3H82A

Crystal structure of the high affinity heterodimer of hif2 alpha and arnt c-terminal pas domains with the artificial ligand ths020
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
115
structure length
115
Chain Sequence
b'EFKGLDSKTFLSEHSMDMKFTYCDDRITELIGYHPEELLGRSAYEFYHALDSENMTKSHQNLCTKGQVVSGQYRMLAKHGGYVWLETQGTVIYNPRNLQPQCIMCVNYVLSEIEK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Aryl hydrocarbon receptor nuclear translocator
publication title Principles of ligand binding within a completely buried cavity in HIF2alpha PAS-B
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 32
structure length 115
sequence length 115
ec nomenclature
pdb deposition date 2009-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08447 PAS_3 PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3h82A00
2D01A 4HOIA 2VV6A 1XJ2A 4B9OA 4L9EA 4WF0A 4I38A 3G6OA 3CLOA 3LYXA 4LRZE 2PDRA 4I3JA 4RQ9A 4BBUA 2V9AA 3FG8A 5HD5A 5DJTA 2B02A 3MQOA 3IS2B 3OLOA 1XJ6A 4DJ2A 4NXEA 3MR0A 2PD8A 1OTIA 3F1NA 1V9ZA 4GS9A 3LIAA 3H82B 1N9LA 4HJ4A 1S67L 3BY9A 3GDIA 4GHIB 1TS7A 1D7EA 1KOUA 5EFWA 3HJIA 4HQAA 3LIBA 1OT9A 2Z6DA 3RTYA 1P97A 4KQDA 1LSVA 5F68A 5TBMB 1LSXA 3HJKA 1S4SA 3ZQ5A 2QKPA 5HDDA 4EERA 4F3LB 4LRXC 5DKLA 1OJGA 2PR5A 3UE6A 2V0WA 1WA9A 3A0RA 1S1ZA 2A24A 3UB9A 2J80A 2ZOIA 4XT2B 4R3AA 3H9WA 3E4OA 4LLOB 5HWTA 4L9FA 1F9IA 1T1BA 4HP9A 1LL8A 4HHDA 1ODVA 4I3AA 3ULFA 1LT0A 2PYRA 3D72A 3H7WB 2P7JA 3IS2A 3KX0X 2L0WA 2R78A 3E4PA 2V1AA 4NXFA 3VE4A 2GJ3A 5IS1A 5DJUA 1P0ZA 2YKFA 3H82A 2ZBBA 4H6JB 1T1CA 2VLGA 1GSXA 3K3DA 4EQ1A 4HY8A 3NOPC 4HH2A 4WN5A 3LIDA 1OTAA 2YKHA 2ZOHA 4HNBA 2OWHA 2D02A 2JHEA 4NXGA 5TBMA 1Y28A 1S66L 3MQQA 3E4QA 5HWVA 4F3LA 3UB6A 1UWNX 5HZHA 1TS6A 4K08A 2M1CA 4XT2A 1OJ5A 5AVEA 3A0SA 1T18A 4R70A 5G4YA 5F69A 1F98A 5F6AA 2PYPA 4R6LA 3PYPA 1OTBA 1NWZA 3K3CA 4EW7A 4MN6A 1OTEA 4HI4A 3ICYA 3UMEA 3A0VA 2VEAA 3EEHA 4GCZA 1DRMA 1VB6A 2Z6CA 3H7WA 1OT6A 2EA9A 2WKQA 2WKRA 4I39A 2W0NA 2H28A 5KIZA 4I5SA 4BBTA 1TS0A 4HP4A 4EESA 1DP8A 4PKYG 4H6JA 3P7NA 5J4EA 1LSWA 2VV7A 4DJ3A 3F1PB 4HJ6A 1XFNA 5HSQA 5AVFA 4JGQA 5HWWA 4LRYC 1DP9A 4HH3A 3LUQA 4EEUA 5HDCA 1EW0A 2CMNA 2QWSA 4JGRA 1S1YA 4JGPA 1T1AA 3EWKA 1DP6A 3MJQA 2K7SA 4WL9A 4EEPA 2OWJA 5G4ZA 3BY8A 3LIEA 2HV1A 2PR6A 4GHIA 1OTDA 2OOLA 3UMDA 3SW1A 1XJ3A 4MN5A 3CWFA 1UWPX 1XJ4A 4WLAA 3LIFA 2BASA 2VV8A 1N9OA 2KDKA 2WKPA 3MFXA 3F1PA 2V0UA 4I3IA 5J7EA 5I5LA 3PHYA 3F1OB 4KUOA 5HDSA 4EXOA 1TS8A 3LICA 5DKKA 3UB8A 2QJ5A 3VOLA 1G28A 5F5YA 1UGUA 4PKYA 4JGOA 1GSWA 3LI8A 2QHKA 5HD3A 1T19A 2PHYA 3C2WA 5J3WA 2PD7A 5A8BA 1V9YA 4LPZA 4EETB 3IBRA 4WUJA 2KX6A 3F1NB 1N9NA 3VE3A 3B33A 3UB7A 4GS9B 4HIAA 4YWZA 4KUKA 4NXBA 1XFQA 3FC7A 2L4RA 3NOUC 4E04A 3BWLA 5IU1A 3T50A 2JN7A 3CAXA 3NOTC 4R38A 3C8CA 3RH8B 1MZUA 1S4RA 1GSVA 2W27A 3NHQA 2INWA 3GECA 4GW9A 2I9VA 4L9GA 3MXQA 2QJ7A 1BYWA 1X0OA 4BBVA 2L1MA 1D06A 4M4XA 1JNUA 4HJ3A 2V1BA 3NJAA 3LI9A 2A24B 3F1OA
chains in the Genus database with same CATH superfamily
4Y3IA 1MBLA 2OLUA 3KYZA 2WGWA 4WF0A 3MQ0A 3CLOA 1PRQA 3T4LA 4ZJ3A 2XK1A 3PTEA 5K5BA 2PDRA 4I3JA 4BBUA 3UPPA 2V9AA 2Y2NA 5DJTA 3ZCZA 1F5MA 3FPWA 3MR0A 5F1FA 4X1MA 3UE3A 4Q0JA 4X68A 1KVMA 4NEED 3H82B 4B4ZA 3TRCA 1N9LA 3BY9A 4BMWA 3UB5P 3LGOA 3BECA 1D7EA 1KOUA 5EFWA 1E25A 3C4OA 4O7DA 1OT9A 4PPRA 4Y0TA 3PAEA 1P97A 3SS4A 3S7PA 1HVBA 2DRWA 2MJ6A 4K91A 5CXWA 1PZOA 2HDSA 3ZDJA 4QY6A 2QKPA 3MXSA 4EERA 2EX8A 4F3LB 3T4JA 5FSRA 2XF3A 4BL3A 1OJGA 4ZJ1A 4HEFA 3UE6A 4N9KA 3KSHA 1KVLA 2XQZA 3V5MA 3UE0A 1PIOA 3A3FA 5CTNA 1SZVA 4GD6A 2HGVA 5CERA 3UB9A 5HAQA 2ZMFA 1KDSA 2ZOIA 2H0TA 3LY4A 4XT2B 5CGXA 2EFUA 1K25A 4FOFA 3H9WA 4BENA 5FAQA 2WGVA 1F9IA 3BFFA 3VMAA 2G7UA 4UA7A 3G30A 3ZVTA 1IYSA 4DN0A 5M1AA 3ZHHA 4JXSA 3D72A 1FSWA 1YT4A 3TW8A 5GLCA 1PWCA 3KX0X 2L0WA 3OCLA 2R78A 1ES5A 5IS1A 1XGIA 3JVUA 4MNRA 1T1CA 3FWLA 2Q9MA 1GSXA 1O7EA 3O3VA 4EQ1A 1IYQA 4LV2A 4HY8A 2VZWA 4L0LA 4U0XA 3NOPC 4ZTKA 2Y8HA 4WN5A 2VK3A 4QWOA 1W8YA 3WS4A 4OPYA 4GZBA 1S6RA 2OWHA 2PBDP 5AQ9A 4GOGA 1Y28A 3IX8A 3TG9A 1S66L 3MQQA 4E3IA 2VJWA 2BG1A 3T4SA 4PM7A 4S2MA 3UB6A 1UWNX 1XP4A 4JPMA 2V20A 1IYPA 2G2UA 2GDNA 3JVVA 4PM5A 5GHXA 2XFTA 2ZC4B 1O07A 4MBFA 5BOHA 4OOLA 5AVEA 2J3WA 2Y2LA 1T18A 3DTMA 3QHYA 5F6AA 5I94A 3EQVA 4E3JA 1YLTA 3K3CA 4EUVA 3ICYA 3UMEA 2M7VA 1OT6A 5DVAA 4R3BA 1JVJA 3C4PA 3ZG0A 5CX7A 4LGWA 1PI4A 2WKEA 4I5SA 2C5WB 4O01A 1NYMA 3PXPA 3HLFA 1IELA 1FCMA 3KYQA 4LFUA 2W3EA 4JKTA 1XFNA 2P9VA 3E98A 3RXXA 4DF6A 5AVFA 1FR6A 3V50A 5EUAA 2CC1A 3HCYA 1DP9A 5FQQA 3EGDC 4IUHA 5L07A 3WS5A 2HP5A 2R9XA 3LUQA 1W8QA 2EXAA 3B42A 1NJ4A 1S1YA 4LV1A 1DP6A 1KE0A 1CK3A 4S2NA 3LCEA 2K7SA 4WL9A 3NI9A 2JCHA 2PT7A 4G3WA 2OWJA 5G4ZA 3UY6A 3BY8A 3QP4A 1GHMA 3Q07A 5D3OA 1VETB 1L0GA 5FI2A 2OOLA 2IWDA 4HBUA 1K0KA 4Y5FA 3SH7A 4UA9A 2V8FA 2ZC5B 3HL9A 3CI6A 1J3WA 2DNSA 2ZM0A 2X02A 2IA2A 4U3TA 1BSGA 2XSSA 4WLAA 2EX9A 5HPFA 3LIFA 1MXOA 4OLDA 3VP0A 2JC7A 3IF6A 4NK3A 2LB5A 3C5AA 3BRMA 1FQGA 2ZC6B 2IWBA 3T4QA 2B95A 3D4FA 1MKIA 4OH0A 3EEAA 2Y2MA 4B93A 3NCKA 2G2WA 2XFSA 2WGWB 3IF5A 4GJ4A 4EXOA 4O8GA 3CJMA 5CRFA 5HX9A 3OPPA 3CPTA 4WEKA 2WKIA 2XDMA 3JPUA 2O99A 1DJCA 4EBNA 4JGOA 3EOIA 4MCWA 3QP1A 1F2KA 3T4OA 5GHZA 2QHKA 3AGDA 1T19A 3QNBA 2E8JA 4B88A 2EXBA 1PWDA 4EETB 3HUMA 1HD8A 4B4XA 1YMXA 2W1TA 1N9NA 4HBTA 4FTXA 3VFFA 4N9LA 5TJJA 5E2GA 1MPLA 3BJNA 3DAVA 3R7WA 3CMZA 4NXBA 2QZ6A 2L4RA 4UQIS 4E04A 3KSIA 3BWLA 3ZNYA 2OSUA 2WZXA 1G68A 3S1YA 3C8CA 2Q9NA 5E2EA 2EWVA 3OC2A 1BUEA 1SKFA 2INWA 2JE5A 4GD8A 3K2NA 1TD5A 2I9VA 4HJ3A 3NJAA 3S7NA 3L9KA 5FQJA 1M6KA 1XJ2A 3N8LA 4L9EA 5CHJA 1CEFA 2W3DA 2VGLS 4KZ3A 4I38A 3D3OA 3G6OA 3ZG7B 4OQ0A 1CI9A 2WUQA 1CI8A 2JKTI 3HLDA 3BFEA 1ZG4A 4RQ9A 4Z1WA 4KZ9A 3FG8A 2HP9A 5HD5A 1K55C 4M3KA 1U60A 3MQOA 3OLOA 3SOIA 4RX2A 3PBOA 1OTIA 4GS9A 4C3QA 5E43A 4HJ4A 1S67L 3M2KA 1YKDA 2Y2QA 3GDIA 1TS7A 2A2LA 1YLYA 1Q2QA 2XA7M 2QPNA 3HJIA 3SZTA 4RX3A 3RTYA 4E6WA 3HBRA 4R4SA 4MN7A 4ME4A 2HJ9C 4LCLA 3S22A 1A0KA 5F68A 3G35A 1CF0A 2Z2MB 3ZYTA 3S7OA 1ZKJA 3BQAA 1LLBA 3SH8A 5JYPA 1G6OA 2E8IA 4P6BA 4R23A 4GKUA 2A24A 4GLQA 3UO9A 4R3AA 3CUEC 3IWOA 2ZMVA 2OAP1 2HPBA 3IQAA 4BLMA 4X56A 1NRFA 4L9FA 4DE0A 5F82A 2X01A 3Q7VA 5L2FA 4HP9A 3VSKA 2EWWA 4Y15A 2BLSA 3TE8A 3T1SA 1LT0A 3IXGA 4ETZA 1HZOA 3IS2A 1RGYA 4DDSA 1YSQA 5J8XA 1IKGA 5CECA 3C38A 5HL6A 3MFDA 2P08A 2ZBBA 4KQQA 5HAPA 3Q1FA 3K3DA 2Z2LB 1JWPA 3LO7A 1BLCA 2P9VB 5KSCA 4YNRA 4BWIA 4P6ZM 3MZFA 1NLZA 1L0FA 2ZOHA 2D02A 3LR0A 5EPHA 2Y2GA 3VOZA 4H8RA 3IXDA 1EROA 5FA7A 1PYYA 4K08A 3IT9A 4WZ5A 3DTEA 3VSLA 3NDEA 4U0TA 4ID4A 2WKHA 3NDGA 3A0SA 5G4YA 4E3NA 2W3FA 3P09A 1Y54A 3OPHA 4Y7PA 1NWZA 4MN6A 1E3UD 1OTEA 1H8YA 5EVIA 2ZQCA 3MF0A 3GVBA 3EEHA 1VB6A 4KZBA 3H7WA 4KZ6A 5EVEA 2ZMAA 1GHIA 2K2NA 4I39A 3IF6B 4CLCA 1W63M 4BBTA 1TS0A 4HP4A 3E0YA 5EOOA 4H6JA 4KENB 5J4EA 1LSWA 3G2YA 2FH5A 4DJ3A 3HLEA 4HJ6A 1DJBA 2NUPC 2UWXA 4LRYC 5HPIA 4OQGA 5KMWA 5CGSA 3JYIA 4KZ4A 4R4RA 3VP3A 4K0XA 1CJFA 1I2SA 3CPTB 1LL5A 4EEUA 1STZA 2CMNA 3AGFA 1PW8A 2QWSA 5EECA 4JGRA 4JGPA 1YPRA 3EWKA 1ACFA 4C6YA 4ZAMA 5HAIA 4BD1A 3FV7A 4WMCA 5E2HA 4BL2A 1SDNA 1NZOA 2WADA 3QP2A 3NULA 3UPOA 1OMEA 2HJEA 2W1TB 3TSGA 3Q82A 5G18A 3ZFZA 3A3JA 1ES3A 3NBLA 5DTTA 3G4PA 3R7WB 2Y2KA 3BM6A 3LR4A 3KSGA 1S0WA 4YFMA 1WE4A 1XJ3A 5FATA 4FSFA 3CWFA 3PBQA 5A91A 1PZPA 1SDEA 2ZQ9A 4QPRA 4RYEA 1FR1A 2Y91A 1YM1A 4CQHA 5AJGA 3ITAA 2BASA 5FDHA 5FQMA 1PWGA 4RA7A 3HLCA 5EM1A 2KDKA 3UDFA 1EI5A 4S2KA 3PBRA 3UNWA 1OPXA 3O5YA 5GL9A 5I5LA 2ZC7A 1PFLA 4R3JA 2VGJA 3NECA 2PU2A 5HDSA 2GX5A 2FFFB 5A92A 3GV9A 3LICA 5FAPA 1KGEA 4MBKA 2P04A 1L0DA 3UB8A 1L2SA 3N8SA 4LV3A 5F5YA 1UGUA 4JXVA 4PKYA 4DE3A 1GSWA 5KZHA 3IX3A 2WGIA 2XD5A 3OZHA 5HD3A 3G31A 4EBLA 2PD7A 5A8BA 1DY6A 3HLBA 4WUJA 3D9YA 2KX6A 4ETXA 3UB7A 4GS9B 2JKRI 4HIAA 2Y79A 2KOIA 4NKPA 3O87A 4MBHA 2PBYA 2ZL1A 5HARA 4S2NC 4EBPA 3BYDA 3IWQA 5IHVA 1S4RA 3ITBA 1GSVA 2Y2HA 5FQKA 4QU3A 2O9CA 4OP8A 4CJNA 1VEUA 5TFQA 3MXQA 3LFVA 1ZG6A 3U4LP 4QJGA 1BYWA 1X0OA 2L1MA 2XD1A 2V1BA 1TF1A 3KSFA 2A24B 3NIAA 3CZDA 1ESIA 3N4IA 1TDLA 2VV6A 3G2ZA 4B9OA 4X1LA 3DBAA 3I7JA 5FI7A 1LI9A 3IF6C 4DDYA 3LYXA 3Q7VB 1YMSA 4LRZE 5EOEA 1MY8A 3EQUA 3A3IA 3ZG8B 1ALQA 4X53A 2B18A 1JTDA 4BQMA 3IS2B 4DJ2A 1ONHA 4NXEA 5TR7A 1AXBA 4N1HA 4FH2A 3F1NA 4FUWA 1NRJA 3ZG5A 2R9WA 4S2JA 3P01A 4P0MA 5C5KA 5HW3A 4QB8A 2PAVP 3GMWA 5F1GA 2NUTC 3SH9A 1JWZA 3GR2A 4DMZA 3B47A 4EU0A 1IFQA 1LSXA 1S4SA 5CTMA 3ZQ5A 3G34A 5HDDA 3MKFA 4E3KA 4ZBEA 5TGFA 4LRXC 3UDXA 5DKLA 4Y2FA 4X6TA 1W7FA 1W79A 2ZQ7A 2V0WA 3DWZA 4KZ7A 3L7HA 1K4FA 2K31A 4P6ZS 3A0RA 3BLMA 5DFXA 5FI6A 4OLGA 4KZ5A 1S1ZA 4EV4A 3MKEA 2J80A 1W5DA 4MDZA 3RJUA 4QHCA 4CLCE 2XROA 1NLYA 3BW6A 3E4OA 3OPLA 4LLOB 1QMFA 1XA7A 5CGWA 4ZJ2A 2FFYA 1HTZA 1K56A 1T1BA 2WAEA 3DWKA 1LL8A 4WYYA 5EVIB 4IVIA 4DRTA 4I3AA 1Z09A 4LCMA 5MC7A 4R0QA 2PYRA 3H7WB 4PHTA 2BTFP 1K57A 1Z6FA 3PBSA 1YAXA 4CLCB 1BZAA 5GLAA 1GHPA 4E3MA 2WYXA 1WYCA 2PRFA 4H6JB 5DTKA 2H5SA 4ZRRA 1YLJA 1H3QA 4WBGA 1YSPA 1BT5A 3LIDA 4KQOA 4G3VA 2YKHA 3WS1A 3O86A 3ZG9B 3V67A 1K6RA 3M6BA 1IEMA 2JHEA 5TBMA 3W4OA 4JF6A 5GLBA 3IXBA 2I72A 3HVFA 1KDWA 2GZAA 5DTSA 1NY0A 3B3XA 3BFDA 2EFXA 1RGZA 5EE8A 4WM9A 3P98A 3T4TA 4EQIA 2AVXA 2OAQ1 1K55A 3VP1A 5F69A 4Y17A 4P85A 2JKGA 4OQHA 4R6LA 3EGXC 3PYPA 4EW7A 4HI4A 3A0VA 4GNUA 3LEQA 2VEAA 5HL1A 4KQRA 3W4PA 2WKQA 1KE3A 1D1JA 4JBFA 2H28A 3T1RA 1NXYA 3FPVA 3UDIA 4PAUA 1DP8A 4OPZA 4PKYG 3C7UA 1G6AA 5FASA 3MSHA 2M7UA 3N7WA 1FSYA 1XKZA 1DJAA 5HSQA 3V3RA 4OPRA 5HWWA 1ERQA 1HLUP 1FCNA 4Y0UA 5DF7A 1PI5A 1ESUA 2FZ0A 4A5RA 1VM1A 1IYOA 3A3DA 4OONA 4HH3A 4ESPA 1I5QA 2LB9A 1K54C 3QNCA 2Y55A 2Q0OA 1J9MA 3WRZA 1WYBA 5FEFA 2HDRA 3MJQA 5FQIA 1SKOA 4PMAA 2JKTM 3WWXA 3M6HA 3G32A 1OTDA 3GTCA 3LR3A 3DTKA 3PBTA 1BTLA 2Y2OA 3PAGA 3SW1A 3BLSA 1YQSA 1NZUA 4X25A 1RP5A 4MN5A 4RVAA 2V2FF 2ZL1B 3QP6A 2A3UA 1UWPX 4XUZA 3C7VA 1BLPA 5AQAA 5A90A 1LHYA 1KGFA 4WZ5C 5AQ7A 5GLDA 1TVFA 4K0WA 1H0MA 1MC0A 5GHYA 2ACGA 4UQIM 1VEUB 1N9OA 3S7QA 3BQ8A 4YOFA 4WZ4A 4F94A 3S4XA 2WKPA 1BLSA 4MLLA 3MFXA 1E4DA 3F1PA 2V0UA 3E2KA 4I3IA 5J7EA 4KUOA 3IBJA 5EVIC 5DF9A 5KSHA 4Y0OA 2QYBA 2ZD8A 2XR0A 1KE4A 2J7VA 5DKKA 2P74A 1K4EA 4CLCC 3C30A 2QJ5A 1TDGA 1G28A 4IEDA 5JYOA 1ES4A 1JWVA 2H10A 1KGGA 3LI8A 4Q0IA 3T1QB 5CEBA 1N4OA 2VGLM 3C2WA 3HREA 1C3BA 4DKIA 3BEBA 1V9YA 4FCFA 5F83A 3MZDA 3F1NB 4Q8IA 4GB7A 5L09A 4FD8A 4YWZA 4KZ8A 1XFQA 4BJPA 3FC7A 4JF4A 4DXBA 3NOUC 2OV5A 2UV0E 4JXWA 2JBFA 1K6SA 5IU1A 4XXRA 3T50A 1NYYA 2JN7A 1VQQA 3NOTC 1FILA 3V3SA 4IJGA 3HUOA 1BULA 2HP6A 1H8MA 3IHBA 4II7A 3FKVA 3NHQA 3NC8A 3PR6A 4L9GA 5DF8A 3RFBA 2QJ7A 1MWTA 4BBVA 3TJZC 1D06A 4M4XA 3IXHA 1CQAA 5L10A 1MWUA 4G3KA 3ZGAB 1QMEA 1RCJA 2B5RA 4N92A 2HF6A 3F1OA 3RXWA 4S2OA 2Y2IA 4UA6A 2D01A 4HOIA 1EWZA 1GCEA 3O88A 4QY5A 4WELA 3U2AA 2XGNA 4E3OA 4NG2A 3FKWA 4IBXA 4AFIA 4S2IA 2IWCA 1N9BA 2ZQDA 1ONGA 4DE1A 2J8YA 2B02A 2OLVA 1XJ6A 2J9OA 5FAOA 2PD8A 3W4QA 1GA9A 4DE2A 1PW1A 1V9ZA 3ZNTA 4MEZA 3LIAA 5FQ9A 2JKFA 2Y2PA 3T1XA 4EUZA 3HUNA 4GHIB 2EX6A 2ZQ8A 2HDQA 1G5UA 4HQAA 3LIBA 3WS2A 1XGJA 1Y4OA 2V1ZA 2Z6DA 2XH9A 4KQDA 1H5XA 1LI0A 4KG5A 2W1RA 1LSVA 5TBMB 3HJKA 1FOFA 3OBFA 4UHUA 2O9BA 2XRNA 3IHAA 2X71A 2PR5A 1WA9A 5EVID 4X55A 2GNXA 4IVKA 4HESA 4OOMA 4C75A 1YLWA 2W3HA 4E3LA 3VV4A 3QP8A 5HWTA 4CLCD 2HDUA 2O9AA 3HLWA 2ZM8A 3BFCA 4BD0A 1GA0A 4DXCA 4HHDA 2PU4A 1ODVA 3GQZA 3ULFA 2P7JA 3E2LA 1XX2A 4UEYA 2Y2JA 2XA7S 3OOVA 4PM9A 3E4PA 2V1AA 4NXFA 3VE4A 2GJ3A 5DJUA 1P0ZA 1XPBA 4ARZB 2YKFA 3FYZA 3H82A 5E2FA 2VLGA 3DW0A 1BLHA 5AQBA 4D2OA 3LEZA 5FL3A 3FZCA 4WMCD 4HH2A 2J3TC 3LY3A 2RL3A 2VA0A 4EWFA 1OTAA 3ISGA 3T4KA 4CPKA 3KO6A 4HNBA 1P9WA 4NXGA 3E4QA 5HWVA 4F3LA 1MWRA 1FIKA 5HZHA 3MXRA 2VKSA 3VFHA 1TS6A 2DCFA 5M19A 1ZHHB 2M1CA 1Q2PA 1SKOB 4LENA 2DMWA 4QD4A 4R1GA 4XT2A 2ZC3B 3VP4A 3N6IA 3UPNA 4Y13A 1OJ5A 1ZTUA 4R70A 1F98A 3MS6A 1L3LA 3BFGA 3M2JA 2PYPA 4FH4A 4IBRA 1OTBA 3IH9A 4YINA 3CG5A 2JKRM 4GCZA 1DRMA 5A93A 1CEGA 2O0YA 2Z6CA 3IWIA 4NETA 3MBZA 2EA9A 2WKRA 1AWIA 2W0NA 2VX8A 4UAAA 2Y59A 2EX2A 4GDBA 5U47A 5KIZA 4OOYA 4EESA 2VGKA 2KLIA 2C6WB 4OQIA 1XA1A 2ZQAA 3P7NA 1TEMA 2VV7A 3F1PB 1SCWA 3Q81A 4JGQA 1H8ZA 2ZLYA 1YLPA 3UN7A 1K57C 1LL9A 1PNEA 5HDCA 1EW0A 3IX4A 4P87A 4D60A 3A3EA 4GN2A 1ERMA 1K38A 1T1AA 3UE1A 4O0PA 3CITA 4EEPA 4GDNA 4Z9QA 4PM8A 5EM0A 2ZJ9A 3LIEA 3OCNA 2HV1A 2PR6A 1JTGA 3GRJA 4GHIA 2H0YA 3SS5A 3T12B 1I2WA 4E6XA 2WK0A 4WEJA 3PBNA 1FCOA 3UMDA 5IT5A 3HLGA 3W8KA 4S2LA 1XJ4A 4JF5A 5CHUA 4OPQA 5FEGA 1XXMA 2HZ5A 4PM6A 3W2ZA 5EV0A 3N8RA 4OP5A 2VV8A 4KG2A 4KZAA 5L8MA 1E3UA 4Q0HA 3V39A 3DTIA 1MWSA 4OKPA 1MKMA 3SS3A 2J3TD 3PHYA 2WZZA 3F1OB 5HFOA 4N1XA 3GSGA 4JLFA 2J9PA 1TS8A 3MMHA 3NY4A 3VP2A 3VOLA 4JXGA 4X69A 1IKIA 3WS0A 4ZDXA 2WAFA 5M18A 1VHMA 3AGEA 1ZC2A 5CHMA 2PHYA 4ARZA 3KYEA 1W63Q 2W3GA 5J3WA 5DFYA 4S2PA 4LPZA 3IBRA 2QMIA 2XEPA 4LV0A 3VE3A 5CEDA 3OPRA 3B33A 1M40A 1VETA 3ZVWA 1ES2A 4KG6A 3IH8A 4XUXA 4KUKA 1IOUA 2RCXA 3CUEA 3TOIA 1P9RA 5LBRA 4IHQA 3CAXA 3VOYA 4MMNA 4R38A 3WRTA 2A49A 3RH8B 1MZUA 5EVLA 1L0EA 3LR5A 2W27A 3GECA 4GW9A 3QP5A 1K56D 4IUKA 2Y4AA 1YLZA 3MZEA 1SHVA 2ZM2A 1JNUA 2XLNA 3CHWP 5FDSA 3LI9A 2V8CA 1K54A 4OVDA 3Q7ZA 3R4KA
chains in the Genus database with same CATH topology
4Y3IA 2D01A 4HOIA 2VV6A 1XJ2A 3KYZA 4B9OA 4L9EA 4WF0A 3MQ0A 2W3DA 4WELA 2VGLS 3U2AA 4I38A 3DBAA 3D3OA 3G6OA 3CLOA 3LYXA 3T4LA 4LRZE 3EQUA 2JKTI 5K5BA 2PDRA 4I3JA 4RQ9A 4AFIA 4Z1WA 4BBUA 2V9AA 3FG8A 5HD5A 5DJTA 2B18A 1F5MA 3FPWA 2B02A 3MQOA 3IS2B 3OLOA 1XJ6A 4DJ2A 4NXEA 3MR0A 3PBOA 2PD8A 1OTIA 3F1NA 1NRJA 1V9ZA 3UE3A 4GS9A 3LIAA 4Q0JA 4NEED 3H82B 3TRCA 1N9LA 3P01A 4HJ4A 1S67L 3BY9A 5C5KA 4BMWA 1YKDA 3GDIA 4GHIB 1TS7A 2A2LA 1D7EA 1KOUA 2NUTC 5EFWA 2XA7M 3HJIA 4HQAA 3LIBA 1OT9A 2Z6DA 4DMZA 3B47A 3RTYA 1P97A 4KQDA 3S7PA 4MN7A 2MJ6A 4ME4A 4EU0A 2W1RA 2HJ9C 1LSVA 5F68A 5TBMB 1IFQA 1LSXA 3HJKA 1S4SA 3ZQ5A 2QKPA 5HDDA 3OBFA 3ZYTA 4EERA 4F3LB 3T4JA 3S7OA 4LRXC 2O9BA 2XRNA 5DKLA 4Y2FA 3BQAA 1OJGA 2PR5A 3UE6A 2V0WA 3KSHA 1WA9A 1G6OA 2K31A 4P6ZS 2GNXA 3A0RA 5DFXA 1S1ZA 2HGVA 2A24A 4OOMA 3UB9A 4GLQA 2ZMFA 2J80A 2ZOIA 2W3HA 4XT2B 4R3AA 3CUEC 2ZMVA 4FOFA 4MDZA 3VV4A 4CLCE 2OAP1 3H9WA 2XROA 1NLYA 3BW6A 3E4OA 4LLOB 5HWTA 4CLCD 4L9FA 2O9AA 1F9IA 2G7UA 1T1BA 4HP9A 2EWWA 1LL8A 4HHDA 3TE8A 1ODVA 4DN0A 4I3AA 3ULFA 5MC7A 1LT0A 2PYRA 3D72A 3H7WB 4PHTA 4ETZA 3TW8A 2P7JA 3IS2A 3KX0X 2L0WA 1YSQA 3OCLA 4UEYA 3PBSA 1YAXA 2XA7S 4CLCB 3OOVA 2R78A 3E4PA 2V1AA 4NXFA 3VE4A 2GJ3A 5IS1A 3C38A 5DJUA 1P0ZA 3JVUA 4ARZB 2YKFA 5HL6A 2P08A 3H82A 2ZBBA 4H6JB 1T1CA 2VLGA 1GSXA 3K3DA 4EQ1A 4ZRRA 4HY8A 5FL3A 2VZWA 4L0LA 4YNRA 1H3QA 3NOPC 4BWIA 2Y8HA 4P6ZM 4HH2A 4WN5A 1NLZA 2J3TC 2VA0A 1YSPA 3LIDA 1OTAA 4KQOA 4G3VA 2YKHA 3T4KA 3V67A 2ZOHA 3KO6A 4HNBA 2OWHA 1P9WA 2D02A 2JHEA 3LR0A 4NXGA 5TBMA 1Y28A 1S66L 3MQQA 3E4QA 2VJWA 5HWVA 3T4SA 4F3LA 3UB6A 1UWNX 5HZHA 2VKSA 2GZAA 1TS6A 1ZHHB 4K08A 2M1CA 2DMWA 3JVVA 4XT2A 3T4TA 2OAQ1 4OOLA 1OJ5A 1ZTUA 5AVEA 2J3WA 3A0SA 1T18A 4R70A 5G4YA 5F69A 1F98A 5F6AA 2W3FA 2PYPA 3EQVA 3EGXC 4R6LA 3PYPA 1OTBA 1NWZA 3K3CA 4EW7A 4MN6A 4EUVA 1OTEA 4HI4A 3ICYA 3UMEA 3A0VA 2JKRM 3MF0A 2VEAA 3EEHA 4GCZA 1DRMA 2M7VA 1VB6A 2O0YA 2Z6CA 3H7WA 1OT6A 2EA9A 2WKQA 2WKRA 2K2NA 4I39A 2W0NA 2H28A 2VX8A 5CX7A 3FPVA 5KIZA 4CLCA 1W63M 4I5SA 4BBTA 1TS0A 4HP4A 4PAUA 4O01A 4EESA 1DP8A 4PKYG 2KLIA 3E0YA 3PXPA 4H6JA 3P7NA 5J4EA 2M7UA 1LSWA 2FH5A 2VV7A 3KYQA 4DJ3A 3F1PB 4HJ6A 2W3EA 1XFNA 5HSQA 3E98A 5AVFA 4JGQA 2NUPC 5HWWA 3HCYA 4LRYC 1DP9A 5HPIA 2FZ0A 3EGDC 4IUHA 4HH3A 2LB9A 3LUQA 4EEUA 5HDCA 1EW0A 1STZA 2CMNA 3B42A 2QWSA 4JGRA 1S1YA 4JGPA 1T1AA 3EWKA 1DP6A 3MJQA 2K7SA 4WL9A 4O0PA 3CITA 4EEPA 2PT7A 4G3WA 2OWJA 5G4ZA 3BY8A 2JKTM 3LIEA 3OCNA 2HV1A 2HJEA 2PR6A 4GHIA 2W1TB 1OTDA 3LR3A 2OOLA 4WEJA 3R7WB 3PBTA 3PBNA 4Y5FA 3LR4A 3UMDA 3KSGA 3SW1A 5IT5A 1XJ3A 3CI6A 4MN5A 4FSFA 3CWFA 3PBQA 1UWPX 1XJ4A 2IA2A 2XSSA 4WLAA 5HPFA 3LIFA 4QPRA 4CQHA 5AJGA 1MC0A 2BASA 2LB5A 3W2ZA 4UQIM 2VV8A 1N9OA 3S7QA 3BQ8A 3T4QA 4YOFA 2KDKA 5L8MA 2WKPA 4Q0HA 3MFXA 3EEAA 3F1PA 3PBRA 1OPXA 2V0UA 3O5YA 4I3IA 5J7EA 4B93A 1MKMA 2J3TD 5I5LA 3PHYA 3F1OB 4KUOA 3IBJA 5DF9A 5KSHA 5HDSA 2GX5A 4GJ4A 4EXOA 2QYBA 4O8GA 1TS8A 3LICA 5DKKA 2P04A 3MMHA 3UB8A 4WEKA 4CLCC 3C30A 2QJ5A 3VOLA 2O99A 1G28A 5F5YA 1UGUA 4PKYA 4JGOA 3EOIA 4MCWA 1GSWA 1VHMA 3LI8A 3T4OA 4Q0IA 2QHKA 5HD3A 1T19A 2PHYA 2VGLM 4ARZA 1W63Q 2W3GA 3C2WA 5J3WA 2PD7A 5A8BA 5DFYA 1V9YA 4LPZA 4EETB 3IBRA 4WUJA 2KX6A 3F1NB 2W1TA 1N9NA 3VE3A 4ETXA 3B33A 3UB7A 4GS9B 2JKRI 4HIAA 5TJJA 2Y79A 3BJNA 3R7WA 4YWZA 4KUKA 4NXBA 2KOIA 1IOUA 4NKPA 4BJPA 1XFQA 3FC7A 2L4RA 4UQIS 3NOUC 4E04A 3KSIA 3CUEA 3BWLA 1P9RA 5IU1A 5LBRA 3T50A 4IHQA 2JN7A 3CAXA 3NOTC 4MMNA 4IJGA 4R38A 3C8CA 1H8MA 3RH8B 1MZUA 1S4RA 2EWVA 1GSVA 4II7A 3OC2A 3LR5A 2W27A 3NHQA 2O9CA 2INWA 3GECA 3K2NA 1TD5A 4GW9A 2I9VA 3PR6A 4L9GA 3MXQA 3LFVA 4IUKA 3RFBA 2QJ7A 1BYWA 1X0OA 4BBVA 2L1MA 3TJZC 1D06A 4M4XA 1JNUA 4HJ3A 2V1BA 1TF1A 3KSFA 3NJAA 3LI9A 4G3KA 3S7NA 2HF6A 2A24B 3F1OA 3R4KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2D01 A;  4HOI A;  2VV6 A;  1XJ2 A;  4B9O A;  4L9E A;  4WF0 A;  4I38 A;  3G6O A;  3CLO A;  3LYX A;  4LRZ E;  2PDR A;  4I3J A;  4RQ9 A;  4BBU A;  2V9A A;  3FG8 A;  5HD5 A;  5DJT A;  2B02 A;  3MQO A;  3IS2 B;  3OLO A;  1XJ6 A;  4DJ2 A;  4NXE A;  3MR0 A;  2PD8 A;  1OTI A;  3F1N A;  1V9Z A;  4GS9 A;  3LIA A;  3H82 B;  1N9L A;  4HJ4 A;  1S67 L;  3BY9 A;  3GDI A;  4GHI B;  1TS7 A;  1D7E A;  1KOU A;  5EFW A;  3HJI A;  4HQA A;  3LIB A;  1OT9 A;  2Z6D A;  3RTY A;  1P97 A;  4KQD A;  1LSV A;  5F68 A;  5TBM B;  1LSX A;  3HJK A;  1S4S A;  3ZQ5 A;  2QKP A;  5HDD A;  4EER A;  4F3L B;  4LRX C;  5DKL A;  1OJG A;  2PR5 A;  3UE6 A;  2V0W A;  1WA9 A;  3A0R A;  1S1Z A;  2A24 A;  3UB9 A;  2J80 A;  2ZOI A;  4XT2 B;  4R3A A;  3H9W A;  3E4O A;  4LLO B;  5HWT A;  4L9F A;  1F9I A;  1T1B A;  4HP9 A;  1LL8 A;  4HHD A;  1ODV A;  4I3A A;  3ULF A;  1LT0 A;  2PYR A;  3D72 A;  3H7W B;  2P7J A;  3IS2 A;  3KX0 X;  2L0W A;  2R78 A;  3E4P A;  2V1A A;  4NXF A;  3VE4 A;  2GJ3 A;  5IS1 A;  5DJU A;  1P0Z A;  2YKF A;  3H82 A;  2ZBB A;  4H6J B;  1T1C A;  2VLG A;  1GSX A;  3K3D A;  4EQ1 A;  4HY8 A;  3NOP C;  4HH2 A;  4WN5 A;  3LID A;  1OTA A;  2YKH A;  2ZOH A;  4HNB A;  2OWH A;  2D02 A;  2JHE A;  4NXG A;  5TBM A;  1Y28 A;  1S66 L;  3MQQ A;  3E4Q A;  5HWV A;  4F3L A;  3UB6 A;  1UWN X;  5HZH A;  1TS6 A;  4K08 A;  2M1C A;  4XT2 A;  1OJ5 A;  5AVE A;  3A0S A;  1T18 A;  4R70 A;  5G4Y A;  5F69 A;  1F98 A;  5F6A A;  2PYP A;  4R6L A;  3PYP A;  1OTB A;  1NWZ A;  3K3C A;  4EW7 A;  4MN6 A;  1OTE A;  4HI4 A;  3ICY A;  3UME A;  3A0V A;  2VEA A;  3EEH A;  4GCZ A;  1DRM A;  1VB6 A;  2Z6C A;  3H7W A;  1OT6 A;  2EA9 A;  2WKQ A;  2WKR A;  4I39 A;  2W0N A;  2H28 A;  5KIZ A;  4I5S A;  4BBT A;  1TS0 A;  4HP4 A;  4EES A;  1DP8 A;  4PKY G;  4H6J A;  3P7N A;  5J4E A;  1LSW A;  2VV7 A;  4DJ3 A;  3F1P B;  4HJ6 A;  1XFN A;  5HSQ A;  5AVF A;  4JGQ A;  5HWW A;  4LRY C;  1DP9 A;  4HH3 A;  3LUQ A;  4EEU A;  5HDC A;  1EW0 A;  2CMN A;  2QWS A;  4JGR A;  1S1Y A;  4JGP A;  1T1A A;  3EWK A;  1DP6 A;  3MJQ A;  2K7S A;  4WL9 A;  4EEP A;  2OWJ A;  5G4Z A;  3BY8 A;  3LIE A;  2HV1 A;  2PR6 A;  4GHI A;  1OTD A;  2OOL A;  3UMD A;  3SW1 A;  1XJ3 A;  4MN5 A;  3CWF A;  1UWP X;  1XJ4 A;  4WLA A;  3LIF A;  2BAS A;  2VV8 A;  1N9O A;  2KDK A;  2WKP A;  3MFX A;  3F1P A;  2V0U A;  4I3I A;  5J7E A;  5I5L A;  3PHY A;  3F1O B;  4KUO A;  5HDS A;  4EXO A;  1TS8 A;  3LIC A;  5DKK A;  3UB8 A;  2QJ5 A;  3VOL A;  1G28 A;  5F5Y A;  1UGU A;  4PKY A;  4JGO A;  1GSW A;  3LI8 A;  2QHK A;  5HD3 A;  1T19 A;  2PHY A;  3C2W A;  5J3W A;  2PD7 A;  5A8B A;  1V9Y A;  4LPZ A;  4EET B;  3IBR A;  4WUJ A;  2KX6 A;  3F1N B;  1N9N A;  3VE3 A;  3B33 A;  3UB7 A;  4GS9 B;  4HIA A;  4YWZ A;  4KUK A;  4NXB A;  1XFQ A;  3FC7 A;  2L4R A;  3NOU C;  4E04 A;  3BWL A;  5IU1 A;  3T50 A;  2JN7 A;  3CAX A;  3NOT C;  4R38 A;  3C8C A;  3RH8 B;  1MZU A;  1S4R A;  1GSV A;  2W27 A;  3NHQ A;  2INW A;  3GEC A;  4GW9 A;  2I9V A;  4L9G A;  3MXQ A;  2QJ7 A;  1BYW A;  1X0O A;  4BBV A;  2L1M A;  1D06 A;  4M4X A;  1JNU A;  4HJ3 A;  2V1B A;  3NJA A;  3LI9 A;  2A24 B;  3F1O A; 
#chains in the Genus database with same CATH topology
 4Y3I A;  1MBL A;  2OLU A;  3KYZ A;  2WGW A;  4WF0 A;  3MQ0 A;  3CLO A;  1PRQ A;  3T4L A;  4ZJ3 A;  2XK1 A;  3PTE A;  5K5B A;  2PDR A;  4I3J A;  4BBU A;  3UPP A;  2V9A A;  2Y2N A;  5DJT A;  3ZCZ A;  1F5M A;  3FPW A;  3MR0 A;  5F1F A;  4X1M A;  3UE3 A;  4Q0J A;  4X68 A;  1KVM A;  4NEE D;  3H82 B;  4B4Z A;  3TRC A;  1N9L A;  3BY9 A;  4BMW A;  3UB5 P;  3LGO A;  3BEC A;  1D7E A;  1KOU A;  5EFW A;  1E25 A;  3C4O A;  4O7D A;  1OT9 A;  4PPR A;  4Y0T A;  3PAE A;  1P97 A;  3SS4 A;  3S7P A;  1HVB A;  2DRW A;  2MJ6 A;  4K91 A;  5CXW A;  1PZO A;  2HDS A;  3ZDJ A;  4QY6 A;  2QKP A;  3MXS A;  4EER A;  2EX8 A;  4F3L B;  3T4J A;  5FSR A;  2XF3 A;  4BL3 A;  1OJG A;  4ZJ1 A;  4HEF A;  3UE6 A;  4N9K A;  3KSH A;  1KVL A;  2XQZ A;  3V5M A;  3UE0 A;  1PIO A;  3A3F A;  5CTN A;  1SZV A;  4GD6 A;  2HGV A;  5CER A;  3UB9 A;  5HAQ A;  2ZMF A;  1KDS A;  2ZOI A;  2H0T A;  3LY4 A;  4XT2 B;  5CGX A;  2EFU A;  1K25 A;  4FOF A;  3H9W A;  4BEN A;  5FAQ A;  2WGV A;  1F9I A;  3BFF A;  3VMA A;  2G7U A;  4UA7 A;  3G30 A;  3ZVT A;  1IYS A;  4DN0 A;  5M1A A;  3ZHH A;  4JXS A;  3D72 A;  1FSW A;  1YT4 A;  3TW8 A;  5GLC A;  1PWC A;  3KX0 X;  2L0W A;  3OCL A;  2R78 A;  1ES5 A;  5IS1 A;  1XGI A;  3JVU A;  4MNR A;  1T1C A;  3FWL A;  2Q9M A;  1GSX A;  1O7E A;  3O3V A;  4EQ1 A;  1IYQ A;  4LV2 A;  4HY8 A;  2VZW A;  4L0L A;  4U0X A;  3NOP C;  4ZTK A;  2Y8H A;  4WN5 A;  2VK3 A;  4QWO A;  1W8Y A;  3WS4 A;  4OPY A;  4GZB A;  1S6R A;  2OWH A;  2PBD P;  5AQ9 A;  4GOG A;  1Y28 A;  3IX8 A;  3TG9 A;  1S66 L;  3MQQ A;  4E3I A;  2VJW A;  2BG1 A;  3T4S A;  4PM7 A;  4S2M A;  3UB6 A;  1UWN X;  1XP4 A;  4JPM A;  2V20 A;  1IYP A;  2G2U A;  2GDN A;  3JVV A;  4PM5 A;  5GHX A;  2XFT A;  2ZC4 B;  1O07 A;  4MBF A;  5BOH A;  4OOL A;  5AVE A;  2J3W A;  2Y2L A;  1T18 A;  3DTM A;  3QHY A;  5F6A A;  5I94 A;  3EQV A;  4E3J A;  1YLT A;  3K3C A;  4EUV A;  3ICY A;  3UME A;  2M7V A;  1OT6 A;  5DVA A;  4R3B A;  1JVJ A;  3C4P A;  3ZG0 A;  5CX7 A;  4LGW A;  1PI4 A;  2WKE A;  4I5S A;  2C5W B;  4O01 A;  1NYM A;  3PXP A;  3HLF A;  1IEL A;  1FCM A;  3KYQ A;  4LFU A;  2W3E A;  4JKT A;  1XFN A;  2P9V A;  3E98 A;  3RXX A;  4DF6 A;  5AVF A;  1FR6 A;  3V50 A;  5EUA A;  2CC1 A;  3HCY A;  1DP9 A;  5FQQ A;  3EGD C;  4IUH A;  5L07 A;  3WS5 A;  2HP5 A;  2R9X A;  3LUQ A;  1W8Q A;  2EXA A;  3B42 A;  1NJ4 A;  1S1Y A;  4LV1 A;  1DP6 A;  1KE0 A;  1CK3 A;  4S2N A;  3LCE A;  2K7S A;  4WL9 A;  3NI9 A;  2JCH A;  2PT7 A;  4G3W A;  2OWJ A;  5G4Z A;  3UY6 A;  3BY8 A;  3QP4 A;  1GHM A;  3Q07 A;  5D3O A;  1VET B;  1L0G A;  5FI2 A;  2OOL A;  2IWD A;  4HBU A;  1K0K A;  4Y5F A;  3SH7 A;  4UA9 A;  2V8F A;  2ZC5 B;  3HL9 A;  3CI6 A;  1J3W A;  2DNS A;  2ZM0 A;  2X02 A;  2IA2 A;  4U3T A;  1BSG A;  2XSS A;  4WLA A;  2EX9 A;  5HPF A;  3LIF A;  1MXO A;  4OLD A;  3VP0 A;  2JC7 A;  3IF6 A;  4NK3 A;  2LB5 A;  3C5A A;  3BRM A;  1FQG A;  2ZC6 B;  2IWB A;  3T4Q A;  2B95 A;  3D4F A;  1MKI A;  4OH0 A;  3EEA A;  2Y2M A;  4B93 A;  3NCK A;  2G2W A;  2XFS A;  2WGW B;  3IF5 A;  4GJ4 A;  4EXO A;  4O8G A;  3CJM A;  5CRF A;  5HX9 A;  3OPP A;  3CPT A;  4WEK A;  2WKI A;  2XDM A;  3JPU A;  2O99 A;  1DJC A;  4EBN A;  4JGO A;  3EOI A;  4MCW A;  3QP1 A;  1F2K A;  3T4O A;  5GHZ A;  2QHK A;  3AGD A;  1T19 A;  3QNB A;  2E8J A;  4B88 A;  2EXB A;  1PWD A;  4EET B;  3HUM A;  1HD8 A;  4B4X A;  1YMX A;  2W1T A;  1N9N A;  4HBT A;  4FTX A;  3VFF A;  4N9L A;  5TJJ A;  5E2G A;  1MPL A;  3BJN A;  3DAV A;  3R7W A;  3CMZ A;  4NXB A;  2QZ6 A;  2L4R A;  4UQI S;  4E04 A;  3KSI A;  3BWL A;  3ZNY A;  2OSU A;  2WZX A;  1G68 A;  3S1Y A;  3C8C A;  2Q9N A;  5E2E A;  2EWV A;  3OC2 A;  1BUE A;  1SKF A;  2INW A;  2JE5 A;  4GD8 A;  3K2N A;  1TD5 A;  2I9V A;  4HJ3 A;  3NJA A;  3S7N A;  3L9K A;  5FQJ A;  1M6K A;  1XJ2 A;  3N8L A;  4L9E A;  5CHJ A;  1CEF A;  2W3D A;  2VGL S;  4KZ3 A;  4I38 A;  3D3O A;  3G6O A;  3ZG7 B;  4OQ0 A;  1CI9 A;  2WUQ A;  1CI8 A;  2JKT I;  3HLD A;  3BFE A;  1ZG4 A;  4RQ9 A;  4Z1W A;  4KZ9 A;  3FG8 A;  2HP9 A;  5HD5 A;  1K55 C;  4M3K A;  1U60 A;  3MQO A;  3OLO A;  3SOI A;  4RX2 A;  3PBO A;  1OTI A;  4GS9 A;  4C3Q A;  5E43 A;  4HJ4 A;  1S67 L;  3M2K A;  1YKD A;  2Y2Q A;  3GDI A;  1TS7 A;  2A2L A;  1YLY A;  1Q2Q A;  2XA7 M;  2QPN A;  3HJI A;  3SZT A;  4RX3 A;  3RTY A;  4E6W A;  3HBR A;  4R4S A;  4MN7 A;  4ME4 A;  2HJ9 C;  4LCL A;  3S22 A;  1A0K A;  5F68 A;  3G35 A;  1CF0 A;  2Z2M B;  3ZYT A;  3S7O A;  1ZKJ A;  3BQA A;  1LLB A;  3SH8 A;  5JYP A;  1G6O A;  2E8I A;  4P6B A;  4R23 A;  4GKU A;  2A24 A;  4GLQ A;  3UO9 A;  4R3A A;  3CUE C;  3IWO A;  2ZMV A;  2OAP 1;  2HPB A;  3IQA A;  4BLM A;  4X56 A;  1NRF A;  4L9F A;  4DE0 A;  5F82 A;  2X01 A;  3Q7V A;  5L2F A;  4HP9 A;  3VSK A;  2EWW A;  4Y15 A;  2BLS A;  3TE8 A;  3T1S A;  1LT0 A;  3IXG A;  4ETZ A;  1HZO A;  3IS2 A;  1RGY A;  4DDS A;  1YSQ A;  5J8X A;  1IKG A;  5CEC A;  3C38 A;  5HL6 A;  3MFD A;  2P08 A;  2ZBB A;  4KQQ A;  5HAP A;  3Q1F A;  3K3D A;  2Z2L B;  1JWP A;  3LO7 A;  1BLC A;  2P9V B;  5KSC A;  4YNR A;  4BWI A;  4P6Z M;  3MZF A;  1NLZ A;  1L0F A;  2ZOH A;  2D02 A;  3LR0 A;  5EPH A;  2Y2G A;  3VOZ A;  4H8R A;  3IXD A;  1ERO A;  5FA7 A;  1PYY A;  4K08 A;  3IT9 A;  4WZ5 A;  3DTE A;  3VSL A;  3NDE A;  4U0T A;  4ID4 A;  2WKH A;  3NDG A;  3A0S A;  5G4Y A;  4E3N A;  2W3F A;  3P09 A;  1Y54 A;  3OPH A;  4Y7P A;  1NWZ A;  4MN6 A;  1E3U D;  1OTE A;  1H8Y A;  5EVI A;  2ZQC A;  3MF0 A;  3GVB A;  3EEH A;  1VB6 A;  4KZB A;  3H7W A;  4KZ6 A;  5EVE A;  2ZMA A;  1GHI A;  2K2N A;  4I39 A;  3IF6 B;  4CLC A;  1W63 M;  4BBT A;  1TS0 A;  4HP4 A;  3E0Y A;  5EOO A;  4H6J A;  4KEN B;  5J4E A;  1LSW A;  3G2Y A;  2FH5 A;  4DJ3 A;  3HLE A;  4HJ6 A;  1DJB A;  2NUP C;  2UWX A;  4LRY C;  5HPI A;  4OQG A;  5KMW A;  5CGS A;  3JYI A;  4KZ4 A;  4R4R A;  3VP3 A;  4K0X A;  1CJF A;  1I2S A;  3CPT B;  1LL5 A;  4EEU A;  1STZ A;  2CMN A;  3AGF A;  1PW8 A;  2QWS A;  5EEC A;  4JGR A;  4JGP A;  1YPR A;  3EWK A;  1ACF A;  4C6Y A;  4ZAM A;  5HAI A;  4BD1 A;  3FV7 A;  4WMC A;  5E2H A;  4BL2 A;  1SDN A;  1NZO A;  2WAD A;  3QP2 A;  3NUL A;  3UPO A;  1OME A;  2HJE A;  2W1T B;  3TSG A;  3Q82 A;  5G18 A;  3ZFZ A;  3A3J A;  1ES3 A;  3NBL A;  5DTT A;  3G4P A;  3R7W B;  2Y2K A;  3BM6 A;  3LR4 A;  3KSG A;  1S0W A;  4YFM A;  1WE4 A;  1XJ3 A;  5FAT A;  4FSF A;  3CWF A;  3PBQ A;  5A91 A;  1PZP A;  1SDE A;  2ZQ9 A;  4QPR A;  4RYE A;  1FR1 A;  2Y91 A;  1YM1 A;  4CQH A;  5AJG A;  3ITA A;  2BAS A;  5FDH A;  5FQM A;  1PWG A;  4RA7 A;  3HLC A;  5EM1 A;  2KDK A;  3UDF A;  1EI5 A;  4S2K A;  3PBR A;  3UNW A;  1OPX A;  3O5Y A;  5GL9 A;  5I5L A;  2ZC7 A;  1PFL A;  4R3J A;  2VGJ A;  3NEC A;  2PU2 A;  5HDS A;  2GX5 A;  2FFF B;  5A92 A;  3GV9 A;  3LIC A;  5FAP A;  1KGE A;  4MBK A;  2P04 A;  1L0D A;  3UB8 A;  1L2S A;  3N8S A;  4LV3 A;  5F5Y A;  1UGU A;  4JXV A;  4PKY A;  4DE3 A;  1GSW A;  5KZH A;  3IX3 A;  2WGI A;  2XD5 A;  3OZH A;  5HD3 A;  3G31 A;  4EBL A;  2PD7 A;  5A8B A;  1DY6 A;  3HLB A;  4WUJ A;  3D9Y A;  2KX6 A;  4ETX A;  3UB7 A;  4GS9 B;  2JKR I;  4HIA A;  2Y79 A;  2KOI A;  4NKP A;  3O87 A;  4MBH A;  2PBY A;  2ZL1 A;  5HAR A;  4S2N C;  4EBP A;  3BYD A;  3IWQ A;  5IHV A;  1S4R A;  3ITB A;  1GSV A;  2Y2H A;  5FQK A;  4QU3 A;  2O9C A;  4OP8 A;  4CJN A;  1VEU A;  5TFQ A;  3MXQ A;  3LFV A;  1ZG6 A;  3U4L P;  4QJG A;  1BYW A;  1X0O A;  2L1M A;  2XD1 A;  2V1B A;  1TF1 A;  3KSF A;  2A24 B;  3NIA A;  3CZD A;  1ESI A;  3N4I A;  1TDL A;  2VV6 A;  3G2Z A;  4B9O A;  4X1L A;  3DBA A;  3I7J A;  5FI7 A;  1LI9 A;  3IF6 C;  4DDY A;  3LYX A;  3Q7V B;  1YMS A;  4LRZ E;  5EOE A;  1MY8 A;  3EQU A;  3A3I A;  3ZG8 B;  1ALQ A;  4X53 A;  2B18 A;  1JTD A;  4BQM A;  3IS2 B;  4DJ2 A;  1ONH A;  4NXE A;  5TR7 A;  1AXB A;  4N1H A;  4FH2 A;  3F1N A;  4FUW A;  1NRJ A;  3ZG5 A;  2R9W A;  4S2J A;  3P01 A;  4P0M A;  5C5K A;  5HW3 A;  4QB8 A;  2PAV P;  3GMW A;  5F1G A;  2NUT C;  3SH9 A;  1JWZ A;  3GR2 A;  4DMZ A;  3B47 A;  4EU0 A;  1IFQ A;  1LSX A;  1S4S A;  5CTM A;  3ZQ5 A;  3G34 A;  5HDD A;  3MKF A;  4E3K A;  4ZBE A;  5TGF A;  4LRX C;  3UDX A;  5DKL A;  4Y2F A;  4X6T A;  1W7F A;  1W79 A;  2ZQ7 A;  2V0W A;  3DWZ A;  4KZ7 A;  3L7H A;  1K4F A;  2K31 A;  4P6Z S;  3A0R A;  3BLM A;  5DFX A;  5FI6 A;  4OLG A;  4KZ5 A;  1S1Z A;  4EV4 A;  3MKE A;  2J80 A;  1W5D A;  4MDZ A;  3RJU A;  4QHC A;  4CLC E;  2XRO A;  1NLY A;  3BW6 A;  3E4O A;  3OPL A;  4LLO B;  1QMF A;  1XA7 A;  5CGW A;  4ZJ2 A;  2FFY A;  1HTZ A;  1K56 A;  1T1B A;  2WAE A;  3DWK A;  1LL8 A;  4WYY A;  5EVI B;  4IVI A;  4DRT A;  4I3A A;  1Z09 A;  4LCM A;  5MC7 A;  4R0Q A;  2PYR A;  3H7W B;  4PHT A;  2BTF P;  1K57 A;  1Z6F A;  3PBS A;  1YAX A;  4CLC B;  1BZA A;  5GLA A;  1GHP A;  4E3M A;  2WYX A;  1WYC A;  2PRF A;  4H6J B;  5DTK A;  2H5S A;  4ZRR A;  1YLJ A;  1H3Q A;  4WBG A;  1YSP A;  1BT5 A;  3LID A;  4KQO A;  4G3V A;  2YKH A;  3WS1 A;  3O86 A;  3ZG9 B;  3V67 A;  1K6R A;  3M6B A;  1IEM A;  2JHE A;  5TBM A;  3W4O A;  4JF6 A;  5GLB A;  3IXB A;  2I72 A;  3HVF A;  1KDW A;  2GZA A;  5DTS A;  1NY0 A;  3B3X A;  3BFD A;  2EFX A;  1RGZ A;  5EE8 A;  4WM9 A;  3P98 A;  3T4T A;  4EQI A;  2AVX A;  2OAQ 1;  1K55 A;  3VP1 A;  5F69 A;  4Y17 A;  4P85 A;  2JKG A;  4OQH A;  4R6L A;  3EGX C;  3PYP A;  4EW7 A;  4HI4 A;  3A0V A;  4GNU A;  3LEQ A;  2VEA A;  5HL1 A;  4KQR A;  3W4P A;  2WKQ A;  1KE3 A;  1D1J A;  4JBF A;  2H28 A;  3T1R A;  1NXY A;  3FPV A;  3UDI A;  4PAU A;  1DP8 A;  4OPZ A;  4PKY G;  3C7U A;  1G6A A;  5FAS A;  3MSH A;  2M7U A;  3N7W A;  1FSY A;  1XKZ A;  1DJA A;  5HSQ A;  3V3R A;  4OPR A;  5HWW A;  1ERQ A;  1HLU P;  1FCN A;  4Y0U A;  5DF7 A;  1PI5 A;  1ESU A;  2FZ0 A;  4A5R A;  1VM1 A;  1IYO A;  3A3D A;  4OON A;  4HH3 A;  4ESP A;  1I5Q A;  2LB9 A;  1K54 C;  3QNC A;  2Y55 A;  2Q0O A;  1J9M A;  3WRZ A;  1WYB A;  5FEF A;  2HDR A;  3MJQ A;  5FQI A;  1SKO A;  4PMA A;  2JKT M;  3WWX A;  3M6H A;  3G32 A;  1OTD A;  3GTC A;  3LR3 A;  3DTK A;  3PBT A;  1BTL A;  2Y2O A;  3PAG A;  3SW1 A;  3BLS A;  1YQS A;  1NZU A;  4X25 A;  1RP5 A;  4MN5 A;  4RVA A;  2V2F F;  2ZL1 B;  3QP6 A;  2A3U A;  1UWP X;  4XUZ A;  3C7V A;  1BLP A;  5AQA A;  5A90 A;  1LHY A;  1KGF A;  4WZ5 C;  5AQ7 A;  5GLD A;  1TVF A;  4K0W A;  1H0M A;  1MC0 A;  5GHY A;  2ACG A;  4UQI M;  1VEU B;  1N9O A;  3S7Q A;  3BQ8 A;  4YOF A;  4WZ4 A;  4F94 A;  3S4X A;  2WKP A;  1BLS A;  4MLL A;  3MFX A;  1E4D A;  3F1P A;  2V0U A;  3E2K A;  4I3I A;  5J7E A;  4KUO A;  3IBJ A;  5EVI C;  5DF9 A;  5KSH A;  4Y0O A;  2QYB A;  2ZD8 A;  2XR0 A;  1KE4 A;  2J7V A;  5DKK A;  2P74 A;  1K4E A;  4CLC C;  3C30 A;  2QJ5 A;  1TDG A;  1G28 A;  4IED A;  5JYO A;  1ES4 A;  1JWV A;  2H10 A;  1KGG A;  3LI8 A;  4Q0I A;  3T1Q B;  5CEB A;  1N4O A;  2VGL M;  3C2W A;  3HRE A;  1C3B A;  4DKI A;  3BEB A;  1V9Y A;  4FCF A;  5F83 A;  3MZD A;  3F1N B;  4Q8I A;  4GB7 A;  5L09 A;  4FD8 A;  4YWZ A;  4KZ8 A;  1XFQ A;  4BJP A;  3FC7 A;  4JF4 A;  4DXB A;  3NOU C;  2OV5 A;  2UV0 E;  4JXW A;  2JBF A;  1K6S A;  5IU1 A;  4XXR A;  3T50 A;  1NYY A;  2JN7 A;  1VQQ A;  3NOT C;  1FIL A;  3V3S A;  4IJG A;  3HUO A;  1BUL A;  2HP6 A;  1H8M A;  3IHB A;  4II7 A;  3FKV A;  3NHQ A;  3NC8 A;  3PR6 A;  4L9G A;  5DF8 A;  3RFB A;  2QJ7 A;  1MWT A;  4BBV A;  3TJZ C;  1D06 A;  4M4X A;  3IXH A;  1CQA A;  5L10 A;  1MWU A;  4G3K A;  3ZGA B;  1QME A;  1RCJ A;  2B5R A;  4N92 A;  2HF6 A;  3F1O A;  3RXW A;  4S2O A;  2Y2I A;  4UA6 A;  2D01 A;  4HOI A;  1EWZ A;  1GCE A;  3O88 A;  4QY5 A;  4WEL A;  3U2A A;  2XGN A;  4E3O A;  4NG2 A;  3FKW A;  4IBX A;  4AFI A;  4S2I A;  2IWC A;  1N9B A;  2ZQD A;  1ONG A;  4DE1 A;  2J8Y A;  2B02 A;  2OLV A;  1XJ6 A;  2J9O A;  5FAO A;  2PD8 A;  3W4Q A;  1GA9 A;  4DE2 A;  1PW1 A;  1V9Z A;  3ZNT A;  4MEZ A;  3LIA A;  5FQ9 A;  2JKF A;  2Y2P A;  3T1X A;  4EUZ A;  3HUN A;  4GHI B;  2EX6 A;  2ZQ8 A;  2HDQ A;  1G5U A;  4HQA A;  3LIB A;  3WS2 A;  1XGJ A;  1Y4O A;  2V1Z A;  2Z6D A;  2XH9 A;  4KQD A;  1H5X A;  1LI0 A;  4KG5 A;  2W1R A;  1LSV A;  5TBM B;  3HJK A;  1FOF A;  3OBF A;  4UHU A;  2O9B A;  2XRN A;  3IHA A;  2X71 A;  2PR5 A;  1WA9 A;  5EVI D;  4X55 A;  2GNX A;  4IVK A;  4HES A;  4OOM A;  4C75 A;  1YLW A;  2W3H A;  4E3L A;  3VV4 A;  3QP8 A;  5HWT A;  4CLC D;  2HDU A;  2O9A A;  3HLW A;  2ZM8 A;  3BFC A;  4BD0 A;  1GA0 A;  4DXC A;  4HHD A;  2PU4 A;  1ODV A;  3GQZ A;  3ULF A;  2P7J A;  3E2L A;  1XX2 A;  4UEY A;  2Y2J A;  2XA7 S;  3OOV A;  4PM9 A;  3E4P A;  2V1A A;  4NXF A;  3VE4 A;  2GJ3 A;  5DJU A;  1P0Z A;  1XPB A;  4ARZ B;  2YKF A;  3FYZ A;  3H82 A;  5E2F A;  2VLG A;  3DW0 A;  1BLH A;  5AQB A;  4D2O A;  3LEZ A;  5FL3 A;  3FZC A;  4WMC D;  4HH2 A;  2J3T C;  3LY3 A;  2RL3 A;  2VA0 A;  4EWF A;  1OTA A;  3ISG A;  3T4K A;  4CPK A;  3KO6 A;  4HNB A;  1P9W A;  4NXG A;  3E4Q A;  5HWV A;  4F3L A;  1MWR A;  1FIK A;  5HZH A;  3MXR A;  2VKS A;  3VFH A;  1TS6 A;  2DCF A;  5M19 A;  1ZHH B;  2M1C A;  1Q2P A;  1SKO B;  4LEN A;  2DMW A;  4QD4 A;  4R1G A;  4XT2 A;  2ZC3 B;  3VP4 A;  3N6I A;  3UPN A;  4Y13 A;  1OJ5 A;  1ZTU A;  4R70 A;  1F98 A;  3MS6 A;  1L3L A;  3BFG A;  3M2J A;  2PYP A;  4FH4 A;  4IBR A;  1OTB A;  3IH9 A;  4YIN A;  3CG5 A;  2JKR M;  4GCZ A;  1DRM A;  5A93 A;  1CEG A;  2O0Y A;  2Z6C A;  3IWI A;  4NET A;  3MBZ A;  2EA9 A;  2WKR A;  1AWI A;  2W0N A;  2VX8 A;  4UAA A;  2Y59 A;  2EX2 A;  4GDB A;  5U47 A;  5KIZ A;  4OOY A;  4EES A;  2VGK A;  2KLI A;  2C6W B;  4OQI A;  1XA1 A;  2ZQA A;  3P7N A;  1TEM A;  2VV7 A;  3F1P B;  1SCW A;  3Q81 A;  4JGQ A;  1H8Z A;  2ZLY A;  1YLP A;  3UN7 A;  1K57 C;  1LL9 A;  1PNE A;  5HDC A;  1EW0 A;  3IX4 A;  4P87 A;  4D60 A;  3A3E A;  4GN2 A;  1ERM A;  1K38 A;  1T1A A;  3UE1 A;  4O0P A;  3CIT A;  4EEP A;  4GDN A;  4Z9Q A;  4PM8 A;  5EM0 A;  2ZJ9 A;  3LIE A;  3OCN A;  2HV1 A;  2PR6 A;  1JTG A;  3GRJ A;  4GHI A;  2H0Y A;  3SS5 A;  3T12 B;  1I2W A;  4E6X A;  2WK0 A;  4WEJ A;  3PBN A;  1FCO A;  3UMD A;  5IT5 A;  3HLG A;  3W8K A;  4S2L A;  1XJ4 A;  4JF5 A;  5CHU A;  4OPQ A;  5FEG A;  1XXM A;  2HZ5 A;  4PM6 A;  3W2Z A;  5EV0 A;  3N8R A;  4OP5 A;  2VV8 A;  4KG2 A;  4KZA A;  5L8M A;  1E3U A;  4Q0H A;  3V39 A;  3DTI A;  1MWS A;  4OKP A;  1MKM A;  3SS3 A;  2J3T D;  3PHY A;  2WZZ A;  3F1O B;  5HFO A;  4N1X A;  3GSG A;  4JLF A;  2J9P A;  1TS8 A;  3MMH A;  3NY4 A;  3VP2 A;  3VOL A;  4JXG A;  4X69 A;  1IKI A;  3WS0 A;  4ZDX A;  2WAF A;  5M18 A;  1VHM A;  3AGE A;  1ZC2 A;  5CHM A;  2PHY A;  4ARZ A;  3KYE A;  1W63 Q;  2W3G A;  5J3W A;  5DFY A;  4S2P A;  4LPZ A;  3IBR A;  2QMI A;  2XEP A;  4LV0 A;  3VE3 A;  5CED A;  3OPR A;  3B33 A;  1M40 A;  1VET A;  3ZVW A;  1ES2 A;  4KG6 A;  3IH8 A;  4XUX A;  4KUK A;  1IOU A;  2RCX A;  3CUE A;  3TOI A;  1P9R A;  5LBR A;  4IHQ A;  3CAX A;  3VOY A;  4MMN A;  4R38 A;  3WRT A;  2A49 A;  3RH8 B;  1MZU A;  5EVL A;  1L0E A;  3LR5 A;  2W27 A;  3GEC A;  4GW9 A;  3QP5 A;  1K56 D;  4IUK A;  2Y4A A;  1YLZ A;  3MZE A;  1SHV A;  2ZM2 A;  1JNU A;  2XLN A;  3CHW P;  5FDS A;  3LI9 A;  2V8C A;  1K54 A;  4OVD A;  3Q7Z A;  3R4K A; 
#chains in the Genus database with same CATH homology
 4Y3I A;  2D01 A;  4HOI A;  2VV6 A;  1XJ2 A;  3KYZ A;  4B9O A;  4L9E A;  4WF0 A;  3MQ0 A;  2W3D A;  4WEL A;  2VGL S;  3U2A A;  4I38 A;  3DBA A;  3D3O A;  3G6O A;  3CLO A;  3LYX A;  3T4L A;  4LRZ E;  3EQU A;  2JKT I;  5K5B A;  2PDR A;  4I3J A;  4RQ9 A;  4AFI A;  4Z1W A;  4BBU A;  2V9A A;  3FG8 A;  5HD5 A;  5DJT A;  2B18 A;  1F5M A;  3FPW A;  2B02 A;  3MQO A;  3IS2 B;  3OLO A;  1XJ6 A;  4DJ2 A;  4NXE A;  3MR0 A;  3PBO A;  2PD8 A;  1OTI A;  3F1N A;  1NRJ A;  1V9Z A;  3UE3 A;  4GS9 A;  3LIA A;  4Q0J A;  4NEE D;  3H82 B;  3TRC A;  1N9L A;  3P01 A;  4HJ4 A;  1S67 L;  3BY9 A;  5C5K A;  4BMW A;  1YKD A;  3GDI A;  4GHI B;  1TS7 A;  2A2L A;  1D7E A;  1KOU A;  2NUT C;  5EFW A;  2XA7 M;  3HJI A;  4HQA A;  3LIB A;  1OT9 A;  2Z6D A;  4DMZ A;  3B47 A;  3RTY A;  1P97 A;  4KQD A;  3S7P A;  4MN7 A;  2MJ6 A;  4ME4 A;  4EU0 A;  2W1R A;  2HJ9 C;  1LSV A;  5F68 A;  5TBM B;  1IFQ A;  1LSX A;  3HJK A;  1S4S A;  3ZQ5 A;  2QKP A;  5HDD A;  3OBF A;  3ZYT A;  4EER A;  4F3L B;  3T4J A;  3S7O A;  4LRX C;  2O9B A;  2XRN A;  5DKL A;  4Y2F A;  3BQA A;  1OJG A;  2PR5 A;  3UE6 A;  2V0W A;  3KSH A;  1WA9 A;  1G6O A;  2K31 A;  4P6Z S;  2GNX A;  3A0R A;  5DFX A;  1S1Z A;  2HGV A;  2A24 A;  4OOM A;  3UB9 A;  4GLQ A;  2ZMF A;  2J80 A;  2ZOI A;  2W3H A;  4XT2 B;  4R3A A;  3CUE C;  2ZMV A;  4FOF A;  4MDZ A;  3VV4 A;  4CLC E;  2OAP 1;  3H9W A;  2XRO A;  1NLY A;  3BW6 A;  3E4O A;  4LLO B;  5HWT A;  4CLC D;  4L9F A;  2O9A A;  1F9I A;  2G7U A;  1T1B A;  4HP9 A;  2EWW A;  1LL8 A;  4HHD A;  3TE8 A;  1ODV A;  4DN0 A;  4I3A A;  3ULF A;  5MC7 A;  1LT0 A;  2PYR A;  3D72 A;  3H7W B;  4PHT A;  4ETZ A;  3TW8 A;  2P7J A;  3IS2 A;  3KX0 X;  2L0W A;  1YSQ A;  3OCL A;  4UEY A;  3PBS A;  1YAX A;  2XA7 S;  4CLC B;  3OOV A;  2R78 A;  3E4P A;  2V1A A;  4NXF A;  3VE4 A;  2GJ3 A;  5IS1 A;  3C38 A;  5DJU A;  1P0Z A;  3JVU A;  4ARZ B;  2YKF A;  5HL6 A;  2P08 A;  3H82 A;  2ZBB A;  4H6J B;  1T1C A;  2VLG A;  1GSX A;  3K3D A;  4EQ1 A;  4ZRR A;  4HY8 A;  5FL3 A;  2VZW A;  4L0L A;  4YNR A;  1H3Q A;  3NOP C;  4BWI A;  2Y8H A;  4P6Z M;  4HH2 A;  4WN5 A;  1NLZ A;  2J3T C;  2VA0 A;  1YSP A;  3LID A;  1OTA A;  4KQO A;  4G3V A;  2YKH A;  3T4K A;  3V67 A;  2ZOH A;  3KO6 A;  4HNB A;  2OWH A;  1P9W A;  2D02 A;  2JHE A;  3LR0 A;  4NXG A;  5TBM A;  1Y28 A;  1S66 L;  3MQQ A;  3E4Q A;  2VJW A;  5HWV A;  3T4S A;  4F3L A;  3UB6 A;  1UWN X;  5HZH A;  2VKS A;  2GZA A;  1TS6 A;  1ZHH B;  4K08 A;  2M1C A;  2DMW A;  3JVV A;  4XT2 A;  3T4T A;  2OAQ 1;  4OOL A;  1OJ5 A;  1ZTU A;  5AVE A;  2J3W A;  3A0S A;  1T18 A;  4R70 A;  5G4Y A;  5F69 A;  1F98 A;  5F6A A;  2W3F A;  2PYP A;  3EQV A;  3EGX C;  4R6L A;  3PYP A;  1OTB A;  1NWZ A;  3K3C A;  4EW7 A;  4MN6 A;  4EUV A;  1OTE A;  4HI4 A;  3ICY A;  3UME A;  3A0V A;  2JKR M;  3MF0 A;  2VEA A;  3EEH A;  4GCZ A;  1DRM A;  2M7V A;  1VB6 A;  2O0Y A;  2Z6C A;  3H7W A;  1OT6 A;  2EA9 A;  2WKQ A;  2WKR A;  2K2N A;  4I39 A;  2W0N A;  2H28 A;  2VX8 A;  5CX7 A;  3FPV A;  5KIZ A;  4CLC A;  1W63 M;  4I5S A;  4BBT A;  1TS0 A;  4HP4 A;  4PAU A;  4O01 A;  4EES A;  1DP8 A;  4PKY G;  2KLI A;  3E0Y A;  3PXP A;  4H6J A;  3P7N A;  5J4E A;  2M7U A;  1LSW A;  2FH5 A;  2VV7 A;  3KYQ A;  4DJ3 A;  3F1P B;  4HJ6 A;  2W3E A;  1XFN A;  5HSQ A;  3E98 A;  5AVF A;  4JGQ A;  2NUP C;  5HWW A;  3HCY A;  4LRY C;  1DP9 A;  5HPI A;  2FZ0 A;  3EGD C;  4IUH A;  4HH3 A;  2LB9 A;  3LUQ A;  4EEU A;  5HDC A;  1EW0 A;  1STZ A;  2CMN A;  3B42 A;  2QWS A;  4JGR A;  1S1Y A;  4JGP A;  1T1A A;  3EWK A;  1DP6 A;  3MJQ A;  2K7S A;  4WL9 A;  4O0P A;  3CIT A;  4EEP A;  2PT7 A;  4G3W A;  2OWJ A;  5G4Z A;  3BY8 A;  2JKT M;  3LIE A;  3OCN A;  2HV1 A;  2HJE A;  2PR6 A;  4GHI A;  2W1T B;  1OTD A;  3LR3 A;  2OOL A;  4WEJ A;  3R7W B;  3PBT A;  3PBN A;  4Y5F A;  3LR4 A;  3UMD A;  3KSG A;  3SW1 A;  5IT5 A;  1XJ3 A;  3CI6 A;  4MN5 A;  4FSF A;  3CWF A;  3PBQ A;  1UWP X;  1XJ4 A;  2IA2 A;  2XSS A;  4WLA A;  5HPF A;  3LIF A;  4QPR A;  4CQH A;  5AJG A;  1MC0 A;  2BAS A;  2LB5 A;  3W2Z A;  4UQI M;  2VV8 A;  1N9O A;  3S7Q A;  3BQ8 A;  3T4Q A;  4YOF A;  2KDK A;  5L8M A;  2WKP A;  4Q0H A;  3MFX A;  3EEA A;  3F1P A;  3PBR A;  1OPX A;  2V0U A;  3O5Y A;  4I3I A;  5J7E A;  4B93 A;  1MKM A;  2J3T D;  5I5L A;  3PHY A;  3F1O B;  4KUO A;  3IBJ A;  5DF9 A;  5KSH A;  5HDS A;  2GX5 A;  4GJ4 A;  4EXO A;  2QYB A;  4O8G A;  1TS8 A;  3LIC A;  5DKK A;  2P04 A;  3MMH A;  3UB8 A;  4WEK A;  4CLC C;  3C30 A;  2QJ5 A;  3VOL A;  2O99 A;  1G28 A;  5F5Y A;  1UGU A;  4PKY A;  4JGO A;  3EOI A;  4MCW A;  1GSW A;  1VHM A;  3LI8 A;  3T4O A;  4Q0I A;  2QHK A;  5HD3 A;  1T19 A;  2PHY A;  2VGL M;  4ARZ A;  1W63 Q;  2W3G A;  3C2W A;  5J3W A;  2PD7 A;  5A8B A;  5DFY A;  1V9Y A;  4LPZ A;  4EET B;  3IBR A;  4WUJ A;  2KX6 A;  3F1N B;  2W1T A;  1N9N A;  3VE3 A;  4ETX A;  3B33 A;  3UB7 A;  4GS9 B;  2JKR I;  4HIA A;  5TJJ A;  2Y79 A;  3BJN A;  3R7W A;  4YWZ A;  4KUK A;  4NXB A;  2KOI A;  1IOU A;  4NKP A;  4BJP A;  1XFQ A;  3FC7 A;  2L4R A;  4UQI S;  3NOU C;  4E04 A;  3KSI A;  3CUE A;  3BWL A;  1P9R A;  5IU1 A;  5LBR A;  3T50 A;  4IHQ A;  2JN7 A;  3CAX A;  3NOT C;  4MMN A;  4IJG A;  4R38 A;  3C8C A;  1H8M A;  3RH8 B;  1MZU A;  1S4R A;  2EWV A;  1GSV A;  4II7 A;  3OC2 A;  3LR5 A;  2W27 A;  3NHQ A;  2O9C A;  2INW A;  3GEC A;  3K2N A;  1TD5 A;  4GW9 A;  2I9V A;  3PR6 A;  4L9G A;  3MXQ A;  3LFV A;  4IUK A;  3RFB A;  2QJ7 A;  1BYW A;  1X0O A;  4BBV A;  2L1M A;  3TJZ C;  1D06 A;  4M4X A;  1JNU A;  4HJ3 A;  2V1B A;  1TF1 A;  3KSF A;  3NJA A;  3LI9 A;  4G3K A;  3S7N A;  2HF6 A;  2A24 B;  3F1O A;  3R4K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...