5HX9 A;  3HLG A;  3MKE A;  4OOY A;  4OPZ A;  5CED A;  1DJA A;  3CZD A;  3O3V A;  3N4I A;  1IKG A;  1BSG A;  3HUO A;  3TG9 A;  2Y2I A;  3BYD A;  1XA7 A;  4HES A;  5CTM A;  1IKI A;  3DW0 A;  4N9L A;  5TFQ A;  1K55 C;  1VM1 A;  2ZC3 B;  2EFU A;  3DWK A;  1BLH A;  5FAS A;  5I94 A;  3UDF A;  3W4Q A;  3ZG8 B;  3G2Z A;  1EWZ A;  4LV1 A;  3JYI A;  1SDN A;  4WBG A;  5AQA A;  3W4O A;  1GA0 A;  4B4X A;  1JWV A;  4LV2 A;  2P9V A;  4JF4 A;  3S1Y A;  3G34 A;  4H8R A;  3UPP A;  3P09 A;  2P74 A;  3IF6 B;  4R1G A;  3M6B A;  4GNU A;  4KZ6 A;  1IYS A;  1G6A A;  2V1Z A;  3WWX A;  3UE3 A;  4IBR A;  2OV5 A;  3GMW A;  3HLD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...