2W1TB

Crystal structure of b. subtilis spovt
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
173
structure length
173
Chain Sequence
GIVRRIDDLGRVVIPKEIRRTLRIREGDPLEIFVDRDGEVILKKYSPISELGDFAKEYADALYDSLGHSVLICDRDVYIAVSGSSKKDYLNKSISEMLERTMDQRSSVLESDAKSVQLVNGIDEDMNSYTVGPIVANGDPIGAVVIFSKDQTMGEVEHKAVETAAGFLARQME
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords STAGE V SPORULATION PROTEIN T
publication title Crystal Structure of Spovt, the Final Modulator of Gene Expression During Spore Development in Bacillus Subtilis
pubmed doi rcsb
source organism Bacillus subtilis
total genus 39
structure length 173
sequence length 173
ec nomenclature
pdb deposition date 2008-10-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF04014 MazE_antitoxin Antidote-toxin recognition MazE, bacterial antitoxin
B PF15714 SpoVT_C Stage V sporulation protein T C-terminal, transcription factor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.260.10 Mainly Beta Ribbon Pemi-like Protein 1; Chain: D Pemi-like Protein 1; Chain: D 2w1tB01
3.30.450.40 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2w1tB02
3R4KA 2VKSA 2Y79A 2W3FA 4GW9A 3EEAA 3LFVA 2LB9A 5DFYA 2M7VA 1ZTUA 3ZQ5A 2K1NA 2VEAA 2RO4A 3OBFA 4GLQA 3KSIA 5ITMA 3DBAA 2VZWA 3E0YA 2O0YA 4EUVA 2LB5A 5LBRA 2W3DA 2W1TA 1VHMA 4IJGA 4Q0JA 4MN7A 4R70A 2K31A 1Z0RA 5AJGA 4MCWA 2O99A 4QPRA 3NOTC 4G3WA 1YFBA 2W3EA 3KO6A 2XSSA 1MVFD 4ME4A 4PAUA 2O9CA 1TF1A 4RQ9A 2RO3A 4ZRRA 2L66A 2GLWA 2XRNA 4LRZE 3KSFA 2GX5A 1TD5A 1MKMA 2W3GA 3KSHA 5HSQA 4MDZA 2Y8HA 3MF0A 2B18A 2O9AA 3MQ0A 3IBRA 1STZA 4Y5FA 2W1TB 3O27A 2KOIA 4DMZA 4IUHA 4YOFA 2RO5A 2O9BA 2FY9A 1YSQA 4O01A 3E98A 4O0PA 4Y2FA 4Y3IA 3IBJA 4Z1WA 3C2WA 5DFXA 2ZMFA 5K5BA 3NHQA 2W1RA 4Q0IA 3CITA 3W2ZA 4LRXC 3BJNA 2KLIA 4LRYC 5I5LA 4R6LA 4Q0HA 4EU0A 1YSPA 5HPFA 1YKDA 5TJJA 3KSGA 4DN0A 4FOFA 4E04A 3RFBA 3G6OA 5L8MA 4CQHA 1MC0A 2W3HA 4G3KA 5HPIA 4MMNA 4ETZA 5HL6A 4YNRA 2VJWA 3TRCA 3OOVA 4G3VA 3S7NA 3HCYA 3K2NA 3TNDB 1UB4C 2G7UA 2QYBA 3S7OA 3MMHA 4IUKA 2XROA 5C5KA 2HGVA 2M7UA 3VV4A 2K2NA 2OOLA 2IA2A 1YSFA 1F5MA 3D3OA 3NOUC 3O5YA 4O8GA 3S7PA 3S7QA 4ETXA 5ITJA 4BWIA 3NOPC 3CI6A
chains in the Genus database with same CATH superfamily
3VMAA 4UA7A 2W3FA 1I2WA 5D3OA 4A5RA 3C38A 5DFYA 3P98A 2VGLM 3ZQ5A 4GD6A 2Q9MA 4Y0UA 4BENA 4LPZA 4MBHA 2PDRA 3JVUA 2PYRA 1ERMA 2VK3A 1Z0RA 3UN7A 5DF9A 1BSGA 3LR5A 2PBDP 5CGSA 1L0DA 4JXGA 1PW8A 4K91A 1GHIA 1E3UD 1WYCA 3DWKA 3HLCA 2BTFP 3VE4A 3ZHHA 3IWQA 4HESA 4C75A 2Z2MB 4OQ0A 4DDSA 1JWZA 4WN5A 4U3TA 1S1YA 2J9PA 3MQQA 4EUZA 5EVIC 4KG5A 2HP5A 1GSXA 2Y2JA 4D60A 4EBPA 3JYIA 3SW1A 3IX8A 3DTIA 1XFNA 2ZMAA 1CEFA 2DCFA 2I9VA 2J3WA 1HTZA 1ESUA 5CXWA 5HARA 3V39A 4PHTA 3BYDA 5A92A 3T4KA 1P9WA 1MPLA 3AGFA 2QMIA 1IKGA 3S1YA 4QY5A 4KZ6A 1K56A 3T1SA 1I2SA 3SH9A 4JXWA 5HL6A 1N4OA 5CGXA 3MSHA 3CHWP 4X25A 4E6XA 3MMHA 5CEDA 5KSCA 4U0TA 4R4SA 2EXAA 5FQMA 1F5MA 2P9VB 4PMAA 2Y2KA 4LFUA 5FAPA 1K57A 2LB9A 4GD8A 1ESIA 1M6KA 3BFDA 3UPOA 3R7WB 2QKPA 3BY9A 3G34A 1MWSA 3DBAA 3MR0A 3MS6A 5HD5A 4WYYA 3T4OA 3VP0A 3NC8A 1W7FA 3QP6A 1FIKA 1QMFA 1PRQA 4L9FA 5GHYA 2JBFA 3LIBA 1VEUB 1NWZA 2XFSA 2XRNA 3IX4A 3LEQA 2GX5A 1TD5A 2V8CA 4HP4A 4BD0A 2HJ9C 3MQ0A 3FZCA 3N7WA 3EGDC 3UPPA 2RO5A 3D4FA 1XJ2A 4AFIA 2WKIA 4P6BA 4XUXA 2UWXA 5FQQA 3PHYA 3T1XA 1H8YA 4WL9A 2EX8A 3IX3A 3G2YA 4U0XA 3W4PA 3O3VA 1OPXA 3EGXC 3CLOA 4HI4A 1D7EA 1YSPA 2P9VA 2J8YA 5E2FA 5E2HA 1LL5A 3PBOA 2VV8A 5HW3A 4LCLA 2J3TC 1TS7A 3SS3A 3MFXA 3S7NA 3R7WA 1EWZA 1QMEA 1P0ZA 2OAP1 4BL3A 2IA2A 4ZJ3A 2EWVA 3MKFA 5TFQA 3CI6A 4LV3A 4Y0OA 1JTGA 1VEUA 3MZDA 4OQHA 5U47A 3RJUA 1MWUA 5EM0A 1T19A 1DP8A 4IHQA 5E43A 3EQUA 3UMDA 1NJ4A 3DAVA 2ZBBA 2O99A 4OP5A 4L0LA 3HVFA 4UAAA 1BLSA 1KGGA 1YLWA 3ITAA 4YFMA 5HSQA 3IT9A 3VP3A 4GKUA 3BLMA 3LYXA 4NXBA 2KOIA 1HLUP 1AWIA 2KX6A 4WM9A 1N9LA 2JN7A 2V2FF 3OC2A 1PWCA 5EOEA 2WK0A 5J8XA 4C3QA 1N9OA 5KSHA 3UB6A 2WKQA 1YT4A 2EA9A 4UHUA 1FCMA 3W2ZA 3BJNA 4ZBEA 4FCFA 3H9WA 3GECA 5AQAA 4K0WA 2EXBA 2PBYA 1E4DA 3CMZA 5HWVA 1KE4A 1C3BA 5HPIA 4MMNA 4DE0A 2PD8A 3OOVA 4GDBA 3A0SA 4EBLA 4LCMA 3GSGA 4R0QA 3VP1A 3OPRA 3P01A 5G4ZA 1FCOA 4H6JB 5E2EA 1V9YA 5ITJA 2Y2HA 3IS2B 1OTDA 5HWTA 2R9WA 3PAEA 3LFVA 3HUMA 3LR4A 2VEAA 1IYQA 4UQIM 1IKIA 5DTSA 2O0YA 2PD7A 2Y2QA 5DVAA 4HJ4A 4R3AA 1ERQA 3C7VA 4OPRA 1FSYA 2O9CA 1Y54A 2L66A 5GLCA 2GLWA 5J7EA 2XK1A 4MLLA 4X55A 3KYQA 5DTKA 1T1BA 3CG5A 5EFWA 3ISGA 4IEDA 3B33A 5CHUA 2V1AA 4GNUA 4I38A 5F83A 2Y2NA 2HDQA 3C4PA 5F5YA 1IYSA 3WS1A 5KMWA 3C7UA 3H82B 3IBJA 5FI2A 5EVEA 4QWOA 3BM6A 5DF8A 4CLCE 5I94A 4DE2A 3B47A 2HPBA 2H10A 3ITBA 4N9KA 4H6JA 1ALQA 5TJJA 3MKEA 3LIFA 4DN0A 3L9KA 3IS2A 2Y2PA 1MBLA 3NDEA 4X56A 1DRMA 4QB8A 1MC0A 4BJPA 1DP9A 1GCEA 4G3VA 1GHMA 4MNRA 3LR3A 4GOGA 1XGJA 2ZJ9A 3K3CA 3VE3A 2HP6A 2PU2A 5L07A 1SZVA 5M1AA 3A0RA 2HV1A 4R4RA 1XGIA 3LO7A 1FR1A 2ZL1B 2M7VA 1LSVA 3F1OB 2G2WA 1YM1A 4EQ1A 3IF6B 1XFQA 1N9BA 3VSLA 3N8RA 1K38A 4ME4A 1W63M 3H82A 3A3EA 2ZC5B 4JDOA 3KSHA 3KX0X 3NY4A 5FA7A 1BLPA 2VLGA 4YINA 2W1TB 1DJCA 2E8IA 3HLWA 4ARZB 3FG8A 4JGOA 4GZBA 5F1GA 3BY8A 4Y17A 2WADA 1OTBA 5EE8A 3M2KA 4DDYA 2Y2LA 4ZDXA 4Z1WA 4CLCB 3MZFA 3LI8A 1L0FA 2W1RA 3LIAA 5I5LA 1LL9A 3BRMA 3UB5P 1OTIA 3IF6C 3Q1FA 3NBLA 1P97A 4OH0A 1FILA 3F1PB 4MN6A 5GLAA 3DW0A 3KYZA 2ZL1A 4FD8A 3F1OA 1DJAA 3IF6A 2G7UA 3VP2A 1NLYA 4B9OA 1JNUA 1ONHA 1YSFA 3O5YA 2IWDA 2VKSA 5F6AA 3T12B 1K6SA 4PM9A 2HP9A 3IXHA 3BWLA 3UMEA 3M6BA 3WS2A 3KSIA 3GQZA 4EUVA 2W1TA 4CLCC 4P0MA 5HAQA 3DTKA 4ARZA 1Z09A 4G3WA 4PAUA 1YFBA 1F2KA 5EPHA 5GHXA 2JC7A 3BLSA 2CMNA 4CLCA 1Y28A 3O87A 1VQQA 2X02A 4WMCD 5FDHA 5CTMA 2W0NA 3WS5A 2ZQCA 1PYYA 5HX9A 4RVAA 2JKTI 3F1PA 3CUEC 4JF5A 4GS9B 2ZQAA 1HVBA 2L1MA 1LHYA 2XH9A 4I3IA 3E4PA 3RTYA 4HOIA 2XGNA 1NZUA 2XA7S 5AQ9A 5IU1A 2EX2A 4QU3A 4LRXC 5BOHA 3CUEA 1M40A 1WA9A 2JE5A 4KUKA 1O07A 4HNBA 3FPWA 3U2AA 2PYPA 1KE3A 3UDXA 3K2NA 1Q2PA 4QJGA 3OCNA 4JKTA 4HIAA 2Y2GA 2WYXA 1XKZA 3M6HA 3Q7VB 2NUPC 2WUQA 5EECA 4NKPA 1HZOA 3LIDA 3LY3A 4KQQA 2JKTM 3PR6A 3FPVA 5DTTA 3PBNA 4LV1A 4ID4A 1L3LA 1K57C 1MY8A 4Y13A 1YQSA 1ZC2A 5EOOA 1T1CA 4ZAMA 1MVFD 1EI5A 4KZ8A 3NDGA 2EFUA 4GS9A 3NJAA 2XQZA 4FUWA 3LR0A 2VGLS 2H28A 4E3JA 3UNWA 4RYEA 1VETB 2D01A 4IUHA 3G32A 1SKFA 3TW8A 4JPMA 4KZBA 1W79A 4R1GA 1K0KA 1ZG4A 2PU4A 3HLDA 2BASA 1DY6A 3IXGA 1L0EA 5F1FA 4OLDA 3UB7A 2P04A 3IWIA 1ES4A 3GDIA 1K6RA 4Q0IA 4WF0A 2PR5A 4XT2B 4IVKA 3Q7VA 3NECA 4X69A 4HJ6A 5DF7A 3PBTA 1GSVA 3JPUA 2B02A 4S2NC 2W27A 1CJFA 2C5WB 2H0YA 4NETA 4IUKA 2WAFA 3PAGA 3ZFZA 4DF6A 4S2MA 4KG2A 5A8BA 5M18A 4BWIA 1CQAA 4WZ4A 3HREA 4S2NA 2Y79A 4LGWA 3ZG8B 1XXMA 4IVIA 3OBFA 5ITMA 2JCHA 3E0YA 2JKRM 1VETA 4HQAA 4Q0JA 2Q9NA 1T18A 3UO9A 3A3FA 1D06A 3ZDJA 1TVFA 3T4TA 4ZRRA 4P87A 1XA7A 4ZTKA 1IYPA 4EEPA 4X6TA 3KSFA 5A93A 1KGFA 4GHIB 4P6ZM 4KZ4A 1RGYA 1CEGA 4N9LA 2OV5A 5AQBA 4Y5FA 4WBGA 2VA0A 2BG1A 4XT2A 2O9BA 1OJGA 3C30A 5DJUA 4O01A 5FQ9A 1BLCA 2M1CA 5FSRA 2A24B 4E3IA 3A3DA 5EV0A 3T4JA 5DKKA 3BQ8A 5CERA 1XPBA 2VGKA 1YLTA 3IF5A 3SH7A 4JXSA 1H3QA 3BFCA 5EVID 1XJ4A 5GHZA 2V20A 2ZM8A 3UB8A 3LCEA 4Q8IA 2WZZA 1LL8A 4KZAA 4IBXA 2L0WA 5L09A 1K56D 4CJNA 4Y7PA 2ZQDA 3NI9A 2ZMVA 1FCNA 3T50A 4EW7A 4S2IA 4B4ZA 3LY4A 3T4LA 4O8GA 2A49A 1GHPA 2IWCA 4N1XA 2ZC7A 4DE3A 4HY8A 3E2LA 2WGVA 2XDMA 2ZD8A 2WKHA 4OOMA 4E3KA 4YWZA 1TEMA 4GHIA 2ZQ7A 5FQIA 2I72A 4I3JA 2FZ0A 3C5AA 1BZAA 3Q81A 3BFEA 1Q2QA 5TBMB 1XJ3A 1BLHA 1NYMA 1CI8A 1GSWA 3NOTC 1Y4OA 1MWTA 2A24A 4HH2A 1S66L 3MQOA 4R38A 2V8FA 3QP5A 3CZDA 3AGEA 2QA4I 2QWSA 2Y2IA 3NCKA 1KDSA 1BUEA 1STZA 2K7SA 3OPLA 5M19A 4KZ3A 2ZM2A 2GJ3A 4OLGA 1G28A 4OONA 3E98A 1L2SA 1ZHHB 1W8QA 5CECA 3CJMA 4L9EA 1E25A 5K5BA 5IS1A 3U4LP 3W4QA 3ZG7B 3EQVA 3CITA 3E2KA 1YPRA 2WKRA 5HDCA 4EU0A 3F1NB 3MXQA 3Q07A 4JXVA 1TDGA 4PM7A 4BD1A 4UEYA 3O88A 3ZCZA 2HDRA 3C4OA 3ZNTA 1L0GA 3GVBA 3N8SA 1LI0A 3CPTB 1F98A 1RCJA 5TBMA 4JF6A 5CX7A 4BL2A 1PZOA 5DKLA 3B42A 5J4EA 1ES3A 3NOPC 3BQAA 2J3TD 3OZHA 2UV0E 4UA6A 4S2KA 3G31A 4GW9A 5FAOA 3VOYA 3ZG0A 1ZTUA 3VOLA 4O7DA 1MKIA 1I5QA 3V5MA 2ZQ9A 3LI9A 3RH8B 1G6OA 2DNSA 1K55C 1S4RA 3GV9A 5HZHA 2XSSA 1E3UA 4OVDA 4BBUA 1CK3A 4HEFA 1W8YA 2V1BA 3WRZA 2A3UA 4MDZA 1K55A 4F94A 4UQIS 4HJ3A 2RCXA 4K0XA 4QHCA 3TSGA 1ACFA 3ZGAB 3E4QA 5J3WA 4YOFA 5HL1A 2DRWA 2WGIA 5FDSA 3F1NA 4Y0TA 3BFGA 2HDUA 3ICYA 5CHJA 4E3OA 3OCLA 3D72A 2QZ6A 3DTMA 2V1ZA 4I39A 3CPTA 3WWXA 1YLYA 5GL9A 1XX2A 2H5SA 4GN2A 4ESPA 1YKDA 1NYYA 3KSGA 2Y2MA 1U60A 3ZNYA 4KG6A 1P9RA 2GNXA 4LLOB 1SHVA 2Q0OA 1JWVA 1J3WA 1W63Q 5EM1A 4DXCA 4DKIA 1HD8A 2XROA 2H0TA 5C5KA 2MJ6A 2XLNA 1MWRA 3A3JA 3H7WB 5GLDA 3CAXA 1H5XA 5CGWA 3S7PA 2IWBA 3UE0A 5HFOA 5L8MA 1IFQA 3TOIA 4M3KA 3G30A 4GCZA 4HBTA 2J9OA 1YLPA 3MZEA 4DJ2A 3HL9A 4MBFA 4KUOA 5AVFA 3T1QB 2P7JA 4WLAA 1SDEA 4I3AA 3LUQA 1FSWA 1SDNA 4BLMA 4LRZE 4OP8A 4OPQA 1PWDA 5IHVA 3D9YA 3WS0A 4KQOA 1JVJA 3MF0A 2B5RA 2HJEA 4JBFA 3QP4A 2B95A 4OPZA 1BTLA 4DMZA 2CC1A 4EXOA 2RL3A 4EEUA 5CRFA 1KGEA 3PBQA 4D2OA 3I7JA 2D02A 5TGFA 4NXEA 5EVLA 3LGOA 1KVLA 3EEHA 3TJZC 1OJ5A 5AVEA 1H8MA 5EVIB 2VX8A 3H7WA 5FI6A 3PBSA 1UWNX 2VGJA 3N8LA 1K4FA 4H8RA 3Q7ZA 4E3NA 1K25A 3HCYA 4HH3A 3ZG9B 1IOUA 4XXRA 3UB9A 1AXBA 2XF3A 2HGVA 3OPPA 3KYEA 3DWZA 3VOZA 1F9IA 1RGZA 4RX2A 1S6RA 3LEZA 5E2GA 3TE8A 3RXXA 3VFHA 3BW6A 3MFDA 2VV6A 5FEFA 3V67A 1H8ZA 2RO4A 1O7EA 3QNBA 1S4SA 4EV4A 2WZXA 4E3LA 5LBRA 1NRFA 3MJQA 1LSWA 1TS8A 2K31A 1WYBA 5A91A 5IT5A 2AVXA 3S4XA 1LT0A 5TR7A 4GJ4A 1GA0A 1EW0A 1G68A 3S22A 1PNEA 4UA9A 5FI7A 1SKOB 4CPKA 5EVIA 1T1AA 1OTEA 1PI4A 2FY9A 4B4XA 2EFXA 2ZQ8A 4PM6A 2ZC3B 1J9MA 5MC7A 1KE0A 1NXYA 3C2WA 1LSXA 3ULFA 1OTAA 3PYPA 3E4OA 3M2JA 3UDFA 2QJ7A 2FH5A 3G35A 2R78A 2Y2OA 1JWPA 3DTEA 4OQGA 2PT7A 4Y15A 3FKVA 4FH2A 4DJ3A 2X01A 1JTDA 2VV7A 4E04A 4RX3A 3RFBA 4X1MA 4BMWA 5CHMA 3O86A 4S2OA 2JKRI 1OT9A 1BULA 2WKPA 4OQIA 4RA7A 5GLBA 4S2PA 3SS5A 3GTCA 4WELA 2Y91A 4K08A 4GB7A 1YLZA 2R9XA 4KENB 3HLGA 3UPNA 4DRTA 3BECA 3D3OA 2EX6A 3QP8A 5CEBA 2Y59A 4N92A 1TS0A 2J80A 3IXBA 3L7HA 4GLQA 4JLFA 4NG2A 2OAQ1 1SKOA 1VHMA 2J7VA 2V9AA 4I5SA 4R70A 4F3LB 1MZUA 3IHBA 3KO6A 2FFFB 1TF1A 2YKHA 4DE1A 2RO3A 3FV7A 2XD5A 1GA9A 1CF0A 5G4YA 3HLFA 1PZPA 1MKMA 3HUNA 4EBNA 3FWLA 5JYOA 1YAXA 2O9AA 5F69A 3HBRA 4CLCD 3TG9A 3O27A 3VFFA 1ES5A 4HBUA 4OKPA 4PPRA 4JGQA 2BLSA 2NUTC 1K4EA 4O0PA 4LENA 3T1RA 2HF6A 3ZVWA 3WRTA 3RXWA 1PFLA 1A0KA 3T4QA 3IHAA 3NIAA 3MBZA 5CTNA 4X1LA 3W8KA 3NHQA 2OLVA 4HHDA 3GRJA 5AQ7A 1XP4A 1IELA 3SZTA 5L2FA 3ZYTA 2ZLYA 1RP5A 1ZKJA 2E8JA 1G6AA 4CQHA 4WEJA 3SOIA 2W3HA 3IWOA 4GDNA 4FTXA 4G3KA 2WKEA 1N9NA 4X68A 2VJWA 4N1HA 3QHYA 4BBVA 1X0OA 1OT6A 4PM5A 4OOYA 3S7OA 3WS4A 5FASA 4F3LA 4JGRA 5FQJA 3CWFA 1BYWA 5HWWA 3N6IA 3VP4A 4ETXA 2X71A 5HAIA 1NZOA 2P08A 3HUOA 4PM8A 4ZJ1A 3EEAA 2ZOHA 5HDDA 2WGWB 2KDKA 1PI5A 2VZWA 4P85A 2LB5A 1UWPX 4WZ5C 4MN7A 4KZ9A 4JDMA 2ZC4B 1S0WA 3AGDA 4MBKA 5AJGA 4MCWA 4R3JA 3UE6A 1TDLA 3VSKA 2OSUA 1H0MA 3NULA 3V50A 3K3DA 4MN5A 4M4XA 2EWWA 2FFYA 4FSFA 4PKYG 4WZ5A 4EQIA 3FYZA 1EROA 2B18A 2V0WA 3IBRA 3ZG5A 4BQMA 3W4OA 3OLOA 1NRJA 4NXGA 1IEMA 3C8CA 4NEED 4Y3IA 4QD4A 2XEPA 4B93A 2OWJA 3IH9A 4P6ZS 5DFXA 1XA1A 5KIZA 4MEZA 3QP2A 3EWKA 2PRFA 1YMSA 5A90A 4FH4A 2JHEA 4OPYA 4WEKA 2PHYA 3G2ZA 1Z6FA 3HLEA 3G6OA 2Y55A 2WGWA 3TRCA 4S2JA 2QJ5A 3VV4A 3QNCA 1DJBA 3NOUC 5FL3A 4IBRA 1KOUA 3R4KA 1KDWA 5HAPA 1S1ZA 4KZ5A 1FR6A 1K54C 1IYOA 1WE4A 2ZM0A 2W3DA 2Z2LB 2QPNA 1ES2A 4QPRA 3A3IA 3OPHA 4RQ9A 2ACGA 3SH8A 1K54A 3V3RA 4QY6A 4WMCA 2Y4AA 5HD3A 2GDNA 5L10A 4NXFA 3PTEA 4Z9QA 4B88A 1NY0A 3T4SA 1YSQA 1ZG6A 3GMWA 4LV0A 4Y2FA 1W5DA 5HDSA 1PIOA 3HLBA 2Z6DA 3UE1A 4EERA 1ODVA 2ZOIA 2ZMFA 1KVMA 4II7A 1OMEA 5F68A 4X53A 4LRYC 5F82A 1ONGA 2PAVP 5HPFA 2YKFA 1FOFA 4BBTA 4FOFA 3IH8A 4R3BA 2V0UA 2PR6A 3FKWA 4KQRA 4YNRA 1CI9A 4WUJA 1PWGA 3TNDB 1MXOA 4C6YA 4HP9A 2M7UA 4XUZA 1FQGA 2INWA 1NLZA 5FEGA 3S7QA 3N4IA 3UDIA 1YLJA 3LICA 4L9GA 2OLUA 2XR0A 2WAEA 3FC7A 2K1NA 1BT5A 2A2LA 4EWFA 1XJ6A 4OOLA 3PBRA 3PXPA 4IJGA 1YMXA 4KQDA 5FQKA 4KZ7A 2P74A 4S2LA 1VM1A 3V3SA 5JYPA 2W3EA 3MXSA 2ZC6B 2G2UA 3A0VA 3LIEA 4JGPA 2W3GA 3HJIA 4EETB 1DP6A 2XA7M 2Y8HA 3HJKA 5KZHA 4PKYA 3IQAA 1LLBA 4R23A 2EX9A 3P7NA 2JKFA 1TS6A 2XFTA 1V9ZA 3ZVTA 2GZAA 3Q82A 3GR2A 1UGUA 3BEBA 3EOIA 3SS4A 3UY6A 3BFFA 3P09A 4ZJ2A 2HDSA 2KLIA 4R6LA 4JF4A 4Q0HA 4NK3A 5DJTA 2Z6CA 4LV2A 5FAQA 5G18A 2HZ5A 3G4PA 5EUAA 2XD1A 2DMWA 2QHKA 3QP1A 3UE3A 4ETZA 1S67L 2JKGA 4E3MA 4E6WA 2C6WB 3IXDA 3JVVA 5FATA 2OWHA 1UB4C 3B3XA 1D1JA 2QYBA 2L4RA 1VB6A 3MXRA 2K2NA 2OOLA 1SCWA 1G5UA 4DXBA 4EESA 1PW1A 1LI9A
chains in the Genus database with same CATH topology
2W3FA 4HY8A 4OOMA 1TS0A 4YWZA 2J80A 4GHIA 3C38A 5DFYA 2M7VA 2VGLM 3ZQ5A 1LSVA 4GLQA 3A0RA 3F1OB 4EQ1A 4I3JA 1XFQA 2FZ0A 2OAQ1 4LPZA 1VHMA 2V9AA 2PDRA 3JVUA 5TBMB 4I5SA 4R70A 2PYRA 1XJ3A 4F3LB 1Z0RA 1GSWA 5DF9A 1MZUA 3NOTC 4ME4A 3KO6A 1TF1A 1W63M 2YKHA 3LR5A 2RO3A 2A24A 4HH2A 1S66L 3H82A 3MQOA 5G4YA 4R38A 4JDOA 1MKMA 3KSHA 3VE4A 3KX0X 2QA4I 1YAXA 2O9AA 2QWSA 5F69A 1STZA 2K7SA 4CLCD 2VLGA 2W1TB 3O27A 4ARZB 3FG8A 4JGQA 2GJ3A 2NUTC 4JGOA 4WN5A 1S1YA 1G28A 3BY8A 3MQQA 1OTBA 3E98A 4O0PA 1ZHHB 1GSXA 2HF6A 3SW1A 4L9EA 4Z1WA 3T4QA 4CLCB 1XFNA 2I9VA 2J3WA 5K5BA 5IS1A 3LI8A 3EQVA 2W1RA 3NHQA 3CITA 3LIAA 4HHDA 5I5LA 4PHTA 2WKRA 1OTIA 5HDCA 4EU0A 3T4KA 3F1NB 3ZYTA 1P9WA 1P97A 3MXQA 3F1PB 4UEYA 4MN6A 4CQHA 4WEJA 2W3HA 4G3KA 3KYZA 1N9NA 5HL6A 2VJWA 3F1OA 4BBVA 1X0OA 1OT6A 2G7UA 3S7OA 3MMHA 1NLYA 4B9OA 1F98A 5TBMA 5CX7A 1JNUA 4F3LA 4JGRA 1YSFA 1F5MA 3CWFA 3B42A 3O5YA 5DKLA 1BYWA 5HWWA 4ETXA 5J4EA 3NOPC 3BQAA 2J3TD 2VKSA 5F6AA 2P08A 4GW9A 3EEAA 3BWLA 2ZOHA 2LB9A 3UMEA 5HDDA 1ZTUA 3VOLA 3R7WB 2KDKA 2QKPA 3KSIA 3BY9A 3DBAA 2VZWA 3MR0A 3LI9A 4EUVA 3RH8B 2LB5A 1UWPX 2W1TA 1G6OA 4MN7A 5HD5A 4CLCC 4JDMA 1S4RA 3UE6A 5AJGA 4MCWA 3T4OA 4ARZA 5HZHA 4G3WA 4PAUA 1YFBA 2XSSA 4L9FA 4BBUA 3LIBA 1NWZA 2XRNA 2V1BA 3K3DA 4MN5A 4M4XA 2EWWA 2GX5A 1TD5A 4FSFA 4PKYG 2CMNA 4CLCA 1Y28A 4HP4A 4MDZA 2HJ9C 2B18A 3MQ0A 2V0WA 4UQIS 4HJ3A 3IBRA 2W0NA 3E4QA 5J3WA 4YOFA 3EGDC 2RO5A 3F1NA 1XJ2A 3OLOA 1NRJA 2JKTI 3F1PA 3CUEC 4NXGA 3ICYA 4AFIA 3C8CA 4GS9B 4NEED 4Y3IA 2L1MA 3OCLA 3D72A 3PHYA 4B93A 2OWJA 3E4PA 4I3IA 4P6ZS 4WL9A 5DFXA 3RTYA 4HOIA 4I39A 2XA7S 5KIZA 5IU1A 4LRXC 3EWKA 1OPXA 3CUEA 3EGXC 3CLOA 2JHEA 4HI4A 1D7EA 1YSPA 1YKDA 1WA9A 3KSGA 4KUKA 4WEKA 2PHYA 4HNBA 3PBOA 3G6OA 1P9RA 2VV8A 3FPWA 3U2AA 2GNXA 2J3TC 4LLOB 2PYPA 1TS7A 3MFXA 3TRCA 3S7NA 3R7WA 3K2NA 1W63Q 1P0ZA 2OAP1 2XROA 5C5KA 2MJ6A 2QJ5A 3OCNA 4HIAA 3VV4A 2IA2A 3H7WB 3CAXA 3NOUC 3S7PA 5FL3A 2EWVA 1KOUA 2NUPC 3CI6A 5L8MA 1IFQA 3R4KA 4NKPA 3LIDA 4GCZA 1T19A 2JKTM 1DP8A 3PR6A 3FPVA 3PBNA 4IHQA 4DJ2A 1S1ZA 4KUOA 2W3DA 5AVFA 2P7JA 3EQUA 4WLAA 1T1CA 3UMDA 2ZBBA 2O99A 4QPRA 1MVFD 4L0LA 4I3AA 3LUQA 4RQ9A 4GS9A 3NJAA 4LRZE 3LR0A 5HSQA 5HD3A 4KQOA 2VGLS 3MF0A 2H28A 2HJEA 2D01A 3LYXA 4NXBA 4NXFA 2KOIA 4DMZA 4IUHA 4EXOA 2KX6A 3TW8A 3T4SA 4EEUA 1YSQA 3PBQA 1N9LA 2BASA 2JN7A 4Y2FA 2D02A 3OC2A 5HDSA 4NXEA 3UB7A 1N9OA 2Z6DA 2P04A 4EERA 3EEHA 1ODVA 3TJZC 5KSHA 1OJ5A 3UB6A 2ZOIA 2WKQA 2ZMFA 4II7A 5F68A 5AVEA 3GDIA 4WF0A 4Q0IA 2EA9A 3W2ZA 3BJNA 4LRYC 1H8MA 2PR5A 2VX8A 3H9WA 3GECA 4XT2B 3H7WA 5HPFA 2YKFA 1UWNX 3PBSA 4BBTA 4FOFA 5HWVA 2V0UA 2PR6A 4HJ6A 5HPIA 4MMNA 3PBTA 1GSVA 2PD8A 4YNRA 3OOVA 2B02A 3A0SA 4WUJA 3HCYA 4HH3A 1IOUA 3TNDB 2W27A 3UB9A 4IUKA 4HP9A 2HGVA 2M7UA 3P01A 5G4ZA 2INWA 1NLZA 4H6JB 1V9YA 1F9IA 5A8BA 3S7QA 5ITJA 4BWIA 3IS2B 1OTDA 5HWTA 3TE8A 2Y79A 3LICA 3BW6A 2VV6A 4L9GA 3LFVA 3V67A 3LR4A 3FC7A 2K1NA 2VEAA 2RO4A 3OBFA 4UQIM 5ITMA 2A2LA 1S4SA 1XJ6A 3E0YA 2JKRM 4OOLA 2O0YA 2PD7A 3PBRA 5LBRA 3PXPA 4HQAA 4IJGA 3MJQA 4Q0JA 4KQDA 1LSWA 1TS8A 1T18A 2K31A 4HJ4A 4R3AA 2W3EA 1D06A 2O9CA 3T4TA 3A0VA 5IT5A 4ZRRA 2L66A 2GLWA 5J7EA 1LT0A 4GJ4A 3LIEA 4EEPA 3KSFA 3KYQA 1EW0A 4JGPA 1T1BA 4GHIB 4P6ZM 5EFWA 2W3GA 3HJIA 4EETB 1DP6A 2XA7M 3B33A 2Y8HA 3HJKA 4PKYA 4Y5FA 2V1AA 2VA0A 4I38A 4XT2A 1T1AA 3P7NA 1OTEA 1TS6A 2O9BA 1OJGA 2FY9A 3C30A 5DJUA 5F5YA 1V9ZA 4O01A 2GZAA 2M1CA 2A24B 3H82B 3T4JA 3IBJA 5DKKA 1UGUA 5MC7A 3BQ8A 3C2WA 3EOIA 1LSXA 3ULFA 1OTAA 3PYPA 3E4OA 4CLCE 2QJ7A 2FH5A 3B47A 2KLIA 4R6LA 2R78A 4Q0HA 1H3QA 5DJTA 2Z6CA 4H6JA 2PT7A 5TJJA 4DN0A 3LIFA 4DJ3A 2VV7A 4E04A 3IS2A 3RFBA 1XJ4A 2DMWA 1DRMA 4BMWA 1MC0A 3UB8A 2QHKA 3UE3A 4ETZA 1LL8A 1S67L 2JKRI 4BJPA 2L0WA 1DP9A 1OT9A 2WKPA 4G3VA 3JVVA 2OWHA 3LR3A 1UB4C 4WELA 2QYBA 2ZMVA 2L4RA 3K3CA 3VE3A 1VB6A 4K08A 3T50A 4EW7A 2K2NA 2OOLA 4EESA 3D3OA 3T4LA 4O8GA 2HV1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3R4K A;  2VKS A;  2Y79 A;  2W3F A;  4GW9 A;  3EEA A;  3LFV A;  2LB9 A;  5DFY A;  2M7V A;  1ZTU A;  3ZQ5 A;  2K1N A;  2VEA A;  2RO4 A;  3OBF A;  4GLQ A;  3KSI A;  5ITM A;  3DBA A;  2VZW A;  3E0Y A;  2O0Y A;  4EUV A;  2LB5 A;  5LBR A;  2W3D A;  2W1T A;  1VHM A;  4IJG A;  4Q0J A;  4MN7 A;  4R70 A;  2K31 A;  1Z0R A;  5AJG A;  4MCW A;  2O99 A;  4QPR A;  3NOT C;  4G3W A;  1YFB A;  2W3E A;  3KO6 A;  2XSS A;  1MVF D;  4ME4 A;  4PAU A;  2O9C A;  1TF1 A;  4RQ9 A;  2RO3 A;  4ZRR A;  2L66 A;  2GLW A;  2XRN A;  4LRZ E;  3KSF A;  2GX5 A;  1TD5 A;  1MKM A;  2W3G A;  3KSH A;  5HSQ A;  4MDZ A;  2Y8H A;  3MF0 A;  2B18 A;  2O9A A;  3MQ0 A;  3IBR A;  1STZ A;  4Y5F A;  2W1T B;  3O27 A;  2KOI A;  4DMZ A;  4IUH A;  4YOF A;  2RO5 A;  2O9B A;  2FY9 A;  1YSQ A;  4O01 A;  3E98 A;  4O0P A;  4Y2F A;  4Y3I A;  3IBJ A;  4Z1W A;  3C2W A;  5DFX A;  2ZMF A;  5K5B A;  3NHQ A;  2W1R A;  4Q0I A;  3CIT A;  3W2Z A;  4LRX C;  3BJN A;  2KLI A;  4LRY C;  5I5L A;  4R6L A;  4Q0H A;  4EU0 A;  1YSP A;  5HPF A;  1YKD A;  5TJJ A;  3KSG A;  4DN0 A;  4FOF A;  4E04 A;  3RFB A;  3G6O A;  5L8M A;  4CQH A;  1MC0 A;  2W3H A;  4G3K A;  5HPI A;  4MMN A;  4ETZ A;  5HL6 A;  4YNR A;  2VJW A;  3TRC A;  3OOV A;  4G3V A;  3S7N A;  3HCY A;  3K2N A;  3TND B;  1UB4 C;  2G7U A;  2QYB A;  3S7O A;  3MMH A;  4IUK A;  2XRO A;  5C5K A;  2HGV A;  2M7U A;  3VV4 A;  2K2N A;  2OOL A;  2IA2 A;  1YSF A;  1F5M A;  3D3O A;  3NOU C;  3O5Y A;  4O8G A;  3S7P A;  3S7Q A;  4ETX A;  5ITJ A;  4BWI A;  3NOP C;  3CI6 A; 
#chains in the Genus database with same CATH topology
 3VMA A;  4UA7 A;  2W3F A;  1I2W A;  5D3O A;  4A5R A;  3C38 A;  5DFY A;  3P98 A;  2VGL M;  3ZQ5 A;  4GD6 A;  2Q9M A;  4Y0U A;  4BEN A;  4LPZ A;  4MBH A;  2PDR A;  3JVU A;  2PYR A;  1ERM A;  2VK3 A;  1Z0R A;  3UN7 A;  5DF9 A;  1BSG A;  3LR5 A;  2PBD P;  5CGS A;  1L0D A;  4JXG A;  1PW8 A;  4K91 A;  1GHI A;  1E3U D;  1WYC A;  3DWK A;  3HLC A;  2BTF P;  3VE4 A;  3ZHH A;  3IWQ A;  4HES A;  4C75 A;  2Z2M B;  4OQ0 A;  4DDS A;  1JWZ A;  4WN5 A;  4U3T A;  1S1Y A;  2J9P A;  3MQQ A;  4EUZ A;  5EVI C;  4KG5 A;  2HP5 A;  1GSX A;  2Y2J A;  4D60 A;  4EBP A;  3JYI A;  3SW1 A;  3IX8 A;  3DTI A;  1XFN A;  2ZMA A;  1CEF A;  2DCF A;  2I9V A;  2J3W A;  1HTZ A;  1ESU A;  5CXW A;  5HAR A;  3V39 A;  4PHT A;  3BYD A;  5A92 A;  3T4K A;  1P9W A;  1MPL A;  3AGF A;  2QMI A;  1IKG A;  3S1Y A;  4QY5 A;  4KZ6 A;  1K56 A;  3T1S A;  1I2S A;  3SH9 A;  4JXW A;  5HL6 A;  1N4O A;  5CGX A;  3MSH A;  3CHW P;  4X25 A;  4E6X A;  3MMH A;  5CED A;  5KSC A;  4U0T A;  4R4S A;  2EXA A;  5FQM A;  1F5M A;  2P9V B;  4PMA A;  2Y2K A;  4LFU A;  5FAP A;  1K57 A;  2LB9 A;  4GD8 A;  1ESI A;  1M6K A;  3BFD A;  3UPO A;  3R7W B;  2QKP A;  3BY9 A;  3G34 A;  1MWS A;  3DBA A;  3MR0 A;  3MS6 A;  5HD5 A;  4WYY A;  3T4O A;  3VP0 A;  3NC8 A;  1W7F A;  3QP6 A;  1FIK A;  1QMF A;  1PRQ A;  4L9F A;  5GHY A;  2JBF A;  3LIB A;  1VEU B;  1NWZ A;  2XFS A;  2XRN A;  3IX4 A;  3LEQ A;  2GX5 A;  1TD5 A;  2V8C A;  4HP4 A;  4BD0 A;  2HJ9 C;  3MQ0 A;  3FZC A;  3N7W A;  3EGD C;  3UPP A;  2RO5 A;  3D4F A;  1XJ2 A;  4AFI A;  2WKI A;  4P6B A;  4XUX A;  2UWX A;  5FQQ A;  3PHY A;  3T1X A;  1H8Y A;  4WL9 A;  2EX8 A;  3IX3 A;  3G2Y A;  4U0X A;  3W4P A;  3O3V A;  1OPX A;  3EGX C;  3CLO A;  4HI4 A;  1D7E A;  1YSP A;  2P9V A;  2J8Y A;  5E2F A;  5E2H A;  1LL5 A;  3PBO A;  2VV8 A;  5HW3 A;  4LCL A;  2J3T C;  1TS7 A;  3SS3 A;  3MFX A;  3S7N A;  3R7W A;  1EWZ A;  1QME A;  1P0Z A;  2OAP 1;  4BL3 A;  2IA2 A;  4ZJ3 A;  2EWV A;  3MKF A;  5TFQ A;  3CI6 A;  4LV3 A;  4Y0O A;  1JTG A;  1VEU A;  3MZD A;  4OQH A;  5U47 A;  3RJU A;  1MWU A;  5EM0 A;  1T19 A;  1DP8 A;  4IHQ A;  5E43 A;  3EQU A;  3UMD A;  1NJ4 A;  3DAV A;  2ZBB A;  2O99 A;  4OP5 A;  4L0L A;  3HVF A;  4UAA A;  1BLS A;  1KGG A;  1YLW A;  3ITA A;  4YFM A;  5HSQ A;  3IT9 A;  3VP3 A;  4GKU A;  3BLM A;  3LYX A;  4NXB A;  2KOI A;  1HLU P;  1AWI A;  2KX6 A;  4WM9 A;  1N9L A;  2JN7 A;  2V2F F;  3OC2 A;  1PWC A;  5EOE A;  2WK0 A;  5J8X A;  4C3Q A;  1N9O A;  5KSH A;  3UB6 A;  2WKQ A;  1YT4 A;  2EA9 A;  4UHU A;  1FCM A;  3W2Z A;  3BJN A;  4ZBE A;  4FCF A;  3H9W A;  3GEC A;  5AQA A;  4K0W A;  2EXB A;  2PBY A;  1E4D A;  3CMZ A;  5HWV A;  1KE4 A;  1C3B A;  5HPI A;  4MMN A;  4DE0 A;  2PD8 A;  3OOV A;  4GDB A;  3A0S A;  4EBL A;  4LCM A;  3GSG A;  4R0Q A;  3VP1 A;  3OPR A;  3P01 A;  5G4Z A;  1FCO A;  4H6J B;  5E2E A;  1V9Y A;  5ITJ A;  2Y2H A;  3IS2 B;  1OTD A;  5HWT A;  2R9W A;  3PAE A;  3LFV A;  3HUM A;  3LR4 A;  2VEA A;  1IYQ A;  4UQI M;  1IKI A;  5DTS A;  2O0Y A;  2PD7 A;  2Y2Q A;  5DVA A;  4HJ4 A;  4R3A A;  1ERQ A;  3C7V A;  4OPR A;  1FSY A;  2O9C A;  1Y54 A;  2L66 A;  5GLC A;  2GLW A;  5J7E A;  2XK1 A;  4MLL A;  4X55 A;  3KYQ A;  5DTK A;  1T1B A;  3CG5 A;  5EFW A;  3ISG A;  4IED A;  3B33 A;  5CHU A;  2V1A A;  4GNU A;  4I38 A;  5F83 A;  2Y2N A;  2HDQ A;  3C4P A;  5F5Y A;  1IYS A;  3WS1 A;  5KMW A;  3C7U A;  3H82 B;  3IBJ A;  5FI2 A;  5EVE A;  4QWO A;  3BM6 A;  5DF8 A;  4CLC E;  5I94 A;  4DE2 A;  3B47 A;  2HPB A;  2H10 A;  3ITB A;  4N9K A;  4H6J A;  1ALQ A;  5TJJ A;  3MKE A;  3LIF A;  4DN0 A;  3L9K A;  3IS2 A;  2Y2P A;  1MBL A;  3NDE A;  4X56 A;  1DRM A;  4QB8 A;  1MC0 A;  4BJP A;  1DP9 A;  1GCE A;  4G3V A;  1GHM A;  4MNR A;  3LR3 A;  4GOG A;  1XGJ A;  2ZJ9 A;  3K3C A;  3VE3 A;  2HP6 A;  2PU2 A;  5L07 A;  1SZV A;  5M1A A;  3A0R A;  2HV1 A;  4R4R A;  1XGI A;  3LO7 A;  1FR1 A;  2ZL1 B;  2M7V A;  1LSV A;  3F1O B;  2G2W A;  1YM1 A;  4EQ1 A;  3IF6 B;  1XFQ A;  1N9B A;  3VSL A;  3N8R A;  1K38 A;  4ME4 A;  1W63 M;  3H82 A;  3A3E A;  2ZC5 B;  4JDO A;  3KSH A;  3KX0 X;  3NY4 A;  5FA7 A;  1BLP A;  2VLG A;  4YIN A;  2W1T B;  1DJC A;  2E8I A;  3HLW A;  4ARZ B;  3FG8 A;  4JGO A;  4GZB A;  5F1G A;  3BY8 A;  4Y17 A;  2WAD A;  1OTB A;  5EE8 A;  3M2K A;  4DDY A;  2Y2L A;  4ZDX A;  4Z1W A;  4CLC B;  3MZF A;  3LI8 A;  1L0F A;  2W1R A;  3LIA A;  5I5L A;  1LL9 A;  3BRM A;  3UB5 P;  1OTI A;  3IF6 C;  3Q1F A;  3NBL A;  1P97 A;  4OH0 A;  1FIL A;  3F1P B;  4MN6 A;  5GLA A;  3DW0 A;  3KYZ A;  2ZL1 A;  4FD8 A;  3F1O A;  1DJA A;  3IF6 A;  2G7U A;  3VP2 A;  1NLY A;  4B9O A;  1JNU A;  1ONH A;  1YSF A;  3O5Y A;  2IWD A;  2VKS A;  5F6A A;  3T12 B;  1K6S A;  4PM9 A;  2HP9 A;  3IXH A;  3BWL A;  3UME A;  3M6B A;  3WS2 A;  3KSI A;  3GQZ A;  4EUV A;  2W1T A;  4CLC C;  4P0M A;  5HAQ A;  3DTK A;  4ARZ A;  1Z09 A;  4G3W A;  4PAU A;  1YFB A;  1F2K A;  5EPH A;  5GHX A;  2JC7 A;  3BLS A;  2CMN A;  4CLC A;  1Y28 A;  3O87 A;  1VQQ A;  2X02 A;  4WMC D;  5FDH A;  5CTM A;  2W0N A;  3WS5 A;  2ZQC A;  1PYY A;  5HX9 A;  4RVA A;  2JKT I;  3F1P A;  3CUE C;  4JF5 A;  4GS9 B;  2ZQA A;  1HVB A;  2L1M A;  1LHY A;  2XH9 A;  4I3I A;  3E4P A;  3RTY A;  4HOI A;  2XGN A;  1NZU A;  2XA7 S;  5AQ9 A;  5IU1 A;  2EX2 A;  4QU3 A;  4LRX C;  5BOH A;  3CUE A;  1M40 A;  1WA9 A;  2JE5 A;  4KUK A;  1O07 A;  4HNB A;  3FPW A;  3U2A A;  2PYP A;  1KE3 A;  3UDX A;  3K2N A;  1Q2P A;  4QJG A;  3OCN A;  4JKT A;  4HIA A;  2Y2G A;  2WYX A;  1XKZ A;  3M6H A;  3Q7V B;  2NUP C;  2WUQ A;  5EEC A;  4NKP A;  1HZO A;  3LID A;  3LY3 A;  4KQQ A;  2JKT M;  3PR6 A;  3FPV A;  5DTT A;  3PBN A;  4LV1 A;  4ID4 A;  1L3L A;  1K57 C;  1MY8 A;  4Y13 A;  1YQS A;  1ZC2 A;  5EOO A;  1T1C A;  4ZAM A;  1MVF D;  1EI5 A;  4KZ8 A;  3NDG A;  2EFU A;  4GS9 A;  3NJA A;  2XQZ A;  4FUW A;  3LR0 A;  2VGL S;  2H28 A;  4E3J A;  3UNW A;  4RYE A;  1VET B;  2D01 A;  4IUH A;  3G32 A;  1SKF A;  3TW8 A;  4JPM A;  4KZB A;  1W79 A;  4R1G A;  1K0K A;  1ZG4 A;  2PU4 A;  3HLD A;  2BAS A;  1DY6 A;  3IXG A;  1L0E A;  5F1F A;  4OLD A;  3UB7 A;  2P04 A;  3IWI A;  1ES4 A;  3GDI A;  1K6R A;  4Q0I A;  4WF0 A;  2PR5 A;  4XT2 B;  4IVK A;  3Q7V A;  3NEC A;  4X69 A;  4HJ6 A;  5DF7 A;  3PBT A;  1GSV A;  3JPU A;  2B02 A;  4S2N C;  2W27 A;  1CJF A;  2C5W B;  2H0Y A;  4NET A;  4IUK A;  2WAF A;  3PAG A;  3ZFZ A;  4DF6 A;  4S2M A;  4KG2 A;  5A8B A;  5M18 A;  4BWI A;  1CQA A;  4WZ4 A;  3HRE A;  4S2N A;  2Y79 A;  4LGW A;  3ZG8 B;  1XXM A;  4IVI A;  3OBF A;  5ITM A;  2JCH A;  3E0Y A;  2JKR M;  1VET A;  4HQA A;  4Q0J A;  2Q9N A;  1T18 A;  3UO9 A;  3A3F A;  1D06 A;  3ZDJ A;  1TVF A;  3T4T A;  4ZRR A;  4P87 A;  1XA7 A;  4ZTK A;  1IYP A;  4EEP A;  4X6T A;  3KSF A;  5A93 A;  1KGF A;  4GHI B;  4P6Z M;  4KZ4 A;  1RGY A;  1CEG A;  4N9L A;  2OV5 A;  5AQB A;  4Y5F A;  4WBG A;  2VA0 A;  2BG1 A;  4XT2 A;  2O9B A;  1OJG A;  3C30 A;  5DJU A;  4O01 A;  5FQ9 A;  1BLC A;  2M1C A;  5FSR A;  2A24 B;  4E3I A;  3A3D A;  5EV0 A;  3T4J A;  5DKK A;  3BQ8 A;  5CER A;  1XPB A;  2VGK A;  1YLT A;  3IF5 A;  3SH7 A;  4JXS A;  1H3Q A;  3BFC A;  5EVI D;  1XJ4 A;  5GHZ A;  2V20 A;  2ZM8 A;  3UB8 A;  3LCE A;  4Q8I A;  2WZZ A;  1LL8 A;  4KZA A;  4IBX A;  2L0W A;  5L09 A;  1K56 D;  4CJN A;  4Y7P A;  2ZQD A;  3NI9 A;  2ZMV A;  1FCN A;  3T50 A;  4EW7 A;  4S2I A;  4B4Z A;  3LY4 A;  3T4L A;  4O8G A;  2A49 A;  1GHP A;  2IWC A;  4N1X A;  2ZC7 A;  4DE3 A;  4HY8 A;  3E2L A;  2WGV A;  2XDM A;  2ZD8 A;  2WKH A;  4OOM A;  4E3K A;  4YWZ A;  1TEM A;  4GHI A;  2ZQ7 A;  5FQI A;  2I72 A;  4I3J A;  2FZ0 A;  3C5A A;  1BZA A;  3Q81 A;  3BFE A;  1Q2Q A;  5TBM B;  1XJ3 A;  1BLH A;  1NYM A;  1CI8 A;  1GSW A;  3NOT C;  1Y4O A;  1MWT A;  2A24 A;  4HH2 A;  1S66 L;  3MQO A;  4R38 A;  2V8F A;  3QP5 A;  3CZD A;  3AGE A;  2QA4 I;  2QWS A;  2Y2I A;  3NCK A;  1KDS A;  1BUE A;  1STZ A;  2K7S A;  3OPL A;  5M19 A;  4KZ3 A;  2ZM2 A;  2GJ3 A;  4OLG A;  1G28 A;  4OON A;  3E98 A;  1L2S A;  1ZHH B;  1W8Q A;  5CEC A;  3CJM A;  4L9E A;  1E25 A;  5K5B A;  5IS1 A;  3U4L P;  3W4Q A;  3ZG7 B;  3EQV A;  3CIT A;  3E2K A;  1YPR A;  2WKR A;  5HDC A;  4EU0 A;  3F1N B;  3MXQ A;  3Q07 A;  4JXV A;  1TDG A;  4PM7 A;  4BD1 A;  4UEY A;  3O88 A;  3ZCZ A;  2HDR A;  3C4O A;  3ZNT A;  1L0G A;  3GVB A;  3N8S A;  1LI0 A;  3CPT B;  1F98 A;  1RCJ A;  5TBM A;  4JF6 A;  5CX7 A;  4BL2 A;  1PZO A;  5DKL A;  3B42 A;  5J4E A;  1ES3 A;  3NOP C;  3BQA A;  2J3T D;  3OZH A;  2UV0 E;  4UA6 A;  4S2K A;  3G31 A;  4GW9 A;  5FAO A;  3VOY A;  3ZG0 A;  1ZTU A;  3VOL A;  4O7D A;  1MKI A;  1I5Q A;  3V5M A;  2ZQ9 A;  3LI9 A;  3RH8 B;  1G6O A;  2DNS A;  1K55 C;  1S4R A;  3GV9 A;  5HZH A;  2XSS A;  1E3U A;  4OVD A;  4BBU A;  1CK3 A;  4HEF A;  1W8Y A;  2V1B A;  3WRZ A;  2A3U A;  4MDZ A;  1K55 A;  4F94 A;  4UQI S;  4HJ3 A;  2RCX A;  4K0X A;  4QHC A;  3TSG A;  1ACF A;  3ZGA B;  3E4Q A;  5J3W A;  4YOF A;  5HL1 A;  2DRW A;  2WGI A;  5FDS A;  3F1N A;  4Y0T A;  3BFG A;  2HDU A;  3ICY A;  5CHJ A;  4E3O A;  3OCL A;  3D72 A;  2QZ6 A;  3DTM A;  2V1Z A;  4I39 A;  3CPT A;  3WWX A;  1YLY A;  5GL9 A;  1XX2 A;  2H5S A;  4GN2 A;  4ESP A;  1YKD A;  1NYY A;  3KSG A;  2Y2M A;  1U60 A;  3ZNY A;  4KG6 A;  1P9R A;  2GNX A;  4LLO B;  1SHV A;  2Q0O A;  1JWV A;  1J3W A;  1W63 Q;  5EM1 A;  4DXC A;  4DKI A;  1HD8 A;  2XRO A;  2H0T A;  5C5K A;  2MJ6 A;  2XLN A;  1MWR A;  3A3J A;  3H7W B;  5GLD A;  3CAX A;  1H5X A;  5CGW A;  3S7P A;  2IWB A;  3UE0 A;  5HFO A;  5L8M A;  1IFQ A;  3TOI A;  4M3K A;  3G30 A;  4GCZ A;  4HBT A;  2J9O A;  1YLP A;  3MZE A;  4DJ2 A;  3HL9 A;  4MBF A;  4KUO A;  5AVF A;  3T1Q B;  2P7J A;  4WLA A;  1SDE A;  4I3A A;  3LUQ A;  1FSW A;  1SDN A;  4BLM A;  4LRZ E;  4OP8 A;  4OPQ A;  1PWD A;  5IHV A;  3D9Y A;  3WS0 A;  4KQO A;  1JVJ A;  3MF0 A;  2B5R A;  2HJE A;  4JBF A;  3QP4 A;  2B95 A;  4OPZ A;  1BTL A;  4DMZ A;  2CC1 A;  4EXO A;  2RL3 A;  4EEU A;  5CRF A;  1KGE A;  3PBQ A;  4D2O A;  3I7J A;  2D02 A;  5TGF A;  4NXE A;  5EVL A;  3LGO A;  1KVL A;  3EEH A;  3TJZ C;  1OJ5 A;  5AVE A;  1H8M A;  5EVI B;  2VX8 A;  3H7W A;  5FI6 A;  3PBS A;  1UWN X;  2VGJ A;  3N8L A;  1K4F A;  4H8R A;  3Q7Z A;  4E3N A;  1K25 A;  3HCY A;  4HH3 A;  3ZG9 B;  1IOU A;  4XXR A;  3UB9 A;  1AXB A;  2XF3 A;  2HGV A;  3OPP A;  3KYE A;  3DWZ A;  3VOZ A;  1F9I A;  1RGZ A;  4RX2 A;  1S6R A;  3LEZ A;  5E2G A;  3TE8 A;  3RXX A;  3VFH A;  3BW6 A;  3MFD A;  2VV6 A;  5FEF A;  3V67 A;  1H8Z A;  2RO4 A;  1O7E A;  3QNB A;  1S4S A;  4EV4 A;  2WZX A;  4E3L A;  5LBR A;  1NRF A;  3MJQ A;  1LSW A;  1TS8 A;  2K31 A;  1WYB A;  5A91 A;  5IT5 A;  2AVX A;  3S4X A;  1LT0 A;  5TR7 A;  4GJ4 A;  1GA0 A;  1EW0 A;  1G68 A;  3S22 A;  1PNE A;  4UA9 A;  5FI7 A;  1SKO B;  4CPK A;  5EVI A;  1T1A A;  1OTE A;  1PI4 A;  2FY9 A;  4B4X A;  2EFX A;  2ZQ8 A;  4PM6 A;  2ZC3 B;  1J9M A;  5MC7 A;  1KE0 A;  1NXY A;  3C2W A;  1LSX A;  3ULF A;  1OTA A;  3PYP A;  3E4O A;  3M2J A;  3UDF A;  2QJ7 A;  2FH5 A;  3G35 A;  2R78 A;  2Y2O A;  1JWP A;  3DTE A;  4OQG A;  2PT7 A;  4Y15 A;  3FKV A;  4FH2 A;  4DJ3 A;  2X01 A;  1JTD A;  2VV7 A;  4E04 A;  4RX3 A;  3RFB A;  4X1M A;  4BMW A;  5CHM A;  3O86 A;  4S2O A;  2JKR I;  1OT9 A;  1BUL A;  2WKP A;  4OQI A;  4RA7 A;  5GLB A;  4S2P A;  3SS5 A;  3GTC A;  4WEL A;  2Y91 A;  4K08 A;  4GB7 A;  1YLZ A;  2R9X A;  4KEN B;  3HLG A;  3UPN A;  4DRT A;  3BEC A;  3D3O A;  2EX6 A;  3QP8 A;  5CEB A;  2Y59 A;  4N92 A;  1TS0 A;  2J80 A;  3IXB A;  3L7H A;  4GLQ A;  4JLF A;  4NG2 A;  2OAQ 1;  1SKO A;  1VHM A;  2J7V A;  2V9A A;  4I5S A;  4R70 A;  4F3L B;  1MZU A;  3IHB A;  3KO6 A;  2FFF B;  1TF1 A;  2YKH A;  4DE1 A;  2RO3 A;  3FV7 A;  2XD5 A;  1GA9 A;  1CF0 A;  5G4Y A;  3HLF A;  1PZP A;  1MKM A;  3HUN A;  4EBN A;  3FWL A;  5JYO A;  1YAX A;  2O9A A;  5F69 A;  3HBR A;  4CLC D;  3TG9 A;  3O27 A;  3VFF A;  1ES5 A;  4HBU A;  4OKP A;  4PPR A;  4JGQ A;  2BLS A;  2NUT C;  1K4E A;  4O0P A;  4LEN A;  3T1R A;  2HF6 A;  3ZVW A;  3WRT A;  3RXW A;  1PFL A;  1A0K A;  3T4Q A;  3IHA A;  3NIA A;  3MBZ A;  5CTN A;  4X1L A;  3W8K A;  3NHQ A;  2OLV A;  4HHD A;  3GRJ A;  5AQ7 A;  1XP4 A;  1IEL A;  3SZT A;  5L2F A;  3ZYT A;  2ZLY A;  1RP5 A;  1ZKJ A;  2E8J A;  1G6A A;  4CQH A;  4WEJ A;  3SOI A;  2W3H A;  3IWO A;  4GDN A;  4FTX A;  4G3K A;  2WKE A;  1N9N A;  4X68 A;  2VJW A;  4N1H A;  3QHY A;  4BBV A;  1X0O A;  1OT6 A;  4PM5 A;  4OOY A;  3S7O A;  3WS4 A;  5FAS A;  4F3L A;  4JGR A;  5FQJ A;  3CWF A;  1BYW A;  5HWW A;  3N6I A;  3VP4 A;  4ETX A;  2X71 A;  5HAI A;  1NZO A;  2P08 A;  3HUO A;  4PM8 A;  4ZJ1 A;  3EEA A;  2ZOH A;  5HDD A;  2WGW B;  2KDK A;  1PI5 A;  2VZW A;  4P85 A;  2LB5 A;  1UWP X;  4WZ5 C;  4MN7 A;  4KZ9 A;  4JDM A;  2ZC4 B;  1S0W A;  3AGD A;  4MBK A;  5AJG A;  4MCW A;  4R3J A;  3UE6 A;  1TDL A;  3VSK A;  2OSU A;  1H0M A;  3NUL A;  3V50 A;  3K3D A;  4MN5 A;  4M4X A;  2EWW A;  2FFY A;  4FSF A;  4PKY G;  4WZ5 A;  4EQI A;  3FYZ A;  1ERO A;  2B18 A;  2V0W A;  3IBR A;  3ZG5 A;  4BQM A;  3W4O A;  3OLO A;  1NRJ A;  4NXG A;  1IEM A;  3C8C A;  4NEE D;  4Y3I A;  4QD4 A;  2XEP A;  4B93 A;  2OWJ A;  3IH9 A;  4P6Z S;  5DFX A;  1XA1 A;  5KIZ A;  4MEZ A;  3QP2 A;  3EWK A;  2PRF A;  1YMS A;  5A90 A;  4FH4 A;  2JHE A;  4OPY A;  4WEK A;  2PHY A;  3G2Z A;  1Z6F A;  3HLE A;  3G6O A;  2Y55 A;  2WGW A;  3TRC A;  4S2J A;  2QJ5 A;  3VV4 A;  3QNC A;  1DJB A;  3NOU C;  5FL3 A;  4IBR A;  1KOU A;  3R4K A;  1KDW A;  5HAP A;  1S1Z A;  4KZ5 A;  1FR6 A;  1K54 C;  1IYO A;  1WE4 A;  2ZM0 A;  2W3D A;  2Z2L B;  2QPN A;  1ES2 A;  4QPR A;  3A3I A;  3OPH A;  4RQ9 A;  2ACG A;  3SH8 A;  1K54 A;  3V3R A;  4QY6 A;  4WMC A;  2Y4A A;  5HD3 A;  2GDN A;  5L10 A;  4NXF A;  3PTE A;  4Z9Q A;  4B88 A;  1NY0 A;  3T4S A;  1YSQ A;  1ZG6 A;  3GMW A;  4LV0 A;  4Y2F A;  1W5D A;  5HDS A;  1PIO A;  3HLB A;  2Z6D A;  3UE1 A;  4EER A;  1ODV A;  2ZOI A;  2ZMF A;  1KVM A;  4II7 A;  1OME A;  5F68 A;  4X53 A;  4LRY C;  5F82 A;  1ONG A;  2PAV P;  5HPF A;  2YKF A;  1FOF A;  4BBT A;  4FOF A;  3IH8 A;  4R3B A;  2V0U A;  2PR6 A;  3FKW A;  4KQR A;  4YNR A;  1CI9 A;  4WUJ A;  1PWG A;  3TND B;  1MXO A;  4C6Y A;  4HP9 A;  2M7U A;  4XUZ A;  1FQG A;  2INW A;  1NLZ A;  5FEG A;  3S7Q A;  3N4I A;  3UDI A;  1YLJ A;  3LIC A;  4L9G A;  2OLU A;  2XR0 A;  2WAE A;  3FC7 A;  2K1N A;  1BT5 A;  2A2L A;  4EWF A;  1XJ6 A;  4OOL A;  3PBR A;  3PXP A;  4IJG A;  1YMX A;  4KQD A;  5FQK A;  4KZ7 A;  2P74 A;  4S2L A;  1VM1 A;  3V3S A;  5JYP A;  2W3E A;  3MXS A;  2ZC6 B;  2G2U A;  3A0V A;  3LIE A;  4JGP A;  2W3G A;  3HJI A;  4EET B;  1DP6 A;  2XA7 M;  2Y8H A;  3HJK A;  5KZH A;  4PKY A;  3IQA A;  1LLB A;  4R23 A;  2EX9 A;  3P7N A;  2JKF A;  1TS6 A;  2XFT A;  1V9Z A;  3ZVT A;  2GZA A;  3Q82 A;  3GR2 A;  1UGU A;  3BEB A;  3EOI A;  3SS4 A;  3UY6 A;  3BFF A;  3P09 A;  4ZJ2 A;  2HDS A;  2KLI A;  4R6L A;  4JF4 A;  4Q0H A;  4NK3 A;  5DJT A;  2Z6C A;  4LV2 A;  5FAQ A;  5G18 A;  2HZ5 A;  3G4P A;  5EUA A;  2XD1 A;  2DMW A;  2QHK A;  3QP1 A;  3UE3 A;  4ETZ A;  1S67 L;  2JKG A;  4E3M A;  4E6W A;  2C6W B;  3IXD A;  3JVV A;  5FAT A;  2OWH A;  1UB4 C;  3B3X A;  1D1J A;  2QYB A;  2L4R A;  1VB6 A;  3MXR A;  2K2N A;  2OOL A;  1SCW A;  1G5U A;  4DXB A;  4EES A;  1PW1 A;  1LI9 A; 
#chains in the Genus database with same CATH homology
 2W3F A;  4HY8 A;  4OOM A;  1TS0 A;  4YWZ A;  2J80 A;  4GHI A;  3C38 A;  5DFY A;  2M7V A;  2VGL M;  3ZQ5 A;  1LSV A;  4GLQ A;  3A0R A;  3F1O B;  4EQ1 A;  4I3J A;  1XFQ A;  2FZ0 A;  2OAQ 1;  4LPZ A;  1VHM A;  2V9A A;  2PDR A;  3JVU A;  5TBM B;  4I5S A;  4R70 A;  2PYR A;  1XJ3 A;  4F3L B;  1Z0R A;  1GSW A;  5DF9 A;  1MZU A;  3NOT C;  4ME4 A;  3KO6 A;  1TF1 A;  1W63 M;  2YKH A;  3LR5 A;  2RO3 A;  2A24 A;  4HH2 A;  1S66 L;  3H82 A;  3MQO A;  5G4Y A;  4R38 A;  4JDO A;  1MKM A;  3KSH A;  3VE4 A;  3KX0 X;  2QA4 I;  1YAX A;  2O9A A;  2QWS A;  5F69 A;  1STZ A;  2K7S A;  4CLC D;  2VLG A;  2W1T B;  3O27 A;  4ARZ B;  3FG8 A;  4JGQ A;  2GJ3 A;  2NUT C;  4JGO A;  4WN5 A;  1S1Y A;  1G28 A;  3BY8 A;  3MQQ A;  1OTB A;  3E98 A;  4O0P A;  1ZHH B;  1GSX A;  2HF6 A;  3SW1 A;  4L9E A;  4Z1W A;  3T4Q A;  4CLC B;  1XFN A;  2I9V A;  2J3W A;  5K5B A;  5IS1 A;  3LI8 A;  3EQV A;  2W1R A;  3NHQ A;  3CIT A;  3LIA A;  4HHD A;  5I5L A;  4PHT A;  2WKR A;  1OTI A;  5HDC A;  4EU0 A;  3T4K A;  3F1N B;  3ZYT A;  1P9W A;  1P97 A;  3MXQ A;  3F1P B;  4UEY A;  4MN6 A;  4CQH A;  4WEJ A;  2W3H A;  4G3K A;  3KYZ A;  1N9N A;  5HL6 A;  2VJW A;  3F1O A;  4BBV A;  1X0O A;  1OT6 A;  2G7U A;  3S7O A;  3MMH A;  1NLY A;  4B9O A;  1F98 A;  5TBM A;  5CX7 A;  1JNU A;  4F3L A;  4JGR A;  1YSF A;  1F5M A;  3CWF A;  3B42 A;  3O5Y A;  5DKL A;  1BYW A;  5HWW A;  4ETX A;  5J4E A;  3NOP C;  3BQA A;  2J3T D;  2VKS A;  5F6A A;  2P08 A;  4GW9 A;  3EEA A;  3BWL A;  2ZOH A;  2LB9 A;  3UME A;  5HDD A;  1ZTU A;  3VOL A;  3R7W B;  2KDK A;  2QKP A;  3KSI A;  3BY9 A;  3DBA A;  2VZW A;  3MR0 A;  3LI9 A;  4EUV A;  3RH8 B;  2LB5 A;  1UWP X;  2W1T A;  1G6O A;  4MN7 A;  5HD5 A;  4CLC C;  4JDM A;  1S4R A;  3UE6 A;  5AJG A;  4MCW A;  3T4O A;  4ARZ A;  5HZH A;  4G3W A;  4PAU A;  1YFB A;  2XSS A;  4L9F A;  4BBU A;  3LIB A;  1NWZ A;  2XRN A;  2V1B A;  3K3D A;  4MN5 A;  4M4X A;  2EWW A;  2GX5 A;  1TD5 A;  4FSF A;  4PKY G;  2CMN A;  4CLC A;  1Y28 A;  4HP4 A;  4MDZ A;  2HJ9 C;  2B18 A;  3MQ0 A;  2V0W A;  4UQI S;  4HJ3 A;  3IBR A;  2W0N A;  3E4Q A;  5J3W A;  4YOF A;  3EGD C;  2RO5 A;  3F1N A;  1XJ2 A;  3OLO A;  1NRJ A;  2JKT I;  3F1P A;  3CUE C;  4NXG A;  3ICY A;  4AFI A;  3C8C A;  4GS9 B;  4NEE D;  4Y3I A;  2L1M A;  3OCL A;  3D72 A;  3PHY A;  4B93 A;  2OWJ A;  3E4P A;  4I3I A;  4P6Z S;  4WL9 A;  5DFX A;  3RTY A;  4HOI A;  4I39 A;  2XA7 S;  5KIZ A;  5IU1 A;  4LRX C;  3EWK A;  1OPX A;  3CUE A;  3EGX C;  3CLO A;  2JHE A;  4HI4 A;  1D7E A;  1YSP A;  1YKD A;  1WA9 A;  3KSG A;  4KUK A;  4WEK A;  2PHY A;  4HNB A;  3PBO A;  3G6O A;  1P9R A;  2VV8 A;  3FPW A;  3U2A A;  2GNX A;  2J3T C;  4LLO B;  2PYP A;  1TS7 A;  3MFX A;  3TRC A;  3S7N A;  3R7W A;  3K2N A;  1W63 Q;  1P0Z A;  2OAP 1;  2XRO A;  5C5K A;  2MJ6 A;  2QJ5 A;  3OCN A;  4HIA A;  3VV4 A;  2IA2 A;  3H7W B;  3CAX A;  3NOU C;  3S7P A;  5FL3 A;  2EWV A;  1KOU A;  2NUP C;  3CI6 A;  5L8M A;  1IFQ A;  3R4K A;  4NKP A;  3LID A;  4GCZ A;  1T19 A;  2JKT M;  1DP8 A;  3PR6 A;  3FPV A;  3PBN A;  4IHQ A;  4DJ2 A;  1S1Z A;  4KUO A;  2W3D A;  5AVF A;  2P7J A;  3EQU A;  4WLA A;  1T1C A;  3UMD A;  2ZBB A;  2O99 A;  4QPR A;  1MVF D;  4L0L A;  4I3A A;  3LUQ A;  4RQ9 A;  4GS9 A;  3NJA A;  4LRZ E;  3LR0 A;  5HSQ A;  5HD3 A;  4KQO A;  2VGL S;  3MF0 A;  2H28 A;  2HJE A;  2D01 A;  3LYX A;  4NXB A;  4NXF A;  2KOI A;  4DMZ A;  4IUH A;  4EXO A;  2KX6 A;  3TW8 A;  3T4S A;  4EEU A;  1YSQ A;  3PBQ A;  1N9L A;  2BAS A;  2JN7 A;  4Y2F A;  2D02 A;  3OC2 A;  5HDS A;  4NXE A;  3UB7 A;  1N9O A;  2Z6D A;  2P04 A;  4EER A;  3EEH A;  1ODV A;  3TJZ C;  5KSH A;  1OJ5 A;  3UB6 A;  2ZOI A;  2WKQ A;  2ZMF A;  4II7 A;  5F68 A;  5AVE A;  3GDI A;  4WF0 A;  4Q0I A;  2EA9 A;  3W2Z A;  3BJN A;  4LRY C;  1H8M A;  2PR5 A;  2VX8 A;  3H9W A;  3GEC A;  4XT2 B;  3H7W A;  5HPF A;  2YKF A;  1UWN X;  3PBS A;  4BBT A;  4FOF A;  5HWV A;  2V0U A;  2PR6 A;  4HJ6 A;  5HPI A;  4MMN A;  3PBT A;  1GSV A;  2PD8 A;  4YNR A;  3OOV A;  2B02 A;  3A0S A;  4WUJ A;  3HCY A;  4HH3 A;  1IOU A;  3TND B;  2W27 A;  3UB9 A;  4IUK A;  4HP9 A;  2HGV A;  2M7U A;  3P01 A;  5G4Z A;  2INW A;  1NLZ A;  4H6J B;  1V9Y A;  1F9I A;  5A8B A;  3S7Q A;  5ITJ A;  4BWI A;  3IS2 B;  1OTD A;  5HWT A;  3TE8 A;  2Y79 A;  3LIC A;  3BW6 A;  2VV6 A;  4L9G A;  3LFV A;  3V67 A;  3LR4 A;  3FC7 A;  2K1N A;  2VEA A;  2RO4 A;  3OBF A;  4UQI M;  5ITM A;  2A2L A;  1S4S A;  1XJ6 A;  3E0Y A;  2JKR M;  4OOL A;  2O0Y A;  2PD7 A;  3PBR A;  5LBR A;  3PXP A;  4HQA A;  4IJG A;  3MJQ A;  4Q0J A;  4KQD A;  1LSW A;  1TS8 A;  1T18 A;  2K31 A;  4HJ4 A;  4R3A A;  2W3E A;  1D06 A;  2O9C A;  3T4T A;  3A0V A;  5IT5 A;  4ZRR A;  2L66 A;  2GLW A;  5J7E A;  1LT0 A;  4GJ4 A;  3LIE A;  4EEP A;  3KSF A;  3KYQ A;  1EW0 A;  4JGP A;  1T1B A;  4GHI B;  4P6Z M;  5EFW A;  2W3G A;  3HJI A;  4EET B;  1DP6 A;  2XA7 M;  3B33 A;  2Y8H A;  3HJK A;  4PKY A;  4Y5F A;  2V1A A;  2VA0 A;  4I38 A;  4XT2 A;  1T1A A;  3P7N A;  1OTE A;  1TS6 A;  2O9B A;  1OJG A;  2FY9 A;  3C30 A;  5DJU A;  5F5Y A;  1V9Z A;  4O01 A;  2GZA A;  2M1C A;  2A24 B;  3H82 B;  3T4J A;  3IBJ A;  5DKK A;  1UGU A;  5MC7 A;  3BQ8 A;  3C2W A;  3EOI A;  1LSX A;  3ULF A;  1OTA A;  3PYP A;  3E4O A;  4CLC E;  2QJ7 A;  2FH5 A;  3B47 A;  2KLI A;  4R6L A;  2R78 A;  4Q0H A;  1H3Q A;  5DJT A;  2Z6C A;  4H6J A;  2PT7 A;  5TJJ A;  4DN0 A;  3LIF A;  4DJ3 A;  2VV7 A;  4E04 A;  3IS2 A;  3RFB A;  1XJ4 A;  2DMW A;  1DRM A;  4BMW A;  1MC0 A;  3UB8 A;  2QHK A;  3UE3 A;  4ETZ A;  1LL8 A;  1S67 L;  2JKR I;  4BJP A;  2L0W A;  1DP9 A;  1OT9 A;  2WKP A;  4G3V A;  3JVV A;  2OWH A;  3LR3 A;  1UB4 C;  4WEL A;  2QYB A;  2ZMV A;  2L4R A;  3K3C A;  3VE3 A;  1VB6 A;  4K08 A;  3T50 A;  4EW7 A;  2K2N A;  2OOL A;  4EES A;  3D3O A;  3T4L A;  4O8G A;  2HV1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...