3H82A

Crystal structure of the high affinity heterodimer of hif2 alpha and arnt c-terminal pas domains with the artificial ligand ths020
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
115
structure length
115
Chain Sequence
EFKGLDSKTFLSEHSMDMKFTYCDDRITELIGYHPEELLGRSAYEFYHALDSENMTKSHQNLCTKGQVVSGQYRMLAKHGGYVWLETQGTVIYNPRNLQPQCIMCVNYVLSEIEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription
molecule keywords Aryl hydrocarbon receptor nuclear translocator
publication title Principles of ligand binding within a completely buried cavity in HIF2alpha PAS-B
pubmed doi rcsb
source organism Homo sapiens
total genus 32
structure length 115
sequence length 115
ec nomenclature
pdb deposition date 2009-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08447 PAS_3 PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3h82A00
5EFWA 4B9OA 4RQ9A 5G4YA 4E04A 2YKHA 1DP8A 4GHIB 1S1YA 5DKKA 1OJGA 1OTBA 5IU1A 3BY8A 3SW1A 1DRMA 4NXBA 4XT2B 2D01A 3MQOA 4EERA 3H7WB 4HOIA 3NOPC 3A0RA 4BBTA 3KX0X 3IS2A 4HNBA 1OTIA 4LLOB 2M1CA 4PKYG 1T1CA 1T1BA 4F3LB 3C2WA 3F1OA 4EEUA 3A0VA 2WKRA 5IS1A 1VB6A 4EQ1A 5F6AA 3LIBA 1D7EA 3PYPA 4HJ6A 2VV8A 1V9ZA 4WN5A 3ULFA 2V0WA 1F9IA 3FC7A 5AVEA 3LI8A 1D06A 1S4SA 2PR6A 3VE4A 1S4RA 3D72A 2BASA 5DKLA 3P7NA 1V9YA 2VV6A 2A24A 3EWKA 4HI4A 4HQAA 4I39A 3K3CA 1DP6A 2GJ3A 5HWVA 3VOLA 3UE6A 4WF0A 1KOUA 2PD8A 1S66L 5J3WA 2QJ5A 3MFXA 3CWFA 3A0SA 5DJUA 2PDRA 5J4EA 2K7SA 4WUJA 4EETB 4BBUA 1XJ6A 4NXEA 3F1NB 3NHQA 2I9VA 5AVFA 1F98A 1XJ3A 2PR5A 5F68A 5HDSA 3LIDA 4L9GA 3NOTC 5F69A 1N9LA 5HD5A 2QHKA 5TBMB 1OTAA 1JNUA 3OLOA 1LSVA 1OJ5A 2J80A 3LIFA 1DP9A 3F1PA 4LRYC 3RTYA 4GS9A 4HJ4A 5G4ZA 1P0ZA 1XFQA 2B02A 4I3JA 5I5LA 1N9OA 4R70A 2QJ7A 1XJ4A 2OOLA 2VLGA 3LYXA 4HHDA 3MXQA 2D02A 4WL9A 4HP9A 1OTDA 3H82A 3LIEA 2R78A 3F1NA 3LUQA 2PYPA 2Z6CA 3VE3A 5HWTA 5F5YA 2WKPA 4H6JB 1T1AA 4JGRA 2ZOHA 1ODVA 2WKQA 4I3AA 3E4OA 4HY8A 4GHIA 1OTEA 1XJ2A 4KUKA 2W27A 4I38A 4DJ3A 4BBVA 4XT2A 3FG8A 5J7EA 4KUOA 2HV1A 4HIAA 2P7JA 3H7WA 4K08A 1UWPX 1T19A 5HWWA 2V1BA 3BY9A 4GCZA 4F3LA 1XFNA 4R3AA 2QKPA 4HH2A 4L9EA 1OT9A 3NJAA 3UB7A 3E4QA 2L1MA 3IBRA 3EEHA 3GECA 3LICA 1TS8A 2H28A 1EW0A 3GDIA 1LSWA 2EA9A 3IS2B 1LSXA 4EEPA 4YWZA 2CMNA 4NXFA 3CLOA 3RH8B 2VV7A 1GSWA 3F1OB 2V9AA 2QWSA 2PHYA 4HP4A 4PKYA 5KIZA 1TS6A 2YKFA 2L0WA 1UWNX 4L9FA 1GSXA 2V1AA 1S67L 3ZQ5A 2PD7A 4DJ2A 2JN7A 3NOUC 5HSQA 2PYRA 4I5SA 3BWLA 2V0UA 1N9NA 1MZUA 5A8BA 1P97A 1Y28A 4LRXC 3H9WA 3C8CA 4I3IA 4HH3A 3ICYA 4HJ3A 2A24B 3T50A 3G6OA 4M4XA 5TBMA 3CAXA 1X0OA 3HJKA 3B33A 4LRZE 2W0NA 5DJTA 4GW9A 2ZBBA 1T18A 1WA9A 3UMDA 1TS0A 3UMEA 1TS7A 4MN5A 2JHEA 4KQDA 3UB9A 3LI9A 4R6LA 2KDKA 2OWHA 5HDDA 2KX6A 2VEAA 3MQQA 4EESA 4EW7A 4WLAA 4JGPA 3F1PB 5HDCA 4LPZA 2Z6DA 1OT6A 4GS9B 4H6JA 3LIAA 4JGQA 3UB8A 4MN6A 1NWZA 5HZHA 2ZOIA 2L4RA 1LT0A 3PHYA 4EXOA 2INWA 2OWJA 1GSVA 1BYWA 4R38A 4JGOA 1S1ZA 3H82B 1LL8A 1UGUA 1G28A 3K3DA 5HD3A 3HJIA 4NXGA 3E4PA 3UB6A 3MJQA 3MR0A
chains in the Genus database with same CATH superfamily
1G68A 3MKEA 4E04A 2YKHA 4ARZA 4F94A 4FUWA 1CF0A 1K6RA 3A3FA 3HUMA 2HZ5A 2XSSA 3T4QA 1DRMA 1RCJA 4ETXA 1FILA 3OPRA 4XT2B 5HX9A 1LHYA 2W1TB 2ZLYA 4X6TA 4GZBA 1F5MA 2XFTA 3A0RA 3IT9A 3KX0X 3IS2A 3PBOA 4HNBA 3VOZA 2M1CA 1GHMA 3TW8A 4PKYG 2PT7A 5FQQA 4ZJ3A 2LB5A 3S7NA 4N92A 5DF9A 4R3JA 1NY0A 3B3XA 4RYEA 3BRMA 4H8RA 5IS1A 1BSGA 3U4LP 1LI9A 4MMNA 2FFYA 4DMZA 5F6AA 4OQGA 2W3GA 2VV8A 1V9ZA 3RFBA 3G30A 4B88A 1NLYA 3TRCA 3GTCA 3LGOA 3BLSA 3LI8A 1MY8A 4Q8IA 1KVLA 3C4PA 2Y2OA 5KSHA 5U47A 4YFMA 4GDNA 2Y2QA 3RJUA 2ZM8A 4NKPA 5DKLA 3DBAA 1KGFA 3S7PA 1ONGA 2HJ9C 2VV6A 2A24A 2FH5A 4LV1A 1MC0A 4JF6A 3HBRA 1MXOA 4HI4A 5FA7A 1IOUA 2ZMAA 1GHPA 1KDSA 2WGVA 3K3CA 2OLUA 3VOLA 2GNXA 4WF0A 2ZC7A 3E2KA 1ZKJA 2PD8A 1S66L 2K2NA 2EX6A 4BWIA 5EVIC 2J3WA 1FQGA 5GHXA 3WS4A 3OCLA 2PDRA 2K7SA 1XJ6A 3VMAA 2Y2JA 1WYCA 2I9VA 3C38A 4KQRA 4Q0JA 2VGJA 4RX2A 1E25A 4P85A 2EX8A 4L9GA 4WMCA 3CMZA 1GA0A 4QPRA 4IBRA 1K38A 5TBMB 3UPOA 5L10A 1ESUA 3CG5A 3OLOA 4S2NA 3K2NA 4OONA 5C5KA 2EX2A 1DP9A 3F1PA 1DJAA 2XH9A 1W79A 3RTYA 4JLFA 3S7OA 1E4DA 3NCKA 3QP4A 1XFQA 2O0YA 1BLPA 4QB8A 4DKIA 2QJ7A 4MLLA 3VSLA 4E3NA 5IT5A 4DXCA 3DWZA 3GMWA 5AQBA 2WAFA 5FASA 3F1NA 5HWTA 2I72A 3PBTA 4UQIS 4X1MA 3DTIA 5L09A 5FQ9A 5DTTA 1T1AA 3S1YA 1ONHA 1ODVA 1W5DA 2H0YA 3Q7ZA 2J3TD 1CEGA 3CHWP 1XJ2A 4P6BA 1H8YA 2R9WA 4Y0OA 3ZVWA 4KUOA 3LO7A 2H10A 3C5AA 2VX8A 4Y5FA 3R7WB 2P7JA 3H7WA 5L07A 3TE8A 2HP5A 4QHCA 2DRWA 5HWWA 4GCZA 3WRTA 2E8IA 4R3AA 3VP1A 2Y91A 4UA9A 4N1XA 4ARZB 3CJMA 2Y2IA 1H3QA 3BFFA 4QJGA 1OT9A 3UB7A 5F82A 4LV2A 1YLJA 4P87A 4IVKA 3GECA 3W4QA 3PBQA 4GOGA 3LICA 4LCMA 4NETA 3QNCA 1LSWA 3IS2B 1NZOA 1L0FA 4EUVA 3D9YA 3T4OA 4Y13A 3PAGA 1PI4A 4DXBA 2VGLS 5EVEA 2Z2MB 4HP4A 3W4PA 2LB9A 1CJFA 1MBLA 4OQIA 4QY5A 3BYDA 3Q81A 4GKUA 1FCOA 3LY3A 1MPLA 4C75A 3VP4A 1EI5A 3T1RA 3QP2A 5AQ7A 2W1RA 4KZ7A 4Q0IA 4BL3A 1E3UA 3ZQ5A 3JVVA 1FR6A 3O86A 5HSQA 4II7A 3ZFZA 2KOIA 3IX4A 1N9NA 3GR2A 1MZUA 1P97A 3MFDA 3IXBA 4I3IA 2Y2GA 3ICYA 3ZG7B 4FD8A 3TJZC 1ESIA 4WELA 3UY6A 2A24B 2C5WB 3MF0A 2WADA 4OLDA 5FL3A 4IUKA 3OBFA 3GV9A 1X0OA 3PBSA 3B33A 4HESA 1CK3A 2W0NA 3NY4A 2H0TA 5DJTA 5A90A 2ZQ9A 4GD6A 2QMIA 4YINA 1RGYA 1SZVA 4DE0A 2HP6A 3NDGA 3UMEA 3IWOA 4K91A 3G35A 4JKTA 1KGEA 3MZDA 1YLYA 4RA7A 4KG2A 3SH7A 5HL1A 4S2MA 2OWHA 4OOMA 3EQVA 5EE8A 3QP8A 4HBUA 4WLAA 5FQMA 4XUXA 1SCWA 4JGPA 3F1PB 5HDCA 4PM5A 4R23A 3UB5P 3UB8A 4E3LA 1TD5A 4KZ9A 1N9BA 4CQHA 4GDBA 1SDEA 3E98A 2OWJA 3U2AA 3T4TA 2BLSA 2XR0A 3UO9A 4ZTKA 1LL8A 4X55A 3VFHA 1ES4A 2VGKA 1K56D 3KYEA 4FCFA 3HJIA 4NXGA 3E4PA 1SKFA 3UB6A 4UQIM 3MR0A 4RQ9A 3MS6A 5G4YA 1MKMA 5E2FA 4O7DA 1O7EA 3ZNYA 1YQSA 2PU4A 1OJGA 5IU1A 3HUOA 2QPNA 4YOFA 1I5QA 5FI2A 2D01A 3MQOA 3M2KA 2OSUA 4EERA 1JWVA 1ERQA 3H7WB 4PM9A 5E43A 4HOIA 2VZWA 1ES5A 4FTXA 3VP2A 3EGDC 1OTIA 4LLOB 3S4XA 5CX7A 3C4OA 3NULA 4E3IA 2OAQ1 1T1CA 1ZHHB 3C2WA 1SDNA 5HARA 3F1OA 5D3OA 2WAEA 3QNBA 5FI7A 5TGFA 1YM1A 1VB6A 4CLCD 1PWCA 5CHMA 3LIBA 1L0GA 5AQ9A 1FR1A 3PYPA 4HJ6A 2VA0A 3DTEA 5EOEA 3QP6A 4E6XA 3MZFA 2EFUA 3VP0A 3IX8A 5A91A 3V67A 4N9LA 4KZ3A 3Q82A 1S4SA 1K56A 1G6AA 2PR6A 3B42A 1PWDA 3VE4A 3T4SA 3FKVA 1L0EA 1H8ZA 3D72A 4OQ0A 1KGGA 4GB7A 4M3KA 4G3WA 5K5BA 4MBFA 1WE4A 2M7VA 4WZ4A 2OV5A 1DP6A 2GJ3A 1PRQA 3HREA 4IBXA 4QU3A 3S7QA 1S0WA 4UA7A 1BTLA 3CWFA 1KDWA 3ZHHA 3A3EA 5DFXA 3CUEA 5CHUA 4XXRA 1JWZA 4NXEA 2WGWA 4JBFA 1BLSA 2EFXA 1XJ3A 2PR5A 5F68A 1CI8A 4P0MA 1LI0A 2K31A 5F69A 4OH0A 3MSHA 1MWRA 5BOHA 3BQ8A 2W3FA 3IBJA 3E0YA 4LRYC 4GS9A 4HJ4A 3T1XA 1CI9A 3DW0A 4I3JA 2VLGA 3LYXA 4OPRA 2G2WA 3UDIA 3MXQA 3VP3A 1H5XA 2V8FA 3BQAA 1J9MA 2P08A 1OTDA 4DDYA 3O3VA 5GLDA 3LIEA 4OP5A 4G3VA 3N8SA 1GHIA 5F5YA 1DJCA 3UPPA 1NYMA 3DTMA 2O9CA 5GHZA 1XP4A 2ZOHA 2J8YA 2HJEA 1YLZA 4S2NC 4DF6A 4BD1A 4HY8A 4GHIA 3A3DA 4KZAA 5GLAA 4S2IA 1OTEA 2X02A 4KUKA 4L0LA 4OOYA 3TOIA 5EV0A 2XF3A 1Z6FA 2HV1A 4HIAA 2FZ0A 3ITAA 1HLUP 1KE0A 3C7UA 5DTSA 1BULA 3HLBA 2B18A 2XD5A 4S2KA 4A5RA 3NDEA 4WEJA 4DE1A 1K4FA 3ZCZA 2WKEA 4ID4A 1XFNA 5TR7A 5CECA 1L0DA 4LV0A 3E4QA 1FCNA 2ZC4B 4U0TA 3R4KA 3G34A 5J8XA 4PHTA 3QP5A 1TS8A 5EVID 2Y2NA 3GDIA 1Y54A 1LSXA 1IFQA 3OZHA 1IKGA 2Y2LA 4LFUA 5KZHA 1GSWA 3F1OB 4U3TA 5EUAA 2DCFA 2QWSA 2PHYA 3UDFA 3HVFA 3UDXA 4UEYA 5AQAA 2KLIA 4IEDA 5DF8A 3SH8A 3A3JA 5DF7A 3IXGA 4O0PA 2L0WA 2DMWA 1UWNX 4XUZA 3MKFA 1S67L 2PD7A 2JN7A 3QHYA 3NC8A 2V0UA 2JKRM 1Y28A 1K54A 3UE0A 3C8CA 4Y2FA 3BFEA 1SKOA 4HH3A 5DTKA 3IWQA 1N4OA 4K0WA 3SS3A 5HAIA 5EECA 5MC7A 4JF5A 1YMXA 3T1SA 1PFLA 2JKRI 4GD8A 2Y2KA 4IUHA 4KZ8A 2ZC3B 2HDSA 1IYPA 4LRZE 2HF6A 4MCWA 3ZG0A 1XKZA 5F83A 1AWIA 4FSFA 1T18A 3GSGA 3SOIA 2VKSA 1STZA 3N8LA 3UMDA 3WS1A 3JVUA 2ZJ9A 3ZG9B 1TS0A 3HLWA 2J7VA 5FQJA 2WGWB 4O01A 4OPYA 2Y79A 4S2JA 1FSWA 4EBNA 2QYBA 2WZZA 1M40A 3C7VA 2EX9A 4R6LA 1VQQA 3HUNA 4WM9A 1PW1A 3D4FA 5CXWA 1AXBA 4EW7A 4Y3IA 4D60A 2IWBA 3Q7VA 4GS9B 4H6JA 2Q9NA 5A93A 2XQZA 1NJ4A 2NUPC 2B5RA 1LT0A 4PM7A 1FCMA 3HCYA 5TJJA 3RXWA 3CITA 1ERMA 3LR5A 1H8MA 1BYWA 5HPFA 4N1HA 4BQMA 3L7HA 2NUTC 3AGEA 3BFDA 3S22A 4JXVA 4KZ6A 3HLDA 1UGUA 5HFOA 3K3DA 3FKWA 3W8KA 4E3KA 4RVAA 3BLMA 3ZVTA 1K0KA 4OQHA 3MJQA 2XK1A 5M18A 3ZNTA 5EFWA 4B93A 1I2WA 3LEZA 4GHIB 5FAQA 4R3BA 1ES3A 1OTBA 3PTEA 3KSIA 3SW1A 2W3EA 1YKDA 3D3OA 4Z1WA 2RL3A 5M1AA 3HLGA 4AFIA 3EOIA 1NRJA 2RCXA 5LBRA 1CQAA 1T1BA 2A49A 5CEBA 2PRFA 1JTDA 3A0VA 1W7FA 4WBGA 3IXDA 1J3WA 3CPTA 3AGFA 5EOOA 3RXXA 3M6HA 4EQ1A 5CTNA 3AGDA 2JKFA 1D7EA 4PPRA 2Q9MA 3VFFA 2Y59A 3NECA 2HDRA 2V0WA 1F9IA 3VOYA 3FC7A 2W3HA 2ZMFA 5HPIA 4KENB 1A0KA 3T4KA 3V3SA 1XA1A 3M2JA 3OPLA 5E2GA 2P74A 3W4OA 1D06A 4IHQA 1L3LA 5FDSA 4HBTA 1IYOA 3T4JA 1VETA 1S4RA 5L8MA 4EQIA 2BASA 2CC1A 1V9YA 4GN2A 3HLFA 4KQQA 4R1GA 4MBKA 1TEMA 4HQAA 4I39A 4WZ5A 4MBHA 5HWVA 4X68A 1KE3A 1D1JA 2ZQ8A 5J3WA 4Y7PA 2QJ5A 3IH9A 3NI9A 3MFXA 1WYBA 3A0SA 4QD4A 3TG9A 5GLCA 4EETB 5CHJA 2JCHA 2XLNA 4BLMA 1W8YA 4E3JA 3F1NB 3NHQA 3ITBA 1F98A 1SKOB 3LY4A 2HDQA 3NBLA 5EPHA 5F1FA 5FEGA 3LIDA 1YLPA 3FV7A 5HW3A 2V2FF 4X56A 1I2SA 1N9LA 3SS4A 4N9KA 3KSFA 4MNRA 2WGIA 4FH4A 4B4XA 1O07A 2OLVA 1K4EA 3KSHA 2J80A 2FFFB 4ZRRA 2UV0E 4UHUA 1QMFA 4EBPA 2H5SA 3Q07A 2HDUA 3KO6A 1N9OA 4EWFA 2ZL1A 4HHDA 3OOVA 4JXWA 3G2YA 4OOLA 4OVDA 2D02A 1M6KA 4MDZA 4HP9A 3CUEC 3H82A 2EWWA 4EU0A 3LUQA 3SS5A 2PYPA 3JPUA 1W63M 3HLEA 2ZM2A 3Q7VB 1K55A 4KZ4A 4H6JB 4JGRA 2XRNA 3G2ZA 2WKQA 4GNUA 4I3AA 3E4OA 3PXPA 1MWUA 5FAPA 5FATA 3O87A 2Y4AA 4BL2A 2P04A 2W27A 1MWSA 4DJ3A 4BBVA 4X1LA 1XGJA 3FG8A 1FIKA 2PU2A 1Y4OA 1VEUA 4WYYA 1UWPX 5F1GA 4QWOA 2P9VA 3BY9A 4G3KA 3SZTA 2X01A 4F3LA 4FH2A 4DRTA 4X53A 3BM6A 4YNRA 3IWIA 2G2UA 4L9EA 4O8GA 4UA6A 1XX2A 2L1MA 1SHVA 3WS5A 4ZBEA 1LL9A 4PM6A 3FPVA 4DDSA 3MBZA 1JWPA 2H28A 1EW0A 2XFSA 2VK3A 2ZMVA 1GCEA 4ZAMA 4EEPA 4S2PA 4PAUA 1G5UA 2CMNA 3FWLA 1G6OA 4NXFA 3E2LA 3CLOA 2JKTI 4OKPA 4CLCA 2V9AA 4E3OA 1F2KA 3CPTB 2A3UA 4NK3A 4PKYA 1C3BA 5CGXA 4CJNA 5FQKA 5EM0A 1FOFA 2WK0A 1K57A 5KSCA 1TS6A 2WZXA 5GLBA 2X71A 2YKFA 1GSXA 4KG6A 5JYOA 3GQZA 3GRJA 4EBLA 1GA9A 4BJPA 1ZG4A 3IF6A 4DJ2A 3NOUC 1JVJA 4I5SA 4C6YA 1NZUA 1CEFA 5A8BA 4OPZA 1VETB 3H9WA 5GHYA 3N4IA 1ZG6A 4JF4A 3P09A 2O9AA 5DFYA 3MMHA 2HGVA 1IYSA 2XGNA 1PNEA 3CZDA 3OPPA 2MJ6A 2ACGA 4WMCD 4OPQA 2V1ZA 1DY6A 1XGIA 3PAEA 3HLCA 2ZBBA 4BD0A 4OP8A 5IHVA 1WA9A 4KZ5A 1OPXA 5HAPA 1ZC2A 4MN5A 4WEKA 2XA7M 2XDMA 5CTMA 1MWTA 2QZ6A 3BECA 3LR0A 5CEDA 3V3RA 1NYYA 4PMAA 2KDKA 1P9WA 1EWZA 1K54C 2KX6A 2JKGA 5HDDA 3MQQA 4EESA 1ACFA 4X69A 4EV4A 4LPZA 2Z6DA 1OT6A 4JGQA 3ZDJA 4MN6A 2GDNA 4ZDXA 2ZOIA 2GX5A 4BMWA 2ZL1B 2L4RA 2INWA 4Y0TA 4P6ZM 3C30A 1GSVA 5EVLA 1NRFA 4LGWA 2XD1A 2M7UA 3H82B 3M6BA 2G7UA 1G28A 3OC2A 3MXRA 5M19A 5HD3A 3UE3A 4ZJ1A 2J9OA 1BUEA 1PZOA 2R9XA 1NLZA 4B9OA 1DP8A 4R0QA 1KVMA 4DE3A 3G32A 1S1YA 5DKKA 1VM1A 2Z2LB 2Y8HA 3V5MA 1YAXA 3BY8A 3G4PA 4LCLA 3PBRA 4NXBA 1IKIA 4Y15A 2V20A 1VEUB 3IHBA 3NOPC 4BBTA 3B47A 5FDHA 2P9VB 3BJNA 4KQOA 4F3LB 2W3DA 4EEUA 2WKRA 5FAOA 2PBDP 1YPRA 1Z09A 3SH9A 4BENA 3T4LA 1TF1A 3LEQA 4KG5A 4HEFA 3OCNA 4ESPA 3HL9A 2J3TC 5EVIA 1S6RA 3PR6A 2GZAA 1HD8A 1BLHA 1HTZA 2J9PA 4WN5A 1FSYA 3ULFA 4NG2A 3ZGAB 5AVEA 1E3UD 2JC7A 4CLCB 4MEZA 4S2LA 3Q1FA 2JE5A 3P7NA 1YSQA 2B95A 4Y0UA 3EWKA 2PAVP 1PW8A 4JXGA 1HVBA 3MZEA 3UE1A 1ALQA 1K6SA 4Q0HA 2WUQA 3UE6A 1KOUA 5CGSA 1PWGA 3ZG5A 3N7WA 3OPHA 2Y2MA 1YSPA 3IF6B 2JBFA 2ZQAA 5DJUA 4EUZA 3VV4A 5J4EA 4S2OA 4Z9QA 3I7JA 4WUJA 5TFQA 4BBUA 3IQAA 5AVFA 3IXHA 1TVFA 5GL9A 3KSGA 3V50A 5HDSA 4ME4A 3FYZA 5G18A 1HZOA 3NOTC 2ZQ7A 2OAP1 1NXYA 5HD5A 2QHKA 1VHMA 1OTAA 1XPBA 1P9RA 1JNUA 3MQ0A 3P01A 1LSVA 1OJ5A 3LIFA 3WS0A 1K25A 1ZTUA 1JTGA 2PBYA 2ZC5B 1IEMA 5EM1A 1IYQA 1PZPA 5G4ZA 4WZ5C 4E6WA 1P0ZA 2C6WB 2B02A 2WKHA 5I5LA 1PI5A 4R70A 1XJ4A 2OOLA 1YLTA 3FPWA 3UPNA 4LENA 4NEED 4WL9A 2ZC6B 2ZM0A 4LV3A 3NIAA 4DN0A 2Q0OA 2R78A 2Z6CA 3VE3A 3N6IA 3IHAA 3DAVA 1KE4A 3WS2A 3JYIA 2WKPA 2UWXA 2EXBA 4QY6A 2ZD8A 3O88A 5E2HA 2WYXA 5KMWA 5A92A 2VJWA 2WKIA 4I38A 4RX3A 4XT2A 2W1TA 5J7EA 4MN7A 1EROA 4K08A 5FI6A 4DE2A 2HP9A 1T19A 2V1BA 2DNSA 3EGXC 2EXAA 1XXMA 2QKPA 1XA7A 4HH2A 3UN7A 3NJAA 2BG1A 3A3IA 3ZG8B 4R4SA 3IBRA 3LFVA 3EEHA 3N8RA 1K55C 1YT4A 4D2OA 5FEFA 5FQIA 2O9BA 3KYZA 1BLCA 5JYPA 2XA7S 2EA9A 3EQUA 3IX3A 3UNWA 4YWZA 2IWCA 1H0MA 3RH8B 2VV7A 3QP1A 5KIZA 1OMEA 3BFCA 4IVIA 4CLCE 5I94A 1BZAA 5EVIB 3CI6A 1TDLA 1ES2A 3BW6A 4L9FA 3P98A 5HAQA 4R4RA 3W2ZA 4P6ZS 1YMSA 1QMEA 5E2EA 4IJGA 3DWKA 3TSGA 2V1AA 4GLQA 1Q2PA 5HL6A 4C3QA 5CERA 2PYRA 2EWVA 3BWLA 5DVAA 3LCEA 1MKIA 4CPKA 4LRXC 4E3MA 3ZYTA 4HJ3A 3T12B 3IH8A 4U0XA 1U60A 1W8QA 3T1QB 3T50A 3G6OA 3G31A 4M4XA 4ZJ2A 5TBMA 4CLCC 3CAXA 3MXSA 5FSRA 3PBNA 4PM8A 2V8CA 4X25A 3HJKA 3ISGA 1TDGA 1K57C 2XROA 5L2FA 4GW9A 1LL5A 4KZBA 1TS7A 2AVXA 1PYYA 3IF6C 4KQDA 2JHEA 3UB9A 3BEBA 3LI9A 5CGWA 1IELA 3LR3A 2IA2A 4ETZA 3EEAA 2VEAA 4Y17A 2VGLM 5AJGA 3DTKA 2ZQCA 1RP5A 4GJ4A 4OLGA 2E8JA 3WRZA 2O99A 3IF5A 4JPMA 3LIAA 1NWZA 2Y55A 5HZHA 2JKTM 3VSKA 3GVBA 2A2LA 3FZCA 4UAAA 3PHYA 4FOFA 4EXOA 1DJBA 3V39A 3L9KA 4R38A 4JGOA 1S1ZA 1PIOA 3LR4A 2XEPA 2BTFP 4B4ZA 3BFGA 1BT5A 3R7WA 2ZQDA 4JXSA 1W63Q 2Y2PA 1LLBA 5CRFA 2IWDA 3WWXA 4K0XA 2HPBA 3KYQA 1YLWA 1Q2QA 1L2SA 2Y2HA 3O5YA 1RGZA
chains in the Genus database with same CATH topology
1NLZA 5EFWA 4B93A 4B9OA 4RQ9A 5G4YA 4E04A 2YKHA 1DP8A 1MKMA 4ARZA 4GHIB 1S1YA 5DKKA 2Y8HA 1YAXA 2XSSA 1OJGA 1OTBA 5IU1A 3BY8A 3KSIA 3T4QA 3SW1A 4YOFA 1DRMA 4ETXA 3PBRA 4NXBA 2W3EA 4XT2B 2D01A 1YKDA 3MQOA 2W1TB 3D3OA 4Z1WA 4EERA 3H7WB 1F5MA 4HOIA 2VZWA 3NOPC 3A0RA 4BBTA 3EGDC 3KX0X 3IS2A 3PBOA 4HNBA 1OTIA 4LLOB 4AFIA 3B47A 3EOIA 2M1CA 5CX7A 1NRJA 3TW8A 4PKYG 2PT7A 5LBRA 3BJNA 4KQOA 2OAQ1 1T1CA 1T1BA 4F3LB 1ZHHB 2W3DA 3C2WA 2LB5A 3S7NA 3F1OA 4EEUA 3A0VA 5DF9A 2WKRA 5IS1A 1VB6A 3T4LA 1TF1A 4CLCD 4MMNA 4EQ1A 3OCNA 4DMZA 5F6AA 3LIBA 2J3TC 1D7EA 3PR6A 3PYPA 2GZAA 4HJ6A 2W3GA 2VA0A 2VV8A 1V9ZA 3RFBA 4WN5A 3ULFA 2V0WA 1F9IA 1NLYA 3FC7A 2W3HA 2ZMFA 5AVEA 3TRCA 5HPIA 3T4KA 3V67A 3LI8A 1D06A 4IHQA 5KSHA 1S4SA 2PR6A 3B42A 4CLCB 3T4JA 3VE4A 3T4SA 1S4RA 3D72A 5L8MA 4NKPA 2BASA 5DKLA 3P7NA 3DBAA 1V9YA 3S7PA 1YSQA 2HJ9C 2VV6A 2A24A 2FH5A 4G3WA 5K5BA 1MC0A 3EWKA 4HI4A 4HQAA 4I39A 1IOUA 2M7VA 3K3CA 1DP6A 2GJ3A 3S7QA 5HWVA 4Q0HA 3VOLA 2GNXA 3UE6A 4WF0A 1KOUA 2PD8A 1S66L 2K2NA 5J3WA 4BWIA 2QJ5A 3MFXA 2J3WA 1YSPA 3CWFA 3A0SA 5DJUA 3OCLA 2PDRA 3VV4A 5J4EA 2K7SA 4WUJA 4EETB 4BBUA 1XJ6A 5DFXA 3CUEA 4NXEA 3F1NB 3NHQA 2I9VA 5AVFA 3C38A 1F98A 1XJ3A 4Q0JA 2PR5A 3KSGA 5F68A 5HDSA 4ME4A 3LIDA 4L9GA 4QPRA 2K31A 3NOTC 1N9LA 2OAP1 5F69A 5HD5A 2QHKA 1VHMA 5TBMB 1OTAA 1P9RA 3KSFA 1JNUA 3OLOA 3MQ0A 3K2NA 3KSHA 3P01A 1LSVA 1OJ5A 2J80A 3LIFA 5C5KA 4ZRRA 3BQ8A 1DP9A 3F1PA 2W3FA 1ZTUA 3IBJA 3E0YA 4LRYC 3RTYA 4GS9A 3S7OA 4HJ4A 5G4ZA 1P0ZA 1XFQA 2O0YA 2B02A 3KO6A 4I3JA 5I5LA 1N9OA 4R70A 2QJ7A 1XJ4A 2OOLA 2VLGA 3LYXA 4HHDA 3OOVA 3MXQA 3FPWA 4OOLA 2D02A 4NEED 4WL9A 5IT5A 4MDZA 3BQAA 4HP9A 3CUEC 2P08A 1OTDA 3H82A 4DN0A 2EWWA 4EU0A 3LIEA 2R78A 3F1NA 3LUQA 4G3VA 2PYPA 2Z6CA 3VE3A 5HWTA 3PBTA 1W63M 5F5YA 4UQIS 2WKPA 4H6JB 1T1AA 2O9CA 4JGRA 2ZOHA 2XRNA 2HJEA 1ODVA 2WKQA 4I3AA 3E4OA 3PXPA 4HY8A 4GHIA 2J3TD 1OTEA 1XJ2A 2P04A 4KUKA 2VJWA 2W27A 4I38A 4DJ3A 4BBVA 4L0LA 4XT2A 3FG8A 2W1TA 5J7EA 4KUOA 2HV1A 4HIAA 2VX8A 2FZ0A 4MN7A 4Y5FA 3R7WB 2P7JA 3H7WA 3TE8A 4K08A 1UWPX 2B18A 1T19A 5HWWA 2V1BA 3BY9A 4G3KA 4WEJA 3EGXC 4GCZA 4F3LA 1XFNA 4R3AA 4YNRA 2QKPA 4HH2A 4ARZB 4L9EA 1H3QA 4O8GA 1OT9A 3NJAA 3UB7A 3E4QA 2L1MA 3IBRA 3LFVA 3EEHA 3R4KA 4PHTA 3GECA 3FPVA 3PBQA 2O9BA 3LICA 1TS8A 2H28A 1EW0A 3KYZA 3GDIA 1LSWA 2XA7S 2ZMVA 2EA9A 3IS2B 1LSXA 3EQUA 1IFQA 4EEPA 4PAUA 4YWZA 2CMNA 1G6OA 4EUVA 4NXFA 3T4OA 3CLOA 3RH8B 2VV7A 2JKTI 1GSWA 4CLCA 2VGLS 3F1OB 2V9AA 2QWSA 2PHYA 4HP4A 2LB9A 4PKYA 5KIZA 4CLCE 4UEYA 2KLIA 1TS6A 3CI6A 2YKFA 4O0PA 2L0WA 3BW6A 2DMWA 1UWNX 4L9FA 1GSXA 3W2ZA 4P6ZS 2W1RA 4Q0IA 4IJGA 2V1AA 4GLQA 1S67L 4BJPA 5HL6A 3ZQ5A 3JVVA 2PD7A 4DJ2A 2JN7A 3NOUC 5HSQA 2PYRA 4II7A 2EWVA 4I5SA 3BWLA 2KOIA 2V0UA 1N9NA 2JKRM 1MZUA 5A8BA 1P97A 1Y28A 4LRXC 3H9WA 3C8CA 4Y2FA 3ZYTA 4I3IA 4HH3A 3ICYA 4HJ3A 5MC7A 2O9AA 3TJZC 5DFYA 3MMHA 4WELA 2HGVA 2A24B 3T50A 2JKRI 3G6OA 3MF0A 4M4XA 5TBMA 4CLCC 3CAXA 2MJ6A 4IUHA 3PBNA 5FL3A 4IUKA 3OBFA 1X0OA 3PBSA 3HJKA 3B33A 4LRZE 2HF6A 4MCWA 2W0NA 2XROA 5DJTA 4FSFA 4GW9A 2ZBBA 1T18A 2VKSA 1STZA 1WA9A 3UMDA 1OPXA 3JVUA 1TS0A 3UMEA 1TS7A 4O01A 2Y79A 4MN5A 4WEKA 2XA7M 2QYBA 2JHEA 4KQDA 3UB9A 3LR0A 3LI9A 4R6LA 2KDKA 3LR3A 1P9WA 2OWHA 2IA2A 4OOMA 4ETZA 5HDDA 2KX6A 3EEAA 2VEAA 3MQQA 3EQVA 2VGLM 5AJGA 4EESA 4EW7A 4WLAA 4GJ4A 4JGPA 4Y3IA 3F1PB 5HDCA 4LPZA 2Z6DA 2O99A 1OT6A 4GS9B 4H6JA 3LIAA 4JGQA 3UB8A 4MN6A 2NUPC 1TD5A 1NWZA 5HZHA 2ZOIA 2JKTM 2GX5A 4BMWA 2A2LA 2L4RA 1LT0A 3PHYA 4FOFA 4CQHA 2INWA 3HCYA 4EXOA 3U2AA 3E98A 5TJJA 2OWJA 3CITA 4P6ZM 3C30A 1GSVA 3LR5A 3T4TA 1H8MA 1BYWA 4R38A 4JGOA 1S1ZA 5HPFA 3LR4A 2M7UA 2NUTC 3H82B 2G7UA 3R7WA 1W63Q 1LL8A 1UGUA 1G28A 3OC2A 3K3DA 5HD3A 3UE3A 3HJIA 4NXGA 3E4PA 3KYQA 3O5YA 3UB6A 3MJQA 4UQIM 3MR0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5EFW A;  4B9O A;  4RQ9 A;  5G4Y A;  4E04 A;  2YKH A;  1DP8 A;  4GHI B;  1S1Y A;  5DKK A;  1OJG A;  1OTB A;  5IU1 A;  3BY8 A;  3SW1 A;  1DRM A;  4NXB A;  4XT2 B;  2D01 A;  3MQO A;  4EER A;  3H7W B;  4HOI A;  3NOP C;  3A0R A;  4BBT A;  3KX0 X;  3IS2 A;  4HNB A;  1OTI A;  4LLO B;  2M1C A;  4PKY G;  1T1C A;  1T1B A;  4F3L B;  3C2W A;  3F1O A;  4EEU A;  3A0V A;  2WKR A;  5IS1 A;  1VB6 A;  4EQ1 A;  5F6A A;  3LIB A;  1D7E A;  3PYP A;  4HJ6 A;  2VV8 A;  1V9Z A;  4WN5 A;  3ULF A;  2V0W A;  1F9I A;  3FC7 A;  5AVE A;  3LI8 A;  1D06 A;  1S4S A;  2PR6 A;  3VE4 A;  1S4R A;  3D72 A;  2BAS A;  5DKL A;  3P7N A;  1V9Y A;  2VV6 A;  2A24 A;  3EWK A;  4HI4 A;  4HQA A;  4I39 A;  3K3C A;  1DP6 A;  2GJ3 A;  5HWV A;  3VOL A;  3UE6 A;  4WF0 A;  1KOU A;  2PD8 A;  1S66 L;  5J3W A;  2QJ5 A;  3MFX A;  3CWF A;  3A0S A;  5DJU A;  2PDR A;  5J4E A;  2K7S A;  4WUJ A;  4EET B;  4BBU A;  1XJ6 A;  4NXE A;  3F1N B;  3NHQ A;  2I9V A;  5AVF A;  1F98 A;  1XJ3 A;  2PR5 A;  5F68 A;  5HDS A;  3LID A;  4L9G A;  3NOT C;  5F69 A;  1N9L A;  5HD5 A;  2QHK A;  5TBM B;  1OTA A;  1JNU A;  3OLO A;  1LSV A;  1OJ5 A;  2J80 A;  3LIF A;  1DP9 A;  3F1P A;  4LRY C;  3RTY A;  4GS9 A;  4HJ4 A;  5G4Z A;  1P0Z A;  1XFQ A;  2B02 A;  4I3J A;  5I5L A;  1N9O A;  4R70 A;  2QJ7 A;  1XJ4 A;  2OOL A;  2VLG A;  3LYX A;  4HHD A;  3MXQ A;  2D02 A;  4WL9 A;  4HP9 A;  1OTD A;  3H82 A;  3LIE A;  2R78 A;  3F1N A;  3LUQ A;  2PYP A;  2Z6C A;  3VE3 A;  5HWT A;  5F5Y A;  2WKP A;  4H6J B;  1T1A A;  4JGR A;  2ZOH A;  1ODV A;  2WKQ A;  4I3A A;  3E4O A;  4HY8 A;  4GHI A;  1OTE A;  1XJ2 A;  4KUK A;  2W27 A;  4I38 A;  4DJ3 A;  4BBV A;  4XT2 A;  3FG8 A;  5J7E A;  4KUO A;  2HV1 A;  4HIA A;  2P7J A;  3H7W A;  4K08 A;  1UWP X;  1T19 A;  5HWW A;  2V1B A;  3BY9 A;  4GCZ A;  4F3L A;  1XFN A;  4R3A A;  2QKP A;  4HH2 A;  4L9E A;  1OT9 A;  3NJA A;  3UB7 A;  3E4Q A;  2L1M A;  3IBR A;  3EEH A;  3GEC A;  3LIC A;  1TS8 A;  2H28 A;  1EW0 A;  3GDI A;  1LSW A;  2EA9 A;  3IS2 B;  1LSX A;  4EEP A;  4YWZ A;  2CMN A;  4NXF A;  3CLO A;  3RH8 B;  2VV7 A;  1GSW A;  3F1O B;  2V9A A;  2QWS A;  2PHY A;  4HP4 A;  4PKY A;  5KIZ A;  1TS6 A;  2YKF A;  2L0W A;  1UWN X;  4L9F A;  1GSX A;  2V1A A;  1S67 L;  3ZQ5 A;  2PD7 A;  4DJ2 A;  2JN7 A;  3NOU C;  5HSQ A;  2PYR A;  4I5S A;  3BWL A;  2V0U A;  1N9N A;  1MZU A;  5A8B A;  1P97 A;  1Y28 A;  4LRX C;  3H9W A;  3C8C A;  4I3I A;  4HH3 A;  3ICY A;  4HJ3 A;  2A24 B;  3T50 A;  3G6O A;  4M4X A;  5TBM A;  3CAX A;  1X0O A;  3HJK A;  3B33 A;  4LRZ E;  2W0N A;  5DJT A;  4GW9 A;  2ZBB A;  1T18 A;  1WA9 A;  3UMD A;  1TS0 A;  3UME A;  1TS7 A;  4MN5 A;  2JHE A;  4KQD A;  3UB9 A;  3LI9 A;  4R6L A;  2KDK A;  2OWH A;  5HDD A;  2KX6 A;  2VEA A;  3MQQ A;  4EES A;  4EW7 A;  4WLA A;  4JGP A;  3F1P B;  5HDC A;  4LPZ A;  2Z6D A;  1OT6 A;  4GS9 B;  4H6J A;  3LIA A;  4JGQ A;  3UB8 A;  4MN6 A;  1NWZ A;  5HZH A;  2ZOI A;  2L4R A;  1LT0 A;  3PHY A;  4EXO A;  2INW A;  2OWJ A;  1GSV A;  1BYW A;  4R38 A;  4JGO A;  1S1Z A;  3H82 B;  1LL8 A;  1UGU A;  1G28 A;  3K3D A;  5HD3 A;  3HJI A;  4NXG A;  3E4P A;  3UB6 A;  3MJQ A;  3MR0 A; 
#chains in the Genus database with same CATH topology
 1G68 A;  3MKE A;  4E04 A;  2YKH A;  4ARZ A;  4F94 A;  4FUW A;  1CF0 A;  1K6R A;  3A3F A;  3HUM A;  2HZ5 A;  2XSS A;  3T4Q A;  1DRM A;  1RCJ A;  4ETX A;  1FIL A;  3OPR A;  4XT2 B;  5HX9 A;  1LHY A;  2W1T B;  2ZLY A;  4X6T A;  4GZB A;  1F5M A;  2XFT A;  3A0R A;  3IT9 A;  3KX0 X;  3IS2 A;  3PBO A;  4HNB A;  3VOZ A;  2M1C A;  1GHM A;  3TW8 A;  4PKY G;  2PT7 A;  5FQQ A;  4ZJ3 A;  2LB5 A;  3S7N A;  4N92 A;  5DF9 A;  4R3J A;  1NY0 A;  3B3X A;  4RYE A;  3BRM A;  4H8R A;  5IS1 A;  1BSG A;  3U4L P;  1LI9 A;  4MMN A;  2FFY A;  4DMZ A;  5F6A A;  4OQG A;  2W3G A;  2VV8 A;  1V9Z A;  3RFB A;  3G30 A;  4B88 A;  1NLY A;  3TRC A;  3GTC A;  3LGO A;  3BLS A;  3LI8 A;  1MY8 A;  4Q8I A;  1KVL A;  3C4P A;  2Y2O A;  5KSH A;  5U47 A;  4YFM A;  4GDN A;  2Y2Q A;  3RJU A;  2ZM8 A;  4NKP A;  5DKL A;  3DBA A;  1KGF A;  3S7P A;  1ONG A;  2HJ9 C;  2VV6 A;  2A24 A;  2FH5 A;  4LV1 A;  1MC0 A;  4JF6 A;  3HBR A;  1MXO A;  4HI4 A;  5FA7 A;  1IOU A;  2ZMA A;  1GHP A;  1KDS A;  2WGV A;  3K3C A;  2OLU A;  3VOL A;  2GNX A;  4WF0 A;  2ZC7 A;  3E2K A;  1ZKJ A;  2PD8 A;  1S66 L;  2K2N A;  2EX6 A;  4BWI A;  5EVI C;  2J3W A;  1FQG A;  5GHX A;  3WS4 A;  3OCL A;  2PDR A;  2K7S A;  1XJ6 A;  3VMA A;  2Y2J A;  1WYC A;  2I9V A;  3C38 A;  4KQR A;  4Q0J A;  2VGJ A;  4RX2 A;  1E25 A;  4P85 A;  2EX8 A;  4L9G A;  4WMC A;  3CMZ A;  1GA0 A;  4QPR A;  4IBR A;  1K38 A;  5TBM B;  3UPO A;  5L10 A;  1ESU A;  3CG5 A;  3OLO A;  4S2N A;  3K2N A;  4OON A;  5C5K A;  2EX2 A;  1DP9 A;  3F1P A;  1DJA A;  2XH9 A;  1W79 A;  3RTY A;  4JLF A;  3S7O A;  1E4D A;  3NCK A;  3QP4 A;  1XFQ A;  2O0Y A;  1BLP A;  4QB8 A;  4DKI A;  2QJ7 A;  4MLL A;  3VSL A;  4E3N A;  5IT5 A;  4DXC A;  3DWZ A;  3GMW A;  5AQB A;  2WAF A;  5FAS A;  3F1N A;  5HWT A;  2I72 A;  3PBT A;  4UQI S;  4X1M A;  3DTI A;  5L09 A;  5FQ9 A;  5DTT A;  1T1A A;  3S1Y A;  1ONH A;  1ODV A;  1W5D A;  2H0Y A;  3Q7Z A;  2J3T D;  1CEG A;  3CHW P;  1XJ2 A;  4P6B A;  1H8Y A;  2R9W A;  4Y0O A;  3ZVW A;  4KUO A;  3LO7 A;  2H10 A;  3C5A A;  2VX8 A;  4Y5F A;  3R7W B;  2P7J A;  3H7W A;  5L07 A;  3TE8 A;  2HP5 A;  4QHC A;  2DRW A;  5HWW A;  4GCZ A;  3WRT A;  2E8I A;  4R3A A;  3VP1 A;  2Y91 A;  4UA9 A;  4N1X A;  4ARZ B;  3CJM A;  2Y2I A;  1H3Q A;  3BFF A;  4QJG A;  1OT9 A;  3UB7 A;  5F82 A;  4LV2 A;  1YLJ A;  4P87 A;  4IVK A;  3GEC A;  3W4Q A;  3PBQ A;  4GOG A;  3LIC A;  4LCM A;  4NET A;  3QNC A;  1LSW A;  3IS2 B;  1NZO A;  1L0F A;  4EUV A;  3D9Y A;  3T4O A;  4Y13 A;  3PAG A;  1PI4 A;  4DXB A;  2VGL S;  5EVE A;  2Z2M B;  4HP4 A;  3W4P A;  2LB9 A;  1CJF A;  1MBL A;  4OQI A;  4QY5 A;  3BYD A;  3Q81 A;  4GKU A;  1FCO A;  3LY3 A;  1MPL A;  4C75 A;  3VP4 A;  1EI5 A;  3T1R A;  3QP2 A;  5AQ7 A;  2W1R A;  4KZ7 A;  4Q0I A;  4BL3 A;  1E3U A;  3ZQ5 A;  3JVV A;  1FR6 A;  3O86 A;  5HSQ A;  4II7 A;  3ZFZ A;  2KOI A;  3IX4 A;  1N9N A;  3GR2 A;  1MZU A;  1P97 A;  3MFD A;  3IXB A;  4I3I A;  2Y2G A;  3ICY A;  3ZG7 B;  4FD8 A;  3TJZ C;  1ESI A;  4WEL A;  3UY6 A;  2A24 B;  2C5W B;  3MF0 A;  2WAD A;  4OLD A;  5FL3 A;  4IUK A;  3OBF A;  3GV9 A;  1X0O A;  3PBS A;  3B33 A;  4HES A;  1CK3 A;  2W0N A;  3NY4 A;  2H0T A;  5DJT A;  5A90 A;  2ZQ9 A;  4GD6 A;  2QMI A;  4YIN A;  1RGY A;  1SZV A;  4DE0 A;  2HP6 A;  3NDG A;  3UME A;  3IWO A;  4K91 A;  3G35 A;  4JKT A;  1KGE A;  3MZD A;  1YLY A;  4RA7 A;  4KG2 A;  3SH7 A;  5HL1 A;  4S2M A;  2OWH A;  4OOM A;  3EQV A;  5EE8 A;  3QP8 A;  4HBU A;  4WLA A;  5FQM A;  4XUX A;  1SCW A;  4JGP A;  3F1P B;  5HDC A;  4PM5 A;  4R23 A;  3UB5 P;  3UB8 A;  4E3L A;  1TD5 A;  4KZ9 A;  1N9B A;  4CQH A;  4GDB A;  1SDE A;  3E98 A;  2OWJ A;  3U2A A;  3T4T A;  2BLS A;  2XR0 A;  3UO9 A;  4ZTK A;  1LL8 A;  4X55 A;  3VFH A;  1ES4 A;  2VGK A;  1K56 D;  3KYE A;  4FCF A;  3HJI A;  4NXG A;  3E4P A;  1SKF A;  3UB6 A;  4UQI M;  3MR0 A;  4RQ9 A;  3MS6 A;  5G4Y A;  1MKM A;  5E2F A;  4O7D A;  1O7E A;  3ZNY A;  1YQS A;  2PU4 A;  1OJG A;  5IU1 A;  3HUO A;  2QPN A;  4YOF A;  1I5Q A;  5FI2 A;  2D01 A;  3MQO A;  3M2K A;  2OSU A;  4EER A;  1JWV A;  1ERQ A;  3H7W B;  4PM9 A;  5E43 A;  4HOI A;  2VZW A;  1ES5 A;  4FTX A;  3VP2 A;  3EGD C;  1OTI A;  4LLO B;  3S4X A;  5CX7 A;  3C4O A;  3NUL A;  4E3I A;  2OAQ 1;  1T1C A;  1ZHH B;  3C2W A;  1SDN A;  5HAR A;  3F1O A;  5D3O A;  2WAE A;  3QNB A;  5FI7 A;  5TGF A;  1YM1 A;  1VB6 A;  4CLC D;  1PWC A;  5CHM A;  3LIB A;  1L0G A;  5AQ9 A;  1FR1 A;  3PYP A;  4HJ6 A;  2VA0 A;  3DTE A;  5EOE A;  3QP6 A;  4E6X A;  3MZF A;  2EFU A;  3VP0 A;  3IX8 A;  5A91 A;  3V67 A;  4N9L A;  4KZ3 A;  3Q82 A;  1S4S A;  1K56 A;  1G6A A;  2PR6 A;  3B42 A;  1PWD A;  3VE4 A;  3T4S A;  3FKV A;  1L0E A;  1H8Z A;  3D72 A;  4OQ0 A;  1KGG A;  4GB7 A;  4M3K A;  4G3W A;  5K5B A;  4MBF A;  1WE4 A;  2M7V A;  4WZ4 A;  2OV5 A;  1DP6 A;  2GJ3 A;  1PRQ A;  3HRE A;  4IBX A;  4QU3 A;  3S7Q A;  1S0W A;  4UA7 A;  1BTL A;  3CWF A;  1KDW A;  3ZHH A;  3A3E A;  5DFX A;  3CUE A;  5CHU A;  4XXR A;  1JWZ A;  4NXE A;  2WGW A;  4JBF A;  1BLS A;  2EFX A;  1XJ3 A;  2PR5 A;  5F68 A;  1CI8 A;  4P0M A;  1LI0 A;  2K31 A;  5F69 A;  4OH0 A;  3MSH A;  1MWR A;  5BOH A;  3BQ8 A;  2W3F A;  3IBJ A;  3E0Y A;  4LRY C;  4GS9 A;  4HJ4 A;  3T1X A;  1CI9 A;  3DW0 A;  4I3J A;  2VLG A;  3LYX A;  4OPR A;  2G2W A;  3UDI A;  3MXQ A;  3VP3 A;  1H5X A;  2V8F A;  3BQA A;  1J9M A;  2P08 A;  1OTD A;  4DDY A;  3O3V A;  5GLD A;  3LIE A;  4OP5 A;  4G3V A;  3N8S A;  1GHI A;  5F5Y A;  1DJC A;  3UPP A;  1NYM A;  3DTM A;  2O9C A;  5GHZ A;  1XP4 A;  2ZOH A;  2J8Y A;  2HJE A;  1YLZ A;  4S2N C;  4DF6 A;  4BD1 A;  4HY8 A;  4GHI A;  3A3D A;  4KZA A;  5GLA A;  4S2I A;  1OTE A;  2X02 A;  4KUK A;  4L0L A;  4OOY A;  3TOI A;  5EV0 A;  2XF3 A;  1Z6F A;  2HV1 A;  4HIA A;  2FZ0 A;  3ITA A;  1HLU P;  1KE0 A;  3C7U A;  5DTS A;  1BUL A;  3HLB A;  2B18 A;  2XD5 A;  4S2K A;  4A5R A;  3NDE A;  4WEJ A;  4DE1 A;  1K4F A;  3ZCZ A;  2WKE A;  4ID4 A;  1XFN A;  5TR7 A;  5CEC A;  1L0D A;  4LV0 A;  3E4Q A;  1FCN A;  2ZC4 B;  4U0T A;  3R4K A;  3G34 A;  5J8X A;  4PHT A;  3QP5 A;  1TS8 A;  5EVI D;  2Y2N A;  3GDI A;  1Y54 A;  1LSX A;  1IFQ A;  3OZH A;  1IKG A;  2Y2L A;  4LFU A;  5KZH A;  1GSW A;  3F1O B;  4U3T A;  5EUA A;  2DCF A;  2QWS A;  2PHY A;  3UDF A;  3HVF A;  3UDX A;  4UEY A;  5AQA A;  2KLI A;  4IED A;  5DF8 A;  3SH8 A;  3A3J A;  5DF7 A;  3IXG A;  4O0P A;  2L0W A;  2DMW A;  1UWN X;  4XUZ A;  3MKF A;  1S67 L;  2PD7 A;  2JN7 A;  3QHY A;  3NC8 A;  2V0U A;  2JKR M;  1Y28 A;  1K54 A;  3UE0 A;  3C8C A;  4Y2F A;  3BFE A;  1SKO A;  4HH3 A;  5DTK A;  3IWQ A;  1N4O A;  4K0W A;  3SS3 A;  5HAI A;  5EEC A;  5MC7 A;  4JF5 A;  1YMX A;  3T1S A;  1PFL A;  2JKR I;  4GD8 A;  2Y2K A;  4IUH A;  4KZ8 A;  2ZC3 B;  2HDS A;  1IYP A;  4LRZ E;  2HF6 A;  4MCW A;  3ZG0 A;  1XKZ A;  5F83 A;  1AWI A;  4FSF A;  1T18 A;  3GSG A;  3SOI A;  2VKS A;  1STZ A;  3N8L A;  3UMD A;  3WS1 A;  3JVU A;  2ZJ9 A;  3ZG9 B;  1TS0 A;  3HLW A;  2J7V A;  5FQJ A;  2WGW B;  4O01 A;  4OPY A;  2Y79 A;  4S2J A;  1FSW A;  4EBN A;  2QYB A;  2WZZ A;  1M40 A;  3C7V A;  2EX9 A;  4R6L A;  1VQQ A;  3HUN A;  4WM9 A;  1PW1 A;  3D4F A;  5CXW A;  1AXB A;  4EW7 A;  4Y3I A;  4D60 A;  2IWB A;  3Q7V A;  4GS9 B;  4H6J A;  2Q9N A;  5A93 A;  2XQZ A;  1NJ4 A;  2NUP C;  2B5R A;  1LT0 A;  4PM7 A;  1FCM A;  3HCY A;  5TJJ A;  3RXW A;  3CIT A;  1ERM A;  3LR5 A;  1H8M A;  1BYW A;  5HPF A;  4N1H A;  4BQM A;  3L7H A;  2NUT C;  3AGE A;  3BFD A;  3S22 A;  4JXV A;  4KZ6 A;  3HLD A;  1UGU A;  5HFO A;  3K3D A;  3FKW A;  3W8K A;  4E3K A;  4RVA A;  3BLM A;  3ZVT A;  1K0K A;  4OQH A;  3MJQ A;  2XK1 A;  5M18 A;  3ZNT A;  5EFW A;  4B93 A;  1I2W A;  3LEZ A;  4GHI B;  5FAQ A;  4R3B A;  1ES3 A;  1OTB A;  3PTE A;  3KSI A;  3SW1 A;  2W3E A;  1YKD A;  3D3O A;  4Z1W A;  2RL3 A;  5M1A A;  3HLG A;  4AFI A;  3EOI A;  1NRJ A;  2RCX A;  5LBR A;  1CQA A;  1T1B A;  2A49 A;  5CEB A;  2PRF A;  1JTD A;  3A0V A;  1W7F A;  4WBG A;  3IXD A;  1J3W A;  3CPT A;  3AGF A;  5EOO A;  3RXX A;  3M6H A;  4EQ1 A;  5CTN A;  3AGD A;  2JKF A;  1D7E A;  4PPR A;  2Q9M A;  3VFF A;  2Y59 A;  3NEC A;  2HDR A;  2V0W A;  1F9I A;  3VOY A;  3FC7 A;  2W3H A;  2ZMF A;  5HPI A;  4KEN B;  1A0K A;  3T4K A;  3V3S A;  1XA1 A;  3M2J A;  3OPL A;  5E2G A;  2P74 A;  3W4O A;  1D06 A;  4IHQ A;  1L3L A;  5FDS A;  4HBT A;  1IYO A;  3T4J A;  1VET A;  1S4R A;  5L8M A;  4EQI A;  2BAS A;  2CC1 A;  1V9Y A;  4GN2 A;  3HLF A;  4KQQ A;  4R1G A;  4MBK A;  1TEM A;  4HQA A;  4I39 A;  4WZ5 A;  4MBH A;  5HWV A;  4X68 A;  1KE3 A;  1D1J A;  2ZQ8 A;  5J3W A;  4Y7P A;  2QJ5 A;  3IH9 A;  3NI9 A;  3MFX A;  1WYB A;  3A0S A;  4QD4 A;  3TG9 A;  5GLC A;  4EET B;  5CHJ A;  2JCH A;  2XLN A;  4BLM A;  1W8Y A;  4E3J A;  3F1N B;  3NHQ A;  3ITB A;  1F98 A;  1SKO B;  3LY4 A;  2HDQ A;  3NBL A;  5EPH A;  5F1F A;  5FEG A;  3LID A;  1YLP A;  3FV7 A;  5HW3 A;  2V2F F;  4X56 A;  1I2S A;  1N9L A;  3SS4 A;  4N9K A;  3KSF A;  4MNR A;  2WGI A;  4FH4 A;  4B4X A;  1O07 A;  2OLV A;  1K4E A;  3KSH A;  2J80 A;  2FFF B;  4ZRR A;  2UV0 E;  4UHU A;  1QMF A;  4EBP A;  2H5S A;  3Q07 A;  2HDU A;  3KO6 A;  1N9O A;  4EWF A;  2ZL1 A;  4HHD A;  3OOV A;  4JXW A;  3G2Y A;  4OOL A;  4OVD A;  2D02 A;  1M6K A;  4MDZ A;  4HP9 A;  3CUE C;  3H82 A;  2EWW A;  4EU0 A;  3LUQ A;  3SS5 A;  2PYP A;  3JPU A;  1W63 M;  3HLE A;  2ZM2 A;  3Q7V B;  1K55 A;  4KZ4 A;  4H6J B;  4JGR A;  2XRN A;  3G2Z A;  2WKQ A;  4GNU A;  4I3A A;  3E4O A;  3PXP A;  1MWU A;  5FAP A;  5FAT A;  3O87 A;  2Y4A A;  4BL2 A;  2P04 A;  2W27 A;  1MWS A;  4DJ3 A;  4BBV A;  4X1L A;  1XGJ A;  3FG8 A;  1FIK A;  2PU2 A;  1Y4O A;  1VEU A;  4WYY A;  1UWP X;  5F1G A;  4QWO A;  2P9V A;  3BY9 A;  4G3K A;  3SZT A;  2X01 A;  4F3L A;  4FH2 A;  4DRT A;  4X53 A;  3BM6 A;  4YNR A;  3IWI A;  2G2U A;  4L9E A;  4O8G A;  4UA6 A;  1XX2 A;  2L1M A;  1SHV A;  3WS5 A;  4ZBE A;  1LL9 A;  4PM6 A;  3FPV A;  4DDS A;  3MBZ A;  1JWP A;  2H28 A;  1EW0 A;  2XFS A;  2VK3 A;  2ZMV A;  1GCE A;  4ZAM A;  4EEP A;  4S2P A;  4PAU A;  1G5U A;  2CMN A;  3FWL A;  1G6O A;  4NXF A;  3E2L A;  3CLO A;  2JKT I;  4OKP A;  4CLC A;  2V9A A;  4E3O A;  1F2K A;  3CPT B;  2A3U A;  4NK3 A;  4PKY A;  1C3B A;  5CGX A;  4CJN A;  5FQK A;  5EM0 A;  1FOF A;  2WK0 A;  1K57 A;  5KSC A;  1TS6 A;  2WZX A;  5GLB A;  2X71 A;  2YKF A;  1GSX A;  4KG6 A;  5JYO A;  3GQZ A;  3GRJ A;  4EBL A;  1GA9 A;  4BJP A;  1ZG4 A;  3IF6 A;  4DJ2 A;  3NOU C;  1JVJ A;  4I5S A;  4C6Y A;  1NZU A;  1CEF A;  5A8B A;  4OPZ A;  1VET B;  3H9W A;  5GHY A;  3N4I A;  1ZG6 A;  4JF4 A;  3P09 A;  2O9A A;  5DFY A;  3MMH A;  2HGV A;  1IYS A;  2XGN A;  1PNE A;  3CZD A;  3OPP A;  2MJ6 A;  2ACG A;  4WMC D;  4OPQ A;  2V1Z A;  1DY6 A;  1XGI A;  3PAE A;  3HLC A;  2ZBB A;  4BD0 A;  4OP8 A;  5IHV A;  1WA9 A;  4KZ5 A;  1OPX A;  5HAP A;  1ZC2 A;  4MN5 A;  4WEK A;  2XA7 M;  2XDM A;  5CTM A;  1MWT A;  2QZ6 A;  3BEC A;  3LR0 A;  5CED A;  3V3R A;  1NYY A;  4PMA A;  2KDK A;  1P9W A;  1EWZ A;  1K54 C;  2KX6 A;  2JKG A;  5HDD A;  3MQQ A;  4EES A;  1ACF A;  4X69 A;  4EV4 A;  4LPZ A;  2Z6D A;  1OT6 A;  4JGQ A;  3ZDJ A;  4MN6 A;  2GDN A;  4ZDX A;  2ZOI A;  2GX5 A;  4BMW A;  2ZL1 B;  2L4R A;  2INW A;  4Y0T A;  4P6Z M;  3C30 A;  1GSV A;  5EVL A;  1NRF A;  4LGW A;  2XD1 A;  2M7U A;  3H82 B;  3M6B A;  2G7U A;  1G28 A;  3OC2 A;  3MXR A;  5M19 A;  5HD3 A;  3UE3 A;  4ZJ1 A;  2J9O A;  1BUE A;  1PZO A;  2R9X A;  1NLZ A;  4B9O A;  1DP8 A;  4R0Q A;  1KVM A;  4DE3 A;  3G32 A;  1S1Y A;  5DKK A;  1VM1 A;  2Z2L B;  2Y8H A;  3V5M A;  1YAX A;  3BY8 A;  3G4P A;  4LCL A;  3PBR A;  4NXB A;  1IKI A;  4Y15 A;  2V20 A;  1VEU B;  3IHB A;  3NOP C;  4BBT A;  3B47 A;  5FDH A;  2P9V B;  3BJN A;  4KQO A;  4F3L B;  2W3D A;  4EEU A;  2WKR A;  5FAO A;  2PBD P;  1YPR A;  1Z09 A;  3SH9 A;  4BEN A;  3T4L A;  1TF1 A;  3LEQ A;  4KG5 A;  4HEF A;  3OCN A;  4ESP A;  3HL9 A;  2J3T C;  5EVI A;  1S6R A;  3PR6 A;  2GZA A;  1HD8 A;  1BLH A;  1HTZ A;  2J9P A;  4WN5 A;  1FSY A;  3ULF A;  4NG2 A;  3ZGA B;  5AVE A;  1E3U D;  2JC7 A;  4CLC B;  4MEZ A;  4S2L A;  3Q1F A;  2JE5 A;  3P7N A;  1YSQ A;  2B95 A;  4Y0U A;  3EWK A;  2PAV P;  1PW8 A;  4JXG A;  1HVB A;  3MZE A;  3UE1 A;  1ALQ A;  1K6S A;  4Q0H A;  2WUQ A;  3UE6 A;  1KOU A;  5CGS A;  1PWG A;  3ZG5 A;  3N7W A;  3OPH A;  2Y2M A;  1YSP A;  3IF6 B;  2JBF A;  2ZQA A;  5DJU A;  4EUZ A;  3VV4 A;  5J4E A;  4S2O A;  4Z9Q A;  3I7J A;  4WUJ A;  5TFQ A;  4BBU A;  3IQA A;  5AVF A;  3IXH A;  1TVF A;  5GL9 A;  3KSG A;  3V50 A;  5HDS A;  4ME4 A;  3FYZ A;  5G18 A;  1HZO A;  3NOT C;  2ZQ7 A;  2OAP 1;  1NXY A;  5HD5 A;  2QHK A;  1VHM A;  1OTA A;  1XPB A;  1P9R A;  1JNU A;  3MQ0 A;  3P01 A;  1LSV A;  1OJ5 A;  3LIF A;  3WS0 A;  1K25 A;  1ZTU A;  1JTG A;  2PBY A;  2ZC5 B;  1IEM A;  5EM1 A;  1IYQ A;  1PZP A;  5G4Z A;  4WZ5 C;  4E6W A;  1P0Z A;  2C6W B;  2B02 A;  2WKH A;  5I5L A;  1PI5 A;  4R70 A;  1XJ4 A;  2OOL A;  1YLT A;  3FPW A;  3UPN A;  4LEN A;  4NEE D;  4WL9 A;  2ZC6 B;  2ZM0 A;  4LV3 A;  3NIA A;  4DN0 A;  2Q0O A;  2R78 A;  2Z6C A;  3VE3 A;  3N6I A;  3IHA A;  3DAV A;  1KE4 A;  3WS2 A;  3JYI A;  2WKP A;  2UWX A;  2EXB A;  4QY6 A;  2ZD8 A;  3O88 A;  5E2H A;  2WYX A;  5KMW A;  5A92 A;  2VJW A;  2WKI A;  4I38 A;  4RX3 A;  4XT2 A;  2W1T A;  5J7E A;  4MN7 A;  1ERO A;  4K08 A;  5FI6 A;  4DE2 A;  2HP9 A;  1T19 A;  2V1B A;  2DNS A;  3EGX C;  2EXA A;  1XXM A;  2QKP A;  1XA7 A;  4HH2 A;  3UN7 A;  3NJA A;  2BG1 A;  3A3I A;  3ZG8 B;  4R4S A;  3IBR A;  3LFV A;  3EEH A;  3N8R A;  1K55 C;  1YT4 A;  4D2O A;  5FEF A;  5FQI A;  2O9B A;  3KYZ A;  1BLC A;  5JYP A;  2XA7 S;  2EA9 A;  3EQU A;  3IX3 A;  3UNW A;  4YWZ A;  2IWC A;  1H0M A;  3RH8 B;  2VV7 A;  3QP1 A;  5KIZ A;  1OME A;  3BFC A;  4IVI A;  4CLC E;  5I94 A;  1BZA A;  5EVI B;  3CI6 A;  1TDL A;  1ES2 A;  3BW6 A;  4L9F A;  3P98 A;  5HAQ A;  4R4R A;  3W2Z A;  4P6Z S;  1YMS A;  1QME A;  5E2E A;  4IJG A;  3DWK A;  3TSG A;  2V1A A;  4GLQ A;  1Q2P A;  5HL6 A;  4C3Q A;  5CER A;  2PYR A;  2EWV A;  3BWL A;  5DVA A;  3LCE A;  1MKI A;  4CPK A;  4LRX C;  4E3M A;  3ZYT A;  4HJ3 A;  3T12 B;  3IH8 A;  4U0X A;  1U60 A;  1W8Q A;  3T1Q B;  3T50 A;  3G6O A;  3G31 A;  4M4X A;  4ZJ2 A;  5TBM A;  4CLC C;  3CAX A;  3MXS A;  5FSR A;  3PBN A;  4PM8 A;  2V8C A;  4X25 A;  3HJK A;  3ISG A;  1TDG A;  1K57 C;  2XRO A;  5L2F A;  4GW9 A;  1LL5 A;  4KZB A;  1TS7 A;  2AVX A;  1PYY A;  3IF6 C;  4KQD A;  2JHE A;  3UB9 A;  3BEB A;  3LI9 A;  5CGW A;  1IEL A;  3LR3 A;  2IA2 A;  4ETZ A;  3EEA A;  2VEA A;  4Y17 A;  2VGL M;  5AJG A;  3DTK A;  2ZQC A;  1RP5 A;  4GJ4 A;  4OLG A;  2E8J A;  3WRZ A;  2O99 A;  3IF5 A;  4JPM A;  3LIA A;  1NWZ A;  2Y55 A;  5HZH A;  2JKT M;  3VSK A;  3GVB A;  2A2L A;  3FZC A;  4UAA A;  3PHY A;  4FOF A;  4EXO A;  1DJB A;  3V39 A;  3L9K A;  4R38 A;  4JGO A;  1S1Z A;  1PIO A;  3LR4 A;  2XEP A;  2BTF P;  4B4Z A;  3BFG A;  1BT5 A;  3R7W A;  2ZQD A;  4JXS A;  1W63 Q;  2Y2P A;  1LLB A;  5CRF A;  2IWD A;  3WWX A;  4K0X A;  2HPB A;  3KYQ A;  1YLW A;  1Q2Q A;  1L2S A;  2Y2H A;  3O5Y A;  1RGZ A; 
#chains in the Genus database with same CATH homology
 1NLZ A;  5EFW A;  4B93 A;  4B9O A;  4RQ9 A;  5G4Y A;  4E04 A;  2YKH A;  1DP8 A;  1MKM A;  4ARZ A;  4GHI B;  1S1Y A;  5DKK A;  2Y8H A;  1YAX A;  2XSS A;  1OJG A;  1OTB A;  5IU1 A;  3BY8 A;  3KSI A;  3T4Q A;  3SW1 A;  4YOF A;  1DRM A;  4ETX A;  3PBR A;  4NXB A;  2W3E A;  4XT2 B;  2D01 A;  1YKD A;  3MQO A;  2W1T B;  3D3O A;  4Z1W A;  4EER A;  3H7W B;  1F5M A;  4HOI A;  2VZW A;  3NOP C;  3A0R A;  4BBT A;  3EGD C;  3KX0 X;  3IS2 A;  3PBO A;  4HNB A;  1OTI A;  4LLO B;  4AFI A;  3B47 A;  3EOI A;  2M1C A;  5CX7 A;  1NRJ A;  3TW8 A;  4PKY G;  2PT7 A;  5LBR A;  3BJN A;  4KQO A;  2OAQ 1;  1T1C A;  1T1B A;  4F3L B;  1ZHH B;  2W3D A;  3C2W A;  2LB5 A;  3S7N A;  3F1O A;  4EEU A;  3A0V A;  5DF9 A;  2WKR A;  5IS1 A;  1VB6 A;  3T4L A;  1TF1 A;  4CLC D;  4MMN A;  4EQ1 A;  3OCN A;  4DMZ A;  5F6A A;  3LIB A;  2J3T C;  1D7E A;  3PR6 A;  3PYP A;  2GZA A;  4HJ6 A;  2W3G A;  2VA0 A;  2VV8 A;  1V9Z A;  3RFB A;  4WN5 A;  3ULF A;  2V0W A;  1F9I A;  1NLY A;  3FC7 A;  2W3H A;  2ZMF A;  5AVE A;  3TRC A;  5HPI A;  3T4K A;  3V67 A;  3LI8 A;  1D06 A;  4IHQ A;  5KSH A;  1S4S A;  2PR6 A;  3B42 A;  4CLC B;  3T4J A;  3VE4 A;  3T4S A;  1S4R A;  3D72 A;  5L8M A;  4NKP A;  2BAS A;  5DKL A;  3P7N A;  3DBA A;  1V9Y A;  3S7P A;  1YSQ A;  2HJ9 C;  2VV6 A;  2A24 A;  2FH5 A;  4G3W A;  5K5B A;  1MC0 A;  3EWK A;  4HI4 A;  4HQA A;  4I39 A;  1IOU A;  2M7V A;  3K3C A;  1DP6 A;  2GJ3 A;  3S7Q A;  5HWV A;  4Q0H A;  3VOL A;  2GNX A;  3UE6 A;  4WF0 A;  1KOU A;  2PD8 A;  1S66 L;  2K2N A;  5J3W A;  4BWI A;  2QJ5 A;  3MFX A;  2J3W A;  1YSP A;  3CWF A;  3A0S A;  5DJU A;  3OCL A;  2PDR A;  3VV4 A;  5J4E A;  2K7S A;  4WUJ A;  4EET B;  4BBU A;  1XJ6 A;  5DFX A;  3CUE A;  4NXE A;  3F1N B;  3NHQ A;  2I9V A;  5AVF A;  3C38 A;  1F98 A;  1XJ3 A;  4Q0J A;  2PR5 A;  3KSG A;  5F68 A;  5HDS A;  4ME4 A;  3LID A;  4L9G A;  4QPR A;  2K31 A;  3NOT C;  1N9L A;  2OAP 1;  5F69 A;  5HD5 A;  2QHK A;  1VHM A;  5TBM B;  1OTA A;  1P9R A;  3KSF A;  1JNU A;  3OLO A;  3MQ0 A;  3K2N A;  3KSH A;  3P01 A;  1LSV A;  1OJ5 A;  2J80 A;  3LIF A;  5C5K A;  4ZRR A;  3BQ8 A;  1DP9 A;  3F1P A;  2W3F A;  1ZTU A;  3IBJ A;  3E0Y A;  4LRY C;  3RTY A;  4GS9 A;  3S7O A;  4HJ4 A;  5G4Z A;  1P0Z A;  1XFQ A;  2O0Y A;  2B02 A;  3KO6 A;  4I3J A;  5I5L A;  1N9O A;  4R70 A;  2QJ7 A;  1XJ4 A;  2OOL A;  2VLG A;  3LYX A;  4HHD A;  3OOV A;  3MXQ A;  3FPW A;  4OOL A;  2D02 A;  4NEE D;  4WL9 A;  5IT5 A;  4MDZ A;  3BQA A;  4HP9 A;  3CUE C;  2P08 A;  1OTD A;  3H82 A;  4DN0 A;  2EWW A;  4EU0 A;  3LIE A;  2R78 A;  3F1N A;  3LUQ A;  4G3V A;  2PYP A;  2Z6C A;  3VE3 A;  5HWT A;  3PBT A;  1W63 M;  5F5Y A;  4UQI S;  2WKP A;  4H6J B;  1T1A A;  2O9C A;  4JGR A;  2ZOH A;  2XRN A;  2HJE A;  1ODV A;  2WKQ A;  4I3A A;  3E4O A;  3PXP A;  4HY8 A;  4GHI A;  2J3T D;  1OTE A;  1XJ2 A;  2P04 A;  4KUK A;  2VJW A;  2W27 A;  4I38 A;  4DJ3 A;  4BBV A;  4L0L A;  4XT2 A;  3FG8 A;  2W1T A;  5J7E A;  4KUO A;  2HV1 A;  4HIA A;  2VX8 A;  2FZ0 A;  4MN7 A;  4Y5F A;  3R7W B;  2P7J A;  3H7W A;  3TE8 A;  4K08 A;  1UWP X;  2B18 A;  1T19 A;  5HWW A;  2V1B A;  3BY9 A;  4G3K A;  4WEJ A;  3EGX C;  4GCZ A;  4F3L A;  1XFN A;  4R3A A;  4YNR A;  2QKP A;  4HH2 A;  4ARZ B;  4L9E A;  1H3Q A;  4O8G A;  1OT9 A;  3NJA A;  3UB7 A;  3E4Q A;  2L1M A;  3IBR A;  3LFV A;  3EEH A;  3R4K A;  4PHT A;  3GEC A;  3FPV A;  3PBQ A;  2O9B A;  3LIC A;  1TS8 A;  2H28 A;  1EW0 A;  3KYZ A;  3GDI A;  1LSW A;  2XA7 S;  2ZMV A;  2EA9 A;  3IS2 B;  1LSX A;  3EQU A;  1IFQ A;  4EEP A;  4PAU A;  4YWZ A;  2CMN A;  1G6O A;  4EUV A;  4NXF A;  3T4O A;  3CLO A;  3RH8 B;  2VV7 A;  2JKT I;  1GSW A;  4CLC A;  2VGL S;  3F1O B;  2V9A A;  2QWS A;  2PHY A;  4HP4 A;  2LB9 A;  4PKY A;  5KIZ A;  4CLC E;  4UEY A;  2KLI A;  1TS6 A;  3CI6 A;  2YKF A;  4O0P A;  2L0W A;  3BW6 A;  2DMW A;  1UWN X;  4L9F A;  1GSX A;  3W2Z A;  4P6Z S;  2W1R A;  4Q0I A;  4IJG A;  2V1A A;  4GLQ A;  1S67 L;  4BJP A;  5HL6 A;  3ZQ5 A;  3JVV A;  2PD7 A;  4DJ2 A;  2JN7 A;  3NOU C;  5HSQ A;  2PYR A;  4II7 A;  2EWV A;  4I5S A;  3BWL A;  2KOI A;  2V0U A;  1N9N A;  2JKR M;  1MZU A;  5A8B A;  1P97 A;  1Y28 A;  4LRX C;  3H9W A;  3C8C A;  4Y2F A;  3ZYT A;  4I3I A;  4HH3 A;  3ICY A;  4HJ3 A;  5MC7 A;  2O9A A;  3TJZ C;  5DFY A;  3MMH A;  4WEL A;  2HGV A;  2A24 B;  3T50 A;  2JKR I;  3G6O A;  3MF0 A;  4M4X A;  5TBM A;  4CLC C;  3CAX A;  2MJ6 A;  4IUH A;  3PBN A;  5FL3 A;  4IUK A;  3OBF A;  1X0O A;  3PBS A;  3HJK A;  3B33 A;  4LRZ E;  2HF6 A;  4MCW A;  2W0N A;  2XRO A;  5DJT A;  4FSF A;  4GW9 A;  2ZBB A;  1T18 A;  2VKS A;  1STZ A;  1WA9 A;  3UMD A;  1OPX A;  3JVU A;  1TS0 A;  3UME A;  1TS7 A;  4O01 A;  2Y79 A;  4MN5 A;  4WEK A;  2XA7 M;  2QYB A;  2JHE A;  4KQD A;  3UB9 A;  3LR0 A;  3LI9 A;  4R6L A;  2KDK A;  3LR3 A;  1P9W A;  2OWH A;  2IA2 A;  4OOM A;  4ETZ A;  5HDD A;  2KX6 A;  3EEA A;  2VEA A;  3MQQ A;  3EQV A;  2VGL M;  5AJG A;  4EES A;  4EW7 A;  4WLA A;  4GJ4 A;  4JGP A;  4Y3I A;  3F1P B;  5HDC A;  4LPZ A;  2Z6D A;  2O99 A;  1OT6 A;  4GS9 B;  4H6J A;  3LIA A;  4JGQ A;  3UB8 A;  4MN6 A;  2NUP C;  1TD5 A;  1NWZ A;  5HZH A;  2ZOI A;  2JKT M;  2GX5 A;  4BMW A;  2A2L A;  2L4R A;  1LT0 A;  3PHY A;  4FOF A;  4CQH A;  2INW A;  3HCY A;  4EXO A;  3U2A A;  3E98 A;  5TJJ A;  2OWJ A;  3CIT A;  4P6Z M;  3C30 A;  1GSV A;  3LR5 A;  3T4T A;  1H8M A;  1BYW A;  4R38 A;  4JGO A;  1S1Z A;  5HPF A;  3LR4 A;  2M7U A;  2NUT C;  3H82 B;  2G7U A;  3R7W A;  1W63 Q;  1LL8 A;  1UGU A;  1G28 A;  3OC2 A;  3K3D A;  5HD3 A;  3UE3 A;  3HJI A;  4NXG A;  3E4P A;  3KYQ A;  3O5Y A;  3UB6 A;  3MJQ A;  4UQI M;  3MR0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...