2W1TB

Crystal structure of b. subtilis spovt
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
173
structure length
173
Chain Sequence
GIVRRIDDLGRVVIPKEIRRTLRIREGDPLEIFVDRDGEVILKKYSPISELGDFAKEYADALYDSLGHSVLICDRDVYIAVSGSSKKDYLNKSISEMLERTMDQRSSVLESDAKSVQLVNGIDEDMNSYTVGPIVANGDPIGAVVIFSKDQTMGEVEHKAVETAAGFLARQME
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords STAGE V SPORULATION PROTEIN T
publication title Crystal Structure of Spovt, the Final Modulator of Gene Expression During Spore Development in Bacillus Subtilis
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Transcription
total genus 39
structure length 173
sequence length 173
ec nomenclature
pdb deposition date 2008-10-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF04014 MazE_antitoxin Antidote-toxin recognition MazE, bacterial antitoxin
B PF15714 SpoVT_C Stage V sporulation protein T C-terminal, transcription factor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.260.10 Mainly Beta Ribbon Pemi-like Protein 1; Chain: D Pemi-like Protein 1; Chain: D 2w1tB01
3.30.450.40 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2w1tB02
2GX5A 5ITJA 2OOLA 1F5MA 2O9AA 4Y5FA 2VEAA 2VZWA 4LRXC 4MMNA 3MF0A 3S7OA 3KSHA 4GW9A 2XSSA 5DFXA 2K1NA 3NHQA 4IJGA 4ETZA 2M7UA 5HSQA 2KLIA 2W3HA 1YSPA 5HL6A 4G3VA 2O0YA 1MKMA 2K2NA 1TF1A 1YSFA 3C2WA 3D3OA 4CQHA 3E98A 3KO6A 4EUVA 2RO5A 5HPIA 4G3WA 4LRYC 4O8GA 2HGVA 3S7NA 2L66A 2G7UA 4Z1WA 2M7VA 4MDZA 5ITMA 4Q0HA 2VJWA 1ZTUA 3IBRA 5C5KA 5K5BA 2W3GA 3S7QA 2RO4A 2O9CA 2O99A 3G6OA 4MCWA 3NOTC 4Q0IA 4Y3IA 2W3DA 2QYBA 2VKSA 1YSQA 3O5YA 3TNDB 2ZMFA 2Y79A 3KSGA 2KOIA 3E0YA 4R6LA 3ZQ5A 3KSIA 2XROA 1Z0RA 3BJNA 3CITA 2W3FA 4DMZA 4O01A 4BWIA 3IBJA 2W1TA 4MN7A 4PAUA 1MC0A 4GLQA 1MVFD 1TD5A 3S7PA 4YOFA 3K2NA 3CI6A 4IUHA 2W1TB 3LFVA 4R70A 3TRCA 1VHMA 3R4KA 2IA2A 4ETXA 5DFYA 3NOPC 3W2ZA 1STZA 4LRZE 2W3EA 1YKDA 2RO3A 4RQ9A 1UB4C 3HCYA 4G3KA 4O0PA 3EEAA 4Q0JA 2W1RA 3MMHA 4E04A 2B18A 4ME4A 3OBFA 5I5LA 3DBAA 2Y8HA 4Y2FA 4FOFA 4DN0A 3O27A 3OOVA 2K31A 3VV4A 4ZRRA 4EU0A 3RFBA 3NOUC 2O9BA 5LBRA 3KSFA 5TJJA 2LB5A 5HPFA 4QPRA 2GLWA 4IUKA 1YFBA 4YNRA 5AJGA 5L8MA 2XRNA 3MQ0A 2LB9A 2FY9A
chains in the Genus database with same CATH superfamily
1ALQA 4KG6A 4X55A 1HLUP 1T1AA 4GNUA 3S7OA 4OQ0A 1S6RA 1XA7A 1OTAA 4S2IA 2V8CA 1PI5A 3A3DA 3BFFA 3D3OA 4R3AA 2HPBA 3KO6A 3UMDA 4HBUA 1KDWA 1K57C 4E3NA 3QNBA 2W27A 2ZC7A 1W63Q 3CLOA 2VKSA 4GD6A 2Y91A 1HVBA 2ZMFA 3H7WA 3ITBA 3EQUA 2KOIA 2C6WB 4JXVA 3OLOA 4HI4A 2XROA 3CITA 3MZEA 4GD8A 3MZFA 3OPRA 4B93A 4PM6A 3OZHA 1BLPA 4R4SA 5CTNA 4GLQA 3DTEA 1ZG6A 2C5WB 5FDHA 4LLOB 2ZC6B 4II7A 5MC7A 3F1NA 5DFYA 4KZ5A 2WYXA 4LCLA 3FKWA 5EPHA 1BSGA 5HAQA 3WRZA 2OAQ1 2NUTC 1NZOA 1MZUA 2Z2MB 4FOFA 3G2YA 2D02A 4E3IA 4DDYA 3P09A 5FAOA 4IBXA 5EE8A 3VOYA 1NXYA 2XGNA 5CEDA 1T1CA 2VX8A 3B33A 5AJGA 5L8MA 5FEGA 4LV2A 2O9AA 3HLCA 2NUPC 2PR5A 1PZOA 3T1RA 2Z2LB 3T12B 2J3TD 2B5RA 3NULA 4HP9A 1DJCA 4ZTKA 1SDEA 4I3IA 2HJ9C 3HLFA 1K54A 1TDLA 4M4XA 1N4OA 3LEQA 5L2FA 3C4OA 3BM6A 3GQZA 1N9NA 3HLWA 3G2ZA 1ZTUA 3IBRA 3ZDJA 2ZOHA 1KDSA 3UNWA 1L3LA 1L0DA 2PRFA 2Y2KA 1MXOA 3TNDB 1F2KA 1SKOA 4N1XA 1BZAA 1JVJA 4PMAA 3NI9A 4LV0A 3IBJA 2FH5A 5HDDA 1I5QA 2P9VA 3D9YA 4GS9A 4KUKA 5EVID 3RXXA 3CI6A 5FQKA 4EXOA 3UE6A 5M18A 4F3LB 2ZM0A 1TVFA 3PTEA 1N9OA 1O07A 3ZHHA 2FFFB 5A92A 5AQAA 3UE1A 3WS5A 4QWOA 4ZJ1A 3T1XA 4NEED 5EOEA 2WKHA 3I7JA 4Z9QA 3C4PA 3U4LP 1CF0A 4S2JA 4ZJ2A 1S1YA 2JN7A 5CX7A 3ZCZA 1DJAA 1YLYA 5HZHA 2XRNA 4Y17A 2OOLA 4ZAMA 3T4LA 1DP9A 4QHCA 5DFXA 3NHQA 2WAEA 3VP2A 1YQSA 3L7HA 1V9YA 1OJ5A 1QMEA 2A24B 1TF1A 3AGEA 3H82B 2J3WA 2W0NA 5KSCA 1Q2QA 2HGVA 4JGRA 5F6AA 4B4ZA 5A90A 3LIBA 4U0XA 4P85A 3IWIA 2JKGA 4NG2A 2HP9A 1VEUA 4CLCE 1FSWA 4FD8A 4P6ZS 3R7WA 4KG2A 3LIAA 3ZG8B 3IF6B 4N9KA 1BUEA 2R78A 1VETA 3K3DA 3PBOA 1Z6FA 3CPTA 3G35A 4YOFA 4D60A 4IHQA 2HP5A 2V20A 4KZ8A 5A91A 3IWOA 5KIZA 2IA2A 4BD0A 3EGXC 4ARZA 1MWUA 3NOPC 1BULA 1UWPX 3W2ZA 1YLWA 4YFMA 3TOIA 2V1BA 1DRMA 2X71A 3V3RA 3G34A 3ZNTA 2Q9MA 3UPOA 4WEKA 1NYMA 1XGIA 4EQ1A 3O27A 1XFQA 5KZHA 4FTXA 1KOUA 4XXRA 1C3BA 3MXQA 2LB5A 1QMFA 1MBLA 1ESUA 4JGOA 1CEGA 5F83A 2K7SA 4NXFA 3CMZA 3VP1A 3RXWA 1K6RA 4KZ3A 5DF9A 3FPWA 4Y5FA 3UDFA 5L10A 5DTTA 2Y4AA 3BLSA 4WF0A 4DE2A 2V0UA 4NXBA 2Y2MA 1MWRA 4QY6A 5CHUA 5GLBA 5IU1A 1OTEA 5KSHA 1OTDA 2Y2OA 3LR5A 1XJ6A 5C5KA 3PXPA 1CK3A 1YAXA 2PR6A 3MQQA 4MCWA 3NOTC 4DXBA 1ERMA 2KX6A 4GDBA 1UGUA 5HDCA 3IF6A 1MWSA 4JDOA 4BMWA 3EEHA 3BQ8A 2WKQA 4MN7A 5GLAA 4MBHA 5HD3A 3S7PA 4GB7A 4Q8IA 2QA4I 3W4OA 2Q0OA 3SH7A 1L0FA 2XDMA 3DAVA 3LICA 3AGDA 5FQIA 3TSGA 5FI6A 1P0ZA 2PHYA 1I2WA 1KGEA 4L9FA 2ZM2A 3S22A 4S2LA 3ULFA 1XP4A 2H5SA 3NOUC 3LIDA 4JPMA 4OP5A 4N9LA 1ZG4A 4BJPA 3OPLA 5EM0A 2PYPA 3MFDA 1OT6A 4PKYG 3C8CA 4QY5A 4GW9A 3UB6A 4NK3A 5HL6A 2XH9A 1IYSA 1FSYA 4NXGA 3BFCA 3NECA 3C2WA 4LCMA 5F68A 1EROA 3PBSA 4LRYC 1T1BA 2PU4A 3BEBA 3U2AA 4L9GA 2BG1A 2XR0A 2Y59A 2HDUA 2J3TC 1SZVA 1K0KA 3FG8A 4RVAA 1XJ2A 1VQQA 4HBTA 5D3OA 3FZCA 3HREA 5EFWA 3DTMA 3SS4A 3MBZA 4FCFA 3NC8A 1BLHA 1JTGA 4GDNA 2JHEA 3FC7A 4GN2A 5EVEA 3K2NA 5F1GA 3VOLA 3KX0X 4C75A 1XFNA 4UHUA 5HFOA 4ETXA 5TR7A 4WELA 4AFIA 4PM8A 4X6TA 1F98A 4OVDA 2EA9A 4KENB 4OLDA 4KQOA 2JKRI 4OONA 2QHKA 1KE3A 4R4RA 1T19A 3QP4A 4WZ5C 3B47A 5FA7A 2BASA 1AXBA 2G2WA 3G4PA 3RTYA 5A8BA 4HY8A 1K4FA 5HARA 5EVLA 1RGYA 2FY9A 5FASA 2DNSA 4OPQA 3SZTA 2UV0E 3LR0A 2O0YA 4X68A 4Y13A 1GSXA 4Y0TA 3T1QB 1OT9A 3KYEA 2ZC4B 2P04A 2HZ5A 1JWVA 5EVIB 2L0WA 4KZ6A 3GSGA 3OC2A 4KZAA 3OPHA 3MXSA 5J3WA 2O99A 1K38A 5DKLA 1J3WA 4E3MA 2H0TA 4R3JA 2ZLYA 1KE0A 3N4IA 1S4SA 3KSGA 1ZHHB 5BOHA 5CERA 5DF8A 4P6BA 1HZOA 2VK3A 4FH2A 2ZQCA 3UO9A 2EXBA 3IH8A 3HLBA 3C5AA 2VV7A 2EWWA 4KZ7A 4OOLA 1NZUA 3VE3A 4PAUA 2ZQ9A 3LI8A 1TD5A 3LR4A 3VP0A 1PZPA 4HNBA 2V8FA 1JWZA 2XD1A 5E2HA 5GL9A 1FQGA 5CHMA 1RGZA 1FCMA 2QJ5A 4JXWA 3IS2B 3EEAA 1DJBA 3BFEA 3T4OA 1CQAA 4DDSA 1D1JA 1G6OA 2JC7A 3O88A 4I5SA 2J80A 4JGPA 1AWIA 3DTKA 3HJKA 3UPNA 3TG9A 2BLSA 4WYYA 3HLDA 5TFQA 3V67A 3LGOA 3OCLA 4HJ6A 3NIAA 4E3OA 5HX9A 1F5MA 4JDMA 4IJGA 5CGXA 2WZXA 5EVIA 4WZ5A 2J7VA 3B3XA 2OV5A 4EQIA 2I9VA 2RO5A 5DVAA 3WS4A 1MKIA 3CUEC 2RO4A 4X1MA 3G6OA 1Y28A 5CGSA 2VV8A 5TBMB 4WBGA 1GCEA 5J4EA 1TEMA 2Y79A 3E2KA 5FATA 4ZDXA 1OJGA 3QP2A 2WKPA 2VA0A 4I3AA 2XLNA 4YWZA 2QZ6A 2OLUA 1GA0A 4PKYA 1TS8A 1H5XA 5HL1A 4DJ2A 2DMWA 1S1ZA 3IS2A 3QP8A 4OH0A 5AVFA 1IKIA 4OPRA 4C3QA 4Y15A 2J8YA 2W3EA 3ZG0A 2OWHA 3T4KA 3VFHA 3LEZA 2B18A 3D72A 4KG5A 2PYRA 2PD8A 4DN0A 3OOVA 1S0WA 3AGFA 3TJZC 4EU0A 2HV1A 1LI9A 3LYXA 2X01A 4HIAA 4CPKA 1ZKJA 4ZJ3A 1PIOA 3UDXA 3V39A 4BD1A 2L4RA 2Y2HA 3TE8A 2RO3A 3M6BA 3UE3A 3VFFA 1FR6A 1BTLA 2VZWA 1PWGA 2K1NA 4EBLA 4EV4A 5HSQA 3RJUA 3PBNA 2H10A 4DE1A 1MKMA 2A2LA 3IXDA 4WMCD 1G6AA 1LL9A 1P97A 5HPIA 3NJAA 1FR1A 4JF4A 3BFGA 4GHIB 5DF7A 1Y4OA 4E6XA 5ITMA 3JYIA 5E2EA 5K5BA 1XX2A 3Q82A 5DKKA 3S7QA 4JXGA 3IF6C 4Q0IA 4S2NA 1TDGA 1FIKA 2A49A 3WS2A 1XA1A 3O5YA 4BENA 1YT4A 2Y2QA 3FYZA 3MSHA 3ZQ5A 2PD7A 1WA9A 3T4SA 4I38A 2W3FA 4OQIA 2J9PA 2QMIA 4P6ZM 1MVFD 3IHBA 4X56A 3Q07A 2D01A 5U47A 1CI8A 1KVMA 5L09A 3TRCA 1IKGA 4MEZA 1J9MA 3CUEA 4K0WA 4U0TA 3ZNYA 1YPRA 1GHPA 1ONHA 3GMWA 4F94A 3IF5A 3MMHA 5FQJA 4FUWA 3EOIA 4F3LA 3A3JA 1KGGA 2XFSA 3SS5A 4Y2FA 4OOMA 2WKRA 3ZVWA 2WKEA 3UPPA 4B9OA 5A93A 4QPRA 3UB5P 1VB6A 1YFBA 2YKHA 1YLJA 3LR3A 1DP8A 4EUZA 1MY8A 1RP5A 3FKVA 4LRXC 4MMNA 1XKZA 4QD4A 1W8QA 3PAGA 4PM9A 2YKFA 3KYZA 3NY4A 3RH8B 1XXMA 4GHIA 5FQQA 5FI7A 3G32A 3ZFZA 5JYPA 2ZJ9A 4YINA 1MWTA 3NDEA 1BYWA 4HH3A 1PWDA 2A24A 2R9WA 2ZBBA 2PAVP 3IX8A 3IXGA 5EM1A 2W3DA 3H82A 2QYBA 5HD5A 1RCJA 2WGVA 1FCOA 2Y2LA 2ZQ8A 4O7DA 5TGFA 2ZQ7A 3ZG7B 1FILA 1H8MA 5AQ9A 4H6JB 1DY6A 3F1PB 4IUHA 3LFVA 1NY0A 1GA9A 1G5UA 1VHMA 4EEPA 3LI9A 2OSUA 2EX8A 4H8RA 1LL8A 1N9BA 5CXWA 5F1FA 1X0OA 2PU2A 3MKEA 1PI4A 4CJNA 1Y54A 1I2SA 3ITAA 2W1RA 2EX6A 4HH2A 3BECA 3OBFA 2XA7S 1OMEA 4MNRA 1EWZA 4S2KA 4E3JA 1JNUA 4BLMA 2ZC3B 4UQIM 3W4QA 4S2OA 4QB8A 3B42A 1YLPA 3PYPA 1PNEA 4PPRA 4R1GA 1PFLA 4E3LA 1Q2PA 4NXEA 4P87A 4FSFA 1LSWA 3PBQA 2EFUA 4ETZA 1TS7A 1HD8A 2W3HA 3T4QA 1YSPA 3N8LA 3NCKA 4U3TA 2ACGA 4Y7PA 1S66L 1LSXA 2ZC5B 3G31A 2EWVA 4G3WA 2RCXA 5HW3A 2M7VA 4UEYA 1SDNA 2W3GA 3BW6A 2VGLS 4KQDA 1YSQA 3F1OB 4A5RA 2QKPA 4PM7A 1TS0A 2UWXA 4H6JA 1L2SA 3W4PA 3BFDA 4L9EA 3KSIA 3F1PA 2INWA 1M40A 1YM1A 3HUNA 4EERA 1MC0A 3CG5A 4LFUA 4S2PA 3MKFA 3A3FA 4HOIA 2ZL1B 3IT9A 3T4JA 4LGWA 3VE4A 2P74A 3SS3A 3Q1FA 3LUQA 2WGWB 4BBTA 5FAPA 3N7WA 4RQ9A 3FWLA 2Y2PA 1W8YA 4OOYA 4ME4A 3A3IA 1FOFA 3O87A 5DTKA 3P7NA 5G4ZA 3RFBA 2Y2JA 4HP4A 2DCFA 2O9BA 5F5YA 2Y55A 3W8KA 5G18A 2GLWA 1ES3A 4UA7A 4WL9A 4HJ3A 2HP6A 2J9OA 4KZ4A 1ERQA 1IFQA 4IVKA 3L9KA 5EVIC 4HEFA 2PBDP 1N9LA 2X02A 2JKTI 4JXSA 3ZVTA 4NETA 4CQHA 2V1AA 1NRFA 5F82A 1BLSA 3M2KA 2H28A 3HUMA 4EETB 3QP5A 1K56D 4Q0HA 3CZDA 5KMWA 3UMEA 3DWZA 3QHYA 4DXCA 2IWCA 4EWFA 4E6WA 4R3BA 4B4XA 1K55C 3SH8A 5J7EA 3BJNA 4KZ9A 4O01A 2ZL1A 5E2GA 1W63M 4HQAA 2OLVA 3GV9A 3G30A 1NRJA 4WM9A 5J8XA 2WGWA 3IH9A 1SHVA 3MQOA 3HUOA 3SW1A 4XUXA 1V9ZA 3R4KA 3UN7A 1E4DA 1GHIA 3HLEA 4UA9A 1M6KA 1ZC2A 2EX2A 4WUJA 1UWNX 3IWQA 2VGJA 3PBRA 1YMXA 5HAPA 1H8YA 3TW8A 2Y2NA 3DW0A 2Q9NA 1HTZA 5TJJA 3SOIA 3BRMA 1G68A 1OTIA 4RX3A 3M2JA 2XEPA 3UB8A 4KQQA 1E3UD 1A0KA 1JTDA 3JPUA 2AVXA 4XUZA 2GX5A 1K4EA 4CLCD 5HWWA 3C30A 2XSSA 4HHDA 2M7UA 5HDSA 4G3VA 3LO7A 4ZBEA 4K91A 1NJ4A 3D4FA 1D06A 3VOZA 4EUVA 4X1LA 3LCEA 1SKOB 3C7UA 3C38A 4S2NC 4QJGA 2E8IA 2M1CA 3LIEA 2VJWA 1L0GA 5GLDA 2RL3A 4L0LA 3VSLA 2P9VB 4GS9B 2GZAA 4X69A 3A0SA 3CAXA 3VP3A 3O3VA 4K08A 4R6LA 5EV0A 5CTMA 2EXAA 2WADA 2QPNA 1Z0RA 2ZMVA 4DRTA 5F69A 4MN6A 3V50A 2QJ7A 3FPVA 4MBFA 1E25A 2PT7A 3BLMA 3ICYA 4BBUA 2WZZA 3QP1A 1MPLA 2IWDA 5DJUA 4WMCA 4G3KA 4XT2B 4Q0JA 1K55A 4E04A 4KQRA 4ID4A 3T1SA 1BLCA 4GOGA 2P7JA 1OPXA 5CECA 3H9WA 3IHAA 3JVVA 5DJTA 2V2FF 1EI5A 5GHZA 1WE4A 3MJQA 4OKPA 3MQ0A 2MJ6A 5ITJA 4QU3A 1CEFA 1PRQA 1WYCA 2I72A 1VM1A 1Z09A 3CHWP 3UB7A 5IS1A 5GLCA 3UDIA 1BT5A 3E98A 1VEUB 4GKUA 4OPYA 4OP8A 4JF5A 2V0WA 3NBLA 4DF6A 1K6SA 2VV6A 3R7WB 2ZMAA 3V3SA 5HWVA 2L66A 2G7UA 3IX4A 1PW1A 2O9CA 1T18A 1LHYA 1K57A 1KE4A 4Y3IA 3WS0A 1VETB 3HLGA 1ACFA 3CPTB 5FL3A 2PDRA 4IVIA 4LV1A 1YLZA 3C7VA 3IQAA 2B95A 3WS1A 4ARZB 5CEBA 5TBMA 2PBYA 3A3EA 5L07A 1SCWA 3S4XA 1NLZA 1ES5A 3PBTA 2GDNA 4XT2A 2JCHA 1TS6A 1XJ4A 1UB4C 3PHYA 1F9IA 5AQBA 3A0RA 1NWZA 1P9RA 3MXRA 3QNCA 3UY6A 5I5LA 2Y8HA 1LL5A 3FV7A 4N1HA 3VV4A 4X25A 4EEUA 4RX2A 2H0YA 2WKIA 3GTCA 3NDGA 3QP6A 4LV3A 5CHJA 5FEFA 4IUKA 3MFXA 3Q7ZA 5FDSA 4YNRA 5FAQA 5GHXA 3N8SA 1ESIA 1K25A 1GHMA 3ZGAB 3MF0A 3EGDC 3S1YA 2KLIA 2EX9A 1ONGA 2HJEA 2VGKA 1YSFA 3K3CA 1WYBA 1EW0A 1H3QA 3LY4A 3HVFA 5FQ9A 3Q81A 2R9XA 4UAAA 1YMSA 3ISGA 1IYQA 1S4RA 4Z1WA 4EBNA 2B02A 3MR0A 4PHTA 4RYEA 1G28A 4OPZA 4E3KA 3LY3A 2GJ3A 2OWJA 2ZM8A 2V9AA 4LPZA 3V5MA 2QWSA 3ZYTA 3JVUA 2FFYA 3BYDA 1D7EA 1PW8A 5HWTA 4MN5A 1FCNA 4R0QA 4HESA 5EECA 4GCZA 3BWLA 1LSVA 2W1TB 4BL3A 3P01A 3CJMA 1ODVA 3E4OA 1GSWA 1ES4A 2WAFA 4OLGA 5FI2A 4LRZE 3E4QA 5E43A 3BY8A 5E2FA 2HDRA 4IEDA 1CJFA 3ZG5A 3DBAA 2WK0A 4FH4A 4Y0UA 3VP4A 5CGWA 5LBRA 4S2MA 3KSFA 3IX3A 4ESPA 5HPFA 4P0MA 2XA7M 2Y2IA 2ZQAA 4UA6A 1H0MA 4DJ3A 1W7FA 5IT5A 4IBRA 3BQAA 3GVBA 1L0EA 1KGFA 1DP6A 2VLGA 3GDIA 2EFXA 2WUQA 4JBFA 2XFTA 5FQMA 5I94A 2VEAA 2A3UA 3A0VA 2JBFA 4X53A 1XJ3A 3E2LA 2JE5A 3SH9A 3KYQA 3WWXA 4PM5A 4JKTA 2JKFA 4K0XA 4WLAA 4O8GA 5AVEA 3S7NA 4CLCC 2ZD8A 1YLTA 1S67L 4JGQA 4GJ4A 2Z6DA 2ZOIA 4D2OA 1IEMA 2GNXA 5EUAA 3E0YA 5IHVA 4EBPA 4R23A 3OPPA 2VGLM 4DMZA 4I39A 4UQIS 4BWIA 2W1TA 3E4PA 4WN5A 4N92A 1IYPA 4DE3A 1H8ZA 1LT0A 5EOOA 1IOUA 5AQ7A 1NLYA 5M19A 2FZ0A 4KUOA 3T50A 1W5DA 3OCNA 4CLCB 1SKFA 2HDSA 1YKDA 3HCYA 4JF6A 4R38A 4O0PA 2WGIA 4MLLA 4BQMA 3Q7VB 5GHYA 1LI0A 1O7EA 3T4TA 3GRJA 2L1MA 4LENA 1K56A 4WEJA 4EESA 4RA7A 2P08A 4Y0OA 2XD5A 3UB9A 4DE0A 3LIFA 3O86A 5DTSA 1PYYA 2LB9A 1KVLA 2DRWA 3KSHA 2E8JA 1JWPA 3GECA 4OQGA 3UE0A 1P9WA 5M1AA 3WRTA 3MS6A 2K2NA 3EWKA 2Y2GA 1LLBA 3BY9A 2KDKA 3IXBA 2ZQDA 2JKRM 3CWFA 4BL2A 2BTFP 5HAIA 3DTIA 3ZG9B 4WZ4A 2XQZA 3N8RA 4MDZA 3N6IA 1IYOA 2JKTM 1W79A 5JYOA 2Z6CA 4HJ4A 3MZDA 4MBKA 3PR6A 1XGJA 1OTBA 2HDQA 3M6HA 3H7WB 1NYYA 4BBVA 3HL9A 3IXHA 2CC1A 1GSVA 3VMAA 3F1OA 1E3UA 5FSRA 4GZBA 4CLCA 1PWCA 4R70A 4KZBA 2IWBA 1IELA 3EQVA 5G4YA 4JLFA 3Q7VA 4EW7A 1U60A 1STZA 1ES2A 4NKPA 2G2UA 3F1NB 2XF3A 1CI9A 2XK1A 5CRFA 4OQHA 4DKIA 4C6YA 2K31A 3DWKA 4B88A 4ZRRA 2V1ZA 3VSKA 3GR2A 1K54C 3HBRA 4M3KA 3HJIA 2OAP1 2HF6A 4I3JA 1XPBA 3P98A 2CMNA 3PAEA
chains in the Genus database with same CATH topology
1DP8A 5ITJA 2PYPA 4PKYG 1OT6A 3C8CA 1T1AA 4LRXC 4MMNA 3S7OA 4GW9A 3UB7A 3UB6A 5HL6A 5IS1A 1OTAA 2YKFA 3KYZA 3RH8B 4NXGA 4GHIA 3C2WA 3D3OA 4R3AA 3E98A 3KO6A 5F68A 3UMDA 2V0WA 3PBSA 4LRYC 1T1BA 2VV6A 3R7WB 5HWVA 2L66A 2G7UA 3U2AA 4L9GA 1BYWA 2W27A 1W63Q 4HH3A 2J3TC 2O9CA 2A24A 2ZBBA 1T18A 4Y3IA 2W3DA 3CLOA 2QYBA 3FG8A 3H82A 2VKSA 5HD5A 1XJ2A 5FL3A 2ZMFA 3H7WA 3EQUA 2KOIA 2PDRA 3OLOA 5EFWA 4HI4A 2XROA 3CITA 1H8MA 4ARZB 4B93A 4H6JB 5TBMA 2JHEA 4GLQA 3FC7A 3F1PB 3K2NA 3VOLA 4IUHA 3LFVA 3KX0X 4LLOB 1XFNA 1VHMA 4EEPA 4II7A 3LI9A 1NLZA 5MC7A 3PBTA 3F1NA 4XT2A 4ETXA 1LL8A 5DFYA 4WELA 4AFIA 1TS6A 1X0OA 1F98A 1XJ4A 1UB4C 3PHYA 2EA9A 1F9IA 3A0RA 1NWZA 1P9RA 2W1RA 4HH2A 4KQOA 2JKRI 3OBFA 2QHKA 5I5LA 2OAQ1 2NUTC 1T19A 2XA7S 1MZUA 2Y8HA 3B47A 4FOFA 2D02A 2BASA 3VV4A 1JNUA 4EEUA 4UQIM 3RTYA 5A8BA 3B42A 1T1CA 4HY8A 2VX8A 3B33A 3PYPA 4IUKA 3MFXA 4YNRA 5AJGA 5L8MA 2FY9A 4NXEA 2O9AA 4FSFA 1LSWA 2NUPC 2PR5A 3MF0A 3PBQA 3EGDC 4ETZA 1TS7A 2KLIA 2W3HA 2J3TD 3T4QA 1YSPA 4HP9A 3LR0A 2O0YA 2HJEA 3K3CA 1YSFA 1GSXA 1S66L 4I3IA 1OT9A 2HJ9C 1EW0A 1H3QA 2P04A 1LSXA 2EWVA 2L0WA 4G3WA 4M4XA 1S4RA 3OC2A 1N9NA 4Z1WA 2M7VA 2B02A 3MR0A 4UEYA 4PHTA 1ZTUA 3IBRA 2ZOHA 2W3GA 5J3WA 1G28A 2O99A 5DKLA 3BW6A 2VGLS 4KQDA 1YSQA 3F1OB 2GJ3A 3TNDB 2QKPA 1S4SA 2OWJA 3KSGA 1ZHHB 1TS0A 2V9AA 4LPZA 4H6JA 4L9EA 2QWSA 3KSIA 3F1PA 3ZYTA 2INWA 2VV7A 3JVUA 2EWWA 3IBJA 1D7EA 4OOLA 2FH5A 5HDDA 4EERA 5HWTA 4MN5A 3VE3A 4PAUA 1MC0A 3LI8A 4GS9A 1TD5A 3LR4A 4KUKA 4HNBA 4GCZA 3CI6A 3BWLA 4EXOA 1LSVA 3UE6A 2W1TB 3P01A 4HOIA 4F3LB 1ODVA 3E4OA 1GSWA 1N9OA 3T4JA 3VE4A 2QJ5A 3LUQA 4BBTA 4LRZE 3E4QA 3IS2B 4RQ9A 3EEAA 3BY8A 4NEED 4ME4A 3T4OA 3DBAA 1G6OA 3P7NA 4I5SA 2J80A 4JGPA 3HJKA 5G4ZA 1S1YA 3RFBA 4HP4A 2O9BA 5LBRA 5F5YA 2JN7A 3KSFA 5CX7A 5HPFA 2XA7M 2GLWA 3V67A 4WL9A 5HZHA 4HJ3A 4DJ3A 2XRNA 5IT5A 3OCLA 3BQAA 4HJ6A 1DP6A 2VLGA 3GDIA 2OOLA 3T4LA 1DP9A 1IFQA 1F5MA 4JDMA 2VEAA 3A0VA 5DFXA 3NHQA 4IJGA 1XJ3A 1V9YA 1N9LA 1OJ5A 2A24B 1TF1A 2JKTI 4CQHA 3H82B 2J3WA 2W0NA 2V1AA 2I9VA 3KYQA 2RO5A 4WLAA 4O8GA 2HGVA 4JGRA 5F6AA 2H28A 5AVEA 3S7NA 4CLCC 4EETB 3LIBA 1S67L 4Q0HA 4JGQA 3CUEC 3UMEA 4GJ4A 2RO4A 3G6OA 1Y28A 2Z6DA 2VV8A 5TBMB 4CLCE 2ZOIA 5J4EA 2Y79A 2GNXA 4P6ZS 3R7WA 5J7EA 3E0YA 1OJGA 3BJNA 2WKPA 2VGLM 4DMZA 3LIAA 4I39A 4O01A 4UQIS 2VA0A 4BWIA 2W1TA 3E4PA 4WN5A 4I3AA 1W63M 2R78A 1LT0A 3K3DA 1IOUA 4YWZA 4HQAA 3PBOA 4YOFA 4IHQA 1NRJA 4PKYA 1TS8A 3MQOA 1NLYA 4DJ2A 2DMWA 1S1ZA 3SW1A 1V9ZA 2FZ0A 3IS2A 4KUOA 3R4KA 3T50A 5KIZA 2IA2A 5AVFA 3EGXC 4ARZA 3OCNA 3NOPC 4CLCB 1UWPX 3W2ZA 2W3EA 1YKDA 2OWHA 3HCYA 3T4KA 2V1BA 4R38A 4O0PA 4WUJA 1DRMA 1UWNX 2B18A 3D72A 3PBRA 4WEKA 2PYRA 3T4TA 2PD8A 3TW8A 4EQ1A 4DN0A 3O27A 1XFQA 3OOVA 2L1MA 1KOUA 3TJZC 4EU0A 2HV1A 3MXQA 3LYXA 4HIAA 4WEJA 5TJJA 2LB5A 4EESA 1OTIA 2P08A 4JGOA 3UB9A 3LIFA 3UB8A 2K7SA 2L4RA 2LB9A 4NXFA 3TE8A 2RO3A 2GX5A 3UE3A 4CLCD 5DF9A 3FPWA 5HWWA 4Y5FA 3C30A 2VZWA 3KSHA 2XSSA 4HHDA 2K1NA 2M7UA 5HSQA 3GECA 5HDSA 4G3VA 4WF0A 1P9WA 3PBNA 1MKMA 2K2NA 3EWKA 2A2LA 2V0UA 4NXBA 1D06A 3BY9A 2KDKA 4EUVA 5IU1A 1P97A 2JKRM 3CWFA 3NJAA 5HPIA 1OTEA 5KSHA 4GHIB 1OTDA 3C38A 4MDZA 5ITMA 2M1CA 3LIEA 3LR5A 1XJ6A 2VJWA 5C5KA 5K5BA 3PXPA 1YAXA 2PR6A 5DKKA 3S7QA 3MQQA 2JKTM 4MCWA 3NOTC 4Q0IA 4L0LA 2KX6A 3O5YA 4GS9B 1UGUA 2GZAA 2Z6CA 4HJ4A 3A0SA 3CAXA 5HDCA 4JDOA 4K08A 4R6LA 2PD7A 1WA9A 3PR6A 3ZQ5A 1OTBA 3T4SA 4BMWA 4I38A 3EEHA 1Z0RA 2ZMVA 2W3FA 3H7WB 5F69A 4MN6A 3BQ8A 4BBVA 2QJ7A 3FPVA 2WKQA 1GSVA 4MN7A 4P6ZM 1MVFD 3F1OA 5HD3A 3S7PA 2D01A 4CLCA 2PT7A 4R70A 3TRCA 3EQVA 2QA4I 5G4YA 3ICYA 3CUEA 4BBUA 4EW7A 1STZA 3LICA 5DJUA 4NKPA 4G3KA 3F1NB 4XT2B 4Q0JA 1P0ZA 3MMHA 4E04A 2PHYA 3EOIA 4F3LA 4L9FA 4Y2FA 4OOMA 2WKRA 2K31A 3ULFA 4ZRRA 2P7JA 1OPXA 3NOUC 3H9WA 3HJIA 3LIDA 2OAP1 3JVVA 5DJTA 2HF6A 4I3JA 4B9OA 4BJPA 4QPRA 1VB6A 1YFBA 2YKHA 3MJQA 3MQ0A 2MJ6A 2CMNA 3LR3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GX5 A;  5ITJ A;  2OOL A;  1F5M A;  2O9A A;  4Y5F A;  2VEA A;  2VZW A;  4LRX C;  4MMN A;  3MF0 A;  3S7O A;  3KSH A;  4GW9 A;  2XSS A;  5DFX A;  2K1N A;  3NHQ A;  4IJG A;  4ETZ A;  2M7U A;  5HSQ A;  2KLI A;  2W3H A;  1YSP A;  5HL6 A;  4G3V A;  2O0Y A;  1MKM A;  2K2N A;  1TF1 A;  1YSF A;  3C2W A;  3D3O A;  4CQH A;  3E98 A;  3KO6 A;  4EUV A;  2RO5 A;  5HPI A;  4G3W A;  4LRY C;  4O8G A;  2HGV A;  3S7N A;  2L66 A;  2G7U A;  4Z1W A;  2M7V A;  4MDZ A;  5ITM A;  4Q0H A;  2VJW A;  1ZTU A;  3IBR A;  5C5K A;  5K5B A;  2W3G A;  3S7Q A;  2RO4 A;  2O9C A;  2O99 A;  3G6O A;  4MCW A;  3NOT C;  4Q0I A;  4Y3I A;  2W3D A;  2QYB A;  2VKS A;  1YSQ A;  3O5Y A;  3TND B;  2ZMF A;  2Y79 A;  3KSG A;  2KOI A;  3E0Y A;  4R6L A;  3ZQ5 A;  3KSI A;  2XRO A;  1Z0R A;  3BJN A;  3CIT A;  2W3F A;  4DMZ A;  4O01 A;  4BWI A;  3IBJ A;  2W1T A;  4MN7 A;  4PAU A;  1MC0 A;  4GLQ A;  1MVF D;  1TD5 A;  3S7P A;  4YOF A;  3K2N A;  3CI6 A;  4IUH A;  2W1T B;  3LFV A;  4R70 A;  3TRC A;  1VHM A;  3R4K A;  2IA2 A;  4ETX A;  5DFY A;  3NOP C;  3W2Z A;  1STZ A;  4LRZ E;  2W3E A;  1YKD A;  2RO3 A;  4RQ9 A;  1UB4 C;  3HCY A;  4G3K A;  4O0P A;  3EEA A;  4Q0J A;  2W1R A;  3MMH A;  4E04 A;  2B18 A;  4ME4 A;  3OBF A;  5I5L A;  3DBA A;  2Y8H A;  4Y2F A;  4FOF A;  4DN0 A;  3O27 A;  3OOV A;  2K31 A;  3VV4 A;  4ZRR A;  4EU0 A;  3RFB A;  3NOU C;  2O9B A;  5LBR A;  3KSF A;  5TJJ A;  2LB5 A;  5HPF A;  4QPR A;  2GLW A;  4IUK A;  1YFB A;  4YNR A;  5AJG A;  5L8M A;  2XRN A;  3MQ0 A;  2LB9 A;  2FY9 A; 
#chains in the Genus database with same CATH topology
 1ALQ A;  4KG6 A;  4X55 A;  1HLU P;  1T1A A;  4GNU A;  3S7O A;  4OQ0 A;  1S6R A;  1XA7 A;  1OTA A;  4S2I A;  2V8C A;  1PI5 A;  3A3D A;  3BFF A;  3D3O A;  4R3A A;  2HPB A;  3KO6 A;  3UMD A;  4HBU A;  1KDW A;  1K57 C;  4E3N A;  3QNB A;  2W27 A;  2ZC7 A;  1W63 Q;  3CLO A;  2VKS A;  4GD6 A;  2Y91 A;  1HVB A;  2ZMF A;  3H7W A;  3ITB A;  3EQU A;  2KOI A;  2C6W B;  4JXV A;  3OLO A;  4HI4 A;  2XRO A;  3CIT A;  3MZE A;  4GD8 A;  3MZF A;  3OPR A;  4B93 A;  4PM6 A;  3OZH A;  1BLP A;  4R4S A;  5CTN A;  4GLQ A;  3DTE A;  1ZG6 A;  2C5W B;  5FDH A;  4LLO B;  2ZC6 B;  4II7 A;  5MC7 A;  3F1N A;  5DFY A;  4KZ5 A;  2WYX A;  4LCL A;  3FKW A;  5EPH A;  1BSG A;  5HAQ A;  3WRZ A;  2OAQ 1;  2NUT C;  1NZO A;  1MZU A;  2Z2M B;  4FOF A;  3G2Y A;  2D02 A;  4E3I A;  4DDY A;  3P09 A;  5FAO A;  4IBX A;  5EE8 A;  3VOY A;  1NXY A;  2XGN A;  5CED A;  1T1C A;  2VX8 A;  3B33 A;  5AJG A;  5L8M A;  5FEG A;  4LV2 A;  2O9A A;  3HLC A;  2NUP C;  2PR5 A;  1PZO A;  3T1R A;  2Z2L B;  3T12 B;  2J3T D;  2B5R A;  3NUL A;  4HP9 A;  1DJC A;  4ZTK A;  1SDE A;  4I3I A;  2HJ9 C;  3HLF A;  1K54 A;  1TDL A;  4M4X A;  1N4O A;  3LEQ A;  5L2F A;  3C4O A;  3BM6 A;  3GQZ A;  1N9N A;  3HLW A;  3G2Z A;  1ZTU A;  3IBR A;  3ZDJ A;  2ZOH A;  1KDS A;  3UNW A;  1L3L A;  1L0D A;  2PRF A;  2Y2K A;  1MXO A;  3TND B;  1F2K A;  1SKO A;  4N1X A;  1BZA A;  1JVJ A;  4PMA A;  3NI9 A;  4LV0 A;  3IBJ A;  2FH5 A;  5HDD A;  1I5Q A;  2P9V A;  3D9Y A;  4GS9 A;  4KUK A;  5EVI D;  3RXX A;  3CI6 A;  5FQK A;  4EXO A;  3UE6 A;  5M18 A;  4F3L B;  2ZM0 A;  1TVF A;  3PTE A;  1N9O A;  1O07 A;  3ZHH A;  2FFF B;  5A92 A;  5AQA A;  3UE1 A;  3WS5 A;  4QWO A;  4ZJ1 A;  3T1X A;  4NEE D;  5EOE A;  2WKH A;  3I7J A;  4Z9Q A;  3C4P A;  3U4L P;  1CF0 A;  4S2J A;  4ZJ2 A;  1S1Y A;  2JN7 A;  5CX7 A;  3ZCZ A;  1DJA A;  1YLY A;  5HZH A;  2XRN A;  4Y17 A;  2OOL A;  4ZAM A;  3T4L A;  1DP9 A;  4QHC A;  5DFX A;  3NHQ A;  2WAE A;  3VP2 A;  1YQS A;  3L7H A;  1V9Y A;  1OJ5 A;  1QME A;  2A24 B;  1TF1 A;  3AGE A;  3H82 B;  2J3W A;  2W0N A;  5KSC A;  1Q2Q A;  2HGV A;  4JGR A;  5F6A A;  4B4Z A;  5A90 A;  3LIB A;  4U0X A;  4P85 A;  3IWI A;  2JKG A;  4NG2 A;  2HP9 A;  1VEU A;  4CLC E;  1FSW A;  4FD8 A;  4P6Z S;  3R7W A;  4KG2 A;  3LIA A;  3ZG8 B;  3IF6 B;  4N9K A;  1BUE A;  2R78 A;  1VET A;  3K3D A;  3PBO A;  1Z6F A;  3CPT A;  3G35 A;  4YOF A;  4D60 A;  4IHQ A;  2HP5 A;  2V20 A;  4KZ8 A;  5A91 A;  3IWO A;  5KIZ A;  2IA2 A;  4BD0 A;  3EGX C;  4ARZ A;  1MWU A;  3NOP C;  1BUL A;  1UWP X;  3W2Z A;  1YLW A;  4YFM A;  3TOI A;  2V1B A;  1DRM A;  2X71 A;  3V3R A;  3G34 A;  3ZNT A;  2Q9M A;  3UPO A;  4WEK A;  1NYM A;  1XGI A;  4EQ1 A;  3O27 A;  1XFQ A;  5KZH A;  4FTX A;  1KOU A;  4XXR A;  1C3B A;  3MXQ A;  2LB5 A;  1QMF A;  1MBL A;  1ESU A;  4JGO A;  1CEG A;  5F83 A;  2K7S A;  4NXF A;  3CMZ A;  3VP1 A;  3RXW A;  1K6R A;  4KZ3 A;  5DF9 A;  3FPW A;  4Y5F A;  3UDF A;  5L10 A;  5DTT A;  2Y4A A;  3BLS A;  4WF0 A;  4DE2 A;  2V0U A;  4NXB A;  2Y2M A;  1MWR A;  4QY6 A;  5CHU A;  5GLB A;  5IU1 A;  1OTE A;  5KSH A;  1OTD A;  2Y2O A;  3LR5 A;  1XJ6 A;  5C5K A;  3PXP A;  1CK3 A;  1YAX A;  2PR6 A;  3MQQ A;  4MCW A;  3NOT C;  4DXB A;  1ERM A;  2KX6 A;  4GDB A;  1UGU A;  5HDC A;  3IF6 A;  1MWS A;  4JDO A;  4BMW A;  3EEH A;  3BQ8 A;  2WKQ A;  4MN7 A;  5GLA A;  4MBH A;  5HD3 A;  3S7P A;  4GB7 A;  4Q8I A;  2QA4 I;  3W4O A;  2Q0O A;  3SH7 A;  1L0F A;  2XDM A;  3DAV A;  3LIC A;  3AGD A;  5FQI A;  3TSG A;  5FI6 A;  1P0Z A;  2PHY A;  1I2W A;  1KGE A;  4L9F A;  2ZM2 A;  3S22 A;  4S2L A;  3ULF A;  1XP4 A;  2H5S A;  3NOU C;  3LID A;  4JPM A;  4OP5 A;  4N9L A;  1ZG4 A;  4BJP A;  3OPL A;  5EM0 A;  2PYP A;  3MFD A;  1OT6 A;  4PKY G;  3C8C A;  4QY5 A;  4GW9 A;  3UB6 A;  4NK3 A;  5HL6 A;  2XH9 A;  1IYS A;  1FSY A;  4NXG A;  3BFC A;  3NEC A;  3C2W A;  4LCM A;  5F68 A;  1ERO A;  3PBS A;  4LRY C;  1T1B A;  2PU4 A;  3BEB A;  3U2A A;  4L9G A;  2BG1 A;  2XR0 A;  2Y59 A;  2HDU A;  2J3T C;  1SZV A;  1K0K A;  3FG8 A;  4RVA A;  1XJ2 A;  1VQQ A;  4HBT A;  5D3O A;  3FZC A;  3HRE A;  5EFW A;  3DTM A;  3SS4 A;  3MBZ A;  4FCF A;  3NC8 A;  1BLH A;  1JTG A;  4GDN A;  2JHE A;  3FC7 A;  4GN2 A;  5EVE A;  3K2N A;  5F1G A;  3VOL A;  3KX0 X;  4C75 A;  1XFN A;  4UHU A;  5HFO A;  4ETX A;  5TR7 A;  4WEL A;  4AFI A;  4PM8 A;  4X6T A;  1F98 A;  4OVD A;  2EA9 A;  4KEN B;  4OLD A;  4KQO A;  2JKR I;  4OON A;  2QHK A;  1KE3 A;  4R4R A;  1T19 A;  3QP4 A;  4WZ5 C;  3B47 A;  5FA7 A;  2BAS A;  1AXB A;  2G2W A;  3G4P A;  3RTY A;  5A8B A;  4HY8 A;  1K4F A;  5HAR A;  5EVL A;  1RGY A;  2FY9 A;  5FAS A;  2DNS A;  4OPQ A;  3SZT A;  2UV0 E;  3LR0 A;  2O0Y A;  4X68 A;  4Y13 A;  1GSX A;  4Y0T A;  3T1Q B;  1OT9 A;  3KYE A;  2ZC4 B;  2P04 A;  2HZ5 A;  1JWV A;  5EVI B;  2L0W A;  4KZ6 A;  3GSG A;  3OC2 A;  4KZA A;  3OPH A;  3MXS A;  5J3W A;  2O99 A;  1K38 A;  5DKL A;  1J3W A;  4E3M A;  2H0T A;  4R3J A;  2ZLY A;  1KE0 A;  3N4I A;  1S4S A;  3KSG A;  1ZHH B;  5BOH A;  5CER A;  5DF8 A;  4P6B A;  1HZO A;  2VK3 A;  4FH2 A;  2ZQC A;  3UO9 A;  2EXB A;  3IH8 A;  3HLB A;  3C5A A;  2VV7 A;  2EWW A;  4KZ7 A;  4OOL A;  1NZU A;  3VE3 A;  4PAU A;  2ZQ9 A;  3LI8 A;  1TD5 A;  3LR4 A;  3VP0 A;  1PZP A;  4HNB A;  2V8F A;  1JWZ A;  2XD1 A;  5E2H A;  5GL9 A;  1FQG A;  5CHM A;  1RGZ A;  1FCM A;  2QJ5 A;  4JXW A;  3IS2 B;  3EEA A;  1DJB A;  3BFE A;  3T4O A;  1CQA A;  4DDS A;  1D1J A;  1G6O A;  2JC7 A;  3O88 A;  4I5S A;  2J80 A;  4JGP A;  1AWI A;  3DTK A;  3HJK A;  3UPN A;  3TG9 A;  2BLS A;  4WYY A;  3HLD A;  5TFQ A;  3V67 A;  3LGO A;  3OCL A;  4HJ6 A;  3NIA A;  4E3O A;  5HX9 A;  1F5M A;  4JDM A;  4IJG A;  5CGX A;  2WZX A;  5EVI A;  4WZ5 A;  2J7V A;  3B3X A;  2OV5 A;  4EQI A;  2I9V A;  2RO5 A;  5DVA A;  3WS4 A;  1MKI A;  3CUE C;  2RO4 A;  4X1M A;  3G6O A;  1Y28 A;  5CGS A;  2VV8 A;  5TBM B;  4WBG A;  1GCE A;  5J4E A;  1TEM A;  2Y79 A;  3E2K A;  5FAT A;  4ZDX A;  1OJG A;  3QP2 A;  2WKP A;  2VA0 A;  4I3A A;  2XLN A;  4YWZ A;  2QZ6 A;  2OLU A;  1GA0 A;  4PKY A;  1TS8 A;  1H5X A;  5HL1 A;  4DJ2 A;  2DMW A;  1S1Z A;  3IS2 A;  3QP8 A;  4OH0 A;  5AVF A;  1IKI A;  4OPR A;  4C3Q A;  4Y15 A;  2J8Y A;  2W3E A;  3ZG0 A;  2OWH A;  3T4K A;  3VFH A;  3LEZ A;  2B18 A;  3D72 A;  4KG5 A;  2PYR A;  2PD8 A;  4DN0 A;  3OOV A;  1S0W A;  3AGF A;  3TJZ C;  4EU0 A;  2HV1 A;  1LI9 A;  3LYX A;  2X01 A;  4HIA A;  4CPK A;  1ZKJ A;  4ZJ3 A;  1PIO A;  3UDX A;  3V39 A;  4BD1 A;  2L4R A;  2Y2H A;  3TE8 A;  2RO3 A;  3M6B A;  3UE3 A;  3VFF A;  1FR6 A;  1BTL A;  2VZW A;  1PWG A;  2K1N A;  4EBL A;  4EV4 A;  5HSQ A;  3RJU A;  3PBN A;  2H10 A;  4DE1 A;  1MKM A;  2A2L A;  3IXD A;  4WMC D;  1G6A A;  1LL9 A;  1P97 A;  5HPI A;  3NJA A;  1FR1 A;  4JF4 A;  3BFG A;  4GHI B;  5DF7 A;  1Y4O A;  4E6X A;  5ITM A;  3JYI A;  5E2E A;  5K5B A;  1XX2 A;  3Q82 A;  5DKK A;  3S7Q A;  4JXG A;  3IF6 C;  4Q0I A;  4S2N A;  1TDG A;  1FIK A;  2A49 A;  3WS2 A;  1XA1 A;  3O5Y A;  4BEN A;  1YT4 A;  2Y2Q A;  3FYZ A;  3MSH A;  3ZQ5 A;  2PD7 A;  1WA9 A;  3T4S A;  4I38 A;  2W3F A;  4OQI A;  2J9P A;  2QMI A;  4P6Z M;  1MVF D;  3IHB A;  4X56 A;  3Q07 A;  2D01 A;  5U47 A;  1CI8 A;  1KVM A;  5L09 A;  3TRC A;  1IKG A;  4MEZ A;  1J9M A;  3CUE A;  4K0W A;  4U0T A;  3ZNY A;  1YPR A;  1GHP A;  1ONH A;  3GMW A;  4F94 A;  3IF5 A;  3MMH A;  5FQJ A;  4FUW A;  3EOI A;  4F3L A;  3A3J A;  1KGG A;  2XFS A;  3SS5 A;  4Y2F A;  4OOM A;  2WKR A;  3ZVW A;  2WKE A;  3UPP A;  4B9O A;  5A93 A;  4QPR A;  3UB5 P;  1VB6 A;  1YFB A;  2YKH A;  1YLJ A;  3LR3 A;  1DP8 A;  4EUZ A;  1MY8 A;  1RP5 A;  3FKV A;  4LRX C;  4MMN A;  1XKZ A;  4QD4 A;  1W8Q A;  3PAG A;  4PM9 A;  2YKF A;  3KYZ A;  3NY4 A;  3RH8 B;  1XXM A;  4GHI A;  5FQQ A;  5FI7 A;  3G32 A;  3ZFZ A;  5JYP A;  2ZJ9 A;  4YIN A;  1MWT A;  3NDE A;  1BYW A;  4HH3 A;  1PWD A;  2A24 A;  2R9W A;  2ZBB A;  2PAV P;  3IX8 A;  3IXG A;  5EM1 A;  2W3D A;  3H82 A;  2QYB A;  5HD5 A;  1RCJ A;  2WGV A;  1FCO A;  2Y2L A;  2ZQ8 A;  4O7D A;  5TGF A;  2ZQ7 A;  3ZG7 B;  1FIL A;  1H8M A;  5AQ9 A;  4H6J B;  1DY6 A;  3F1P B;  4IUH A;  3LFV A;  1NY0 A;  1GA9 A;  1G5U A;  1VHM A;  4EEP A;  3LI9 A;  2OSU A;  2EX8 A;  4H8R A;  1LL8 A;  1N9B A;  5CXW A;  5F1F A;  1X0O A;  2PU2 A;  3MKE A;  1PI4 A;  4CJN A;  1Y54 A;  1I2S A;  3ITA A;  2W1R A;  2EX6 A;  4HH2 A;  3BEC A;  3OBF A;  2XA7 S;  1OME A;  4MNR A;  1EWZ A;  4S2K A;  4E3J A;  1JNU A;  4BLM A;  2ZC3 B;  4UQI M;  3W4Q A;  4S2O A;  4QB8 A;  3B42 A;  1YLP A;  3PYP A;  1PNE A;  4PPR A;  4R1G A;  1PFL A;  4E3L A;  1Q2P A;  4NXE A;  4P87 A;  4FSF A;  1LSW A;  3PBQ A;  2EFU A;  4ETZ A;  1TS7 A;  1HD8 A;  2W3H A;  3T4Q A;  1YSP A;  3N8L A;  3NCK A;  4U3T A;  2ACG A;  4Y7P A;  1S66 L;  1LSX A;  2ZC5 B;  3G31 A;  2EWV A;  4G3W A;  2RCX A;  5HW3 A;  2M7V A;  4UEY A;  1SDN A;  2W3G A;  3BW6 A;  2VGL S;  4KQD A;  1YSQ A;  3F1O B;  4A5R A;  2QKP A;  4PM7 A;  1TS0 A;  2UWX A;  4H6J A;  1L2S A;  3W4P A;  3BFD A;  4L9E A;  3KSI A;  3F1P A;  2INW A;  1M40 A;  1YM1 A;  3HUN A;  4EER A;  1MC0 A;  3CG5 A;  4LFU A;  4S2P A;  3MKF A;  3A3F A;  4HOI A;  2ZL1 B;  3IT9 A;  3T4J A;  4LGW A;  3VE4 A;  2P74 A;  3SS3 A;  3Q1F A;  3LUQ A;  2WGW B;  4BBT A;  5FAP A;  3N7W A;  4RQ9 A;  3FWL A;  2Y2P A;  1W8Y A;  4OOY A;  4ME4 A;  3A3I A;  1FOF A;  3O87 A;  5DTK A;  3P7N A;  5G4Z A;  3RFB A;  2Y2J A;  4HP4 A;  2DCF A;  2O9B A;  5F5Y A;  2Y55 A;  3W8K A;  5G18 A;  2GLW A;  1ES3 A;  4UA7 A;  4WL9 A;  4HJ3 A;  2HP6 A;  2J9O A;  4KZ4 A;  1ERQ A;  1IFQ A;  4IVK A;  3L9K A;  5EVI C;  4HEF A;  2PBD P;  1N9L A;  2X02 A;  2JKT I;  4JXS A;  3ZVT A;  4NET A;  4CQH A;  2V1A A;  1NRF A;  5F82 A;  1BLS A;  3M2K A;  2H28 A;  3HUM A;  4EET B;  3QP5 A;  1K56 D;  4Q0H A;  3CZD A;  5KMW A;  3UME A;  3DWZ A;  3QHY A;  4DXC A;  2IWC A;  4EWF A;  4E6W A;  4R3B A;  4B4X A;  1K55 C;  3SH8 A;  5J7E A;  3BJN A;  4KZ9 A;  4O01 A;  2ZL1 A;  5E2G A;  1W63 M;  4HQA A;  2OLV A;  3GV9 A;  3G30 A;  1NRJ A;  4WM9 A;  5J8X A;  2WGW A;  3IH9 A;  1SHV A;  3MQO A;  3HUO A;  3SW1 A;  4XUX A;  1V9Z A;  3R4K A;  3UN7 A;  1E4D A;  1GHI A;  3HLE A;  4UA9 A;  1M6K A;  1ZC2 A;  2EX2 A;  4WUJ A;  1UWN X;  3IWQ A;  2VGJ A;  3PBR A;  1YMX A;  5HAP A;  1H8Y A;  3TW8 A;  2Y2N A;  3DW0 A;  2Q9N A;  1HTZ A;  5TJJ A;  3SOI A;  3BRM A;  1G68 A;  1OTI A;  4RX3 A;  3M2J A;  2XEP A;  3UB8 A;  4KQQ A;  1E3U D;  1A0K A;  1JTD A;  3JPU A;  2AVX A;  4XUZ A;  2GX5 A;  1K4E A;  4CLC D;  5HWW A;  3C30 A;  2XSS A;  4HHD A;  2M7U A;  5HDS A;  4G3V A;  3LO7 A;  4ZBE A;  4K91 A;  1NJ4 A;  3D4F A;  1D06 A;  3VOZ A;  4EUV A;  4X1L A;  3LCE A;  1SKO B;  3C7U A;  3C38 A;  4S2N C;  4QJG A;  2E8I A;  2M1C A;  3LIE A;  2VJW A;  1L0G A;  5GLD A;  2RL3 A;  4L0L A;  3VSL A;  2P9V B;  4GS9 B;  2GZA A;  4X69 A;  3A0S A;  3CAX A;  3VP3 A;  3O3V A;  4K08 A;  4R6L A;  5EV0 A;  5CTM A;  2EXA A;  2WAD A;  2QPN A;  1Z0R A;  2ZMV A;  4DRT A;  5F69 A;  4MN6 A;  3V50 A;  2QJ7 A;  3FPV A;  4MBF A;  1E25 A;  2PT7 A;  3BLM A;  3ICY A;  4BBU A;  2WZZ A;  3QP1 A;  1MPL A;  2IWD A;  5DJU A;  4WMC A;  4G3K A;  4XT2 B;  4Q0J A;  1K55 A;  4E04 A;  4KQR A;  4ID4 A;  3T1S A;  1BLC A;  4GOG A;  2P7J A;  1OPX A;  5CEC A;  3H9W A;  3IHA A;  3JVV A;  5DJT A;  2V2F F;  1EI5 A;  5GHZ A;  1WE4 A;  3MJQ A;  4OKP A;  3MQ0 A;  2MJ6 A;  5ITJ A;  4QU3 A;  1CEF A;  1PRQ A;  1WYC A;  2I72 A;  1VM1 A;  1Z09 A;  3CHW P;  3UB7 A;  5IS1 A;  5GLC A;  3UDI A;  1BT5 A;  3E98 A;  1VEU B;  4GKU A;  4OPY A;  4OP8 A;  4JF5 A;  2V0W A;  3NBL A;  4DF6 A;  1K6S A;  2VV6 A;  3R7W B;  2ZMA A;  3V3S A;  5HWV A;  2L66 A;  2G7U A;  3IX4 A;  1PW1 A;  2O9C A;  1T18 A;  1LHY A;  1K57 A;  1KE4 A;  4Y3I A;  3WS0 A;  1VET B;  3HLG A;  1ACF A;  3CPT B;  5FL3 A;  2PDR A;  4IVI A;  4LV1 A;  1YLZ A;  3C7V A;  3IQA A;  2B95 A;  3WS1 A;  4ARZ B;  5CEB A;  5TBM A;  2PBY A;  3A3E A;  5L07 A;  1SCW A;  3S4X A;  1NLZ A;  1ES5 A;  3PBT A;  2GDN A;  4XT2 A;  2JCH A;  1TS6 A;  1XJ4 A;  1UB4 C;  3PHY A;  1F9I A;  5AQB A;  3A0R A;  1NWZ A;  1P9R A;  3MXR A;  3QNC A;  3UY6 A;  5I5L A;  2Y8H A;  1LL5 A;  3FV7 A;  4N1H A;  3VV4 A;  4X25 A;  4EEU A;  4RX2 A;  2H0Y A;  2WKI A;  3GTC A;  3NDG A;  3QP6 A;  4LV3 A;  5CHJ A;  5FEF A;  4IUK A;  3MFX A;  3Q7Z A;  5FDS A;  4YNR A;  5FAQ A;  5GHX A;  3N8S A;  1ESI A;  1K25 A;  1GHM A;  3ZGA B;  3MF0 A;  3EGD C;  3S1Y A;  2KLI A;  2EX9 A;  1ONG A;  2HJE A;  2VGK A;  1YSF A;  3K3C A;  1WYB A;  1EW0 A;  1H3Q A;  3LY4 A;  3HVF A;  5FQ9 A;  3Q81 A;  2R9X A;  4UAA A;  1YMS A;  3ISG A;  1IYQ A;  1S4R A;  4Z1W A;  4EBN A;  2B02 A;  3MR0 A;  4PHT A;  4RYE A;  1G28 A;  4OPZ A;  4E3K A;  3LY3 A;  2GJ3 A;  2OWJ A;  2ZM8 A;  2V9A A;  4LPZ A;  3V5M A;  2QWS A;  3ZYT A;  3JVU A;  2FFY A;  3BYD A;  1D7E A;  1PW8 A;  5HWT A;  4MN5 A;  1FCN A;  4R0Q A;  4HES A;  5EEC A;  4GCZ A;  3BWL A;  1LSV A;  2W1T B;  4BL3 A;  3P01 A;  3CJM A;  1ODV A;  3E4O A;  1GSW A;  1ES4 A;  2WAF A;  4OLG A;  5FI2 A;  4LRZ E;  3E4Q A;  5E43 A;  3BY8 A;  5E2F A;  2HDR A;  4IED A;  1CJF A;  3ZG5 A;  3DBA A;  2WK0 A;  4FH4 A;  4Y0U A;  3VP4 A;  5CGW A;  5LBR A;  4S2M A;  3KSF A;  3IX3 A;  4ESP A;  5HPF A;  4P0M A;  2XA7 M;  2Y2I A;  2ZQA A;  4UA6 A;  1H0M A;  4DJ3 A;  1W7F A;  5IT5 A;  4IBR A;  3BQA A;  3GVB A;  1L0E A;  1KGF A;  1DP6 A;  2VLG A;  3GDI A;  2EFX A;  2WUQ A;  4JBF A;  2XFT A;  5FQM A;  5I94 A;  2VEA A;  2A3U A;  3A0V A;  2JBF A;  4X53 A;  1XJ3 A;  3E2L A;  2JE5 A;  3SH9 A;  3KYQ A;  3WWX A;  4PM5 A;  4JKT A;  2JKF A;  4K0X A;  4WLA A;  4O8G A;  5AVE A;  3S7N A;  4CLC C;  2ZD8 A;  1YLT A;  1S67 L;  4JGQ A;  4GJ4 A;  2Z6D A;  2ZOI A;  4D2O A;  1IEM A;  2GNX A;  5EUA A;  3E0Y A;  5IHV A;  4EBP A;  4R23 A;  3OPP A;  2VGL M;  4DMZ A;  4I39 A;  4UQI S;  4BWI A;  2W1T A;  3E4P A;  4WN5 A;  4N92 A;  1IYP A;  4DE3 A;  1H8Z A;  1LT0 A;  5EOO A;  1IOU A;  5AQ7 A;  1NLY A;  5M19 A;  2FZ0 A;  4KUO A;  3T50 A;  1W5D A;  3OCN A;  4CLC B;  1SKF A;  2HDS A;  1YKD A;  3HCY A;  4JF6 A;  4R38 A;  4O0P A;  2WGI A;  4MLL A;  4BQM A;  3Q7V B;  5GHY A;  1LI0 A;  1O7E A;  3T4T A;  3GRJ A;  2L1M A;  4LEN A;  1K56 A;  4WEJ A;  4EES A;  4RA7 A;  2P08 A;  4Y0O A;  2XD5 A;  3UB9 A;  4DE0 A;  3LIF A;  3O86 A;  5DTS A;  1PYY A;  2LB9 A;  1KVL A;  2DRW A;  3KSH A;  2E8J A;  1JWP A;  3GEC A;  4OQG A;  3UE0 A;  1P9W A;  5M1A A;  3WRT A;  3MS6 A;  2K2N A;  3EWK A;  2Y2G A;  1LLB A;  3BY9 A;  2KDK A;  3IXB A;  2ZQD A;  2JKR M;  3CWF A;  4BL2 A;  2BTF P;  5HAI A;  3DTI A;  3ZG9 B;  4WZ4 A;  2XQZ A;  3N8R A;  4MDZ A;  3N6I A;  1IYO A;  2JKT M;  1W79 A;  5JYO A;  2Z6C A;  4HJ4 A;  3MZD A;  4MBK A;  3PR6 A;  1XGJ A;  1OTB A;  2HDQ A;  3M6H A;  3H7W B;  1NYY A;  4BBV A;  3HL9 A;  3IXH A;  2CC1 A;  1GSV A;  3VMA A;  3F1O A;  1E3U A;  5FSR A;  4GZB A;  4CLC A;  1PWC A;  4R70 A;  4KZB A;  2IWB A;  1IEL A;  3EQV A;  5G4Y A;  4JLF A;  3Q7V A;  4EW7 A;  1U60 A;  1STZ A;  1ES2 A;  4NKP A;  2G2U A;  3F1N B;  2XF3 A;  1CI9 A;  2XK1 A;  5CRF A;  4OQH A;  4DKI A;  4C6Y A;  2K31 A;  3DWK A;  4B88 A;  4ZRR A;  2V1Z A;  3VSK A;  3GR2 A;  1K54 C;  3HBR A;  4M3K A;  3HJI A;  2OAP 1;  2HF6 A;  4I3J A;  1XPB A;  3P98 A;  2CMN A;  3PAE A; 
#chains in the Genus database with same CATH homology
 1DP8 A;  5ITJ A;  2PYP A;  4PKY G;  1OT6 A;  3C8C A;  1T1A A;  4LRX C;  4MMN A;  3S7O A;  4GW9 A;  3UB7 A;  3UB6 A;  5HL6 A;  5IS1 A;  1OTA A;  2YKF A;  3KYZ A;  3RH8 B;  4NXG A;  4GHI A;  3C2W A;  3D3O A;  4R3A A;  3E98 A;  3KO6 A;  5F68 A;  3UMD A;  2V0W A;  3PBS A;  4LRY C;  1T1B A;  2VV6 A;  3R7W B;  5HWV A;  2L66 A;  2G7U A;  3U2A A;  4L9G A;  1BYW A;  2W27 A;  1W63 Q;  4HH3 A;  2J3T C;  2O9C A;  2A24 A;  2ZBB A;  1T18 A;  4Y3I A;  2W3D A;  3CLO A;  2QYB A;  3FG8 A;  3H82 A;  2VKS A;  5HD5 A;  1XJ2 A;  5FL3 A;  2ZMF A;  3H7W A;  3EQU A;  2KOI A;  2PDR A;  3OLO A;  5EFW A;  4HI4 A;  2XRO A;  3CIT A;  1H8M A;  4ARZ B;  4B93 A;  4H6J B;  5TBM A;  2JHE A;  4GLQ A;  3FC7 A;  3F1P B;  3K2N A;  3VOL A;  4IUH A;  3LFV A;  3KX0 X;  4LLO B;  1XFN A;  1VHM A;  4EEP A;  4II7 A;  3LI9 A;  1NLZ A;  5MC7 A;  3PBT A;  3F1N A;  4XT2 A;  4ETX A;  1LL8 A;  5DFY A;  4WEL A;  4AFI A;  1TS6 A;  1X0O A;  1F98 A;  1XJ4 A;  1UB4 C;  3PHY A;  2EA9 A;  1F9I A;  3A0R A;  1NWZ A;  1P9R A;  2W1R A;  4HH2 A;  4KQO A;  2JKR I;  3OBF A;  2QHK A;  5I5L A;  2OAQ 1;  2NUT C;  1T19 A;  2XA7 S;  1MZU A;  2Y8H A;  3B47 A;  4FOF A;  2D02 A;  2BAS A;  3VV4 A;  1JNU A;  4EEU A;  4UQI M;  3RTY A;  5A8B A;  3B42 A;  1T1C A;  4HY8 A;  2VX8 A;  3B33 A;  3PYP A;  4IUK A;  3MFX A;  4YNR A;  5AJG A;  5L8M A;  2FY9 A;  4NXE A;  2O9A A;  4FSF A;  1LSW A;  2NUP C;  2PR5 A;  3MF0 A;  3PBQ A;  3EGD C;  4ETZ A;  1TS7 A;  2KLI A;  2W3H A;  2J3T D;  3T4Q A;  1YSP A;  4HP9 A;  3LR0 A;  2O0Y A;  2HJE A;  3K3C A;  1YSF A;  1GSX A;  1S66 L;  4I3I A;  1OT9 A;  2HJ9 C;  1EW0 A;  1H3Q A;  2P04 A;  1LSX A;  2EWV A;  2L0W A;  4G3W A;  4M4X A;  1S4R A;  3OC2 A;  1N9N A;  4Z1W A;  2M7V A;  2B02 A;  3MR0 A;  4UEY A;  4PHT A;  1ZTU A;  3IBR A;  2ZOH A;  2W3G A;  5J3W A;  1G28 A;  2O99 A;  5DKL A;  3BW6 A;  2VGL S;  4KQD A;  1YSQ A;  3F1O B;  2GJ3 A;  3TND B;  2QKP A;  1S4S A;  2OWJ A;  3KSG A;  1ZHH B;  1TS0 A;  2V9A A;  4LPZ A;  4H6J A;  4L9E A;  2QWS A;  3KSI A;  3F1P A;  3ZYT A;  2INW A;  2VV7 A;  3JVU A;  2EWW A;  3IBJ A;  1D7E A;  4OOL A;  2FH5 A;  5HDD A;  4EER A;  5HWT A;  4MN5 A;  3VE3 A;  4PAU A;  1MC0 A;  3LI8 A;  4GS9 A;  1TD5 A;  3LR4 A;  4KUK A;  4HNB A;  4GCZ A;  3CI6 A;  3BWL A;  4EXO A;  1LSV A;  3UE6 A;  2W1T B;  3P01 A;  4HOI A;  4F3L B;  1ODV A;  3E4O A;  1GSW A;  1N9O A;  3T4J A;  3VE4 A;  2QJ5 A;  3LUQ A;  4BBT A;  4LRZ E;  3E4Q A;  3IS2 B;  4RQ9 A;  3EEA A;  3BY8 A;  4NEE D;  4ME4 A;  3T4O A;  3DBA A;  1G6O A;  3P7N A;  4I5S A;  2J80 A;  4JGP A;  3HJK A;  5G4Z A;  1S1Y A;  3RFB A;  4HP4 A;  2O9B A;  5LBR A;  5F5Y A;  2JN7 A;  3KSF A;  5CX7 A;  5HPF A;  2XA7 M;  2GLW A;  3V67 A;  4WL9 A;  5HZH A;  4HJ3 A;  4DJ3 A;  2XRN A;  5IT5 A;  3OCL A;  3BQA A;  4HJ6 A;  1DP6 A;  2VLG A;  3GDI A;  2OOL A;  3T4L A;  1DP9 A;  1IFQ A;  1F5M A;  4JDM A;  2VEA A;  3A0V A;  5DFX A;  3NHQ A;  4IJG A;  1XJ3 A;  1V9Y A;  1N9L A;  1OJ5 A;  2A24 B;  1TF1 A;  2JKT I;  4CQH A;  3H82 B;  2J3W A;  2W0N A;  2V1A A;  2I9V A;  3KYQ A;  2RO5 A;  4WLA A;  4O8G A;  2HGV A;  4JGR A;  5F6A A;  2H28 A;  5AVE A;  3S7N A;  4CLC C;  4EET B;  3LIB A;  1S67 L;  4Q0H A;  4JGQ A;  3CUE C;  3UME A;  4GJ4 A;  2RO4 A;  3G6O A;  1Y28 A;  2Z6D A;  2VV8 A;  5TBM B;  4CLC E;  2ZOI A;  5J4E A;  2Y79 A;  2GNX A;  4P6Z S;  3R7W A;  5J7E A;  3E0Y A;  1OJG A;  3BJN A;  2WKP A;  2VGL M;  4DMZ A;  3LIA A;  4I39 A;  4O01 A;  4UQI S;  2VA0 A;  4BWI A;  2W1T A;  3E4P A;  4WN5 A;  4I3A A;  1W63 M;  2R78 A;  1LT0 A;  3K3D A;  1IOU A;  4YWZ A;  4HQA A;  3PBO A;  4YOF A;  4IHQ A;  1NRJ A;  4PKY A;  1TS8 A;  3MQO A;  1NLY A;  4DJ2 A;  2DMW A;  1S1Z A;  3SW1 A;  1V9Z A;  2FZ0 A;  3IS2 A;  4KUO A;  3R4K A;  3T50 A;  5KIZ A;  2IA2 A;  5AVF A;  3EGX C;  4ARZ A;  3OCN A;  3NOP C;  4CLC B;  1UWP X;  3W2Z A;  2W3E A;  1YKD A;  2OWH A;  3HCY A;  3T4K A;  2V1B A;  4R38 A;  4O0P A;  4WUJ A;  1DRM A;  1UWN X;  2B18 A;  3D72 A;  3PBR A;  4WEK A;  2PYR A;  3T4T A;  2PD8 A;  3TW8 A;  4EQ1 A;  4DN0 A;  3O27 A;  1XFQ A;  3OOV A;  2L1M A;  1KOU A;  3TJZ C;  4EU0 A;  2HV1 A;  3MXQ A;  3LYX A;  4HIA A;  4WEJ A;  5TJJ A;  2LB5 A;  4EES A;  1OTI A;  2P08 A;  4JGO A;  3UB9 A;  3LIF A;  3UB8 A;  2K7S A;  2L4R A;  2LB9 A;  4NXF A;  3TE8 A;  2RO3 A;  2GX5 A;  3UE3 A;  4CLC D;  5DF9 A;  3FPW A;  5HWW A;  4Y5F A;  3C30 A;  2VZW A;  3KSH A;  2XSS A;  4HHD A;  2K1N A;  2M7U A;  5HSQ A;  3GEC A;  5HDS A;  4G3V A;  4WF0 A;  1P9W A;  3PBN A;  1MKM A;  2K2N A;  3EWK A;  2A2L A;  2V0U A;  4NXB A;  1D06 A;  3BY9 A;  2KDK A;  4EUV A;  5IU1 A;  1P97 A;  2JKR M;  3CWF A;  3NJA A;  5HPI A;  1OTE A;  5KSH A;  4GHI B;  1OTD A;  3C38 A;  4MDZ A;  5ITM A;  2M1C A;  3LIE A;  3LR5 A;  1XJ6 A;  2VJW A;  5C5K A;  5K5B A;  3PXP A;  1YAX A;  2PR6 A;  5DKK A;  3S7Q A;  3MQQ A;  2JKT M;  4MCW A;  3NOT C;  4Q0I A;  4L0L A;  2KX6 A;  3O5Y A;  4GS9 B;  1UGU A;  2GZA A;  2Z6C A;  4HJ4 A;  3A0S A;  3CAX A;  5HDC A;  4JDO A;  4K08 A;  4R6L A;  2PD7 A;  1WA9 A;  3PR6 A;  3ZQ5 A;  1OTB A;  3T4S A;  4BMW A;  4I38 A;  3EEH A;  1Z0R A;  2ZMV A;  2W3F A;  3H7W B;  5F69 A;  4MN6 A;  3BQ8 A;  4BBV A;  2QJ7 A;  3FPV A;  2WKQ A;  1GSV A;  4MN7 A;  4P6Z M;  1MVF D;  3F1O A;  5HD3 A;  3S7P A;  2D01 A;  4CLC A;  2PT7 A;  4R70 A;  3TRC A;  3EQV A;  2QA4 I;  5G4Y A;  3ICY A;  3CUE A;  4BBU A;  4EW7 A;  1STZ A;  3LIC A;  5DJU A;  4NKP A;  4G3K A;  3F1N B;  4XT2 B;  4Q0J A;  1P0Z A;  3MMH A;  4E04 A;  2PHY A;  3EOI A;  4F3L A;  4L9F A;  4Y2F A;  4OOM A;  2WKR A;  2K31 A;  3ULF A;  4ZRR A;  2P7J A;  1OPX A;  3NOU C;  3H9W A;  3HJI A;  3LID A;  2OAP 1;  3JVV A;  5DJT A;  2HF6 A;  4I3J A;  4B9O A;  4BJP A;  4QPR A;  1VB6 A;  1YFB A;  2YKH A;  3MJQ A;  3MQ0 A;  2MJ6 A;  2CMN A;  3LR3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...