4QD4A

Structure of adc-68, a novel carbapenem-hydrolyzing class c extended-spectrum -lactamase from acinetobacter baumannii
Total Genus 125
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
125
sequence length
357
structure length
357
Chain Sequence
PKDQEIKKLVDQNFKPLLEKYDVPGMAVGVIQNNKKYEMYYGLQSVQDKKAVNSSTIFELGSVSKLFTATAGAYAKNKGKISFDDTPGKYWKELKNTPIDQVNLLQLATYTSGNLALQFPDEVQTDQQVLTFFKDWKPKNPIGEYRQYSNPSIGLFGKVVALSMNKPFDQVLEKIIFPALGLKHSYVNVAKTQMQNYAFGYNQENQPIRVNPGPLDAPAYGVKSTLPDMLSFIHANLNPQKYPADIQRAINETHQGRYQVNTMYQALGWEEFSYPATLQTLLDSNSEQIVMKPNKVTAISKEPSVKMYHKTGSTNGFGTYVVFIPKENIGLVMLTNKRIPNEERIKAAYAVLNAIKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactamase ADC-68
publication title Structure of ADC-68, a novel carbapenem-hydrolyzing class C extended-spectrum beta-lactamase isolated from Acinetobacter baumannii
pubmed doi rcsb
source organism Acinetobacter baumannii
molecule tags Hydrolase
total genus 125
structure length 357
sequence length 357
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-05-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00144 Beta-lactamase Beta-lactamase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 4qd4A00
2ZMAA 1BLPA 4U0TA 2XFSA 3UDXA 4XUXA 2Y2HA 1IKGA 5U47A 5TFQA 2WGVA 4MBHA 1S6RA 2X01A 4ZJ3A 5GHXA 1KDWA 1KVLA 4BL3A 1ONGA 2OLVA 3P98A 1EWZA 4RA7A 5FI6A 4EV4A 2H5SA 3WS0A 3DWZA 3DWKA 3OPLA 4S2PA 4XXRA 3M6HA 1MY8A 4KQQA 2XR0A 4PMAA 4HBUA 1FSYA 5A91A 2Z2LB 4D2OA 2EX8A 2R9XA 4ZDXA 3VOYA 4IVIA 3ZCZA 3UDFA 4ZAMA 2XLNA 5KZHA 1YLTA 1RP5A 1I2WA 2XD1A 1E3UD 3LCEA 4GB7A 3SS5A 2Y2OA 4OVDA 2ZM0A 2A49A 3O87A 4S2MA 3G34A 2ZM8A 4JKTA 3GQZA 2HP5A 1K55A 4DE0A 3N8SA 4MLLA 2Y91A 1H8ZA 2Q9NA 3IHBA 3N8RA 3QNBA 4KZBA 5FAQA 1XA1A 2H0YA 4NK3A 1XPBA 4KZ9A 4S2JA 3D4FA 5DF7A 4FCFA 4S2KA 4GN2A 4RVAA 5E2FA 1RCJA 4FH4A 2X02A 4GOGA 4LV3A 1XGJA 4Y0UA 4E3OA 4GDBA 1K4EA 1SKFA 4KENB 4Y7PA 4X69A 1YLWA 1K55C 4IVKA 5GHYA 5GLDA 3UE0A 3WWXA 1FOFA 3FKWA 4JLFA 2VGJA 1HTZA 1M6KA 3ISGA 1G68A 4IEDA 1VM1A 1L0DA 2P9VB 1XX2A 1BLHA 4E3KA 1ONHA 3AGFA 2ZQ9A 1MWSA 3OPHA 1GHIA 2Y2IA 1PI5A 3SOIA 1KVMA 3A3DA 5DTTA 5TGFA 3BFGA 5A92A 2WAFA 3VP3A 3UNWA 4PM7A 3MXSA 4L0LA 1BT5A 1SCWA 3C7VA 4LENA 3G2ZA 3OPPA 1VQQA 4U0XA 1K4FA 4XUZA 3ITAA 3PBQA 3HUMA 1BLCA 3G35A 3S22A 5HW3A 1XP4A 4H8RA 4OPZA 1PWDA 5G18A 3WRZA 3B3XA 1YLPA 4RX3A 4WYYA 5EPHA 1JWZA 1MPLA 5AQAA 5CGXA 4ZJ2A 4C6YA 5JYOA 3MZDA 3ZG9B 3VP0A 2QZ6A 3SH8A 3IHAA 1M40A 1W8YA 1GCEA 1JTDA 5F82A 1CEGA 4KZAA 1TDGA 2UWXA 3ITBA 4Y0OA 3NI9A 1CI9A 4WZ4A 4E3IA 1DY6A 1NZUA 3PBSA 2C6WB 4WBGA 3WRTA 4QJGA 3M2JA 3VMAA 2DNSA 1WE4A 3A3FA 4LV0A 4QB8A 3ZG7B 1BZAA 3ZNTA 3V3SA 1PI4A 4EBPA 1WYBA 2G2WA 3JYIA 2OLUA 5FSRA 3V5MA 1FCNA 1NYYA 3VP2A 5CECA 3G32A 3UPNA 3MKFA 3ZG0A 5DVAA 2ZC5B 5CRFA 4DE2A 1MWTA 4KQRA 4GZBA 1L0EA 1S0WA 1RGYA 3GV9A 4JF4A 4MNRA 3VOZA 3LO7A 4JBFA 1K38A 3ZVWA 1LI0A 1LL5A 4LCMA 3ZG8B 4O7DA 4E3NA 3BRMA 3UPOA 1QMEA 2ZM2A 3HLBA 5BOHA 1IYQA 4OLGA 1DJCA 1IYPA 1W5DA 3WS4A 1LLBA 1XKZA 2B5RA 4EWFA 4Q8IA 2Y2GA 1PYYA 1NZOA 2HDSA 3TOIA 2I72A 3MZFA 5EOEA 3IWQA 4WMCD 3LY4A 3NCKA 4BL2A 3HUOA 1N9BA 2E8IA 3G2YA 2Y59A 2HP9A 4QY6A 2JE5A 3FWLA 3EQVA 3UE1A 1SHVA 4WZ5C 3GSGA 1JWVA 1KGGA 1NXYA 3P09A 4LV2A 2EXBA 3BFDA 1O07A 1K56D 3N8LA 4R23A 1ERQA 4JF6A 5CXWA 3O86A 4RYEA 5HFOA 4S2NC 5FQ9A 4P6BA 2FFYA 2VGKA 5EOOA 4K0WA 5FQMA 5M18A 2XD5A 4N1HA 1YM1A 1KDSA 2EFXA 3GRJA 5HARA 1ESIA 3UE3A 5I94A 3HL9A 5KMWA 4MEZA 2Y2QA 2Y2PA 2XQZA 4UA9A 1K54A 4K91A 5HAPA 3Q07A 2ZQCA 4PM9A 2Y55A 4BQMA 2PU4A 2ZQAA 3QHYA 1L0FA 2X71A 3Q82A 4OQHA 1K57A 4GD6A 3ZGAB 3N6IA 3N7WA 4WELA 3HLGA 4X53A 2H0TA 3LEZA 5AQ9A 4HESA 3MFDA 2HPBA 1K54C 1W8QA 5F83A 3IWOA 1PWCA 1W79A 5HAIA 2Y4AA 3FZCA 3OCLA 4GNUA 3UPPA 1PZPA 2RCXA 2QPNA 3PTEA 1ALQA 4ZJ1A 5FQJA 4KZ4A 1GA9A 2WKIA 4KZ6A 1ZC2A 4A5RA 3O88A 5E43A 1BSGA 3QNCA 5FAOA 5DTKA 3GR2A 3OPRA 4Z9QA 2JC7A 4QHCA 3VSLA 3SS4A 4UA6A 1ZG6A 5CEDA 2WK0A 3M2KA 5AQ7A 3UN7A 1U60A 3HREA 2XFTA 1MXOA 1FQGA 2XEPA 5EVIA 1TEMA 1LHYA 1EI5A 2XF3A 2ZQ8A 4BD0A 4GD8A 5L2FA 3GMWA 3G31A 3HUNA 1CEFA 1Z6FA 5FQIA 2BLSA 5EE8A 1FCOA 1PW8A 2HP6A 4WM9A 1HVBA 3BM6A 1IEMA 4C75A 3PAEA 5HL1A 1KE4A 3FV7A 3NY4A 2Y2NA 1XXMA 5FQKA 3V50A 1KE0A 1PZOA 3S4XA 5FA7A 4E6XA 3ZFZA 2ZC7A 1WYCA 2Y2MA 3DTMA 3IH8A 1K6SA 5HX9A 3NDEA 4B88A 3ZHHA 2HDQA 3IF6A 3WS1A 3Q7ZA 1Y54A 5CHJA 5FQQA 3LY3A 2J9PA 1QMFA 3GVBA 1RGZA 1SDNA 4DE3A 2ZC4B 2EXAA 4E3MA 4F94A 2DRWA 3HBRA 2IWBA 1K6RA 4N9LA 3IXDA 2OV5A 3VSKA 4R4RA 4X68A 2WGIA 4X55A 2PU2A 1ZKJA 4FH2A 4KG5A 4JXGA 2J9OA 1MWUA 4R1GA 1ES4A 2IWCA 2XK1A 3BEBA 2EFUA 2WKHA 3FYZA 4ZBEA 2HDUA 1DJAA 1I2SA 4UAAA 4IBRA 5CHUA 3EQUA 4N92A 3HLDA 3Q81A 1FR6A 3CMZA 3TG9A 4HEFA 4S2IA 5AQBA 4OOMA 1YLJA 3DW0A 4ZTKA 3WS2A 4WEJA 1DJBA 1TVFA 3TSGA 1AXBA 4OLDA 2ZC6B 3CJMA 3MXRA 4QY5A 5E2EA 1G6AA 2Y2LA 2WKEA 2ZD8A 3IXHA 4OQIA 4PPRA 4UA7A 5DTSA 3BFEA 1L0GA 3IXGA 5CEBA 4KQOA 5FDHA 4B4XA 4MBKA 1PW1A 1CK3A 3BLSA 3FKVA 2R9WA 4OOYA 1NY0A 4GDNA 4OP5A 5CGWA 3PBNA 2Y2KA 4JF5A 4S2LA 1KGEA 3OCNA 4WMCA 5F1FA 2WZZA 5HAQA 2V1ZA 1LL9A 1YT4A 4M3KA 3HVFA 5CTMA 1GHPA 1H8YA 3AGEA 3C4PA 3A3IA 2ZC3B 1IYSA 2XDMA 4DE1A 1ES5A 4OKPA 2WGWA 4PM5A 5CGSA 1I5QA 1BULA 3PBRA 4S2OA 1W7FA 1K56A 4KZ7A 5M19A 3BLMA 3UY6A 4IBXA 1FR1A 2ZLYA 4NETA 4DDYA 4RX2A 4R4SA 5FAPA 4JXSA 4P87A 1KGFA 1E4DA 4R0QA 5EUAA 3ZDJA 2G2UA 4BD1A 4ID4A 3C7UA 1PWGA 3Q1FA 1E3UA 1ES3A 4E6WA 5E2HA 5CHMA 4DF6A 3G4PA 5CTNA 2HDRA 4KG2A 4PM6A 3A3EA 4YINA 5JYPA 3GTCA 3UO9A 5DF9A 4CJNA 2WADA 3N4IA 4DXCA 3IWIA 4X6TA 5EECA 3W4OA 1J9MA 3NC8A 1YLZA 3NIAA 5DF8A 4QU3A 2A3UA 3HLFA 1HZOA 5FI7A 3PAGA 5IHVA 4N9KA 3ZG5A 1K57C 3CZDA 3C4OA 2PBYA 4B4ZA 3MZEA 3SH9A 2J8YA 1ERMA 1MKIA 5KSCA 1C3BA 1KE3A 4LV1A 1PIOA 2XH9A 4EUZA 2DCFA 3IT9A 3I7JA 1JTGA 5GHZA 4UHUA 3RXWA 1ESUA 4N1XA 1H5XA 3HLEA 3IQAA 3IF5A 2H10A 4P85A 3M6BA 4JXVA 4KZ3A 4OONA 5EVIB 3W4PA 4EBLA 4P0MA 1XGIA 3SH7A 1ZG4A 3IH9A 4KG6A 2V2FF 3VP4A 1NRFA 4FSFA 4U3TA 2P9VA 3MBZA 1N4OA 4YFMA 2P74A 4BJPA 2WYXA 1YMSA 4EBNA 4DDSA 5A90A 1BLSA 1IKIA 4R3JA 4KZ5A 3AGDA 1SDEA 2WUQA 5EVID 3HLCA 5E2GA 5EVIC 3ZNYA 2Z2MB 4OPYA 4OQGA 3RXXA 3RJUA 5FI2A 4DKIA 3MKEA 4MBFA 4OH0A 5A93A 4FD8A 1BTLA 4KZ8A 1TDLA 1YLYA 2XGNA 3BFCA 1GA0A 1Q2QA 3VFFA 1BUEA 1GHMA 3OZHA 1FSWA 3IF6B 5FASA 4Y0TA 1ES2A 2QMIA 4EQIA 5KSHA 3WS5A 1OMEA 4LCLA 4BLMA 1EROA 3PBOA 5D3OA 5EVLA 2Q9MA 3BECA 3OC2A 3S1YA 2WAEA 4QD4A 1Q2PA 1IELA 3NDGA 4E3JA 3IXBA 4E3LA 2BG1A 2JBFA 5CERA 3A3JA 3IF6C 3O3VA 2ZQ7A 4C3QA 1CI8A 1JVJA 4K0XA 3W8KA 2Y2JA 5F1GA 2EX9A 1IYOA 2V20A 2WZXA 3V3RA 3C5AA 5GLAA 5GLBA 1E25A 3V39A 3ZVTA 2ZQDA 4OPQA 2IWDA 5TR7A 2J7VA 3PBTA 4BENA 1FCMA 1YMXA 1O7EA 4PM8A 3CG5A 2EX2A 3SS3A 2EX6A 4OP8A 2GDNA 1L2SA 3VFHA 2CC1A 1XA7A 4JPMA 2FFFB 2C5WB 1MWRA 4JXWA 3Q7VA 2ZJ9A 3E2KA 4CPKA 3BFFA 3W4QA 3Q7VB 5GLCA 4OQ0A 2RL3A 1HD8A 3E2LA 3G30A 1NYMA 3VP1A 3HLWA 1YQSA 1MBLA 4R3BA 1K25A 3BYDA 4DRTA 4OOLA 4X56A 2OSUA 1LI9A 3NBLA 4WZ5A 4DXBA 5FATA 4GKUA 1NJ4A 2WGWB 4WEKA 1JWPA 5GL9A 3UDIA 4OPRA 5M1AA 5J8XA 2JCHA 4S2NA 4HBTA
chains in the Genus database with same CATH superfamily
5DFYA 2XFSA 3UDXA 4XUXA 5U47A 5TFQA 2MJ6A 2JKFA 1KVLA 4WN5A 1ONGA 3OPLA 3DWKA 3M6HA 4HBUA 1FSYA 2Z2LB 2JKRM 1TF1A 3SZTA 2XLNA 1N9OA 4OVDA 2ZM0A 3O87A 3G34A 3JPUA 4DE0A 3N8SA 4MLLA 2PYRA 1G5UA 2V8FA 2Q9NA 4KZBA 4S2JA 5DF7A 4S2KA 3T4TA 1STZA 4FH4A 2X02A 2HF6A 1SKFA 5J4EA 3UE0A 3FKWA 2OOLA 2A24A 2VGJA 1HTZA 3C8CA 3PHYA 3LUQA 4HI4A 3AGFA 4Y17A 3OPHA 3MXSA 2BTFP 1BT5A 1SCWA 4U0XA 5HW3A 4H8RA 1YLPA 1MPLA 4ZJ2A 4C6YA 4F3LB 5JYOA 3ZG9B 3VP0A 3SH8A 5HD3A 1W8YA 1GCEA 5HWTA 1CEGA 2JKGA 1SZVA 4WZ4A 4P6ZS 1DY6A 1ZHHB 4WBGA 4BBUA 2M1CA 4LV0A 1WE4A 4QB8A 3ZNTA 3E4OA 3C2WA 4EBPA 4AFIA 2G2WA 3JYIA 1FCNA 4DE2A 4KQRA 4GZBA 1S0WA 3GV9A 5C5KA 3U2AA 4MNRA 1T1CA 3R4KA 4O7DA 1H8MA 3D3OA 3H9WA 4LPZA 5BOHA 4I3IA 1DJCA 1W5DA 3WS4A 2W1RA 4EWFA 2AVXA 2Z6DA 4Q8IA 2I72A 3IWQA 1YKDA 3LY4A 2LB5A 2E8IA 3G2YA 2Y59A 4MN5A 3MF0A 4DJ3A 1P0ZA 2EWVA 3GSGA 3LR4A 3P09A 4S2NC 2GJ3A 3VOLA 5M18A 1DP6A 2EFXA 1ESIA 5I94A 5KMWA 5DKKA 1K54A 4K91A 5HAPA 2PU4A 1PNEA 1L0FA 4KQDA 3Q82A 4GD6A 3ZGAB 3N6IA 3N7WA 2W3DA 3EOIA 1YPRA 3PYPA 2V9AA 4HIAA 1PWCA 1W79A 2Y4AA 4EUVA 1GSXA 2QPNA 1GA9A 1XJ6A 2A24B 5FAOA 5HWWA 3GR2A 4QHCA 2VA0A 3CHWP 4UA6A 4PAUA 5AQ7A 3UN7A 1MXOA 2XA7M 2VGLS 4HJ3A 3K3DA 5EVIA 1EI5A 2XF3A 5L2FA 5FQIA 5EE8A 1PW8A 2INWA 3T12B 4X25A 1XXMA 3ULFA 5FQKA 3V50A 2V8CA 2GX5A 4E6XA 3ZFZA 1GSVA 2LB9A 3Q7ZA 4EEUA 1RGZA 4F94A 4E3MA 3QP5A 3MJQA 4X68A 5HDSA 2O99A 2XRNA 4HH2A 3T4KA 4FH2A 3LR5A 2J9OA 4R1GA 1GSWA 2EFUA 4ZBEA 1T19A 1DJAA 1DP9A 5FEFA 2FZ0A 3TJZC 4N92A 3KYZA 3Q81A 3KX0X 1FR6A 3CMZA 4HEFA 4S2IA 5AQBA 1YLJA 4CLCD 4ZTKA 1DJBA 4Q0JA 1TVFA 5E2EA 2WKEA 4QPRA 5CEBA 3BFEA 4B4XA 1CK3A 2R9WA 1NY0A 4O01A 5TBMA 1XFNA 4CLCE 4JF5A 1KGEA 1GHPA 5L09A 4EERA 3A3IA 1IYSA 4DE1A 4G3KA 1ES5A 4PM5A 1BULA 3PBRA 1W7FA 3BLMA 1FR1A 3VV4A 1EW0A 3KO6A 4P87A 4GHIB 1PWGA 2KLIA 3G4PA 2HDRA 2WADA 3N4IA 5EECA 1J9MA 3NC8A 5DF8A 4QU3A 1HZOA 1OT6A 1LL8A 1FIKA 3ZG5A 3CZDA 4B4ZA 3MZEA 4EEPA 2J8YA 1ERMA 2O9CA 1C3BA 1KE3A 2P7JA 1PIOA 4ETZA 5GHZA 4UHUA 4N1XA 1H5XA 3HLEA 4UQIS 2H10A 5EVIB 4JGPA 1ZG4A 1G28A 2EWWA 4U3TA 3EWKA 3LIFA 4BJPA 2WYXA 1YMSA 4DDSA 1BLSA 4KZ5A 3HLCA 2Z2MB 1SKOA 4I38A 3QP1A 3P01A 1TDLA 2XGNA 3BFCA 1PRQA 1Q2QA 3RFBA 1GHMA 4ME4A 4P6ZM 4G3WA 4FTXA 3A0VA 4RQ9A 4Y0TA 1W63Q 3WS5A 1ZTUA 1IFQA 1Q2PA 2XROA 1IELA 4E3JA 4E3LA 2BG1A 3LFVA 5CERA 1L3LA 3IF6C 2VJWA 1CF0A 3W8KA 1IYOA 2V20A 3V39A 3ZVTA 2IWDA 2W3EA 1OTAA 3LI8A 5EM1A 3PBTA 1FCMA 1YMXA 1O7EA 1ACFA 2CC1A 4JPMA 4DJ2A 4R70A 3LYXA 3E2KA 3D72A 3Q7VB 4OQ0A 2RL3A 4EW7A 3G30A 3HLWA 1YQSA 3H82A 5TBMB 4R3BA 3BYDA 1CJFA 4HP4A 4M4XA 5AVEA 4X56A 4GLQA 2WKRA 3NBLA 3FPVA 4GKUA 5GL9A 2VEAA 2ZMAA 4EETB 1IKGA 5HPFA 4O0PA 4BL3A 3IBRA 1EWZA 5FI6A 3WS0A 3T1RA 3DWZA 4S2PA 1MY8A 1Z09A 2R9XA 5KZHA 4BBVA 1I2WA 2PHYA 1E3UD 3SS5A 4GB7A 2Y2OA 4S2MA 4JKTA 2HV1A 1K55A 1D7EA 3IX8A 2Y91A 3D9YA 1VB6A 3IHBA 5FAQA 3ZG7B 5FDSA 1XPBA 5HDCA 4FCFA 4GN2A 4RVAA 1RCJA 4LV3A 3MSHA 4IVKA 5GHYA 5GLDA 3WWXA 4JLFA 1M6KA 1G68A 1L0DA 3GDIA 1GHIA 1KVMA 3A3DA 2L4RA 4YOFA 5TGFA 3BFGA 3F1NA 3VP3A 3UNWA 3G2ZA 4XUZA 1VQQA 1SKOB 3PBQA 1BLCA 3B3XA 3H7WA 3S7NA 4F3LA 5AQAA 4Y2FA 4UEYA 2QZ6A 3NOPC 1M40A 1JTDA 2D01A 1TS0A 1CQAA 5TJJA 3KYQA 3ITBA 2VK3A 4E3IA 4R3AA 3PBSA 2E8JA 2C6WB 4GW9A 4QJGA 3M2JA 3VMAA 2DNSA 3A3FA 1PI4A 2VKSA 5HSQA 2L0WA 4KUOA 3MKFA 2V1BA 5DVAA 5CRFA 5J7EA 4CLCB 1RGYA 3S7QA 3LO7A 1K38A 1OT9A 1JNUA 4NG2A 2W27A 4I5SA 3H82B 5DKLA 3HLBA 1XKZA 2B5RA 4H6JB 4GS9A 3MZFA 2QJ5A 4WMCD 1T1BA 4FUWA 3HUOA 1N9BA 2VLGA 5EVEA 4K08A 5CX7A 1NRJA 3FWLA 4WZ5C 2PDRA 1JWVA 1NXYA 3E4QA 3BFDA 3N8LA 4R23A 4I3JA 4JF6A 5CXWA 5HFOA 3O86A 1KOUA 4P6BA 5EOOA 5FQMA 3K2NA 2NUTC 4WLAA 1NWZA 4WL9A 4GJ4A 1OTDA 2ZQCA 3CLOA 4BQMA 3QHYA 3GECA 1K57A 4R38A 4WELA 4X53A 2WKPA 3B42A 3JVUA 2K2NA 2HPBA 2HZ5A 1K54C 1W8QA 3OCLA 3ZYTA 3EGDC 2RCXA 3LIBA 4NXGA 4B93A 2WKIA 4KZ6A 3O88A 1P97A 3QNCA 3C38A 3LGOA 2JC7A 3SS4A 1Y4OA 1ZG6A 3F1NB 1U60A 1N9LA 4ARZB 2YKFA 2FH5A 4BD0A 4GD8A 2KX6A 3MQOA 3G31A 3O5YA 3H7WB 4MCWA 4QWOA 3QP6A 1IEMA 2OWJA 3MXQA 2Y2NA 1KE0A 1PZOA 3E98A 1K6SA 5HX9A 3NDEA 2K31A 4HJ6A 5KIZA 3A0RA 5HL6A 3V67A 3LY3A 3GVBA 2ZC4B 2IWBA 3IXDA 4R4RA 1YAXA 1ZKJA 3OLOA 4KG5A 1G6OA 3CWFA 4JXGA 3ZQ5A 1ES4A 2WKHA 3FYZA 1I2SA 5CHUA 2PR5A 3OBFA 4WEJA 3B47A 3TSGA 4OLDA 2ZC6B 3MXRA 4QY5A 1NLYA 2W3FA 4OQIA 3IXHA 4UA7A 1F2KA 3NOTC 4LRXC 4GS9B 5FDHA 4FOFA 3BLSA 4OOYA 4KUKA 4GDNA 5DFXA 3OCNA 4WMCA 3AGEA 3G6OA 4X1LA 2ZBBA 2PD7A 1LSXA 5CGSA 4S2OA 4KZ7A 5M19A 2GNXA 4GHIA 1S4SA 3C7UA 5HWVA 3IWIA 1YLZA 4BWIA 4NXFA 5IHVA 3C4OA 1XFQA 5KSCA 3BWLA 2B02A 4L9EA 4ESPA 5IS1A 3RXWA 3M6BA 4JXVA 4KZ3A 1F98A 3FC7A 2VZWA 4P0MA 1XGIA 3IH9A 3VP4A 3MBZA 2O9BA 1LSWA 1IKIA 3ZNYA 3RXXA 4IUKA 5FI2A 4KZ8A 1FSWA 3T50A 3L9KA 4EQIA 4BLMA 5EVLA 4HOIA 3S1YA 2WAEA 3IXBA 2QYBA 5EV0A 4K0XA 5GLAA 5GLBA 2ZQDA 4OPQA 5FL3A 4EESA 4PM8A 3QP4A 5F69A 2EX2A 5AJGA 4OP8A 1L2SA 3R7WA 2C5WB 4JXWA 3Q7VA 4CPKA 3T4JA 1HD8A 1MBLA 1K25A 4DRTA 4OOLA 1LT0A 5FATA 1NJ4A 3UDIA 4WEKA 1JWPA 5DJTA 5M1AA 1IOUA 4S2NA 3MQ0A 3NULA 3MR0A 3PXPA 5A8BA 4MBHA 1S6RA 2X01A 5GHXA 3P98A 4RA7A 2H5SA 4XXRA 4PMAA 1PFLA 4EU0A 2R78A 2GZAA 4IVIA 3ZCZA 5AVFA 2HJ9C 5J3WA 4ZAMA 5K5BA 1YLTA 3LCEA 2A49A 2O9AA 5LBRA 3GQZA 2HP5A 3BW6A 4ZJ3A 3N8RA 3QNBA 1XA1A 2H0YA 4KZ9A 3D4FA 2H28A 3MMHA 5G4YA 2PR6A 3MFXA 4Y0UA 4GOGA 4E3OA 4LFUA 4GDBA 1K4EA 4KENB 4X69A 1K55C 3K3CA 3UB9A 3ISGA 1VM1A 1XX2A 1BLHA 1ONHA 2Y2IA 1PI5A 5DTTA 3HJKA 4II7A 5A92A 1XJ2A 4PM7A 2CMNA 3VE4A 3C7VA 1K4FA 1T1AA 3ITAA 3S22A 1XP4A 1PWDA 3WRZA 4RX3A 4WYYA 4MN7A 3MZDA 1S4RA 2ZL1A 5F82A 4KZAA 1TDGA 2UWXA 4Y0OA 3NI9A 5HPIA 1F9IA 5F6AA 4IJGA 3BY8A 2QHKA 3MS6A 1BZAA 3V3SA 1VEUA 3CITA 1NYYA 3VP2A 4Z1WA 2NUPC 2ZC5B 4CLCA 1MWTA 1L0EA 4JF4A 3R7WB 4JBFA 3ZVWA 2DMWA 3ZG8B 2WKQA 4E3NA 1OJGA 3UPOA 1QMEA 4OLGA 1IYPA 1LLBA 4H6JA 3LIDA 3S7OA 1FILA 2Y2GA 3TOIA 2W1TB 1H3QA 4Y15A 2A2LA 5EOEA 1OTIA 4BL2A 3CUEC 2W0NA 4QY6A 3EQVA 1SHVA 4Y13A 3TW8A 2QJ7A 4LV2A 2EXBA 1O07A 4XT2A 1ERQA 4K0WA 3T4QA 2XD5A 1KDSA 3UE3A 3HL9A 3DAVA 2Y2PA 4UA9A 4GCZA 2Y55A 4L9FA 2VX8A 4OQHA 1P9WA 5IT5A 3HLGA 3LEZA 5AQ9A 3MFDA 5F83A 4GNUA 1PZPA 2VGLM 1ALQA 4ZJ1A 5FQJA 1S66L 5E43A 1BSGA 5DTKA 3OPRA 4Z9QA 3VSLA 3NHQA 5CEDA 3M2KA 4ARZA 3HREA 4HHDA 1FQGA 2KOIA 3T1SA 3HUNA 1UWNX 1CEFA 1Z6FA 2PBDP 1FCOA 2HP6A 4WM9A 5I5LA 3BM6A 4C75A 5HL1A 3PAEA 2ZL1B 3FV7A 3NY4A 5L07A 3S4XA 5FA7A 1WYCA 1MZUA 3KSHA 3FG8A 4B88A 3ZHHA 1X0OA 2HDQA 3IF6A 3WS1A 5CHJA 5FQQA 1N9NA 1QMFA 1VEUB 1SDNA 2EXAA 3FPWA 2DRWA 3HBRA 2ZMFA 3VSKA 4X55A 3BQAA 4ETXA 1MWUA 1XJ3A 4WUJA 1V9YA 2XK1A 4LLOB 2HDUA 4UAAA 4JGOA 3HLDA 3TG9A 1Y28A 4OOMA 3DW0A 3F1OB 5DJUA 3CJMA 2HJEA 2ZD8A 4BBTA 4PPRA 3KSFA 4KQOA 1BYWA 1MKMA 3F1PA 4DMZA 4MBKA 3UB5P 3DTKA 4OP5A 5CGWA 3PBNA 3KYEA 4S2LA 2WZZA 4PHTA 5HAQA 2V1ZA 1LL9A 1YT4A 2VV6A 4M3KA 2O0YA 3HVFA 5CTMA 1H8YA 5G4ZA 2ZC3B 4XT2B 4OKPA 2WGWA 2VV8A 5F5YA 3RH8B 1VETA 2ZLYA 4NETA 2PAVP 5FAPA 4R4SA 3EEHA 1E4DA 2Z6CA 4R0QA 3ZDJA 2G2UA 3RTYA 3Q1FA 1E3UA 2JKRI 5CHMA 4HNBA 4DF6A 5CTNA 4KG2A 4PM6A 3A3EA 4YINA 4CJNA 4DXCA 4X6TA 3UMEA 4N9KA 4UQIM 3NJAA 2G7UA 3SH9A 1MKIA 4LV1A 2XH9A 1JTGA 1H0MA 4P85A 1OPXA 4OONA 4LRZE 4KG6A 2V2FF 4FSFA 2P9VA 1N4OA 5FEGA 4LGWA 2P74A 3T4SA 4EBNA 5A90A 5EVID 1SDEA 2WUQA 1VHMA 4B9OA 3LIEA 5EVIC 5F68A 4Q0IA 3RJUA 3IBJA 4DKIA 4MBFA 4OH0A 1BTLA 3VFFA 4DN0A 1BUEA 3L7HA 3UE6A 3IF6B 5FASA 5L8MA 1ES2A 2QMIA 1OMEA 4LCLA 4NXEA 1TD5A 5D3OA 2Q9MA 1F5MA 3BECA 2QKPA 1T18A 2JBFA 3LR0A 3A3JA 2IA2A 2ZQ7A 4C3QA 1CI8A 1JVJA 2Y2JA 2EX9A 2WZXA 4I39A 3T1XA 4ZRRA 3SW1A 5TR7A 2J7VA 4L9GA 2J3TD 5HDDA 4BENA 2J3TC 3CG5A 1J3WA 3VFHA 1XA7A 2FFFB 3F1PB 1MWRA 2ZJ9A 3BFFA 3OOVA 5GLCA 3C30A 3S7PA 3VP1A 4HJ4A 2OSUA 4WZ5A 5L10A 4G3VA 2WGWB 1LSVA 4OPRA 5J8XA 5EUAA 3CPTB 3BJNA 1BLPA 4U0TA 1VETB 2Y2HA 2WGVA 3DTEA 1KDWA 1TS7A 2OLVA 3TE8A 4EV4A 4JGRA 4Y3IA 4LRYC 4KQQA 2XR0A 2PD8A 5A91A 4D2OA 2BASA 1K0KA 2EX8A 4ZDXA 3VOYA 2I9VA 3UDFA 2V0WA 1RP5A 2XD1A 4MMNA 2ZM8A 2UV0E 4MN6A 3IX4A 2YKHA 1P9RA 1H8ZA 2J80A 2ZOHA 4NK3A 4HP9A 5E2FA 4HH3A 1XGJA 2OWHA 4Y7PA 1YLWA 1FOFA 1XJ4A 4PKYG 4IEDA 2P9VB 4BMWA 4E3KA 2ZQ9A 1MWSA 3SOIA 1WA9A 2WAFA 1TS8A 4IHQA 4L0LA 4LENA 3OPPA 5MC7A 3HUMA 3G35A 4YNRA 4OPZA 2J3WA 5G18A 5EPHA 1JWZA 4EXOA 5CGXA 1A0KA 3IHAA 2P04A 2PRFA 1CI9A 2M7VA 1NZUA 4JGQA 3EGXC 2M7UA 3WRTA 3T1QB 3IS2A 3HJIA 1WYBA 2OLUA 4NXBA 3LR3A 5FSRA 3V5MA 5CECA 3G32A 1UGUA 3UPNA 3ZG0A 2ZMVA 3VOZA 2JN7A 1S1YA 3A0SA 1LI0A 1LL5A 4LCMA 3VE3A 3BY9A 3BRMA 4WF0A 2ZM2A 1IYQA 3T4OA 4CLCC 4I3AA 4D60A 1YSPA 2JKTI 2W1TA 1PYYA 1NZOA 2HDSA 2JHEA 3NCKA 2HGVA 2JKTM 2HP9A 3E4PA 2JE5A 3UE1A 3UB7A 2KDKA 1KGGA 4YWZA 3LI9A 1K56D 2ACGA 4RYEA 5FQ9A 2FFYA 2VGKA 4N1HA 1YM1A 2Q0OA 3GRJA 5HARA 4MEZA 2Y2QA 2XQZA 5EM0A 3Q07A 2B18A 4PM9A 4HQAA 2ZQAA 2V1AA 3UB8A 2X71A 1DP8A 3CAXA 2H0TA 1D06A 4HESA 3DTIA 2D02A 1V9ZA 3IWOA 1HLUP 3QP8A 5HAIA 3FZCA 3EEAA 3UPPA 3PTEA 5IU1A 4KZ4A 1ZC2A 4A5RA 3DBAA 4NEED 2V0UA 2WK0A 2PT7A 3LIAA 2XFTA 2XEPA 1TEMA 1LHYA 2ZQ8A 4HY8A 3GMWA 4Y5FA 3KSIA 4IUHA 2PYPA 2BLSA 5HD5A 4MDZA 4NKPA 1HVBA 1KE4A 3UMDA 3LICA 2ZC7A 3BQ8A 2Y2MA 3DTMA 3IH8A 2VV7A 1Y54A 3IS2B 3ICYA 2J9PA 4DE3A 3KSGA 1K6RA 4N9LA 2OV5A 2WGIA 2PU2A 2IWCA 3BEBA 4IBRA 3PR6A 2ZOIA 3EQUA 5EFWA 1OTEA 3F1OA 3WS2A 1AXBA 1G6AA 2Y2LA 1L0GA 5DTSA 3IXGA 3QP2A 1D1JA 1PW1A 3FKVA 4CQHA 2Y2KA 5F1FA 3NOUC 3P7NA 2P08A 1W63M 3C4PA 3TRCA 2EA9A 2XDMA 1DRMA 1I5QA 4R6LA 3IX3A 1K56A 4E04A 5HZHA 3UY6A 1AWIA 4IBXA 4DDYA 4RX2A 1NLZA 4JXSA 1KGFA 4Q0HA 4BD1A 3E0YA 4ID4A 1ES3A 4E6WA 5E2HA 3T4LA 5JYPA 3GTCA 3UO9A 5DF9A 3W4OA 3NIAA 4O8GA 2A3UA 3HLFA 5FI7A 2OAQ1 3PAGA 1K57C 2PBYA 4X1MA 2QWSA 3LEQA 4EUZA 2DCFA 3IT9A 2XSSA 3I7JA 3U4LP 1ESUA 3IQAA 3IF5A 1OJ5A 3W4PA 4EBLA 3SH7A 3JVVA 3NECA 1NRFA 1TS6A 4YFMA 3HCYA 3UB6A 4R3JA 2XA7S 3AGDA 1UWPX 5E2GA 2W3GA 4OPYA 4OQGA 1MC0A 3MKEA 5A93A 4FD8A 1S67L 1YLYA 1GA0A 1OTBA 3OZHA 4EQ1A 2OAP1 5KSHA 3W2ZA 1EROA 3PBOA 3OC2A 4QD4A 3NDGA 3O3VA 3MQQA 5F1GA 4PKYA 3V3RA 3C5AA 1E25A 2B95A 2W3HA 1YSQA 3SS3A 3CI6A 2EX6A 2GDNA 1ODVA 3B33A 3W4QA 2Y8HA 3E2LA 1NYMA 3CUEA 2Y79A 2L1MA 2K7SA 1LI9A 4DXBA 1S1ZA 3CPTA 2JCHA 4HBTA
chains in the Genus database with same CATH topology
2ZMAA 1BLPA 4U0TA 2XFSA 3UDXA 4XUXA 2Y2HA 1IKGA 5U47A 5TFQA 2WGVA 4MBHA 1S6RA 2X01A 4ZJ3A 5GHXA 1KDWA 1KVLA 4BL3A 1ONGA 2OLVA 3P98A 1EWZA 4RA7A 5FI6A 4EV4A 2H5SA 3WS0A 3DWZA 3DWKA 3OPLA 4S2PA 4XXRA 3M6HA 1MY8A 4KQQA 2XR0A 4PMAA 4HBUA 1FSYA 5A91A 2Z2LB 4D2OA 2EX8A 2R9XA 4ZDXA 3VOYA 4IVIA 3ZCZA 3UDFA 4ZAMA 2XLNA 5KZHA 1YLTA 1RP5A 1I2WA 2XD1A 1E3UD 3LCEA 4GB7A 3SS5A 2Y2OA 4OVDA 2ZM0A 2A49A 3O87A 4S2MA 3G34A 2ZM8A 4JKTA 3GQZA 2HP5A 1K55A 4DE0A 3N8SA 4MLLA 2Y91A 1H8ZA 2Q9NA 3IHBA 3N8RA 3QNBA 4KZBA 5FAQA 1XA1A 2H0YA 4NK3A 1XPBA 4KZ9A 4S2JA 3D4FA 5DF7A 4FCFA 4S2KA 4GN2A 4RVAA 5E2FA 1RCJA 4FH4A 2X02A 4GOGA 4LV3A 1XGJA 4Y0UA 4E3OA 4GDBA 1K4EA 1SKFA 4KENB 4Y7PA 4X69A 1YLWA 1K55C 4IVKA 5GHYA 5GLDA 3UE0A 3WWXA 1FOFA 3FKWA 4JLFA 2VGJA 1HTZA 1M6KA 3ISGA 1G68A 4IEDA 1VM1A 1L0DA 2P9VB 1XX2A 1BLHA 4E3KA 1ONHA 3AGFA 2ZQ9A 1MWSA 3OPHA 1GHIA 2Y2IA 1PI5A 3SOIA 1KVMA 3A3DA 5DTTA 5TGFA 3BFGA 5A92A 2WAFA 3VP3A 3UNWA 4PM7A 3MXSA 4L0LA 1BT5A 1SCWA 3C7VA 4LENA 3G2ZA 3OPPA 1VQQA 4U0XA 1K4FA 4XUZA 3ITAA 3PBQA 3HUMA 1BLCA 3G35A 3S22A 5HW3A 1XP4A 4H8RA 4OPZA 1PWDA 5G18A 3WRZA 3B3XA 1YLPA 4RX3A 4WYYA 5EPHA 1JWZA 1MPLA 5AQAA 5CGXA 4ZJ2A 4C6YA 5JYOA 3MZDA 3ZG9B 3VP0A 2QZ6A 3SH8A 3IHAA 1M40A 1W8YA 1GCEA 1JTDA 5F82A 1CEGA 4KZAA 1TDGA 2UWXA 3ITBA 4Y0OA 3NI9A 1CI9A 4WZ4A 4E3IA 1DY6A 1NZUA 3PBSA 2C6WB 4WBGA 3WRTA 4QJGA 3M2JA 3VMAA 2DNSA 1WE4A 3A3FA 4LV0A 4QB8A 3ZG7B 1BZAA 3ZNTA 3V3SA 1PI4A 4EBPA 1WYBA 2G2WA 3JYIA 2OLUA 5FSRA 3V5MA 1FCNA 1NYYA 3VP2A 5CECA 3G32A 3UPNA 3MKFA 3ZG0A 5DVAA 2ZC5B 5CRFA 4DE2A 1MWTA 4KQRA 4GZBA 1L0EA 1S0WA 1RGYA 3GV9A 4JF4A 4MNRA 3VOZA 3LO7A 4JBFA 1K38A 3ZVWA 1LI0A 1LL5A 4LCMA 3ZG8B 4O7DA 4E3NA 3BRMA 3UPOA 1QMEA 2ZM2A 3HLBA 5BOHA 1IYQA 4OLGA 1DJCA 1IYPA 1W5DA 3WS4A 1LLBA 1XKZA 2B5RA 4EWFA 4Q8IA 2Y2GA 1PYYA 1NZOA 2HDSA 3TOIA 2I72A 3MZFA 5EOEA 3IWQA 4WMCD 3LY4A 3NCKA 4BL2A 3HUOA 1N9BA 2E8IA 3G2YA 2Y59A 2HP9A 4QY6A 2JE5A 3FWLA 3EQVA 3UE1A 1SHVA 4WZ5C 3GSGA 1JWVA 1KGGA 1NXYA 3P09A 4LV2A 2EXBA 3BFDA 1O07A 1K56D 3N8LA 4R23A 1ERQA 4JF6A 5CXWA 3O86A 4RYEA 5HFOA 4S2NC 5FQ9A 4P6BA 2FFYA 2VGKA 5EOOA 4K0WA 5FQMA 5M18A 2XD5A 4N1HA 1YM1A 1KDSA 2EFXA 3GRJA 5HARA 1ESIA 3UE3A 5I94A 3HL9A 5KMWA 4MEZA 2Y2QA 2Y2PA 2XQZA 4UA9A 1K54A 4K91A 5HAPA 3Q07A 2ZQCA 4PM9A 2Y55A 4BQMA 2PU4A 2ZQAA 3QHYA 1L0FA 2X71A 3Q82A 4OQHA 1K57A 4GD6A 3ZGAB 3N6IA 3N7WA 4WELA 3HLGA 4X53A 2H0TA 3LEZA 5AQ9A 4HESA 3MFDA 2HPBA 1K54C 1W8QA 5F83A 3IWOA 1PWCA 1W79A 5HAIA 2Y4AA 3FZCA 3OCLA 4GNUA 3UPPA 1PZPA 2RCXA 2QPNA 3PTEA 1ALQA 4ZJ1A 5FQJA 4KZ4A 1GA9A 2WKIA 4KZ6A 1ZC2A 4A5RA 3O88A 5E43A 1BSGA 3QNCA 5FAOA 5DTKA 3GR2A 3OPRA 4Z9QA 2JC7A 4QHCA 3VSLA 3SS4A 4UA6A 1ZG6A 5CEDA 2WK0A 3M2KA 5AQ7A 3UN7A 1U60A 3HREA 2XFTA 1MXOA 1FQGA 2XEPA 5EVIA 1TEMA 1LHYA 1EI5A 2XF3A 2ZQ8A 4BD0A 4GD8A 5L2FA 3GMWA 3G31A 3HUNA 1CEFA 1Z6FA 5FQIA 2BLSA 5EE8A 1FCOA 1PW8A 2HP6A 4WM9A 1HVBA 3BM6A 1IEMA 4C75A 3PAEA 5HL1A 1KE4A 3FV7A 3NY4A 2Y2NA 1XXMA 5FQKA 3V50A 1KE0A 1PZOA 3S4XA 5FA7A 4E6XA 3ZFZA 2ZC7A 1WYCA 2Y2MA 3DTMA 3IH8A 1K6SA 5HX9A 3NDEA 4B88A 3ZHHA 2HDQA 3IF6A 3WS1A 3Q7ZA 1Y54A 5CHJA 5FQQA 3LY3A 2J9PA 1QMFA 3GVBA 1RGZA 1SDNA 4DE3A 2ZC4B 2EXAA 4E3MA 4F94A 2DRWA 3HBRA 2IWBA 1K6RA 4N9LA 3IXDA 2OV5A 3VSKA 4R4RA 4X68A 2WGIA 4X55A 2PU2A 1ZKJA 4FH2A 4KG5A 4JXGA 2J9OA 1MWUA 4R1GA 1ES4A 2IWCA 2XK1A 3BEBA 2EFUA 2WKHA 3FYZA 4ZBEA 2HDUA 1DJAA 1I2SA 4UAAA 4IBRA 5CHUA 3EQUA 4N92A 3HLDA 3Q81A 1FR6A 3CMZA 3TG9A 4HEFA 4S2IA 5AQBA 4OOMA 1YLJA 3DW0A 4ZTKA 3WS2A 4WEJA 1DJBA 1TVFA 3TSGA 1AXBA 4OLDA 2ZC6B 3CJMA 3MXRA 4QY5A 5E2EA 1G6AA 2Y2LA 2WKEA 2ZD8A 3IXHA 4OQIA 4PPRA 4UA7A 5DTSA 3BFEA 1L0GA 3IXGA 5CEBA 4KQOA 5FDHA 4B4XA 4MBKA 1PW1A 1CK3A 3BLSA 3FKVA 2R9WA 4OOYA 1NY0A 4GDNA 4OP5A 5CGWA 3PBNA 2Y2KA 4JF5A 4S2LA 1KGEA 3OCNA 4WMCA 5F1FA 2WZZA 5HAQA 2V1ZA 1LL9A 1YT4A 4M3KA 3HVFA 5CTMA 1GHPA 1H8YA 3AGEA 3C4PA 3A3IA 2ZC3B 1IYSA 2XDMA 4DE1A 1ES5A 4OKPA 2WGWA 4PM5A 5CGSA 1I5QA 1BULA 3PBRA 4S2OA 1W7FA 1K56A 4KZ7A 5M19A 3BLMA 3UY6A 4IBXA 1FR1A 2ZLYA 4NETA 4DDYA 4RX2A 4R4SA 5FAPA 4JXSA 4P87A 1KGFA 1E4DA 4R0QA 5EUAA 3ZDJA 2G2UA 4BD1A 4ID4A 3C7UA 1PWGA 3Q1FA 1E3UA 1ES3A 4E6WA 5E2HA 5CHMA 4DF6A 3G4PA 5CTNA 2HDRA 4KG2A 4PM6A 3A3EA 4YINA 5JYPA 3GTCA 3UO9A 5DF9A 4CJNA 2WADA 3N4IA 4DXCA 3IWIA 4X6TA 5EECA 3W4OA 1J9MA 3NC8A 1YLZA 3NIAA 5DF8A 4QU3A 2A3UA 3HLFA 1HZOA 5FI7A 3PAGA 5IHVA 4N9KA 3ZG5A 1K57C 3CZDA 3C4OA 2PBYA 4B4ZA 3MZEA 3SH9A 2J8YA 1ERMA 1MKIA 5KSCA 1C3BA 1KE3A 4LV1A 1PIOA 2XH9A 4EUZA 2DCFA 3IT9A 3I7JA 1JTGA 5GHZA 4UHUA 3RXWA 1ESUA 4N1XA 1H5XA 3HLEA 3IQAA 3IF5A 2H10A 4P85A 3M6BA 4JXVA 4KZ3A 4OONA 5EVIB 3W4PA 4EBLA 4P0MA 1XGIA 3SH7A 1ZG4A 3IH9A 4KG6A 2V2FF 3VP4A 1NRFA 4FSFA 4U3TA 2P9VA 3MBZA 1N4OA 4YFMA 2P74A 4BJPA 2WYXA 1YMSA 4EBNA 4DDSA 5A90A 1BLSA 1IKIA 4R3JA 4KZ5A 3AGDA 1SDEA 2WUQA 5EVID 3HLCA 5E2GA 5EVIC 3ZNYA 2Z2MB 4OPYA 4OQGA 3RXXA 3RJUA 5FI2A 4DKIA 3MKEA 4MBFA 4OH0A 5A93A 4FD8A 1BTLA 4KZ8A 1TDLA 1YLYA 2XGNA 3BFCA 1GA0A 1Q2QA 3VFFA 1BUEA 1GHMA 3OZHA 1FSWA 3IF6B 5FASA 4Y0TA 1ES2A 2QMIA 4EQIA 5KSHA 3WS5A 1OMEA 4LCLA 4BLMA 1EROA 3PBOA 5D3OA 5EVLA 2Q9MA 3BECA 3OC2A 3S1YA 2WAEA 4QD4A 1Q2PA 1IELA 3NDGA 4E3JA 3IXBA 4E3LA 2BG1A 2JBFA 5CERA 3A3JA 3IF6C 3O3VA 2ZQ7A 4C3QA 1CI8A 1JVJA 4K0XA 3W8KA 2Y2JA 5F1GA 2EX9A 1IYOA 2V20A 2WZXA 3V3RA 3C5AA 5GLAA 5GLBA 1E25A 3V39A 3ZVTA 2ZQDA 4OPQA 2IWDA 5TR7A 2J7VA 3PBTA 4BENA 1FCMA 1YMXA 1O7EA 4PM8A 3CG5A 2EX2A 3SS3A 2EX6A 4OP8A 2GDNA 1L2SA 3VFHA 2CC1A 1XA7A 4JPMA 2FFFB 2C5WB 1MWRA 4JXWA 3Q7VA 2ZJ9A 3E2KA 4CPKA 3BFFA 3W4QA 3Q7VB 5GLCA 4OQ0A 2RL3A 1HD8A 3E2LA 3G30A 1NYMA 3VP1A 3HLWA 1YQSA 1MBLA 4R3BA 1K25A 3BYDA 4DRTA 4OOLA 4X56A 2OSUA 1LI9A 3NBLA 4WZ5A 4DXBA 5FATA 4GKUA 1NJ4A 2WGWB 4WEKA 1JWPA 5GL9A 3UDIA 4OPRA 5M1AA 5J8XA 2JCHA 4S2NA 4HBTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZMA A;  1BLP A;  4U0T A;  2XFS A;  3UDX A;  4XUX A;  2Y2H A;  1IKG A;  5U47 A;  5TFQ A;  2WGV A;  4MBH A;  1S6R A;  2X01 A;  4ZJ3 A;  5GHX A;  1KDW A;  1KVL A;  4BL3 A;  1ONG A;  2OLV A;  3P98 A;  1EWZ A;  4RA7 A;  5FI6 A;  4EV4 A;  2H5S A;  3WS0 A;  3DWZ A;  3DWK A;  3OPL A;  4S2P A;  4XXR A;  3M6H A;  1MY8 A;  4KQQ A;  2XR0 A;  4PMA A;  4HBU A;  1FSY A;  5A91 A;  2Z2L B;  4D2O A;  2EX8 A;  2R9X A;  4ZDX A;  3VOY A;  4IVI A;  3ZCZ A;  3UDF A;  4ZAM A;  2XLN A;  5KZH A;  1YLT A;  1RP5 A;  1I2W A;  2XD1 A;  1E3U D;  3LCE A;  4GB7 A;  3SS5 A;  2Y2O A;  4OVD A;  2ZM0 A;  2A49 A;  3O87 A;  4S2M A;  3G34 A;  2ZM8 A;  4JKT A;  3GQZ A;  2HP5 A;  1K55 A;  4DE0 A;  3N8S A;  4MLL A;  2Y91 A;  1H8Z A;  2Q9N A;  3IHB A;  3N8R A;  3QNB A;  4KZB A;  5FAQ A;  1XA1 A;  2H0Y A;  4NK3 A;  1XPB A;  4KZ9 A;  4S2J A;  3D4F A;  5DF7 A;  4FCF A;  4S2K A;  4GN2 A;  4RVA A;  5E2F A;  1RCJ A;  4FH4 A;  2X02 A;  4GOG A;  4LV3 A;  1XGJ A;  4Y0U A;  4E3O A;  4GDB A;  1K4E A;  1SKF A;  4KEN B;  4Y7P A;  4X69 A;  1YLW A;  1K55 C;  4IVK A;  5GHY A;  5GLD A;  3UE0 A;  3WWX A;  1FOF A;  3FKW A;  4JLF A;  2VGJ A;  1HTZ A;  1M6K A;  3ISG A;  1G68 A;  4IED A;  1VM1 A;  1L0D A;  2P9V B;  1XX2 A;  1BLH A;  4E3K A;  1ONH A;  3AGF A;  2ZQ9 A;  1MWS A;  3OPH A;  1GHI A;  2Y2I A;  1PI5 A;  3SOI A;  1KVM A;  3A3D A;  5DTT A;  5TGF A;  3BFG A;  5A92 A;  2WAF A;  3VP3 A;  3UNW A;  4PM7 A;  3MXS A;  4L0L A;  1BT5 A;  1SCW A;  3C7V A;  4LEN A;  3G2Z A;  3OPP A;  1VQQ A;  4U0X A;  1K4F A;  4XUZ A;  3ITA A;  3PBQ A;  3HUM A;  1BLC A;  3G35 A;  3S22 A;  5HW3 A;  1XP4 A;  4H8R A;  4OPZ A;  1PWD A;  5G18 A;  3WRZ A;  3B3X A;  1YLP A;  4RX3 A;  4WYY A;  5EPH A;  1JWZ A;  1MPL A;  5AQA A;  5CGX A;  4ZJ2 A;  4C6Y A;  5JYO A;  3MZD A;  3ZG9 B;  3VP0 A;  2QZ6 A;  3SH8 A;  3IHA A;  1M40 A;  1W8Y A;  1GCE A;  1JTD A;  5F82 A;  1CEG A;  4KZA A;  1TDG A;  2UWX A;  3ITB A;  4Y0O A;  3NI9 A;  1CI9 A;  4WZ4 A;  4E3I A;  1DY6 A;  1NZU A;  3PBS A;  2C6W B;  4WBG A;  3WRT A;  4QJG A;  3M2J A;  3VMA A;  2DNS A;  1WE4 A;  3A3F A;  4LV0 A;  4QB8 A;  3ZG7 B;  1BZA A;  3ZNT A;  3V3S A;  1PI4 A;  4EBP A;  1WYB A;  2G2W A;  3JYI A;  2OLU A;  5FSR A;  3V5M A;  1FCN A;  1NYY A;  3VP2 A;  5CEC A;  3G32 A;  3UPN A;  3MKF A;  3ZG0 A;  5DVA A;  2ZC5 B;  5CRF A;  4DE2 A;  1MWT A;  4KQR A;  4GZB A;  1L0E A;  1S0W A;  1RGY A;  3GV9 A;  4JF4 A;  4MNR A;  3VOZ A;  3LO7 A;  4JBF A;  1K38 A;  3ZVW A;  1LI0 A;  1LL5 A;  4LCM A;  3ZG8 B;  4O7D A;  4E3N A;  3BRM A;  3UPO A;  1QME A;  2ZM2 A;  3HLB A;  5BOH A;  1IYQ A;  4OLG A;  1DJC A;  1IYP A;  1W5D A;  3WS4 A;  1LLB A;  1XKZ A;  2B5R A;  4EWF A;  4Q8I A;  2Y2G A;  1PYY A;  1NZO A;  2HDS A;  3TOI A;  2I72 A;  3MZF A;  5EOE A;  3IWQ A;  4WMC D;  3LY4 A;  3NCK A;  4BL2 A;  3HUO A;  1N9B A;  2E8I A;  3G2Y A;  2Y59 A;  2HP9 A;  4QY6 A;  2JE5 A;  3FWL A;  3EQV A;  3UE1 A;  1SHV A;  4WZ5 C;  3GSG A;  1JWV A;  1KGG A;  1NXY A;  3P09 A;  4LV2 A;  2EXB A;  3BFD A;  1O07 A;  1K56 D;  3N8L A;  4R23 A;  1ERQ A;  4JF6 A;  5CXW A;  3O86 A;  4RYE A;  5HFO A;  4S2N C;  5FQ9 A;  4P6B A;  2FFY A;  2VGK A;  5EOO A;  4K0W A;  5FQM A;  5M18 A;  2XD5 A;  4N1H A;  1YM1 A;  1KDS A;  2EFX A;  3GRJ A;  5HAR A;  1ESI A;  3UE3 A;  5I94 A;  3HL9 A;  5KMW A;  4MEZ A;  2Y2Q A;  2Y2P A;  2XQZ A;  4UA9 A;  1K54 A;  4K91 A;  5HAP A;  3Q07 A;  2ZQC A;  4PM9 A;  2Y55 A;  4BQM A;  2PU4 A;  2ZQA A;  3QHY A;  1L0F A;  2X71 A;  3Q82 A;  4OQH A;  1K57 A;  4GD6 A;  3ZGA B;  3N6I A;  3N7W A;  4WEL A;  3HLG A;  4X53 A;  2H0T A;  3LEZ A;  5AQ9 A;  4HES A;  3MFD A;  2HPB A;  1K54 C;  1W8Q A;  5F83 A;  3IWO A;  1PWC A;  1W79 A;  5HAI A;  2Y4A A;  3FZC A;  3OCL A;  4GNU A;  3UPP A;  1PZP A;  2RCX A;  2QPN A;  3PTE A;  1ALQ A;  4ZJ1 A;  5FQJ A;  4KZ4 A;  1GA9 A;  2WKI A;  4KZ6 A;  1ZC2 A;  4A5R A;  3O88 A;  5E43 A;  1BSG A;  3QNC A;  5FAO A;  5DTK A;  3GR2 A;  3OPR A;  4Z9Q A;  2JC7 A;  4QHC A;  3VSL A;  3SS4 A;  4UA6 A;  1ZG6 A;  5CED A;  2WK0 A;  3M2K A;  5AQ7 A;  3UN7 A;  1U60 A;  3HRE A;  2XFT A;  1MXO A;  1FQG A;  2XEP A;  5EVI A;  1TEM A;  1LHY A;  1EI5 A;  2XF3 A;  2ZQ8 A;  4BD0 A;  4GD8 A;  5L2F A;  3GMW A;  3G31 A;  3HUN A;  1CEF A;  1Z6F A;  5FQI A;  2BLS A;  5EE8 A;  1FCO A;  1PW8 A;  2HP6 A;  4WM9 A;  1HVB A;  3BM6 A;  1IEM A;  4C75 A;  3PAE A;  5HL1 A;  1KE4 A;  3FV7 A;  3NY4 A;  2Y2N A;  1XXM A;  5FQK A;  3V50 A;  1KE0 A;  1PZO A;  3S4X A;  5FA7 A;  4E6X A;  3ZFZ A;  2ZC7 A;  1WYC A;  2Y2M A;  3DTM A;  3IH8 A;  1K6S A;  5HX9 A;  3NDE A;  4B88 A;  3ZHH A;  2HDQ A;  3IF6 A;  3WS1 A;  3Q7Z A;  1Y54 A;  5CHJ A;  5FQQ A;  3LY3 A;  2J9P A;  1QMF A;  3GVB A;  1RGZ A;  1SDN A;  4DE3 A;  2ZC4 B;  2EXA A;  4E3M A;  4F94 A;  2DRW A;  3HBR A;  2IWB A;  1K6R A;  4N9L A;  3IXD A;  2OV5 A;  3VSK A;  4R4R A;  4X68 A;  2WGI A;  4X55 A;  2PU2 A;  1ZKJ A;  4FH2 A;  4KG5 A;  4JXG A;  2J9O A;  1MWU A;  4R1G A;  1ES4 A;  2IWC A;  2XK1 A;  3BEB A;  2EFU A;  2WKH A;  3FYZ A;  4ZBE A;  2HDU A;  1DJA A;  1I2S A;  4UAA A;  4IBR A;  5CHU A;  3EQU A;  4N92 A;  3HLD A;  3Q81 A;  1FR6 A;  3CMZ A;  3TG9 A;  4HEF A;  4S2I A;  5AQB A;  4OOM A;  1YLJ A;  3DW0 A;  4ZTK A;  3WS2 A;  4WEJ A;  1DJB A;  1TVF A;  3TSG A;  1AXB A;  4OLD A;  2ZC6 B;  3CJM A;  3MXR A;  4QY5 A;  5E2E A;  1G6A A;  2Y2L A;  2WKE A;  2ZD8 A;  3IXH A;  4OQI A;  4PPR A;  4UA7 A;  5DTS A;  3BFE A;  1L0G A;  3IXG A;  5CEB A;  4KQO A;  5FDH A;  4B4X A;  4MBK A;  1PW1 A;  1CK3 A;  3BLS A;  3FKV A;  2R9W A;  4OOY A;  1NY0 A;  4GDN A;  4OP5 A;  5CGW A;  3PBN A;  2Y2K A;  4JF5 A;  4S2L A;  1KGE A;  3OCN A;  4WMC A;  5F1F A;  2WZZ A;  5HAQ A;  2V1Z A;  1LL9 A;  1YT4 A;  4M3K A;  3HVF A;  5CTM A;  1GHP A;  1H8Y A;  3AGE A;  3C4P A;  3A3I A;  2ZC3 B;  1IYS A;  2XDM A;  4DE1 A;  1ES5 A;  4OKP A;  2WGW A;  4PM5 A;  5CGS A;  1I5Q A;  1BUL A;  3PBR A;  4S2O A;  1W7F A;  1K56 A;  4KZ7 A;  5M19 A;  3BLM A;  3UY6 A;  4IBX A;  1FR1 A;  2ZLY A;  4NET A;  4DDY A;  4RX2 A;  4R4S A;  5FAP A;  4JXS A;  4P87 A;  1KGF A;  1E4D A;  4R0Q A;  5EUA A;  3ZDJ A;  2G2U A;  4BD1 A;  4ID4 A;  3C7U A;  1PWG A;  3Q1F A;  1E3U A;  1ES3 A;  4E6W A;  5E2H A;  5CHM A;  4DF6 A;  3G4P A;  5CTN A;  2HDR A;  4KG2 A;  4PM6 A;  3A3E A;  4YIN A;  5JYP A;  3GTC A;  3UO9 A;  5DF9 A;  4CJN A;  2WAD A;  3N4I A;  4DXC A;  3IWI A;  4X6T A;  5EEC A;  3W4O A;  1J9M A;  3NC8 A;  1YLZ A;  3NIA A;  5DF8 A;  4QU3 A;  2A3U A;  3HLF A;  1HZO A;  5FI7 A;  3PAG A;  5IHV A;  4N9K A;  3ZG5 A;  1K57 C;  3CZD A;  3C4O A;  2PBY A;  4B4Z A;  3MZE A;  3SH9 A;  2J8Y A;  1ERM A;  1MKI A;  5KSC A;  1C3B A;  1KE3 A;  4LV1 A;  1PIO A;  2XH9 A;  4EUZ A;  2DCF A;  3IT9 A;  3I7J A;  1JTG A;  5GHZ A;  4UHU A;  3RXW A;  1ESU A;  4N1X A;  1H5X A;  3HLE A;  3IQA A;  3IF5 A;  2H10 A;  4P85 A;  3M6B A;  4JXV A;  4KZ3 A;  4OON A;  5EVI B;  3W4P A;  4EBL A;  4P0M A;  1XGI A;  3SH7 A;  1ZG4 A;  3IH9 A;  4KG6 A;  2V2F F;  3VP4 A;  1NRF A;  4FSF A;  4U3T A;  2P9V A;  3MBZ A;  1N4O A;  4YFM A;  2P74 A;  4BJP A;  2WYX A;  1YMS A;  4EBN A;  4DDS A;  5A90 A;  1BLS A;  1IKI A;  4R3J A;  4KZ5 A;  3AGD A;  1SDE A;  2WUQ A;  5EVI D;  3HLC A;  5E2G A;  5EVI C;  3ZNY A;  2Z2M B;  4OPY A;  4OQG A;  3RXX A;  3RJU A;  5FI2 A;  4DKI A;  3MKE A;  4MBF A;  4OH0 A;  5A93 A;  4FD8 A;  1BTL A;  4KZ8 A;  1TDL A;  1YLY A;  2XGN A;  3BFC A;  1GA0 A;  1Q2Q A;  3VFF A;  1BUE A;  1GHM A;  3OZH A;  1FSW A;  3IF6 B;  5FAS A;  4Y0T A;  1ES2 A;  2QMI A;  4EQI A;  5KSH A;  3WS5 A;  1OME A;  4LCL A;  4BLM A;  1ERO A;  3PBO A;  5D3O A;  5EVL A;  2Q9M A;  3BEC A;  3OC2 A;  3S1Y A;  2WAE A;  4QD4 A;  1Q2P A;  1IEL A;  3NDG A;  4E3J A;  3IXB A;  4E3L A;  2BG1 A;  2JBF A;  5CER A;  3A3J A;  3IF6 C;  3O3V A;  2ZQ7 A;  4C3Q A;  1CI8 A;  1JVJ A;  4K0X A;  3W8K A;  2Y2J A;  5F1G A;  2EX9 A;  1IYO A;  2V20 A;  2WZX A;  3V3R A;  3C5A A;  5GLA A;  5GLB A;  1E25 A;  3V39 A;  3ZVT A;  2ZQD A;  4OPQ A;  2IWD A;  5TR7 A;  2J7V A;  3PBT A;  4BEN A;  1FCM A;  1YMX A;  1O7E A;  4PM8 A;  3CG5 A;  2EX2 A;  3SS3 A;  2EX6 A;  4OP8 A;  2GDN A;  1L2S A;  3VFH A;  2CC1 A;  1XA7 A;  4JPM A;  2FFF B;  2C5W B;  1MWR A;  4JXW A;  3Q7V A;  2ZJ9 A;  3E2K A;  4CPK A;  3BFF A;  3W4Q A;  3Q7V B;  5GLC A;  4OQ0 A;  2RL3 A;  1HD8 A;  3E2L A;  3G30 A;  1NYM A;  3VP1 A;  3HLW A;  1YQS A;  1MBL A;  4R3B A;  1K25 A;  3BYD A;  4DRT A;  4OOL A;  4X56 A;  2OSU A;  1LI9 A;  3NBL A;  4WZ5 A;  4DXB A;  5FAT A;  4GKU A;  1NJ4 A;  2WGW B;  4WEK A;  1JWP A;  5GL9 A;  3UDI A;  4OPR A;  5M1A A;  5J8X A;  2JCH A;  4S2N A;  4HBT A; 
#chains in the Genus database with same CATH topology
 5DFY A;  2XFS A;  3UDX A;  4XUX A;  5U47 A;  5TFQ A;  2MJ6 A;  2JKF A;  1KVL A;  4WN5 A;  1ONG A;  3OPL A;  3DWK A;  3M6H A;  4HBU A;  1FSY A;  2Z2L B;  2JKR M;  1TF1 A;  3SZT A;  2XLN A;  1N9O A;  4OVD A;  2ZM0 A;  3O87 A;  3G34 A;  3JPU A;  4DE0 A;  3N8S A;  4MLL A;  2PYR A;  1G5U A;  2V8F A;  2Q9N A;  4KZB A;  4S2J A;  5DF7 A;  4S2K A;  3T4T A;  1STZ A;  4FH4 A;  2X02 A;  2HF6 A;  1SKF A;  5J4E A;  3UE0 A;  3FKW A;  2OOL A;  2A24 A;  2VGJ A;  1HTZ A;  3C8C A;  3PHY A;  3LUQ A;  4HI4 A;  3AGF A;  4Y17 A;  3OPH A;  3MXS A;  2BTF P;  1BT5 A;  1SCW A;  4U0X A;  5HW3 A;  4H8R A;  1YLP A;  1MPL A;  4ZJ2 A;  4C6Y A;  4F3L B;  5JYO A;  3ZG9 B;  3VP0 A;  3SH8 A;  5HD3 A;  1W8Y A;  1GCE A;  5HWT A;  1CEG A;  2JKG A;  1SZV A;  4WZ4 A;  4P6Z S;  1DY6 A;  1ZHH B;  4WBG A;  4BBU A;  2M1C A;  4LV0 A;  1WE4 A;  4QB8 A;  3ZNT A;  3E4O A;  3C2W A;  4EBP A;  4AFI A;  2G2W A;  3JYI A;  1FCN A;  4DE2 A;  4KQR A;  4GZB A;  1S0W A;  3GV9 A;  5C5K A;  3U2A A;  4MNR A;  1T1C A;  3R4K A;  4O7D A;  1H8M A;  3D3O A;  3H9W A;  4LPZ A;  5BOH A;  4I3I A;  1DJC A;  1W5D A;  3WS4 A;  2W1R A;  4EWF A;  2AVX A;  2Z6D A;  4Q8I A;  2I72 A;  3IWQ A;  1YKD A;  3LY4 A;  2LB5 A;  2E8I A;  3G2Y A;  2Y59 A;  4MN5 A;  3MF0 A;  4DJ3 A;  1P0Z A;  2EWV A;  3GSG A;  3LR4 A;  3P09 A;  4S2N C;  2GJ3 A;  3VOL A;  5M18 A;  1DP6 A;  2EFX A;  1ESI A;  5I94 A;  5KMW A;  5DKK A;  1K54 A;  4K91 A;  5HAP A;  2PU4 A;  1PNE A;  1L0F A;  4KQD A;  3Q82 A;  4GD6 A;  3ZGA B;  3N6I A;  3N7W A;  2W3D A;  3EOI A;  1YPR A;  3PYP A;  2V9A A;  4HIA A;  1PWC A;  1W79 A;  2Y4A A;  4EUV A;  1GSX A;  2QPN A;  1GA9 A;  1XJ6 A;  2A24 B;  5FAO A;  5HWW A;  3GR2 A;  4QHC A;  2VA0 A;  3CHW P;  4UA6 A;  4PAU A;  5AQ7 A;  3UN7 A;  1MXO A;  2XA7 M;  2VGL S;  4HJ3 A;  3K3D A;  5EVI A;  1EI5 A;  2XF3 A;  5L2F A;  5FQI A;  5EE8 A;  1PW8 A;  2INW A;  3T12 B;  4X25 A;  1XXM A;  3ULF A;  5FQK A;  3V50 A;  2V8C A;  2GX5 A;  4E6X A;  3ZFZ A;  1GSV A;  2LB9 A;  3Q7Z A;  4EEU A;  1RGZ A;  4F94 A;  4E3M A;  3QP5 A;  3MJQ A;  4X68 A;  5HDS A;  2O99 A;  2XRN A;  4HH2 A;  3T4K A;  4FH2 A;  3LR5 A;  2J9O A;  4R1G A;  1GSW A;  2EFU A;  4ZBE A;  1T19 A;  1DJA A;  1DP9 A;  5FEF A;  2FZ0 A;  3TJZ C;  4N92 A;  3KYZ A;  3Q81 A;  3KX0 X;  1FR6 A;  3CMZ A;  4HEF A;  4S2I A;  5AQB A;  1YLJ A;  4CLC D;  4ZTK A;  1DJB A;  4Q0J A;  1TVF A;  5E2E A;  2WKE A;  4QPR A;  5CEB A;  3BFE A;  4B4X A;  1CK3 A;  2R9W A;  1NY0 A;  4O01 A;  5TBM A;  1XFN A;  4CLC E;  4JF5 A;  1KGE A;  1GHP A;  5L09 A;  4EER A;  3A3I A;  1IYS A;  4DE1 A;  4G3K A;  1ES5 A;  4PM5 A;  1BUL A;  3PBR A;  1W7F A;  3BLM A;  1FR1 A;  3VV4 A;  1EW0 A;  3KO6 A;  4P87 A;  4GHI B;  1PWG A;  2KLI A;  3G4P A;  2HDR A;  2WAD A;  3N4I A;  5EEC A;  1J9M A;  3NC8 A;  5DF8 A;  4QU3 A;  1HZO A;  1OT6 A;  1LL8 A;  1FIK A;  3ZG5 A;  3CZD A;  4B4Z A;  3MZE A;  4EEP A;  2J8Y A;  1ERM A;  2O9C A;  1C3B A;  1KE3 A;  2P7J A;  1PIO A;  4ETZ A;  5GHZ A;  4UHU A;  4N1X A;  1H5X A;  3HLE A;  4UQI S;  2H10 A;  5EVI B;  4JGP A;  1ZG4 A;  1G28 A;  2EWW A;  4U3T A;  3EWK A;  3LIF A;  4BJP A;  2WYX A;  1YMS A;  4DDS A;  1BLS A;  4KZ5 A;  3HLC A;  2Z2M B;  1SKO A;  4I38 A;  3QP1 A;  3P01 A;  1TDL A;  2XGN A;  3BFC A;  1PRQ A;  1Q2Q A;  3RFB A;  1GHM A;  4ME4 A;  4P6Z M;  4G3W A;  4FTX A;  3A0V A;  4RQ9 A;  4Y0T A;  1W63 Q;  3WS5 A;  1ZTU A;  1IFQ A;  1Q2P A;  2XRO A;  1IEL A;  4E3J A;  4E3L A;  2BG1 A;  3LFV A;  5CER A;  1L3L A;  3IF6 C;  2VJW A;  1CF0 A;  3W8K A;  1IYO A;  2V20 A;  3V39 A;  3ZVT A;  2IWD A;  2W3E A;  1OTA A;  3LI8 A;  5EM1 A;  3PBT A;  1FCM A;  1YMX A;  1O7E A;  1ACF A;  2CC1 A;  4JPM A;  4DJ2 A;  4R70 A;  3LYX A;  3E2K A;  3D72 A;  3Q7V B;  4OQ0 A;  2RL3 A;  4EW7 A;  3G30 A;  3HLW A;  1YQS A;  3H82 A;  5TBM B;  4R3B A;  3BYD A;  1CJF A;  4HP4 A;  4M4X A;  5AVE A;  4X56 A;  4GLQ A;  2WKR A;  3NBL A;  3FPV A;  4GKU A;  5GL9 A;  2VEA A;  2ZMA A;  4EET B;  1IKG A;  5HPF A;  4O0P A;  4BL3 A;  3IBR A;  1EWZ A;  5FI6 A;  3WS0 A;  3T1R A;  3DWZ A;  4S2P A;  1MY8 A;  1Z09 A;  2R9X A;  5KZH A;  4BBV A;  1I2W A;  2PHY A;  1E3U D;  3SS5 A;  4GB7 A;  2Y2O A;  4S2M A;  4JKT A;  2HV1 A;  1K55 A;  1D7E A;  3IX8 A;  2Y91 A;  3D9Y A;  1VB6 A;  3IHB A;  5FAQ A;  3ZG7 B;  5FDS A;  1XPB A;  5HDC A;  4FCF A;  4GN2 A;  4RVA A;  1RCJ A;  4LV3 A;  3MSH A;  4IVK A;  5GHY A;  5GLD A;  3WWX A;  4JLF A;  1M6K A;  1G68 A;  1L0D A;  3GDI A;  1GHI A;  1KVM A;  3A3D A;  2L4R A;  4YOF A;  5TGF A;  3BFG A;  3F1N A;  3VP3 A;  3UNW A;  3G2Z A;  4XUZ A;  1VQQ A;  1SKO B;  3PBQ A;  1BLC A;  3B3X A;  3H7W A;  3S7N A;  4F3L A;  5AQA A;  4Y2F A;  4UEY A;  2QZ6 A;  3NOP C;  1M40 A;  1JTD A;  2D01 A;  1TS0 A;  1CQA A;  5TJJ A;  3KYQ A;  3ITB A;  2VK3 A;  4E3I A;  4R3A A;  3PBS A;  2E8J A;  2C6W B;  4GW9 A;  4QJG A;  3M2J A;  3VMA A;  2DNS A;  3A3F A;  1PI4 A;  2VKS A;  5HSQ A;  2L0W A;  4KUO A;  3MKF A;  2V1B A;  5DVA A;  5CRF A;  5J7E A;  4CLC B;  1RGY A;  3S7Q A;  3LO7 A;  1K38 A;  1OT9 A;  1JNU A;  4NG2 A;  2W27 A;  4I5S A;  3H82 B;  5DKL A;  3HLB A;  1XKZ A;  2B5R A;  4H6J B;  4GS9 A;  3MZF A;  2QJ5 A;  4WMC D;  1T1B A;  4FUW A;  3HUO A;  1N9B A;  2VLG A;  5EVE A;  4K08 A;  5CX7 A;  1NRJ A;  3FWL A;  4WZ5 C;  2PDR A;  1JWV A;  1NXY A;  3E4Q A;  3BFD A;  3N8L A;  4R23 A;  4I3J A;  4JF6 A;  5CXW A;  5HFO A;  3O86 A;  1KOU A;  4P6B A;  5EOO A;  5FQM A;  3K2N A;  2NUT C;  4WLA A;  1NWZ A;  4WL9 A;  4GJ4 A;  1OTD A;  2ZQC A;  3CLO A;  4BQM A;  3QHY A;  3GEC A;  1K57 A;  4R38 A;  4WEL A;  4X53 A;  2WKP A;  3B42 A;  3JVU A;  2K2N A;  2HPB A;  2HZ5 A;  1K54 C;  1W8Q A;  3OCL A;  3ZYT A;  3EGD C;  2RCX A;  3LIB A;  4NXG A;  4B93 A;  2WKI A;  4KZ6 A;  3O88 A;  1P97 A;  3QNC A;  3C38 A;  3LGO A;  2JC7 A;  3SS4 A;  1Y4O A;  1ZG6 A;  3F1N B;  1U60 A;  1N9L A;  4ARZ B;  2YKF A;  2FH5 A;  4BD0 A;  4GD8 A;  2KX6 A;  3MQO A;  3G31 A;  3O5Y A;  3H7W B;  4MCW A;  4QWO A;  3QP6 A;  1IEM A;  2OWJ A;  3MXQ A;  2Y2N A;  1KE0 A;  1PZO A;  3E98 A;  1K6S A;  5HX9 A;  3NDE A;  2K31 A;  4HJ6 A;  5KIZ A;  3A0R A;  5HL6 A;  3V67 A;  3LY3 A;  3GVB A;  2ZC4 B;  2IWB A;  3IXD A;  4R4R A;  1YAX A;  1ZKJ A;  3OLO A;  4KG5 A;  1G6O A;  3CWF A;  4JXG A;  3ZQ5 A;  1ES4 A;  2WKH A;  3FYZ A;  1I2S A;  5CHU A;  2PR5 A;  3OBF A;  4WEJ A;  3B47 A;  3TSG A;  4OLD A;  2ZC6 B;  3MXR A;  4QY5 A;  1NLY A;  2W3F A;  4OQI A;  3IXH A;  4UA7 A;  1F2K A;  3NOT C;  4LRX C;  4GS9 B;  5FDH A;  4FOF A;  3BLS A;  4OOY A;  4KUK A;  4GDN A;  5DFX A;  3OCN A;  4WMC A;  3AGE A;  3G6O A;  4X1L A;  2ZBB A;  2PD7 A;  1LSX A;  5CGS A;  4S2O A;  4KZ7 A;  5M19 A;  2GNX A;  4GHI A;  1S4S A;  3C7U A;  5HWV A;  3IWI A;  1YLZ A;  4BWI A;  4NXF A;  5IHV A;  3C4O A;  1XFQ A;  5KSC A;  3BWL A;  2B02 A;  4L9E A;  4ESP A;  5IS1 A;  3RXW A;  3M6B A;  4JXV A;  4KZ3 A;  1F98 A;  3FC7 A;  2VZW A;  4P0M A;  1XGI A;  3IH9 A;  3VP4 A;  3MBZ A;  2O9B A;  1LSW A;  1IKI A;  3ZNY A;  3RXX A;  4IUK A;  5FI2 A;  4KZ8 A;  1FSW A;  3T50 A;  3L9K A;  4EQI A;  4BLM A;  5EVL A;  4HOI A;  3S1Y A;  2WAE A;  3IXB A;  2QYB A;  5EV0 A;  4K0X A;  5GLA A;  5GLB A;  2ZQD A;  4OPQ A;  5FL3 A;  4EES A;  4PM8 A;  3QP4 A;  5F69 A;  2EX2 A;  5AJG A;  4OP8 A;  1L2S A;  3R7W A;  2C5W B;  4JXW A;  3Q7V A;  4CPK A;  3T4J A;  1HD8 A;  1MBL A;  1K25 A;  4DRT A;  4OOL A;  1LT0 A;  5FAT A;  1NJ4 A;  3UDI A;  4WEK A;  1JWP A;  5DJT A;  5M1A A;  1IOU A;  4S2N A;  3MQ0 A;  3NUL A;  3MR0 A;  3PXP A;  5A8B A;  4MBH A;  1S6R A;  2X01 A;  5GHX A;  3P98 A;  4RA7 A;  2H5S A;  4XXR A;  4PMA A;  1PFL A;  4EU0 A;  2R78 A;  2GZA A;  4IVI A;  3ZCZ A;  5AVF A;  2HJ9 C;  5J3W A;  4ZAM A;  5K5B A;  1YLT A;  3LCE A;  2A49 A;  2O9A A;  5LBR A;  3GQZ A;  2HP5 A;  3BW6 A;  4ZJ3 A;  3N8R A;  3QNB A;  1XA1 A;  2H0Y A;  4KZ9 A;  3D4F A;  2H28 A;  3MMH A;  5G4Y A;  2PR6 A;  3MFX A;  4Y0U A;  4GOG A;  4E3O A;  4LFU A;  4GDB A;  1K4E A;  4KEN B;  4X69 A;  1K55 C;  3K3C A;  3UB9 A;  3ISG A;  1VM1 A;  1XX2 A;  1BLH A;  1ONH A;  2Y2I A;  1PI5 A;  5DTT A;  3HJK A;  4II7 A;  5A92 A;  1XJ2 A;  4PM7 A;  2CMN A;  3VE4 A;  3C7V A;  1K4F A;  1T1A A;  3ITA A;  3S22 A;  1XP4 A;  1PWD A;  3WRZ A;  4RX3 A;  4WYY A;  4MN7 A;  3MZD A;  1S4R A;  2ZL1 A;  5F82 A;  4KZA A;  1TDG A;  2UWX A;  4Y0O A;  3NI9 A;  5HPI A;  1F9I A;  5F6A A;  4IJG A;  3BY8 A;  2QHK A;  3MS6 A;  1BZA A;  3V3S A;  1VEU A;  3CIT A;  1NYY A;  3VP2 A;  4Z1W A;  2NUP C;  2ZC5 B;  4CLC A;  1MWT A;  1L0E A;  4JF4 A;  3R7W B;  4JBF A;  3ZVW A;  2DMW A;  3ZG8 B;  2WKQ A;  4E3N A;  1OJG A;  3UPO A;  1QME A;  4OLG A;  1IYP A;  1LLB A;  4H6J A;  3LID A;  3S7O A;  1FIL A;  2Y2G A;  3TOI A;  2W1T B;  1H3Q A;  4Y15 A;  2A2L A;  5EOE A;  1OTI A;  4BL2 A;  3CUE C;  2W0N A;  4QY6 A;  3EQV A;  1SHV A;  4Y13 A;  3TW8 A;  2QJ7 A;  4LV2 A;  2EXB A;  1O07 A;  4XT2 A;  1ERQ A;  4K0W A;  3T4Q A;  2XD5 A;  1KDS A;  3UE3 A;  3HL9 A;  3DAV A;  2Y2P A;  4UA9 A;  4GCZ A;  2Y55 A;  4L9F A;  2VX8 A;  4OQH A;  1P9W A;  5IT5 A;  3HLG A;  3LEZ A;  5AQ9 A;  3MFD A;  5F83 A;  4GNU A;  1PZP A;  2VGL M;  1ALQ A;  4ZJ1 A;  5FQJ A;  1S66 L;  5E43 A;  1BSG A;  5DTK A;  3OPR A;  4Z9Q A;  3VSL A;  3NHQ A;  5CED A;  3M2K A;  4ARZ A;  3HRE A;  4HHD A;  1FQG A;  2KOI A;  3T1S A;  3HUN A;  1UWN X;  1CEF A;  1Z6F A;  2PBD P;  1FCO A;  2HP6 A;  4WM9 A;  5I5L A;  3BM6 A;  4C75 A;  5HL1 A;  3PAE A;  2ZL1 B;  3FV7 A;  3NY4 A;  5L07 A;  3S4X A;  5FA7 A;  1WYC A;  1MZU A;  3KSH A;  3FG8 A;  4B88 A;  3ZHH A;  1X0O A;  2HDQ A;  3IF6 A;  3WS1 A;  5CHJ A;  5FQQ A;  1N9N A;  1QMF A;  1VEU B;  1SDN A;  2EXA A;  3FPW A;  2DRW A;  3HBR A;  2ZMF A;  3VSK A;  4X55 A;  3BQA A;  4ETX A;  1MWU A;  1XJ3 A;  4WUJ A;  1V9Y A;  2XK1 A;  4LLO B;  2HDU A;  4UAA A;  4JGO A;  3HLD A;  3TG9 A;  1Y28 A;  4OOM A;  3DW0 A;  3F1O B;  5DJU A;  3CJM A;  2HJE A;  2ZD8 A;  4BBT A;  4PPR A;  3KSF A;  4KQO A;  1BYW A;  1MKM A;  3F1P A;  4DMZ A;  4MBK A;  3UB5 P;  3DTK A;  4OP5 A;  5CGW A;  3PBN A;  3KYE A;  4S2L A;  2WZZ A;  4PHT A;  5HAQ A;  2V1Z A;  1LL9 A;  1YT4 A;  2VV6 A;  4M3K A;  2O0Y A;  3HVF A;  5CTM A;  1H8Y A;  5G4Z A;  2ZC3 B;  4XT2 B;  4OKP A;  2WGW A;  2VV8 A;  5F5Y A;  3RH8 B;  1VET A;  2ZLY A;  4NET A;  2PAV P;  5FAP A;  4R4S A;  3EEH A;  1E4D A;  2Z6C A;  4R0Q A;  3ZDJ A;  2G2U A;  3RTY A;  3Q1F A;  1E3U A;  2JKR I;  5CHM A;  4HNB A;  4DF6 A;  5CTN A;  4KG2 A;  4PM6 A;  3A3E A;  4YIN A;  4CJN A;  4DXC A;  4X6T A;  3UME A;  4N9K A;  4UQI M;  3NJA A;  2G7U A;  3SH9 A;  1MKI A;  4LV1 A;  2XH9 A;  1JTG A;  1H0M A;  4P85 A;  1OPX A;  4OON A;  4LRZ E;  4KG6 A;  2V2F F;  4FSF A;  2P9V A;  1N4O A;  5FEG A;  4LGW A;  2P74 A;  3T4S A;  4EBN A;  5A90 A;  5EVI D;  1SDE A;  2WUQ A;  1VHM A;  4B9O A;  3LIE A;  5EVI C;  5F68 A;  4Q0I A;  3RJU A;  3IBJ A;  4DKI A;  4MBF A;  4OH0 A;  1BTL A;  3VFF A;  4DN0 A;  1BUE A;  3L7H A;  3UE6 A;  3IF6 B;  5FAS A;  5L8M A;  1ES2 A;  2QMI A;  1OME A;  4LCL A;  4NXE A;  1TD5 A;  5D3O A;  2Q9M A;  1F5M A;  3BEC A;  2QKP A;  1T18 A;  2JBF A;  3LR0 A;  3A3J A;  2IA2 A;  2ZQ7 A;  4C3Q A;  1CI8 A;  1JVJ A;  2Y2J A;  2EX9 A;  2WZX A;  4I39 A;  3T1X A;  4ZRR A;  3SW1 A;  5TR7 A;  2J7V A;  4L9G A;  2J3T D;  5HDD A;  4BEN A;  2J3T C;  3CG5 A;  1J3W A;  3VFH A;  1XA7 A;  2FFF B;  3F1P B;  1MWR A;  2ZJ9 A;  3BFF A;  3OOV A;  5GLC A;  3C30 A;  3S7P A;  3VP1 A;  4HJ4 A;  2OSU A;  4WZ5 A;  5L10 A;  4G3V A;  2WGW B;  1LSV A;  4OPR A;  5J8X A;  5EUA A;  3CPT B;  3BJN A;  1BLP A;  4U0T A;  1VET B;  2Y2H A;  2WGV A;  3DTE A;  1KDW A;  1TS7 A;  2OLV A;  3TE8 A;  4EV4 A;  4JGR A;  4Y3I A;  4LRY C;  4KQQ A;  2XR0 A;  2PD8 A;  5A91 A;  4D2O A;  2BAS A;  1K0K A;  2EX8 A;  4ZDX A;  3VOY A;  2I9V A;  3UDF A;  2V0W A;  1RP5 A;  2XD1 A;  4MMN A;  2ZM8 A;  2UV0 E;  4MN6 A;  3IX4 A;  2YKH A;  1P9R A;  1H8Z A;  2J80 A;  2ZOH A;  4NK3 A;  4HP9 A;  5E2F A;  4HH3 A;  1XGJ A;  2OWH A;  4Y7P A;  1YLW A;  1FOF A;  1XJ4 A;  4PKY G;  4IED A;  2P9V B;  4BMW A;  4E3K A;  2ZQ9 A;  1MWS A;  3SOI A;  1WA9 A;  2WAF A;  1TS8 A;  4IHQ A;  4L0L A;  4LEN A;  3OPP A;  5MC7 A;  3HUM A;  3G35 A;  4YNR A;  4OPZ A;  2J3W A;  5G18 A;  5EPH A;  1JWZ A;  4EXO A;  5CGX A;  1A0K A;  3IHA A;  2P04 A;  2PRF A;  1CI9 A;  2M7V A;  1NZU A;  4JGQ A;  3EGX C;  2M7U A;  3WRT A;  3T1Q B;  3IS2 A;  3HJI A;  1WYB A;  2OLU A;  4NXB A;  3LR3 A;  5FSR A;  3V5M A;  5CEC A;  3G32 A;  1UGU A;  3UPN A;  3ZG0 A;  2ZMV A;  3VOZ A;  2JN7 A;  1S1Y A;  3A0S A;  1LI0 A;  1LL5 A;  4LCM A;  3VE3 A;  3BY9 A;  3BRM A;  4WF0 A;  2ZM2 A;  1IYQ A;  3T4O A;  4CLC C;  4I3A A;  4D60 A;  1YSP A;  2JKT I;  2W1T A;  1PYY A;  1NZO A;  2HDS A;  2JHE A;  3NCK A;  2HGV A;  2JKT M;  2HP9 A;  3E4P A;  2JE5 A;  3UE1 A;  3UB7 A;  2KDK A;  1KGG A;  4YWZ A;  3LI9 A;  1K56 D;  2ACG A;  4RYE A;  5FQ9 A;  2FFY A;  2VGK A;  4N1H A;  1YM1 A;  2Q0O A;  3GRJ A;  5HAR A;  4MEZ A;  2Y2Q A;  2XQZ A;  5EM0 A;  3Q07 A;  2B18 A;  4PM9 A;  4HQA A;  2ZQA A;  2V1A A;  3UB8 A;  2X71 A;  1DP8 A;  3CAX A;  2H0T A;  1D06 A;  4HES A;  3DTI A;  2D02 A;  1V9Z A;  3IWO A;  1HLU P;  3QP8 A;  5HAI A;  3FZC A;  3EEA A;  3UPP A;  3PTE A;  5IU1 A;  4KZ4 A;  1ZC2 A;  4A5R A;  3DBA A;  4NEE D;  2V0U A;  2WK0 A;  2PT7 A;  3LIA A;  2XFT A;  2XEP A;  1TEM A;  1LHY A;  2ZQ8 A;  4HY8 A;  3GMW A;  4Y5F A;  3KSI A;  4IUH A;  2PYP A;  2BLS A;  5HD5 A;  4MDZ A;  4NKP A;  1HVB A;  1KE4 A;  3UMD A;  3LIC A;  2ZC7 A;  3BQ8 A;  2Y2M A;  3DTM A;  3IH8 A;  2VV7 A;  1Y54 A;  3IS2 B;  3ICY A;  2J9P A;  4DE3 A;  3KSG A;  1K6R A;  4N9L A;  2OV5 A;  2WGI A;  2PU2 A;  2IWC A;  3BEB A;  4IBR A;  3PR6 A;  2ZOI A;  3EQU A;  5EFW A;  1OTE A;  3F1O A;  3WS2 A;  1AXB A;  1G6A A;  2Y2L A;  1L0G A;  5DTS A;  3IXG A;  3QP2 A;  1D1J A;  1PW1 A;  3FKV A;  4CQH A;  2Y2K A;  5F1F A;  3NOU C;  3P7N A;  2P08 A;  1W63 M;  3C4P A;  3TRC A;  2EA9 A;  2XDM A;  1DRM A;  1I5Q A;  4R6L A;  3IX3 A;  1K56 A;  4E04 A;  5HZH A;  3UY6 A;  1AWI A;  4IBX A;  4DDY A;  4RX2 A;  1NLZ A;  4JXS A;  1KGF A;  4Q0H A;  4BD1 A;  3E0Y A;  4ID4 A;  1ES3 A;  4E6W A;  5E2H A;  3T4L A;  5JYP A;  3GTC A;  3UO9 A;  5DF9 A;  3W4O A;  3NIA A;  4O8G A;  2A3U A;  3HLF A;  5FI7 A;  2OAQ 1;  3PAG A;  1K57 C;  2PBY A;  4X1M A;  2QWS A;  3LEQ A;  4EUZ A;  2DCF A;  3IT9 A;  2XSS A;  3I7J A;  3U4L P;  1ESU A;  3IQA A;  3IF5 A;  1OJ5 A;  3W4P A;  4EBL A;  3SH7 A;  3JVV A;  3NEC A;  1NRF A;  1TS6 A;  4YFM A;  3HCY A;  3UB6 A;  4R3J A;  2XA7 S;  3AGD A;  1UWP X;  5E2G A;  2W3G A;  4OPY A;  4OQG A;  1MC0 A;  3MKE A;  5A93 A;  4FD8 A;  1S67 L;  1YLY A;  1GA0 A;  1OTB A;  3OZH A;  4EQ1 A;  2OAP 1;  5KSH A;  3W2Z A;  1ERO A;  3PBO A;  3OC2 A;  4QD4 A;  3NDG A;  3O3V A;  3MQQ A;  5F1G A;  4PKY A;  3V3R A;  3C5A A;  1E25 A;  2B95 A;  2W3H A;  1YSQ A;  3SS3 A;  3CI6 A;  2EX6 A;  2GDN A;  1ODV A;  3B33 A;  3W4Q A;  2Y8H A;  3E2L A;  1NYM A;  3CUE A;  2Y79 A;  2L1M A;  2K7S A;  1LI9 A;  4DXB A;  1S1Z A;  3CPT A;  2JCH A;  4HBT A; 
#chains in the Genus database with same CATH homology
 2ZMA A;  1BLP A;  4U0T A;  2XFS A;  3UDX A;  4XUX A;  2Y2H A;  1IKG A;  5U47 A;  5TFQ A;  2WGV A;  4MBH A;  1S6R A;  2X01 A;  4ZJ3 A;  5GHX A;  1KDW A;  1KVL A;  4BL3 A;  1ONG A;  2OLV A;  3P98 A;  1EWZ A;  4RA7 A;  5FI6 A;  4EV4 A;  2H5S A;  3WS0 A;  3DWZ A;  3DWK A;  3OPL A;  4S2P A;  4XXR A;  3M6H A;  1MY8 A;  4KQQ A;  2XR0 A;  4PMA A;  4HBU A;  1FSY A;  5A91 A;  2Z2L B;  4D2O A;  2EX8 A;  2R9X A;  4ZDX A;  3VOY A;  4IVI A;  3ZCZ A;  3UDF A;  4ZAM A;  2XLN A;  5KZH A;  1YLT A;  1RP5 A;  1I2W A;  2XD1 A;  1E3U D;  3LCE A;  4GB7 A;  3SS5 A;  2Y2O A;  4OVD A;  2ZM0 A;  2A49 A;  3O87 A;  4S2M A;  3G34 A;  2ZM8 A;  4JKT A;  3GQZ A;  2HP5 A;  1K55 A;  4DE0 A;  3N8S A;  4MLL A;  2Y91 A;  1H8Z A;  2Q9N A;  3IHB A;  3N8R A;  3QNB A;  4KZB A;  5FAQ A;  1XA1 A;  2H0Y A;  4NK3 A;  1XPB A;  4KZ9 A;  4S2J A;  3D4F A;  5DF7 A;  4FCF A;  4S2K A;  4GN2 A;  4RVA A;  5E2F A;  1RCJ A;  4FH4 A;  2X02 A;  4GOG A;  4LV3 A;  1XGJ A;  4Y0U A;  4E3O A;  4GDB A;  1K4E A;  1SKF A;  4KEN B;  4Y7P A;  4X69 A;  1YLW A;  1K55 C;  4IVK A;  5GHY A;  5GLD A;  3UE0 A;  3WWX A;  1FOF A;  3FKW A;  4JLF A;  2VGJ A;  1HTZ A;  1M6K A;  3ISG A;  1G68 A;  4IED A;  1VM1 A;  1L0D A;  2P9V B;  1XX2 A;  1BLH A;  4E3K A;  1ONH A;  3AGF A;  2ZQ9 A;  1MWS A;  3OPH A;  1GHI A;  2Y2I A;  1PI5 A;  3SOI A;  1KVM A;  3A3D A;  5DTT A;  5TGF A;  3BFG A;  5A92 A;  2WAF A;  3VP3 A;  3UNW A;  4PM7 A;  3MXS A;  4L0L A;  1BT5 A;  1SCW A;  3C7V A;  4LEN A;  3G2Z A;  3OPP A;  1VQQ A;  4U0X A;  1K4F A;  4XUZ A;  3ITA A;  3PBQ A;  3HUM A;  1BLC A;  3G35 A;  3S22 A;  5HW3 A;  1XP4 A;  4H8R A;  4OPZ A;  1PWD A;  5G18 A;  3WRZ A;  3B3X A;  1YLP A;  4RX3 A;  4WYY A;  5EPH A;  1JWZ A;  1MPL A;  5AQA A;  5CGX A;  4ZJ2 A;  4C6Y A;  5JYO A;  3MZD A;  3ZG9 B;  3VP0 A;  2QZ6 A;  3SH8 A;  3IHA A;  1M40 A;  1W8Y A;  1GCE A;  1JTD A;  5F82 A;  1CEG A;  4KZA A;  1TDG A;  2UWX A;  3ITB A;  4Y0O A;  3NI9 A;  1CI9 A;  4WZ4 A;  4E3I A;  1DY6 A;  1NZU A;  3PBS A;  2C6W B;  4WBG A;  3WRT A;  4QJG A;  3M2J A;  3VMA A;  2DNS A;  1WE4 A;  3A3F A;  4LV0 A;  4QB8 A;  3ZG7 B;  1BZA A;  3ZNT A;  3V3S A;  1PI4 A;  4EBP A;  1WYB A;  2G2W A;  3JYI A;  2OLU A;  5FSR A;  3V5M A;  1FCN A;  1NYY A;  3VP2 A;  5CEC A;  3G32 A;  3UPN A;  3MKF A;  3ZG0 A;  5DVA A;  2ZC5 B;  5CRF A;  4DE2 A;  1MWT A;  4KQR A;  4GZB A;  1L0E A;  1S0W A;  1RGY A;  3GV9 A;  4JF4 A;  4MNR A;  3VOZ A;  3LO7 A;  4JBF A;  1K38 A;  3ZVW A;  1LI0 A;  1LL5 A;  4LCM A;  3ZG8 B;  4O7D A;  4E3N A;  3BRM A;  3UPO A;  1QME A;  2ZM2 A;  3HLB A;  5BOH A;  1IYQ A;  4OLG A;  1DJC A;  1IYP A;  1W5D A;  3WS4 A;  1LLB A;  1XKZ A;  2B5R A;  4EWF A;  4Q8I A;  2Y2G A;  1PYY A;  1NZO A;  2HDS A;  3TOI A;  2I72 A;  3MZF A;  5EOE A;  3IWQ A;  4WMC D;  3LY4 A;  3NCK A;  4BL2 A;  3HUO A;  1N9B A;  2E8I A;  3G2Y A;  2Y59 A;  2HP9 A;  4QY6 A;  2JE5 A;  3FWL A;  3EQV A;  3UE1 A;  1SHV A;  4WZ5 C;  3GSG A;  1JWV A;  1KGG A;  1NXY A;  3P09 A;  4LV2 A;  2EXB A;  3BFD A;  1O07 A;  1K56 D;  3N8L A;  4R23 A;  1ERQ A;  4JF6 A;  5CXW A;  3O86 A;  4RYE A;  5HFO A;  4S2N C;  5FQ9 A;  4P6B A;  2FFY A;  2VGK A;  5EOO A;  4K0W A;  5FQM A;  5M18 A;  2XD5 A;  4N1H A;  1YM1 A;  1KDS A;  2EFX A;  3GRJ A;  5HAR A;  1ESI A;  3UE3 A;  5I94 A;  3HL9 A;  5KMW A;  4MEZ A;  2Y2Q A;  2Y2P A;  2XQZ A;  4UA9 A;  1K54 A;  4K91 A;  5HAP A;  3Q07 A;  2ZQC A;  4PM9 A;  2Y55 A;  4BQM A;  2PU4 A;  2ZQA A;  3QHY A;  1L0F A;  2X71 A;  3Q82 A;  4OQH A;  1K57 A;  4GD6 A;  3ZGA B;  3N6I A;  3N7W A;  4WEL A;  3HLG A;  4X53 A;  2H0T A;  3LEZ A;  5AQ9 A;  4HES A;  3MFD A;  2HPB A;  1K54 C;  1W8Q A;  5F83 A;  3IWO A;  1PWC A;  1W79 A;  5HAI A;  2Y4A A;  3FZC A;  3OCL A;  4GNU A;  3UPP A;  1PZP A;  2RCX A;  2QPN A;  3PTE A;  1ALQ A;  4ZJ1 A;  5FQJ A;  4KZ4 A;  1GA9 A;  2WKI A;  4KZ6 A;  1ZC2 A;  4A5R A;  3O88 A;  5E43 A;  1BSG A;  3QNC A;  5FAO A;  5DTK A;  3GR2 A;  3OPR A;  4Z9Q A;  2JC7 A;  4QHC A;  3VSL A;  3SS4 A;  4UA6 A;  1ZG6 A;  5CED A;  2WK0 A;  3M2K A;  5AQ7 A;  3UN7 A;  1U60 A;  3HRE A;  2XFT A;  1MXO A;  1FQG A;  2XEP A;  5EVI A;  1TEM A;  1LHY A;  1EI5 A;  2XF3 A;  2ZQ8 A;  4BD0 A;  4GD8 A;  5L2F A;  3GMW A;  3G31 A;  3HUN A;  1CEF A;  1Z6F A;  5FQI A;  2BLS A;  5EE8 A;  1FCO A;  1PW8 A;  2HP6 A;  4WM9 A;  1HVB A;  3BM6 A;  1IEM A;  4C75 A;  3PAE A;  5HL1 A;  1KE4 A;  3FV7 A;  3NY4 A;  2Y2N A;  1XXM A;  5FQK A;  3V50 A;  1KE0 A;  1PZO A;  3S4X A;  5FA7 A;  4E6X A;  3ZFZ A;  2ZC7 A;  1WYC A;  2Y2M A;  3DTM A;  3IH8 A;  1K6S A;  5HX9 A;  3NDE A;  4B88 A;  3ZHH A;  2HDQ A;  3IF6 A;  3WS1 A;  3Q7Z A;  1Y54 A;  5CHJ A;  5FQQ A;  3LY3 A;  2J9P A;  1QMF A;  3GVB A;  1RGZ A;  1SDN A;  4DE3 A;  2ZC4 B;  2EXA A;  4E3M A;  4F94 A;  2DRW A;  3HBR A;  2IWB A;  1K6R A;  4N9L A;  3IXD A;  2OV5 A;  3VSK A;  4R4R A;  4X68 A;  2WGI A;  4X55 A;  2PU2 A;  1ZKJ A;  4FH2 A;  4KG5 A;  4JXG A;  2J9O A;  1MWU A;  4R1G A;  1ES4 A;  2IWC A;  2XK1 A;  3BEB A;  2EFU A;  2WKH A;  3FYZ A;  4ZBE A;  2HDU A;  1DJA A;  1I2S A;  4UAA A;  4IBR A;  5CHU A;  3EQU A;  4N92 A;  3HLD A;  3Q81 A;  1FR6 A;  3CMZ A;  3TG9 A;  4HEF A;  4S2I A;  5AQB A;  4OOM A;  1YLJ A;  3DW0 A;  4ZTK A;  3WS2 A;  4WEJ A;  1DJB A;  1TVF A;  3TSG A;  1AXB A;  4OLD A;  2ZC6 B;  3CJM A;  3MXR A;  4QY5 A;  5E2E A;  1G6A A;  2Y2L A;  2WKE A;  2ZD8 A;  3IXH A;  4OQI A;  4PPR A;  4UA7 A;  5DTS A;  3BFE A;  1L0G A;  3IXG A;  5CEB A;  4KQO A;  5FDH A;  4B4X A;  4MBK A;  1PW1 A;  1CK3 A;  3BLS A;  3FKV A;  2R9W A;  4OOY A;  1NY0 A;  4GDN A;  4OP5 A;  5CGW A;  3PBN A;  2Y2K A;  4JF5 A;  4S2L A;  1KGE A;  3OCN A;  4WMC A;  5F1F A;  2WZZ A;  5HAQ A;  2V1Z A;  1LL9 A;  1YT4 A;  4M3K A;  3HVF A;  5CTM A;  1GHP A;  1H8Y A;  3AGE A;  3C4P A;  3A3I A;  2ZC3 B;  1IYS A;  2XDM A;  4DE1 A;  1ES5 A;  4OKP A;  2WGW A;  4PM5 A;  5CGS A;  1I5Q A;  1BUL A;  3PBR A;  4S2O A;  1W7F A;  1K56 A;  4KZ7 A;  5M19 A;  3BLM A;  3UY6 A;  4IBX A;  1FR1 A;  2ZLY A;  4NET A;  4DDY A;  4RX2 A;  4R4S A;  5FAP A;  4JXS A;  4P87 A;  1KGF A;  1E4D A;  4R0Q A;  5EUA A;  3ZDJ A;  2G2U A;  4BD1 A;  4ID4 A;  3C7U A;  1PWG A;  3Q1F A;  1E3U A;  1ES3 A;  4E6W A;  5E2H A;  5CHM A;  4DF6 A;  3G4P A;  5CTN A;  2HDR A;  4KG2 A;  4PM6 A;  3A3E A;  4YIN A;  5JYP A;  3GTC A;  3UO9 A;  5DF9 A;  4CJN A;  2WAD A;  3N4I A;  4DXC A;  3IWI A;  4X6T A;  5EEC A;  3W4O A;  1J9M A;  3NC8 A;  1YLZ A;  3NIA A;  5DF8 A;  4QU3 A;  2A3U A;  3HLF A;  1HZO A;  5FI7 A;  3PAG A;  5IHV A;  4N9K A;  3ZG5 A;  1K57 C;  3CZD A;  3C4O A;  2PBY A;  4B4Z A;  3MZE A;  3SH9 A;  2J8Y A;  1ERM A;  1MKI A;  5KSC A;  1C3B A;  1KE3 A;  4LV1 A;  1PIO A;  2XH9 A;  4EUZ A;  2DCF A;  3IT9 A;  3I7J A;  1JTG A;  5GHZ A;  4UHU A;  3RXW A;  1ESU A;  4N1X A;  1H5X A;  3HLE A;  3IQA A;  3IF5 A;  2H10 A;  4P85 A;  3M6B A;  4JXV A;  4KZ3 A;  4OON A;  5EVI B;  3W4P A;  4EBL A;  4P0M A;  1XGI A;  3SH7 A;  1ZG4 A;  3IH9 A;  4KG6 A;  2V2F F;  3VP4 A;  1NRF A;  4FSF A;  4U3T A;  2P9V A;  3MBZ A;  1N4O A;  4YFM A;  2P74 A;  4BJP A;  2WYX A;  1YMS A;  4EBN A;  4DDS A;  5A90 A;  1BLS A;  1IKI A;  4R3J A;  4KZ5 A;  3AGD A;  1SDE A;  2WUQ A;  5EVI D;  3HLC A;  5E2G A;  5EVI C;  3ZNY A;  2Z2M B;  4OPY A;  4OQG A;  3RXX A;  3RJU A;  5FI2 A;  4DKI A;  3MKE A;  4MBF A;  4OH0 A;  5A93 A;  4FD8 A;  1BTL A;  4KZ8 A;  1TDL A;  1YLY A;  2XGN A;  3BFC A;  1GA0 A;  1Q2Q A;  3VFF A;  1BUE A;  1GHM A;  3OZH A;  1FSW A;  3IF6 B;  5FAS A;  4Y0T A;  1ES2 A;  2QMI A;  4EQI A;  5KSH A;  3WS5 A;  1OME A;  4LCL A;  4BLM A;  1ERO A;  3PBO A;  5D3O A;  5EVL A;  2Q9M A;  3BEC A;  3OC2 A;  3S1Y A;  2WAE A;  4QD4 A;  1Q2P A;  1IEL A;  3NDG A;  4E3J A;  3IXB A;  4E3L A;  2BG1 A;  2JBF A;  5CER A;  3A3J A;  3IF6 C;  3O3V A;  2ZQ7 A;  4C3Q A;  1CI8 A;  1JVJ A;  4K0X A;  3W8K A;  2Y2J A;  5F1G A;  2EX9 A;  1IYO A;  2V20 A;  2WZX A;  3V3R A;  3C5A A;  5GLA A;  5GLB A;  1E25 A;  3V39 A;  3ZVT A;  2ZQD A;  4OPQ A;  2IWD A;  5TR7 A;  2J7V A;  3PBT A;  4BEN A;  1FCM A;  1YMX A;  1O7E A;  4PM8 A;  3CG5 A;  2EX2 A;  3SS3 A;  2EX6 A;  4OP8 A;  2GDN A;  1L2S A;  3VFH A;  2CC1 A;  1XA7 A;  4JPM A;  2FFF B;  2C5W B;  1MWR A;  4JXW A;  3Q7V A;  2ZJ9 A;  3E2K A;  4CPK A;  3BFF A;  3W4Q A;  3Q7V B;  5GLC A;  4OQ0 A;  2RL3 A;  1HD8 A;  3E2L A;  3G30 A;  1NYM A;  3VP1 A;  3HLW A;  1YQS A;  1MBL A;  4R3B A;  1K25 A;  3BYD A;  4DRT A;  4OOL A;  4X56 A;  2OSU A;  1LI9 A;  3NBL A;  4WZ5 A;  4DXB A;  5FAT A;  4GKU A;  1NJ4 A;  2WGW B;  4WEK A;  1JWP A;  5GL9 A;  3UDI A;  4OPR A;  5M1A A;  5J8X A;  2JCH A;  4S2N A;  4HBT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...