2W1TB

Crystal structure of b. subtilis spovt
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
173
structure length
173
Chain Sequence
GIVRRIDDLGRVVIPKEIRRTLRIREGDPLEIFVDRDGEVILKKYSPISELGDFAKEYADALYDSLGHSVLICDRDVYIAVSGSSKKDYLNKSISEMLERTMDQRSSVLESDAKSVQLVNGIDEDMNSYTVGPIVANGDPIGAVVIFSKDQTMGEVEHKAVETAAGFLARQME
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords STAGE V SPORULATION PROTEIN T
publication title Crystal Structure of Spovt, the Final Modulator of Gene Expression During Spore Development in Bacillus Subtilis
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Transcription
total genus 39
structure length 173
sequence length 173
ec nomenclature
pdb deposition date 2008-10-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF04014 MazE_antitoxin Antidote-toxin recognition MazE, bacterial antitoxin
B PF15714 SpoVT_C Stage V sporulation protein T C-terminal, transcription factor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.260.10 Mainly Beta Ribbon Pemi-like Protein 1; Chain: D Pemi-like Protein 1; Chain: D 2w1tB01
3.30.450.40 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2w1tB02
2W3DA 2W3FA 2O99A 3CITA 3MQ0A 2G7UA 3DBAA 5I5LA 1MKMA 4ETXA 3MF0A 2FY9A 4Z1WA 3RFBA 2W1TA 2LB5A 3NHQA 3ZQ5A 1YSPA 4Q0IA 4Q0JA 1TD5A 2O9AA 4YOFA 3G6OA 2B18A 2K2NA 3TRCA 2GX5A 3KSGA 5L8MA 4G3WA 4Y2FA 5LBRA 2VJWA 2K31A 4MMNA 2XRNA 2KLIA 1YSQA 2W1TB 3BJNA 1ZTUA 3OBFA 3NOUC 4O0PA 4LRZE 4GLQA 3TNDB 2Y79A 4IJGA 4E04A 2LB9A 4IUKA 1YFBA 4MDZA 2W1RA 3KSHA 4LRYC 4YNRA 2RO3A 3KSFA 2O9CA 3KO6A 5C5KA 4FOFA 4Y5FA 3VV4A 4MN7A 2XROA 3S7QA 4DMZA 4IUHA 3S7OA 4G3KA 2VKSA 3NOPC 1MC0A 2W3HA 3K2NA 3C2WA 5ITMA 2K1NA 4G3VA 4LRXC 3O5YA 2L66A 4QPRA 1VHMA 2OOLA 1STZA 3E0YA 4Y3IA 5HPIA 1UB4C 3S7NA 3NOTC 4Q0HA 3OOVA 3HCYA 1MVFD 2KOIA 2O9BA 1F5MA 1TF1A 2Y8HA 2QYBA 4EUVA 2RO5A 2W3EA 4O01A 2IA2A 3O27A 4CQHA 1YKDA 2GLWA 2W3GA 4ZRRA 2HGVA 2ZMFA 3MMHA 5TJJA 3E98A 3IBRA 2O0YA 3IBJA 5HL6A 4BWIA 4ETZA 4MCWA 5DFYA 4R70A 4DN0A 4PAUA 4EU0A 3D3OA 1Z0RA 3KSIA 3LFVA 2VEAA 4RQ9A 5K5BA 3W2ZA 4R6LA 5AJGA 2M7UA 1YSFA 4ME4A 3CI6A 3S7PA 2VZWA 5HSQA 5HPFA 2RO4A 2XSSA 5DFXA 5ITJA 2M7VA 4O8GA 3R4KA 4GW9A 3EEAA
chains in the Genus database with same CATH superfamily
3N7WA 4DJ3A 3CPTA 3EGXC 2Z6CA 4JGRA 4R1GA 3KX0X 4S2LA 3NHQA 4Q0IA 3TW8A 5FQJA 2INWA 2V0UA 5GLDA 2ZM0A 3Q1FA 2VJWA 1YLPA 1PI5A 1DP6A 4JXWA 1SDEA 1HD8A 1S1ZA 3LICA 3DTMA 5EPHA 1DRMA 3CZDA 3M2JA 4R23A 4EWFA 3VE3A 5CHJA 1XX2A 3KSFA 5C5KA 4KZ4A 2X02A 4Y15A 2ZL1B 3T4SA 2C5WB 4G3KA 2W3HA 3G32A 5A91A 4DJ2A 1BUEA 2P08A 3PAEA 4O7DA 5CX7A 1VHMA 2PBYA 2KDKA 2EA9A 4Y3IA 5DTKA 5JYPA 2GJ3A 2ZMAA 3HLDA 3IF6A 1NLZA 5F69A 4OQ0A 3EEHA 5TBMA 3SOIA 3HVFA 3AGDA 4D2OA 4S2NA 2RCXA 2WGWB 3T4LA 3UPPA 3LCEA 2XR0A 2OSUA 4KG5A 4GZBA 3G2YA 4RQ9A 3DW0A 1WYBA 5CTMA 2HDRA 1OTAA 5DFXA 5M1AA 2ZMVA 1TDLA 4S2IA 5FSRA 2O99A 3UDIA 4BD0A 2LB5A 3F1PA 2L1MA 1ES2A 5DF9A 4R3BA 4JGPA 4E3JA 2WKIA 1VB6A 1SDNA 5DF8A 3VP0A 3BECA 1FSYA 4GHIB 3TNDB 4EETB 5EOEA 2VA0A 5M19A 3PBSA 3SS4A 2JKRI 2W1RA 2Y2JA 2BASA 4LRYC 4WEJA 4KQRA 3HLWA 3IXBA 3UDXA 3IT9A 2HP9A 1SKOB 1LL5A 2OAQ1 4R3JA 5DTTA 4LRXC 1H8YA 1A0KA 4QD4A 1XPBA 1NLYA 2Y55A 4JBFA 2O9BA 4KQQA 4LV2A 3VOYA 2XDMA 1QMFA 4NXBA 4O01A 1O7EA 4IBRA 2W3GA 3L7HA 3BRMA 1CF0A 1LLBA 4LPZA 4OPRA 5HL6A 2ZC5B 5DFYA 3PXPA 4OQHA 1W8YA 3VP2A 1DY6A 5GLBA 2Y2LA 3QP1A 4CJNA 1ES4A 2EFUA 4GD8A 4EEPA 3IWQA 3UDFA 4NG2A 3UB8A 1U60A 2MJ6A 5HPFA 1TDGA 3BM6A 5FI7A 2A49A 1FSWA 3ZCZA 1MXOA 1IYSA 2WUQA 5FDHA 3MQ0A 2XGNA 2H0TA 2ZOHA 4EV4A 2FY9A 3EWKA 4Z1WA 2QA4I 1H8ZA 2DRWA 4LV0A 4OKPA 2VGLM 5EECA 2ZQ9A 4HJ4A 3VFHA 2XEPA 3B3XA 5IHVA 3FPWA 1MKIA 2G2WA 2VGLS 1K25A 1DJCA 4JGQA 2WZZA 4QHCA 3ITAA 3VE4A 4X1LA 2HDUA 4IUKA 4EQIA 4GOGA 4A5RA 1YLJA 4FOFA 3HUNA 3MR0A 1JTGA 4EBPA 2D02A 3O86A 1FCNA 1F2KA 2H28A 2BG1A 2J9OA 5IT5A 4KG6A 4BL3A 1KDSA 4HJ6A 3MJQA 1NRJA 1MWUA 4X55A 3PHYA 3TOIA 4GJ4A 3WWXA 2OAP1 2XD1A 2HGVA 1W63M 3V5MA 4CLCC 1LSXA 1OTDA 1K54C 1MZUA 1E25A 1GA9A 1ACFA 3IS2B 5TGFA 3CMZA 1LSVA 3H82A 5E2FA 4EBNA 5EOOA 1BYWA 1X0OA 4MN5A 3S7PA 1WE4A 4PKYG 5CHMA 2JE5A 1K0KA 4OLGA 4U0XA 2XQZA 4OPYA 2JCHA 3MFXA 2EX9A 2B5RA 2AVXA 4YFMA 3N8LA 1TD5A 1YMXA 4DE2A 5EVIA 3E4QA 2ACGA 3G35A 4KQOA 2XRNA 2W1TB 4OH0A 2WAEA 2ZQ7A 1YQSA 3BEBA 3S4XA 1GSWA 4CPKA 4MEZA 5GHYA 1MBLA 2PAVP 3HBRA 2VGJA 1CJFA 3ZGAB 2ZLYA 3NOPC 1PWDA 4BD1A 4LV3A 2HZ5A 2PDRA 1OT9A 2Y2KA 4HQAA 3IQAA 3E0YA 5L10A 4P0MA 3T4OA 2JKRM 1V9ZA 1TS7A 3FKWA 4XUXA 2JN7A 3BW6A 1KGGA 3PTEA 1NYYA 1CI9A 4KG2A 2XFTA 3BLMA 4QY5A 5J4EA 1W79A 3V67A 4P85A 5F82A 4DF6A 2XA7S 4BWIA 5F5YA 3QP8A 2WKQA 3MXSA 4ZTKA 1EROA 4KZ3A 3T4QA 4XT2A 3ZNTA 2I72A 1PYYA 3A3DA 4HNBA 4BMWA 1G6AA 1KE3A 1OPXA 1XJ4A 3UE1A 3OCNA 1D06A 5J3WA 4HHDA 2W3FA 1N4OA 1MWRA 2J8YA 3V39A 3GMWA 5I5LA 1K57A 5FQKA 4YINA 4YOFA 3VP3A 4K91A 1N9LA 1T18A 3Q7VA 4DE1A 2QJ5A 2EWVA 5DJTA 3MXRA 2PBDP 3CUEC 1LHYA 1IKGA 3LYXA 4KZAA 3IX4A 1V9YA 3IXDA 1WYCA 2VK3A 3P09A 4YNRA 1YLWA 1EW0A 1YLTA 5HWTA 3BWLA 3GV9A 3K3DA 4UQIM 3N8SA 4ARZA 4QPRA 2PYRA 3TG9A 1S67L 4LFUA 4UQIS 5F1GA 3LO7A 3NOTC 1W5DA 4S2MA 1VQQA 5JYOA 2JC7A 3NCKA 3LIBA 1DP9A 5CXWA 1YKDA 3TSGA 4ZRRA 3R7WB 3PYPA 1N9NA 2HP6A 1XJ3A 1G5UA 3D3OA 3UB5P 4R38A 3HLEA 4C3QA 5K5BA 3U4LP 4WYYA 4B88A 5TR7A 5CECA 4U0TA 5DKLA 2M7VA 3QP2A 4CLCD 1W8QA 2W3DA 2WKEA 2ZL1A 4HBTA 3SS5A 2PD7A 1Z6FA 3MFDA 4HJ3A 3RFBA 5KSHA 2XF3A 5G4YA 3MS6A 2V1BA 3C30A 1NWZA 3G4PA 3ZVTA 1EWZA 3BY8A 1P97A 5L8MA 4F3LA 3LGOA 3A3EA 1SHVA 3T12B 1ZHHB 3BJNA 2DNSA 3IWOA 5KMWA 4X68A 4IJGA 1KE0A 4OP5A 3T4TA 2RO3A 1F98A 4EW7A 4Y5FA 2Q9MA 2A24A 5CERA 4RX3A 4I38A 4R3AA 5A90A 3W4PA 3PBOA 4JXGA 1STZA 2WKHA 1TS8A 1LI0A 5IS1A 1IEMA 3F1OB 1K6RA 3AGFA 2JHEA 3BY9A 5AQAA 4CQHA 5DTSA 3S22A 1OTIA 3L9KA 3LR4A 3SH7A 1SKFA 5EV0A 5CTNA 4MNRA 2ZC3B 1C3BA 2JKFA 1S1YA 4Y13A 3LI9A 5AQ7A 3HLGA 4K08A 4ME4A 2YKFA 5E2EA 3N8RA 5HSQA 3F1NA 5J7EA 1VETA 4E3KA 4ZJ2A 1K56D 3C4OA 3MXQA 3CITA 2OLUA 1LT0A 1GHMA 3UE6A 1JWZA 3A0SA 3C5AA 4GKUA 2P04A 1L3LA 2P7JA 3CPTB 3JYIA 2P9VA 3MQOA 5HL1A 4NKPA 4FTXA 1IFQA 3LEZA 2FFYA 2WGIA 3W8KA 3OBFA 4WN5A 3NULA 3GECA 3OPRA 3C7UA 3KSHA 2O9CA 4Y0OA 3H7WA 5HDSA 4UHUA 4ZBEA 4IEDA 1VEUA 4DMZA 4GB7A 5U47A 4HP9A 1NXYA 1FIKA 4WMCA 3Q82A 4JDMA 3ZG8B 5HX9A 2PU2A 4HOIA 2GZAA 2IWCA 3EOIA 4NK3A 1N9BA 2H5SA 3A0VA 3BFEA 3MQQA 2GLWA 5EM1A 4C6YA 2ZMFA 1Q2PA 3IF6B 3ZFZA 3IH8A 4I3AA 3C38A 4S2PA 3IBJA 3BYDA 1IYOA 5HARA 4CLCA 3IX8A 5TBMB 3LFVA 1S4RA 4JLFA 1K54A 3WS4A 5HWWA 5A92A 1HVBA 4P6BA 5HAQA 3VOZA 2ZC6B 5GLAA 3PAGA 1KDWA 4KUKA 2G7UA 3DBAA 1NZUA 1OTEA 4EBLA 1NRFA 3FV7A 1E4DA 3JVVA 2VV7A 1LSWA 1CQAA 2ZC4B 4GDNA 4G3WA 2WZXA 2J80A 1XA7A 4MMNA 1ERMA 3VFFA 5FAQA 3F1PB 3PBQA 3Q81A 5F6AA 5D3OA 1JWVA 3CLOA 2JBFA 4MLLA 5HFOA 4MDZA 3BLSA 1L2SA 4WBGA 3TE8A 2J3TC 2GDNA 3PBTA 1BZAA 2VKSA 3GSGA 1H0MA 1BLSA 5EVLA 2OLVA 3FZCA 2L66A 4PM6A 2Y91A 4II7A 4IVIA 1J9MA 3H9WA 5FASA 1JVJA 1F9IA 3OPHA 3LUQA 2WKRA 1MVFD 1F5MA 3Q7ZA 4GS9A 1UGUA 3WS2A 4LCMA 4MBFA 4PM8A 4PKYA 4BQMA 4BBUA 5CEBA 5FQMA 1PW8A 3ZNYA 1MWSA 4WZ5C 4WL9A 2ZQ8A 2W27A 4R70A 1K56A 4PMAA 4EU0A 3TJZC 3G30A 5HDDA 2ZM2A 3B42A 1BLHA 4WM9A 1S6RA 1YLYA 3BFDA 2XSSA 3UMEA 1OTBA 3ZYTA 4DE0A 1LI9A 1MY8A 4NXGA 1MKMA 4B4XA 4H6JA 4LLOB 3ZHHA 2Z6DA 2WGVA 3A0RA 3WRTA 4R4RA 4E3LA 1JTDA 3MZEA 3O87A 1ODVA 2B18A 4LV1A 2CC1A 3KSGA 1RGYA 4B93A 1SCWA 3G31A 1QMEA 3UNWA 3DAVA 4KZ9A 5E2HA 3IH9A 2JKTI 2QKPA 1H8MA 1ESUA 2I9VA 4O0PA 3M6HA 2QMIA 4DXBA 3CUEA 4E04A 3MZDA 1XA1A 1YFBA 5A8BA 2HV1A 3P98A 3HJKA 4R4SA 1LL8A 1XGJA 1D1JA 3HJIA 2W0NA 1S0WA 4PPRA 3D72A 1IKIA 4XUZA 4BBTA 3LIAA 4KQDA 3SW1A 1HLUP 4H8RA 1MC0A 5DF7A 5CRFA 4G3VA 4WELA 2RL3A 4N92A 2E8JA 2CMNA 1KVMA 2YKHA 3A3IA 2L0WA 3S7NA 1BULA 2KOIA 5FEGA 3AGEA 4EUVA 1FR6A 1K38A 4JF5A 4UAAA 1XGIA 3WS1A 1PWCA 4WLAA 5TJJA 3NJAA 4MCWA 4Y7PA 5HAIA 2QJ7A 5FA7A 2HDSA 3E2KA 2EXBA 2VGKA 3W2ZA 2OWJA 1YSFA 5HAPA 4GD6A 2Y2QA 1ONHA 1FCMA 3MSHA 3HL9A 3V50A 2PU4A 2VV6A 2Y2GA 3H82B 4GCZA 2HJEA 3T1QB 3MF0A 3JPUA 3ZG9B 3LIEA 4WF0A 4ID4A 3NY4A 1HZOA 4YWZA 3P01A 3G6OA 4X25A 1KGFA 5AVFA 5HD3A 3SS3A 3TRCA 2WAFA 3HREA 3DTEA 2KLIA 1YSQA 1ZKJA 3IHAA 2EXAA 5EVIB 4E6XA 5HDCA 3A3JA 4HP4A 4BJPA 2ZQDA 3QP4A 5G18A 3NBLA 4UA7A 5HZHA 4DDSA 4HESA 4BLMA 3HUOA 1RCJA 3KYEA 3K2NA 1IELA 2ZOIA 3UB9A 2Y2OA 1OT6A 3E4OA 4RVAA 5FQIA 3IXGA 3OOVA 1UWPX 4P87A 5CGWA 1TF1A 3UY6A 1NY0A 2J3TD 3FKVA 2RO5A 2PHYA 2Y2IA 3E4PA 3K3CA 4EERA 2A3UA 4IHQA 4OP8A 4PHTA 1VM1A 4NXFA 4FSFA 1S4SA 4XXRA 3N4IA 3BQAA 3UPOA 5EVIC 3OPPA 4UA9A 5AQBA 4BL2A 2Q0OA 3DTKA 4CLCE 4S2KA 4I39A 4OQGA 2VZWA 2H0YA 4OONA 2ZQCA 4PM5A 4B4ZA 1G6OA 3U2AA 4OPZA 3PR6A 1OMEA 1RP5A 3UO9A 2XFSA 5FAOA 1WA9A 4GNUA 2BTFP 3BFFA 4N1XA 4KZ5A 2V20A 3KYQA 1BTLA 4Y2FA 1SZVA 3QNCA 5KZHA 4EESA 3GTCA 5GL9A 2C6WB 4JXVA 3FC7A 3LR3A 3Q7VB 2X01A 1PI4A 5FEFA 4QJGA 4Q8IA 1EI5A 2R78A 3UMDA 1ES3A 3QP5A 1MPLA 3OCLA 4IUHA 2JKTM 3C8CA 4X69A 3C2WA 3O5YA 4MBKA 3V3SA 5DJUA 1ES5A 3C7VA 3S1YA 2UWXA 2WGWA 4ARZB 3Q07A 4KUOA 4E6WA 3UE3A 5E43A 5GHXA 3ZG5A 2IA2A 1K6SA 3IX3A 4QB8A 4JXSA 5G4ZA 1CI8A 1BSGA 3BFCA 4PAUA 2BLSA 1K55C 4RX2A 2VEAA 2Y2HA 2EX8A 5I94A 4ZDXA 5F68A 2GNXA 4UA6A 3UN7A 1W7FA 3RH8B 2RO4A 1FILA 4ZAMA 4O8GA 1O07A 1I5QA 4ZJ3A 3EEAA 3B33A 2OWHA 3FYZA 3UE0A 4ETXA 2HF6A 5A93A 2O9AA 4HH2A 4PM7A 3WRZA 4GHIA 2FFFB 2Y2NA 3M2KA 3UB6A 1K4EA 3LY3A 3ZDJA 2V8CA 4QU3A 2L4RA 4OOLA 1T1AA 4K0WA 1SKOA 2NUTC 4KZ8A 5TFQA 4Y17A 3PBRA 4F3LB 4E3IA 2EWWA 4ESPA 5EM0A 2PD8A 1T1BA 2WYXA 1PZOA 3VV4A 1PFLA 3C4PA 2EX6A 1DP8A 1RGZA 3S7OA 1DJAA 1M40A 4FH4A 1CEFA 4KZBA 1H3QA 2V8FA 1YAXA 4OVDA 2OOLA 2Y2MA 3G2ZA 2OV5A 2VLGA 5AQ9A 3IHBA 4BENA 4EUZA 4DRTA 4PM9A 2HJ9C 2A24B 1ALQA 4Q0HA 1I2WA 3HCYA 5EUAA 2J3WA 4U3TA 4OOYA 4X6TA 1XP4A 1L0FA 5F1FA 3VSLA 3O3VA 1YM1A 3HLCA 3MZFA 3MMHA 3LIFA 3E98A 2ZBBA 3WS0A 2QPNA 3MKFA 2X71A 1PWGA 3EQUA 4WZ5A 1Z0RA 1GSXA 5AJGA 3D4FA 4JGOA 3NDEA 4N9LA 5J8XA 3D9YA 1Y4OA 3RTYA 3T1RA 1YMSA 5FL3A 2ZQAA 5EVID 1GHPA 3T50A 3ZQ5A 1YSPA 5CGXA 3F1NB 3LEQA 1KOUA 4Y0UA 1VETB 1T1CA 4M3KA 1L0GA 3DWKA 2DMWA 2G2UA 3GQZA 3NIAA 4JDOA 2VX8A 2ZJ9A 1AWIA 2Y4AA 3T1XA 3I7JA 2P9VB 3MBZA 5KSCA 4RA7A 4EQ1A 2HP5A 2V0WA 5HWVA 2KX6A 1FR1A 3CHWP 2Z2MB 3GDIA 4F94A 4EXOA 4FUWA 3S7QA 2V9AA 4HI4A 4RYEA 1BLCA 2FH5A 2P74A 4KZ7A 3HLFA 1ZG4A 3NC8A 2K1NA 4JKTA 3IF6C 5EFWA 4ZJ1A 1Y28A 3P7NA 5HPIA 3H7WB 1UB4C 1VEUB 2EX2A 3GRJA 3DTIA 1LL9A 1GCEA 1L0EA 2W3EA 3W4OA 3IS2A 3T1SA 4R0QA 4S2NC 3UPNA 4IVKA 3KYZA 1PZPA 3IBRA 1K4FA 2NUPC 5CHUA 3UB7A 3M6BA 4HEFA 1P9RA 4AFIA 3RXXA 1IOUA 1PNEA 2ZM8A 1M6KA 5FDSA 1E3UD 3VMAA 3ICYA 4CLCB 1AXBA 4HY8A 5IU1A 1P0ZA 5BOHA 1XFQA 3R4KA 3NECA 3T4JA 4E3NA 3MKEA 2W1TA 5CEDA 1DJBA 4Q0JA 2Y2PA 2PR5A 2IWDA 3VSKA 1ZC2A 3RJUA 2K31A 4X53A 1PRQA 4WEKA 2Q9NA 2QHKA 4LGWA 1UWNX 4Y0TA 3QP6A 1GSVA 4GLQA 4L9FA 4JPMA 2Y79A 5DVAA 3A3FA 1N9OA 1XKZA 4I5SA 4NXEA 5KIZA 2FZ0A 1GA0A 3LY4A 1YLZA 1NJ4A 4NETA 4L9GA 5ITMA 1XXMA 4DKIA 4B9OA 1NYMA 1G68A 4DXCA 1FQGA 4LENA 4JF6A 2HPBA 5F83A 2Y8HA 2QYBA 2ZC7A 3E2LA 4OPQA 1BLPA 4K0XA 1MWTA 2WK0A 3IXHA 2J9PA 4GS9B 4I3JA 4DN0A 5HW3A 1JWPA 3SH8A 2XD5A 2HDQA 5E2GA 4HH3A 4R6LA 2WKPA 1OJGA 4FH2A 3CAXA 3N6IA 4FCFA 4N9KA 1KGEA 3ZVWA 2QWSA 4M4XA 5ITJA 2PT7A 3IWIA 3WS5A 1BT5A 1YPRA 3ZG7B 3RXWA 4P6ZM 3GR2A 3PBNA 2K2NA 4P6ZS 3BQ8A 1TVFA 5DKKA 3SH9A 2PR6A 3JVUA 4H6JB 1ONGA 1P9WA 2B95A 2H10A 1ZTUA 3VOLA 3NOUC 3EQVA 1PW1A 2UV0E 2E8IA 2PYPA 1FCOA 1Q2QA 3NDGA 2XA7M 3ULFA 3KO6A 1XJ6A 1GHIA 2XROA 1YT4A 2V2FF 4BBVA 3OLOA 1D7EA 2ZD8A 4E3OA 1CK3A 1S66L 1KE4A 3R7WA 3W4QA 5L2FA 3G34A 5EVEA 1L0DA 3OC2A 1TEMA 2XLNA 4WZ4A 2QZ6A 5FI2A 4GDBA 3DWZA 4LCLA 3T4KA 1E3UA 3QNBA 2M1CA 2O0YA 3OPLA 4X1MA 4ETZA 3B47A 4WUJA 4OOMA 4NEED 5EE8A 1NZOA 4S2JA 5L09A 4JF4A 2IWBA 4N1HA 3CG5A 2M7UA 1K55A 2DCFA 1Z09A 1ESIA 4QY6A 2B02A 4QWOA 1W63Q 4L9EA 5FATA 1G28A 4HIAA 3NI9A 1ZG6A 1CEGA 5FI6A 1HTZA 2Z2LB 2V1AA 2R9WA 2VV8A 2XH9A 3SZTA 1IYQA 2GX5A 4E3MA 4IBXA 3LI8A 5LBRA 3LR5A 3EGDC 4S2OA 5CGSA 2R9XA 4X56A 2D01A 2J7VA 3QHYA 4XT2B 3HLBA 4OQIA 2V1ZA 5HD5A 4LRZE 2EFXA 3LR0A 3HUMA 4Z9QA 5FQ9A 2LB9A 4C75A 2WADA 3CJMA 4I3IA 4KENB 1JNUA 4WMCD 4MN7A 3ZG0A 1Y54A 4UEYA 4DE3A 3FPVA 3F1OA 3FWLA 5GLCA 5MC7A 5FQQA 3VP4A 4EEUA 4GN2A 1T19A 3ISGA 5M18A 5FAPA 2XK1A 2JKGA 1KVLA 3O88A 3V3RA 4D60A 5GHZA 3GVBA 2A2LA 3FG8A 2PRFA 5L07A 2Y59A 3O27A 3LIDA 4MN6A 1OJ5A 3OZHA 1J3WA 4FD8A 4L0LA 2K7SA 4KZ6A 1XFNA 5AVEA 1XJ2A 3BFGA 3VP1A 4MBHA 1IYPA 1TS0A 3ITBA 3KSIA 4DDYA 1TS6A 1FOFA 4HBUA 3IF5A 3CI6A 1PIOA 1I2SA 1H5XA 4OLDA 1ERQA 3CWFA 1K57C 4GW9A
chains in the Genus database with same CATH topology
4HHDA 3ZYTA 4DJ3A 3EGXC 2W3FA 2Z6CA 4NXGA 5FL3A 5I5LA 1MKMA 4JGRA 4H6JA 3KX0X 4LLOB 3T50A 3NHQA 2Z6DA 3ZQ5A 1YSPA 4Q0IA 3A0RA 3TW8A 3F1NB 4YOFA 2INWA 1KOUA 2V0UA 1T1CA 1ODVA 2B18A 3KSGA 4B93A 1N9LA 1T18A 2VJWA 2DMWA 2QJ5A 1DP6A 2EWVA 5DJTA 2JKTI 2QKPA 4JDOA 2VX8A 1H8MA 4O0PA 2I9VA 1S1ZA 3CUEC 3LICA 1DRMA 3LYXA 1V9YA 3CUEA 4E04A 4EQ1A 1YFBA 2V0WA 5HWVA 5A8BA 2HV1A 2KX6A 3HJKA 3VE3A 4YNRA 1LL8A 3KSFA 5C5KA 3GDIA 3HJIA 2W0NA 1EW0A 3D72A 4EXOA 5HWTA 4BBTA 3BWLA 3K3DA 3S7QA 3LIAA 4KQDA 3T4SA 2V9AA 4UQIM 3SW1A 4G3KA 4HI4A 2FH5A 1MC0A 2W3HA 4DJ2A 4ARZA 2K1NA 4G3VA 2P08A 4WELA 2PYRA 4QPRA 1VHMA 1S67L 5CX7A 5EFWA 2KDKA 2CMNA 2YKHA 2EA9A 1Y28A 3P7NA 4Y3IA 3H7WB 5HPIA 2GJ3A 2L0WA 4UQIS 1UB4C 3S7NA 3NOTC 1NLZA 5F69A 2KOIA 4EUVA 2W3EA 3LIBA 1DP9A 3EEHA 3IS2A 5TBMA 1YKDA 4ZRRA 3KYZA 3R7WB 4WLAA 5TJJA 3IBRA 2NUPC 3PYPA 1N9NA 3NJAA 3T4LA 3UB7A 4MCWA 1P9RA 1XJ3A 2QJ7A 3D3OA 4R38A 4AFIA 5K5BA 4RQ9A 1IOUA 3W2ZA 2OWJA 1YSFA 1OTAA 3ICYA 4CLCB 5DFXA 5DKLA 4HY8A 2M7VA 5IU1A 1P0ZA 2VV6A 4CLCD 2ZMVA 1XFQA 3R4KA 4GCZA 3H82B 2W3DA 2O99A 3T4JA 2HJEA 3MF0A 2PD7A 4HJ3A 3RFBA 5KSHA 2W1TA 2LB5A 5G4YA 3F1PA 3LIEA 4WF0A 4Q0JA 2V1BA 2L1MA 3C30A 1NWZA 4YWZA 3P01A 2PR5A 3G6OA 5DF9A 5AVFA 5HD3A 3TRCA 3BY8A 1P97A 5L8MA 4JGPA 4F3LA 2K31A 4WEKA 1VB6A 2KLIA 2QHKA 1YSQA 1UWNX 1ZHHB 3BJNA 1GSVA 4GLQA 4L9FA 4GHIB 3TNDB 4EETB 5HDCA 2Y79A 4IJGA 4HP4A 1N9OA 4BJPA 2VA0A 4I5SA 3PBSA 4NXEA 2JKRI 2FZ0A 2W1RA 3T4TA 2BASA 5KIZA 4LRYC 4WEJA 2RO3A 5HZHA 1F98A 4EW7A 4Y5FA 2A24A 2OAQ1 4L9GA 3K2NA 4I38A 5ITMA 2ZOIA 4LRXC 4R3AA 3UB9A 3PBOA 4B9OA 1STZA 1OT6A 3E4OA 1NLYA 1TS8A 3OOVA 1UWPX 2O9BA 5IS1A 1TF1A 2Y8HA 3F1OB 2QYBA 2J3TD 2RO5A 2PHYA 3E4PA 2JHEA 3K3CA 4NXBA 4O01A 4EERA 3BY9A 4CQHA 2W3GA 4IHQA 4PHTA 1OTIA 3LR4A 4NXFA 4FSFA 4LPZA 1S4SA 5HL6A 5DFYA 3BQAA 3PXPA 4GS9B 4I3JA 4DN0A 1S1YA 3LI9A 4HH3A 4R6LA 4CLCE 4K08A 4EEPA 2WKPA 4ME4A 4I39A 1OJGA 3UB8A 2MJ6A 2YKFA 2VZWA 5HSQA 5HPFA 3CAXA 2QWSA 3F1NA 4M4XA 5ITJA 5J7EA 2PT7A 1G6OA 3U2AA 3MXQA 3PR6A 3CITA 3MQ0A 4P6ZM 2ZOHA 1LT0A 2FY9A 3EWKA 4Z1WA 2QA4I 3UE6A 1WA9A 2VGLM 3A0SA 3PBNA 2P04A 2K2NA 4HJ4A 3KYQA 4P6ZS 3BQ8A 2P7JA 3MQOA 4NKPA 5DKKA 4Y2FA 2PR6A 3FPWA 1IFQA 3JVUA 4H6JB 2VGLS 4EESA 1P9WA 4JGQA 1ZTUA 3OBFA 3NOUC 3VOLA 3EQVA 4WN5A 3FC7A 3VE4A 3GECA 3LR3A 2PYPA 4IUKA 3KSHA 2XA7M 3ULFA 2R78A 3UMDA 2O9CA 3KO6A 4FOFA 1XJ6A 3MR0A 3H7WA 5HDSA 3OCLA 4DMZA 2XROA 4IUHA 2JKTM 3C8CA 2D02A 4BBVA 3OLOA 4HP9A 1D7EA 3C2WA 2H28A 3O5YA 5IT5A 1S66L 4JDMA 4HJ6A 3MJQA 5DJUA 1NRJA 3R7WA 4HOIA 3PHYA 2GZAA 3EOIA 3OC2A 4ARZB 4KUOA 3UE3A 4GJ4A 2IA2A 3A0VA 2OAP1 3MQQA 2GLWA 3T4KA 2HGVA 2ZMFA 1W63M 4CLCC 4I3AA 2M1CA 3C38A 1LSXA 2O0YA 5G4ZA 1OTDA 3IBJA 4ETZA 3B47A 4WUJA 4CLCA 4OOMA 1MZUA 4PAUA 4NEED 3IS2B 5TBMB 3LFVA 1LSVA 2VEAA 1S4RA 3H82A 2M7UA 5HWWA 5F68A 2GNXA 1BYWA 1X0OA 4MN5A 3S7PA 3RH8B 2B02A 4PKYG 1W63Q 2RO4A 4L9EA 4O8GA 1G28A 3EEAA 3B33A 2OWHA 4KUKA 4HIAA 3MFXA 2G7UA 3DBAA 4ETXA 1OTEA 2HF6A 3JVVA 1TD5A 2O9AA 4HH2A 2VV7A 1LSWA 2V1AA 2VV8A 4GHIA 3UB6A 3E4QA 2GX5A 4G3WA 3LI8A 5LBRA 2J80A 3LR5A 3EGDC 4KQOA 2L4RA 4MMNA 2XRNA 4OOLA 2W1TB 2D01A 3F1PB 3PBQA 4XT2B 1T1AA 5F6AA 5HD5A 4LRZE 2NUTC 3LR0A 3CLOA 3PBRA 4F3LB 2LB9A 1GSWA 2EWWA 4MDZA 2PD8A 1T1BA 3TE8A 4I3IA 2J3TC 1JNUA 3VV4A 1DP8A 4MN7A 3S7OA 3PBTA 2VKSA 3NOPC 4UEYA 1H3QA 3FPVA 3F1OA 1YAXA 5MC7A 2PDRA 1OT9A 2L66A 4EEUA 2OOLA 1T19A 4HQAA 4II7A 3E0YA 2VLGA 3H9WA 3T4OA 2JKRM 1V9ZA 1F9IA 1TS7A 2HJ9C 2A24B 4Q0HA 3LUQA 2JN7A 3BW6A 2WKRA 1MVFD 3HCYA 2J3WA 1F5MA 4GS9A 1UGUA 2A2LA 3FG8A 5J4EA 3O27A 3V67A 3LIDA 4MN6A 1OJ5A 4PKYA 4L0LA 2K7SA 3LIFA 3E98A 3MMHA 2XA7S 2ZBBA 4BBUA 4BWIA 1XFNA 5F5YA 4WL9A 5AVEA 1XJ2A 2WKQA 2W27A 4R70A 4EU0A 3T4QA 3EQUA 3TJZC 1TS0A 1Z0RA 3KSIA 4XT2A 5HDDA 1TS6A 1GSXA 5AJGA 3B42A 4HNBA 4JGOA 3CI6A 4BMWA 2XSSA 3UMEA 1OPXA 1XJ4A 3CWFA 3RTYA 3OCNA 1D06A 1OTBA 5J3WA 4GW9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2W3D A;  2W3F A;  2O99 A;  3CIT A;  3MQ0 A;  2G7U A;  3DBA A;  5I5L A;  1MKM A;  4ETX A;  3MF0 A;  2FY9 A;  4Z1W A;  3RFB A;  2W1T A;  2LB5 A;  3NHQ A;  3ZQ5 A;  1YSP A;  4Q0I A;  4Q0J A;  1TD5 A;  2O9A A;  4YOF A;  3G6O A;  2B18 A;  2K2N A;  3TRC A;  2GX5 A;  3KSG A;  5L8M A;  4G3W A;  4Y2F A;  5LBR A;  2VJW A;  2K31 A;  4MMN A;  2XRN A;  2KLI A;  1YSQ A;  2W1T B;  3BJN A;  1ZTU A;  3OBF A;  3NOU C;  4O0P A;  4LRZ E;  4GLQ A;  3TND B;  2Y79 A;  4IJG A;  4E04 A;  2LB9 A;  4IUK A;  1YFB A;  4MDZ A;  2W1R A;  3KSH A;  4LRY C;  4YNR A;  2RO3 A;  3KSF A;  2O9C A;  3KO6 A;  5C5K A;  4FOF A;  4Y5F A;  3VV4 A;  4MN7 A;  2XRO A;  3S7Q A;  4DMZ A;  4IUH A;  3S7O A;  4G3K A;  2VKS A;  3NOP C;  1MC0 A;  2W3H A;  3K2N A;  3C2W A;  5ITM A;  2K1N A;  4G3V A;  4LRX C;  3O5Y A;  2L66 A;  4QPR A;  1VHM A;  2OOL A;  1STZ A;  3E0Y A;  4Y3I A;  5HPI A;  1UB4 C;  3S7N A;  3NOT C;  4Q0H A;  3OOV A;  3HCY A;  1MVF D;  2KOI A;  2O9B A;  1F5M A;  1TF1 A;  2Y8H A;  2QYB A;  4EUV A;  2RO5 A;  2W3E A;  4O01 A;  2IA2 A;  3O27 A;  4CQH A;  1YKD A;  2GLW A;  2W3G A;  4ZRR A;  2HGV A;  2ZMF A;  3MMH A;  5TJJ A;  3E98 A;  3IBR A;  2O0Y A;  3IBJ A;  5HL6 A;  4BWI A;  4ETZ A;  4MCW A;  5DFY A;  4R70 A;  4DN0 A;  4PAU A;  4EU0 A;  3D3O A;  1Z0R A;  3KSI A;  3LFV A;  2VEA A;  4RQ9 A;  5K5B A;  3W2Z A;  4R6L A;  5AJG A;  2M7U A;  1YSF A;  4ME4 A;  3CI6 A;  3S7P A;  2VZW A;  5HSQ A;  5HPF A;  2RO4 A;  2XSS A;  5DFX A;  5ITJ A;  2M7V A;  4O8G A;  3R4K A;  4GW9 A;  3EEA A; 
#chains in the Genus database with same CATH topology
 3N7W A;  4DJ3 A;  3CPT A;  3EGX C;  2Z6C A;  4JGR A;  4R1G A;  3KX0 X;  4S2L A;  3NHQ A;  4Q0I A;  3TW8 A;  5FQJ A;  2INW A;  2V0U A;  5GLD A;  2ZM0 A;  3Q1F A;  2VJW A;  1YLP A;  1PI5 A;  1DP6 A;  4JXW A;  1SDE A;  1HD8 A;  1S1Z A;  3LIC A;  3DTM A;  5EPH A;  1DRM A;  3CZD A;  3M2J A;  4R23 A;  4EWF A;  3VE3 A;  5CHJ A;  1XX2 A;  3KSF A;  5C5K A;  4KZ4 A;  2X02 A;  4Y15 A;  2ZL1 B;  3T4S A;  2C5W B;  4G3K A;  2W3H A;  3G32 A;  5A91 A;  4DJ2 A;  1BUE A;  2P08 A;  3PAE A;  4O7D A;  5CX7 A;  1VHM A;  2PBY A;  2KDK A;  2EA9 A;  4Y3I A;  5DTK A;  5JYP A;  2GJ3 A;  2ZMA A;  3HLD A;  3IF6 A;  1NLZ A;  5F69 A;  4OQ0 A;  3EEH A;  5TBM A;  3SOI A;  3HVF A;  3AGD A;  4D2O A;  4S2N A;  2RCX A;  2WGW B;  3T4L A;  3UPP A;  3LCE A;  2XR0 A;  2OSU A;  4KG5 A;  4GZB A;  3G2Y A;  4RQ9 A;  3DW0 A;  1WYB A;  5CTM A;  2HDR A;  1OTA A;  5DFX A;  5M1A A;  2ZMV A;  1TDL A;  4S2I A;  5FSR A;  2O99 A;  3UDI A;  4BD0 A;  2LB5 A;  3F1P A;  2L1M A;  1ES2 A;  5DF9 A;  4R3B A;  4JGP A;  4E3J A;  2WKI A;  1VB6 A;  1SDN A;  5DF8 A;  3VP0 A;  3BEC A;  1FSY A;  4GHI B;  3TND B;  4EET B;  5EOE A;  2VA0 A;  5M19 A;  3PBS A;  3SS4 A;  2JKR I;  2W1R A;  2Y2J A;  2BAS A;  4LRY C;  4WEJ A;  4KQR A;  3HLW A;  3IXB A;  3UDX A;  3IT9 A;  2HP9 A;  1SKO B;  1LL5 A;  2OAQ 1;  4R3J A;  5DTT A;  4LRX C;  1H8Y A;  1A0K A;  4QD4 A;  1XPB A;  1NLY A;  2Y55 A;  4JBF A;  2O9B A;  4KQQ A;  4LV2 A;  3VOY A;  2XDM A;  1QMF A;  4NXB A;  4O01 A;  1O7E A;  4IBR A;  2W3G A;  3L7H A;  3BRM A;  1CF0 A;  1LLB A;  4LPZ A;  4OPR A;  5HL6 A;  2ZC5 B;  5DFY A;  3PXP A;  4OQH A;  1W8Y A;  3VP2 A;  1DY6 A;  5GLB A;  2Y2L A;  3QP1 A;  4CJN A;  1ES4 A;  2EFU A;  4GD8 A;  4EEP A;  3IWQ A;  3UDF A;  4NG2 A;  3UB8 A;  1U60 A;  2MJ6 A;  5HPF A;  1TDG A;  3BM6 A;  5FI7 A;  2A49 A;  1FSW A;  3ZCZ A;  1MXO A;  1IYS A;  2WUQ A;  5FDH A;  3MQ0 A;  2XGN A;  2H0T A;  2ZOH A;  4EV4 A;  2FY9 A;  3EWK A;  4Z1W A;  2QA4 I;  1H8Z A;  2DRW A;  4LV0 A;  4OKP A;  2VGL M;  5EEC A;  2ZQ9 A;  4HJ4 A;  3VFH A;  2XEP A;  3B3X A;  5IHV A;  3FPW A;  1MKI A;  2G2W A;  2VGL S;  1K25 A;  1DJC A;  4JGQ A;  2WZZ A;  4QHC A;  3ITA A;  3VE4 A;  4X1L A;  2HDU A;  4IUK A;  4EQI A;  4GOG A;  4A5R A;  1YLJ A;  4FOF A;  3HUN A;  3MR0 A;  1JTG A;  4EBP A;  2D02 A;  3O86 A;  1FCN A;  1F2K A;  2H28 A;  2BG1 A;  2J9O A;  5IT5 A;  4KG6 A;  4BL3 A;  1KDS A;  4HJ6 A;  3MJQ A;  1NRJ A;  1MWU A;  4X55 A;  3PHY A;  3TOI A;  4GJ4 A;  3WWX A;  2OAP 1;  2XD1 A;  2HGV A;  1W63 M;  3V5M A;  4CLC C;  1LSX A;  1OTD A;  1K54 C;  1MZU A;  1E25 A;  1GA9 A;  1ACF A;  3IS2 B;  5TGF A;  3CMZ A;  1LSV A;  3H82 A;  5E2F A;  4EBN A;  5EOO A;  1BYW A;  1X0O A;  4MN5 A;  3S7P A;  1WE4 A;  4PKY G;  5CHM A;  2JE5 A;  1K0K A;  4OLG A;  4U0X A;  2XQZ A;  4OPY A;  2JCH A;  3MFX A;  2EX9 A;  2B5R A;  2AVX A;  4YFM A;  3N8L A;  1TD5 A;  1YMX A;  4DE2 A;  5EVI A;  3E4Q A;  2ACG A;  3G35 A;  4KQO A;  2XRN A;  2W1T B;  4OH0 A;  2WAE A;  2ZQ7 A;  1YQS A;  3BEB A;  3S4X A;  1GSW A;  4CPK A;  4MEZ A;  5GHY A;  1MBL A;  2PAV P;  3HBR A;  2VGJ A;  1CJF A;  3ZGA B;  2ZLY A;  3NOP C;  1PWD A;  4BD1 A;  4LV3 A;  2HZ5 A;  2PDR A;  1OT9 A;  2Y2K A;  4HQA A;  3IQA A;  3E0Y A;  5L10 A;  4P0M A;  3T4O A;  2JKR M;  1V9Z A;  1TS7 A;  3FKW A;  4XUX A;  2JN7 A;  3BW6 A;  1KGG A;  3PTE A;  1NYY A;  1CI9 A;  4KG2 A;  2XFT A;  3BLM A;  4QY5 A;  5J4E A;  1W79 A;  3V67 A;  4P85 A;  5F82 A;  4DF6 A;  2XA7 S;  4BWI A;  5F5Y A;  3QP8 A;  2WKQ A;  3MXS A;  4ZTK A;  1ERO A;  4KZ3 A;  3T4Q A;  4XT2 A;  3ZNT A;  2I72 A;  1PYY A;  3A3D A;  4HNB A;  4BMW A;  1G6A A;  1KE3 A;  1OPX A;  1XJ4 A;  3UE1 A;  3OCN A;  1D06 A;  5J3W A;  4HHD A;  2W3F A;  1N4O A;  1MWR A;  2J8Y A;  3V39 A;  3GMW A;  5I5L A;  1K57 A;  5FQK A;  4YIN A;  4YOF A;  3VP3 A;  4K91 A;  1N9L A;  1T18 A;  3Q7V A;  4DE1 A;  2QJ5 A;  2EWV A;  5DJT A;  3MXR A;  2PBD P;  3CUE C;  1LHY A;  1IKG A;  3LYX A;  4KZA A;  3IX4 A;  1V9Y A;  3IXD A;  1WYC A;  2VK3 A;  3P09 A;  4YNR A;  1YLW A;  1EW0 A;  1YLT A;  5HWT A;  3BWL A;  3GV9 A;  3K3D A;  4UQI M;  3N8S A;  4ARZ A;  4QPR A;  2PYR A;  3TG9 A;  1S67 L;  4LFU A;  4UQI S;  5F1G A;  3LO7 A;  3NOT C;  1W5D A;  4S2M A;  1VQQ A;  5JYO A;  2JC7 A;  3NCK A;  3LIB A;  1DP9 A;  5CXW A;  1YKD A;  3TSG A;  4ZRR A;  3R7W B;  3PYP A;  1N9N A;  2HP6 A;  1XJ3 A;  1G5U A;  3D3O A;  3UB5 P;  4R38 A;  3HLE A;  4C3Q A;  5K5B A;  3U4L P;  4WYY A;  4B88 A;  5TR7 A;  5CEC A;  4U0T A;  5DKL A;  2M7V A;  3QP2 A;  4CLC D;  1W8Q A;  2W3D A;  2WKE A;  2ZL1 A;  4HBT A;  3SS5 A;  2PD7 A;  1Z6F A;  3MFD A;  4HJ3 A;  3RFB A;  5KSH A;  2XF3 A;  5G4Y A;  3MS6 A;  2V1B A;  3C30 A;  1NWZ A;  3G4P A;  3ZVT A;  1EWZ A;  3BY8 A;  1P97 A;  5L8M A;  4F3L A;  3LGO A;  3A3E A;  1SHV A;  3T12 B;  1ZHH B;  3BJN A;  2DNS A;  3IWO A;  5KMW A;  4X68 A;  4IJG A;  1KE0 A;  4OP5 A;  3T4T A;  2RO3 A;  1F98 A;  4EW7 A;  4Y5F A;  2Q9M A;  2A24 A;  5CER A;  4RX3 A;  4I38 A;  4R3A A;  5A90 A;  3W4P A;  3PBO A;  4JXG A;  1STZ A;  2WKH A;  1TS8 A;  1LI0 A;  5IS1 A;  1IEM A;  3F1O B;  1K6R A;  3AGF A;  2JHE A;  3BY9 A;  5AQA A;  4CQH A;  5DTS A;  3S22 A;  1OTI A;  3L9K A;  3LR4 A;  3SH7 A;  1SKF A;  5EV0 A;  5CTN A;  4MNR A;  2ZC3 B;  1C3B A;  2JKF A;  1S1Y A;  4Y13 A;  3LI9 A;  5AQ7 A;  3HLG A;  4K08 A;  4ME4 A;  2YKF A;  5E2E A;  3N8R A;  5HSQ A;  3F1N A;  5J7E A;  1VET A;  4E3K A;  4ZJ2 A;  1K56 D;  3C4O A;  3MXQ A;  3CIT A;  2OLU A;  1LT0 A;  1GHM A;  3UE6 A;  1JWZ A;  3A0S A;  3C5A A;  4GKU A;  2P04 A;  1L3L A;  2P7J A;  3CPT B;  3JYI A;  2P9V A;  3MQO A;  5HL1 A;  4NKP A;  4FTX A;  1IFQ A;  3LEZ A;  2FFY A;  2WGI A;  3W8K A;  3OBF A;  4WN5 A;  3NUL A;  3GEC A;  3OPR A;  3C7U A;  3KSH A;  2O9C A;  4Y0O A;  3H7W A;  5HDS A;  4UHU A;  4ZBE A;  4IED A;  1VEU A;  4DMZ A;  4GB7 A;  5U47 A;  4HP9 A;  1NXY A;  1FIK A;  4WMC A;  3Q82 A;  4JDM A;  3ZG8 B;  5HX9 A;  2PU2 A;  4HOI A;  2GZA A;  2IWC A;  3EOI A;  4NK3 A;  1N9B A;  2H5S A;  3A0V A;  3BFE A;  3MQQ A;  2GLW A;  5EM1 A;  4C6Y A;  2ZMF A;  1Q2P A;  3IF6 B;  3ZFZ A;  3IH8 A;  4I3A A;  3C38 A;  4S2P A;  3IBJ A;  3BYD A;  1IYO A;  5HAR A;  4CLC A;  3IX8 A;  5TBM B;  3LFV A;  1S4R A;  4JLF A;  1K54 A;  3WS4 A;  5HWW A;  5A92 A;  1HVB A;  4P6B A;  5HAQ A;  3VOZ A;  2ZC6 B;  5GLA A;  3PAG A;  1KDW A;  4KUK A;  2G7U A;  3DBA A;  1NZU A;  1OTE A;  4EBL A;  1NRF A;  3FV7 A;  1E4D A;  3JVV A;  2VV7 A;  1LSW A;  1CQA A;  2ZC4 B;  4GDN A;  4G3W A;  2WZX A;  2J80 A;  1XA7 A;  4MMN A;  1ERM A;  3VFF A;  5FAQ A;  3F1P B;  3PBQ A;  3Q81 A;  5F6A A;  5D3O A;  1JWV A;  3CLO A;  2JBF A;  4MLL A;  5HFO A;  4MDZ A;  3BLS A;  1L2S A;  4WBG A;  3TE8 A;  2J3T C;  2GDN A;  3PBT A;  1BZA A;  2VKS A;  3GSG A;  1H0M A;  1BLS A;  5EVL A;  2OLV A;  3FZC A;  2L66 A;  4PM6 A;  2Y91 A;  4II7 A;  4IVI A;  1J9M A;  3H9W A;  5FAS A;  1JVJ A;  1F9I A;  3OPH A;  3LUQ A;  2WKR A;  1MVF D;  1F5M A;  3Q7Z A;  4GS9 A;  1UGU A;  3WS2 A;  4LCM A;  4MBF A;  4PM8 A;  4PKY A;  4BQM A;  4BBU A;  5CEB A;  5FQM A;  1PW8 A;  3ZNY A;  1MWS A;  4WZ5 C;  4WL9 A;  2ZQ8 A;  2W27 A;  4R70 A;  1K56 A;  4PMA A;  4EU0 A;  3TJZ C;  3G30 A;  5HDD A;  2ZM2 A;  3B42 A;  1BLH A;  4WM9 A;  1S6R A;  1YLY A;  3BFD A;  2XSS A;  3UME A;  1OTB A;  3ZYT A;  4DE0 A;  1LI9 A;  1MY8 A;  4NXG A;  1MKM A;  4B4X A;  4H6J A;  4LLO B;  3ZHH A;  2Z6D A;  2WGV A;  3A0R A;  3WRT A;  4R4R A;  4E3L A;  1JTD A;  3MZE A;  3O87 A;  1ODV A;  2B18 A;  4LV1 A;  2CC1 A;  3KSG A;  1RGY A;  4B93 A;  1SCW A;  3G31 A;  1QME A;  3UNW A;  3DAV A;  4KZ9 A;  5E2H A;  3IH9 A;  2JKT I;  2QKP A;  1H8M A;  1ESU A;  2I9V A;  4O0P A;  3M6H A;  2QMI A;  4DXB A;  3CUE A;  4E04 A;  3MZD A;  1XA1 A;  1YFB A;  5A8B A;  2HV1 A;  3P98 A;  3HJK A;  4R4S A;  1LL8 A;  1XGJ A;  1D1J A;  3HJI A;  2W0N A;  1S0W A;  4PPR A;  3D72 A;  1IKI A;  4XUZ A;  4BBT A;  3LIA A;  4KQD A;  3SW1 A;  1HLU P;  4H8R A;  1MC0 A;  5DF7 A;  5CRF A;  4G3V A;  4WEL A;  2RL3 A;  4N92 A;  2E8J A;  2CMN A;  1KVM A;  2YKH A;  3A3I A;  2L0W A;  3S7N A;  1BUL A;  2KOI A;  5FEG A;  3AGE A;  4EUV A;  1FR6 A;  1K38 A;  4JF5 A;  4UAA A;  1XGI A;  3WS1 A;  1PWC A;  4WLA A;  5TJJ A;  3NJA A;  4MCW A;  4Y7P A;  5HAI A;  2QJ7 A;  5FA7 A;  2HDS A;  3E2K A;  2EXB A;  2VGK A;  3W2Z A;  2OWJ A;  1YSF A;  5HAP A;  4GD6 A;  2Y2Q A;  1ONH A;  1FCM A;  3MSH A;  3HL9 A;  3V50 A;  2PU4 A;  2VV6 A;  2Y2G A;  3H82 B;  4GCZ A;  2HJE A;  3T1Q B;  3MF0 A;  3JPU A;  3ZG9 B;  3LIE A;  4WF0 A;  4ID4 A;  3NY4 A;  1HZO A;  4YWZ A;  3P01 A;  3G6O A;  4X25 A;  1KGF A;  5AVF A;  5HD3 A;  3SS3 A;  3TRC A;  2WAF A;  3HRE A;  3DTE A;  2KLI A;  1YSQ A;  1ZKJ A;  3IHA A;  2EXA A;  5EVI B;  4E6X A;  5HDC A;  3A3J A;  4HP4 A;  4BJP A;  2ZQD A;  3QP4 A;  5G18 A;  3NBL A;  4UA7 A;  5HZH A;  4DDS A;  4HES A;  4BLM A;  3HUO A;  1RCJ A;  3KYE A;  3K2N A;  1IEL A;  2ZOI A;  3UB9 A;  2Y2O A;  1OT6 A;  3E4O A;  4RVA A;  5FQI A;  3IXG A;  3OOV A;  1UWP X;  4P87 A;  5CGW A;  1TF1 A;  3UY6 A;  1NY0 A;  2J3T D;  3FKV A;  2RO5 A;  2PHY A;  2Y2I A;  3E4P A;  3K3C A;  4EER A;  2A3U A;  4IHQ A;  4OP8 A;  4PHT A;  1VM1 A;  4NXF A;  4FSF A;  1S4S A;  4XXR A;  3N4I A;  3BQA A;  3UPO A;  5EVI C;  3OPP A;  4UA9 A;  5AQB A;  4BL2 A;  2Q0O A;  3DTK A;  4CLC E;  4S2K A;  4I39 A;  4OQG A;  2VZW A;  2H0Y A;  4OON A;  2ZQC A;  4PM5 A;  4B4Z A;  1G6O A;  3U2A A;  4OPZ A;  3PR6 A;  1OME A;  1RP5 A;  3UO9 A;  2XFS A;  5FAO A;  1WA9 A;  4GNU A;  2BTF P;  3BFF A;  4N1X A;  4KZ5 A;  2V20 A;  3KYQ A;  1BTL A;  4Y2F A;  1SZV A;  3QNC A;  5KZH A;  4EES A;  3GTC A;  5GL9 A;  2C6W B;  4JXV A;  3FC7 A;  3LR3 A;  3Q7V B;  2X01 A;  1PI4 A;  5FEF A;  4QJG A;  4Q8I A;  1EI5 A;  2R78 A;  3UMD A;  1ES3 A;  3QP5 A;  1MPL A;  3OCL A;  4IUH A;  2JKT M;  3C8C A;  4X69 A;  3C2W A;  3O5Y A;  4MBK A;  3V3S A;  5DJU A;  1ES5 A;  3C7V A;  3S1Y A;  2UWX A;  2WGW A;  4ARZ B;  3Q07 A;  4KUO A;  4E6W A;  3UE3 A;  5E43 A;  5GHX A;  3ZG5 A;  2IA2 A;  1K6S A;  3IX3 A;  4QB8 A;  4JXS A;  5G4Z A;  1CI8 A;  1BSG A;  3BFC A;  4PAU A;  2BLS A;  1K55 C;  4RX2 A;  2VEA A;  2Y2H A;  2EX8 A;  5I94 A;  4ZDX A;  5F68 A;  2GNX A;  4UA6 A;  3UN7 A;  1W7F A;  3RH8 B;  2RO4 A;  1FIL A;  4ZAM A;  4O8G A;  1O07 A;  1I5Q A;  4ZJ3 A;  3EEA A;  3B33 A;  2OWH A;  3FYZ A;  3UE0 A;  4ETX A;  2HF6 A;  5A93 A;  2O9A A;  4HH2 A;  4PM7 A;  3WRZ A;  4GHI A;  2FFF B;  2Y2N A;  3M2K A;  3UB6 A;  1K4E A;  3LY3 A;  3ZDJ A;  2V8C A;  4QU3 A;  2L4R A;  4OOL A;  1T1A A;  4K0W A;  1SKO A;  2NUT C;  4KZ8 A;  5TFQ A;  4Y17 A;  3PBR A;  4F3L B;  4E3I A;  2EWW A;  4ESP A;  5EM0 A;  2PD8 A;  1T1B A;  2WYX A;  1PZO A;  3VV4 A;  1PFL A;  3C4P A;  2EX6 A;  1DP8 A;  1RGZ A;  3S7O A;  1DJA A;  1M40 A;  4FH4 A;  1CEF A;  4KZB A;  1H3Q A;  2V8F A;  1YAX A;  4OVD A;  2OOL A;  2Y2M A;  3G2Z A;  2OV5 A;  2VLG A;  5AQ9 A;  3IHB A;  4BEN A;  4EUZ A;  4DRT A;  4PM9 A;  2HJ9 C;  2A24 B;  1ALQ A;  4Q0H A;  1I2W A;  3HCY A;  5EUA A;  2J3W A;  4U3T A;  4OOY A;  4X6T A;  1XP4 A;  1L0F A;  5F1F A;  3VSL A;  3O3V A;  1YM1 A;  3HLC A;  3MZF A;  3MMH A;  3LIF A;  3E98 A;  2ZBB A;  3WS0 A;  2QPN A;  3MKF A;  2X71 A;  1PWG A;  3EQU A;  4WZ5 A;  1Z0R A;  1GSX A;  5AJG A;  3D4F A;  4JGO A;  3NDE A;  4N9L A;  5J8X A;  3D9Y A;  1Y4O A;  3RTY A;  3T1R A;  1YMS A;  5FL3 A;  2ZQA A;  5EVI D;  1GHP A;  3T50 A;  3ZQ5 A;  1YSP A;  5CGX A;  3F1N B;  3LEQ A;  1KOU A;  4Y0U A;  1VET B;  1T1C A;  4M3K A;  1L0G A;  3DWK A;  2DMW A;  2G2U A;  3GQZ A;  3NIA A;  4JDO A;  2VX8 A;  2ZJ9 A;  1AWI A;  2Y4A A;  3T1X A;  3I7J A;  2P9V B;  3MBZ A;  5KSC A;  4RA7 A;  4EQ1 A;  2HP5 A;  2V0W A;  5HWV A;  2KX6 A;  1FR1 A;  3CHW P;  2Z2M B;  3GDI A;  4F94 A;  4EXO A;  4FUW A;  3S7Q A;  2V9A A;  4HI4 A;  4RYE A;  1BLC A;  2FH5 A;  2P74 A;  4KZ7 A;  3HLF A;  1ZG4 A;  3NC8 A;  2K1N A;  4JKT A;  3IF6 C;  5EFW A;  4ZJ1 A;  1Y28 A;  3P7N A;  5HPI A;  3H7W B;  1UB4 C;  1VEU B;  2EX2 A;  3GRJ A;  3DTI A;  1LL9 A;  1GCE A;  1L0E A;  2W3E A;  3W4O A;  3IS2 A;  3T1S A;  4R0Q A;  4S2N C;  3UPN A;  4IVK A;  3KYZ A;  1PZP A;  3IBR A;  1K4F A;  2NUP C;  5CHU A;  3UB7 A;  3M6B A;  4HEF A;  1P9R A;  4AFI A;  3RXX A;  1IOU A;  1PNE A;  2ZM8 A;  1M6K A;  5FDS A;  1E3U D;  3VMA A;  3ICY A;  4CLC B;  1AXB A;  4HY8 A;  5IU1 A;  1P0Z A;  5BOH A;  1XFQ A;  3R4K A;  3NEC A;  3T4J A;  4E3N A;  3MKE A;  2W1T A;  5CED A;  1DJB A;  4Q0J A;  2Y2P A;  2PR5 A;  2IWD A;  3VSK A;  1ZC2 A;  3RJU A;  2K31 A;  4X53 A;  1PRQ A;  4WEK A;  2Q9N A;  2QHK A;  4LGW A;  1UWN X;  4Y0T A;  3QP6 A;  1GSV A;  4GLQ A;  4L9F A;  4JPM A;  2Y79 A;  5DVA A;  3A3F A;  1N9O A;  1XKZ A;  4I5S A;  4NXE A;  5KIZ A;  2FZ0 A;  1GA0 A;  3LY4 A;  1YLZ A;  1NJ4 A;  4NET A;  4L9G A;  5ITM A;  1XXM A;  4DKI A;  4B9O A;  1NYM A;  1G68 A;  4DXC A;  1FQG A;  4LEN A;  4JF6 A;  2HPB A;  5F83 A;  2Y8H A;  2QYB A;  2ZC7 A;  3E2L A;  4OPQ A;  1BLP A;  4K0X A;  1MWT A;  2WK0 A;  3IXH A;  2J9P A;  4GS9 B;  4I3J A;  4DN0 A;  5HW3 A;  1JWP A;  3SH8 A;  2XD5 A;  2HDQ A;  5E2G A;  4HH3 A;  4R6L A;  2WKP A;  1OJG A;  4FH2 A;  3CAX A;  3N6I A;  4FCF A;  4N9K A;  1KGE A;  3ZVW A;  2QWS A;  4M4X A;  5ITJ A;  2PT7 A;  3IWI A;  3WS5 A;  1BT5 A;  1YPR A;  3ZG7 B;  3RXW A;  4P6Z M;  3GR2 A;  3PBN A;  2K2N A;  4P6Z S;  3BQ8 A;  1TVF A;  5DKK A;  3SH9 A;  2PR6 A;  3JVU A;  4H6J B;  1ONG A;  1P9W A;  2B95 A;  2H10 A;  1ZTU A;  3VOL A;  3NOU C;  3EQV A;  1PW1 A;  2UV0 E;  2E8I A;  2PYP A;  1FCO A;  1Q2Q A;  3NDG A;  2XA7 M;  3ULF A;  3KO6 A;  1XJ6 A;  1GHI A;  2XRO A;  1YT4 A;  2V2F F;  4BBV A;  3OLO A;  1D7E A;  2ZD8 A;  4E3O A;  1CK3 A;  1S66 L;  1KE4 A;  3R7W A;  3W4Q A;  5L2F A;  3G34 A;  5EVE A;  1L0D A;  3OC2 A;  1TEM A;  2XLN A;  4WZ4 A;  2QZ6 A;  5FI2 A;  4GDB A;  3DWZ A;  4LCL A;  3T4K A;  1E3U A;  3QNB A;  2M1C A;  2O0Y A;  3OPL A;  4X1M A;  4ETZ A;  3B47 A;  4WUJ A;  4OOM A;  4NEE D;  5EE8 A;  1NZO A;  4S2J A;  5L09 A;  4JF4 A;  2IWB A;  4N1H A;  3CG5 A;  2M7U A;  1K55 A;  2DCF A;  1Z09 A;  1ESI A;  4QY6 A;  2B02 A;  4QWO A;  1W63 Q;  4L9E A;  5FAT A;  1G28 A;  4HIA A;  3NI9 A;  1ZG6 A;  1CEG A;  5FI6 A;  1HTZ A;  2Z2L B;  2V1A A;  2R9W A;  2VV8 A;  2XH9 A;  3SZT A;  1IYQ A;  2GX5 A;  4E3M A;  4IBX A;  3LI8 A;  5LBR A;  3LR5 A;  3EGD C;  4S2O A;  5CGS A;  2R9X A;  4X56 A;  2D01 A;  2J7V A;  3QHY A;  4XT2 B;  3HLB A;  4OQI A;  2V1Z A;  5HD5 A;  4LRZ E;  2EFX A;  3LR0 A;  3HUM A;  4Z9Q A;  5FQ9 A;  2LB9 A;  4C75 A;  2WAD A;  3CJM A;  4I3I A;  4KEN B;  1JNU A;  4WMC D;  4MN7 A;  3ZG0 A;  1Y54 A;  4UEY A;  4DE3 A;  3FPV A;  3F1O A;  3FWL A;  5GLC A;  5MC7 A;  5FQQ A;  3VP4 A;  4EEU A;  4GN2 A;  1T19 A;  3ISG A;  5M18 A;  5FAP A;  2XK1 A;  2JKG A;  1KVL A;  3O88 A;  3V3R A;  4D60 A;  5GHZ A;  3GVB A;  2A2L A;  3FG8 A;  2PRF A;  5L07 A;  2Y59 A;  3O27 A;  3LID A;  4MN6 A;  1OJ5 A;  3OZH A;  1J3W A;  4FD8 A;  4L0L A;  2K7S A;  4KZ6 A;  1XFN A;  5AVE A;  1XJ2 A;  3BFG A;  3VP1 A;  4MBH A;  1IYP A;  1TS0 A;  3ITB A;  3KSI A;  4DDY A;  1TS6 A;  1FOF A;  4HBU A;  3IF5 A;  3CI6 A;  1PIO A;  1I2S A;  1H5X A;  4OLD A;  1ERQ A;  3CWF A;  1K57 C;  4GW9 A; 
#chains in the Genus database with same CATH homology
 4HHD A;  3ZYT A;  4DJ3 A;  3EGX C;  2W3F A;  2Z6C A;  4NXG A;  5FL3 A;  5I5L A;  1MKM A;  4JGR A;  4H6J A;  3KX0 X;  4LLO B;  3T50 A;  3NHQ A;  2Z6D A;  3ZQ5 A;  1YSP A;  4Q0I A;  3A0R A;  3TW8 A;  3F1N B;  4YOF A;  2INW A;  1KOU A;  2V0U A;  1T1C A;  1ODV A;  2B18 A;  3KSG A;  4B93 A;  1N9L A;  1T18 A;  2VJW A;  2DMW A;  2QJ5 A;  1DP6 A;  2EWV A;  5DJT A;  2JKT I;  2QKP A;  4JDO A;  2VX8 A;  1H8M A;  4O0P A;  2I9V A;  1S1Z A;  3CUE C;  3LIC A;  1DRM A;  3LYX A;  1V9Y A;  3CUE A;  4E04 A;  4EQ1 A;  1YFB A;  2V0W A;  5HWV A;  5A8B A;  2HV1 A;  2KX6 A;  3HJK A;  3VE3 A;  4YNR A;  1LL8 A;  3KSF A;  5C5K A;  3GDI A;  3HJI A;  2W0N A;  1EW0 A;  3D72 A;  4EXO A;  5HWT A;  4BBT A;  3BWL A;  3K3D A;  3S7Q A;  3LIA A;  4KQD A;  3T4S A;  2V9A A;  4UQI M;  3SW1 A;  4G3K A;  4HI4 A;  2FH5 A;  1MC0 A;  2W3H A;  4DJ2 A;  4ARZ A;  2K1N A;  4G3V A;  2P08 A;  4WEL A;  2PYR A;  4QPR A;  1VHM A;  1S67 L;  5CX7 A;  5EFW A;  2KDK A;  2CMN A;  2YKH A;  2EA9 A;  1Y28 A;  3P7N A;  4Y3I A;  3H7W B;  5HPI A;  2GJ3 A;  2L0W A;  4UQI S;  1UB4 C;  3S7N A;  3NOT C;  1NLZ A;  5F69 A;  2KOI A;  4EUV A;  2W3E A;  3LIB A;  1DP9 A;  3EEH A;  3IS2 A;  5TBM A;  1YKD A;  4ZRR A;  3KYZ A;  3R7W B;  4WLA A;  5TJJ A;  3IBR A;  2NUP C;  3PYP A;  1N9N A;  3NJA A;  3T4L A;  3UB7 A;  4MCW A;  1P9R A;  1XJ3 A;  2QJ7 A;  3D3O A;  4R38 A;  4AFI A;  5K5B A;  4RQ9 A;  1IOU A;  3W2Z A;  2OWJ A;  1YSF A;  1OTA A;  3ICY A;  4CLC B;  5DFX A;  5DKL A;  4HY8 A;  2M7V A;  5IU1 A;  1P0Z A;  2VV6 A;  4CLC D;  2ZMV A;  1XFQ A;  3R4K A;  4GCZ A;  3H82 B;  2W3D A;  2O99 A;  3T4J A;  2HJE A;  3MF0 A;  2PD7 A;  4HJ3 A;  3RFB A;  5KSH A;  2W1T A;  2LB5 A;  5G4Y A;  3F1P A;  3LIE A;  4WF0 A;  4Q0J A;  2V1B A;  2L1M A;  3C30 A;  1NWZ A;  4YWZ A;  3P01 A;  2PR5 A;  3G6O A;  5DF9 A;  5AVF A;  5HD3 A;  3TRC A;  3BY8 A;  1P97 A;  5L8M A;  4JGP A;  4F3L A;  2K31 A;  4WEK A;  1VB6 A;  2KLI A;  2QHK A;  1YSQ A;  1UWN X;  1ZHH B;  3BJN A;  1GSV A;  4GLQ A;  4L9F A;  4GHI B;  3TND B;  4EET B;  5HDC A;  2Y79 A;  4IJG A;  4HP4 A;  1N9O A;  4BJP A;  2VA0 A;  4I5S A;  3PBS A;  4NXE A;  2JKR I;  2FZ0 A;  2W1R A;  3T4T A;  2BAS A;  5KIZ A;  4LRY C;  4WEJ A;  2RO3 A;  5HZH A;  1F98 A;  4EW7 A;  4Y5F A;  2A24 A;  2OAQ 1;  4L9G A;  3K2N A;  4I38 A;  5ITM A;  2ZOI A;  4LRX C;  4R3A A;  3UB9 A;  3PBO A;  4B9O A;  1STZ A;  1OT6 A;  3E4O A;  1NLY A;  1TS8 A;  3OOV A;  1UWP X;  2O9B A;  5IS1 A;  1TF1 A;  2Y8H A;  3F1O B;  2QYB A;  2J3T D;  2RO5 A;  2PHY A;  3E4P A;  2JHE A;  3K3C A;  4NXB A;  4O01 A;  4EER A;  3BY9 A;  4CQH A;  2W3G A;  4IHQ A;  4PHT A;  1OTI A;  3LR4 A;  4NXF A;  4FSF A;  4LPZ A;  1S4S A;  5HL6 A;  5DFY A;  3BQA A;  3PXP A;  4GS9 B;  4I3J A;  4DN0 A;  1S1Y A;  3LI9 A;  4HH3 A;  4R6L A;  4CLC E;  4K08 A;  4EEP A;  2WKP A;  4ME4 A;  4I39 A;  1OJG A;  3UB8 A;  2MJ6 A;  2YKF A;  2VZW A;  5HSQ A;  5HPF A;  3CAX A;  2QWS A;  3F1N A;  4M4X A;  5ITJ A;  5J7E A;  2PT7 A;  1G6O A;  3U2A A;  3MXQ A;  3PR6 A;  3CIT A;  3MQ0 A;  4P6Z M;  2ZOH A;  1LT0 A;  2FY9 A;  3EWK A;  4Z1W A;  2QA4 I;  3UE6 A;  1WA9 A;  2VGL M;  3A0S A;  3PBN A;  2P04 A;  2K2N A;  4HJ4 A;  3KYQ A;  4P6Z S;  3BQ8 A;  2P7J A;  3MQO A;  4NKP A;  5DKK A;  4Y2F A;  2PR6 A;  3FPW A;  1IFQ A;  3JVU A;  4H6J B;  2VGL S;  4EES A;  1P9W A;  4JGQ A;  1ZTU A;  3OBF A;  3NOU C;  3VOL A;  3EQV A;  4WN5 A;  3FC7 A;  3VE4 A;  3GEC A;  3LR3 A;  2PYP A;  4IUK A;  3KSH A;  2XA7 M;  3ULF A;  2R78 A;  3UMD A;  2O9C A;  3KO6 A;  4FOF A;  1XJ6 A;  3MR0 A;  3H7W A;  5HDS A;  3OCL A;  4DMZ A;  2XRO A;  4IUH A;  2JKT M;  3C8C A;  2D02 A;  4BBV A;  3OLO A;  4HP9 A;  1D7E A;  3C2W A;  2H28 A;  3O5Y A;  5IT5 A;  1S66 L;  4JDM A;  4HJ6 A;  3MJQ A;  5DJU A;  1NRJ A;  3R7W A;  4HOI A;  3PHY A;  2GZA A;  3EOI A;  3OC2 A;  4ARZ B;  4KUO A;  3UE3 A;  4GJ4 A;  2IA2 A;  3A0V A;  2OAP 1;  3MQQ A;  2GLW A;  3T4K A;  2HGV A;  2ZMF A;  1W63 M;  4CLC C;  4I3A A;  2M1C A;  3C38 A;  1LSX A;  2O0Y A;  5G4Z A;  1OTD A;  3IBJ A;  4ETZ A;  3B47 A;  4WUJ A;  4CLC A;  4OOM A;  1MZU A;  4PAU A;  4NEE D;  3IS2 B;  5TBM B;  3LFV A;  1LSV A;  2VEA A;  1S4R A;  3H82 A;  2M7U A;  5HWW A;  5F68 A;  2GNX A;  1BYW A;  1X0O A;  4MN5 A;  3S7P A;  3RH8 B;  2B02 A;  4PKY G;  1W63 Q;  2RO4 A;  4L9E A;  4O8G A;  1G28 A;  3EEA A;  3B33 A;  2OWH A;  4KUK A;  4HIA A;  3MFX A;  2G7U A;  3DBA A;  4ETX A;  1OTE A;  2HF6 A;  3JVV A;  1TD5 A;  2O9A A;  4HH2 A;  2VV7 A;  1LSW A;  2V1A A;  2VV8 A;  4GHI A;  3UB6 A;  3E4Q A;  2GX5 A;  4G3W A;  3LI8 A;  5LBR A;  2J80 A;  3LR5 A;  3EGD C;  4KQO A;  2L4R A;  4MMN A;  2XRN A;  4OOL A;  2W1T B;  2D01 A;  3F1P B;  3PBQ A;  4XT2 B;  1T1A A;  5F6A A;  5HD5 A;  4LRZ E;  2NUT C;  3LR0 A;  3CLO A;  3PBR A;  4F3L B;  2LB9 A;  1GSW A;  2EWW A;  4MDZ A;  2PD8 A;  1T1B A;  3TE8 A;  4I3I A;  2J3T C;  1JNU A;  3VV4 A;  1DP8 A;  4MN7 A;  3S7O A;  3PBT A;  2VKS A;  3NOP C;  4UEY A;  1H3Q A;  3FPV A;  3F1O A;  1YAX A;  5MC7 A;  2PDR A;  1OT9 A;  2L66 A;  4EEU A;  2OOL A;  1T19 A;  4HQA A;  4II7 A;  3E0Y A;  2VLG A;  3H9W A;  3T4O A;  2JKR M;  1V9Z A;  1F9I A;  1TS7 A;  2HJ9 C;  2A24 B;  4Q0H A;  3LUQ A;  2JN7 A;  3BW6 A;  2WKR A;  1MVF D;  3HCY A;  2J3W A;  1F5M A;  4GS9 A;  1UGU A;  2A2L A;  3FG8 A;  5J4E A;  3O27 A;  3V67 A;  3LID A;  4MN6 A;  1OJ5 A;  4PKY A;  4L0L A;  2K7S A;  3LIF A;  3E98 A;  3MMH A;  2XA7 S;  2ZBB A;  4BBU A;  4BWI A;  1XFN A;  5F5Y A;  4WL9 A;  5AVE A;  1XJ2 A;  2WKQ A;  2W27 A;  4R70 A;  4EU0 A;  3T4Q A;  3EQU A;  3TJZ C;  1TS0 A;  1Z0R A;  3KSI A;  4XT2 A;  5HDD A;  1TS6 A;  1GSX A;  5AJG A;  3B42 A;  4HNB A;  4JGO A;  3CI6 A;  4BMW A;  2XSS A;  3UME A;  1OPX A;  1XJ4 A;  3CWF A;  3RTY A;  3OCN A;  1D06 A;  1OTB A;  5J3W A;  4GW9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...