4QD4A

Structure of adc-68, a novel carbapenem-hydrolyzing class c extended-spectrum -lactamase from acinetobacter baumannii
Total Genus 125
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
125
sequence length
357
structure length
357
Chain Sequence
PKDQEIKKLVDQNFKPLLEKYDVPGMAVGVIQNNKKYEMYYGLQSVQDKKAVNSSTIFELGSVSKLFTATAGAYAKNKGKISFDDTPGKYWKELKNTPIDQVNLLQLATYTSGNLALQFPDEVQTDQQVLTFFKDWKPKNPIGEYRQYSNPSIGLFGKVVALSMNKPFDQVLEKIIFPALGLKHSYVNVAKTQMQNYAFGYNQENQPIRVNPGPLDAPAYGVKSTLPDMLSFIHANLNPQKYPADIQRAINETHQGRYQVNTMYQALGWEEFSYPATLQTLLDSNSEQIVMKPNKVTAISKEPSVKMYHKTGSTNGFGTYVVFIPKENIGLVMLTNKRIPNEERIKAAYAVLNAIKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Beta-lactamase ADC-68
publication title Structure of ADC-68, a novel carbapenem-hydrolyzing class C extended-spectrum beta-lactamase isolated from Acinetobacter baumannii
pubmed doi rcsb
source organism Acinetobacter baumannii
total genus 125
structure length 357
sequence length 357
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-05-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00144 Beta-lactamase Beta-lactamase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 4qd4A00
3IF6C 4BJPA 4X55A 1WE4A 1ZG4A 3BRMA 3HBRA 1AXBA 2ZQCA 3D4FA 4FSFA 4ZTKA 1KE4A 2A3UA 3G4PA 3HLFA 1YLPA 1L0EA 2WYXA 4OPRA 4PM5A 4ZAMA 5TGFA 2GDNA 4DDYA 1W8QA 1MWUA 2WKHA 2WGVA 5I94A 2QMIA 3HUNA 2Y2PA 2ZC6B 1KVMA 5G18A 2Z2LB 3C7VA 2ZJ9A 5CGSA 4P6BA 4HEFA 4KZ3A 4L0LA 4ID4A 1IYQA 1FSYA 4GD6A 4OONA 1SDEA 4KQOA 3B3XA 1CEFA 3UDIA 1K55A 2JCHA 1I5QA 3HLCA 4K0XA 1XGIA 4OPZA 5AQ7A 2WUQA 3RXWA 3UE3A 3DWKA 3FV7A 1TDLA 4GNUA 5HARA 2P9VA 2Y2GA 3BYDA 4FD8A 3Q7ZA 4X6TA 1NRFA 3WRTA 1LL5A 1JWVA 2X02A 3GV9A 3LY3A 2ZC3B 5GL9A 1GA9A 3N6IA 2EX9A 4KZ4A 4X69A 4S2PA 5FQIA 4ZJ3A 2Y2QA 4JF4A 3UNWA 4K91A 2WGIA 4PMAA 5EE8A 1DJAA 4FCFA 5DF8A 3NCKA 3N8SA 4N92A 2QZ6A 4R0QA 4B88A 4DE1A 3DW0A 2XQZA 1ES4A 4OPYA 3UN7A 3MZFA 3V3SA 1KVLA 3ZG0A 3IXGA 1ERMA 4HBUA 1K57A 5GHYA 4E3MA 5CEDA 3SH9A 1Y54A 4EBNA 1M40A 4EUZA 1SDNA 1K4FA 4OVDA 4PM7A 1U60A 5E43A 4BL2A 3IH8A 3WRZA 3ZDJA 1H8YA 1DJCA 4WZ5C 1EROA 5EECA 4GB7A 1BT5A 1L0GA 4GN2A 2ZLYA 5F1GA 5CHMA 5HFOA 3V39A 4E3JA 3IXHA 5GHXA 3WWXA 1XXMA 3A3IA 3IXDA 1FQGA 1IEMA 1MWSA 2Y2LA 4JXSA 4NETA 5CRFA 1PW8A 5A91A 1M6KA 2J9PA 4DXBA 3GTCA 1K6RA 4EWFA 3C4OA 4JLFA 5E2GA 5BOHA 5FAPA 1IYOA 1XA1A 2ZQ8A 2ZC7A 4NK3A 1WYBA 2X71A 3OPPA 2UWXA 4WEKA 4N9KA 3IF6B 1RGYA 2HPBA 4IVKA 1FOFA 4KG5A 3IXBA 5DTTA 3VP2A 2E8IA 4GDNA 1BUEA 1XPBA 5JYOA 2BG1A 1O7EA 1PZOA 1S0WA 1E3UD 3O87A 3C5AA 2A49A 2Y2OA 2XGNA 3UPNA 3G31A 3ZNYA 4Y7PA 3UPPA 4Y0OA 5M18A 3WS0A 3M2JA 4WEJA 4WYYA 3EQVA 1QMEA 5E2HA 3IF5A 4QU3A 4WMCA 3BEBA 3QHYA 5IHVA 3VOYA 3WS4A 2RCXA 5EOOA 3ZG7B 3PBQA 4OP8A 5FASA 2G2WA 4JXGA 4QB8A 4UA9A 4OQHA 4E3LA 4WBGA 3FZCA 4KZ5A 4PM9A 3W4PA 4EV4A 4QY6A 2Y4AA 2J7VA 5AQAA 2ZC5B 1PI5A 1MPLA 4OKPA 2XFSA 2IWBA 3ITBA 5CXWA 5CEBA 2EX2A 3IWOA 1KGFA 2FFFB 3MZEA 1K56D 2Y2MA 2XD1A 3NI9A 4U3TA 1FCNA 1O07A 3G34A 5EVIA 4B4ZA 3PBOA 2JC7A 4S2KA 5HX9A 2VGKA 4WM9A 3ITAA 4MBFA 3UE0A 2ZM2A 3SH7A 1NZOA 1KGGA 4KG6A 3LCEA 4OOLA 5EUAA 1CI9A 5DVAA 2DCFA 1S6RA 4JBFA 4A5RA 3UPOA 5AQ9A 2J8YA 5A92A 3HLWA 2WZXA 4LCMA 4KZ9A 4BL3A 2H5SA 1IYSA 1ZG6A 2H0TA 3IWQA 1HD8A 3CG5A 5CTNA 4ZBEA 1YT4A 3ZGAB 4DF6A 5M19A 3VMAA 5FDHA 1NJ4A 4QHCA 2EX8A 1N4OA 2Y2KA 4E3NA 3MZDA 4PM6A 4OOMA 3Q82A 5FQQA 3A3FA 3V50A 1BLHA 1ONHA 3IF6A 3MKFA 2DRWA 1SCWA 2HP5A 3CJMA 1H5XA 1E4DA 4N1XA 4R23A 3SH8A 2XFTA 2XEPA 4MBHA 3ZG9B 4BENA 4BLMA 1JWZA 3IH9A 4DDSA 5AQBA 3V5MA 3OCNA 3Q81A 4JPMA 1ES5A 4MNRA 4O7DA 2QPNA 3HLBA 3PBRA 1FCMA 5TFQA 3ZNTA 3JYIA 1I2SA 4OLDA 4P0MA 2ZQDA 2P74A 1TDGA 4CJNA 1XA7A 4N1HA 3NDGA 4HBTA 5FQJA 5F1FA 4PPRA 1MY8A 1KE0A 2Y2NA 2CC1A 4D2OA 4R3JA 4KZ6A 2HP9A 1ES2A 5EVIB 4RVAA 3RXXA 3N8RA 3PAEA 5HAQA 3HUMA 3IHAA 3CMZA 1TVFA 4LV0A 1BLPA 5U47A 4C6YA 4EBLA 4BD0A 1ZKJA 4KQQA 3SS3A 1E25A 3GR2A 4QJGA 3MXRA 4X56A 1K38A 1RCJA 1NXYA 3I7JA 4KZ7A 2WZZA 3G32A 2HDQA 3Q7VB 4JF6A 1GHIA 3HVFA 1YMXA 3NIAA 4GKUA 2X01A 1KGEA 3IT9A 1MWTA 4P87A 1FR6A 3PBSA 4IBRA 1PI4A 3O3VA 2XDMA 5GHZA 1K25A 5HAIA 1IYPA 1K6SA 4KZ8A 3W4QA 2Z2MB 3GQZA 4P85A 5TR7A 3GRJA 2WAEA 4HESA 1ALQA 2ZQ9A 3ZCZA 4WZ5A 3QNBA 4DE3A 4UHUA 3HLEA 4S2NC 1BLCA 3VFFA 1JVJA 4F94A 1FCOA 3ZG5A 4FH2A 4IEDA 3MXSA 1J9MA 4OQIA 3HUOA 3N4IA 1PZPA 4Z9QA 3ZVTA 1W8YA 1Q2QA 5GLAA 2Y59A 5CHUA 3E2KA 4S2LA 3OC2A 4RX2A 3GVBA 4WMCD 4N9LA 4E6WA 1LI0A 3G2ZA 3E2LA 5GLDA 1BSGA 1OMEA 3ZHHA 1K54C 1NYYA 2Y2JA 1LLBA 1NYMA 5FI6A 1K4EA 1LI9A 1W7FA 2PBYA 1BTLA 4JXVA 2XH9A 3C7UA 4E3IA 1DJBA 4R1GA 5F82A 1HTZA 2HDUA 1Z6FA 2EFUA 4UAAA 1IKGA 5CGWA 4ZJ2A 2Q9MA 1I2WA 1PWGA 2XF3A 4MLLA 3SS4A 5EVID 2ZD8A 1QMFA 4RYEA 3M6BA 1ONGA 4KZBA 1FR1A 4U0XA 3ZG8B 5HL1A 5FQ9A 2R9XA 3N8LA 3VP3A 3HL9A 5GLBA 5FQKA 1MKIA 1YLJA 1PW1A 2XD5A 3W4OA 4XXRA 3FKVA 4RX3A 3WS1A 1XGJA 2ZQ7A 3UO9A 3BFDA 2WGWB 4UA7A 2IWCA 5GLCA 3Q7VA 3BFGA 4DKIA 4EBPA 3OZHA 1EWZA 3OPLA 3PTEA 3VP4A 4EQIA 5J8XA 3AGDA 1KE3A 2C6WB 3MBZA 4BQMA 2ZC4B 1MXOA 5FAOA 2IWDA 3MKEA 3N7WA 3ZFZA 5KMWA 3MFDA 1ES3A 2XK1A 3IQAA 1CI8A 1LL9A 2HDRA 5DF7A 5A93A 3Q07A 1K55C 5DTKA 5FI7A 3LY4A 4YFMA 2J9OA 4S2OA 1BLSA 1NZUA 3FYZA 2G2UA 4R4RA 4XUXA 4Y0UA 1KDSA 1YQSA 3GSGA 3VFHA 4C3QA 3G30A 5CTMA 3W8KA 3BFCA 3VP0A 3NDEA 2Y91A 4OPQA 5KZHA 1SHVA 3O88A 1VM1A 2ZM8A 4GOGA 4KENB 4OLGA 4S2JA 2Y55A 4BD1A 3VSKA 4XUZA 1MBLA 1L0DA 5FSRA 4DRTA 3M6HA 5EPHA 3QNCA 2XR0A 2JBFA 3HLDA 1RGZA 2B5RA 1K57C 5E2EA 2XLNA 1C3BA 2WK0A 3AGEA 3NBLA 3WS5A 3PBNA 1XX2A 3VSLA 4GDBA 1BZAA 4KZAA 2WKEA 2WKIA 1JTGA 2WADA 4WELA 1ESUA 1G6AA 4OQGA 3DWZA 4JXWA 4IVIA 5DF9A 3BFFA 3IWIA 3NC8A 3DTMA 5M1AA 5A90A 1PYYA 1RP5A 2PU4A 4LV2A 1N9BA 3TSGA 1ZC2A 3OCLA 5CECA 1WYCA 3UE1A 3UDFA 2HP6A 2V2FF 1W79A 2EX6A 1YMSA 2EXAA 1ERQA 3EQUA 1GCEA 4M3KA 3A3EA 2WGWA 4QD4A 5KSHA 1XKZA 2BLSA 3A3DA 2EXBA 2C5WB 2JE5A 3BM6A 2Q9NA 2R9WA 4S2MA 4GD8A 4X53A 5EVLA 5JYPA 1PWDA 3PBTA 4IBXA 4OOYA 4UA6A 3SOIA 4R4SA 3LEZA 2I72A 4OQ0A 1VQQA 1XP4A 4S2IA 5F83A 3V3RA 1IELA 4QY5A 3SS5A 3VP1A 3HLGA 4DE0A 4JF5A 3TOIA 5FA7A 1YLYA 3FWLA 3ISGA 4LV1A 3S4XA 2PU2A 1GA0A 3P98A 5FI2A 5HW3A 3BLSA 2RL3A 4MEZA 4Q8IA 5E2FA 4RA7A 3GMWA 4KG2A 5L2FA 4YINA 1PIOA 5KSCA 4PM8A 4X68A 2EFXA 2VGJA 1LHYA 1NY0A 3UDXA 2ZMAA 1JWPA 3IHBA 4R3BA 3NY4A 1TEMA 1MWRA 1HZOA 1W5DA 3P09A 3ZVWA 4E3OA 2FFYA 1YLZA 1E3UA 4S2NA 1ESIA 4Y0TA 5EOEA 3S22A 4K0WA 4FH4A 4LV3A 3OPHA 1GHPA 2H10A 2V1ZA 5CGXA 5DTSA 1CK3A 1SKFA 1DY6A 1EI5A 2P9VB 2ZQAA 1L2SA 2Y2HA 5CHJA 2OLUA 3G2YA 4DXCA 3BLMA 3UY6A 2V20A 4GZBA 5EVIC 1G68A 4JKTA 5FATA 3TG9A 1IKIA 1Q2PA 5FQMA 4E6XA 2H0YA 1PWCA 1YM1A 4C75A 3VOZA 2Y2IA 3HREA 3O86A 4CPKA 4E3KA 4OH0A 1H8ZA 2HDSA 4OP5A 1K54A 2ZM0A 1YLTA 3M2KA 1CEGA 3PAGA 4MBKA 1KDWA 4LENA 3C4PA 4KQRA 4ZJ1A 4DE2A 3S1YA 4H8RA 1GHMA 3CZDA 3AGFA 2OLVA 5FAQA 1HVBA 2WAFA 3BFEA 3BECA 4ZDXA 1K56A 5D3OA 4U0TA 3WS2A 5HAPA 4B4XA 2OSUA 4LCLA 3OPRA 5CERA 1FSWA 3A3JA 3FKWA 4WZ4A 1JTDA 2OV5A 3LO7A 3RJUA 2DNSA 3Q1FA 1L0FA 1YLWA 3G35A 1BULA
chains in the Genus database with same CATH superfamily
1WE4A 2ZL1B 2V0UA 3D4FA 4GW9A 2WGVA 3HUNA 2Y2PA 1KVMA 2Z2LB 3HJIA 5CGSA 5EM0A 4L0LA 3ICYA 4GHIA 3HLCA 1OJ5A 2WUQA 3FV7A 4GNUA 2P9VA 2Y2GA 4HH2A 2INWA 4EQ1A 1GA9A 5FQIA 4S2PA 4ZJ3A 4K91A 2W1RA 4R0QA 4B88A 4GS9B 5G4YA 1Y28A 3ZG0A 1K57A 5GHYA 3EEHA 1OTAA 5HDCA 3SH9A 4D60A 3GECA 1M40A 4EUZA 1SDNA 1K4FA 4OVDA 4EU0A 1U60A 2LB5A 2D01A 4ARZB 5F69A 3V39A 5F1GA 5CHMA 1DP9A 3H9WA 3CITA 2PD8A 3IXDA 1IEMA 1OPXA 1PW8A 3PHYA 1M6KA 4DXBA 1T18A 1K6RA 5E2GA 1IOUA 1XA1A 2ZQ8A 4NK3A 1D06A 3C30A 4WEKA 4N9KA 4IVKA 2HPBA 5DTTA 3EOIA 1XPBA 4HH3A 1X0OA 1PZOA 4HY8A 3C5AA 3UPNA 4UEYA 2WKQA 3EQVA 3IF5A 3TRCA 2JKGA 2RCXA 2W0NA 4JXGA 3FZCA 3W4PA 4QY6A 5LBRA 1PI5A 2IWBA 5CXWA 5L8MA 3MZEA 1KGFA 4PKYG 5HSQA 3PBOA 1OTIA 2JC7A 5HX9A 4WM9A 2ZMVA 2VLGA 1OTEA 1NZOA 2QKPA 5EUAA 4JBFA 3UPOA 2J8YA 4CJNA 1IYSA 3H7WA 3ZGAB 5CTNA 1HD8A 3T4TA 5M19A 3T1RA 4QPRA 3KO6A 3Q82A 5TJJA 3IF6A 4X25A 4HJ3A 4MDZA 3CJMA 1E4DA 4R23A 3BWLA 4MBHA 3ZG9B 4BENA 2CMNA 4DDSA 3V5MA 3OCNA 2QPNA 3HLBA 3PBRA 3IX3A 3T50A 5TFQA 3ZNTA 3JYIA 2KOIA 3HCYA 4Q0IA 3NDGA 2K31A 4PPRA 4XT2B 3BJNA 2P7JA 3RXXA 3N8RA 3PAEA 4C6YA 4EBLA 4BD0A 1F2KA 3SS3A 3FPVA 2WKRA 1K38A 3LIAA 2HDQA 1GHIA 1S4RA 4FTXA 3NIAA 1MWTA 4P87A 1FR6A 5EV0A 5GHZA 1K25A 4Y13A 2Z2MB 3MJQA 4P85A 4B9OA 3GRJA 1ALQA 3ZCZA 2PD7A 1D1JA 3F1OA 4S2NC 3QP6A 1FCOA 2D02A 5HD5A 2W3DA 3C2WA 4CLCE 3MXSA 1N9LA 4HI4A 3HUOA 3ZVTA 4Z9QA 1Q2QA 4YNRA 1OT6A 3E2KA 3OC2A 4RX2A 5MC7A 4F3LB 3G2ZA 1LL8A 3T4JA 3KSHA 1K54C 1NYYA 3B42A 3MMHA 1W7FA 2JHEA 1BTLA 4JXVA 4ETZA 4R1GA 5F82A 2HDUA 4UAAA 2VGLM 1I2WA 3SS4A 2LB9A 2B18A 1ONGA 1FR1A 5FQ9A 3N8LA 1MKIA 1PW1A 1BYWA 2XD5A 3W4OA 3WS1A 1S66L 3UO9A 3UMEA 4UA7A 4ME4A 2IWCA 5IU1A 3Q7VA 3FC7A 1UGUA 4R38A 5KIZA 4ETXA 3NOUC 3BQAA 5FAOA 3N7WA 5KMWA 2XK1A 1CI8A 3SW1A 3CI6A 2HDRA 5DF7A 1K55C 4NXGA 2HJEA 3LY4A 2PRFA 2J9OA 3FYZA 2G2UA 4XUXA 1KDSA 2EWVA 3GSGA 3G30A 3BFCA 2Q0OA 3FPWA 3BY8A 3UB7A 1SHVA 1VM1A 2ZM8A 4DJ3A 1VB6A 3K2NA 5DKKA 5TBMA 1MBLA 5FSRA 1C3BA 4EXOA 4GDBA 1CF0A 2WKEA 1JTGA 4JXWA 3T1XA 3BFFA 5M1AA 5A90A 1PYYA 1N9BA 3OCLA 1WYCA 3U2AA 1J3WA 3LR3A 2XRNA 1GCEA 3A3EA 4JGOA 3BM6A 5EVLA 2Q9NA 2R9WA 5JYPA 1V9YA 3VE3A 4UA6A 3SOIA 2VJWA 3VP1A 1FILA 3V3RA 3SS5A 2O99A 1UWNX 1YLYA 3ISGA 3S4XA 5HW3A 2DMWA 4MEZA 5FL3A 5KSCA 1LHYA 4R3BA 1E3UA 1ESIA 5EOEA 3OPHA 2H10A 2W1TA 2H28A 1EI5A 5CHJA 4DXCA 3BLMA 3GDIA 5EVIC 5FQMA 2H0YA 4CLCA 3VOZA 3HREA 3O86A 4E3KA 2ZM0A 1CEGA 3PAGA 1KDWA 3CZDA 2O0YA 1OTBA 1H3QA 4ZDXA 1CQAA 3F1NA 4LCLA 3FKWA 3LO7A 3RJUA 1MZUA 1STZA 1L0FA 3G35A 1BULA 3CWFA 4BJPA 3T12B 3MF0A 5J4EA 4X1LA 4FSFA 4ZTKA 4I38A 3NULA 4OPRA 2WYXA 5TGFA 2JKRI 2GDNA 4O0PA 2GJ3A 5G18A 2QWSA 4ID4A 1FSYA 3LFVA 1T1BA 1CEFA 5AQ7A 3OLOA 1TDLA 3BYDA 2K7SA 2VKSA 4FD8A 1MC0A 3V67A 3KYEA 1JWVA 2X02A 2W3FA 2EX9A 4KZ4A 2EWWA 2WGIA 5EE8A 5DF8A 3NCKA 4N92A 2QZ6A 2MJ6A 3P01A 3DW0A 1T1CA 2XQZA 3UN7A 4CQHA 4DJ2A 2AVXA 2A24A 3K3CA 5EECA 3EGDC 2XA7M 5HPFA 3WWXA 1XXMA 4JXSA 1FQGA 5CRFA 1MWSA 2Y2LA 4DMZA 3T4SA 5F5YA 3GTCA 3C4OA 4EW7A 4FOFA 1WYBA 3OPPA 2W3EA 3R7WA 2V8FA 4KG5A 2E8IA 5JYOA 1BUEA 4BBVA 3TW8A 1E3UD 3A0VA 2A49A 2XGNA 4EESA 1OTDA 3WS0A 2VX8A 3M2JA 4WEJA 3DBAA 3E4PA 4WMCA 3QHYA 5IHVA 3WS4A 4BBTA 4CLCD 5FASA 4Y5FA 4WBGA 1YKDA 2J7VA 1VETB 2JN7A 2ZC5B 1MPLA 3LI9A 3ITBA 2EX2A 3IWOA 2VEAA 3LIBA 4WF0A 2KX6A 3UE0A 5DJTA 4OOLA 1CJFA 4A5RA 3E4OA 2OAQ1 5A92A 3HLWA 4LCMA 4BL3A 3IWQA 3CG5A 1YT4A 3KYQA 3VMAA 3VOLA 1NJ4A 2VK3A 2Y2KA 2ACGA 5AJGA 2ZMFA 1ONHA 1IFQA 4EUVA 1H5XA 4N1XA 3SH8A 2K2NA 2PYPA 1JWZA 3IH9A 4NG2A 1ES5A 2JKTM 5DKLA 4F3LA 1FIKA 4YOFA 4N1HA 2FZ0A 3ZYTA 4KZ6A 4RVAA 4LRXC 2J80A 5HAQA 3HUMA 1BLPA 3LEQA 1ACFA 2OAP1 4QJGA 3MXRA 1RCJA 1S1YA 3G32A 1YMXA 4E04A 2HV1A 3OOVA 3A0RA 4LLOB 4MCWA 3H82A 4Y2FA 2ZQ9A 1XJ6A 4WZ5A 4UHUA 3NECA 3VFFA 1JVJA 4F94A 3ZG5A 4FH2A 2B95A 1J9MA 4OQIA 1PZPA 4HOIA 1W8YA 5GLAA 2Y59A 5HPIA 4LGWA 4WMCD 2M7VA 1BSGA 1OMEA 3ZHHA 1LLBA 1NYMA 2Y8HA 2PBYA 1HTZA 1Z6FA 5CGWA 1IKGA 4Y17A 3IX8A 4U0XA 3VP3A 3O5YA 5GLBA 4XXRA 3FKVA 3BFDA 4IUHA 4DKIA 3OPLA 4EQIA 1TS6A 1KE3A 3K3DA 3RTYA 3MKEA 4FUWA 1NWZA 3LYXA 3IS2B 5FI7A 4S2OA 5HWVA 4Y0UA 3CAXA 4C3QA 3S7PA 3PYPA 2Y91A 5EM1A 4S2JA 4GOGA 2XA7S 4DRTA 5EPHA 1RGZA 2B5RA 1K57C 2WK0A 3WS5A 3UB5P 4YWZA 4HP9A 3CUEA 5DF9A 4M4XA 3DTMA 1XJ2A 1NRJA 3UE1A 3UDFA 2EX6A 3UB6A 4M3KA 2WGWA 4QD4A 2EXBA 2JE5A 4S2MA 4GD8A 1PWDA 3OBFA 4IBXA 4R4SA 4EEPA 2M7UA 4OQ0A 4WUJA 1IELA 4L9EA 4QY5A 4JF5A 3TOIA 5FA7A 4JGQA 4LV1A 3DTEA 3P98A 5L2FA 3LIFA 1T1AA 2EFXA 4DN0A 4Z1WA 1JWPA 1TEMA 1MWRA 4X1MA 3ZVWA 3L9KA 1YLZA 2W27A 4LV3A 5J3WA 4GHIB 5CGXA 4L9GA 2YKHA 2P9VB 2ZQAA 1L2SA 3UY6A 3T1SA 1NLZA 4JKTA 5FATA 4E6XA 1PWCA 1YM1A 2V0WA 2Y2IA 2QJ7A 3TJZC 2HDSA 2Y79A 1PNEA 2YKFA 3JVVA 4WN5A 4KQRA 4ZJ1A 1PFLA 3QP2A 3SZTA 4DE2A 1GHMA 2OLVA 2WAFA 3BFEA 4G3KA 3A0SA 4B4XA 2OSUA 5AVFA 3OPRA 5CERA 1FSWA 4WZ4A 2OV5A 2DNSA 3Q1FA 5K5BA 3IF6C 3F1PA 4MN7A 1ZG4A 4MN5A 1KE4A 2L4RA 2QHKA 4GCZA 2A3UA 3G4PA 3HLFA 1L0EA 4PM5A 4DDYA 1MWUA 4UQIM 2WKHA 3EEAA 2PHYA 4WL9A 2QMIA 4LRYC 3LR5A 3CHWP 4HEFA 4ESPA 4KZ3A 3IBRA 2W3HA 4GD6A 4OONA 1SDEA 4KQOA 3B3XA 3L7HA 4OPZA 3U4LP 3DWKA 1YPRA 5HARA 1D7EA 4X6TA 1LL5A 4H6JA 3GV9A 2ZC3B 1K0KA 3MR0A 2Y2QA 4JF4A 4PMAA 1DJAA 1ZHHB 4FCFA 3N8SA 1VEUA 4PAUA 4DE1A 4KUOA 1SKOA 4HJ6A 3CPTA 3MZFA 3V3SA 1TS8A 3MSHA 3IXGA 4HBUA 5CEDA 1P97A 2VV6A 4I39A 4BL2A 3IH8A 3PXPA 1H8YA 1DJCA 3BW6A 1EROA 1PRQA 3BQ8A 1BT5A 1NLYA 4GN2A 1L0GA 2J3TD 5HFOA 1VHMA 3H7WB 3IXHA 4PKYA 4IUKA 4LPZA 5GHXA 2ZL1A 2XSSA 3A3IA 2ZOIA 5A91A 3MQQA 4JLFA 5BOHA 5FAPA 1IYOA 3JVUA 2ZC7A 5HL6A 2X71A 3IF6B 2ZOHA 3VP2A 3DTKA 3IXBA 2L0WA 1O7EA 1S0WA 3O87A 1TD5A 2V1BA 4Y7PA 3UPPA 5M18A 4WYYA 4QU3A 3VOYA 5EOOA 4QB8A 1AWIA 4E3LA 2PT7A 2Y4AA 5AQAA 5G4ZA 1S67L 4OKPA 4GS9A 2XFSA 5CEBA 2FFFB 4GJ4A 2Y2MA 4U3TA 2XD1A 4R70A 5HZHA 4B4ZA 2VGKA 1H8MA 2M1CA 1ZTUA 3SH7A 1KGGA 3LCEA 1H0MA 4ARZA 1DP6A 1G6OA 5AQ9A 2WZXA 2H5SA 1ZG6A 4ZBEA 4DF6A 1N4OA 3F1OB 1GSXA 4NKPA 1SCWA 2HP5A 2QJ5A 2XFTA 1ODVA 4II7A 3LI8A 4JPMA 4MNRA 4KQDA 1FCMA 3QP5A 2HZ5A 1WA9A 2ZQDA 2P74A 1XA7A 3EWKA 5FDSA 4HBTA 5F1FA 3PR6A 1MY8A 3S7OA 1KE0A 2CC1A 4D2OA 4R3JA 1P9WA 1ES2A 5EVIB 1XJ4A 1TVFA 4LV0A 2GZAA 4KQQA 4HP4A 4Q0HA 3MS6A 4KZ7A 3Q7VB 4QWOA 2O9CA 3HVFA 4GKUA 1KGEA 2OOLA 3IT9A 3PBSA 3O3VA 2XDMA 5DJUA 1XFNA 4DE3A 1LT0A 3TE8A 1Z09A 4KUKA 4G3WA 3KYZA 3N4IA 3QP8A 2L1MA 4N9LA 4CLCC 1LI0A 3E2LA 5C5KA 2V9AA 5TBMB 4NXEA 5HDSA 2XH9A 3C7UA 4E3IA 5CX7A 4XT2A 4ZJ2A 1PWGA 2OWHA 2XF3A 3LICA 4UQIS 4KZBA 2VV8A 3ZG8B 3IBJA 3VV4A 3LGOA 2NUTC 4RX3A 2EA9A 1G28A 1A0KA 3BFGA 3FG8A 2O9AA 1Y4OA 3PTEA 5J8XA 3AGDA 2GNXA 4G3VA 2C6WB 4BQMA 1LSXA 3ZFZA 3MFDA 1LL9A 1MKMA 5A93A 3KSIA 5EVEA 5HDDA 5DTKA 3R4KA 4YFMA 1TS0A 2VA0A 1BLSA 3MXQA 4R4RA 3VFHA 1XFQA 1YQSA 5CTMA 3W8KA 3VP0A 5IS1A 3QP1A 4OPQA 3O88A 2W1TB 4OLGA 3D72A 3VSKA 4L9FA 1L0DA 5L07A 2HJ9C 4Y3IA 3HLDA 3MFXA 5E2EA 3AGEA 3NBLA 3PBNA 4CLCB 2WKIA 2WADA 4WELA 1ESUA 1G6AA 3DWZA 5HD3A 3IWIA 3NC8A 1RP5A 4LV2A 4Y15A 3NJAA 2V2FF 2EXAA 3EQUA 1L3LA 3F1NB 5KSHA 2C5WB 4X53A 3PBTA 3LEZA 1VQQA 1XP4A 4HNBA 3FWLA 4EETB 5F68A 5HWTA 2Z6CA 5E2FA 4RA7A 5DFYA 3GMWA 4YINA 4PM8A 2VZWA 4NXBA 1OJGA 2P04A 1HZOA 1W5DA 3P09A 4E3OA 4PHTA 4S2NA 3NOPC 4Y0TA 4FH4A 1GHPA 2V1ZA 4I3AA 1DY6A 2Y2HA 2OLUA 3G2YA 2V20A 4GZBA 1IKIA 4C75A 3UB9A 1N9OA 3T4OA 4LRZE 1K54A 3M2KA 4MBKA 4LENA 2UV0E 3S1YA 2IA2A 3AGFA 5FEFA 1HVBA 1K56A 2A24B 4U0TA 3WS2A 2R78A 2BASA 4HQAA 3S7QA 3A3JA 1YLWA 3JPUA 3RFBA 4X55A 1S4SA 3BRMA 3HBRA 1AXBA 2ZQCA 3RH8B 1YLPA 4ZAMA 1W8QA 3R7WB 2HF6A 5I94A 4O8GA 2ZC6B 3NHQA 3C7VA 2ZJ9A 4EEUA 4P6BA 2G7UA 5IT5A 3C8CA 1IYQA 3LIEA 3UDIA 4BMWA 1K55A 2JCHA 1I5QA 4K0XA 1XGIA 3D3OA 3RXWA 3UE3A 3Q7ZA 1P0ZA 1NRFA 1YSPA 3WRTA 5GL9A 3LY3A 4NXFA 4O01A 3N6IA 4X69A 3LUQA 2JKRM 3UNWA 4EERA 2PYRA 4GLQA 3ULFA 1ES4A 4OPYA 4B93A 3QP4A 1KVLA 1ERMA 4E3MA 1F5MA 1Y54A 4EBNA 4PM7A 5E43A 3WRZA 3ZDJA 4WZ5C 4GB7A 3UE6A 4BWIA 2ZLYA 2KLIA 4E3JA 4NETA 3D9YA 2J9PA 1GSWA 4EWFA 3S7NA 4RQ9A 2UWXA 3UMDA 1RGYA 1FOFA 4GDNA 2BG1A 3LR0A 4WLAA 4MN6A 2Y2OA 1DP8A 1V9ZA 3G31A 3ZNYA 4Y0OA 1QMEA 5E2HA 3BEBA 3ZG7B 3PBQA 4OP8A 2G2WA 2J3WA 2HGVA 4UA9A 1N9NA 4OQHA 5HWWA 4KZ5A 2PAVP 4PM9A 4EV4A 1XJ3A 3T1QB 1K56D 3NI9A 1FCNA 1O07A 3G34A 5EVIA 4P6ZM 4S2KA 5A8BA 3ITAA 4MBFA 2PDRA 2ZM2A 1S1ZA 4KG6A 3DAVA 2OWJA 4BBUA 1CI9A 2VV7A 3EGXC 2DCFA 1S6RA 5DVAA 2JKTI 4KZ9A 2H0TA 3H82B 5FDHA 4QHCA 4Q0JA 2EX8A 4E3NA 3MZDA 4I5SA 4PM6A 4OOMA 5FQQA 3V50A 1G5UA 3A3FA 1BLHA 3MKFA 2DRWA 1EW0A 1P9RA 5EFWA 2XEPA 4BLMA 5AQBA 3KSFA 1GSVA 3Q81A 4IJGA 4O7DA 4I3IA 1LSVA 3CUEC 2XROA 1I2SA 4OLDA 4P0MA 1TDGA 3UB8A 5FQJA 2Y2NA 1SZVA 1VETA 2HP9A 3IHAA 3CMZA 3P7NA 5U47A 1ZKJA 2QYBA 1E25A 2BTFP 3GR2A 4X56A 1NXYA 2J3TC 4JGRA 3I7JA 3VE4A 2WZZA 4JF6A 2X01A 4IBRA 1PI4A 5HAIA 1IYPA 1K6SA 5F6AA 4KZ8A 2P08A 3GQZA 3W4QA 5TR7A 4HESA 2WAEA 3KSGA 1UWPX 3QNBA 3HLEA 1BLCA 3IX4A 4IEDA 2V8CA 1TS7A 2ZBBA 1W63Q 3E4QA 4JGPA 5CHUA 4S2LA 3GVBA 3W2ZA 4E6WA 4ZRRA 5GLDA 5L10A 2Y2JA 5FI6A 1K4EA 1LSWA 1LI9A 4AFIA 3LIDA 1DJBA 2EFUA 2Q9MA 1F9IA 4MLLA 5EVID 2ZD8A 1QMFA 4RYEA 3M6BA 5HL1A 2R9XA 5I5LA 3HL9A 5FQKA 1YLJA 4I3JA 5L09A 1XGJA 2ZQ7A 3G6OA 2WGWB 5GLCA 3BY9A 4EBPA 3OZHA 1EWZA 3VP4A 3T4KA 3E98A 3MQ0A 3MBZA 5DFXA 2ZC4B 1MXOA 2IWDA 4K08A 1ES3A 3IQAA 3Q07A 3ZQ5A 2GX5A 5J7EA 2PR5A 4MMNA 3T4QA 1NZUA 3B33A 3NDEA 2FH5A 1KOUA 5KZHA 4KENB 2NUPC 2Y55A 4BD1A 1JNUA 4XUZA 2WKPA 3M6HA 4IHQA 3QNCA 2XR0A 3DTIA 2JBFA 5AVEA 1DRMA 2XLNA 1XX2A 3VSLA 4LFUA 2O9BA 1BZAA 4KZAA 4OQGA 2Z6DA 3HJKA 4HHDA 4IVIA 3TSGA 4NEED 2PU4A 5CECA 1ZC2A 1OT9A 2HP6A 1W79A 1YMSA 1ERQA 3B47A 1XKZA 2BLSA 3A3DA 4OOYA 1YSQA 3C38A 3F1PB 2A2LA 2I72A 5F83A 4S2IA 4DE0A 3HLGA 2PBDP 2B02A 2PU2A 1GA0A 4HJ4A 5FI2A 2E8JA 3BLSA 2RL3A 4Q8IA 3IS2A 4HIAA 4KG2A 1PIOA 4X68A 2VGLS 4R6LA 1TF1A 2VGJA 1NY0A 3UDXA 2ZMAA 4P6ZS 3IHBA 3NY4A 1F98A 2I9VA 2FFYA 3S22A 4K0WA 3NOTC 2KDKA 2W3GA 1W63M 3T4LA 5DTSA 1CK3A 1SKFA 3CLOA 4H6JB 3LR4A 1G68A 3TG9A 1Q2PA 5FEGA 1VEUB 3E0YA 4CPKA 4OH0A 1H8ZA 1SKOB 4OP5A 2V1AA 1YLTA 3CPTB 4R3AA 3C4PA 1YAXA 4H8RA 5FAQA 3MQOA 3BECA 5D3OA 5HAPA 1T19A 2PR6A 3KX0X 1HLUP 1JTDA 2JKFA
chains in the Genus database with same CATH topology
3IF6C 4BJPA 4X55A 1WE4A 1ZG4A 3BRMA 3HBRA 1AXBA 2ZQCA 3D4FA 4FSFA 4ZTKA 1KE4A 2A3UA 3G4PA 3HLFA 1YLPA 1L0EA 2WYXA 4OPRA 4PM5A 4ZAMA 5TGFA 2GDNA 4DDYA 1W8QA 1MWUA 2WKHA 2WGVA 5I94A 2QMIA 3HUNA 2Y2PA 2ZC6B 1KVMA 5G18A 2Z2LB 3C7VA 2ZJ9A 5CGSA 4P6BA 4HEFA 4KZ3A 4L0LA 4ID4A 1IYQA 1FSYA 4GD6A 4OONA 1SDEA 4KQOA 3B3XA 1CEFA 3UDIA 1K55A 2JCHA 1I5QA 3HLCA 4K0XA 1XGIA 4OPZA 5AQ7A 2WUQA 3RXWA 3UE3A 3DWKA 3FV7A 1TDLA 4GNUA 5HARA 2P9VA 2Y2GA 3BYDA 4FD8A 3Q7ZA 4X6TA 1NRFA 3WRTA 1LL5A 1JWVA 2X02A 3GV9A 3LY3A 2ZC3B 5GL9A 1GA9A 3N6IA 2EX9A 4KZ4A 4X69A 4S2PA 5FQIA 4ZJ3A 2Y2QA 4JF4A 3UNWA 4K91A 2WGIA 4PMAA 5EE8A 1DJAA 4FCFA 5DF8A 3NCKA 3N8SA 4N92A 2QZ6A 4R0QA 4B88A 4DE1A 3DW0A 2XQZA 1ES4A 4OPYA 3UN7A 3MZFA 3V3SA 1KVLA 3ZG0A 3IXGA 1ERMA 4HBUA 1K57A 5GHYA 4E3MA 5CEDA 3SH9A 1Y54A 4EBNA 1M40A 4EUZA 1SDNA 1K4FA 4OVDA 4PM7A 1U60A 5E43A 4BL2A 3IH8A 3WRZA 3ZDJA 1H8YA 1DJCA 4WZ5C 1EROA 5EECA 4GB7A 1BT5A 1L0GA 4GN2A 2ZLYA 5F1GA 5CHMA 5HFOA 3V39A 4E3JA 3IXHA 5GHXA 3WWXA 1XXMA 3A3IA 3IXDA 1FQGA 1IEMA 1MWSA 2Y2LA 4JXSA 4NETA 5CRFA 1PW8A 5A91A 1M6KA 2J9PA 4DXBA 3GTCA 1K6RA 4EWFA 3C4OA 4JLFA 5E2GA 5BOHA 5FAPA 1IYOA 1XA1A 2ZQ8A 2ZC7A 4NK3A 1WYBA 2X71A 3OPPA 2UWXA 4WEKA 4N9KA 3IF6B 1RGYA 2HPBA 4IVKA 1FOFA 4KG5A 3IXBA 5DTTA 3VP2A 2E8IA 4GDNA 1BUEA 1XPBA 5JYOA 2BG1A 1O7EA 1PZOA 1S0WA 1E3UD 3O87A 3C5AA 2A49A 2Y2OA 2XGNA 3UPNA 3G31A 3ZNYA 4Y7PA 3UPPA 4Y0OA 5M18A 3WS0A 3M2JA 4WEJA 4WYYA 3EQVA 1QMEA 5E2HA 3IF5A 4QU3A 4WMCA 3BEBA 3QHYA 5IHVA 3VOYA 3WS4A 2RCXA 5EOOA 3ZG7B 3PBQA 4OP8A 5FASA 2G2WA 4JXGA 4QB8A 4UA9A 4OQHA 4E3LA 4WBGA 3FZCA 4KZ5A 4PM9A 3W4PA 4EV4A 4QY6A 2Y4AA 2J7VA 5AQAA 2ZC5B 1PI5A 1MPLA 4OKPA 2XFSA 2IWBA 3ITBA 5CXWA 5CEBA 2EX2A 3IWOA 1KGFA 2FFFB 3MZEA 1K56D 2Y2MA 2XD1A 3NI9A 4U3TA 1FCNA 1O07A 3G34A 5EVIA 4B4ZA 3PBOA 2JC7A 4S2KA 5HX9A 2VGKA 4WM9A 3ITAA 4MBFA 3UE0A 2ZM2A 3SH7A 1NZOA 1KGGA 4KG6A 3LCEA 4OOLA 5EUAA 1CI9A 5DVAA 2DCFA 1S6RA 4JBFA 4A5RA 3UPOA 5AQ9A 2J8YA 5A92A 3HLWA 2WZXA 4LCMA 4KZ9A 4BL3A 2H5SA 1IYSA 1ZG6A 2H0TA 3IWQA 1HD8A 3CG5A 5CTNA 4ZBEA 1YT4A 3ZGAB 4DF6A 5M19A 3VMAA 5FDHA 1NJ4A 4QHCA 2EX8A 1N4OA 2Y2KA 4E3NA 3MZDA 4PM6A 4OOMA 3Q82A 5FQQA 3A3FA 3V50A 1BLHA 1ONHA 3IF6A 3MKFA 2DRWA 1SCWA 2HP5A 3CJMA 1H5XA 1E4DA 4N1XA 4R23A 3SH8A 2XFTA 2XEPA 4MBHA 3ZG9B 4BENA 4BLMA 1JWZA 3IH9A 4DDSA 5AQBA 3V5MA 3OCNA 3Q81A 4JPMA 1ES5A 4MNRA 4O7DA 2QPNA 3HLBA 3PBRA 1FCMA 5TFQA 3ZNTA 3JYIA 1I2SA 4OLDA 4P0MA 2ZQDA 2P74A 1TDGA 4CJNA 1XA7A 4N1HA 3NDGA 4HBTA 5FQJA 5F1FA 4PPRA 1MY8A 1KE0A 2Y2NA 2CC1A 4D2OA 4R3JA 4KZ6A 2HP9A 1ES2A 5EVIB 4RVAA 3RXXA 3N8RA 3PAEA 5HAQA 3HUMA 3IHAA 3CMZA 1TVFA 4LV0A 1BLPA 5U47A 4C6YA 4EBLA 4BD0A 1ZKJA 4KQQA 3SS3A 1E25A 3GR2A 4QJGA 3MXRA 4X56A 1K38A 1RCJA 1NXYA 3I7JA 4KZ7A 2WZZA 3G32A 2HDQA 3Q7VB 4JF6A 1GHIA 3HVFA 1YMXA 3NIAA 4GKUA 2X01A 1KGEA 3IT9A 1MWTA 4P87A 1FR6A 3PBSA 4IBRA 1PI4A 3O3VA 2XDMA 5GHZA 1K25A 5HAIA 1IYPA 1K6SA 4KZ8A 3W4QA 2Z2MB 3GQZA 4P85A 5TR7A 3GRJA 2WAEA 4HESA 1ALQA 2ZQ9A 3ZCZA 4WZ5A 3QNBA 4DE3A 4UHUA 3HLEA 4S2NC 1BLCA 3VFFA 1JVJA 4F94A 1FCOA 3ZG5A 4FH2A 4IEDA 3MXSA 1J9MA 4OQIA 3HUOA 3N4IA 1PZPA 4Z9QA 3ZVTA 1W8YA 1Q2QA 5GLAA 2Y59A 5CHUA 3E2KA 4S2LA 3OC2A 4RX2A 3GVBA 4WMCD 4N9LA 4E6WA 1LI0A 3G2ZA 3E2LA 5GLDA 1BSGA 1OMEA 3ZHHA 1K54C 1NYYA 2Y2JA 1LLBA 1NYMA 5FI6A 1K4EA 1LI9A 1W7FA 2PBYA 1BTLA 4JXVA 2XH9A 3C7UA 4E3IA 1DJBA 4R1GA 5F82A 1HTZA 2HDUA 1Z6FA 2EFUA 4UAAA 1IKGA 5CGWA 4ZJ2A 2Q9MA 1I2WA 1PWGA 2XF3A 4MLLA 3SS4A 5EVID 2ZD8A 1QMFA 4RYEA 3M6BA 1ONGA 4KZBA 1FR1A 4U0XA 3ZG8B 5HL1A 5FQ9A 2R9XA 3N8LA 3VP3A 3HL9A 5GLBA 5FQKA 1MKIA 1YLJA 1PW1A 2XD5A 3W4OA 4XXRA 3FKVA 4RX3A 3WS1A 1XGJA 2ZQ7A 3UO9A 3BFDA 2WGWB 4UA7A 2IWCA 5GLCA 3Q7VA 3BFGA 4DKIA 4EBPA 3OZHA 1EWZA 3OPLA 3PTEA 3VP4A 4EQIA 5J8XA 3AGDA 1KE3A 2C6WB 3MBZA 4BQMA 2ZC4B 1MXOA 5FAOA 2IWDA 3MKEA 3N7WA 3ZFZA 5KMWA 3MFDA 1ES3A 2XK1A 3IQAA 1CI8A 1LL9A 2HDRA 5DF7A 5A93A 3Q07A 1K55C 5DTKA 5FI7A 3LY4A 4YFMA 2J9OA 4S2OA 1BLSA 1NZUA 3FYZA 2G2UA 4R4RA 4XUXA 4Y0UA 1KDSA 1YQSA 3GSGA 3VFHA 4C3QA 3G30A 5CTMA 3W8KA 3BFCA 3VP0A 3NDEA 2Y91A 4OPQA 5KZHA 1SHVA 3O88A 1VM1A 2ZM8A 4GOGA 4KENB 4OLGA 4S2JA 2Y55A 4BD1A 3VSKA 4XUZA 1MBLA 1L0DA 5FSRA 4DRTA 3M6HA 5EPHA 3QNCA 2XR0A 2JBFA 3HLDA 1RGZA 2B5RA 1K57C 5E2EA 2XLNA 1C3BA 2WK0A 3AGEA 3NBLA 3WS5A 3PBNA 1XX2A 3VSLA 4GDBA 1BZAA 4KZAA 2WKEA 2WKIA 1JTGA 2WADA 4WELA 1ESUA 1G6AA 4OQGA 3DWZA 4JXWA 4IVIA 5DF9A 3BFFA 3IWIA 3NC8A 3DTMA 5M1AA 5A90A 1PYYA 1RP5A 2PU4A 4LV2A 1N9BA 3TSGA 1ZC2A 3OCLA 5CECA 1WYCA 3UE1A 3UDFA 2HP6A 2V2FF 1W79A 2EX6A 1YMSA 2EXAA 1ERQA 3EQUA 1GCEA 4M3KA 3A3EA 2WGWA 4QD4A 5KSHA 1XKZA 2BLSA 3A3DA 2EXBA 2C5WB 2JE5A 3BM6A 2Q9NA 2R9WA 4S2MA 4GD8A 4X53A 5EVLA 5JYPA 1PWDA 3PBTA 4IBXA 4OOYA 4UA6A 3SOIA 4R4SA 3LEZA 2I72A 4OQ0A 1VQQA 1XP4A 4S2IA 5F83A 3V3RA 1IELA 4QY5A 3SS5A 3VP1A 3HLGA 4DE0A 4JF5A 3TOIA 5FA7A 1YLYA 3FWLA 3ISGA 4LV1A 3S4XA 2PU2A 1GA0A 3P98A 5FI2A 5HW3A 3BLSA 2RL3A 4MEZA 4Q8IA 5E2FA 4RA7A 3GMWA 4KG2A 5L2FA 4YINA 1PIOA 5KSCA 4PM8A 4X68A 2EFXA 2VGJA 1LHYA 1NY0A 3UDXA 2ZMAA 1JWPA 3IHBA 4R3BA 3NY4A 1TEMA 1MWRA 1HZOA 1W5DA 3P09A 3ZVWA 4E3OA 2FFYA 1YLZA 1E3UA 4S2NA 1ESIA 4Y0TA 5EOEA 3S22A 4K0WA 4FH4A 4LV3A 3OPHA 1GHPA 2H10A 2V1ZA 5CGXA 5DTSA 1CK3A 1SKFA 1DY6A 1EI5A 2P9VB 2ZQAA 1L2SA 2Y2HA 5CHJA 2OLUA 3G2YA 4DXCA 3BLMA 3UY6A 2V20A 4GZBA 5EVIC 1G68A 4JKTA 5FATA 3TG9A 1IKIA 1Q2PA 5FQMA 4E6XA 2H0YA 1PWCA 1YM1A 4C75A 3VOZA 2Y2IA 3HREA 3O86A 4CPKA 4E3KA 4OH0A 1H8ZA 2HDSA 4OP5A 1K54A 2ZM0A 1YLTA 3M2KA 1CEGA 3PAGA 4MBKA 1KDWA 4LENA 3C4PA 4KQRA 4ZJ1A 4DE2A 3S1YA 4H8RA 1GHMA 3CZDA 3AGFA 2OLVA 5FAQA 1HVBA 2WAFA 3BFEA 3BECA 4ZDXA 1K56A 5D3OA 4U0TA 3WS2A 5HAPA 4B4XA 2OSUA 4LCLA 3OPRA 5CERA 1FSWA 3A3JA 3FKWA 4WZ4A 1JTDA 2OV5A 3LO7A 3RJUA 2DNSA 3Q1FA 1L0FA 1YLWA 3G35A 1BULA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IF6 C;  4BJP A;  4X55 A;  1WE4 A;  1ZG4 A;  3BRM A;  3HBR A;  1AXB A;  2ZQC A;  3D4F A;  4FSF A;  4ZTK A;  1KE4 A;  2A3U A;  3G4P A;  3HLF A;  1YLP A;  1L0E A;  2WYX A;  4OPR A;  4PM5 A;  4ZAM A;  5TGF A;  2GDN A;  4DDY A;  1W8Q A;  1MWU A;  2WKH A;  2WGV A;  5I94 A;  2QMI A;  3HUN A;  2Y2P A;  2ZC6 B;  1KVM A;  5G18 A;  2Z2L B;  3C7V A;  2ZJ9 A;  5CGS A;  4P6B A;  4HEF A;  4KZ3 A;  4L0L A;  4ID4 A;  1IYQ A;  1FSY A;  4GD6 A;  4OON A;  1SDE A;  4KQO A;  3B3X A;  1CEF A;  3UDI A;  1K55 A;  2JCH A;  1I5Q A;  3HLC A;  4K0X A;  1XGI A;  4OPZ A;  5AQ7 A;  2WUQ A;  3RXW A;  3UE3 A;  3DWK A;  3FV7 A;  1TDL A;  4GNU A;  5HAR A;  2P9V A;  2Y2G A;  3BYD A;  4FD8 A;  3Q7Z A;  4X6T A;  1NRF A;  3WRT A;  1LL5 A;  1JWV A;  2X02 A;  3GV9 A;  3LY3 A;  2ZC3 B;  5GL9 A;  1GA9 A;  3N6I A;  2EX9 A;  4KZ4 A;  4X69 A;  4S2P A;  5FQI A;  4ZJ3 A;  2Y2Q A;  4JF4 A;  3UNW A;  4K91 A;  2WGI A;  4PMA A;  5EE8 A;  1DJA A;  4FCF A;  5DF8 A;  3NCK A;  3N8S A;  4N92 A;  2QZ6 A;  4R0Q A;  4B88 A;  4DE1 A;  3DW0 A;  2XQZ A;  1ES4 A;  4OPY A;  3UN7 A;  3MZF A;  3V3S A;  1KVL A;  3ZG0 A;  3IXG A;  1ERM A;  4HBU A;  1K57 A;  5GHY A;  4E3M A;  5CED A;  3SH9 A;  1Y54 A;  4EBN A;  1M40 A;  4EUZ A;  1SDN A;  1K4F A;  4OVD A;  4PM7 A;  1U60 A;  5E43 A;  4BL2 A;  3IH8 A;  3WRZ A;  3ZDJ A;  1H8Y A;  1DJC A;  4WZ5 C;  1ERO A;  5EEC A;  4GB7 A;  1BT5 A;  1L0G A;  4GN2 A;  2ZLY A;  5F1G A;  5CHM A;  5HFO A;  3V39 A;  4E3J A;  3IXH A;  5GHX A;  3WWX A;  1XXM A;  3A3I A;  3IXD A;  1FQG A;  1IEM A;  1MWS A;  2Y2L A;  4JXS A;  4NET A;  5CRF A;  1PW8 A;  5A91 A;  1M6K A;  2J9P A;  4DXB A;  3GTC A;  1K6R A;  4EWF A;  3C4O A;  4JLF A;  5E2G A;  5BOH A;  5FAP A;  1IYO A;  1XA1 A;  2ZQ8 A;  2ZC7 A;  4NK3 A;  1WYB A;  2X71 A;  3OPP A;  2UWX A;  4WEK A;  4N9K A;  3IF6 B;  1RGY A;  2HPB A;  4IVK A;  1FOF A;  4KG5 A;  3IXB A;  5DTT A;  3VP2 A;  2E8I A;  4GDN A;  1BUE A;  1XPB A;  5JYO A;  2BG1 A;  1O7E A;  1PZO A;  1S0W A;  1E3U D;  3O87 A;  3C5A A;  2A49 A;  2Y2O A;  2XGN A;  3UPN A;  3G31 A;  3ZNY A;  4Y7P A;  3UPP A;  4Y0O A;  5M18 A;  3WS0 A;  3M2J A;  4WEJ A;  4WYY A;  3EQV A;  1QME A;  5E2H A;  3IF5 A;  4QU3 A;  4WMC A;  3BEB A;  3QHY A;  5IHV A;  3VOY A;  3WS4 A;  2RCX A;  5EOO A;  3ZG7 B;  3PBQ A;  4OP8 A;  5FAS A;  2G2W A;  4JXG A;  4QB8 A;  4UA9 A;  4OQH A;  4E3L A;  4WBG A;  3FZC A;  4KZ5 A;  4PM9 A;  3W4P A;  4EV4 A;  4QY6 A;  2Y4A A;  2J7V A;  5AQA A;  2ZC5 B;  1PI5 A;  1MPL A;  4OKP A;  2XFS A;  2IWB A;  3ITB A;  5CXW A;  5CEB A;  2EX2 A;  3IWO A;  1KGF A;  2FFF B;  3MZE A;  1K56 D;  2Y2M A;  2XD1 A;  3NI9 A;  4U3T A;  1FCN A;  1O07 A;  3G34 A;  5EVI A;  4B4Z A;  3PBO A;  2JC7 A;  4S2K A;  5HX9 A;  2VGK A;  4WM9 A;  3ITA A;  4MBF A;  3UE0 A;  2ZM2 A;  3SH7 A;  1NZO A;  1KGG A;  4KG6 A;  3LCE A;  4OOL A;  5EUA A;  1CI9 A;  5DVA A;  2DCF A;  1S6R A;  4JBF A;  4A5R A;  3UPO A;  5AQ9 A;  2J8Y A;  5A92 A;  3HLW A;  2WZX A;  4LCM A;  4KZ9 A;  4BL3 A;  2H5S A;  1IYS A;  1ZG6 A;  2H0T A;  3IWQ A;  1HD8 A;  3CG5 A;  5CTN A;  4ZBE A;  1YT4 A;  3ZGA B;  4DF6 A;  5M19 A;  3VMA A;  5FDH A;  1NJ4 A;  4QHC A;  2EX8 A;  1N4O A;  2Y2K A;  4E3N A;  3MZD A;  4PM6 A;  4OOM A;  3Q82 A;  5FQQ A;  3A3F A;  3V50 A;  1BLH A;  1ONH A;  3IF6 A;  3MKF A;  2DRW A;  1SCW A;  2HP5 A;  3CJM A;  1H5X A;  1E4D A;  4N1X A;  4R23 A;  3SH8 A;  2XFT A;  2XEP A;  4MBH A;  3ZG9 B;  4BEN A;  4BLM A;  1JWZ A;  3IH9 A;  4DDS A;  5AQB A;  3V5M A;  3OCN A;  3Q81 A;  4JPM A;  1ES5 A;  4MNR A;  4O7D A;  2QPN A;  3HLB A;  3PBR A;  1FCM A;  5TFQ A;  3ZNT A;  3JYI A;  1I2S A;  4OLD A;  4P0M A;  2ZQD A;  2P74 A;  1TDG A;  4CJN A;  1XA7 A;  4N1H A;  3NDG A;  4HBT A;  5FQJ A;  5F1F A;  4PPR A;  1MY8 A;  1KE0 A;  2Y2N A;  2CC1 A;  4D2O A;  4R3J A;  4KZ6 A;  2HP9 A;  1ES2 A;  5EVI B;  4RVA A;  3RXX A;  3N8R A;  3PAE A;  5HAQ A;  3HUM A;  3IHA A;  3CMZ A;  1TVF A;  4LV0 A;  1BLP A;  5U47 A;  4C6Y A;  4EBL A;  4BD0 A;  1ZKJ A;  4KQQ A;  3SS3 A;  1E25 A;  3GR2 A;  4QJG A;  3MXR A;  4X56 A;  1K38 A;  1RCJ A;  1NXY A;  3I7J A;  4KZ7 A;  2WZZ A;  3G32 A;  2HDQ A;  3Q7V B;  4JF6 A;  1GHI A;  3HVF A;  1YMX A;  3NIA A;  4GKU A;  2X01 A;  1KGE A;  3IT9 A;  1MWT A;  4P87 A;  1FR6 A;  3PBS A;  4IBR A;  1PI4 A;  3O3V A;  2XDM A;  5GHZ A;  1K25 A;  5HAI A;  1IYP A;  1K6S A;  4KZ8 A;  3W4Q A;  2Z2M B;  3GQZ A;  4P85 A;  5TR7 A;  3GRJ A;  2WAE A;  4HES A;  1ALQ A;  2ZQ9 A;  3ZCZ A;  4WZ5 A;  3QNB A;  4DE3 A;  4UHU A;  3HLE A;  4S2N C;  1BLC A;  3VFF A;  1JVJ A;  4F94 A;  1FCO A;  3ZG5 A;  4FH2 A;  4IED A;  3MXS A;  1J9M A;  4OQI A;  3HUO A;  3N4I A;  1PZP A;  4Z9Q A;  3ZVT A;  1W8Y A;  1Q2Q A;  5GLA A;  2Y59 A;  5CHU A;  3E2K A;  4S2L A;  3OC2 A;  4RX2 A;  3GVB A;  4WMC D;  4N9L A;  4E6W A;  1LI0 A;  3G2Z A;  3E2L A;  5GLD A;  1BSG A;  1OME A;  3ZHH A;  1K54 C;  1NYY A;  2Y2J A;  1LLB A;  1NYM A;  5FI6 A;  1K4E A;  1LI9 A;  1W7F A;  2PBY A;  1BTL A;  4JXV A;  2XH9 A;  3C7U A;  4E3I A;  1DJB A;  4R1G A;  5F82 A;  1HTZ A;  2HDU A;  1Z6F A;  2EFU A;  4UAA A;  1IKG A;  5CGW A;  4ZJ2 A;  2Q9M A;  1I2W A;  1PWG A;  2XF3 A;  4MLL A;  3SS4 A;  5EVI D;  2ZD8 A;  1QMF A;  4RYE A;  3M6B A;  1ONG A;  4KZB A;  1FR1 A;  4U0X A;  3ZG8 B;  5HL1 A;  5FQ9 A;  2R9X A;  3N8L A;  3VP3 A;  3HL9 A;  5GLB A;  5FQK A;  1MKI A;  1YLJ A;  1PW1 A;  2XD5 A;  3W4O A;  4XXR A;  3FKV A;  4RX3 A;  3WS1 A;  1XGJ A;  2ZQ7 A;  3UO9 A;  3BFD A;  2WGW B;  4UA7 A;  2IWC A;  5GLC A;  3Q7V A;  3BFG A;  4DKI A;  4EBP A;  3OZH A;  1EWZ A;  3OPL A;  3PTE A;  3VP4 A;  4EQI A;  5J8X A;  3AGD A;  1KE3 A;  2C6W B;  3MBZ A;  4BQM A;  2ZC4 B;  1MXO A;  5FAO A;  2IWD A;  3MKE A;  3N7W A;  3ZFZ A;  5KMW A;  3MFD A;  1ES3 A;  2XK1 A;  3IQA A;  1CI8 A;  1LL9 A;  2HDR A;  5DF7 A;  5A93 A;  3Q07 A;  1K55 C;  5DTK A;  5FI7 A;  3LY4 A;  4YFM A;  2J9O A;  4S2O A;  1BLS A;  1NZU A;  3FYZ A;  2G2U A;  4R4R A;  4XUX A;  4Y0U A;  1KDS A;  1YQS A;  3GSG A;  3VFH A;  4C3Q A;  3G30 A;  5CTM A;  3W8K A;  3BFC A;  3VP0 A;  3NDE A;  2Y91 A;  4OPQ A;  5KZH A;  1SHV A;  3O88 A;  1VM1 A;  2ZM8 A;  4GOG A;  4KEN B;  4OLG A;  4S2J A;  2Y55 A;  4BD1 A;  3VSK A;  4XUZ A;  1MBL A;  1L0D A;  5FSR A;  4DRT A;  3M6H A;  5EPH A;  3QNC A;  2XR0 A;  2JBF A;  3HLD A;  1RGZ A;  2B5R A;  1K57 C;  5E2E A;  2XLN A;  1C3B A;  2WK0 A;  3AGE A;  3NBL A;  3WS5 A;  3PBN A;  1XX2 A;  3VSL A;  4GDB A;  1BZA A;  4KZA A;  2WKE A;  2WKI A;  1JTG A;  2WAD A;  4WEL A;  1ESU A;  1G6A A;  4OQG A;  3DWZ A;  4JXW A;  4IVI A;  5DF9 A;  3BFF A;  3IWI A;  3NC8 A;  3DTM A;  5M1A A;  5A90 A;  1PYY A;  1RP5 A;  2PU4 A;  4LV2 A;  1N9B A;  3TSG A;  1ZC2 A;  3OCL A;  5CEC A;  1WYC A;  3UE1 A;  3UDF A;  2HP6 A;  2V2F F;  1W79 A;  2EX6 A;  1YMS A;  2EXA A;  1ERQ A;  3EQU A;  1GCE A;  4M3K A;  3A3E A;  2WGW A;  4QD4 A;  5KSH A;  1XKZ A;  2BLS A;  3A3D A;  2EXB A;  2C5W B;  2JE5 A;  3BM6 A;  2Q9N A;  2R9W A;  4S2M A;  4GD8 A;  4X53 A;  5EVL A;  5JYP A;  1PWD A;  3PBT A;  4IBX A;  4OOY A;  4UA6 A;  3SOI A;  4R4S A;  3LEZ A;  2I72 A;  4OQ0 A;  1VQQ A;  1XP4 A;  4S2I A;  5F83 A;  3V3R A;  1IEL A;  4QY5 A;  3SS5 A;  3VP1 A;  3HLG A;  4DE0 A;  4JF5 A;  3TOI A;  5FA7 A;  1YLY A;  3FWL A;  3ISG A;  4LV1 A;  3S4X A;  2PU2 A;  1GA0 A;  3P98 A;  5FI2 A;  5HW3 A;  3BLS A;  2RL3 A;  4MEZ A;  4Q8I A;  5E2F A;  4RA7 A;  3GMW A;  4KG2 A;  5L2F A;  4YIN A;  1PIO A;  5KSC A;  4PM8 A;  4X68 A;  2EFX A;  2VGJ A;  1LHY A;  1NY0 A;  3UDX A;  2ZMA A;  1JWP A;  3IHB A;  4R3B A;  3NY4 A;  1TEM A;  1MWR A;  1HZO A;  1W5D A;  3P09 A;  3ZVW A;  4E3O A;  2FFY A;  1YLZ A;  1E3U A;  4S2N A;  1ESI A;  4Y0T A;  5EOE A;  3S22 A;  4K0W A;  4FH4 A;  4LV3 A;  3OPH A;  1GHP A;  2H10 A;  2V1Z A;  5CGX A;  5DTS A;  1CK3 A;  1SKF A;  1DY6 A;  1EI5 A;  2P9V B;  2ZQA A;  1L2S A;  2Y2H A;  5CHJ A;  2OLU A;  3G2Y A;  4DXC A;  3BLM A;  3UY6 A;  2V20 A;  4GZB A;  5EVI C;  1G68 A;  4JKT A;  5FAT A;  3TG9 A;  1IKI A;  1Q2P A;  5FQM A;  4E6X A;  2H0Y A;  1PWC A;  1YM1 A;  4C75 A;  3VOZ A;  2Y2I A;  3HRE A;  3O86 A;  4CPK A;  4E3K A;  4OH0 A;  1H8Z A;  2HDS A;  4OP5 A;  1K54 A;  2ZM0 A;  1YLT A;  3M2K A;  1CEG A;  3PAG A;  4MBK A;  1KDW A;  4LEN A;  3C4P A;  4KQR A;  4ZJ1 A;  4DE2 A;  3S1Y A;  4H8R A;  1GHM A;  3CZD A;  3AGF A;  2OLV A;  5FAQ A;  1HVB A;  2WAF A;  3BFE A;  3BEC A;  4ZDX A;  1K56 A;  5D3O A;  4U0T A;  3WS2 A;  5HAP A;  4B4X A;  2OSU A;  4LCL A;  3OPR A;  5CER A;  1FSW A;  3A3J A;  3FKW A;  4WZ4 A;  1JTD A;  2OV5 A;  3LO7 A;  3RJU A;  2DNS A;  3Q1F A;  1L0F A;  1YLW A;  3G35 A;  1BUL A; 
#chains in the Genus database with same CATH topology
 1WE4 A;  2ZL1 B;  2V0U A;  3D4F A;  4GW9 A;  2WGV A;  3HUN A;  2Y2P A;  1KVM A;  2Z2L B;  3HJI A;  5CGS A;  5EM0 A;  4L0L A;  3ICY A;  4GHI A;  3HLC A;  1OJ5 A;  2WUQ A;  3FV7 A;  4GNU A;  2P9V A;  2Y2G A;  4HH2 A;  2INW A;  4EQ1 A;  1GA9 A;  5FQI A;  4S2P A;  4ZJ3 A;  4K91 A;  2W1R A;  4R0Q A;  4B88 A;  4GS9 B;  5G4Y A;  1Y28 A;  3ZG0 A;  1K57 A;  5GHY A;  3EEH A;  1OTA A;  5HDC A;  3SH9 A;  4D60 A;  3GEC A;  1M40 A;  4EUZ A;  1SDN A;  1K4F A;  4OVD A;  4EU0 A;  1U60 A;  2LB5 A;  2D01 A;  4ARZ B;  5F69 A;  3V39 A;  5F1G A;  5CHM A;  1DP9 A;  3H9W A;  3CIT A;  2PD8 A;  3IXD A;  1IEM A;  1OPX A;  1PW8 A;  3PHY A;  1M6K A;  4DXB A;  1T18 A;  1K6R A;  5E2G A;  1IOU A;  1XA1 A;  2ZQ8 A;  4NK3 A;  1D06 A;  3C30 A;  4WEK A;  4N9K A;  4IVK A;  2HPB A;  5DTT A;  3EOI A;  1XPB A;  4HH3 A;  1X0O A;  1PZO A;  4HY8 A;  3C5A A;  3UPN A;  4UEY A;  2WKQ A;  3EQV A;  3IF5 A;  3TRC A;  2JKG A;  2RCX A;  2W0N A;  4JXG A;  3FZC A;  3W4P A;  4QY6 A;  5LBR A;  1PI5 A;  2IWB A;  5CXW A;  5L8M A;  3MZE A;  1KGF A;  4PKY G;  5HSQ A;  3PBO A;  1OTI A;  2JC7 A;  5HX9 A;  4WM9 A;  2ZMV A;  2VLG A;  1OTE A;  1NZO A;  2QKP A;  5EUA A;  4JBF A;  3UPO A;  2J8Y A;  4CJN A;  1IYS A;  3H7W A;  3ZGA B;  5CTN A;  1HD8 A;  3T4T A;  5M19 A;  3T1R A;  4QPR A;  3KO6 A;  3Q82 A;  5TJJ A;  3IF6 A;  4X25 A;  4HJ3 A;  4MDZ A;  3CJM A;  1E4D A;  4R23 A;  3BWL A;  4MBH A;  3ZG9 B;  4BEN A;  2CMN A;  4DDS A;  3V5M A;  3OCN A;  2QPN A;  3HLB A;  3PBR A;  3IX3 A;  3T50 A;  5TFQ A;  3ZNT A;  3JYI A;  2KOI A;  3HCY A;  4Q0I A;  3NDG A;  2K31 A;  4PPR A;  4XT2 B;  3BJN A;  2P7J A;  3RXX A;  3N8R A;  3PAE A;  4C6Y A;  4EBL A;  4BD0 A;  1F2K A;  3SS3 A;  3FPV A;  2WKR A;  1K38 A;  3LIA A;  2HDQ A;  1GHI A;  1S4R A;  4FTX A;  3NIA A;  1MWT A;  4P87 A;  1FR6 A;  5EV0 A;  5GHZ A;  1K25 A;  4Y13 A;  2Z2M B;  3MJQ A;  4P85 A;  4B9O A;  3GRJ A;  1ALQ A;  3ZCZ A;  2PD7 A;  1D1J A;  3F1O A;  4S2N C;  3QP6 A;  1FCO A;  2D02 A;  5HD5 A;  2W3D A;  3C2W A;  4CLC E;  3MXS A;  1N9L A;  4HI4 A;  3HUO A;  3ZVT A;  4Z9Q A;  1Q2Q A;  4YNR A;  1OT6 A;  3E2K A;  3OC2 A;  4RX2 A;  5MC7 A;  4F3L B;  3G2Z A;  1LL8 A;  3T4J A;  3KSH A;  1K54 C;  1NYY A;  3B42 A;  3MMH A;  1W7F A;  2JHE A;  1BTL A;  4JXV A;  4ETZ A;  4R1G A;  5F82 A;  2HDU A;  4UAA A;  2VGL M;  1I2W A;  3SS4 A;  2LB9 A;  2B18 A;  1ONG A;  1FR1 A;  5FQ9 A;  3N8L A;  1MKI A;  1PW1 A;  1BYW A;  2XD5 A;  3W4O A;  3WS1 A;  1S66 L;  3UO9 A;  3UME A;  4UA7 A;  4ME4 A;  2IWC A;  5IU1 A;  3Q7V A;  3FC7 A;  1UGU A;  4R38 A;  5KIZ A;  4ETX A;  3NOU C;  3BQA A;  5FAO A;  3N7W A;  5KMW A;  2XK1 A;  1CI8 A;  3SW1 A;  3CI6 A;  2HDR A;  5DF7 A;  1K55 C;  4NXG A;  2HJE A;  3LY4 A;  2PRF A;  2J9O A;  3FYZ A;  2G2U A;  4XUX A;  1KDS A;  2EWV A;  3GSG A;  3G30 A;  3BFC A;  2Q0O A;  3FPW A;  3BY8 A;  3UB7 A;  1SHV A;  1VM1 A;  2ZM8 A;  4DJ3 A;  1VB6 A;  3K2N A;  5DKK A;  5TBM A;  1MBL A;  5FSR A;  1C3B A;  4EXO A;  4GDB A;  1CF0 A;  2WKE A;  1JTG A;  4JXW A;  3T1X A;  3BFF A;  5M1A A;  5A90 A;  1PYY A;  1N9B A;  3OCL A;  1WYC A;  3U2A A;  1J3W A;  3LR3 A;  2XRN A;  1GCE A;  3A3E A;  4JGO A;  3BM6 A;  5EVL A;  2Q9N A;  2R9W A;  5JYP A;  1V9Y A;  3VE3 A;  4UA6 A;  3SOI A;  2VJW A;  3VP1 A;  1FIL A;  3V3R A;  3SS5 A;  2O99 A;  1UWN X;  1YLY A;  3ISG A;  3S4X A;  5HW3 A;  2DMW A;  4MEZ A;  5FL3 A;  5KSC A;  1LHY A;  4R3B A;  1E3U A;  1ESI A;  5EOE A;  3OPH A;  2H10 A;  2W1T A;  2H28 A;  1EI5 A;  5CHJ A;  4DXC A;  3BLM A;  3GDI A;  5EVI C;  5FQM A;  2H0Y A;  4CLC A;  3VOZ A;  3HRE A;  3O86 A;  4E3K A;  2ZM0 A;  1CEG A;  3PAG A;  1KDW A;  3CZD A;  2O0Y A;  1OTB A;  1H3Q A;  4ZDX A;  1CQA A;  3F1N A;  4LCL A;  3FKW A;  3LO7 A;  3RJU A;  1MZU A;  1STZ A;  1L0F A;  3G35 A;  1BUL A;  3CWF A;  4BJP A;  3T12 B;  3MF0 A;  5J4E A;  4X1L A;  4FSF A;  4ZTK A;  4I38 A;  3NUL A;  4OPR A;  2WYX A;  5TGF A;  2JKR I;  2GDN A;  4O0P A;  2GJ3 A;  5G18 A;  2QWS A;  4ID4 A;  1FSY A;  3LFV A;  1T1B A;  1CEF A;  5AQ7 A;  3OLO A;  1TDL A;  3BYD A;  2K7S A;  2VKS A;  4FD8 A;  1MC0 A;  3V67 A;  3KYE A;  1JWV A;  2X02 A;  2W3F A;  2EX9 A;  4KZ4 A;  2EWW A;  2WGI A;  5EE8 A;  5DF8 A;  3NCK A;  4N92 A;  2QZ6 A;  2MJ6 A;  3P01 A;  3DW0 A;  1T1C A;  2XQZ A;  3UN7 A;  4CQH A;  4DJ2 A;  2AVX A;  2A24 A;  3K3C A;  5EEC A;  3EGD C;  2XA7 M;  5HPF A;  3WWX A;  1XXM A;  4JXS A;  1FQG A;  5CRF A;  1MWS A;  2Y2L A;  4DMZ A;  3T4S A;  5F5Y A;  3GTC A;  3C4O A;  4EW7 A;  4FOF A;  1WYB A;  3OPP A;  2W3E A;  3R7W A;  2V8F A;  4KG5 A;  2E8I A;  5JYO A;  1BUE A;  4BBV A;  3TW8 A;  1E3U D;  3A0V A;  2A49 A;  2XGN A;  4EES A;  1OTD A;  3WS0 A;  2VX8 A;  3M2J A;  4WEJ A;  3DBA A;  3E4P A;  4WMC A;  3QHY A;  5IHV A;  3WS4 A;  4BBT A;  4CLC D;  5FAS A;  4Y5F A;  4WBG A;  1YKD A;  2J7V A;  1VET B;  2JN7 A;  2ZC5 B;  1MPL A;  3LI9 A;  3ITB A;  2EX2 A;  3IWO A;  2VEA A;  3LIB A;  4WF0 A;  2KX6 A;  3UE0 A;  5DJT A;  4OOL A;  1CJF A;  4A5R A;  3E4O A;  2OAQ 1;  5A92 A;  3HLW A;  4LCM A;  4BL3 A;  3IWQ A;  3CG5 A;  1YT4 A;  3KYQ A;  3VMA A;  3VOL A;  1NJ4 A;  2VK3 A;  2Y2K A;  2ACG A;  5AJG A;  2ZMF A;  1ONH A;  1IFQ A;  4EUV A;  1H5X A;  4N1X A;  3SH8 A;  2K2N A;  2PYP A;  1JWZ A;  3IH9 A;  4NG2 A;  1ES5 A;  2JKT M;  5DKL A;  4F3L A;  1FIK A;  4YOF A;  4N1H A;  2FZ0 A;  3ZYT A;  4KZ6 A;  4RVA A;  4LRX C;  2J80 A;  5HAQ A;  3HUM A;  1BLP A;  3LEQ A;  1ACF A;  2OAP 1;  4QJG A;  3MXR A;  1RCJ A;  1S1Y A;  3G32 A;  1YMX A;  4E04 A;  2HV1 A;  3OOV A;  3A0R A;  4LLO B;  4MCW A;  3H82 A;  4Y2F A;  2ZQ9 A;  1XJ6 A;  4WZ5 A;  4UHU A;  3NEC A;  3VFF A;  1JVJ A;  4F94 A;  3ZG5 A;  4FH2 A;  2B95 A;  1J9M A;  4OQI A;  1PZP A;  4HOI A;  1W8Y A;  5GLA A;  2Y59 A;  5HPI A;  4LGW A;  4WMC D;  2M7V A;  1BSG A;  1OME A;  3ZHH A;  1LLB A;  1NYM A;  2Y8H A;  2PBY A;  1HTZ A;  1Z6F A;  5CGW A;  1IKG A;  4Y17 A;  3IX8 A;  4U0X A;  3VP3 A;  3O5Y A;  5GLB A;  4XXR A;  3FKV A;  3BFD A;  4IUH A;  4DKI A;  3OPL A;  4EQI A;  1TS6 A;  1KE3 A;  3K3D A;  3RTY A;  3MKE A;  4FUW A;  1NWZ A;  3LYX A;  3IS2 B;  5FI7 A;  4S2O A;  5HWV A;  4Y0U A;  3CAX A;  4C3Q A;  3S7P A;  3PYP A;  2Y91 A;  5EM1 A;  4S2J A;  4GOG A;  2XA7 S;  4DRT A;  5EPH A;  1RGZ A;  2B5R A;  1K57 C;  2WK0 A;  3WS5 A;  3UB5 P;  4YWZ A;  4HP9 A;  3CUE A;  5DF9 A;  4M4X A;  3DTM A;  1XJ2 A;  1NRJ A;  3UE1 A;  3UDF A;  2EX6 A;  3UB6 A;  4M3K A;  2WGW A;  4QD4 A;  2EXB A;  2JE5 A;  4S2M A;  4GD8 A;  1PWD A;  3OBF A;  4IBX A;  4R4S A;  4EEP A;  2M7U A;  4OQ0 A;  4WUJ A;  1IEL A;  4L9E A;  4QY5 A;  4JF5 A;  3TOI A;  5FA7 A;  4JGQ A;  4LV1 A;  3DTE A;  3P98 A;  5L2F A;  3LIF A;  1T1A A;  2EFX A;  4DN0 A;  4Z1W A;  1JWP A;  1TEM A;  1MWR A;  4X1M A;  3ZVW A;  3L9K A;  1YLZ A;  2W27 A;  4LV3 A;  5J3W A;  4GHI B;  5CGX A;  4L9G A;  2YKH A;  2P9V B;  2ZQA A;  1L2S A;  3UY6 A;  3T1S A;  1NLZ A;  4JKT A;  5FAT A;  4E6X A;  1PWC A;  1YM1 A;  2V0W A;  2Y2I A;  2QJ7 A;  3TJZ C;  2HDS A;  2Y79 A;  1PNE A;  2YKF A;  3JVV A;  4WN5 A;  4KQR A;  4ZJ1 A;  1PFL A;  3QP2 A;  3SZT A;  4DE2 A;  1GHM A;  2OLV A;  2WAF A;  3BFE A;  4G3K A;  3A0S A;  4B4X A;  2OSU A;  5AVF A;  3OPR A;  5CER A;  1FSW A;  4WZ4 A;  2OV5 A;  2DNS A;  3Q1F A;  5K5B A;  3IF6 C;  3F1P A;  4MN7 A;  1ZG4 A;  4MN5 A;  1KE4 A;  2L4R A;  2QHK A;  4GCZ A;  2A3U A;  3G4P A;  3HLF A;  1L0E A;  4PM5 A;  4DDY A;  1MWU A;  4UQI M;  2WKH A;  3EEA A;  2PHY A;  4WL9 A;  2QMI A;  4LRY C;  3LR5 A;  3CHW P;  4HEF A;  4ESP A;  4KZ3 A;  3IBR A;  2W3H A;  4GD6 A;  4OON A;  1SDE A;  4KQO A;  3B3X A;  3L7H A;  4OPZ A;  3U4L P;  3DWK A;  1YPR A;  5HAR A;  1D7E A;  4X6T A;  1LL5 A;  4H6J A;  3GV9 A;  2ZC3 B;  1K0K A;  3MR0 A;  2Y2Q A;  4JF4 A;  4PMA A;  1DJA A;  1ZHH B;  4FCF A;  3N8S A;  1VEU A;  4PAU A;  4DE1 A;  4KUO A;  1SKO A;  4HJ6 A;  3CPT A;  3MZF A;  3V3S A;  1TS8 A;  3MSH A;  3IXG A;  4HBU A;  5CED A;  1P97 A;  2VV6 A;  4I39 A;  4BL2 A;  3IH8 A;  3PXP A;  1H8Y A;  1DJC A;  3BW6 A;  1ERO A;  1PRQ A;  3BQ8 A;  1BT5 A;  1NLY A;  4GN2 A;  1L0G A;  2J3T D;  5HFO A;  1VHM A;  3H7W B;  3IXH A;  4PKY A;  4IUK A;  4LPZ A;  5GHX A;  2ZL1 A;  2XSS A;  3A3I A;  2ZOI A;  5A91 A;  3MQQ A;  4JLF A;  5BOH A;  5FAP A;  1IYO A;  3JVU A;  2ZC7 A;  5HL6 A;  2X71 A;  3IF6 B;  2ZOH A;  3VP2 A;  3DTK A;  3IXB A;  2L0W A;  1O7E A;  1S0W A;  3O87 A;  1TD5 A;  2V1B A;  4Y7P A;  3UPP A;  5M18 A;  4WYY A;  4QU3 A;  3VOY A;  5EOO A;  4QB8 A;  1AWI A;  4E3L A;  2PT7 A;  2Y4A A;  5AQA A;  5G4Z A;  1S67 L;  4OKP A;  4GS9 A;  2XFS A;  5CEB A;  2FFF B;  4GJ4 A;  2Y2M A;  4U3T A;  2XD1 A;  4R70 A;  5HZH A;  4B4Z A;  2VGK A;  1H8M A;  2M1C A;  1ZTU A;  3SH7 A;  1KGG A;  3LCE A;  1H0M A;  4ARZ A;  1DP6 A;  1G6O A;  5AQ9 A;  2WZX A;  2H5S A;  1ZG6 A;  4ZBE A;  4DF6 A;  1N4O A;  3F1O B;  1GSX A;  4NKP A;  1SCW A;  2HP5 A;  2QJ5 A;  2XFT A;  1ODV A;  4II7 A;  3LI8 A;  4JPM A;  4MNR A;  4KQD A;  1FCM A;  3QP5 A;  2HZ5 A;  1WA9 A;  2ZQD A;  2P74 A;  1XA7 A;  3EWK A;  5FDS A;  4HBT A;  5F1F A;  3PR6 A;  1MY8 A;  3S7O A;  1KE0 A;  2CC1 A;  4D2O A;  4R3J A;  1P9W A;  1ES2 A;  5EVI B;  1XJ4 A;  1TVF A;  4LV0 A;  2GZA A;  4KQQ A;  4HP4 A;  4Q0H A;  3MS6 A;  4KZ7 A;  3Q7V B;  4QWO A;  2O9C A;  3HVF A;  4GKU A;  1KGE A;  2OOL A;  3IT9 A;  3PBS A;  3O3V A;  2XDM A;  5DJU A;  1XFN A;  4DE3 A;  1LT0 A;  3TE8 A;  1Z09 A;  4KUK A;  4G3W A;  3KYZ A;  3N4I A;  3QP8 A;  2L1M A;  4N9L A;  4CLC C;  1LI0 A;  3E2L A;  5C5K A;  2V9A A;  5TBM B;  4NXE A;  5HDS A;  2XH9 A;  3C7U A;  4E3I A;  5CX7 A;  4XT2 A;  4ZJ2 A;  1PWG A;  2OWH A;  2XF3 A;  3LIC A;  4UQI S;  4KZB A;  2VV8 A;  3ZG8 B;  3IBJ A;  3VV4 A;  3LGO A;  2NUT C;  4RX3 A;  2EA9 A;  1G28 A;  1A0K A;  3BFG A;  3FG8 A;  2O9A A;  1Y4O A;  3PTE A;  5J8X A;  3AGD A;  2GNX A;  4G3V A;  2C6W B;  4BQM A;  1LSX A;  3ZFZ A;  3MFD A;  1LL9 A;  1MKM A;  5A93 A;  3KSI A;  5EVE A;  5HDD A;  5DTK A;  3R4K A;  4YFM A;  1TS0 A;  2VA0 A;  1BLS A;  3MXQ A;  4R4R A;  3VFH A;  1XFQ A;  1YQS A;  5CTM A;  3W8K A;  3VP0 A;  5IS1 A;  3QP1 A;  4OPQ A;  3O88 A;  2W1T B;  4OLG A;  3D72 A;  3VSK A;  4L9F A;  1L0D A;  5L07 A;  2HJ9 C;  4Y3I A;  3HLD A;  3MFX A;  5E2E A;  3AGE A;  3NBL A;  3PBN A;  4CLC B;  2WKI A;  2WAD A;  4WEL A;  1ESU A;  1G6A A;  3DWZ A;  5HD3 A;  3IWI A;  3NC8 A;  1RP5 A;  4LV2 A;  4Y15 A;  3NJA A;  2V2F F;  2EXA A;  3EQU A;  1L3L A;  3F1N B;  5KSH A;  2C5W B;  4X53 A;  3PBT A;  3LEZ A;  1VQQ A;  1XP4 A;  4HNB A;  3FWL A;  4EET B;  5F68 A;  5HWT A;  2Z6C A;  5E2F A;  4RA7 A;  5DFY A;  3GMW A;  4YIN A;  4PM8 A;  2VZW A;  4NXB A;  1OJG A;  2P04 A;  1HZO A;  1W5D A;  3P09 A;  4E3O A;  4PHT A;  4S2N A;  3NOP C;  4Y0T A;  4FH4 A;  1GHP A;  2V1Z A;  4I3A A;  1DY6 A;  2Y2H A;  2OLU A;  3G2Y A;  2V20 A;  4GZB A;  1IKI A;  4C75 A;  3UB9 A;  1N9O A;  3T4O A;  4LRZ E;  1K54 A;  3M2K A;  4MBK A;  4LEN A;  2UV0 E;  3S1Y A;  2IA2 A;  3AGF A;  5FEF A;  1HVB A;  1K56 A;  2A24 B;  4U0T A;  3WS2 A;  2R78 A;  2BAS A;  4HQA A;  3S7Q A;  3A3J A;  1YLW A;  3JPU A;  3RFB A;  4X55 A;  1S4S A;  3BRM A;  3HBR A;  1AXB A;  2ZQC A;  3RH8 B;  1YLP A;  4ZAM A;  1W8Q A;  3R7W B;  2HF6 A;  5I94 A;  4O8G A;  2ZC6 B;  3NHQ A;  3C7V A;  2ZJ9 A;  4EEU A;  4P6B A;  2G7U A;  5IT5 A;  3C8C A;  1IYQ A;  3LIE A;  3UDI A;  4BMW A;  1K55 A;  2JCH A;  1I5Q A;  4K0X A;  1XGI A;  3D3O A;  3RXW A;  3UE3 A;  3Q7Z A;  1P0Z A;  1NRF A;  1YSP A;  3WRT A;  5GL9 A;  3LY3 A;  4NXF A;  4O01 A;  3N6I A;  4X69 A;  3LUQ A;  2JKR M;  3UNW A;  4EER A;  2PYR A;  4GLQ A;  3ULF A;  1ES4 A;  4OPY A;  4B93 A;  3QP4 A;  1KVL A;  1ERM A;  4E3M A;  1F5M A;  1Y54 A;  4EBN A;  4PM7 A;  5E43 A;  3WRZ A;  3ZDJ A;  4WZ5 C;  4GB7 A;  3UE6 A;  4BWI A;  2ZLY A;  2KLI A;  4E3J A;  4NET A;  3D9Y A;  2J9P A;  1GSW A;  4EWF A;  3S7N A;  4RQ9 A;  2UWX A;  3UMD A;  1RGY A;  1FOF A;  4GDN A;  2BG1 A;  3LR0 A;  4WLA A;  4MN6 A;  2Y2O A;  1DP8 A;  1V9Z A;  3G31 A;  3ZNY A;  4Y0O A;  1QME A;  5E2H A;  3BEB A;  3ZG7 B;  3PBQ A;  4OP8 A;  2G2W A;  2J3W A;  2HGV A;  4UA9 A;  1N9N A;  4OQH A;  5HWW A;  4KZ5 A;  2PAV P;  4PM9 A;  4EV4 A;  1XJ3 A;  3T1Q B;  1K56 D;  3NI9 A;  1FCN A;  1O07 A;  3G34 A;  5EVI A;  4P6Z M;  4S2K A;  5A8B A;  3ITA A;  4MBF A;  2PDR A;  2ZM2 A;  1S1Z A;  4KG6 A;  3DAV A;  2OWJ A;  4BBU A;  1CI9 A;  2VV7 A;  3EGX C;  2DCF A;  1S6R A;  5DVA A;  2JKT I;  4KZ9 A;  2H0T A;  3H82 B;  5FDH A;  4QHC A;  4Q0J A;  2EX8 A;  4E3N A;  3MZD A;  4I5S A;  4PM6 A;  4OOM A;  5FQQ A;  3V50 A;  1G5U A;  3A3F A;  1BLH A;  3MKF A;  2DRW A;  1EW0 A;  1P9R A;  5EFW A;  2XEP A;  4BLM A;  5AQB A;  3KSF A;  1GSV A;  3Q81 A;  4IJG A;  4O7D A;  4I3I A;  1LSV A;  3CUE C;  2XRO A;  1I2S A;  4OLD A;  4P0M A;  1TDG A;  3UB8 A;  5FQJ A;  2Y2N A;  1SZV A;  1VET A;  2HP9 A;  3IHA A;  3CMZ A;  3P7N A;  5U47 A;  1ZKJ A;  2QYB A;  1E25 A;  2BTF P;  3GR2 A;  4X56 A;  1NXY A;  2J3T C;  4JGR A;  3I7J A;  3VE4 A;  2WZZ A;  4JF6 A;  2X01 A;  4IBR A;  1PI4 A;  5HAI A;  1IYP A;  1K6S A;  5F6A A;  4KZ8 A;  2P08 A;  3GQZ A;  3W4Q A;  5TR7 A;  4HES A;  2WAE A;  3KSG A;  1UWP X;  3QNB A;  3HLE A;  1BLC A;  3IX4 A;  4IED A;  2V8C A;  1TS7 A;  2ZBB A;  1W63 Q;  3E4Q A;  4JGP A;  5CHU A;  4S2L A;  3GVB A;  3W2Z A;  4E6W A;  4ZRR A;  5GLD A;  5L10 A;  2Y2J A;  5FI6 A;  1K4E A;  1LSW A;  1LI9 A;  4AFI A;  3LID A;  1DJB A;  2EFU A;  2Q9M A;  1F9I A;  4MLL A;  5EVI D;  2ZD8 A;  1QMF A;  4RYE A;  3M6B A;  5HL1 A;  2R9X A;  5I5L A;  3HL9 A;  5FQK A;  1YLJ A;  4I3J A;  5L09 A;  1XGJ A;  2ZQ7 A;  3G6O A;  2WGW B;  5GLC A;  3BY9 A;  4EBP A;  3OZH A;  1EWZ A;  3VP4 A;  3T4K A;  3E98 A;  3MQ0 A;  3MBZ A;  5DFX A;  2ZC4 B;  1MXO A;  2IWD A;  4K08 A;  1ES3 A;  3IQA A;  3Q07 A;  3ZQ5 A;  2GX5 A;  5J7E A;  2PR5 A;  4MMN A;  3T4Q A;  1NZU A;  3B33 A;  3NDE A;  2FH5 A;  1KOU A;  5KZH A;  4KEN B;  2NUP C;  2Y55 A;  4BD1 A;  1JNU A;  4XUZ A;  2WKP A;  3M6H A;  4IHQ A;  3QNC A;  2XR0 A;  3DTI A;  2JBF A;  5AVE A;  1DRM A;  2XLN A;  1XX2 A;  3VSL A;  4LFU A;  2O9B A;  1BZA A;  4KZA A;  4OQG A;  2Z6D A;  3HJK A;  4HHD A;  4IVI A;  3TSG A;  4NEE D;  2PU4 A;  5CEC A;  1ZC2 A;  1OT9 A;  2HP6 A;  1W79 A;  1YMS A;  1ERQ A;  3B47 A;  1XKZ A;  2BLS A;  3A3D A;  4OOY A;  1YSQ A;  3C38 A;  3F1P B;  2A2L A;  2I72 A;  5F83 A;  4S2I A;  4DE0 A;  3HLG A;  2PBD P;  2B02 A;  2PU2 A;  1GA0 A;  4HJ4 A;  5FI2 A;  2E8J A;  3BLS A;  2RL3 A;  4Q8I A;  3IS2 A;  4HIA A;  4KG2 A;  1PIO A;  4X68 A;  2VGL S;  4R6L A;  1TF1 A;  2VGJ A;  1NY0 A;  3UDX A;  2ZMA A;  4P6Z S;  3IHB A;  3NY4 A;  1F98 A;  2I9V A;  2FFY A;  3S22 A;  4K0W A;  3NOT C;  2KDK A;  2W3G A;  1W63 M;  3T4L A;  5DTS A;  1CK3 A;  1SKF A;  3CLO A;  4H6J B;  3LR4 A;  1G68 A;  3TG9 A;  1Q2P A;  5FEG A;  1VEU B;  3E0Y A;  4CPK A;  4OH0 A;  1H8Z A;  1SKO B;  4OP5 A;  2V1A A;  1YLT A;  3CPT B;  4R3A A;  3C4P A;  1YAX A;  4H8R A;  5FAQ A;  3MQO A;  3BEC A;  5D3O A;  5HAP A;  1T19 A;  2PR6 A;  3KX0 X;  1HLU P;  1JTD A;  2JKF A; 
#chains in the Genus database with same CATH homology
 3IF6 C;  4BJP A;  4X55 A;  1WE4 A;  1ZG4 A;  3BRM A;  3HBR A;  1AXB A;  2ZQC A;  3D4F A;  4FSF A;  4ZTK A;  1KE4 A;  2A3U A;  3G4P A;  3HLF A;  1YLP A;  1L0E A;  2WYX A;  4OPR A;  4PM5 A;  4ZAM A;  5TGF A;  2GDN A;  4DDY A;  1W8Q A;  1MWU A;  2WKH A;  2WGV A;  5I94 A;  2QMI A;  3HUN A;  2Y2P A;  2ZC6 B;  1KVM A;  5G18 A;  2Z2L B;  3C7V A;  2ZJ9 A;  5CGS A;  4P6B A;  4HEF A;  4KZ3 A;  4L0L A;  4ID4 A;  1IYQ A;  1FSY A;  4GD6 A;  4OON A;  1SDE A;  4KQO A;  3B3X A;  1CEF A;  3UDI A;  1K55 A;  2JCH A;  1I5Q A;  3HLC A;  4K0X A;  1XGI A;  4OPZ A;  5AQ7 A;  2WUQ A;  3RXW A;  3UE3 A;  3DWK A;  3FV7 A;  1TDL A;  4GNU A;  5HAR A;  2P9V A;  2Y2G A;  3BYD A;  4FD8 A;  3Q7Z A;  4X6T A;  1NRF A;  3WRT A;  1LL5 A;  1JWV A;  2X02 A;  3GV9 A;  3LY3 A;  2ZC3 B;  5GL9 A;  1GA9 A;  3N6I A;  2EX9 A;  4KZ4 A;  4X69 A;  4S2P A;  5FQI A;  4ZJ3 A;  2Y2Q A;  4JF4 A;  3UNW A;  4K91 A;  2WGI A;  4PMA A;  5EE8 A;  1DJA A;  4FCF A;  5DF8 A;  3NCK A;  3N8S A;  4N92 A;  2QZ6 A;  4R0Q A;  4B88 A;  4DE1 A;  3DW0 A;  2XQZ A;  1ES4 A;  4OPY A;  3UN7 A;  3MZF A;  3V3S A;  1KVL A;  3ZG0 A;  3IXG A;  1ERM A;  4HBU A;  1K57 A;  5GHY A;  4E3M A;  5CED A;  3SH9 A;  1Y54 A;  4EBN A;  1M40 A;  4EUZ A;  1SDN A;  1K4F A;  4OVD A;  4PM7 A;  1U60 A;  5E43 A;  4BL2 A;  3IH8 A;  3WRZ A;  3ZDJ A;  1H8Y A;  1DJC A;  4WZ5 C;  1ERO A;  5EEC A;  4GB7 A;  1BT5 A;  1L0G A;  4GN2 A;  2ZLY A;  5F1G A;  5CHM A;  5HFO A;  3V39 A;  4E3J A;  3IXH A;  5GHX A;  3WWX A;  1XXM A;  3A3I A;  3IXD A;  1FQG A;  1IEM A;  1MWS A;  2Y2L A;  4JXS A;  4NET A;  5CRF A;  1PW8 A;  5A91 A;  1M6K A;  2J9P A;  4DXB A;  3GTC A;  1K6R A;  4EWF A;  3C4O A;  4JLF A;  5E2G A;  5BOH A;  5FAP A;  1IYO A;  1XA1 A;  2ZQ8 A;  2ZC7 A;  4NK3 A;  1WYB A;  2X71 A;  3OPP A;  2UWX A;  4WEK A;  4N9K A;  3IF6 B;  1RGY A;  2HPB A;  4IVK A;  1FOF A;  4KG5 A;  3IXB A;  5DTT A;  3VP2 A;  2E8I A;  4GDN A;  1BUE A;  1XPB A;  5JYO A;  2BG1 A;  1O7E A;  1PZO A;  1S0W A;  1E3U D;  3O87 A;  3C5A A;  2A49 A;  2Y2O A;  2XGN A;  3UPN A;  3G31 A;  3ZNY A;  4Y7P A;  3UPP A;  4Y0O A;  5M18 A;  3WS0 A;  3M2J A;  4WEJ A;  4WYY A;  3EQV A;  1QME A;  5E2H A;  3IF5 A;  4QU3 A;  4WMC A;  3BEB A;  3QHY A;  5IHV A;  3VOY A;  3WS4 A;  2RCX A;  5EOO A;  3ZG7 B;  3PBQ A;  4OP8 A;  5FAS A;  2G2W A;  4JXG A;  4QB8 A;  4UA9 A;  4OQH A;  4E3L A;  4WBG A;  3FZC A;  4KZ5 A;  4PM9 A;  3W4P A;  4EV4 A;  4QY6 A;  2Y4A A;  2J7V A;  5AQA A;  2ZC5 B;  1PI5 A;  1MPL A;  4OKP A;  2XFS A;  2IWB A;  3ITB A;  5CXW A;  5CEB A;  2EX2 A;  3IWO A;  1KGF A;  2FFF B;  3MZE A;  1K56 D;  2Y2M A;  2XD1 A;  3NI9 A;  4U3T A;  1FCN A;  1O07 A;  3G34 A;  5EVI A;  4B4Z A;  3PBO A;  2JC7 A;  4S2K A;  5HX9 A;  2VGK A;  4WM9 A;  3ITA A;  4MBF A;  3UE0 A;  2ZM2 A;  3SH7 A;  1NZO A;  1KGG A;  4KG6 A;  3LCE A;  4OOL A;  5EUA A;  1CI9 A;  5DVA A;  2DCF A;  1S6R A;  4JBF A;  4A5R A;  3UPO A;  5AQ9 A;  2J8Y A;  5A92 A;  3HLW A;  2WZX A;  4LCM A;  4KZ9 A;  4BL3 A;  2H5S A;  1IYS A;  1ZG6 A;  2H0T A;  3IWQ A;  1HD8 A;  3CG5 A;  5CTN A;  4ZBE A;  1YT4 A;  3ZGA B;  4DF6 A;  5M19 A;  3VMA A;  5FDH A;  1NJ4 A;  4QHC A;  2EX8 A;  1N4O A;  2Y2K A;  4E3N A;  3MZD A;  4PM6 A;  4OOM A;  3Q82 A;  5FQQ A;  3A3F A;  3V50 A;  1BLH A;  1ONH A;  3IF6 A;  3MKF A;  2DRW A;  1SCW A;  2HP5 A;  3CJM A;  1H5X A;  1E4D A;  4N1X A;  4R23 A;  3SH8 A;  2XFT A;  2XEP A;  4MBH A;  3ZG9 B;  4BEN A;  4BLM A;  1JWZ A;  3IH9 A;  4DDS A;  5AQB A;  3V5M A;  3OCN A;  3Q81 A;  4JPM A;  1ES5 A;  4MNR A;  4O7D A;  2QPN A;  3HLB A;  3PBR A;  1FCM A;  5TFQ A;  3ZNT A;  3JYI A;  1I2S A;  4OLD A;  4P0M A;  2ZQD A;  2P74 A;  1TDG A;  4CJN A;  1XA7 A;  4N1H A;  3NDG A;  4HBT A;  5FQJ A;  5F1F A;  4PPR A;  1MY8 A;  1KE0 A;  2Y2N A;  2CC1 A;  4D2O A;  4R3J A;  4KZ6 A;  2HP9 A;  1ES2 A;  5EVI B;  4RVA A;  3RXX A;  3N8R A;  3PAE A;  5HAQ A;  3HUM A;  3IHA A;  3CMZ A;  1TVF A;  4LV0 A;  1BLP A;  5U47 A;  4C6Y A;  4EBL A;  4BD0 A;  1ZKJ A;  4KQQ A;  3SS3 A;  1E25 A;  3GR2 A;  4QJG A;  3MXR A;  4X56 A;  1K38 A;  1RCJ A;  1NXY A;  3I7J A;  4KZ7 A;  2WZZ A;  3G32 A;  2HDQ A;  3Q7V B;  4JF6 A;  1GHI A;  3HVF A;  1YMX A;  3NIA A;  4GKU A;  2X01 A;  1KGE A;  3IT9 A;  1MWT A;  4P87 A;  1FR6 A;  3PBS A;  4IBR A;  1PI4 A;  3O3V A;  2XDM A;  5GHZ A;  1K25 A;  5HAI A;  1IYP A;  1K6S A;  4KZ8 A;  3W4Q A;  2Z2M B;  3GQZ A;  4P85 A;  5TR7 A;  3GRJ A;  2WAE A;  4HES A;  1ALQ A;  2ZQ9 A;  3ZCZ A;  4WZ5 A;  3QNB A;  4DE3 A;  4UHU A;  3HLE A;  4S2N C;  1BLC A;  3VFF A;  1JVJ A;  4F94 A;  1FCO A;  3ZG5 A;  4FH2 A;  4IED A;  3MXS A;  1J9M A;  4OQI A;  3HUO A;  3N4I A;  1PZP A;  4Z9Q A;  3ZVT A;  1W8Y A;  1Q2Q A;  5GLA A;  2Y59 A;  5CHU A;  3E2K A;  4S2L A;  3OC2 A;  4RX2 A;  3GVB A;  4WMC D;  4N9L A;  4E6W A;  1LI0 A;  3G2Z A;  3E2L A;  5GLD A;  1BSG A;  1OME A;  3ZHH A;  1K54 C;  1NYY A;  2Y2J A;  1LLB A;  1NYM A;  5FI6 A;  1K4E A;  1LI9 A;  1W7F A;  2PBY A;  1BTL A;  4JXV A;  2XH9 A;  3C7U A;  4E3I A;  1DJB A;  4R1G A;  5F82 A;  1HTZ A;  2HDU A;  1Z6F A;  2EFU A;  4UAA A;  1IKG A;  5CGW A;  4ZJ2 A;  2Q9M A;  1I2W A;  1PWG A;  2XF3 A;  4MLL A;  3SS4 A;  5EVI D;  2ZD8 A;  1QMF A;  4RYE A;  3M6B A;  1ONG A;  4KZB A;  1FR1 A;  4U0X A;  3ZG8 B;  5HL1 A;  5FQ9 A;  2R9X A;  3N8L A;  3VP3 A;  3HL9 A;  5GLB A;  5FQK A;  1MKI A;  1YLJ A;  1PW1 A;  2XD5 A;  3W4O A;  4XXR A;  3FKV A;  4RX3 A;  3WS1 A;  1XGJ A;  2ZQ7 A;  3UO9 A;  3BFD A;  2WGW B;  4UA7 A;  2IWC A;  5GLC A;  3Q7V A;  3BFG A;  4DKI A;  4EBP A;  3OZH A;  1EWZ A;  3OPL A;  3PTE A;  3VP4 A;  4EQI A;  5J8X A;  3AGD A;  1KE3 A;  2C6W B;  3MBZ A;  4BQM A;  2ZC4 B;  1MXO A;  5FAO A;  2IWD A;  3MKE A;  3N7W A;  3ZFZ A;  5KMW A;  3MFD A;  1ES3 A;  2XK1 A;  3IQA A;  1CI8 A;  1LL9 A;  2HDR A;  5DF7 A;  5A93 A;  3Q07 A;  1K55 C;  5DTK A;  5FI7 A;  3LY4 A;  4YFM A;  2J9O A;  4S2O A;  1BLS A;  1NZU A;  3FYZ A;  2G2U A;  4R4R A;  4XUX A;  4Y0U A;  1KDS A;  1YQS A;  3GSG A;  3VFH A;  4C3Q A;  3G30 A;  5CTM A;  3W8K A;  3BFC A;  3VP0 A;  3NDE A;  2Y91 A;  4OPQ A;  5KZH A;  1SHV A;  3O88 A;  1VM1 A;  2ZM8 A;  4GOG A;  4KEN B;  4OLG A;  4S2J A;  2Y55 A;  4BD1 A;  3VSK A;  4XUZ A;  1MBL A;  1L0D A;  5FSR A;  4DRT A;  3M6H A;  5EPH A;  3QNC A;  2XR0 A;  2JBF A;  3HLD A;  1RGZ A;  2B5R A;  1K57 C;  5E2E A;  2XLN A;  1C3B A;  2WK0 A;  3AGE A;  3NBL A;  3WS5 A;  3PBN A;  1XX2 A;  3VSL A;  4GDB A;  1BZA A;  4KZA A;  2WKE A;  2WKI A;  1JTG A;  2WAD A;  4WEL A;  1ESU A;  1G6A A;  4OQG A;  3DWZ A;  4JXW A;  4IVI A;  5DF9 A;  3BFF A;  3IWI A;  3NC8 A;  3DTM A;  5M1A A;  5A90 A;  1PYY A;  1RP5 A;  2PU4 A;  4LV2 A;  1N9B A;  3TSG A;  1ZC2 A;  3OCL A;  5CEC A;  1WYC A;  3UE1 A;  3UDF A;  2HP6 A;  2V2F F;  1W79 A;  2EX6 A;  1YMS A;  2EXA A;  1ERQ A;  3EQU A;  1GCE A;  4M3K A;  3A3E A;  2WGW A;  4QD4 A;  5KSH A;  1XKZ A;  2BLS A;  3A3D A;  2EXB A;  2C5W B;  2JE5 A;  3BM6 A;  2Q9N A;  2R9W A;  4S2M A;  4GD8 A;  4X53 A;  5EVL A;  5JYP A;  1PWD A;  3PBT A;  4IBX A;  4OOY A;  4UA6 A;  3SOI A;  4R4S A;  3LEZ A;  2I72 A;  4OQ0 A;  1VQQ A;  1XP4 A;  4S2I A;  5F83 A;  3V3R A;  1IEL A;  4QY5 A;  3SS5 A;  3VP1 A;  3HLG A;  4DE0 A;  4JF5 A;  3TOI A;  5FA7 A;  1YLY A;  3FWL A;  3ISG A;  4LV1 A;  3S4X A;  2PU2 A;  1GA0 A;  3P98 A;  5FI2 A;  5HW3 A;  3BLS A;  2RL3 A;  4MEZ A;  4Q8I A;  5E2F A;  4RA7 A;  3GMW A;  4KG2 A;  5L2F A;  4YIN A;  1PIO A;  5KSC A;  4PM8 A;  4X68 A;  2EFX A;  2VGJ A;  1LHY A;  1NY0 A;  3UDX A;  2ZMA A;  1JWP A;  3IHB A;  4R3B A;  3NY4 A;  1TEM A;  1MWR A;  1HZO A;  1W5D A;  3P09 A;  3ZVW A;  4E3O A;  2FFY A;  1YLZ A;  1E3U A;  4S2N A;  1ESI A;  4Y0T A;  5EOE A;  3S22 A;  4K0W A;  4FH4 A;  4LV3 A;  3OPH A;  1GHP A;  2H10 A;  2V1Z A;  5CGX A;  5DTS A;  1CK3 A;  1SKF A;  1DY6 A;  1EI5 A;  2P9V B;  2ZQA A;  1L2S A;  2Y2H A;  5CHJ A;  2OLU A;  3G2Y A;  4DXC A;  3BLM A;  3UY6 A;  2V20 A;  4GZB A;  5EVI C;  1G68 A;  4JKT A;  5FAT A;  3TG9 A;  1IKI A;  1Q2P A;  5FQM A;  4E6X A;  2H0Y A;  1PWC A;  1YM1 A;  4C75 A;  3VOZ A;  2Y2I A;  3HRE A;  3O86 A;  4CPK A;  4E3K A;  4OH0 A;  1H8Z A;  2HDS A;  4OP5 A;  1K54 A;  2ZM0 A;  1YLT A;  3M2K A;  1CEG A;  3PAG A;  4MBK A;  1KDW A;  4LEN A;  3C4P A;  4KQR A;  4ZJ1 A;  4DE2 A;  3S1Y A;  4H8R A;  1GHM A;  3CZD A;  3AGF A;  2OLV A;  5FAQ A;  1HVB A;  2WAF A;  3BFE A;  3BEC A;  4ZDX A;  1K56 A;  5D3O A;  4U0T A;  3WS2 A;  5HAP A;  4B4X A;  2OSU A;  4LCL A;  3OPR A;  5CER A;  1FSW A;  3A3J A;  3FKW A;  4WZ4 A;  1JTD A;  2OV5 A;  3LO7 A;  3RJU A;  2DNS A;  3Q1F A;  1L0F A;  1YLW A;  3G35 A;  1BUL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...