4QD4A

Structure of adc-68, a novel carbapenem-hydrolyzing class c extended-spectrum -lactamase from acinetobacter baumannii
Total Genus 125
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
125
sequence length
357
structure length
357
Chain Sequence
PKDQEIKKLVDQNFKPLLEKYDVPGMAVGVIQNNKKYEMYYGLQSVQDKKAVNSSTIFELGSVSKLFTATAGAYAKNKGKISFDDTPGKYWKELKNTPIDQVNLLQLATYTSGNLALQFPDEVQTDQQVLTFFKDWKPKNPIGEYRQYSNPSIGLFGKVVALSMNKPFDQVLEKIIFPALGLKHSYVNVAKTQMQNYAFGYNQENQPIRVNPGPLDAPAYGVKSTLPDMLSFIHANLNPQKYPADIQRAINETHQGRYQVNTMYQALGWEEFSYPATLQTLLDSNSEQIVMKPNKVTAISKEPSVKMYHKTGSTNGFGTYVVFIPKENIGLVMLTNKRIPNEERIKAAYAVLNAIKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of ADC-68, a novel carbapenem-hydrolyzing class C extended-spectrum beta-lactamase isolated from Acinetobacter baumannii
pubmed doi rcsb
source organism Acinetobacter baumannii
molecule tags Hydrolase
molecule keywords Beta-lactamase ADC-68
total genus 125
structure length 357
sequence length 357
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-05-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00144 Beta-lactamase Beta-lactamase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 4qd4A00
2XEPA 5L2FA 5FATA 5EVIC 3HLWA 3WS2A 2WUQA 1FSYA 3IXBA 1QMFA 3HLBA 2ZC5B 3CG5A 3CZDA 2Z2LB 5FI7A 4S2KA 4IBXA 1MWRA 3OPLA 1TDGA 3UE3A 1ZC2A 4WZ4A 4DXBA 3V3SA 3O87A 3TSGA 5U47A 4WMCD 3VP3A 3C7VA 3SH8A 1CK3A 3UPOA 4S2NC 4U0TA 3HLFA 4GDBA 4HBTA 1NYMA 2WKEA 4OQGA 1PZPA 5DF9A 2ZM8A 4OKPA 1IELA 1ES4A 1ES3A 1H5XA 3FZCA 3CMZA 4F94A 3MZFA 4IBRA 5CHMA 1ES2A 4KZ8A 1HZOA 4S2IA 5DF7A 2WKIA 3FV7A 2JE5A 4GDNA 3DTMA 1FOFA 4N1XA 5CHJA 5EOOA 2WAEA 1C3BA 4EWFA 4GOGA 5KMWA 1KGFA 3W4QA 1SKFA 4FH2A 4LCMA 4UA9A 1O7EA 3IHBA 1IYPA 4M3KA 1O07A 3HLEA 4R23A 1RGYA 3N6IA 5TGFA 1TEMA 3BM6A 5HFOA 3S22A 4S2PA 4OLDA 5CHUA 2WAFA 3VP0A 4QHCA 1E3UD 4S2NA 3VOYA 4LENA 3OC2A 2PU4A 1K55A 5F83A 4DDYA 1W8QA 1VQQA 4CPKA 3UPPA 1BSGA 4DKIA 2WGVA 4R3BA 5A93A 4IVKA 2G2UA 2A49A 3G31A 4KZ9A 5AQ7A 3ZG8B 2J9OA 4QD4A 3V50A 2DNSA 4K91A 3GTCA 5HX9A 1JVJA 4BQMA 1NZUA 3Q7VA 4BL3A 3LO7A 4JLFA 3LCEA 1K56A 3NY4A 4HESA 4K0XA 4KG5A 1PWDA 3TOIA 4DE0A 5CGXA 1SHVA 2E8IA 3V5MA 4X55A 4GNUA 4A5RA 2R9WA 4OVDA 2WGWA 3NCKA 4R4SA 3UY6A 1LLBA 5KSCA 3VSKA 1KGGA 1NYYA 1L0EA 4WEKA 3WS4A 5EE8A 2ZQ9A 2VGJA 3UN7A 3N8RA 1NY0A 5FQIA 2EFUA 3WS0A 1I5QA 5GLDA 3O86A 3A3EA 2ZJ9A 4JXWA 1DJCA 3D4FA 4RX3A 2BLSA 1BT5A 1YLYA 3C4OA 5DTKA 2WYXA 2H0TA 1BLHA 3HREA 1KE3A 1ZG4A 4C75A 3IXGA 2X02A 2Y2MA 3GSGA 4CJNA 4E3LA 3G30A 3OPPA 1FR1A 1PWGA 1PYYA 2ZD8A 1DJBA 1FCNA 5M18A 1N9BA 2I72A 1W7FA 3G34A 3P98A 5IHVA 1MXOA 4BENA 3VP1A 4EBNA 5KZHA 5FI6A 4R1GA 2HPBA 2UWXA 3C5AA 1H8YA 5E2GA 1Q2PA 1GCEA 3PTEA 1K57A 1JTDA 4H8RA 4OOMA 3BRMA 4U3TA 3PBNA 1KE0A 1YMSA 3EQUA 2ZQAA 4JXVA 2CC1A 3IQAA 4N9KA 4Y0UA 1W79A 2XH9A 4OQIA 3HLGA 5A91A 4DDSA 2XDMA 1L2SA 3BFCA 3IXHA 3NBLA 3S1YA 4E3KA 5CGSA 5D3OA 4C6YA 1N4OA 3NDGA 3OCLA 3Q07A 2RL3A 5DTSA 5HARA 1PI4A 2DRWA 3MZDA 4OOYA 1FCMA 1K25A 3PAEA 4LV3A 4R0QA 1S0WA 1XGJA 4X6TA 5M1AA 1W5DA 1FQGA 1H8ZA 4N92A 4RA7A 2IWBA 5A92A 3MKEA 1GA0A 2B5RA 5CTNA 4N9LA 5FQJA 1VM1A 3GMWA 3PBQA 1YM1A 3W8KA 1WYBA 1CI8A 2H5SA 3E2KA 2Y2LA 3MXRA 3OPRA 1XA1A 2JBFA 3E2LA 5I94A 1WE4A 4P87A 4LCLA 3N8LA 3O88A 2V20A 4BLMA 3NI9A 4FCFA 1WYCA 3AGEA 2EXBA 3DWKA 1K57C 2WZXA 5M19A 4OPYA 5EUAA 1PZOA 4QU3A 2EX6A 3VFHA 3V39A 1E4DA 1BUEA 4MBHA 3GVBA 4L0LA 5FQKA 4BL2A 3GV9A 2Y59A 4PM7A 4GB7A 1CEFA 1PI5A 1BLSA 2XR0A 4GN2A 2R9XA 1KE4A 3FYZA 1IKIA 1ESIA 3DW0A 1KDSA 4ID4A 4QY6A 4DE1A 5HW3A 2ZQ8A 3IXDA 4Z9QA 1FCOA 1MPLA 3Q81A 1U60A 4HEFA 5E2EA 2G2WA 1E3UA 3SH9A 1GHMA 2EX2A 4RVAA 4EBLA 4PM5A 3A3IA 3IWIA 3ITAA 3UO9A 4Y7PA 4K0WA 4JXSA 4OPQA 5CTMA 4ZAMA 1J9MA 4LV1A 4KZ6A 1XP4A 4PM8A 1NZOA 1KVLA 3FKVA 4PPRA 2Z2MB 1DJAA 3M6BA 2HDUA 1G68A 5EOEA 4KG2A 3BFGA 2C6WB 4DRTA 4E3IA 1QMEA 4OONA 2HDSA 4BD0A 3M6HA 4JF4A 4ZJ1A 1LL5A 3UE1A 4DF6A 5FQMA 5EVLA 1XA7A 3ZVTA 4JPMA 1PWCA 3ZNTA 1YT4A 3O3VA 3HL9A 4GD8A 4KENB 3SOIA 3UPNA 5F1FA 3BFEA 3DWZA 3IF6C 1YLJA 5F82A 2Y55A 2V2FF 3RJUA 3G35A 3BLMA 3C7UA 3WS5A 3M2JA 2P9VB 1K38A 4B88A 1YLPA 3MXSA 3LEZA 1K56D 4IEDA 4MLLA 3MKFA 3GQZA 1I2SA 2Y2OA 4X53A 1DY6A 1Z6FA 2WGWB 2ZM2A 2ZQCA 3N8SA 1ESUA 1K6SA 1BZAA 3HLCA 3MBZA 3WRZA 4EQIA 2ZC4B 3ZDJA 4NETA 3QNBA 1I2WA 3BEBA 5CECA 4JKTA 4HBUA 2C5WB 2J7VA 1E25A 5FQ9A 5EVIB 5CGWA 4GD6A 5CRFA 3SS4A 4UA6A 3ZG9B 5BOHA 5CEDA 2FFFB 3HBRA 5GHZA 4OQ0A 4RX2A 1L0FA 1XXMA 1RCJA 1PW8A 4XUXA 3WRTA 1ES5A 4KZ5A 1SCWA 4C3QA 5DF8A 2ZQ7A 5EECA 3VP2A 4UA7A 4ZJ3A 5AQAA 5HAPA 1IYOA 2QZ6A 3BFFA 4RYEA 5FAOA 1KVMA 1JWPA 1K4EA 2Y2HA 3RXXA 4DXCA 5HAQA 1SDNA 4OH0A 1CEGA 1GHPA 3BECA 3C4PA 3UE0A 4BD1A 3FWLA 4KZ7A 1ZKJA 3B3XA 2ZQDA 3GRJA 3IF5A 3HUMA 3N4IA 5E2HA 1L0DA 4UHUA 3VSLA 3Q7VB 4S2JA 1AXBA 2XFSA 3PBOA 2HP9A 1GHIA 2OV5A 5EVID 1GA9A 1ONHA 1RGZA 1XGIA 4O7DA 2XFTA 3IHAA 1ERMA 4R3JA 2HDRA 3FKWA 4LV0A 1K55C 4ZDXA 2XD1A 3LY4A 3QHYA 4KQOA 1IYQA 1KDWA 1K6RA 3MZEA 3OCNA 5FI2A 5GLAA 5DTTA 2DCFA 1K54C 4KZ4A 5TFQA 1OMEA 2XD5A 4DE2A 2IWCA 2ZLYA 4LV2A 2WADA 4JF6A 2P9VA 4PM9A 4PMAA 1HTZA 4S2OA 5TR7A 1ERQA 4Y0TA 5KSHA 4E6WA 3AGFA 3JYIA 5FAQA 4WYYA 2HP5A 5AQBA 1JWVA 1SDEA 2OLVA 2JC7A 3UDFA 1LI9A 5G18A 4S2MA 2ZC3B 4GZBA 3ZVWA 1XKZA 3NDEA 3ZG5A 4ZTKA 3ZHHA 1K54A 4WELA 4B4XA 4E3NA 5A90A 1LHYA 1MY8A 2FFYA 2Y4AA 1BLCA 4D2OA 4OP8A 3OZHA 2WZZA 3Q1FA 2X01A 1HVBA 1IKGA 4EV4A 2EXAA 4OPRA 3G2YA 3VFFA 5FASA 4X68A 4XXRA 5HAIA 2A3UA 3Q82A 5F1GA 4ZJ2A 5GLCA 3ZGAB 2Y2PA 1MWSA 1FSWA 1IEMA 3GR2A 1NXYA 3IH8A 3IH9A 3A3DA 2J8YA 2Y2QA 3G32A 3IT9A 2HDQA 4KQRA 5GHXA 3CJMA 3IF6A 4QJGA 2PU2A 3HUNA 1BLPA 4OQHA 4KZBA 3NIAA 4ZBEA 5JYPA 3VP4A 1MWTA 1YMXA 1ALQA 1HD8A 2BG1A 2OLUA 4IVIA 3A3FA 5E2FA 3UDIA 2Q9MA 1BULA 1MWUA 3EQVA 3I7JA 3PAGA 4QB8A 1CI9A 2QMIA 3OPHA 2XGNA 4P6BA 5GHYA 4MNRA 3N7WA 4OOLA 3BFDA 2GDNA 4OPZA 4WZ5C 1FR6A 1TDLA 2ZMAA 3ZFZA 4KZAA 1IYSA 3IWQA 1L0GA 3BYDA 2X71A 3Q7ZA 4JXGA 4XUZA 4YINA 3WS1A 4OP5A 4WZ5A 4Y0OA 3BLSA 2Y2GA 2Y91A 3M2KA 3AGDA 2Y2KA 1Q2QA 3VMAA 3LY3A 5DVAA 1KGEA 4FSFA 2XK1A 4JF5A 3MFDA 4WMCA 3IWOA 3ZG7B 3UNWA 4DE3A 4NK3A 1MBLA 3IF6B 4MBKA 3TG9A 2VGKA 2Y2JA 5HL1A 4BJPA 2Q9NA 1TVFA 2JCHA 4KQQA 3W4OA 1NRFA 4Q8IA 4EUZA 3RXWA 3HVFA 5CXWA 3WWXA 3SH7A 4UAAA 2Y2IA 5FSRA 3G4PA 4OLGA 4JBFA 3PBTA 3HLDA 3P09A 2QPNA 5GLBA 4S2LA 3SS5A 3W4PA 2EX8A 3NC8A 4E3MA 2V1ZA 4U0XA 3SS3A 4GKUA 1JTGA 3A3JA 5FDHA 5EPHA 1YLTA 4KZ3A 1ONGA 3ITBA 1JWZA 2HP6A 1PW1A 2OSUA 2P74A 5J8XA 1M40A 2ZC7A 1NJ4A 4YFMA 4E3OA 2H0YA 2WGIA 1LI0A 2XLNA 4P0MA 2XQZA 2IWDA 5FQQA 1K4FA 4E6XA 1RP5A 3QNCA 4WM9A 5FA7A 1S6RA 2ZC6B 2EX9A 3PBRA 1M6KA 3S4XA 1G6AA 4FD8A 5CEBA 5E43A 3VOZA 3ISGA 4B4ZA 4E3JA 2ZM0A 4PM6A 2H10A 1ZG6A 4FH4A 4KG6A 5AQ9A 3HUOA 1YQSA 4X69A 1W8YA 1PIOA 3PBSA 5JYOA 1MKIA 1BTLA 1LL9A 3ZCZA 2Y2NA 2EFXA 4N1HA 3V3RA 4MBFA 1YLZA 4P85A 4QY5A 4WBGA 2XF3A 3ZG0A 1EI5A 5GL9A 3G2ZA 4WEJA 3ZNYA 1EROA 5EVIA 5CERA 2PBYA 1EWZA 1Y54A 1XX2A 1YLWA 2J9PA 4X56A 5FAPA 4MEZA 3UDXA 4R4RA 4EBPA 2WK0A 1XPBA 2WKHA 2RCXA
chains in the Genus database with same CATH superfamily
5LBRA 1FSYA 2HF6A 3CG5A 3CZDA 2KOIA 1IOUA 4WZ4A 5CX7A 4HOIA 5U47A 2V1BA 4U0TA 3F1OB 4OKPA 1LSVA 3BY8A 2PRFA 2UV0E 3T4JA 2JE5A 1TF1A 3TJZC 5F69A 4GOGA 1KGFA 1SKFA 4UA9A 1O7EA 1O07A 4R23A 1OTAA 3BM6A 3S22A 2O9CA 2ZOHA 1G6OA 4DDYA 3FC7A 3CWFA 4R3BA 4EERA 5A93A 4NXEA 3G31A 5AQ7A 2J9OA 3V50A 2DNSA 3GTCA 3S7PA 3PR6A 3QP8A 4JLFA 4K0XA 1PWDA 5CGXA 3PXPA 4MN7A 4GNUA 4A5RA 2R9WA 3KSIA 4I5SA 2WGWA 3UY6A 4BBTA 1LLBA 3VSKA 1NYYA 5EE8A 4JGOA 4EU0A 5FQIA 5GLDA 3O86A 3DBAA 1DJCA 4RX3A 1VB6A 2BLSA 1YLYA 5L8MA 2J3TC 4C75A 3QP2A 3RTYA 4E3LA 3G30A 1VEUA 5M18A 3G34A 3P98A 2EA9A 2LB9A 4OOMA 4Y17A 3BRMA 1YMSA 4Y0UA 1IFQA 3K2NA 3UB9A 5D3OA 2RL3A 5DTSA 5TJJA 1FCMA 4LV3A 3D72A 5M1AA 1FQGA 2IWBA 5A92A 1GA0A 3LYXA 4N9LA 2GX5A 1VM1A 3GMWA 3W8KA 1LSXA 2H5SA 3E2KA 2K2NA 1XA1A 2VK3A 2BTFP 5I94A 4LCLA 3N8LA 2V20A 5HWTA 1WYCA 3UB7A 3AGEA 2VLGA 5EUAA 4QU3A 3V39A 1E4DA 3IS2B 1BUEA 3F1NB 3CPTA 1PI5A 4HIAA 4GN2A 2R9XA 1IKIA 4FUWA 1ESIA 1KDSA 3IXDA 4UEYA 1G28A 4LPZA 3UO9A 4IUKA 5TBMB 4NEED 4JXSA 4OPQA 4Y5FA 1J9MA 4LV1A 1N9LA 1XP4A 1KVLA 5G4YA 3M6BA 5EOEA 4H6JA 3UE1A 5HD3A 4DF6A 4JPMA 3ZNTA 1YT4A 3BFEA 3RJUA 3WS5A 3NOUC 1P9WA 2W1TB 1LSWA 3MXSA 4IEDA 1YLPA 1K56D 3FPWA 1TS0A 1ODVA 4ARZB 4X53A 2JKTI 2ZQCA 1ESUA 2ZC4B 2OAP1 3BEBA 1E25A 4GD6A 1OJGA 2HGVA 4HP4A 3HBRA 3SZTA 4OQ0A 4RX2A 2VGLS 3L7HA 1ES5A 4KZ5A 2KX6A 5EECA 4UA7A 5AQAA 1IYOA 1JWPA 1K4EA 1SDNA 1GHPA 4IHQA 2QJ7A 2J3TD 2ZQDA 3VSLA 4S2JA 2OV5A 5EVID 3E4OA 3A0VA 2XFTA 4R3JA 3LY4A 4KQOA 5GLAA 3NECA 2JHEA 4EQ1A 4LV2A 2P9VA 4Y0TA 1HTZA 4S2OA 5KSHA 4P6ZM 5FAQA 2HP5A 1JWVA 3LI9A 5HD5A 2OWJA 2ZC3B 3NDEA 4B4XA 4E3NA 3MQ0A 4WELA 5A90A 1LHYA 4Y2FA 4Y3IA 3C2WA 2WZZA 3UB5P 1XFQA 4OPRA 4E04A 3VFFA 5FASA 4X68A 4ZJ2A 5GLCA 1UGUA 1NXYA 4Y15A 1S4SA 3IH8A 5HZHA 3A3DA 3BY9A 4QJGA 1T19A 4KZBA 1ALQA 4IVIA 3A3FA 2Q9MA 1BULA 2PYPA 4QB8A 3KSGA 1T1BA 3CITA 3DTEA 2QMIA 3QP4A 4P6BA 5GHYA 4MNRA 2GDNA 1FR6A 1TDLA 2ZMAA 3ZFZA 2K31A 3IWQA 1ACFA 2X71A 3H82B 4OP5A 4XT2A 4O0PA 3M2KA 3LY3A 1OTEA 4JF5A 3LIEA 5HDDA 4WMCA 4F3LB 4BJPA 2Q9NA 2WKQA 4L9GA 3W4OA 4I3AA 2PR6A 4EUZA 2O99A 3MFXA 1ZHHB 4UAAA 2Y2IA 5FSRA 4OLGA 4PAUA 2QPNA 1YPRA 4S2LA 3W4PA 2V1ZA 4U0XA 4BWIA 3LICA 3LR4A 4LLOB 1YLTA 2M1CA 2HP6A 2OSUA 5J8XA 4YFMA 5EV0A 1LI0A 1Y4OA 2XQZA 3IBRA 3QNCA 2VA0A 4WM9A 1S6RA 2EX9A 4ETZA 3E4QA 4Y13A 3T1XA 4E3JA 2H10A 4FH4A 3GECA 1MKIA 5DKKA 3ZCZA 4N1HA 2EFXA 3O5YA 4QY5A 3ZG0A 1EI5A 4XT2B 4WEJA 3T4LA 4DMZA 2PBYA 4X56A 1Y54A 2J9PA 3UDXA 5FAPA 4EBPA 2WK0A 1TS7A 1K54C 5FATA 3WS2A 2WUQA 1QMFA 2ZC5B 1TDGA 2W3EA 3UE3A 3O87A 3TSGA 4DN0A 5HSQA 3VP3A 4LFUA 2B18A 3UPOA 4S2NC 4Q0HA 4GDBA 4OQGA 1PZPA 5DF9A 1IELA 3KX0X 4IBRA 1HZOA 1S67L 5DF7A 3FV7A 1FOFA 2JKRI 4N1XA 5CHJA 3OOVA 3D9YA 4FH2A 4LCMA 2KLIA 4GLQA 3C8CA 1PFLA 3HLEA 1RGYA 3N6IA 4S2PA 5CHUA 1W63M 4S2NA 4LENA 1MC0A 1OJ5A 1K55A 1W8QA 4CPKA 4LRYC 4PKYA 4UQIS 3LIDA 5HL6A 4DKIA 4EETB 2VV7A 1X0OA 2EWVA 4IVKA 4IUHA 3ZG8B 2P7JA 4BQMA 1NZUA 1GSXA 3LO7A 3JPUA 4HESA 3P01A 3TOIA 2E8IA 3NCKA 4R4SA 2J80A 1KGGA 3UN7A 3B33A 2EFUA 1AWIA 4R6LA 2ZJ9A 4JXWA 1BT5A 5DTKA 2L1MA 3IXGA 3GSGA 3C38A 1PWGA 1VEUB 2ZD8A 1DJBA 1N9BA 3F1PB 4R1GA 2UWXA 1H8YA 3UB8A 5E2GA 2XSSA 4CLCB 2XH9A 3HLGA 2XDMA 1L2SA 4NG2A 5CGSA 4C6YA 1N4OA 3Q07A 5HARA 1PI4A 2GNXA 2Z6DA 1W5DA 3ICYA 1H8ZA 2AVXA 5F5YA 1Y28A 2B5RA 4AFIA 4PHTA 3PBQA 1YM1A 1CI8A 3MXRA 4P87A 3LIBA 2J3WA 4HJ4A 2VEAA 3NI9A 4FCFA 1K57C 2WZXA 5M19A 4OPYA 2EX6A 1D1JA 3RFBA 2D01A 2W3GA 3BQ8A 3GVBA 2Y59A 2ACGA 1BLSA 5DFYA 3V67A 3FYZA 3DW0A 4ID4A 4X1LA 4NXFA 3Q81A 3SH9A 2HJEA 5E2EA 2EX2A 4EBLA 4PM5A 3A3IA 4R38A 5J4EA 2V9AA 2ZMVA 5HDSA 3CUEC 1G68A 3CPTB 2C6WB 4E3IA 3TRCA 2HDSA 3K3CA 3M6HA 1DP9A 2QWSA 4B9OA 1PWCA 3O3VA 3HL9A 4KENB 3F1NA 5G4ZA 3QP5A 1XJ4A 3NJAA 1YLJA 2Y55A 3IX3A 3M2JA 1K38A 4B88A 5K5BA 3LEZA 1I2SA 1DY6A 3UE6A 3N8SA 3MBZA 4EQIA 3WRZA 4NETA 2KDKA 4JKTA 4HBUA 2C5WB 2J7VA 5EVIB 4UA6A 5CEDA 2FFFB 5GHZA 1L0FA 1RCJA 1PW8A 4XUXA 1SCWA 1N9OA 5HAPA 5FAOA 1FILA 2Y2HA 3RXXA 1F5MA 3IF5A 3GRJA 1L0DA 3U2AA 3IX4A 1AXBA 2HP9A 1ONHA 1RGZA 3IHAA 4MDZA 4R3AA 3T12B 1IYQA 1K6RA 3OCNA 4KUOA 3PYPA 4Q0IA 4CLCA 3TW8A 4K08A 2IWCA 4IJGA 5TR7A 1ERQA 4G3WA 4WYYA 2JKTM 5AQBA 1LI9A 5G18A 1VHMA 1XKZA 3ZG5A 4ZTKA 2OOLA 2FFYA 1BLCA 3CAXA 4I3JA 2OWHA 3Q1FA 1HVBA 1IKGA 1YSQA 2A3UA 3BW6A 3MQOA 3ZGAB 2Y2PA 1IEMA 3C30A 3MR0A 4KQRA 3T1RA 3HUNA 2PYRA 5JYPA 3VP4A 2BG1A 3MJQA 1OTDA 3PAGA 1CI9A 3BFDA 3EWKA 4WZ5C 4KZAA 2HJ9C 1L0GA 3BYDA 3Q7ZA 4JXGA 5TBMA 5HDCA 3WS1A 3R4KA 2Y2GA 2Y91A 1CQAA 2Y2KA 3CI6A 3VMAA 4MN6A 3BWLA 2XK1A 5J7EA 2V0UA 3IWOA 1S1YA 4NK3A 1MBLA 2P08A 3TG9A 4KQQA 5HPFA 5CXWA 2PHYA 3R7WB 5EVEA 4HJ6A 2M7VA 4JBFA 3PBTA 3P09A 1DRMA 4KQDA 2EX8A 4GKUA 1JTGA 4GCZA 1CF0A 3ITBA 4HH3A 1KOUA 2IA2A 1M40A 4F3LA 2H0YA 2WGIA 5J3WA 3LR3A 4E6XA 3PBRA 1M6KA 5E43A 4B4ZA 1ZG6A 3L9KA 5AQ9A 1W8YA 3ZYTA 5JYOA 5MC7A 1LL9A 2Y2NA 2CMNA 1YAXA 4MBFA 4P85A 1S4RA 4WBGA 3JVVA 3G2ZA 5EVIA 4HI4A 5CERA 1YLWA 3LR5A 3LUQA 2QYBA 3DTIA 1XPBA 3LIFA 2XEPA 5L2FA 2PR5A 3KYEA 4JGQA 3HLBA 2Z2LB 4ME4A 5FI7A 4IBXA 1MWRA 2VX8A 2XA7S 1ZC2A 5FEGA 2QKPA 3C7VA 3HCYA 1CK3A 3HLFA 5EM1A 2NUTC 2ZM8A 2VJWA 5IU1A 1ES3A 3FZCA 5EM0A 3CMZA 3SW1A 1ES2A 1S66L 4CLCC 4S2IA 4GDNA 1TS6A 2JKRM 2WAEA 2L4RA 3EGXC 1IYPA 4M3KA 3EEAA 5TGFA 1TEMA 3DTKA 2GJ3A 4OLDA 1W63Q 3VP0A 4QHCA 1E3UD 3OC2A 1MKMA 2PU4A 1A0KA 1VQQA 3UPPA 1BSGA 3OBFA 2B02A 4I38A 4ESPA 4KZ9A 5HX9A 1T1AA 4LRXC 4BBVA 3KSFA 1T18A 4DE0A 1UWPX 1SHVA 3FG8A 1YSPA 3V5MA 4WF0A 1FIKA 2PDRA 4L9EA 2W1TA 1S1ZA 3WS4A 2ZQ9A 2VGJA 1NY0A 3WS0A 3A3EA 4WN5A 3D4FA 3C4OA 4GJ4A 2WYXA 2H0TA 1KE3A 1ZG4A 2INWA 3LEQA 4CJNA 2ZL1B 2A24B 3OPPA 1FR1A 1PYYA 1FCNA 2PD8A 1W7FA 5KZHA 4EBNA 1MXOA 4BENA 2HPBA 3C5AA 1Q2PA 1JTDA 4H8RA 1KE0A 3EQUA 2CC1A 3IQAA 5DKLA 4OQIA 2H28A 5A91A 4DDSA 3NBLA 4E3KA 2DRWA 4OOYA 1K25A 3JVUA 4R0QA 1S0WA 1XGJA 1NLYA 2ZOIA 4X6TA 4RA7A 5IS1A 2G7UA 4EEUA 3OPRA 4MCWA 2JBFA 5AJGA 1GSVA 2EXBA 4MBHA 4L0LA 4BL2A 3GV9A 4PM7A 4GB7A 1CEFA 1XJ3A 2VV6A 2XR0A 3E0YA 4GHIB 4DE1A 4HY8A 2ZQ8A 4Z9QA 1FCOA 1E3UA 1BYWA 3ITAA 4Y7PA 4ZAMA 4KZ6A 4D60A 1NZOA 3FKVA 1DJAA 4PKYG 2DMWA 2HDUA 4WLAA 1QMEA 4OONA 4BMWA 4WL9A 1Z09A 2W3DA 1ZTUA 3OLOA 1XA7A 3ZVTA 2PAVP 4GD8A 4HP9A 3B42A 3C7UA 3A0RA 1VETB 4QPRA 1TS8A 2Z6CA 1UWNX 1TD5A 3GQZA 4YNRA 5AVFA 2WGWB 2ZM2A 5A8BA 1K6SA 3HLCA 1BZAA 3ZDJA 3IBJA 3QNBA 1I2WA 3A0SA 5FQ9A 2VKSA 4L9FA 3KSHA 5CRFA 3T4OA 1XXMA 2W3FA 4C3QA 3NHQA 3VP2A 1NWZA 4ZJ3A 1F98A 2L0WA 1KVMA 4NKPA 4DXCA 3MMHA 4OH0A 1CEGA 1H8MA 3BECA 3UE0A 3FWLA 4KZ7A 1OT6A 3N4IA 3HUMA 4HQAA 4UHUA 2XFSA 3PBOA 1GHIA 1GA9A 3FKWA 4KUKA 2XD1A 4ZDXA 1KDWA 3MZEA 4FTXA 5DTTA 2DCFA 4KZ4A 1OMEA 4DE2A 2ZLYA 2WADA 4JF6A 3W2ZA 4PMAA 3AGFA 3K3DA 1SDEA 3BJNA 4GZBA 3T1QB 3H7WB 3H82A 5DFXA 1MY8A 2WKRA 2Y4AA 4D2OA 3UMDA 2PT7A 2X01A 4EV4A 3LGOA 1NLZA 5HAIA 3Q82A 5F1GA 2BASA 1JNUA 1MWSA 1FSWA 3GR2A 2ZMFA 3IH9A 2R78A 3G32A 2J8YA 5GHXA 3IT9A 3CJMA 3IF6A 1K0KA 1XJ2A 2PU2A 4OQHA 2WKPA 3NIAA 4ZBEA 1MWTA 1SZVA 4ZRRA 4FOFA 3HJKA 4QWOA 3CLOA 3LR0A 4HJ3A 1J3WA 4EUVA 1IYSA 3T4QA 4XUZA 4DJ2A 4O01A 4YINA 4O8GA 4WZ5A 3BLSA 2FZ0A 2V8CA 3AGDA 3H9WA 1KGEA 4FSFA 1F2KA 4HNBA 3LI8A 4I3IA 3NULA 1TVFA 5DJUA 3HVFA 3WWXA 1SKOB 3HLDA 3T4TA 5GLBA 3SS5A 2GZAA 3SS3A 4YWZA 3EGDC 3A3JA 5FDHA 5EPHA 1GSWA 2XRNA 1JWZA 4EW7A 2P74A 1V9YA 2ZC7A 4E3OA 2XLNA 4P0MA 2IWDA 3E4PA 3CUEA 2M7UA 1EW0A 5FA7A 2ZC6B 3S4XA 2O9AA 4JGRA 3VOZA 3ISGA 2ZM0A 1F9IA 5FL3A 4X69A 1XJ6A 4G3VA 1YLZA 2YKHA 2XF3A 4WUJA 5GL9A 1EROA 2Y8HA 4I39A 4DXBA 3T50A 4MEZA 4R4RA 2WKHA 2RCXA 2W3HA 3G6OA 5EVIC 2P04A 3HLWA 3VOLA 5C5KA 3IXBA 4S2KA 3E98A 3OPLA 2Q0OA 1NRJA 3V3SA 4WMCD 3SH8A 3NOPC 4HBTA 1NYMA 2WKEA 3UMEA 2E8JA 1ES4A 2D02A 3KYZA 1H5XA 4F94A 3MZFA 5CHMA 4KZ8A 3S7OA 2WKIA 3DTMA 5EOOA 2NUPC 1C3BA 4EWFA 5KMWA 3W4QA 3T4KA 3IHBA 3MXQA 4NXBA 3ZQ5A 5HFOA 2WAFA 3VOYA 5F83A 4ETXA 1OTIA 2WGVA 2K7SA 1HLUP 2G2UA 2A49A 4QD4A 4K91A 1JVJA 4BL3A 3Q7VA 2HZ5A 4Z1WA 3LCEA 1K56A 3NY4A 4KG5A 2A2LA 4X55A 4OVDA 5L10A 1WA9A 1LL8A 5KSCA 3QP1A 2OAQ1 1L0EA 4WEKA 2ZBBA 3N8RA 1I5QA 2O0YA 3R7WA 1DP8A 4LRZE 4CLCD 1N9NA 3T1SA 4LGWA 3CHWP 1BLHA 3HREA 1YKDA 2X02A 5L09A 1XFNA 2Y2MA 5DJTA 3VV4A 3QP6A 2I72A 5IHVA 3VP1A 5FI6A 3DAVA 4RQ9A 1GCEA 3PTEA 1K57A 4U3TA 3PBNA 4JXVA 2ZQAA 3NOTC 4N9KA 1W79A 3BFCA 5HWVA 3IXHA 5HWWA 3S1YA 3NDGA 3OCLA 2XROA 3MZDA 4DJ3A 3PAEA 1OTBA 3LFVA 4N92A 1OPXA 3S7NA 3MKEA 5CTNA 5FQJA 1G5UA 1WYBA 5IT5A 3MSHA 2Y2LA 2LB5A 3E2LA 2V8FA 1WE4A 4GS9A 3O88A 5EFWA 4BLMA 4ARZA 3DWKA 4R70A 1PZOA 1H0MA 4HH2A 3VFHA 3MQQA 4H6JB 2FH5A 5FQKA 2B95A 1KE4A 4GHIA 4QY6A 5HW3A 2O9BA 1MPLA 4JGPA 1U60A 4HEFA 2G2WA 1GHMA 4RVAA 3IWIA 1P9RA 4K0WA 5CTMA 3KO6A 4PM8A 2Y79A 4PPRA 4MN5A 5FEFA 2Z2MB 4KG2A 3BFGA 4DRTA 4BD0A 4JF4A 4ZJ1A 1LL5A 3UB6A 3EOIA 5FQMA 3D3OA 3H7WA 2VV8A 3F1OA 5EVLA 3IX8A 3ULFA 3HJIA 3UPNA 3SOIA 4EESA 5F1FA 3DWZA 3IF6C 5F82A 2V2FF 3RH8B 3G35A 3BLMA 3B47A 2P9VB 4B93A 4MLLA 3MKFA 3S7QA 2Y2OA 5FDSA 1Z6FA 3RXWA 4EXOA 4BBUA 5CECA 3GDIA 1PNEA 1DP6A 5CGWA 3P7NA 3SS4A 3ZG9B 4UQIM 5BOHA 3WRTA 4MMNA 5DF8A 2ZQ7A 3MS6A 4GS9B 4G3KA 2A24A 2QZ6A 3BFFA 4RYEA 2YKFA 5HAQA 3FPVA 3C4PA 4BD1A 2JKFA 3LIAA 1ZKJA 5E2HA 3KYQA 3TE8A 3Q7VB 2V1AA 1CJFA 2I9VA 4O7DA 1XGIA 1ERMA 2HDRA 4LV0A 1K55C 3QHYA 4HHDA 1OT9A 5FI2A 3PHYA 5TFQA 2W1RA 5I5LA 5KIZA 2XD5A 4CQHA 3BQAA 2V0WA 1VETA 4PM9A 2VZWA 4E6WA 1SKOA 1P97A 3JYIA 2OLVA 1H3QA 2JC7A 3UDFA 4S2MA 1STZA 5HPIA 3ZVWA 4EEPA 3ZHHA 1K54A 3T4SA 5L07A 4P6ZS 4X1MA 4OP8A 3OZHA 4Q0JA 1T1CA 2EXAA 3G2YA 4XXRA 4II7A 4YOFA 2EWWA 2XA7M 2Y2QA 2HDQA 1BLPA 1YMXA 1HD8A 2OLUA 3UDIA 5E2FA 2W0NA 3EQVA 1MWUA 3I7JA 2W27A 5AVEA 3OPHA 2PD7A 2XGNA 3N7WA 4OOLA 4OPZA 1D7EA 1D06A 4M4XA 3VE4A 2JKGA 3F1PA 1P0ZA 4Y0OA 2VGLM 1Q2QA 5DVAA 3MFDA 3ZG7B 4DE3A 3UNWA 2QJ5A 2MJ6A 3IF6B 4MBKA 2VGKA 2Y2JA 5HL1A 1L3LA 2JCHA 1NRFA 4GW9A 4Q8IA 3EEHA 3SH7A 3IS2A 4X25A 5F6AA 3G4PA 2JN7A 1V9ZA 3NC8A 4E3MA 4KZ3A 1ONGA 1PRQA 1MZUA 1PW1A 3MF0A 2PBDP 1NJ4A 5FQQA 1K4FA 1RP5A 2ZL1A 1LT0A 1G6AA 4FD8A 5CEBA 5F68A 4PM6A 4KG6A 3HUOA 1YQSA 2HV1A 1PIOA 3PBSA 1BTLA 3V3RA 4CLCE 2QHKA 3ZNYA 1EWZA 1XX2A 4NXGA 3VE3A 3B3XA 3U4LP
chains in the Genus database with same CATH topology
2XEPA 5L2FA 5FATA 5EVIC 3HLWA 3WS2A 2WUQA 1FSYA 3IXBA 1QMFA 3HLBA 2ZC5B 3CG5A 3CZDA 2Z2LB 5FI7A 4S2KA 4IBXA 1MWRA 3OPLA 1TDGA 3UE3A 1ZC2A 4WZ4A 4DXBA 3V3SA 3O87A 3TSGA 5U47A 4WMCD 3VP3A 3C7VA 3SH8A 1CK3A 3UPOA 4S2NC 4U0TA 3HLFA 4GDBA 4HBTA 1NYMA 2WKEA 4OQGA 1PZPA 5DF9A 2ZM8A 4OKPA 1IELA 1ES4A 1ES3A 1H5XA 3FZCA 3CMZA 4F94A 3MZFA 4IBRA 5CHMA 1ES2A 4KZ8A 1HZOA 4S2IA 5DF7A 2WKIA 3FV7A 2JE5A 4GDNA 3DTMA 1FOFA 4N1XA 5CHJA 5EOOA 2WAEA 1C3BA 4EWFA 4GOGA 5KMWA 1KGFA 3W4QA 1SKFA 4FH2A 4LCMA 4UA9A 1O7EA 3IHBA 1IYPA 4M3KA 1O07A 3HLEA 4R23A 1RGYA 3N6IA 5TGFA 1TEMA 3BM6A 5HFOA 3S22A 4S2PA 4OLDA 5CHUA 2WAFA 3VP0A 4QHCA 1E3UD 4S2NA 3VOYA 4LENA 3OC2A 2PU4A 1K55A 5F83A 4DDYA 1W8QA 1VQQA 4CPKA 3UPPA 1BSGA 4DKIA 2WGVA 4R3BA 5A93A 4IVKA 2G2UA 2A49A 3G31A 4KZ9A 5AQ7A 3ZG8B 2J9OA 4QD4A 3V50A 2DNSA 4K91A 3GTCA 5HX9A 1JVJA 4BQMA 1NZUA 3Q7VA 4BL3A 3LO7A 4JLFA 3LCEA 1K56A 3NY4A 4HESA 4K0XA 4KG5A 1PWDA 3TOIA 4DE0A 5CGXA 1SHVA 2E8IA 3V5MA 4X55A 4GNUA 4A5RA 2R9WA 4OVDA 2WGWA 3NCKA 4R4SA 3UY6A 1LLBA 5KSCA 3VSKA 1KGGA 1NYYA 1L0EA 4WEKA 3WS4A 5EE8A 2ZQ9A 2VGJA 3UN7A 3N8RA 1NY0A 5FQIA 2EFUA 3WS0A 1I5QA 5GLDA 3O86A 3A3EA 2ZJ9A 4JXWA 1DJCA 3D4FA 4RX3A 2BLSA 1BT5A 1YLYA 3C4OA 5DTKA 2WYXA 2H0TA 1BLHA 3HREA 1KE3A 1ZG4A 4C75A 3IXGA 2X02A 2Y2MA 3GSGA 4CJNA 4E3LA 3G30A 3OPPA 1FR1A 1PWGA 1PYYA 2ZD8A 1DJBA 1FCNA 5M18A 1N9BA 2I72A 1W7FA 3G34A 3P98A 5IHVA 1MXOA 4BENA 3VP1A 4EBNA 5KZHA 5FI6A 4R1GA 2HPBA 2UWXA 3C5AA 1H8YA 5E2GA 1Q2PA 1GCEA 3PTEA 1K57A 1JTDA 4H8RA 4OOMA 3BRMA 4U3TA 3PBNA 1KE0A 1YMSA 3EQUA 2ZQAA 4JXVA 2CC1A 3IQAA 4N9KA 4Y0UA 1W79A 2XH9A 4OQIA 3HLGA 5A91A 4DDSA 2XDMA 1L2SA 3BFCA 3IXHA 3NBLA 3S1YA 4E3KA 5CGSA 5D3OA 4C6YA 1N4OA 3NDGA 3OCLA 3Q07A 2RL3A 5DTSA 5HARA 1PI4A 2DRWA 3MZDA 4OOYA 1FCMA 1K25A 3PAEA 4LV3A 4R0QA 1S0WA 1XGJA 4X6TA 5M1AA 1W5DA 1FQGA 1H8ZA 4N92A 4RA7A 2IWBA 5A92A 3MKEA 1GA0A 2B5RA 5CTNA 4N9LA 5FQJA 1VM1A 3GMWA 3PBQA 1YM1A 3W8KA 1WYBA 1CI8A 2H5SA 3E2KA 2Y2LA 3MXRA 3OPRA 1XA1A 2JBFA 3E2LA 5I94A 1WE4A 4P87A 4LCLA 3N8LA 3O88A 2V20A 4BLMA 3NI9A 4FCFA 1WYCA 3AGEA 2EXBA 3DWKA 1K57C 2WZXA 5M19A 4OPYA 5EUAA 1PZOA 4QU3A 2EX6A 3VFHA 3V39A 1E4DA 1BUEA 4MBHA 3GVBA 4L0LA 5FQKA 4BL2A 3GV9A 2Y59A 4PM7A 4GB7A 1CEFA 1PI5A 1BLSA 2XR0A 4GN2A 2R9XA 1KE4A 3FYZA 1IKIA 1ESIA 3DW0A 1KDSA 4ID4A 4QY6A 4DE1A 5HW3A 2ZQ8A 3IXDA 4Z9QA 1FCOA 1MPLA 3Q81A 1U60A 4HEFA 5E2EA 2G2WA 1E3UA 3SH9A 1GHMA 2EX2A 4RVAA 4EBLA 4PM5A 3A3IA 3IWIA 3ITAA 3UO9A 4Y7PA 4K0WA 4JXSA 4OPQA 5CTMA 4ZAMA 1J9MA 4LV1A 4KZ6A 1XP4A 4PM8A 1NZOA 1KVLA 3FKVA 4PPRA 2Z2MB 1DJAA 3M6BA 2HDUA 1G68A 5EOEA 4KG2A 3BFGA 2C6WB 4DRTA 4E3IA 1QMEA 4OONA 2HDSA 4BD0A 3M6HA 4JF4A 4ZJ1A 1LL5A 3UE1A 4DF6A 5FQMA 5EVLA 1XA7A 3ZVTA 4JPMA 1PWCA 3ZNTA 1YT4A 3O3VA 3HL9A 4GD8A 4KENB 3SOIA 3UPNA 5F1FA 3BFEA 3DWZA 3IF6C 1YLJA 5F82A 2Y55A 2V2FF 3RJUA 3G35A 3BLMA 3C7UA 3WS5A 3M2JA 2P9VB 1K38A 4B88A 1YLPA 3MXSA 3LEZA 1K56D 4IEDA 4MLLA 3MKFA 3GQZA 1I2SA 2Y2OA 4X53A 1DY6A 1Z6FA 2WGWB 2ZM2A 2ZQCA 3N8SA 1ESUA 1K6SA 1BZAA 3HLCA 3MBZA 3WRZA 4EQIA 2ZC4B 3ZDJA 4NETA 3QNBA 1I2WA 3BEBA 5CECA 4JKTA 4HBUA 2C5WB 2J7VA 1E25A 5FQ9A 5EVIB 5CGWA 4GD6A 5CRFA 3SS4A 4UA6A 3ZG9B 5BOHA 5CEDA 2FFFB 3HBRA 5GHZA 4OQ0A 4RX2A 1L0FA 1XXMA 1RCJA 1PW8A 4XUXA 3WRTA 1ES5A 4KZ5A 1SCWA 4C3QA 5DF8A 2ZQ7A 5EECA 3VP2A 4UA7A 4ZJ3A 5AQAA 5HAPA 1IYOA 2QZ6A 3BFFA 4RYEA 5FAOA 1KVMA 1JWPA 1K4EA 2Y2HA 3RXXA 4DXCA 5HAQA 1SDNA 4OH0A 1CEGA 1GHPA 3BECA 3C4PA 3UE0A 4BD1A 3FWLA 4KZ7A 1ZKJA 3B3XA 2ZQDA 3GRJA 3IF5A 3HUMA 3N4IA 5E2HA 1L0DA 4UHUA 3VSLA 3Q7VB 4S2JA 1AXBA 2XFSA 3PBOA 2HP9A 1GHIA 2OV5A 5EVID 1GA9A 1ONHA 1RGZA 1XGIA 4O7DA 2XFTA 3IHAA 1ERMA 4R3JA 2HDRA 3FKWA 4LV0A 1K55C 4ZDXA 2XD1A 3LY4A 3QHYA 4KQOA 1IYQA 1KDWA 1K6RA 3MZEA 3OCNA 5FI2A 5GLAA 5DTTA 2DCFA 1K54C 4KZ4A 5TFQA 1OMEA 2XD5A 4DE2A 2IWCA 2ZLYA 4LV2A 2WADA 4JF6A 2P9VA 4PM9A 4PMAA 1HTZA 4S2OA 5TR7A 1ERQA 4Y0TA 5KSHA 4E6WA 3AGFA 3JYIA 5FAQA 4WYYA 2HP5A 5AQBA 1JWVA 1SDEA 2OLVA 2JC7A 3UDFA 1LI9A 5G18A 4S2MA 2ZC3B 4GZBA 3ZVWA 1XKZA 3NDEA 3ZG5A 4ZTKA 3ZHHA 1K54A 4WELA 4B4XA 4E3NA 5A90A 1LHYA 1MY8A 2FFYA 2Y4AA 1BLCA 4D2OA 4OP8A 3OZHA 2WZZA 3Q1FA 2X01A 1HVBA 1IKGA 4EV4A 2EXAA 4OPRA 3G2YA 3VFFA 5FASA 4X68A 4XXRA 5HAIA 2A3UA 3Q82A 5F1GA 4ZJ2A 5GLCA 3ZGAB 2Y2PA 1MWSA 1FSWA 1IEMA 3GR2A 1NXYA 3IH8A 3IH9A 3A3DA 2J8YA 2Y2QA 3G32A 3IT9A 2HDQA 4KQRA 5GHXA 3CJMA 3IF6A 4QJGA 2PU2A 3HUNA 1BLPA 4OQHA 4KZBA 3NIAA 4ZBEA 5JYPA 3VP4A 1MWTA 1YMXA 1ALQA 1HD8A 2BG1A 2OLUA 4IVIA 3A3FA 5E2FA 3UDIA 2Q9MA 1BULA 1MWUA 3EQVA 3I7JA 3PAGA 4QB8A 1CI9A 2QMIA 3OPHA 2XGNA 4P6BA 5GHYA 4MNRA 3N7WA 4OOLA 3BFDA 2GDNA 4OPZA 4WZ5C 1FR6A 1TDLA 2ZMAA 3ZFZA 4KZAA 1IYSA 3IWQA 1L0GA 3BYDA 2X71A 3Q7ZA 4JXGA 4XUZA 4YINA 3WS1A 4OP5A 4WZ5A 4Y0OA 3BLSA 2Y2GA 2Y91A 3M2KA 3AGDA 2Y2KA 1Q2QA 3VMAA 3LY3A 5DVAA 1KGEA 4FSFA 2XK1A 4JF5A 3MFDA 4WMCA 3IWOA 3ZG7B 3UNWA 4DE3A 4NK3A 1MBLA 3IF6B 4MBKA 3TG9A 2VGKA 2Y2JA 5HL1A 4BJPA 2Q9NA 1TVFA 2JCHA 4KQQA 3W4OA 1NRFA 4Q8IA 4EUZA 3RXWA 3HVFA 5CXWA 3WWXA 3SH7A 4UAAA 2Y2IA 5FSRA 3G4PA 4OLGA 4JBFA 3PBTA 3HLDA 3P09A 2QPNA 5GLBA 4S2LA 3SS5A 3W4PA 2EX8A 3NC8A 4E3MA 2V1ZA 4U0XA 3SS3A 4GKUA 1JTGA 3A3JA 5FDHA 5EPHA 1YLTA 4KZ3A 1ONGA 3ITBA 1JWZA 2HP6A 1PW1A 2OSUA 2P74A 5J8XA 1M40A 2ZC7A 1NJ4A 4YFMA 4E3OA 2H0YA 2WGIA 1LI0A 2XLNA 4P0MA 2XQZA 2IWDA 5FQQA 1K4FA 4E6XA 1RP5A 3QNCA 4WM9A 5FA7A 1S6RA 2ZC6B 2EX9A 3PBRA 1M6KA 3S4XA 1G6AA 4FD8A 5CEBA 5E43A 3VOZA 3ISGA 4B4ZA 4E3JA 2ZM0A 4PM6A 2H10A 1ZG6A 4FH4A 4KG6A 5AQ9A 3HUOA 1YQSA 4X69A 1W8YA 1PIOA 3PBSA 5JYOA 1MKIA 1BTLA 1LL9A 3ZCZA 2Y2NA 2EFXA 4N1HA 3V3RA 4MBFA 1YLZA 4P85A 4QY5A 4WBGA 2XF3A 3ZG0A 1EI5A 5GL9A 3G2ZA 4WEJA 3ZNYA 1EROA 5EVIA 5CERA 2PBYA 1EWZA 1Y54A 1XX2A 1YLWA 2J9PA 4X56A 5FAPA 4MEZA 3UDXA 4R4RA 4EBPA 2WK0A 1XPBA 2WKHA 2RCXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XEP A;  5L2F A;  5FAT A;  5EVI C;  3HLW A;  3WS2 A;  2WUQ A;  1FSY A;  3IXB A;  1QMF A;  3HLB A;  2ZC5 B;  3CG5 A;  3CZD A;  2Z2L B;  5FI7 A;  4S2K A;  4IBX A;  1MWR A;  3OPL A;  1TDG A;  3UE3 A;  1ZC2 A;  4WZ4 A;  4DXB A;  3V3S A;  3O87 A;  3TSG A;  5U47 A;  4WMC D;  3VP3 A;  3C7V A;  3SH8 A;  1CK3 A;  3UPO A;  4S2N C;  4U0T A;  3HLF A;  4GDB A;  4HBT A;  1NYM A;  2WKE A;  4OQG A;  1PZP A;  5DF9 A;  2ZM8 A;  4OKP A;  1IEL A;  1ES4 A;  1ES3 A;  1H5X A;  3FZC A;  3CMZ A;  4F94 A;  3MZF A;  4IBR A;  5CHM A;  1ES2 A;  4KZ8 A;  1HZO A;  4S2I A;  5DF7 A;  2WKI A;  3FV7 A;  2JE5 A;  4GDN A;  3DTM A;  1FOF A;  4N1X A;  5CHJ A;  5EOO A;  2WAE A;  1C3B A;  4EWF A;  4GOG A;  5KMW A;  1KGF A;  3W4Q A;  1SKF A;  4FH2 A;  4LCM A;  4UA9 A;  1O7E A;  3IHB A;  1IYP A;  4M3K A;  1O07 A;  3HLE A;  4R23 A;  1RGY A;  3N6I A;  5TGF A;  1TEM A;  3BM6 A;  5HFO A;  3S22 A;  4S2P A;  4OLD A;  5CHU A;  2WAF A;  3VP0 A;  4QHC A;  1E3U D;  4S2N A;  3VOY A;  4LEN A;  3OC2 A;  2PU4 A;  1K55 A;  5F83 A;  4DDY A;  1W8Q A;  1VQQ A;  4CPK A;  3UPP A;  1BSG A;  4DKI A;  2WGV A;  4R3B A;  5A93 A;  4IVK A;  2G2U A;  2A49 A;  3G31 A;  4KZ9 A;  5AQ7 A;  3ZG8 B;  2J9O A;  4QD4 A;  3V50 A;  2DNS A;  4K91 A;  3GTC A;  5HX9 A;  1JVJ A;  4BQM A;  1NZU A;  3Q7V A;  4BL3 A;  3LO7 A;  4JLF A;  3LCE A;  1K56 A;  3NY4 A;  4HES A;  4K0X A;  4KG5 A;  1PWD A;  3TOI A;  4DE0 A;  5CGX A;  1SHV A;  2E8I A;  3V5M A;  4X55 A;  4GNU A;  4A5R A;  2R9W A;  4OVD A;  2WGW A;  3NCK A;  4R4S A;  3UY6 A;  1LLB A;  5KSC A;  3VSK A;  1KGG A;  1NYY A;  1L0E A;  4WEK A;  3WS4 A;  5EE8 A;  2ZQ9 A;  2VGJ A;  3UN7 A;  3N8R A;  1NY0 A;  5FQI A;  2EFU A;  3WS0 A;  1I5Q A;  5GLD A;  3O86 A;  3A3E A;  2ZJ9 A;  4JXW A;  1DJC A;  3D4F A;  4RX3 A;  2BLS A;  1BT5 A;  1YLY A;  3C4O A;  5DTK A;  2WYX A;  2H0T A;  1BLH A;  3HRE A;  1KE3 A;  1ZG4 A;  4C75 A;  3IXG A;  2X02 A;  2Y2M A;  3GSG A;  4CJN A;  4E3L A;  3G30 A;  3OPP A;  1FR1 A;  1PWG A;  1PYY A;  2ZD8 A;  1DJB A;  1FCN A;  5M18 A;  1N9B A;  2I72 A;  1W7F A;  3G34 A;  3P98 A;  5IHV A;  1MXO A;  4BEN A;  3VP1 A;  4EBN A;  5KZH A;  5FI6 A;  4R1G A;  2HPB A;  2UWX A;  3C5A A;  1H8Y A;  5E2G A;  1Q2P A;  1GCE A;  3PTE A;  1K57 A;  1JTD A;  4H8R A;  4OOM A;  3BRM A;  4U3T A;  3PBN A;  1KE0 A;  1YMS A;  3EQU A;  2ZQA A;  4JXV A;  2CC1 A;  3IQA A;  4N9K A;  4Y0U A;  1W79 A;  2XH9 A;  4OQI A;  3HLG A;  5A91 A;  4DDS A;  2XDM A;  1L2S A;  3BFC A;  3IXH A;  3NBL A;  3S1Y A;  4E3K A;  5CGS A;  5D3O A;  4C6Y A;  1N4O A;  3NDG A;  3OCL A;  3Q07 A;  2RL3 A;  5DTS A;  5HAR A;  1PI4 A;  2DRW A;  3MZD A;  4OOY A;  1FCM A;  1K25 A;  3PAE A;  4LV3 A;  4R0Q A;  1S0W A;  1XGJ A;  4X6T A;  5M1A A;  1W5D A;  1FQG A;  1H8Z A;  4N92 A;  4RA7 A;  2IWB A;  5A92 A;  3MKE A;  1GA0 A;  2B5R A;  5CTN A;  4N9L A;  5FQJ A;  1VM1 A;  3GMW A;  3PBQ A;  1YM1 A;  3W8K A;  1WYB A;  1CI8 A;  2H5S A;  3E2K A;  2Y2L A;  3MXR A;  3OPR A;  1XA1 A;  2JBF A;  3E2L A;  5I94 A;  1WE4 A;  4P87 A;  4LCL A;  3N8L A;  3O88 A;  2V20 A;  4BLM A;  3NI9 A;  4FCF A;  1WYC A;  3AGE A;  2EXB A;  3DWK A;  1K57 C;  2WZX A;  5M19 A;  4OPY A;  5EUA A;  1PZO A;  4QU3 A;  2EX6 A;  3VFH A;  3V39 A;  1E4D A;  1BUE A;  4MBH A;  3GVB A;  4L0L A;  5FQK A;  4BL2 A;  3GV9 A;  2Y59 A;  4PM7 A;  4GB7 A;  1CEF A;  1PI5 A;  1BLS A;  2XR0 A;  4GN2 A;  2R9X A;  1KE4 A;  3FYZ A;  1IKI A;  1ESI A;  3DW0 A;  1KDS A;  4ID4 A;  4QY6 A;  4DE1 A;  5HW3 A;  2ZQ8 A;  3IXD A;  4Z9Q A;  1FCO A;  1MPL A;  3Q81 A;  1U60 A;  4HEF A;  5E2E A;  2G2W A;  1E3U A;  3SH9 A;  1GHM A;  2EX2 A;  4RVA A;  4EBL A;  4PM5 A;  3A3I A;  3IWI A;  3ITA A;  3UO9 A;  4Y7P A;  4K0W A;  4JXS A;  4OPQ A;  5CTM A;  4ZAM A;  1J9M A;  4LV1 A;  4KZ6 A;  1XP4 A;  4PM8 A;  1NZO A;  1KVL A;  3FKV A;  4PPR A;  2Z2M B;  1DJA A;  3M6B A;  2HDU A;  1G68 A;  5EOE A;  4KG2 A;  3BFG A;  2C6W B;  4DRT A;  4E3I A;  1QME A;  4OON A;  2HDS A;  4BD0 A;  3M6H A;  4JF4 A;  4ZJ1 A;  1LL5 A;  3UE1 A;  4DF6 A;  5FQM A;  5EVL A;  1XA7 A;  3ZVT A;  4JPM A;  1PWC A;  3ZNT A;  1YT4 A;  3O3V A;  3HL9 A;  4GD8 A;  4KEN B;  3SOI A;  3UPN A;  5F1F A;  3BFE A;  3DWZ A;  3IF6 C;  1YLJ A;  5F82 A;  2Y55 A;  2V2F F;  3RJU A;  3G35 A;  3BLM A;  3C7U A;  3WS5 A;  3M2J A;  2P9V B;  1K38 A;  4B88 A;  1YLP A;  3MXS A;  3LEZ A;  1K56 D;  4IED A;  4MLL A;  3MKF A;  3GQZ A;  1I2S A;  2Y2O A;  4X53 A;  1DY6 A;  1Z6F A;  2WGW B;  2ZM2 A;  2ZQC A;  3N8S A;  1ESU A;  1K6S A;  1BZA A;  3HLC A;  3MBZ A;  3WRZ A;  4EQI A;  2ZC4 B;  3ZDJ A;  4NET A;  3QNB A;  1I2W A;  3BEB A;  5CEC A;  4JKT A;  4HBU A;  2C5W B;  2J7V A;  1E25 A;  5FQ9 A;  5EVI B;  5CGW A;  4GD6 A;  5CRF A;  3SS4 A;  4UA6 A;  3ZG9 B;  5BOH A;  5CED A;  2FFF B;  3HBR A;  5GHZ A;  4OQ0 A;  4RX2 A;  1L0F A;  1XXM A;  1RCJ A;  1PW8 A;  4XUX A;  3WRT A;  1ES5 A;  4KZ5 A;  1SCW A;  4C3Q A;  5DF8 A;  2ZQ7 A;  5EEC A;  3VP2 A;  4UA7 A;  4ZJ3 A;  5AQA A;  5HAP A;  1IYO A;  2QZ6 A;  3BFF A;  4RYE A;  5FAO A;  1KVM A;  1JWP A;  1K4E A;  2Y2H A;  3RXX A;  4DXC A;  5HAQ A;  1SDN A;  4OH0 A;  1CEG A;  1GHP A;  3BEC A;  3C4P A;  3UE0 A;  4BD1 A;  3FWL A;  4KZ7 A;  1ZKJ A;  3B3X A;  2ZQD A;  3GRJ A;  3IF5 A;  3HUM A;  3N4I A;  5E2H A;  1L0D A;  4UHU A;  3VSL A;  3Q7V B;  4S2J A;  1AXB A;  2XFS A;  3PBO A;  2HP9 A;  1GHI A;  2OV5 A;  5EVI D;  1GA9 A;  1ONH A;  1RGZ A;  1XGI A;  4O7D A;  2XFT A;  3IHA A;  1ERM A;  4R3J A;  2HDR A;  3FKW A;  4LV0 A;  1K55 C;  4ZDX A;  2XD1 A;  3LY4 A;  3QHY A;  4KQO A;  1IYQ A;  1KDW A;  1K6R A;  3MZE A;  3OCN A;  5FI2 A;  5GLA A;  5DTT A;  2DCF A;  1K54 C;  4KZ4 A;  5TFQ A;  1OME A;  2XD5 A;  4DE2 A;  2IWC A;  2ZLY A;  4LV2 A;  2WAD A;  4JF6 A;  2P9V A;  4PM9 A;  4PMA A;  1HTZ A;  4S2O A;  5TR7 A;  1ERQ A;  4Y0T A;  5KSH A;  4E6W A;  3AGF A;  3JYI A;  5FAQ A;  4WYY A;  2HP5 A;  5AQB A;  1JWV A;  1SDE A;  2OLV A;  2JC7 A;  3UDF A;  1LI9 A;  5G18 A;  4S2M A;  2ZC3 B;  4GZB A;  3ZVW A;  1XKZ A;  3NDE A;  3ZG5 A;  4ZTK A;  3ZHH A;  1K54 A;  4WEL A;  4B4X A;  4E3N A;  5A90 A;  1LHY A;  1MY8 A;  2FFY A;  2Y4A A;  1BLC A;  4D2O A;  4OP8 A;  3OZH A;  2WZZ A;  3Q1F A;  2X01 A;  1HVB A;  1IKG A;  4EV4 A;  2EXA A;  4OPR A;  3G2Y A;  3VFF A;  5FAS A;  4X68 A;  4XXR A;  5HAI A;  2A3U A;  3Q82 A;  5F1G A;  4ZJ2 A;  5GLC A;  3ZGA B;  2Y2P A;  1MWS A;  1FSW A;  1IEM A;  3GR2 A;  1NXY A;  3IH8 A;  3IH9 A;  3A3D A;  2J8Y A;  2Y2Q A;  3G32 A;  3IT9 A;  2HDQ A;  4KQR A;  5GHX A;  3CJM A;  3IF6 A;  4QJG A;  2PU2 A;  3HUN A;  1BLP A;  4OQH A;  4KZB A;  3NIA A;  4ZBE A;  5JYP A;  3VP4 A;  1MWT A;  1YMX A;  1ALQ A;  1HD8 A;  2BG1 A;  2OLU A;  4IVI A;  3A3F A;  5E2F A;  3UDI A;  2Q9M A;  1BUL A;  1MWU A;  3EQV A;  3I7J A;  3PAG A;  4QB8 A;  1CI9 A;  2QMI A;  3OPH A;  2XGN A;  4P6B A;  5GHY A;  4MNR A;  3N7W A;  4OOL A;  3BFD A;  2GDN A;  4OPZ A;  4WZ5 C;  1FR6 A;  1TDL A;  2ZMA A;  3ZFZ A;  4KZA A;  1IYS A;  3IWQ A;  1L0G A;  3BYD A;  2X71 A;  3Q7Z A;  4JXG A;  4XUZ A;  4YIN A;  3WS1 A;  4OP5 A;  4WZ5 A;  4Y0O A;  3BLS A;  2Y2G A;  2Y91 A;  3M2K A;  3AGD A;  2Y2K A;  1Q2Q A;  3VMA A;  3LY3 A;  5DVA A;  1KGE A;  4FSF A;  2XK1 A;  4JF5 A;  3MFD A;  4WMC A;  3IWO A;  3ZG7 B;  3UNW A;  4DE3 A;  4NK3 A;  1MBL A;  3IF6 B;  4MBK A;  3TG9 A;  2VGK A;  2Y2J A;  5HL1 A;  4BJP A;  2Q9N A;  1TVF A;  2JCH A;  4KQQ A;  3W4O A;  1NRF A;  4Q8I A;  4EUZ A;  3RXW A;  3HVF A;  5CXW A;  3WWX A;  3SH7 A;  4UAA A;  2Y2I A;  5FSR A;  3G4P A;  4OLG A;  4JBF A;  3PBT A;  3HLD A;  3P09 A;  2QPN A;  5GLB A;  4S2L A;  3SS5 A;  3W4P A;  2EX8 A;  3NC8 A;  4E3M A;  2V1Z A;  4U0X A;  3SS3 A;  4GKU A;  1JTG A;  3A3J A;  5FDH A;  5EPH A;  1YLT A;  4KZ3 A;  1ONG A;  3ITB A;  1JWZ A;  2HP6 A;  1PW1 A;  2OSU A;  2P74 A;  5J8X A;  1M40 A;  2ZC7 A;  1NJ4 A;  4YFM A;  4E3O A;  2H0Y A;  2WGI A;  1LI0 A;  2XLN A;  4P0M A;  2XQZ A;  2IWD A;  5FQQ A;  1K4F A;  4E6X A;  1RP5 A;  3QNC A;  4WM9 A;  5FA7 A;  1S6R A;  2ZC6 B;  2EX9 A;  3PBR A;  1M6K A;  3S4X A;  1G6A A;  4FD8 A;  5CEB A;  5E43 A;  3VOZ A;  3ISG A;  4B4Z A;  4E3J A;  2ZM0 A;  4PM6 A;  2H10 A;  1ZG6 A;  4FH4 A;  4KG6 A;  5AQ9 A;  3HUO A;  1YQS A;  4X69 A;  1W8Y A;  1PIO A;  3PBS A;  5JYO A;  1MKI A;  1BTL A;  1LL9 A;  3ZCZ A;  2Y2N A;  2EFX A;  4N1H A;  3V3R A;  4MBF A;  1YLZ A;  4P85 A;  4QY5 A;  4WBG A;  2XF3 A;  3ZG0 A;  1EI5 A;  5GL9 A;  3G2Z A;  4WEJ A;  3ZNY A;  1ERO A;  5EVI A;  5CER A;  2PBY A;  1EWZ A;  1Y54 A;  1XX2 A;  1YLW A;  2J9P A;  4X56 A;  5FAP A;  4MEZ A;  3UDX A;  4R4R A;  4EBP A;  2WK0 A;  1XPB A;  2WKH A;  2RCX A; 
#chains in the Genus database with same CATH topology
 5LBR A;  1FSY A;  2HF6 A;  3CG5 A;  3CZD A;  2KOI A;  1IOU A;  4WZ4 A;  5CX7 A;  4HOI A;  5U47 A;  2V1B A;  4U0T A;  3F1O B;  4OKP A;  1LSV A;  3BY8 A;  2PRF A;  2UV0 E;  3T4J A;  2JE5 A;  1TF1 A;  3TJZ C;  5F69 A;  4GOG A;  1KGF A;  1SKF A;  4UA9 A;  1O7E A;  1O07 A;  4R23 A;  1OTA A;  3BM6 A;  3S22 A;  2O9C A;  2ZOH A;  1G6O A;  4DDY A;  3FC7 A;  3CWF A;  4R3B A;  4EER A;  5A93 A;  4NXE A;  3G31 A;  5AQ7 A;  2J9O A;  3V50 A;  2DNS A;  3GTC A;  3S7P A;  3PR6 A;  3QP8 A;  4JLF A;  4K0X A;  1PWD A;  5CGX A;  3PXP A;  4MN7 A;  4GNU A;  4A5R A;  2R9W A;  3KSI A;  4I5S A;  2WGW A;  3UY6 A;  4BBT A;  1LLB A;  3VSK A;  1NYY A;  5EE8 A;  4JGO A;  4EU0 A;  5FQI A;  5GLD A;  3O86 A;  3DBA A;  1DJC A;  4RX3 A;  1VB6 A;  2BLS A;  1YLY A;  5L8M A;  2J3T C;  4C75 A;  3QP2 A;  3RTY A;  4E3L A;  3G30 A;  1VEU A;  5M18 A;  3G34 A;  3P98 A;  2EA9 A;  2LB9 A;  4OOM A;  4Y17 A;  3BRM A;  1YMS A;  4Y0U A;  1IFQ A;  3K2N A;  3UB9 A;  5D3O A;  2RL3 A;  5DTS A;  5TJJ A;  1FCM A;  4LV3 A;  3D72 A;  5M1A A;  1FQG A;  2IWB A;  5A92 A;  1GA0 A;  3LYX A;  4N9L A;  2GX5 A;  1VM1 A;  3GMW A;  3W8K A;  1LSX A;  2H5S A;  3E2K A;  2K2N A;  1XA1 A;  2VK3 A;  2BTF P;  5I94 A;  4LCL A;  3N8L A;  2V20 A;  5HWT A;  1WYC A;  3UB7 A;  3AGE A;  2VLG A;  5EUA A;  4QU3 A;  3V39 A;  1E4D A;  3IS2 B;  1BUE A;  3F1N B;  3CPT A;  1PI5 A;  4HIA A;  4GN2 A;  2R9X A;  1IKI A;  4FUW A;  1ESI A;  1KDS A;  3IXD A;  4UEY A;  1G28 A;  4LPZ A;  3UO9 A;  4IUK A;  5TBM B;  4NEE D;  4JXS A;  4OPQ A;  4Y5F A;  1J9M A;  4LV1 A;  1N9L A;  1XP4 A;  1KVL A;  5G4Y A;  3M6B A;  5EOE A;  4H6J A;  3UE1 A;  5HD3 A;  4DF6 A;  4JPM A;  3ZNT A;  1YT4 A;  3BFE A;  3RJU A;  3WS5 A;  3NOU C;  1P9W A;  2W1T B;  1LSW A;  3MXS A;  4IED A;  1YLP A;  1K56 D;  3FPW A;  1TS0 A;  1ODV A;  4ARZ B;  4X53 A;  2JKT I;  2ZQC A;  1ESU A;  2ZC4 B;  2OAP 1;  3BEB A;  1E25 A;  4GD6 A;  1OJG A;  2HGV A;  4HP4 A;  3HBR A;  3SZT A;  4OQ0 A;  4RX2 A;  2VGL S;  3L7H A;  1ES5 A;  4KZ5 A;  2KX6 A;  5EEC A;  4UA7 A;  5AQA A;  1IYO A;  1JWP A;  1K4E A;  1SDN A;  1GHP A;  4IHQ A;  2QJ7 A;  2J3T D;  2ZQD A;  3VSL A;  4S2J A;  2OV5 A;  5EVI D;  3E4O A;  3A0V A;  2XFT A;  4R3J A;  3LY4 A;  4KQO A;  5GLA A;  3NEC A;  2JHE A;  4EQ1 A;  4LV2 A;  2P9V A;  4Y0T A;  1HTZ A;  4S2O A;  5KSH A;  4P6Z M;  5FAQ A;  2HP5 A;  1JWV A;  3LI9 A;  5HD5 A;  2OWJ A;  2ZC3 B;  3NDE A;  4B4X A;  4E3N A;  3MQ0 A;  4WEL A;  5A90 A;  1LHY A;  4Y2F A;  4Y3I A;  3C2W A;  2WZZ A;  3UB5 P;  1XFQ A;  4OPR A;  4E04 A;  3VFF A;  5FAS A;  4X68 A;  4ZJ2 A;  5GLC A;  1UGU A;  1NXY A;  4Y15 A;  1S4S A;  3IH8 A;  5HZH A;  3A3D A;  3BY9 A;  4QJG A;  1T19 A;  4KZB A;  1ALQ A;  4IVI A;  3A3F A;  2Q9M A;  1BUL A;  2PYP A;  4QB8 A;  3KSG A;  1T1B A;  3CIT A;  3DTE A;  2QMI A;  3QP4 A;  4P6B A;  5GHY A;  4MNR A;  2GDN A;  1FR6 A;  1TDL A;  2ZMA A;  3ZFZ A;  2K31 A;  3IWQ A;  1ACF A;  2X71 A;  3H82 B;  4OP5 A;  4XT2 A;  4O0P A;  3M2K A;  3LY3 A;  1OTE A;  4JF5 A;  3LIE A;  5HDD A;  4WMC A;  4F3L B;  4BJP A;  2Q9N A;  2WKQ A;  4L9G A;  3W4O A;  4I3A A;  2PR6 A;  4EUZ A;  2O99 A;  3MFX A;  1ZHH B;  4UAA A;  2Y2I A;  5FSR A;  4OLG A;  4PAU A;  2QPN A;  1YPR A;  4S2L A;  3W4P A;  2V1Z A;  4U0X A;  4BWI A;  3LIC A;  3LR4 A;  4LLO B;  1YLT A;  2M1C A;  2HP6 A;  2OSU A;  5J8X A;  4YFM A;  5EV0 A;  1LI0 A;  1Y4O A;  2XQZ A;  3IBR A;  3QNC A;  2VA0 A;  4WM9 A;  1S6R A;  2EX9 A;  4ETZ A;  3E4Q A;  4Y13 A;  3T1X A;  4E3J A;  2H10 A;  4FH4 A;  3GEC A;  1MKI A;  5DKK A;  3ZCZ A;  4N1H A;  2EFX A;  3O5Y A;  4QY5 A;  3ZG0 A;  1EI5 A;  4XT2 B;  4WEJ A;  3T4L A;  4DMZ A;  2PBY A;  4X56 A;  1Y54 A;  2J9P A;  3UDX A;  5FAP A;  4EBP A;  2WK0 A;  1TS7 A;  1K54 C;  5FAT A;  3WS2 A;  2WUQ A;  1QMF A;  2ZC5 B;  1TDG A;  2W3E A;  3UE3 A;  3O87 A;  3TSG A;  4DN0 A;  5HSQ A;  3VP3 A;  4LFU A;  2B18 A;  3UPO A;  4S2N C;  4Q0H A;  4GDB A;  4OQG A;  1PZP A;  5DF9 A;  1IEL A;  3KX0 X;  4IBR A;  1HZO A;  1S67 L;  5DF7 A;  3FV7 A;  1FOF A;  2JKR I;  4N1X A;  5CHJ A;  3OOV A;  3D9Y A;  4FH2 A;  4LCM A;  2KLI A;  4GLQ A;  3C8C A;  1PFL A;  3HLE A;  1RGY A;  3N6I A;  4S2P A;  5CHU A;  1W63 M;  4S2N A;  4LEN A;  1MC0 A;  1OJ5 A;  1K55 A;  1W8Q A;  4CPK A;  4LRY C;  4PKY A;  4UQI S;  3LID A;  5HL6 A;  4DKI A;  4EET B;  2VV7 A;  1X0O A;  2EWV A;  4IVK A;  4IUH A;  3ZG8 B;  2P7J A;  4BQM A;  1NZU A;  1GSX A;  3LO7 A;  3JPU A;  4HES A;  3P01 A;  3TOI A;  2E8I A;  3NCK A;  4R4S A;  2J80 A;  1KGG A;  3UN7 A;  3B33 A;  2EFU A;  1AWI A;  4R6L A;  2ZJ9 A;  4JXW A;  1BT5 A;  5DTK A;  2L1M A;  3IXG A;  3GSG A;  3C38 A;  1PWG A;  1VEU B;  2ZD8 A;  1DJB A;  1N9B A;  3F1P B;  4R1G A;  2UWX A;  1H8Y A;  3UB8 A;  5E2G A;  2XSS A;  4CLC B;  2XH9 A;  3HLG A;  2XDM A;  1L2S A;  4NG2 A;  5CGS A;  4C6Y A;  1N4O A;  3Q07 A;  5HAR A;  1PI4 A;  2GNX A;  2Z6D A;  1W5D A;  3ICY A;  1H8Z A;  2AVX A;  5F5Y A;  1Y28 A;  2B5R A;  4AFI A;  4PHT A;  3PBQ A;  1YM1 A;  1CI8 A;  3MXR A;  4P87 A;  3LIB A;  2J3W A;  4HJ4 A;  2VEA A;  3NI9 A;  4FCF A;  1K57 C;  2WZX A;  5M19 A;  4OPY A;  2EX6 A;  1D1J A;  3RFB A;  2D01 A;  2W3G A;  3BQ8 A;  3GVB A;  2Y59 A;  2ACG A;  1BLS A;  5DFY A;  3V67 A;  3FYZ A;  3DW0 A;  4ID4 A;  4X1L A;  4NXF A;  3Q81 A;  3SH9 A;  2HJE A;  5E2E A;  2EX2 A;  4EBL A;  4PM5 A;  3A3I A;  4R38 A;  5J4E A;  2V9A A;  2ZMV A;  5HDS A;  3CUE C;  1G68 A;  3CPT B;  2C6W B;  4E3I A;  3TRC A;  2HDS A;  3K3C A;  3M6H A;  1DP9 A;  2QWS A;  4B9O A;  1PWC A;  3O3V A;  3HL9 A;  4KEN B;  3F1N A;  5G4Z A;  3QP5 A;  1XJ4 A;  3NJA A;  1YLJ A;  2Y55 A;  3IX3 A;  3M2J A;  1K38 A;  4B88 A;  5K5B A;  3LEZ A;  1I2S A;  1DY6 A;  3UE6 A;  3N8S A;  3MBZ A;  4EQI A;  3WRZ A;  4NET A;  2KDK A;  4JKT A;  4HBU A;  2C5W B;  2J7V A;  5EVI B;  4UA6 A;  5CED A;  2FFF B;  5GHZ A;  1L0F A;  1RCJ A;  1PW8 A;  4XUX A;  1SCW A;  1N9O A;  5HAP A;  5FAO A;  1FIL A;  2Y2H A;  3RXX A;  1F5M A;  3IF5 A;  3GRJ A;  1L0D A;  3U2A A;  3IX4 A;  1AXB A;  2HP9 A;  1ONH A;  1RGZ A;  3IHA A;  4MDZ A;  4R3A A;  3T12 B;  1IYQ A;  1K6R A;  3OCN A;  4KUO A;  3PYP A;  4Q0I A;  4CLC A;  3TW8 A;  4K08 A;  2IWC A;  4IJG A;  5TR7 A;  1ERQ A;  4G3W A;  4WYY A;  2JKT M;  5AQB A;  1LI9 A;  5G18 A;  1VHM A;  1XKZ A;  3ZG5 A;  4ZTK A;  2OOL A;  2FFY A;  1BLC A;  3CAX A;  4I3J A;  2OWH A;  3Q1F A;  1HVB A;  1IKG A;  1YSQ A;  2A3U A;  3BW6 A;  3MQO A;  3ZGA B;  2Y2P A;  1IEM A;  3C30 A;  3MR0 A;  4KQR A;  3T1R A;  3HUN A;  2PYR A;  5JYP A;  3VP4 A;  2BG1 A;  3MJQ A;  1OTD A;  3PAG A;  1CI9 A;  3BFD A;  3EWK A;  4WZ5 C;  4KZA A;  2HJ9 C;  1L0G A;  3BYD A;  3Q7Z A;  4JXG A;  5TBM A;  5HDC A;  3WS1 A;  3R4K A;  2Y2G A;  2Y91 A;  1CQA A;  2Y2K A;  3CI6 A;  3VMA A;  4MN6 A;  3BWL A;  2XK1 A;  5J7E A;  2V0U A;  3IWO A;  1S1Y A;  4NK3 A;  1MBL A;  2P08 A;  3TG9 A;  4KQQ A;  5HPF A;  5CXW A;  2PHY A;  3R7W B;  5EVE A;  4HJ6 A;  2M7V A;  4JBF A;  3PBT A;  3P09 A;  1DRM A;  4KQD A;  2EX8 A;  4GKU A;  1JTG A;  4GCZ A;  1CF0 A;  3ITB A;  4HH3 A;  1KOU A;  2IA2 A;  1M40 A;  4F3L A;  2H0Y A;  2WGI A;  5J3W A;  3LR3 A;  4E6X A;  3PBR A;  1M6K A;  5E43 A;  4B4Z A;  1ZG6 A;  3L9K A;  5AQ9 A;  1W8Y A;  3ZYT A;  5JYO A;  5MC7 A;  1LL9 A;  2Y2N A;  2CMN A;  1YAX A;  4MBF A;  4P85 A;  1S4R A;  4WBG A;  3JVV A;  3G2Z A;  5EVI A;  4HI4 A;  5CER A;  1YLW A;  3LR5 A;  3LUQ A;  2QYB A;  3DTI A;  1XPB A;  3LIF A;  2XEP A;  5L2F A;  2PR5 A;  3KYE A;  4JGQ A;  3HLB A;  2Z2L B;  4ME4 A;  5FI7 A;  4IBX A;  1MWR A;  2VX8 A;  2XA7 S;  1ZC2 A;  5FEG A;  2QKP A;  3C7V A;  3HCY A;  1CK3 A;  3HLF A;  5EM1 A;  2NUT C;  2ZM8 A;  2VJW A;  5IU1 A;  1ES3 A;  3FZC A;  5EM0 A;  3CMZ A;  3SW1 A;  1ES2 A;  1S66 L;  4CLC C;  4S2I A;  4GDN A;  1TS6 A;  2JKR M;  2WAE A;  2L4R A;  3EGX C;  1IYP A;  4M3K A;  3EEA A;  5TGF A;  1TEM A;  3DTK A;  2GJ3 A;  4OLD A;  1W63 Q;  3VP0 A;  4QHC A;  1E3U D;  3OC2 A;  1MKM A;  2PU4 A;  1A0K A;  1VQQ A;  3UPP A;  1BSG A;  3OBF A;  2B02 A;  4I38 A;  4ESP A;  4KZ9 A;  5HX9 A;  1T1A A;  4LRX C;  4BBV A;  3KSF A;  1T18 A;  4DE0 A;  1UWP X;  1SHV A;  3FG8 A;  1YSP A;  3V5M A;  4WF0 A;  1FIK A;  2PDR A;  4L9E A;  2W1T A;  1S1Z A;  3WS4 A;  2ZQ9 A;  2VGJ A;  1NY0 A;  3WS0 A;  3A3E A;  4WN5 A;  3D4F A;  3C4O A;  4GJ4 A;  2WYX A;  2H0T A;  1KE3 A;  1ZG4 A;  2INW A;  3LEQ A;  4CJN A;  2ZL1 B;  2A24 B;  3OPP A;  1FR1 A;  1PYY A;  1FCN A;  2PD8 A;  1W7F A;  5KZH A;  4EBN A;  1MXO A;  4BEN A;  2HPB A;  3C5A A;  1Q2P A;  1JTD A;  4H8R A;  1KE0 A;  3EQU A;  2CC1 A;  3IQA A;  5DKL A;  4OQI A;  2H28 A;  5A91 A;  4DDS A;  3NBL A;  4E3K A;  2DRW A;  4OOY A;  1K25 A;  3JVU A;  4R0Q A;  1S0W A;  1XGJ A;  1NLY A;  2ZOI A;  4X6T A;  4RA7 A;  5IS1 A;  2G7U A;  4EEU A;  3OPR A;  4MCW A;  2JBF A;  5AJG A;  1GSV A;  2EXB A;  4MBH A;  4L0L A;  4BL2 A;  3GV9 A;  4PM7 A;  4GB7 A;  1CEF A;  1XJ3 A;  2VV6 A;  2XR0 A;  3E0Y A;  4GHI B;  4DE1 A;  4HY8 A;  2ZQ8 A;  4Z9Q A;  1FCO A;  1E3U A;  1BYW A;  3ITA A;  4Y7P A;  4ZAM A;  4KZ6 A;  4D60 A;  1NZO A;  3FKV A;  1DJA A;  4PKY G;  2DMW A;  2HDU A;  4WLA A;  1QME A;  4OON A;  4BMW A;  4WL9 A;  1Z09 A;  2W3D A;  1ZTU A;  3OLO A;  1XA7 A;  3ZVT A;  2PAV P;  4GD8 A;  4HP9 A;  3B42 A;  3C7U A;  3A0R A;  1VET B;  4QPR A;  1TS8 A;  2Z6C A;  1UWN X;  1TD5 A;  3GQZ A;  4YNR A;  5AVF A;  2WGW B;  2ZM2 A;  5A8B A;  1K6S A;  3HLC A;  1BZA A;  3ZDJ A;  3IBJ A;  3QNB A;  1I2W A;  3A0S A;  5FQ9 A;  2VKS A;  4L9F A;  3KSH A;  5CRF A;  3T4O A;  1XXM A;  2W3F A;  4C3Q A;  3NHQ A;  3VP2 A;  1NWZ A;  4ZJ3 A;  1F98 A;  2L0W A;  1KVM A;  4NKP A;  4DXC A;  3MMH A;  4OH0 A;  1CEG A;  1H8M A;  3BEC A;  3UE0 A;  3FWL A;  4KZ7 A;  1OT6 A;  3N4I A;  3HUM A;  4HQA A;  4UHU A;  2XFS A;  3PBO A;  1GHI A;  1GA9 A;  3FKW A;  4KUK A;  2XD1 A;  4ZDX A;  1KDW A;  3MZE A;  4FTX A;  5DTT A;  2DCF A;  4KZ4 A;  1OME A;  4DE2 A;  2ZLY A;  2WAD A;  4JF6 A;  3W2Z A;  4PMA A;  3AGF A;  3K3D A;  1SDE A;  3BJN A;  4GZB A;  3T1Q B;  3H7W B;  3H82 A;  5DFX A;  1MY8 A;  2WKR A;  2Y4A A;  4D2O A;  3UMD A;  2PT7 A;  2X01 A;  4EV4 A;  3LGO A;  1NLZ A;  5HAI A;  3Q82 A;  5F1G A;  2BAS A;  1JNU A;  1MWS A;  1FSW A;  3GR2 A;  2ZMF A;  3IH9 A;  2R78 A;  3G32 A;  2J8Y A;  5GHX A;  3IT9 A;  3CJM A;  3IF6 A;  1K0K A;  1XJ2 A;  2PU2 A;  4OQH A;  2WKP A;  3NIA A;  4ZBE A;  1MWT A;  1SZV A;  4ZRR A;  4FOF A;  3HJK A;  4QWO A;  3CLO A;  3LR0 A;  4HJ3 A;  1J3W A;  4EUV A;  1IYS A;  3T4Q A;  4XUZ A;  4DJ2 A;  4O01 A;  4YIN A;  4O8G A;  4WZ5 A;  3BLS A;  2FZ0 A;  2V8C A;  3AGD A;  3H9W A;  1KGE A;  4FSF A;  1F2K A;  4HNB A;  3LI8 A;  4I3I A;  3NUL A;  1TVF A;  5DJU A;  3HVF A;  3WWX A;  1SKO B;  3HLD A;  3T4T A;  5GLB A;  3SS5 A;  2GZA A;  3SS3 A;  4YWZ A;  3EGD C;  3A3J A;  5FDH A;  5EPH A;  1GSW A;  2XRN A;  1JWZ A;  4EW7 A;  2P74 A;  1V9Y A;  2ZC7 A;  4E3O A;  2XLN A;  4P0M A;  2IWD A;  3E4P A;  3CUE A;  2M7U A;  1EW0 A;  5FA7 A;  2ZC6 B;  3S4X A;  2O9A A;  4JGR A;  3VOZ A;  3ISG A;  2ZM0 A;  1F9I A;  5FL3 A;  4X69 A;  1XJ6 A;  4G3V A;  1YLZ A;  2YKH A;  2XF3 A;  4WUJ A;  5GL9 A;  1ERO A;  2Y8H A;  4I39 A;  4DXB A;  3T50 A;  4MEZ A;  4R4R A;  2WKH A;  2RCX A;  2W3H A;  3G6O A;  5EVI C;  2P04 A;  3HLW A;  3VOL A;  5C5K A;  3IXB A;  4S2K A;  3E98 A;  3OPL A;  2Q0O A;  1NRJ A;  3V3S A;  4WMC D;  3SH8 A;  3NOP C;  4HBT A;  1NYM A;  2WKE A;  3UME A;  2E8J A;  1ES4 A;  2D02 A;  3KYZ A;  1H5X A;  4F94 A;  3MZF A;  5CHM A;  4KZ8 A;  3S7O A;  2WKI A;  3DTM A;  5EOO A;  2NUP C;  1C3B A;  4EWF A;  5KMW A;  3W4Q A;  3T4K A;  3IHB A;  3MXQ A;  4NXB A;  3ZQ5 A;  5HFO A;  2WAF A;  3VOY A;  5F83 A;  4ETX A;  1OTI A;  2WGV A;  2K7S A;  1HLU P;  2G2U A;  2A49 A;  4QD4 A;  4K91 A;  1JVJ A;  4BL3 A;  3Q7V A;  2HZ5 A;  4Z1W A;  3LCE A;  1K56 A;  3NY4 A;  4KG5 A;  2A2L A;  4X55 A;  4OVD A;  5L10 A;  1WA9 A;  1LL8 A;  5KSC A;  3QP1 A;  2OAQ 1;  1L0E A;  4WEK A;  2ZBB A;  3N8R A;  1I5Q A;  2O0Y A;  3R7W A;  1DP8 A;  4LRZ E;  4CLC D;  1N9N A;  3T1S A;  4LGW A;  3CHW P;  1BLH A;  3HRE A;  1YKD A;  2X02 A;  5L09 A;  1XFN A;  2Y2M A;  5DJT A;  3VV4 A;  3QP6 A;  2I72 A;  5IHV A;  3VP1 A;  5FI6 A;  3DAV A;  4RQ9 A;  1GCE A;  3PTE A;  1K57 A;  4U3T A;  3PBN A;  4JXV A;  2ZQA A;  3NOT C;  4N9K A;  1W79 A;  3BFC A;  5HWV A;  3IXH A;  5HWW A;  3S1Y A;  3NDG A;  3OCL A;  2XRO A;  3MZD A;  4DJ3 A;  3PAE A;  1OTB A;  3LFV A;  4N92 A;  1OPX A;  3S7N A;  3MKE A;  5CTN A;  5FQJ A;  1G5U A;  1WYB A;  5IT5 A;  3MSH A;  2Y2L A;  2LB5 A;  3E2L A;  2V8F A;  1WE4 A;  4GS9 A;  3O88 A;  5EFW A;  4BLM A;  4ARZ A;  3DWK A;  4R70 A;  1PZO A;  1H0M A;  4HH2 A;  3VFH A;  3MQQ A;  4H6J B;  2FH5 A;  5FQK A;  2B95 A;  1KE4 A;  4GHI A;  4QY6 A;  5HW3 A;  2O9B A;  1MPL A;  4JGP A;  1U60 A;  4HEF A;  2G2W A;  1GHM A;  4RVA A;  3IWI A;  1P9R A;  4K0W A;  5CTM A;  3KO6 A;  4PM8 A;  2Y79 A;  4PPR A;  4MN5 A;  5FEF A;  2Z2M B;  4KG2 A;  3BFG A;  4DRT A;  4BD0 A;  4JF4 A;  4ZJ1 A;  1LL5 A;  3UB6 A;  3EOI A;  5FQM A;  3D3O A;  3H7W A;  2VV8 A;  3F1O A;  5EVL A;  3IX8 A;  3ULF A;  3HJI A;  3UPN A;  3SOI A;  4EES A;  5F1F A;  3DWZ A;  3IF6 C;  5F82 A;  2V2F F;  3RH8 B;  3G35 A;  3BLM A;  3B47 A;  2P9V B;  4B93 A;  4MLL A;  3MKF A;  3S7Q A;  2Y2O A;  5FDS A;  1Z6F A;  3RXW A;  4EXO A;  4BBU A;  5CEC A;  3GDI A;  1PNE A;  1DP6 A;  5CGW A;  3P7N A;  3SS4 A;  3ZG9 B;  4UQI M;  5BOH A;  3WRT A;  4MMN A;  5DF8 A;  2ZQ7 A;  3MS6 A;  4GS9 B;  4G3K A;  2A24 A;  2QZ6 A;  3BFF A;  4RYE A;  2YKF A;  5HAQ A;  3FPV A;  3C4P A;  4BD1 A;  2JKF A;  3LIA A;  1ZKJ A;  5E2H A;  3KYQ A;  3TE8 A;  3Q7V B;  2V1A A;  1CJF A;  2I9V A;  4O7D A;  1XGI A;  1ERM A;  2HDR A;  4LV0 A;  1K55 C;  3QHY A;  4HHD A;  1OT9 A;  5FI2 A;  3PHY A;  5TFQ A;  2W1R A;  5I5L A;  5KIZ A;  2XD5 A;  4CQH A;  3BQA A;  2V0W A;  1VET A;  4PM9 A;  2VZW A;  4E6W A;  1SKO A;  1P97 A;  3JYI A;  2OLV A;  1H3Q A;  2JC7 A;  3UDF A;  4S2M A;  1STZ A;  5HPI A;  3ZVW A;  4EEP A;  3ZHH A;  1K54 A;  3T4S A;  5L07 A;  4P6Z S;  4X1M A;  4OP8 A;  3OZH A;  4Q0J A;  1T1C A;  2EXA A;  3G2Y A;  4XXR A;  4II7 A;  4YOF A;  2EWW A;  2XA7 M;  2Y2Q A;  2HDQ A;  1BLP A;  1YMX A;  1HD8 A;  2OLU A;  3UDI A;  5E2F A;  2W0N A;  3EQV A;  1MWU A;  3I7J A;  2W27 A;  5AVE A;  3OPH A;  2PD7 A;  2XGN A;  3N7W A;  4OOL A;  4OPZ A;  1D7E A;  1D06 A;  4M4X A;  3VE4 A;  2JKG A;  3F1P A;  1P0Z A;  4Y0O A;  2VGL M;  1Q2Q A;  5DVA A;  3MFD A;  3ZG7 B;  4DE3 A;  3UNW A;  2QJ5 A;  2MJ6 A;  3IF6 B;  4MBK A;  2VGK A;  2Y2J A;  5HL1 A;  1L3L A;  2JCH A;  1NRF A;  4GW9 A;  4Q8I A;  3EEH A;  3SH7 A;  3IS2 A;  4X25 A;  5F6A A;  3G4P A;  2JN7 A;  1V9Z A;  3NC8 A;  4E3M A;  4KZ3 A;  1ONG A;  1PRQ A;  1MZU A;  1PW1 A;  3MF0 A;  2PBD P;  1NJ4 A;  5FQQ A;  1K4F A;  1RP5 A;  2ZL1 A;  1LT0 A;  1G6A A;  4FD8 A;  5CEB A;  5F68 A;  4PM6 A;  4KG6 A;  3HUO A;  1YQS A;  2HV1 A;  1PIO A;  3PBS A;  1BTL A;  3V3R A;  4CLC E;  2QHK A;  3ZNY A;  1EWZ A;  1XX2 A;  4NXG A;  3VE3 A;  3B3X A;  3U4L P; 
#chains in the Genus database with same CATH homology
 2XEP A;  5L2F A;  5FAT A;  5EVI C;  3HLW A;  3WS2 A;  2WUQ A;  1FSY A;  3IXB A;  1QMF A;  3HLB A;  2ZC5 B;  3CG5 A;  3CZD A;  2Z2L B;  5FI7 A;  4S2K A;  4IBX A;  1MWR A;  3OPL A;  1TDG A;  3UE3 A;  1ZC2 A;  4WZ4 A;  4DXB A;  3V3S A;  3O87 A;  3TSG A;  5U47 A;  4WMC D;  3VP3 A;  3C7V A;  3SH8 A;  1CK3 A;  3UPO A;  4S2N C;  4U0T A;  3HLF A;  4GDB A;  4HBT A;  1NYM A;  2WKE A;  4OQG A;  1PZP A;  5DF9 A;  2ZM8 A;  4OKP A;  1IEL A;  1ES4 A;  1ES3 A;  1H5X A;  3FZC A;  3CMZ A;  4F94 A;  3MZF A;  4IBR A;  5CHM A;  1ES2 A;  4KZ8 A;  1HZO A;  4S2I A;  5DF7 A;  2WKI A;  3FV7 A;  2JE5 A;  4GDN A;  3DTM A;  1FOF A;  4N1X A;  5CHJ A;  5EOO A;  2WAE A;  1C3B A;  4EWF A;  4GOG A;  5KMW A;  1KGF A;  3W4Q A;  1SKF A;  4FH2 A;  4LCM A;  4UA9 A;  1O7E A;  3IHB A;  1IYP A;  4M3K A;  1O07 A;  3HLE A;  4R23 A;  1RGY A;  3N6I A;  5TGF A;  1TEM A;  3BM6 A;  5HFO A;  3S22 A;  4S2P A;  4OLD A;  5CHU A;  2WAF A;  3VP0 A;  4QHC A;  1E3U D;  4S2N A;  3VOY A;  4LEN A;  3OC2 A;  2PU4 A;  1K55 A;  5F83 A;  4DDY A;  1W8Q A;  1VQQ A;  4CPK A;  3UPP A;  1BSG A;  4DKI A;  2WGV A;  4R3B A;  5A93 A;  4IVK A;  2G2U A;  2A49 A;  3G31 A;  4KZ9 A;  5AQ7 A;  3ZG8 B;  2J9O A;  4QD4 A;  3V50 A;  2DNS A;  4K91 A;  3GTC A;  5HX9 A;  1JVJ A;  4BQM A;  1NZU A;  3Q7V A;  4BL3 A;  3LO7 A;  4JLF A;  3LCE A;  1K56 A;  3NY4 A;  4HES A;  4K0X A;  4KG5 A;  1PWD A;  3TOI A;  4DE0 A;  5CGX A;  1SHV A;  2E8I A;  3V5M A;  4X55 A;  4GNU A;  4A5R A;  2R9W A;  4OVD A;  2WGW A;  3NCK A;  4R4S A;  3UY6 A;  1LLB A;  5KSC A;  3VSK A;  1KGG A;  1NYY A;  1L0E A;  4WEK A;  3WS4 A;  5EE8 A;  2ZQ9 A;  2VGJ A;  3UN7 A;  3N8R A;  1NY0 A;  5FQI A;  2EFU A;  3WS0 A;  1I5Q A;  5GLD A;  3O86 A;  3A3E A;  2ZJ9 A;  4JXW A;  1DJC A;  3D4F A;  4RX3 A;  2BLS A;  1BT5 A;  1YLY A;  3C4O A;  5DTK A;  2WYX A;  2H0T A;  1BLH A;  3HRE A;  1KE3 A;  1ZG4 A;  4C75 A;  3IXG A;  2X02 A;  2Y2M A;  3GSG A;  4CJN A;  4E3L A;  3G30 A;  3OPP A;  1FR1 A;  1PWG A;  1PYY A;  2ZD8 A;  1DJB A;  1FCN A;  5M18 A;  1N9B A;  2I72 A;  1W7F A;  3G34 A;  3P98 A;  5IHV A;  1MXO A;  4BEN A;  3VP1 A;  4EBN A;  5KZH A;  5FI6 A;  4R1G A;  2HPB A;  2UWX A;  3C5A A;  1H8Y A;  5E2G A;  1Q2P A;  1GCE A;  3PTE A;  1K57 A;  1JTD A;  4H8R A;  4OOM A;  3BRM A;  4U3T A;  3PBN A;  1KE0 A;  1YMS A;  3EQU A;  2ZQA A;  4JXV A;  2CC1 A;  3IQA A;  4N9K A;  4Y0U A;  1W79 A;  2XH9 A;  4OQI A;  3HLG A;  5A91 A;  4DDS A;  2XDM A;  1L2S A;  3BFC A;  3IXH A;  3NBL A;  3S1Y A;  4E3K A;  5CGS A;  5D3O A;  4C6Y A;  1N4O A;  3NDG A;  3OCL A;  3Q07 A;  2RL3 A;  5DTS A;  5HAR A;  1PI4 A;  2DRW A;  3MZD A;  4OOY A;  1FCM A;  1K25 A;  3PAE A;  4LV3 A;  4R0Q A;  1S0W A;  1XGJ A;  4X6T A;  5M1A A;  1W5D A;  1FQG A;  1H8Z A;  4N92 A;  4RA7 A;  2IWB A;  5A92 A;  3MKE A;  1GA0 A;  2B5R A;  5CTN A;  4N9L A;  5FQJ A;  1VM1 A;  3GMW A;  3PBQ A;  1YM1 A;  3W8K A;  1WYB A;  1CI8 A;  2H5S A;  3E2K A;  2Y2L A;  3MXR A;  3OPR A;  1XA1 A;  2JBF A;  3E2L A;  5I94 A;  1WE4 A;  4P87 A;  4LCL A;  3N8L A;  3O88 A;  2V20 A;  4BLM A;  3NI9 A;  4FCF A;  1WYC A;  3AGE A;  2EXB A;  3DWK A;  1K57 C;  2WZX A;  5M19 A;  4OPY A;  5EUA A;  1PZO A;  4QU3 A;  2EX6 A;  3VFH A;  3V39 A;  1E4D A;  1BUE A;  4MBH A;  3GVB A;  4L0L A;  5FQK A;  4BL2 A;  3GV9 A;  2Y59 A;  4PM7 A;  4GB7 A;  1CEF A;  1PI5 A;  1BLS A;  2XR0 A;  4GN2 A;  2R9X A;  1KE4 A;  3FYZ A;  1IKI A;  1ESI A;  3DW0 A;  1KDS A;  4ID4 A;  4QY6 A;  4DE1 A;  5HW3 A;  2ZQ8 A;  3IXD A;  4Z9Q A;  1FCO A;  1MPL A;  3Q81 A;  1U60 A;  4HEF A;  5E2E A;  2G2W A;  1E3U A;  3SH9 A;  1GHM A;  2EX2 A;  4RVA A;  4EBL A;  4PM5 A;  3A3I A;  3IWI A;  3ITA A;  3UO9 A;  4Y7P A;  4K0W A;  4JXS A;  4OPQ A;  5CTM A;  4ZAM A;  1J9M A;  4LV1 A;  4KZ6 A;  1XP4 A;  4PM8 A;  1NZO A;  1KVL A;  3FKV A;  4PPR A;  2Z2M B;  1DJA A;  3M6B A;  2HDU A;  1G68 A;  5EOE A;  4KG2 A;  3BFG A;  2C6W B;  4DRT A;  4E3I A;  1QME A;  4OON A;  2HDS A;  4BD0 A;  3M6H A;  4JF4 A;  4ZJ1 A;  1LL5 A;  3UE1 A;  4DF6 A;  5FQM A;  5EVL A;  1XA7 A;  3ZVT A;  4JPM A;  1PWC A;  3ZNT A;  1YT4 A;  3O3V A;  3HL9 A;  4GD8 A;  4KEN B;  3SOI A;  3UPN A;  5F1F A;  3BFE A;  3DWZ A;  3IF6 C;  1YLJ A;  5F82 A;  2Y55 A;  2V2F F;  3RJU A;  3G35 A;  3BLM A;  3C7U A;  3WS5 A;  3M2J A;  2P9V B;  1K38 A;  4B88 A;  1YLP A;  3MXS A;  3LEZ A;  1K56 D;  4IED A;  4MLL A;  3MKF A;  3GQZ A;  1I2S A;  2Y2O A;  4X53 A;  1DY6 A;  1Z6F A;  2WGW B;  2ZM2 A;  2ZQC A;  3N8S A;  1ESU A;  1K6S A;  1BZA A;  3HLC A;  3MBZ A;  3WRZ A;  4EQI A;  2ZC4 B;  3ZDJ A;  4NET A;  3QNB A;  1I2W A;  3BEB A;  5CEC A;  4JKT A;  4HBU A;  2C5W B;  2J7V A;  1E25 A;  5FQ9 A;  5EVI B;  5CGW A;  4GD6 A;  5CRF A;  3SS4 A;  4UA6 A;  3ZG9 B;  5BOH A;  5CED A;  2FFF B;  3HBR A;  5GHZ A;  4OQ0 A;  4RX2 A;  1L0F A;  1XXM A;  1RCJ A;  1PW8 A;  4XUX A;  3WRT A;  1ES5 A;  4KZ5 A;  1SCW A;  4C3Q A;  5DF8 A;  2ZQ7 A;  5EEC A;  3VP2 A;  4UA7 A;  4ZJ3 A;  5AQA A;  5HAP A;  1IYO A;  2QZ6 A;  3BFF A;  4RYE A;  5FAO A;  1KVM A;  1JWP A;  1K4E A;  2Y2H A;  3RXX A;  4DXC A;  5HAQ A;  1SDN A;  4OH0 A;  1CEG A;  1GHP A;  3BEC A;  3C4P A;  3UE0 A;  4BD1 A;  3FWL A;  4KZ7 A;  1ZKJ A;  3B3X A;  2ZQD A;  3GRJ A;  3IF5 A;  3HUM A;  3N4I A;  5E2H A;  1L0D A;  4UHU A;  3VSL A;  3Q7V B;  4S2J A;  1AXB A;  2XFS A;  3PBO A;  2HP9 A;  1GHI A;  2OV5 A;  5EVI D;  1GA9 A;  1ONH A;  1RGZ A;  1XGI A;  4O7D A;  2XFT A;  3IHA A;  1ERM A;  4R3J A;  2HDR A;  3FKW A;  4LV0 A;  1K55 C;  4ZDX A;  2XD1 A;  3LY4 A;  3QHY A;  4KQO A;  1IYQ A;  1KDW A;  1K6R A;  3MZE A;  3OCN A;  5FI2 A;  5GLA A;  5DTT A;  2DCF A;  1K54 C;  4KZ4 A;  5TFQ A;  1OME A;  2XD5 A;  4DE2 A;  2IWC A;  2ZLY A;  4LV2 A;  2WAD A;  4JF6 A;  2P9V A;  4PM9 A;  4PMA A;  1HTZ A;  4S2O A;  5TR7 A;  1ERQ A;  4Y0T A;  5KSH A;  4E6W A;  3AGF A;  3JYI A;  5FAQ A;  4WYY A;  2HP5 A;  5AQB A;  1JWV A;  1SDE A;  2OLV A;  2JC7 A;  3UDF A;  1LI9 A;  5G18 A;  4S2M A;  2ZC3 B;  4GZB A;  3ZVW A;  1XKZ A;  3NDE A;  3ZG5 A;  4ZTK A;  3ZHH A;  1K54 A;  4WEL A;  4B4X A;  4E3N A;  5A90 A;  1LHY A;  1MY8 A;  2FFY A;  2Y4A A;  1BLC A;  4D2O A;  4OP8 A;  3OZH A;  2WZZ A;  3Q1F A;  2X01 A;  1HVB A;  1IKG A;  4EV4 A;  2EXA A;  4OPR A;  3G2Y A;  3VFF A;  5FAS A;  4X68 A;  4XXR A;  5HAI A;  2A3U A;  3Q82 A;  5F1G A;  4ZJ2 A;  5GLC A;  3ZGA B;  2Y2P A;  1MWS A;  1FSW A;  1IEM A;  3GR2 A;  1NXY A;  3IH8 A;  3IH9 A;  3A3D A;  2J8Y A;  2Y2Q A;  3G32 A;  3IT9 A;  2HDQ A;  4KQR A;  5GHX A;  3CJM A;  3IF6 A;  4QJG A;  2PU2 A;  3HUN A;  1BLP A;  4OQH A;  4KZB A;  3NIA A;  4ZBE A;  5JYP A;  3VP4 A;  1MWT A;  1YMX A;  1ALQ A;  1HD8 A;  2BG1 A;  2OLU A;  4IVI A;  3A3F A;  5E2F A;  3UDI A;  2Q9M A;  1BUL A;  1MWU A;  3EQV A;  3I7J A;  3PAG A;  4QB8 A;  1CI9 A;  2QMI A;  3OPH A;  2XGN A;  4P6B A;  5GHY A;  4MNR A;  3N7W A;  4OOL A;  3BFD A;  2GDN A;  4OPZ A;  4WZ5 C;  1FR6 A;  1TDL A;  2ZMA A;  3ZFZ A;  4KZA A;  1IYS A;  3IWQ A;  1L0G A;  3BYD A;  2X71 A;  3Q7Z A;  4JXG A;  4XUZ A;  4YIN A;  3WS1 A;  4OP5 A;  4WZ5 A;  4Y0O A;  3BLS A;  2Y2G A;  2Y91 A;  3M2K A;  3AGD A;  2Y2K A;  1Q2Q A;  3VMA A;  3LY3 A;  5DVA A;  1KGE A;  4FSF A;  2XK1 A;  4JF5 A;  3MFD A;  4WMC A;  3IWO A;  3ZG7 B;  3UNW A;  4DE3 A;  4NK3 A;  1MBL A;  3IF6 B;  4MBK A;  3TG9 A;  2VGK A;  2Y2J A;  5HL1 A;  4BJP A;  2Q9N A;  1TVF A;  2JCH A;  4KQQ A;  3W4O A;  1NRF A;  4Q8I A;  4EUZ A;  3RXW A;  3HVF A;  5CXW A;  3WWX A;  3SH7 A;  4UAA A;  2Y2I A;  5FSR A;  3G4P A;  4OLG A;  4JBF A;  3PBT A;  3HLD A;  3P09 A;  2QPN A;  5GLB A;  4S2L A;  3SS5 A;  3W4P A;  2EX8 A;  3NC8 A;  4E3M A;  2V1Z A;  4U0X A;  3SS3 A;  4GKU A;  1JTG A;  3A3J A;  5FDH A;  5EPH A;  1YLT A;  4KZ3 A;  1ONG A;  3ITB A;  1JWZ A;  2HP6 A;  1PW1 A;  2OSU A;  2P74 A;  5J8X A;  1M40 A;  2ZC7 A;  1NJ4 A;  4YFM A;  4E3O A;  2H0Y A;  2WGI A;  1LI0 A;  2XLN A;  4P0M A;  2XQZ A;  2IWD A;  5FQQ A;  1K4F A;  4E6X A;  1RP5 A;  3QNC A;  4WM9 A;  5FA7 A;  1S6R A;  2ZC6 B;  2EX9 A;  3PBR A;  1M6K A;  3S4X A;  1G6A A;  4FD8 A;  5CEB A;  5E43 A;  3VOZ A;  3ISG A;  4B4Z A;  4E3J A;  2ZM0 A;  4PM6 A;  2H10 A;  1ZG6 A;  4FH4 A;  4KG6 A;  5AQ9 A;  3HUO A;  1YQS A;  4X69 A;  1W8Y A;  1PIO A;  3PBS A;  5JYO A;  1MKI A;  1BTL A;  1LL9 A;  3ZCZ A;  2Y2N A;  2EFX A;  4N1H A;  3V3R A;  4MBF A;  1YLZ A;  4P85 A;  4QY5 A;  4WBG A;  2XF3 A;  3ZG0 A;  1EI5 A;  5GL9 A;  3G2Z A;  4WEJ A;  3ZNY A;  1ERO A;  5EVI A;  5CER A;  2PBY A;  1EWZ A;  1Y54 A;  1XX2 A;  1YLW A;  2J9P A;  4X56 A;  5FAP A;  4MEZ A;  3UDX A;  4R4R A;  4EBP A;  2WK0 A;  1XPB A;  2WKH A;  2RCX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...