3H82A

Crystal structure of the high affinity heterodimer of hif2 alpha and arnt c-terminal pas domains with the artificial ligand ths020
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
115
structure length
115
Chain Sequence
EFKGLDSKTFLSEHSMDMKFTYCDDRITELIGYHPEELLGRSAYEFYHALDSENMTKSHQNLCTKGQVVSGQYRMLAKHGGYVWLETQGTVIYNPRNLQPQCIMCVNYVLSEIEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Principles of ligand binding within a completely buried cavity in HIF2alpha PAS-B
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords Aryl hydrocarbon receptor nuclear translocator
total genus 32
structure length 115
sequence length 115
ec nomenclature
pdb deposition date 2009-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08447 PAS_3 PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3h82A00
3LICA 4HOIA 3CAXA 3F1NB 5I5LA 3UE6A 5EFWA 2WKRA 3A0SA 3NOUC 1DRMA 4LPZA 5F5YA 4BBVA 4EW7A 2L1MA 4BBTA 2KX6A 4KUKA 3G6OA 1T1CA 3A0VA 2ZBBA 1OTIA 3LI8A 3MQQA 4L9FA 4MN6A 5A8BA 1LSVA 5HWWA 2VLGA 3E4QA 4GW9A 3P7NA 2BASA 4BBUA 1OJGA 2INWA 3F1NA 2PYPA 4KUOA 1XJ2A 5AVEA 1N9LA 1GSVA 2R78A 4K08A 4JGOA 2V0WA 1S1ZA 3MQOA 4JGPA 2PR6A 4XT2A 1UWPX 2PD7A 2YKHA 4I39A 5HWVA 3BY9A 3NOTC 4JGQA 4NXGA 2L0WA 5DKLA 3ZQ5A 4H6JA 4LRXC 4HP4A 3H9WA 3IS2A 2PHYA 1S4SA 1WA9A 2VV8A 2ZOHA 5HZHA 1GSWA 2QJ5A 3KX0X 1GSXA 3D72A 4GS9A 3SW1A 1ODVA 2OWHA 4R38A 4I3IA 1MZUA 3F1PB 3FC7A 5F6AA 2JHEA 2WKPA 4MN5A 2M1CA 4PKYG 5AVFA 3VE4A 4B9OA 2QHKA 4R70A 4F3LA 5J7EA 3NHQA 2PR5A 2HV1A 1JNUA 3H7WB 2V1AA 3UB7A 4EETB 1OT9A 4NXBA 4GCZA 2W0NA 4HY8A 4WN5A 2I9VA 2PD8A 3LIAA 5HDSA 5TBMB 3HJIA 4DJ3A 5IS1A 4HH2A 1EW0A 1DP6A 3CWFA 4LRZE 4LLOB 3NOPC 4LRYC 5HSQA 2KDKA 2J80A 3CLOA 4NXFA 4E04A 5DJTA 3H82A 3VOLA 5KIZA 2GJ3A 4JGRA 2B02A 3LIDA 1S66L 2VV6A 1V9ZA 2PYRA 2V9AA 3H82B 3PYPA 3UMEA 3UMDA 2K7SA 3FG8A 1OTEA 1TS8A 4KQDA 3F1OB 3E4PA 4HQAA 1F98A 2WKQA 2W27A 5HDDA 2A24B 4PKYA 3LIFA 4HHDA 3PHYA 4I38A 4HJ4A 3NJAA 3T50A 1T18A 3EEHA 4EXOA 2ZOIA 3E4OA 3LYXA 1G28A 3MXQA 1XJ6A 1D06A 5J4EA 3GECA 3BWLA 1KOUA 1XFNA 1OJ5A 1S67L 1NWZA 1N9OA 1XJ4A 3F1OA 1OTAA 2OOLA 4GS9B 3ULFA 1XFQA 2D02A 3RTYA 3LIBA 4I3JA 3IS2B 5HD3A 2P7JA 3UB6A 2PDRA 3BY8A 1BYWA 4WF0A 2YKFA 3UB8A 3IBRA 4M4XA 4EERA 1X0OA 2V0UA 1LT0A 3A0RA 3LIEA 3MR0A 1S4RA 4HH3A 4XT2B 4I5SA 3OLOA 4WUJA 1VB6A 2VV7A 4L9GA 4GHIB 2EA9A 4I3AA 1LSWA 2A24A 1DP8A 3MJQA 4NXEA 5G4ZA 1OT6A 5TBMA 5DJUA 5G4YA 5HD5A 4HIAA 4HJ3A 4GHIA 4HNBA 3C8CA 1F9IA 5F68A 5HDCA 3B33A 3LI9A 3GDIA 1DP9A 1P0ZA 2QKPA 3LUQA 4HP9A 4HJ6A 5J3WA 1LL8A 5HWTA 1OTBA 2H28A 3EWKA 3UB9A 4EEUA 3K3DA 1D7EA 4WL9A 3K3CA 1Y28A 4EQ1A 4F3LB 3MFXA 3RH8B 3C2WA 1T19A 4YWZA 1TS0A 1N9NA 1UGUA 2D01A 3F1PA 1TS6A 4RQ9A 5IU1A 2Z6CA 4DJ2A 1T1BA 1TS7A 2JN7A 2QJ7A 3HJKA 4R3AA 5DKKA 2CMNA 2L4RA 4WLAA 4H6JB 2QWSA 1LSXA 1S1YA 1UWNX 4HI4A 3H7WA 5F69A 4EESA 4L9EA 1P97A 4R6LA 1V9YA 1OTDA 1XJ3A 2OWJA 3ICYA 3VE3A 1T1AA 2Z6DA 4EEPA 2VEAA 2V1BA
chains in the Genus database with same CATH superfamily
4O0PA 1P9RA 3LFVA 4BBVA 1IEMA 1NRFA 1VHMA 2DMWA 2W3EA 5G18A 3VSLA 4KQOA 3C7UA 2H0TA 4KZ4A 3PXPA 5FAPA 3BQAA 3CPTB 1XPBA 2QJ5A 4JBFA 4MN5A 5AVFA 1Y4OA 4R70A 5DFYA 4ARZB 5CGXA 2PBDP 4EQIA 2PD8A 3GSGA 1DP6A 1EW0A 3TW8A 3UE3A 1K56D 4OOLA 1BLHA 1E25A 3H82A 2V8CA 1LLBA 3PBQA 3IH8A 2VV6A 2BLSA 3QHYA 4JPMA 3UMDA 3BQ8A 4S2MA 2W27A 1YM1A 4K0XA 3UY6A 2OLVA 2WKIA 4D60A 2O9CA 3M2JA 4QPRA 3ZYTA 3VP3A 1NRJA 2P9VA 3F1OA 1HLUP 5EUAA 1FCOA 2E8JA 2ZM8A 2Y2JA 3JVUA 5FDSA 3MKFA 3EEAA 1YKDA 3C4OA 3IF6C 2VV7A 3MJQA 2UWXA 1IKGA 5DJUA 2LB5A 4G3VA 3B33A 3TJZC 1YLPA 4HJ6A 5HWTA 4E3OA 4WL9A 5LBRA 4QD4A 3B42A 1CI9A 1UWNX 2EX2A 2WAFA 1J3WA 4X53A 3MSHA 4R6LA 3CAXA 3N4IA 4GOGA 3QP5A 4HBUA 5AVEA 4K08A 3MQOA 4GDNA 4R4SA 3ITBA 5I94A 3O88A 4P85A 4DE0A 3KSIA 4PM7A 1MZUA 3UDXA 1YLJA 5JYOA 2OSUA 2QHKA 1ALQA 4OH0A 3GR2A 1BLCA 3U2AA 3HLEA 2J7VA 2ZMVA 1HTZA 5E43A 4ME4A 4Q0IA 4HEFA 3F1OB 5EVID 2ZLYA 1F98A 3PR6A 4DXBA 5KSHA 4I38A 5BOHA 3V3RA 3EEHA 4EXOA 1ERMA 2W3DA 1KOUA 1OJ5A 4KENB 1TF1A 3B47A 1RP5A 5CXWA 4O01A 4NEED 3IBRA 4P6BA 3MBZA 2VJWA 4I5SA 3LR0A 4G3WA 4NG2A 3ZHHA 2ZQCA 2R9XA 5F68A 4HBTA 4HNBA 4GN2A 4S2PA 3K3DA 5F1GA 1I2SA 1FSYA 3TRCA 3C2WA 4YWZA 4H8RA 5CERA 3OPLA 1P9WA 4IUKA 4S2IA 2Y2LA 5EM1A 2G7UA 3E2KA 5FL3A 1JTGA 4HOIA 1BUEA 2WZXA 3OPHA 4EW7A 3QNCA 4DF6A 1T1CA 3G31A 4N1XA 5FEFA 2HPBA 1PFLA 1XJ2A 3Q7ZA 4IUHA 4XT2A 1GA9A 4E3KA 2QZ6A 5FQIA 1FOFA 3KX0X 2IWCA 3N8LA 3F1PB 2JHEA 4FCFA 4PKYG 3WS4A 4F3LA 1DJBA 2EXBA 3PBRA 4HY8A 3MZDA 1BZAA 1PRQA 3LR4A 2AVXA 2EWVA 4BD0A 2M7UA 4NETA 5KIZA 5DJTA 3IX8A 3IQAA 1IYOA 5HAQA 3S7NA 3S7OA 3FG8A 5F82A 3WS0A 4MEZA 4KZ9A 1K55A 4BJPA 1KDWA 4R3BA 3IBJA 5CECA 1FR6A 1NWZA 5FATA 1OTAA 3BLMA 1LL5A 1KE4A 4LFUA 1YLZA 5HPFA 1XA1A 3O86A 4I3AA 1LSWA 3KSHA 2LB9A 5TBMA 1ESUA 3E98A 1DP9A 3D9YA 2A3UA 1XXMA 2OAP1 2O99A 4O8GA 3MKEA 1BSGA 3IX3A 1AXBA 1GHPA 2DNSA 4EWFA 5GHXA 2QWSA 5J8XA 4HI4A 4ZTKA 1XJ3A 3FKVA 3EOIA 4LV1A 2Y2PA 3C30A 2FFFB 1BT5A 1K4EA 2Y2KA 5AQAA 5HWWA 1NLZA 3PBSA 3ZCZA 3F1NA 1KE3A 5CTMA 2Y2GA 4LV3A 3GTCA 1NXYA 4FOFA 1W79A 2YKHA 3A3IA 5M1AA 3BY9A 3DWKA 4JGQA 3PAEA 4QJGA 2H0YA 4P87A 5A91A 3VOYA 3T12B 3LR3A 2IA2A 3NHQA 1JNUA 4IJGA 3UB7A 1EI5A 1TEMA 4HH2A 3E2LA 4OQIA 3FWLA 3TOIA 4MN7A 3KSGA 4X25A 4D2OA 4Y3IA 3GQZA 4S2NC 3IXBA 1E3UA 3R7WA 3FYZA 1ES3A 3CJMA 4B93A 5GLAA 4OP5A 4N9LA 3LGOA 2PBYA 1KGFA 1SHVA 2P7JA 3BY8A 5L8MA 2VZWA 2Z2MB 5EECA 4CLCE 3PBTA 3DTMA 4GHIA 3UPPA 4XUZA 3P98A 2VK3A 1D7EA 4KQRA 3VP0A 4PM6A 5E2GA 3OC2A 5IU1A 2D01A 1TS6A 4YNRA 1OPXA 3Q81A 3W4PA 4Q8IA 1S1YA 3ICYA 3BFFA 1ZKJA 2WKEA 4X69A 3G2YA 1Q2PA 1OTIA 3IWIA 3DTEA 1K6SA 4OPQA 2H10A 1D1JA 5HFOA 3A3JA 4UA9A 5DF8A 4YINA 3EQVA 3D3OA 1IYQA 1S4SA 4WYYA 5FQMA 3V67A 2OWHA 3ZGAB 3FKWA 3NI9A 4C3QA 1HD8A 5EVIC 4QY6A 2HV1A 3T4JA 3JVVA 3B3XA 2ZC5B 2V1ZA 2XR0A 1YLYA 3N7WA 2V9AA 4BD1A 3W4QA 4LENA 3RJUA 2HP5A 4PKYA 2M7VA 4HHDA 4E6XA 1MPLA 3NJAA 5E2FA 5FDHA 2X71A 3GECA 1W8YA 3T1QB 1S67L 1MWSA 4U0XA 5CEBA 3TSGA 5KZHA 3A0RA 3QP2A 4NXEA 4BWIA 4IBRA 4WMCA 2O0YA 1XKZA 4ZBEA 3LUQA 2EX6A 3FV7A 1OTBA 3C4PA 4EU0A 1ES4A 5EVLA 3HUNA 2ZQDA 3G34A 3UN7A 2OWJA 2XDMA 3SH9A 1N9BA 3BECA 5IHVA 5A90A 4E3IA 1CK3A 4UA7A 2WKRA 4R3JA 2L1MA 4KUKA 3G6OA 2VGKA 2QPNA 1IOUA 2Y2OA 3Q1FA 2A49A 3T1RA 1OJGA 3C5AA 3BFDA 3MXSA 1I2WA 3MZEA 4LRXC 4DE3A 5HAIA 1G6OA 5EE8A 1FSWA 1PI5A 4CLCC 4I3IA 5F6AA 4MBHA 4S2OA 1ZG6A 2XFSA 3QP1A 3GRJA 2FFYA 4WN5A 3HJIA 2VX8A 4DDYA 5EVIA 4ZJ2A 4Y2FA 1DY6A 2KDKA 2J80A 1LHYA 2XA7S 3AGDA 2PYRA 4MNRA 3EGDC 3L9KA 2EX9A 3O5YA 1K38A 3E4PA 4JF4A 2Y8HA 5GHYA 4XUXA 3BLSA 5HAPA 3LEQA 5FI2A 1XFNA 2WK0A 3IWQA 2P9VB 4JF6A 1I5QA 2OOLA 1F5MA 4EERA 2MJ6A 4QB8A 4WBGA 4DE1A 1NY0A 1WYBA 2XK1A 3SOIA 3LIEA 2HP9A 3ISGA 5G4ZA 4WMCD 4JXGA 3MZFA 2J9PA 1XGIA 4KZ8A 4NKPA 4E3MA 1F9IA 3KYEA 1W5DA 2JKRM 1H8YA 4M3KA 3EWKA 2C6WB 2JE5A 5GL9A 4DMZA 5TR7A 2HGVA 2XRNA 2QJ7A 2CMNA 3EGXC 3VE3A 2VEAA 3NECA 4E3JA 3UE6A 3MQ0A 1W63M 3LI8A 4JXSA 3V5MA 2P08A 3E4QA 1SDEA 1K56A 3T4TA 4S2JA 3CG5A 1UWPX 3E0YA 2PHYA 4KZAA 5HZHA 1FR1A 4GD6A 1EWZA 2PR5A 5TFQA 3HBRA 3ZG0A 5DFXA 2J3WA 1PW8A 2ZQ7A 2B18A 4HESA 3PYPA 4KZ3A 5FQKA 3OCLA 3LIFA 1BLPA 3T4LA 4EBLA 1G28A 3DAVA 4FH2A 3O87A 1N9OA 1XJ4A 4LCLA 2HDSA 1L3LA 3OCNA 2V0UA 4CLCB 3OLOA 4OP8A 3NCKA 3G35A 2A24A 1DP8A 1FCNA 4MBFA 1H0MA 5GHZA 3C8CA 3T1XA 1FILA 4X1LA 2HP6A 3U4LP 3FZCA 3LR5A 3W4OA 2Z6CA 1LI0A 2HDQA 1T1BA 4EBPA 4Y5FA 2G2WA 3H7WA 4EESA 4JF5A 1OTDA 1PWCA 2Z6DA 1DRMA 2J9OA 1NLYA 5F5YA 2WGVA 4UHUA 5DF9A 3NIAA 5CTNA 3LO7A 3SS4A 4I39A 4H6JA 2H5SA 2HZ5A 3SW1A 1ODVA 5EOOA 4MLLA 3CZDA 2JKTM 4Y17A 3V3SA 4FD8A 2W0NA 2I9VA 3LIAA 2DCFA 3IX4A 2Y2HA 1SKOA 2K2NA 4Q0HA 4RA7A 3R4KA 4Y7PA 1EROA 3IXDA 1S66L 4OKPA 2G2UA 4C6YA 5HDDA 2JKGA 1KGGA 3PHYA 1YLWA 5FQ9A 3I7JA 4IBXA 1TVFA 2XLNA 4WM9A 3NULA 3RXXA 4WELA 1IKIA 1XFQA 1YQSA 3LIBA 3UB6A 2PDRA 1PZPA 1MY8A 4X55A 2IWDA 1VB6A 4WUJA 5DTKA 5G4YA 4KQQA 1H8MA 3HLCA 1MC0A 2QKPA 3UB9A 2H28A 4N9KA 3ZNYA 5FASA 1Y28A 5EM0A 1ONHA 2GDNA 2EWWA 4UQIM 4BENA 2RCXA 4H6JB 5K5BA 5CX7A 2Q0OA 3LY3A 4L9EA 3ZVWA 3HCYA 4B88A 4EEPA 4OLGA 2XROA 5CHUA 3MQQA 5KSCA 2IWBA 1GSVA 4JGOA 4LV2A 4K0WA 4NXGA 1MWUA 3AGEA 3IS2A 4JKTA 3DTKA 5U47A 1KVLA 2WKPA 1TD5A 1BTLA 1U60A 2ZC3B 4OPRA 4G3KA 1YSPA 1NYMA 4E3NA 4DJ3A 3WRTA 1H3QA 3FPVA 2DRWA 4Z9QA 2EX8A 1ZHHB 3PAGA 5AQBA 2XGNA 2WKQA 4OQHA 3FPWA 4OPZA 4HJ4A 3IT9A 3E4OA 2Y4AA 2WYXA 4ZAMA 2XEPA 3D4FA 3ULFA 2JKRI 4UA6A 2FZ0A 3DWZA 1CQAA 2YKFA 5F83A 4XT2B 2WADA 4Y0OA 1L0EA 4HJ3A 4YOFA 4DXCA 4HP9A 1MXOA 2P74A 4ZJ3A 3HLDA 4Y0UA 2JC7A 4ZRRA 4FSFA 5CGSA 2Q9NA 2KOIA 2EFXA 1E4DA 2HDUA 2Z2LB 3V50A 1T1AA 3ZG5A 3S1YA 4E6WA 4BL3A 5GLCA 3UO9A 5A92A 1L0GA 3A0VA 4MN6A 3T4QA 1RGYA 1HZOA 3C7VA 4QHCA 4N1HA 4BBUA 1N9LA 4R23A 3K2NA 1ES2A 3WS2A 1Y54A 2OLUA 4S2KA 5EV0A 1XA7A 2V2FF 2WKHA 4GS9A 2QYBA 4GD8A 4LGWA 3FC7A 5DVAA 4IVIA 1G68A 3HVFA 3WRZA 4NXBA 1K0KA 5HDSA 3VP1A 5M19A 3SH8A 3S7QA 3CLOA 2ZQAA 4E3LA 2B95A 2W1TB 1CEGA 4OVDA 3HLBA 4EBNA 1W63Q 2K7SA 3NC8A 1A0KA 2C5WB 3HLFA 4UAAA 1H5XA 3SS5A 3T50A 5CGWA 3BWLA 4ETZA 3OZHA 4L0LA 3GMWA 2D02A 3IXGA 5HD3A 5L2FA 1XX2A 1X0OA 3Q82A 3MS6A 4GHIB 2BG1A 5KMWA 4WEJA 5TGFA 1P0ZA 1ERQA 1IFQA 4B9OA 5J3WA 4EEUA 3CHWP 3MFXA 3HL9A 3T1SA 1T19A 1TS0A 3WS1A 3A3EA 5EPHA 4KG5A 3IWOA 1M40A 5F69A 3VV4A 2VGJA 1K57C 4OONA 3CUEC 3UDIA 3AGFA 1GHIA 3G4PA 3R7WB 4ZJ1A 2X01A 3T4KA 4OLDA 4KZ6A 4L9FA 2VLGA 2PYPA 4KUOA 4MCWA 4X6TA 2Y91A 5L07A 5HWVA 3MMHA 1MWTA 4WZ5C 3H9WA 2GX5A 2VV8A 3UE1A 4UQIS 1W7FA 5HW3A 1NYYA 3DTIA 4OOYA 5FI7A 2V1AA 1OT9A 1IELA 1PWDA 3S7PA 5EVEA 1MKIA 3QP6A 3BYDA 2VGLS 2XQZA 2HF6A 3IHBA 4IVKA 3LY4A 2ZC6B 3H82B 1V9ZA 3IF5A 2ZMAA 4QWOA 1DJCA 3VP4A 1PYYA 2W3GA 4RX3A 4C75A 4KG6A 2Y55A 3S22A 3LYXA 4X1MA 1XJ6A 1K54A 1SKFA 1DJAA 3Q7VA 2Q9MA 3ZFZA 1NJ4A 1RGZA 5HARA 1S4RA 3VSKA 3MF0A 4S2NA 3JYIA 3SH7A 3O3VA 5HL6A 3LI9A 3VFHA 3VP2A 2GZAA 2PU2A 4FH4A 3K3CA 4EQ1A 5FQJA 2W3HA 2J8YA 1M6KA 3M6HA 2ZL1A 4LV0A 1YMXA 1KVMA 3DW0A 1LSXA 2X02A 1MWRA 4CLCD 3OBFA 3HUMA 1QMEA 3LICA 5I5LA 1E3UD 3A0SA 4BBTA 2J3TD 3NBLA 1Z09A 3ZDJA 1ES5A 2R78A 4PM8A 3MFDA 4LCMA 3HLWA 4QU3A 4PMAA 2XD1A 5MC7A 2K31A 1WA9A 2R9WA 2V20A 5CHMA 3IF6B 1S6RA 3KYZA 3NDEA 3UPOA 2ZM2A 3GVBA 3IXHA 2B5RA 2PRFA 4R1GA 1G5UA 4EETB 3JPUA 5TJJA 3C38A 5DTSA 5IS1A 5FSRA 1XP4A 4LRYC 4RX2A 2GJ3A 3LIDA 3OPRA 3BJNA 2QMIA 3P01A 3UMEA 1TS8A 2ZM0A 4HQAA 2WGWA 5L09A 2WAEA 2NUTC 1T18A 4DKIA 2PU4A 1GA0A 1WYCA 4CPKA 5CEDA 1SZVA 4KG2A 3VFFA 3Q7VB 1LT0A 3PTEA 1CF0A 3QNBA 3MR0A 5FEGA 2GNXA 4WZ4A 5HD5A 4A5RA 2Y59A 1L0FA 2Y2IA 2W3FA 2ZC4B 3ITAA 3W8KA 4KZBA 4RQ9A 1PNEA 3QP8A 5FAQA 5E2HA 2L4RA 4WLAA 2XFTA 4RYEA 3ZNTA 3TG9A 5DF7A 1K4FA 1P97A 2I72A 1CJFA 1K25A 3NOUC 4LPZA 1YSQA 2KX6A 3LCEA 5A8BA 3M6BA 4JLFA 4GW9A 2Y2QA 3P7NA 4BLMA 3PBOA 5FA7A 3W2ZA 3KSFA 4PM5A 4U0TA 3DBAA 2Y2MA 1MKMA 1CI8A 4UEYA 1IYSA 4R38A 3VMAA 3HUOA 1TDGA 1JWVA 3VE4A 4Z1WA 2FH5A 4GCZA 3OPPA 2JBFA 4MMNA 4CQHA 4LLOB 4Y13A 3BRMA 3VOLA 4IEDA 2B02A 1LI9A 3CMZA 4ZDXA 2A24B 4K91A 5HL1A 2ZOIA 3BFGA 3HLGA 3IF6A 1YMSA 2ZD8A 5EOEA 3BFEA 4NK3A 2A2LA 3RTYA 1L0DA 3KO6A 4B4ZA 1PI4A 5AJGA 4F3LB 4AFIA 4PHTA 2WUQA 1VM1A 3F1PA 1UGUA 1YPRA 3MXRA 4BMWA 3HJKA 4OPYA 1PWGA 3NDGA 3UDFA 3WWXA 4PPRA 3N8SA 1V9YA 2ZL1B 2V1BA 2JCHA 3UPNA 1ACFA 3RFBA 5JYPA 3CI6A 1ONGA 2ZBBA 1L2SA 4P6ZM 1VEUB 4XXRA 1QMFA 3P09A 3ZG7B 1OMEA 2XD5A 2V0WA 3BM6A 4JGPA 4EUVA 2PD7A 4OOMA 4WEKA 5CHJA 3ZQ5A 2Y79A 5DKLA 4HP4A 4Y15A 3EQUA 1GSWA 1GSXA 3D72A 2M1CA 2W1RA 3CPTA 2OAQ1 2ZQ8A 1GCEA 1Q2QA 3CWFA 4LRZE 4FUWA 4GJ4A 4P6ZS 4NXFA 2O9AA 3HREA 1K6RA 5D3OA 2Y2NA 1OTEA 2EXAA 4R4RA 1N4OA 2J3TC 2ZMFA 3UB5P 3LEZA 3MXQA 3OOVA 4MBKA 5J4EA 3V39A 1KGEA 4B4XA 4X56A 2XF3A 4WF0A 1HVBA 4M4XA 4QY5A 1GHMA 2EA9A 4HIAA 4MDZA 3M2KA 1VEUA 1Z6FA 1LL8A 3ZVTA 4KZ5A 4EV4A 4EUZA 3RH8B 4R0QA 1N9NA 4DJ2A 5EVIB 4JXWA 4S2LA 5DKKA 3UE0A 1SDNA 3IHAA 2VKSA 3N6IA 2ACGA 2EFUA 1STZA 2KLIA 5IT5A 4DE2A 1NZUA 5HPIA 1PZOA 1C3BA 3CUEA 1XGJA 4P0MA 1SCWA 1S1ZA 4ID4A 4Y0TA 1VETB 2WGIA 3NOTC 2BTFP 5AQ7A 2L0WA 2V8FA 2ZOHA 1H8ZA 1PIOA 4ETXA 4BL2A 3T4SA 3PBNA 4OQ0A 5GLBA 4Q0JA 3GV9A 4U3TA 4N92A 4OQGA 4DN0A 3NOPC 3IH9A 3UNWA 5HSQA 1K55C 1JTDA 4BQMA 1BULA 1ZTUA 1F2KA 2W1TA 3RXWA 4JGRA 5E2EA 1LL9A 1FIKA 5AQ9A 1J9MA 1JVJA 4GNUA 2XA7M 2O9BA 2HJ9C 3ZG8B 1PW1A 1O07A 1YLTA 2ZQ9A 1MBLA 4GS9B 2CC1A 1RCJA 3G30A 4I3JA 3UB8A 1K54C 1FQGA 2RL3A 4GKUA 1YAXA 1ZG4A 4L9GA 1YT4A 1OT6A 5HDCA 2PT7A 2WZZA 4RVAA 4ARZA 1TDLA 4GLQA 1NZOA 5L10A 2XH9A 1SKOB 2JN7A 4R3AA 2PAVP 3L7HA 3T4OA 1JWZA 4ESPA 1IYPA 4DDSA 3F1NB 5EFWA 3ZG9B 3NY4A 4F94A 1LSVA 2BASA 2INWA 3S4XA 5A93A 2VA0A 2VGLM 1FCMA 1VQQA 2PR6A 5HX9A 2XSSA 3N8RA 2OV5A 4KZ7A 1CEFA 3G32A 5C5KA 1ZC2A 1WE4A 3WS5A 3G2ZA 5J7EA 4PAUA 5CRFA 4PM9A 1G6AA 3H7WB 1KE0A 1VETA 2JKFA 5TBMB 2WGWB 1AWIA 2JKTI 2UV0E 4IHQA 4E04A 2P04A 2E8IA 4KQDA 4X68A 4YFMA 3BEBA 4CLCA 2HDRA 3KYQA 3BFCA 4II7A 1D06A 3A3FA 4DRTA 4GB7A 4JXVA 3TE8A 3IS2B 3Q07A 1BYWA 4CJNA 3QP4A 1K57A 4HH3A 3CITA 4FTXA 4GZBA 3BW6A 1JWPA 2ZC7A 3GDIA 5F1FA 3VOZA 1W8QA 5M18A 5FAOA 1BLSA 1S0WA 3SZTA 5FI6A 2NUPC 2ZJ9A 1TS7A 1KDSA 5GLDA 4WZ5A 1ESIA 1O7EA 2HJEA 3SS3A 3A3DA 5FQQA 5DTTA 4GDBA 4O7DA
chains in the Genus database with same CATH topology
4O0PA 1P9RA 2XROA 3LFVA 3NOUC 4LPZA 4BBVA 1YSQA 2KX6A 3MQQA 1OTIA 5A8BA 1VHMA 4GW9A 3P7NA 3PBOA 3W2ZA 3KSFA 1GSVA 2DMWA 2W3EA 4JGOA 4KQOA 3DBAA 3PXPA 4NXGA 3EQVA 3BQAA 1MKMA 3D3OA 3IS2A 1S4SA 2QJ5A 4UEYA 3V67A 2OWHA 4R38A 2WKPA 4MN5A 5AVFA 3VE4A 1TD5A 4ARZB 4R70A 5DFYA 2HV1A 4G3KA 3T4JA 1YSPA 2FH5A 4GCZA 4Z1WA 3JVVA 2PD8A 4DJ3A 4MMNA 1EW0A 1DP6A 3TW8A 4CQHA 1H3QA 4LLOB 3UE3A 4OOLA 3FPVA 3H82A 3VOLA 3PBQA 2B02A 2VV6A 2V9AA 3UMDA 1ZHHB 3BQ8A 2WKQA 2W27A 2A24B 4PKYA 2M7VA 3FPWA 4HHDA 4HJ4A 3NJAA 2O9CA 2ZOIA 3E4OA 4QPRA 3GECA 3ZYTA 1NRJA 1S67L 3F1OA 3ULFA 2JKRI 2A2LA 3RTYA 3KO6A 2FZ0A 2YKFA 3JVUA 3A0RA 4XT2B 3EEAA 1YKDA 2VV7A 3MJQA 4NXEA 4BWIA 5DJUA 2LB5A 4HJ3A 4G3VA 2O0YA 4YOFA 3B33A 5AJGA 3LUQA 4HP9A 3TJZC 4HJ6A 5HWTA 1OTBA 4WL9A 4F3LB 5LBRA 4AFIA 4PHTA 4EU0A 3B42A 1UGUA 3F1PA 4ZRRA 4FSFA 4BMWA 3HJKA 2KOIA 1UWNX 1V9YA 2OWJA 1T1AA 4R6LA 2V1BA 3CAXA 2WKRA 3RFBA 2L1MA 3CI6A 3G6OA 4KUKA 3A0VA 2ZBBA 4MN6A 4P6ZM 3T4QA 1IOUA 4BBUA 1OJGA 5AVEA 1N9LA 4K08A 2V0WA 3MQOA 3K2NA 4JGPA 4EUVA 2PD7A 4OOMA 4WEKA 3ZQ5A 2Y79A 5DKLA 4LRXC 4HP4A 3EQUA 1G6OA 1GSWA 1GSXA 3D72A 4GS9A 3KSIA 2QYBA 4CLCC 4I3IA 1MZUA 3FC7A 5F6AA 2M1CA 2QHKA 2W1RA 2OAQ1 4NXBA 4WN5A 5HDSA 3U2AA 3HJIA 2VX8A 3CWFA 4LRZE 3S7QA 2ZMVA 4GJ4A 4P6ZS 4Y2FA 2KDKA 2J80A 3CLOA 4NXFA 2O9AA 2W1TB 4ME4A 2XA7S 4Q0IA 2PYRA 3EGDC 1W63Q 2K7SA 1OTEA 3F1OB 3O5YA 3E4PA 1F98A 3PR6A 2J3TC 2Y8HA 5KSHA 2ZMFA 4I38A 3T50A 3EEHA 4EXOA 3MXQA 3OOVA 5J4EA 2W3DA 3BWLA 4ETZA 1KOUA 1XFNA 1OJ5A 4L0LA 2OOLA 2D02A 1TF1A 1F5MA 3B47A 5HD3A 4O01A 4WF0A 4EERA 2MJ6A 4NEED 3IBRA 4M4XA 1X0OA 3LIEA 2VJWA 4I5SA 5G4ZA 3LR0A 4G3WA 4GHIB 2EA9A 4HIAA 5F68A 4HNBA 4MDZA 1F9IA 4NKPA 4WEJA 1P0ZA 1IFQA 4B9OA 5J3WA 2JKRM 1LL8A 4EEUA 3EWKA 3K3DA 3TRCA 3MFXA 3RH8B 3C2WA 1T19A 4YWZA 1TS0A 1N9NA 4DJ2A 4DMZA 2HGVA 2XRNA 5DKKA 2QJ7A 2CMNA 1P9WA 4IUKA 3EGXC 2VKSA 5F69A 3VV4A 1STZA 2G7UA 2KLIA 5FL3A 3VE3A 2VEAA 5IT5A 3CUEC 4HOIA 3UE6A 3MQ0A 3R7WB 3T4KA 4EW7A 1W63M 1T1CA 3LI8A 4L9FA 5HPIA 2VLGA 2P08A 3E4QA 3CUEA 2PYPA 4KUOA 1XJ2A 3T4TA 4MCWA 1S1ZA 4IUHA 4XT2A 1UWPX 5HWVA 3MMHA 3NOTC 2L0WA 3E0YA 3H9WA 2GX5A 2PHYA 2VV8A 2ZOHA 5HZHA 3KX0X 4UQIS 4ETXA 3F1PB 3T4SA 2JHEA 4PKYG 4F3LA 3PBNA 2PR5A 4Q0JA 2V1AA 1OT9A 3PBRA 4HY8A 3S7PA 3LR4A 2EWVA 4DN0A 3NOPC 2VGLS 5HSQA 2M7UA 5DFXA 5KIZA 2HF6A 5DJTA 1ZTUA 2J3WA 2W1TA 4JGRA 2B18A 3S7NA 3S7OA 3H82B 1V9ZA 3PYPA 3FG8A 2W3GA 3OCLA 2XA7M 3LIFA 2O9BA 2HJ9C 4BJPA 3T4LA 3IBJA 3LYXA 1G28A 1XJ6A 1NWZA 1N9OA 1XJ4A 1OTAA 4GS9B 4I3JA 3UB8A 3OCNA 5HPFA 2V0UA 1S4RA 1YAXA 4CLCB 3OLOA 4L9GA 3MF0A 4I3AA 1LSWA 2A24A 1DP8A 3KSHA 2LB9A 1OT6A 5TBMA 3E98A 3C8CA 5HL6A 5HDCA 3LI9A 1DP9A 2PT7A 2GZAA 2OAP1 3K3CA 4EQ1A 4ARZA 4GLQA 2O99A 4O8GA 2W3HA 3LR5A 2Z6CA 1T1BA 2JN7A 4R3AA 2QWSA 1LSXA 4HI4A 4Y5FA 3H7WA 4EESA 3T4OA 4CLCD 3OBFA 1OTDA 1XJ3A 2Z6DA 3EOIA 3LICA 3C30A 3F1NB 5I5LA 5EFWA 3A0SA 1DRMA 5F5YA 1NLYA 4BBTA 2J3TD 5DF9A 1LSVA 5HWWA 1NLZA 3PBSA 2BASA 2INWA 3F1NA 2R78A 2VA0A 2VGLM 4FOFA 2PR6A 2YKHA 4I39A 3BY9A 5MC7A 4JGQA 2XSSA 4H6JA 2K31A 1WA9A 3SW1A 1ODVA 5C5KA 3KYZA 3LR3A 2IA2A 5J7EA 4PAUA 3NHQA 1JNUA 4IJGA 3H7WB 2JKTM 3UB7A 4EETB 2W0NA 2I9VA 5TJJA 3C38A 3LIAA 5TBMB 5IS1A 4HH2A 2JKTI 4LRYC 2K2NA 4IHQA 4MN7A 4Q0HA 4E04A 2P04A 3KSGA 3R4KA 2GJ3A 3LIDA 4Y3IA 1S66L 3BJNA 3P01A 3UMEA 3R7WA 1TS8A 4KQDA 4HQAA 5HDDA 4B93A 4CLCA 2NUTC 3PHYA 1T18A 3KYQA 4II7A 1D06A 4WELA 1XFQA 3TE8A 3LIBA 3IS2B 2P7JA 3UB6A 2PDRA 3BY8A 1BYWA 5L8MA 2VZWA 4CLCE 1LT0A 3MR0A 4HH3A 2GNXA 3CITA 3PBTA 4WUJA 1VB6A 3BW6A 5G4YA 5HD5A 4GHIA 1H8MA 3GDIA 1MC0A 2QKPA 3UB9A 2H28A 1D7EA 1Y28A 2W3FA 3OC2A 5IU1A 4RQ9A 2D01A 1TS6A 4YNRA 2NUPC 1TS7A 1OPXA 2L4RA 4WLAA 2EWWA 4UQIM 4H6JB 5K5BA 5CX7A 2HJEA 1S1YA 4L9EA 1P97A 3HCYA 3ICYA 4EEPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LIC A;  4HOI A;  3CAX A;  3F1N B;  5I5L A;  3UE6 A;  5EFW A;  2WKR A;  3A0S A;  3NOU C;  1DRM A;  4LPZ A;  5F5Y A;  4BBV A;  4EW7 A;  2L1M A;  4BBT A;  2KX6 A;  4KUK A;  3G6O A;  1T1C A;  3A0V A;  2ZBB A;  1OTI A;  3LI8 A;  3MQQ A;  4L9F A;  4MN6 A;  5A8B A;  1LSV A;  5HWW A;  2VLG A;  3E4Q A;  4GW9 A;  3P7N A;  2BAS A;  4BBU A;  1OJG A;  2INW A;  3F1N A;  2PYP A;  4KUO A;  1XJ2 A;  5AVE A;  1N9L A;  1GSV A;  2R78 A;  4K08 A;  4JGO A;  2V0W A;  1S1Z A;  3MQO A;  4JGP A;  2PR6 A;  4XT2 A;  1UWP X;  2PD7 A;  2YKH A;  4I39 A;  5HWV A;  3BY9 A;  3NOT C;  4JGQ A;  4NXG A;  2L0W A;  5DKL A;  3ZQ5 A;  4H6J A;  4LRX C;  4HP4 A;  3H9W A;  3IS2 A;  2PHY A;  1S4S A;  1WA9 A;  2VV8 A;  2ZOH A;  5HZH A;  1GSW A;  2QJ5 A;  3KX0 X;  1GSX A;  3D72 A;  4GS9 A;  3SW1 A;  1ODV A;  2OWH A;  4R38 A;  4I3I A;  1MZU A;  3F1P B;  3FC7 A;  5F6A A;  2JHE A;  2WKP A;  4MN5 A;  2M1C A;  4PKY G;  5AVF A;  3VE4 A;  4B9O A;  2QHK A;  4R70 A;  4F3L A;  5J7E A;  3NHQ A;  2PR5 A;  2HV1 A;  1JNU A;  3H7W B;  2V1A A;  3UB7 A;  4EET B;  1OT9 A;  4NXB A;  4GCZ A;  2W0N A;  4HY8 A;  4WN5 A;  2I9V A;  2PD8 A;  3LIA A;  5HDS A;  5TBM B;  3HJI A;  4DJ3 A;  5IS1 A;  4HH2 A;  1EW0 A;  1DP6 A;  3CWF A;  4LRZ E;  4LLO B;  3NOP C;  4LRY C;  5HSQ A;  2KDK A;  2J80 A;  3CLO A;  4NXF A;  4E04 A;  5DJT A;  3H82 A;  3VOL A;  5KIZ A;  2GJ3 A;  4JGR A;  2B02 A;  3LID A;  1S66 L;  2VV6 A;  1V9Z A;  2PYR A;  2V9A A;  3H82 B;  3PYP A;  3UME A;  3UMD A;  2K7S A;  3FG8 A;  1OTE A;  1TS8 A;  4KQD A;  3F1O B;  3E4P A;  4HQA A;  1F98 A;  2WKQ A;  2W27 A;  5HDD A;  2A24 B;  4PKY A;  3LIF A;  4HHD A;  3PHY A;  4I38 A;  4HJ4 A;  3NJA A;  3T50 A;  1T18 A;  3EEH A;  4EXO A;  2ZOI A;  3E4O A;  3LYX A;  1G28 A;  3MXQ A;  1XJ6 A;  1D06 A;  5J4E A;  3GEC A;  3BWL A;  1KOU A;  1XFN A;  1OJ5 A;  1S67 L;  1NWZ A;  1N9O A;  1XJ4 A;  3F1O A;  1OTA A;  2OOL A;  4GS9 B;  3ULF A;  1XFQ A;  2D02 A;  3RTY A;  3LIB A;  4I3J A;  3IS2 B;  5HD3 A;  2P7J A;  3UB6 A;  2PDR A;  3BY8 A;  1BYW A;  4WF0 A;  2YKF A;  3UB8 A;  3IBR A;  4M4X A;  4EER A;  1X0O A;  2V0U A;  1LT0 A;  3A0R A;  3LIE A;  3MR0 A;  1S4R A;  4HH3 A;  4XT2 B;  4I5S A;  3OLO A;  4WUJ A;  1VB6 A;  2VV7 A;  4L9G A;  4GHI B;  2EA9 A;  4I3A A;  1LSW A;  2A24 A;  1DP8 A;  3MJQ A;  4NXE A;  5G4Z A;  1OT6 A;  5TBM A;  5DJU A;  5G4Y A;  5HD5 A;  4HIA A;  4HJ3 A;  4GHI A;  4HNB A;  3C8C A;  1F9I A;  5F68 A;  5HDC A;  3B33 A;  3LI9 A;  3GDI A;  1DP9 A;  1P0Z A;  2QKP A;  3LUQ A;  4HP9 A;  4HJ6 A;  5J3W A;  1LL8 A;  5HWT A;  1OTB A;  2H28 A;  3EWK A;  3UB9 A;  4EEU A;  3K3D A;  1D7E A;  4WL9 A;  3K3C A;  1Y28 A;  4EQ1 A;  4F3L B;  3MFX A;  3RH8 B;  3C2W A;  1T19 A;  4YWZ A;  1TS0 A;  1N9N A;  1UGU A;  2D01 A;  3F1P A;  1TS6 A;  4RQ9 A;  5IU1 A;  2Z6C A;  4DJ2 A;  1T1B A;  1TS7 A;  2JN7 A;  2QJ7 A;  3HJK A;  4R3A A;  5DKK A;  2CMN A;  2L4R A;  4WLA A;  4H6J B;  2QWS A;  1LSX A;  1S1Y A;  1UWN X;  4HI4 A;  3H7W A;  5F69 A;  4EES A;  4L9E A;  1P97 A;  4R6L A;  1V9Y A;  1OTD A;  1XJ3 A;  2OWJ A;  3ICY A;  3VE3 A;  1T1A A;  2Z6D A;  4EEP A;  2VEA A;  2V1B A; 
#chains in the Genus database with same CATH topology
 4O0P A;  1P9R A;  3LFV A;  4BBV A;  1IEM A;  1NRF A;  1VHM A;  2DMW A;  2W3E A;  5G18 A;  3VSL A;  4KQO A;  3C7U A;  2H0T A;  4KZ4 A;  3PXP A;  5FAP A;  3BQA A;  3CPT B;  1XPB A;  2QJ5 A;  4JBF A;  4MN5 A;  5AVF A;  1Y4O A;  4R70 A;  5DFY A;  4ARZ B;  5CGX A;  2PBD P;  4EQI A;  2PD8 A;  3GSG A;  1DP6 A;  1EW0 A;  3TW8 A;  3UE3 A;  1K56 D;  4OOL A;  1BLH A;  1E25 A;  3H82 A;  2V8C A;  1LLB A;  3PBQ A;  3IH8 A;  2VV6 A;  2BLS A;  3QHY A;  4JPM A;  3UMD A;  3BQ8 A;  4S2M A;  2W27 A;  1YM1 A;  4K0X A;  3UY6 A;  2OLV A;  2WKI A;  4D60 A;  2O9C A;  3M2J A;  4QPR A;  3ZYT A;  3VP3 A;  1NRJ A;  2P9V A;  3F1O A;  1HLU P;  5EUA A;  1FCO A;  2E8J A;  2ZM8 A;  2Y2J A;  3JVU A;  5FDS A;  3MKF A;  3EEA A;  1YKD A;  3C4O A;  3IF6 C;  2VV7 A;  3MJQ A;  2UWX A;  1IKG A;  5DJU A;  2LB5 A;  4G3V A;  3B33 A;  3TJZ C;  1YLP A;  4HJ6 A;  5HWT A;  4E3O A;  4WL9 A;  5LBR A;  4QD4 A;  3B42 A;  1CI9 A;  1UWN X;  2EX2 A;  2WAF A;  1J3W A;  4X53 A;  3MSH A;  4R6L A;  3CAX A;  3N4I A;  4GOG A;  3QP5 A;  4HBU A;  5AVE A;  4K08 A;  3MQO A;  4GDN A;  4R4S A;  3ITB A;  5I94 A;  3O88 A;  4P85 A;  4DE0 A;  3KSI A;  4PM7 A;  1MZU A;  3UDX A;  1YLJ A;  5JYO A;  2OSU A;  2QHK A;  1ALQ A;  4OH0 A;  3GR2 A;  1BLC A;  3U2A A;  3HLE A;  2J7V A;  2ZMV A;  1HTZ A;  5E43 A;  4ME4 A;  4Q0I A;  4HEF A;  3F1O B;  5EVI D;  2ZLY A;  1F98 A;  3PR6 A;  4DXB A;  5KSH A;  4I38 A;  5BOH A;  3V3R A;  3EEH A;  4EXO A;  1ERM A;  2W3D A;  1KOU A;  1OJ5 A;  4KEN B;  1TF1 A;  3B47 A;  1RP5 A;  5CXW A;  4O01 A;  4NEE D;  3IBR A;  4P6B A;  3MBZ A;  2VJW A;  4I5S A;  3LR0 A;  4G3W A;  4NG2 A;  3ZHH A;  2ZQC A;  2R9X A;  5F68 A;  4HBT A;  4HNB A;  4GN2 A;  4S2P A;  3K3D A;  5F1G A;  1I2S A;  1FSY A;  3TRC A;  3C2W A;  4YWZ A;  4H8R A;  5CER A;  3OPL A;  1P9W A;  4IUK A;  4S2I A;  2Y2L A;  5EM1 A;  2G7U A;  3E2K A;  5FL3 A;  1JTG A;  4HOI A;  1BUE A;  2WZX A;  3OPH A;  4EW7 A;  3QNC A;  4DF6 A;  1T1C A;  3G31 A;  4N1X A;  5FEF A;  2HPB A;  1PFL A;  1XJ2 A;  3Q7Z A;  4IUH A;  4XT2 A;  1GA9 A;  4E3K A;  2QZ6 A;  5FQI A;  1FOF A;  3KX0 X;  2IWC A;  3N8L A;  3F1P B;  2JHE A;  4FCF A;  4PKY G;  3WS4 A;  4F3L A;  1DJB A;  2EXB A;  3PBR A;  4HY8 A;  3MZD A;  1BZA A;  1PRQ A;  3LR4 A;  2AVX A;  2EWV A;  4BD0 A;  2M7U A;  4NET A;  5KIZ A;  5DJT A;  3IX8 A;  3IQA A;  1IYO A;  5HAQ A;  3S7N A;  3S7O A;  3FG8 A;  5F82 A;  3WS0 A;  4MEZ A;  4KZ9 A;  1K55 A;  4BJP A;  1KDW A;  4R3B A;  3IBJ A;  5CEC A;  1FR6 A;  1NWZ A;  5FAT A;  1OTA A;  3BLM A;  1LL5 A;  1KE4 A;  4LFU A;  1YLZ A;  5HPF A;  1XA1 A;  3O86 A;  4I3A A;  1LSW A;  3KSH A;  2LB9 A;  5TBM A;  1ESU A;  3E98 A;  1DP9 A;  3D9Y A;  2A3U A;  1XXM A;  2OAP 1;  2O99 A;  4O8G A;  3MKE A;  1BSG A;  3IX3 A;  1AXB A;  1GHP A;  2DNS A;  4EWF A;  5GHX A;  2QWS A;  5J8X A;  4HI4 A;  4ZTK A;  1XJ3 A;  3FKV A;  3EOI A;  4LV1 A;  2Y2P A;  3C30 A;  2FFF B;  1BT5 A;  1K4E A;  2Y2K A;  5AQA A;  5HWW A;  1NLZ A;  3PBS A;  3ZCZ A;  3F1N A;  1KE3 A;  5CTM A;  2Y2G A;  4LV3 A;  3GTC A;  1NXY A;  4FOF A;  1W79 A;  2YKH A;  3A3I A;  5M1A A;  3BY9 A;  3DWK A;  4JGQ A;  3PAE A;  4QJG A;  2H0Y A;  4P87 A;  5A91 A;  3VOY A;  3T12 B;  3LR3 A;  2IA2 A;  3NHQ A;  1JNU A;  4IJG A;  3UB7 A;  1EI5 A;  1TEM A;  4HH2 A;  3E2L A;  4OQI A;  3FWL A;  3TOI A;  4MN7 A;  3KSG A;  4X25 A;  4D2O A;  4Y3I A;  3GQZ A;  4S2N C;  3IXB A;  1E3U A;  3R7W A;  3FYZ A;  1ES3 A;  3CJM A;  4B93 A;  5GLA A;  4OP5 A;  4N9L A;  3LGO A;  2PBY A;  1KGF A;  1SHV A;  2P7J A;  3BY8 A;  5L8M A;  2VZW A;  2Z2M B;  5EEC A;  4CLC E;  3PBT A;  3DTM A;  4GHI A;  3UPP A;  4XUZ A;  3P98 A;  2VK3 A;  1D7E A;  4KQR A;  3VP0 A;  4PM6 A;  5E2G A;  3OC2 A;  5IU1 A;  2D01 A;  1TS6 A;  4YNR A;  1OPX A;  3Q81 A;  3W4P A;  4Q8I A;  1S1Y A;  3ICY A;  3BFF A;  1ZKJ A;  2WKE A;  4X69 A;  3G2Y A;  1Q2P A;  1OTI A;  3IWI A;  3DTE A;  1K6S A;  4OPQ A;  2H10 A;  1D1J A;  5HFO A;  3A3J A;  4UA9 A;  5DF8 A;  4YIN A;  3EQV A;  3D3O A;  1IYQ A;  1S4S A;  4WYY A;  5FQM A;  3V67 A;  2OWH A;  3ZGA B;  3FKW A;  3NI9 A;  4C3Q A;  1HD8 A;  5EVI C;  4QY6 A;  2HV1 A;  3T4J A;  3JVV A;  3B3X A;  2ZC5 B;  2V1Z A;  2XR0 A;  1YLY A;  3N7W A;  2V9A A;  4BD1 A;  3W4Q A;  4LEN A;  3RJU A;  2HP5 A;  4PKY A;  2M7V A;  4HHD A;  4E6X A;  1MPL A;  3NJA A;  5E2F A;  5FDH A;  2X71 A;  3GEC A;  1W8Y A;  3T1Q B;  1S67 L;  1MWS A;  4U0X A;  5CEB A;  3TSG A;  5KZH A;  3A0R A;  3QP2 A;  4NXE A;  4BWI A;  4IBR A;  4WMC A;  2O0Y A;  1XKZ A;  4ZBE A;  3LUQ A;  2EX6 A;  3FV7 A;  1OTB A;  3C4P A;  4EU0 A;  1ES4 A;  5EVL A;  3HUN A;  2ZQD A;  3G34 A;  3UN7 A;  2OWJ A;  2XDM A;  3SH9 A;  1N9B A;  3BEC A;  5IHV A;  5A90 A;  4E3I A;  1CK3 A;  4UA7 A;  2WKR A;  4R3J A;  2L1M A;  4KUK A;  3G6O A;  2VGK A;  2QPN A;  1IOU A;  2Y2O A;  3Q1F A;  2A49 A;  3T1R A;  1OJG A;  3C5A A;  3BFD A;  3MXS A;  1I2W A;  3MZE A;  4LRX C;  4DE3 A;  5HAI A;  1G6O A;  5EE8 A;  1FSW A;  1PI5 A;  4CLC C;  4I3I A;  5F6A A;  4MBH A;  4S2O A;  1ZG6 A;  2XFS A;  3QP1 A;  3GRJ A;  2FFY A;  4WN5 A;  3HJI A;  2VX8 A;  4DDY A;  5EVI A;  4ZJ2 A;  4Y2F A;  1DY6 A;  2KDK A;  2J80 A;  1LHY A;  2XA7 S;  3AGD A;  2PYR A;  4MNR A;  3EGD C;  3L9K A;  2EX9 A;  3O5Y A;  1K38 A;  3E4P A;  4JF4 A;  2Y8H A;  5GHY A;  4XUX A;  3BLS A;  5HAP A;  3LEQ A;  5FI2 A;  1XFN A;  2WK0 A;  3IWQ A;  2P9V B;  4JF6 A;  1I5Q A;  2OOL A;  1F5M A;  4EER A;  2MJ6 A;  4QB8 A;  4WBG A;  4DE1 A;  1NY0 A;  1WYB A;  2XK1 A;  3SOI A;  3LIE A;  2HP9 A;  3ISG A;  5G4Z A;  4WMC D;  4JXG A;  3MZF A;  2J9P A;  1XGI A;  4KZ8 A;  4NKP A;  4E3M A;  1F9I A;  3KYE A;  1W5D A;  2JKR M;  1H8Y A;  4M3K A;  3EWK A;  2C6W B;  2JE5 A;  5GL9 A;  4DMZ A;  5TR7 A;  2HGV A;  2XRN A;  2QJ7 A;  2CMN A;  3EGX C;  3VE3 A;  2VEA A;  3NEC A;  4E3J A;  3UE6 A;  3MQ0 A;  1W63 M;  3LI8 A;  4JXS A;  3V5M A;  2P08 A;  3E4Q A;  1SDE A;  1K56 A;  3T4T A;  4S2J A;  3CG5 A;  1UWP X;  3E0Y A;  2PHY A;  4KZA A;  5HZH A;  1FR1 A;  4GD6 A;  1EWZ A;  2PR5 A;  5TFQ A;  3HBR A;  3ZG0 A;  5DFX A;  2J3W A;  1PW8 A;  2ZQ7 A;  2B18 A;  4HES A;  3PYP A;  4KZ3 A;  5FQK A;  3OCL A;  3LIF A;  1BLP A;  3T4L A;  4EBL A;  1G28 A;  3DAV A;  4FH2 A;  3O87 A;  1N9O A;  1XJ4 A;  4LCL A;  2HDS A;  1L3L A;  3OCN A;  2V0U A;  4CLC B;  3OLO A;  4OP8 A;  3NCK A;  3G35 A;  2A24 A;  1DP8 A;  1FCN A;  4MBF A;  1H0M A;  5GHZ A;  3C8C A;  3T1X A;  1FIL A;  4X1L A;  2HP6 A;  3U4L P;  3FZC A;  3LR5 A;  3W4O A;  2Z6C A;  1LI0 A;  2HDQ A;  1T1B A;  4EBP A;  4Y5F A;  2G2W A;  3H7W A;  4EES A;  4JF5 A;  1OTD A;  1PWC A;  2Z6D A;  1DRM A;  2J9O A;  1NLY A;  5F5Y A;  2WGV A;  4UHU A;  5DF9 A;  3NIA A;  5CTN A;  3LO7 A;  3SS4 A;  4I39 A;  4H6J A;  2H5S A;  2HZ5 A;  3SW1 A;  1ODV A;  5EOO A;  4MLL A;  3CZD A;  2JKT M;  4Y17 A;  3V3S A;  4FD8 A;  2W0N A;  2I9V A;  3LIA A;  2DCF A;  3IX4 A;  2Y2H A;  1SKO A;  2K2N A;  4Q0H A;  4RA7 A;  3R4K A;  4Y7P A;  1ERO A;  3IXD A;  1S66 L;  4OKP A;  2G2U A;  4C6Y A;  5HDD A;  2JKG A;  1KGG A;  3PHY A;  1YLW A;  5FQ9 A;  3I7J A;  4IBX A;  1TVF A;  2XLN A;  4WM9 A;  3NUL A;  3RXX A;  4WEL A;  1IKI A;  1XFQ A;  1YQS A;  3LIB A;  3UB6 A;  2PDR A;  1PZP A;  1MY8 A;  4X55 A;  2IWD A;  1VB6 A;  4WUJ A;  5DTK A;  5G4Y A;  4KQQ A;  1H8M A;  3HLC A;  1MC0 A;  2QKP A;  3UB9 A;  2H28 A;  4N9K A;  3ZNY A;  5FAS A;  1Y28 A;  5EM0 A;  1ONH A;  2GDN A;  2EWW A;  4UQI M;  4BEN A;  2RCX A;  4H6J B;  5K5B A;  5CX7 A;  2Q0O A;  3LY3 A;  4L9E A;  3ZVW A;  3HCY A;  4B88 A;  4EEP A;  4OLG A;  2XRO A;  5CHU A;  3MQQ A;  5KSC A;  2IWB A;  1GSV A;  4JGO A;  4LV2 A;  4K0W A;  4NXG A;  1MWU A;  3AGE A;  3IS2 A;  4JKT A;  3DTK A;  5U47 A;  1KVL A;  2WKP A;  1TD5 A;  1BTL A;  1U60 A;  2ZC3 B;  4OPR A;  4G3K A;  1YSP A;  1NYM A;  4E3N A;  4DJ3 A;  3WRT A;  1H3Q A;  3FPV A;  2DRW A;  4Z9Q A;  2EX8 A;  1ZHH B;  3PAG A;  5AQB A;  2XGN A;  2WKQ A;  4OQH A;  3FPW A;  4OPZ A;  4HJ4 A;  3IT9 A;  3E4O A;  2Y4A A;  2WYX A;  4ZAM A;  2XEP A;  3D4F A;  3ULF A;  2JKR I;  4UA6 A;  2FZ0 A;  3DWZ A;  1CQA A;  2YKF A;  5F83 A;  4XT2 B;  2WAD A;  4Y0O A;  1L0E A;  4HJ3 A;  4YOF A;  4DXC A;  4HP9 A;  1MXO A;  2P74 A;  4ZJ3 A;  3HLD A;  4Y0U A;  2JC7 A;  4ZRR A;  4FSF A;  5CGS A;  2Q9N A;  2KOI A;  2EFX A;  1E4D A;  2HDU A;  2Z2L B;  3V50 A;  1T1A A;  3ZG5 A;  3S1Y A;  4E6W A;  4BL3 A;  5GLC A;  3UO9 A;  5A92 A;  1L0G A;  3A0V A;  4MN6 A;  3T4Q A;  1RGY A;  1HZO A;  3C7V A;  4QHC A;  4N1H A;  4BBU A;  1N9L A;  4R23 A;  3K2N A;  1ES2 A;  3WS2 A;  1Y54 A;  2OLU A;  4S2K A;  5EV0 A;  1XA7 A;  2V2F F;  2WKH A;  4GS9 A;  2QYB A;  4GD8 A;  4LGW A;  3FC7 A;  5DVA A;  4IVI A;  1G68 A;  3HVF A;  3WRZ A;  4NXB A;  1K0K A;  5HDS A;  3VP1 A;  5M19 A;  3SH8 A;  3S7Q A;  3CLO A;  2ZQA A;  4E3L A;  2B95 A;  2W1T B;  1CEG A;  4OVD A;  3HLB A;  4EBN A;  1W63 Q;  2K7S A;  3NC8 A;  1A0K A;  2C5W B;  3HLF A;  4UAA A;  1H5X A;  3SS5 A;  3T50 A;  5CGW A;  3BWL A;  4ETZ A;  3OZH A;  4L0L A;  3GMW A;  2D02 A;  3IXG A;  5HD3 A;  5L2F A;  1XX2 A;  1X0O A;  3Q82 A;  3MS6 A;  4GHI B;  2BG1 A;  5KMW A;  4WEJ A;  5TGF A;  1P0Z A;  1ERQ A;  1IFQ A;  4B9O A;  5J3W A;  4EEU A;  3CHW P;  3MFX A;  3HL9 A;  3T1S A;  1T19 A;  1TS0 A;  3WS1 A;  3A3E A;  5EPH A;  4KG5 A;  3IWO A;  1M40 A;  5F69 A;  3VV4 A;  2VGJ A;  1K57 C;  4OON A;  3CUE C;  3UDI A;  3AGF A;  1GHI A;  3G4P A;  3R7W B;  4ZJ1 A;  2X01 A;  3T4K A;  4OLD A;  4KZ6 A;  4L9F A;  2VLG A;  2PYP A;  4KUO A;  4MCW A;  4X6T A;  2Y91 A;  5L07 A;  5HWV A;  3MMH A;  1MWT A;  4WZ5 C;  3H9W A;  2GX5 A;  2VV8 A;  3UE1 A;  4UQI S;  1W7F A;  5HW3 A;  1NYY A;  3DTI A;  4OOY A;  5FI7 A;  2V1A A;  1OT9 A;  1IEL A;  1PWD A;  3S7P A;  5EVE A;  1MKI A;  3QP6 A;  3BYD A;  2VGL S;  2XQZ A;  2HF6 A;  3IHB A;  4IVK A;  3LY4 A;  2ZC6 B;  3H82 B;  1V9Z A;  3IF5 A;  2ZMA A;  4QWO A;  1DJC A;  3VP4 A;  1PYY A;  2W3G A;  4RX3 A;  4C75 A;  4KG6 A;  2Y55 A;  3S22 A;  3LYX A;  4X1M A;  1XJ6 A;  1K54 A;  1SKF A;  1DJA A;  3Q7V A;  2Q9M A;  3ZFZ A;  1NJ4 A;  1RGZ A;  5HAR A;  1S4R A;  3VSK A;  3MF0 A;  4S2N A;  3JYI A;  3SH7 A;  3O3V A;  5HL6 A;  3LI9 A;  3VFH A;  3VP2 A;  2GZA A;  2PU2 A;  4FH4 A;  3K3C A;  4EQ1 A;  5FQJ A;  2W3H A;  2J8Y A;  1M6K A;  3M6H A;  2ZL1 A;  4LV0 A;  1YMX A;  1KVM A;  3DW0 A;  1LSX A;  2X02 A;  1MWR A;  4CLC D;  3OBF A;  3HUM A;  1QME A;  3LIC A;  5I5L A;  1E3U D;  3A0S A;  4BBT A;  2J3T D;  3NBL A;  1Z09 A;  3ZDJ A;  1ES5 A;  2R78 A;  4PM8 A;  3MFD A;  4LCM A;  3HLW A;  4QU3 A;  4PMA A;  2XD1 A;  5MC7 A;  2K31 A;  1WA9 A;  2R9W A;  2V20 A;  5CHM A;  3IF6 B;  1S6R A;  3KYZ A;  3NDE A;  3UPO A;  2ZM2 A;  3GVB A;  3IXH A;  2B5R A;  2PRF A;  4R1G A;  1G5U A;  4EET B;  3JPU A;  5TJJ A;  3C38 A;  5DTS A;  5IS1 A;  5FSR A;  1XP4 A;  4LRY C;  4RX2 A;  2GJ3 A;  3LID A;  3OPR A;  3BJN A;  2QMI A;  3P01 A;  3UME A;  1TS8 A;  2ZM0 A;  4HQA A;  2WGW A;  5L09 A;  2WAE A;  2NUT C;  1T18 A;  4DKI A;  2PU4 A;  1GA0 A;  1WYC A;  4CPK A;  5CED A;  1SZV A;  4KG2 A;  3VFF A;  3Q7V B;  1LT0 A;  3PTE A;  1CF0 A;  3QNB A;  3MR0 A;  5FEG A;  2GNX A;  4WZ4 A;  5HD5 A;  4A5R A;  2Y59 A;  1L0F A;  2Y2I A;  2W3F A;  2ZC4 B;  3ITA A;  3W8K A;  4KZB A;  4RQ9 A;  1PNE A;  3QP8 A;  5FAQ A;  5E2H A;  2L4R A;  4WLA A;  2XFT A;  4RYE A;  3ZNT A;  3TG9 A;  5DF7 A;  1K4F A;  1P97 A;  2I72 A;  1CJF A;  1K25 A;  3NOU C;  4LPZ A;  1YSQ A;  2KX6 A;  3LCE A;  5A8B A;  3M6B A;  4JLF A;  4GW9 A;  2Y2Q A;  3P7N A;  4BLM A;  3PBO A;  5FA7 A;  3W2Z A;  3KSF A;  4PM5 A;  4U0T A;  3DBA A;  2Y2M A;  1MKM A;  1CI8 A;  4UEY A;  1IYS A;  4R38 A;  3VMA A;  3HUO A;  1TDG A;  1JWV A;  3VE4 A;  4Z1W A;  2FH5 A;  4GCZ A;  3OPP A;  2JBF A;  4MMN A;  4CQH A;  4LLO B;  4Y13 A;  3BRM A;  3VOL A;  4IED A;  2B02 A;  1LI9 A;  3CMZ A;  4ZDX A;  2A24 B;  4K91 A;  5HL1 A;  2ZOI A;  3BFG A;  3HLG A;  3IF6 A;  1YMS A;  2ZD8 A;  5EOE A;  3BFE A;  4NK3 A;  2A2L A;  3RTY A;  1L0D A;  3KO6 A;  4B4Z A;  1PI4 A;  5AJG A;  4F3L B;  4AFI A;  4PHT A;  2WUQ A;  1VM1 A;  3F1P A;  1UGU A;  1YPR A;  3MXR A;  4BMW A;  3HJK A;  4OPY A;  1PWG A;  3NDG A;  3UDF A;  3WWX A;  4PPR A;  3N8S A;  1V9Y A;  2ZL1 B;  2V1B A;  2JCH A;  3UPN A;  1ACF A;  3RFB A;  5JYP A;  3CI6 A;  1ONG A;  2ZBB A;  1L2S A;  4P6Z M;  1VEU B;  4XXR A;  1QMF A;  3P09 A;  3ZG7 B;  1OME A;  2XD5 A;  2V0W A;  3BM6 A;  4JGP A;  4EUV A;  2PD7 A;  4OOM A;  4WEK A;  5CHJ A;  3ZQ5 A;  2Y79 A;  5DKL A;  4HP4 A;  4Y15 A;  3EQU A;  1GSW A;  1GSX A;  3D72 A;  2M1C A;  2W1R A;  3CPT A;  2OAQ 1;  2ZQ8 A;  1GCE A;  1Q2Q A;  3CWF A;  4LRZ E;  4FUW A;  4GJ4 A;  4P6Z S;  4NXF A;  2O9A A;  3HRE A;  1K6R A;  5D3O A;  2Y2N A;  1OTE A;  2EXA A;  4R4R A;  1N4O A;  2J3T C;  2ZMF A;  3UB5 P;  3LEZ A;  3MXQ A;  3OOV A;  4MBK A;  5J4E A;  3V39 A;  1KGE A;  4B4X A;  4X56 A;  2XF3 A;  4WF0 A;  1HVB A;  4M4X A;  4QY5 A;  1GHM A;  2EA9 A;  4HIA A;  4MDZ A;  3M2K A;  1VEU A;  1Z6F A;  1LL8 A;  3ZVT A;  4KZ5 A;  4EV4 A;  4EUZ A;  3RH8 B;  4R0Q A;  1N9N A;  4DJ2 A;  5EVI B;  4JXW A;  4S2L A;  5DKK A;  3UE0 A;  1SDN A;  3IHA A;  2VKS A;  3N6I A;  2ACG A;  2EFU A;  1STZ A;  2KLI A;  5IT5 A;  4DE2 A;  1NZU A;  5HPI A;  1PZO A;  1C3B A;  3CUE A;  1XGJ A;  4P0M A;  1SCW A;  1S1Z A;  4ID4 A;  4Y0T A;  1VET B;  2WGI A;  3NOT C;  2BTF P;  5AQ7 A;  2L0W A;  2V8F A;  2ZOH A;  1H8Z A;  1PIO A;  4ETX A;  4BL2 A;  3T4S A;  3PBN A;  4OQ0 A;  5GLB A;  4Q0J A;  3GV9 A;  4U3T A;  4N92 A;  4OQG A;  4DN0 A;  3NOP C;  3IH9 A;  3UNW A;  5HSQ A;  1K55 C;  1JTD A;  4BQM A;  1BUL A;  1ZTU A;  1F2K A;  2W1T A;  3RXW A;  4JGR A;  5E2E A;  1LL9 A;  1FIK A;  5AQ9 A;  1J9M A;  1JVJ A;  4GNU A;  2XA7 M;  2O9B A;  2HJ9 C;  3ZG8 B;  1PW1 A;  1O07 A;  1YLT A;  2ZQ9 A;  1MBL A;  4GS9 B;  2CC1 A;  1RCJ A;  3G30 A;  4I3J A;  3UB8 A;  1K54 C;  1FQG A;  2RL3 A;  4GKU A;  1YAX A;  1ZG4 A;  4L9G A;  1YT4 A;  1OT6 A;  5HDC A;  2PT7 A;  2WZZ A;  4RVA A;  4ARZ A;  1TDL A;  4GLQ A;  1NZO A;  5L10 A;  2XH9 A;  1SKO B;  2JN7 A;  4R3A A;  2PAV P;  3L7H A;  3T4O A;  1JWZ A;  4ESP A;  1IYP A;  4DDS A;  3F1N B;  5EFW A;  3ZG9 B;  3NY4 A;  4F94 A;  1LSV A;  2BAS A;  2INW A;  3S4X A;  5A93 A;  2VA0 A;  2VGL M;  1FCM A;  1VQQ A;  2PR6 A;  5HX9 A;  2XSS A;  3N8R A;  2OV5 A;  4KZ7 A;  1CEF A;  3G32 A;  5C5K A;  1ZC2 A;  1WE4 A;  3WS5 A;  3G2Z A;  5J7E A;  4PAU A;  5CRF A;  4PM9 A;  1G6A A;  3H7W B;  1KE0 A;  1VET A;  2JKF A;  5TBM B;  2WGW B;  1AWI A;  2JKT I;  2UV0 E;  4IHQ A;  4E04 A;  2P04 A;  2E8I A;  4KQD A;  4X68 A;  4YFM A;  3BEB A;  4CLC A;  2HDR A;  3KYQ A;  3BFC A;  4II7 A;  1D06 A;  3A3F A;  4DRT A;  4GB7 A;  4JXV A;  3TE8 A;  3IS2 B;  3Q07 A;  1BYW A;  4CJN A;  3QP4 A;  1K57 A;  4HH3 A;  3CIT A;  4FTX A;  4GZB A;  3BW6 A;  1JWP A;  2ZC7 A;  3GDI A;  5F1F A;  3VOZ A;  1W8Q A;  5M18 A;  5FAO A;  1BLS A;  1S0W A;  3SZT A;  5FI6 A;  2NUP C;  2ZJ9 A;  1TS7 A;  1KDS A;  5GLD A;  4WZ5 A;  1ESI A;  1O7E A;  2HJE A;  3SS3 A;  3A3D A;  5FQQ A;  5DTT A;  4GDB A;  4O7D A; 
#chains in the Genus database with same CATH homology
 4O0P A;  1P9R A;  2XRO A;  3LFV A;  3NOU C;  4LPZ A;  4BBV A;  1YSQ A;  2KX6 A;  3MQQ A;  1OTI A;  5A8B A;  1VHM A;  4GW9 A;  3P7N A;  3PBO A;  3W2Z A;  3KSF A;  1GSV A;  2DMW A;  2W3E A;  4JGO A;  4KQO A;  3DBA A;  3PXP A;  4NXG A;  3EQV A;  3BQA A;  1MKM A;  3D3O A;  3IS2 A;  1S4S A;  2QJ5 A;  4UEY A;  3V67 A;  2OWH A;  4R38 A;  2WKP A;  4MN5 A;  5AVF A;  3VE4 A;  1TD5 A;  4ARZ B;  4R70 A;  5DFY A;  2HV1 A;  4G3K A;  3T4J A;  1YSP A;  2FH5 A;  4GCZ A;  4Z1W A;  3JVV A;  2PD8 A;  4DJ3 A;  4MMN A;  1EW0 A;  1DP6 A;  3TW8 A;  4CQH A;  1H3Q A;  4LLO B;  3UE3 A;  4OOL A;  3FPV A;  3H82 A;  3VOL A;  3PBQ A;  2B02 A;  2VV6 A;  2V9A A;  3UMD A;  1ZHH B;  3BQ8 A;  2WKQ A;  2W27 A;  2A24 B;  4PKY A;  2M7V A;  3FPW A;  4HHD A;  4HJ4 A;  3NJA A;  2O9C A;  2ZOI A;  3E4O A;  4QPR A;  3GEC A;  3ZYT A;  1NRJ A;  1S67 L;  3F1O A;  3ULF A;  2JKR I;  2A2L A;  3RTY A;  3KO6 A;  2FZ0 A;  2YKF A;  3JVU A;  3A0R A;  4XT2 B;  3EEA A;  1YKD A;  2VV7 A;  3MJQ A;  4NXE A;  4BWI A;  5DJU A;  2LB5 A;  4HJ3 A;  4G3V A;  2O0Y A;  4YOF A;  3B33 A;  5AJG A;  3LUQ A;  4HP9 A;  3TJZ C;  4HJ6 A;  5HWT A;  1OTB A;  4WL9 A;  4F3L B;  5LBR A;  4AFI A;  4PHT A;  4EU0 A;  3B42 A;  1UGU A;  3F1P A;  4ZRR A;  4FSF A;  4BMW A;  3HJK A;  2KOI A;  1UWN X;  1V9Y A;  2OWJ A;  1T1A A;  4R6L A;  2V1B A;  3CAX A;  2WKR A;  3RFB A;  2L1M A;  3CI6 A;  3G6O A;  4KUK A;  3A0V A;  2ZBB A;  4MN6 A;  4P6Z M;  3T4Q A;  1IOU A;  4BBU A;  1OJG A;  5AVE A;  1N9L A;  4K08 A;  2V0W A;  3MQO A;  3K2N A;  4JGP A;  4EUV A;  2PD7 A;  4OOM A;  4WEK A;  3ZQ5 A;  2Y79 A;  5DKL A;  4LRX C;  4HP4 A;  3EQU A;  1G6O A;  1GSW A;  1GSX A;  3D72 A;  4GS9 A;  3KSI A;  2QYB A;  4CLC C;  4I3I A;  1MZU A;  3FC7 A;  5F6A A;  2M1C A;  2QHK A;  2W1R A;  2OAQ 1;  4NXB A;  4WN5 A;  5HDS A;  3U2A A;  3HJI A;  2VX8 A;  3CWF A;  4LRZ E;  3S7Q A;  2ZMV A;  4GJ4 A;  4P6Z S;  4Y2F A;  2KDK A;  2J80 A;  3CLO A;  4NXF A;  2O9A A;  2W1T B;  4ME4 A;  2XA7 S;  4Q0I A;  2PYR A;  3EGD C;  1W63 Q;  2K7S A;  1OTE A;  3F1O B;  3O5Y A;  3E4P A;  1F98 A;  3PR6 A;  2J3T C;  2Y8H A;  5KSH A;  2ZMF A;  4I38 A;  3T50 A;  3EEH A;  4EXO A;  3MXQ A;  3OOV A;  5J4E A;  2W3D A;  3BWL A;  4ETZ A;  1KOU A;  1XFN A;  1OJ5 A;  4L0L A;  2OOL A;  2D02 A;  1TF1 A;  1F5M A;  3B47 A;  5HD3 A;  4O01 A;  4WF0 A;  4EER A;  2MJ6 A;  4NEE D;  3IBR A;  4M4X A;  1X0O A;  3LIE A;  2VJW A;  4I5S A;  5G4Z A;  3LR0 A;  4G3W A;  4GHI B;  2EA9 A;  4HIA A;  5F68 A;  4HNB A;  4MDZ A;  1F9I A;  4NKP A;  4WEJ A;  1P0Z A;  1IFQ A;  4B9O A;  5J3W A;  2JKR M;  1LL8 A;  4EEU A;  3EWK A;  3K3D A;  3TRC A;  3MFX A;  3RH8 B;  3C2W A;  1T19 A;  4YWZ A;  1TS0 A;  1N9N A;  4DJ2 A;  4DMZ A;  2HGV A;  2XRN A;  5DKK A;  2QJ7 A;  2CMN A;  1P9W A;  4IUK A;  3EGX C;  2VKS A;  5F69 A;  3VV4 A;  1STZ A;  2G7U A;  2KLI A;  5FL3 A;  3VE3 A;  2VEA A;  5IT5 A;  3CUE C;  4HOI A;  3UE6 A;  3MQ0 A;  3R7W B;  3T4K A;  4EW7 A;  1W63 M;  1T1C A;  3LI8 A;  4L9F A;  5HPI A;  2VLG A;  2P08 A;  3E4Q A;  3CUE A;  2PYP A;  4KUO A;  1XJ2 A;  3T4T A;  4MCW A;  1S1Z A;  4IUH A;  4XT2 A;  1UWP X;  5HWV A;  3MMH A;  3NOT C;  2L0W A;  3E0Y A;  3H9W A;  2GX5 A;  2PHY A;  2VV8 A;  2ZOH A;  5HZH A;  3KX0 X;  4UQI S;  4ETX A;  3F1P B;  3T4S A;  2JHE A;  4PKY G;  4F3L A;  3PBN A;  2PR5 A;  4Q0J A;  2V1A A;  1OT9 A;  3PBR A;  4HY8 A;  3S7P A;  3LR4 A;  2EWV A;  4DN0 A;  3NOP C;  2VGL S;  5HSQ A;  2M7U A;  5DFX A;  5KIZ A;  2HF6 A;  5DJT A;  1ZTU A;  2J3W A;  2W1T A;  4JGR A;  2B18 A;  3S7N A;  3S7O A;  3H82 B;  1V9Z A;  3PYP A;  3FG8 A;  2W3G A;  3OCL A;  2XA7 M;  3LIF A;  2O9B A;  2HJ9 C;  4BJP A;  3T4L A;  3IBJ A;  3LYX A;  1G28 A;  1XJ6 A;  1NWZ A;  1N9O A;  1XJ4 A;  1OTA A;  4GS9 B;  4I3J A;  3UB8 A;  3OCN A;  5HPF A;  2V0U A;  1S4R A;  1YAX A;  4CLC B;  3OLO A;  4L9G A;  3MF0 A;  4I3A A;  1LSW A;  2A24 A;  1DP8 A;  3KSH A;  2LB9 A;  1OT6 A;  5TBM A;  3E98 A;  3C8C A;  5HL6 A;  5HDC A;  3LI9 A;  1DP9 A;  2PT7 A;  2GZA A;  2OAP 1;  3K3C A;  4EQ1 A;  4ARZ A;  4GLQ A;  2O99 A;  4O8G A;  2W3H A;  3LR5 A;  2Z6C A;  1T1B A;  2JN7 A;  4R3A A;  2QWS A;  1LSX A;  4HI4 A;  4Y5F A;  3H7W A;  4EES A;  3T4O A;  4CLC D;  3OBF A;  1OTD A;  1XJ3 A;  2Z6D A;  3EOI A;  3LIC A;  3C30 A;  3F1N B;  5I5L A;  5EFW A;  3A0S A;  1DRM A;  5F5Y A;  1NLY A;  4BBT A;  2J3T D;  5DF9 A;  1LSV A;  5HWW A;  1NLZ A;  3PBS A;  2BAS A;  2INW A;  3F1N A;  2R78 A;  2VA0 A;  2VGL M;  4FOF A;  2PR6 A;  2YKH A;  4I39 A;  3BY9 A;  5MC7 A;  4JGQ A;  2XSS A;  4H6J A;  2K31 A;  1WA9 A;  3SW1 A;  1ODV A;  5C5K A;  3KYZ A;  3LR3 A;  2IA2 A;  5J7E A;  4PAU A;  3NHQ A;  1JNU A;  4IJG A;  3H7W B;  2JKT M;  3UB7 A;  4EET B;  2W0N A;  2I9V A;  5TJJ A;  3C38 A;  3LIA A;  5TBM B;  5IS1 A;  4HH2 A;  2JKT I;  4LRY C;  2K2N A;  4IHQ A;  4MN7 A;  4Q0H A;  4E04 A;  2P04 A;  3KSG A;  3R4K A;  2GJ3 A;  3LID A;  4Y3I A;  1S66 L;  3BJN A;  3P01 A;  3UME A;  3R7W A;  1TS8 A;  4KQD A;  4HQA A;  5HDD A;  4B93 A;  4CLC A;  2NUT C;  3PHY A;  1T18 A;  3KYQ A;  4II7 A;  1D06 A;  4WEL A;  1XFQ A;  3TE8 A;  3LIB A;  3IS2 B;  2P7J A;  3UB6 A;  2PDR A;  3BY8 A;  1BYW A;  5L8M A;  2VZW A;  4CLC E;  1LT0 A;  3MR0 A;  4HH3 A;  2GNX A;  3CIT A;  3PBT A;  4WUJ A;  1VB6 A;  3BW6 A;  5G4Y A;  5HD5 A;  4GHI A;  1H8M A;  3GDI A;  1MC0 A;  2QKP A;  3UB9 A;  2H28 A;  1D7E A;  1Y28 A;  2W3F A;  3OC2 A;  5IU1 A;  4RQ9 A;  2D01 A;  1TS6 A;  4YNR A;  2NUP C;  1TS7 A;  1OPX A;  2L4R A;  4WLA A;  2EWW A;  4UQI M;  4H6J B;  5K5B A;  5CX7 A;  2HJE A;  1S1Y A;  4L9E A;  1P97 A;  3HCY A;  3ICY A;  4EEP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...