4X68A

Crystal structure of op0595 complexed with ampc
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
357
structure length
357
Chain Sequence
MDRLKALVDAAVQPVMKANDIPGLAVAISLKGEPHYFSYGLASKEDGRRVTPETLFEIGSVSKTFTATLAGYALTQDKMRLDDRASQHWPALQGSRFDGISLLDLATYTAGGLPLQFPDSVQKDQAQIRDYYRQWQPTYAPGSQRLYSNPSIGLFGYLAARSLGQPFERLMEQQVFPALGLEQTHLDVPEAALAQYAQGYGKDDRPLRVGPGPLDAEGYGVKTSAADLLRFVDANLHPERLDRPWAQALDATHRGYYKVGDMTQGLGWEAYDWPISLKRLQAGNSTPMALQPHRIARLPAPQALEGQRLLNKTGSTNGFGAYVAFVPGRDLGLVILANRNYPNAERVKIAYAILSGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title OP0595, a new diazabicyclooctane: mode of action as a serine beta-lactamase inhibitor, antibiotic and beta-lactam 'enhancer'
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Beta-lactamase
total genus 122
structure length 357
sequence length 357
chains with identical sequence B
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2014-12-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 4x68A00
3W4PA 4GOGA 4N1XA 3D4FA 1K38A 5HARA 3IWOA 4JF6A 3VSKA 1EWZA 4PM7A 2G2UA 1PZPA 4YFMA 1SKFA 3WS1A 3Q7VA 1GA9A 2Y59A 1PYYA 3HUMA 4R23A 4ZBEA 5A92A 4JXWA 2R9WA 4EBLA 4K0XA 3PTEA 1JWPA 2ZQ8A 3IHAA 5CTMA 2WK0A 3W4OA 1ES4A 1WYCA 3OZHA 2PU4A 3C5AA 3ZNYA 4UHUA 3GTCA 3UE1A 2Y2GA 4FD8A 5CHMA 1K6RA 4LV1A 2Y2LA 1H8YA 1N9BA 1KGEA 1ZC2A 1MWTA 3CZDA 4KZ9A 5HFOA 1I5QA 5EE8A 5EOEA 1ZG4A 4KQRA 1YLJA 4DRTA 2XDMA 1WYBA 5EVIA 3JYIA 2ZLYA 3QNCA 4BQMA 4ZTKA 4QJGA 3DW0A 1SDNA 2EFXA 2EX6A 4XUZA 5U47A 5TFQA 1SDEA 3TSGA 1HTZA 4P85A 1NJ4A 1JTGA 4EBPA 3UE3A 4JXVA 4WBGA 4K91A 4OPRA 1W79A 4DF6A 4R1GA 4OLDA 3TG9A 2Y91A 1MBLA 3ITAA 4BL3A 1VM1A 3PBTA 2HDUA 4OQIA 1MPLA 4KG2A 5DTSA 5EPHA 5HAQA 2WKIA 1MWSA 3ITBA 4PM8A 1CK3A 1FSYA 1W7FA 3BFEA 5GHYA 4QHCA 3P98A 2EX9A 3N8LA 5F82A 3HREA 1K56A 4PM9A 4MBFA 1VQQA 3BYDA 3MKEA 1NXYA 3PAEA 4KQOA 1QMEA 3WRTA 5E43A 1YLTA 3M6HA 4KZAA 4IVIA 3VFFA 2EXBA 2P9VA 4NK3A 5FATA 1BSGA 4QY5A 1H8ZA 4U0XA 4WEKA 3A3FA 3CJMA 3ZGAB 2QZ6A 1E4DA 1ZKJA 5GLBA 1BLSA 2XQZA 1HVBA 1PI5A 3SH7A 3ZVTA 1K4FA 2A3UA 2Y2PA 4X53A 4B4ZA 4JKTA 1YLPA 1PWGA 4GDNA 5FI2A 3ZG5A 2EFUA 3LY3A 1JWVA 3HUNA 2R9XA 2WAFA 4HEFA 4R3BA 4KZ3A 1PIOA 2WGVA 1LL5A 3SH8A 1K55A 2PBYA 3BEBA 3G34A 3HLDA 3IT9A 4GKUA 5FAQA 1L0GA 1W8YA 4IEDA 4S2NA 3IHBA 2HDSA 3OPRA 3SS5A 1ONGA 2XFTA 3VMAA 4OOYA 2VGJA 3Q1FA 2ZC3B 5J8XA 5E2FA 1PWDA 4GZBA 4P6BA 1ESIA 2PU2A 4N9LA 3ZG7B 1XXMA 1TDGA 1IYOA 2H5SA 3GVBA 5CGSA 5EVIB 3NI9A 1NZOA 1L0DA 1NRFA 2J9PA 1E3UD 2Q9NA 4EQIA 2X01A 3OCLA 2ZC4B 1PW8A 2ZD8A 1BTLA 4EBNA 4OOMA 3V5MA 3IF6A 1FCNA 4X69A 3AGEA 4OP5A 3MZFA 3LEZA 3IWQA 3O87A 3G31A 4FSFA 4Y0OA 4RYEA 4HESA 3ZVWA 5F1FA 3VP3A 1W8QA 4OOLA 2Y2JA 5AQAA 4CJNA 2WZZA 3FKVA 3GMWA 3G4PA 2Y55A 3QNBA 5FAPA 1E25A 3MFDA 5A90A 4GN2A 1FCOA 1K54C 1SHVA 2OLUA 2WKHA 5CTNA 4WELA 2Q9MA 1BLPA 2Y2MA 4HBTA 2RL3A 1IYPA 3A3EA 5CRFA 1G6AA 4OKPA 1LI9A 3RXWA 1KVLA 1ESUA 4FH4A 1KE3A 4DE3A 5TR7A 1LLBA 4N92A 1YLYA 4P87A 1L2SA 1ERQA 4MBHA 5CXWA 4B88A 3HL9A 3NY4A 2HDQA 1EROA 4RX2A 2X02A 2WGIA 5I94A 5FQ9A 3BECA 4ZJ3A 4MNRA 4GNUA 3V39A 1M40A 1RGYA 1YT4A 4UA7A 4JF4A 1GHMA 1ES3A 2CC1A 2H10A 4KZ8A 5CHJA 2HP9A 4BD1A 5GLCA 2IWBA 5M18A 2XD5A 4GD8A 3LO7A 4LV3A 3VP2A 3Q81A 3OPLA 4S2MA 5CGWA 3PBOA 2JCHA 5HAPA 5FASA 3SS3A 2ZJ9A 5E2HA 2XK1A 2XF3A 3IF5A 5G18A 5CERA 1RGZA 4WEJA 2IWDA 1MWUA 3G2ZA 4NETA 4X68A 3IXBA 3V3RA 1XGJA 1IYQA 4BENA 3DWKA 3ZCZA 2J9OA 1ES5A 5KZHA 1FSWA 3FZCA 1AXBA 1KDWA 4FCFA 3WS2A 4OVDA 3W4QA 3EQVA 3WWXA 1GHPA 5GHXA 3NBLA 5HW3A 4X55A 5EUAA 5GHZA 3S4XA 1BZAA 2WADA 1NYMA 3NDEA 1N4OA 2OLVA 3UDIA 3UNWA 3UPNA 1K25A 1I2WA 4BD0A 2Y2NA 4OLGA 5TGFA 5AQ9A 3HLBA 1RCJA 1L0EA 2BLSA 4GB7A 3HLWA 3M6BA 4KZ5A 4XXRA 4Y7PA 1CEGA 4ZJ1A 4OP8A 2ZQ9A 4LV0A 1W5DA 4KZ7A 3BFFA 3Q7ZA 3WS5A 3NCKA 1C3BA 4C3QA 1LL9A 4KZ4A 3IXGA 4GDBA 5CECA 3LY4A 1BLHA 3MXRA 4OQ0A 5A91A 1YM1A 4WMCD 4FH2A 3ZHHA 1U60A 1YMXA 3E2KA 2V2FF 4EWFA 2C5WB 3BFGA 3N8RA 4PMAA 4WM9A 2Z2LB 5GLDA 2V20A 2ZC7A 2A49A 3A3DA 2HP6A 2WAEA 3IH8A 3RXXA 3M2KA 1Y54A 4DXBA 1K56D 4PPRA 1IEMA 4U3TA 3MBZA 4R4RA 5F83A 3W8KA 2DNSA 4F94A 3EQUA 5E2GA 1MY8A 2B5RA 2ZM2A 3HBRA 3O3VA 1IKGA 1DJCA 1KVMA 2OV5A 3UDFA 3G35A 3B3XA 4S2OA 5FQQA 2Z2MB 5EVID 3N7WA 5DTTA 1XPBA 1FCMA 2Y4AA 3V50A 3ISGA 3CMZA 1NZUA 3DTMA 4BL2A 1O7EA 2Y2OA 4A5RA 5JYOA 1S6RA 4JXGA 4JXSA 4DDSA 4LV2A 5CGXA 3HLEA 3AGDA 3IH9A 2HPBA 2RCXA 3G32A 4OPQA 1OMEA 4C6YA 2EX8A 2GDNA 3MZDA 4Y0TA 3HLCA 3VOZA 1WE4A 2FFYA 2WYXA 1K6SA 4PM6A 3SOIA 1KGFA 3ZG9B 1YQSA 3FKWA 3N4IA 3UY6A 1GCEA 3UPPA 3DWZA 1HD8A 1O07A 4UA9A 3NDGA 4XUXA 3WS0A 1Q2QA 5GL9A 4DE1A 1XA1A 4X56A 3NIAA 3C7VA 1KE0A 5FQJA 3S1YA 3WS4A 5A93A 3PBRA 4DDYA 1K57C 1QMFA 5L2FA 3OPHA 2JBFA 2FFFB 5FA7A 3UE0A 2IWCA 2XD1A 4E3JA 4MBKA 4E6XA 1IKIA 4O7DA 2XGNA 4KG6A 3OCNA 1IELA 5FQMA 4L0LA 2ZQAA 3VP1A 2J7VA 5IHVA 1JWZA 5DTKA 3SH9A 2Y2KA 2XLNA 1JVJA 3RJUA 4JBFA 4Y0UA 2WKEA 3Q82A 3UDXA 4K0WA 4E3IA 3V3SA 2Y2HA 4R0QA 3ZG8B 4S2NC 4E3NA 1JTDA 5GLAA 3HUOA 5CEBA 5HX9A 1K4EA 2P9VB 3G30A 1ZG6A 4KENB 1BULA 1ES2A 2XR0A 3HLGA 4S2KA 4CPKA 1MWRA 1L0FA 4C75A 5FI6A 4IVKA 2Y2IA 1XP4A 3N6IA 3BFDA 3BLSA 3FYZA 4DE0A 4YINA 4OQHA 2HP5A 4WZ4A 4UA6A 5CHUA 5FQIA 4P0MA 2VGKA 2P74A 4OPYA 1E3UA 3BLMA 4OH0A 5EECA 4LCLA 2ZMAA 1YLWA 5EVIC 4EV4A 2ZQ7A 4RVAA 2ZM0A 3IF6B 3VP4A 1YLZA 4BLMA 2G2WA 3N8SA 3UO9A 3G2YA 4ID4A 4EUZA 3IQAA 2E8IA 5HAIA 4WYYA 5DF7A 1FR1A 1PW1A 3PBNA 4HBUA 1S0WA 1ERMA 2I72A 3IF6C 4JLFA 4MLLA 2WGWA 4N9KA 5DF8A 3Q07A 1KE4A 3PAGA 2QPNA 3PBQA 1TVFA 3HLFA 3MKFA 3BRMA 1MKIA 5KSHA 1CEFA 2OSUA 4OONA 3IXHA 4Z9QA 2XH9A 1XX2A 3Q7VB 4WZ5C 3UN7A 4ZDXA 4KG5A 2BG1A 2C6WB 3O88A 5FI7A 4PM5A 2ZC5B 5DF9A 5CEDA 3GR2A 3M2JA 2DCFA 5E2EA 1K57A 2DRWA 3ZNTA 3VOYA 4R3JA 5M19A 1K55C 2JE5A 4UAAA 4RA7A 3S22A 3OPPA 1TDLA 4KZ6A 1RP5A 1ONHA 1PZOA 4X6TA 5KSCA 2HDRA 3C7UA 2ZQDA 4JPMA 1XA7A 4H8RA 3QHYA 2ZM8A 3IWIA 1Q2PA 2H0YA 3P09A 1BLCA 4IBRA 1EI5A 1BUEA 4DXCA 5FQKA 4E6WA 2H0TA 4N1HA 5EOOA 1DJAA 2QMIA 1IYSA 3O86A 4S2JA 5FAOA 2WGWB 1ALQA 3ZFZA 5AQBA 1XGIA 1LHYA 2EX2A 3C4PA 4QD4A 1MXOA 3IXDA 3LCEA 1CI8A 4QB8A 1FR6A 3VP0A 3NC8A 4WZ5A 4QU3A 1KGGA 4JF5A 2X71A 4E3LA 2EXAA 1I2SA 2Y2QA 3MXSA 4OPZA 3OC2A 4LENA 1KDSA 3I7JA 1J9MA 1DJBA 2WUQA 1PI4A 1NYYA 3A3JA 3CG5A 2XFSA 3ZDJA 3MZEA 3TOIA 2XEPA 4ZAMA 5D3OA 3BFCA 2JC7A 2UWXA 4ZJ2A 4S2LA 3GV9A 5DVAA 3WRZA 4E3MA 1LI0A 3HVFA 1G68A 2ZQCA 1M6KA 4KZBA 4M3KA 3GSGA 4RX3A 5AQ7A 5M1AA 5EVLA 3ZG0A 4BJPA 1SCWA 1CI9A 3E2LA 4GD6A 5FDHA 4E3KA 4E3OA 4OQGA 1FOFA 1NY0A 1Z6FA 4KQQA 2WZXA 2V1ZA 2ZC6B 3BM6A 3PBSA 3C4OA 4U0TA 3FWLA 1BT5A 3GRJA 4MEZA 3A3IA 4QY6A 4S2PA 4Q8IA 4DE2A 5FSRA 5F1GA 2J8YA 3VFHA 4WMCA 1DY6A 4DKIA 1TEMA 3SS4A 1K54A 4S2IA 4IBXA 4B4XA 1XKZA 5HL1A 1HZOA 4R4SA 5KMWA 3AGFA 1PWCA 3VSLA 1YMSA 4D2OA 1GHIA 5BOHA 4LCMA 5JYPA 1FQGA 3GQZA 1GA0A 3FV7A 1H5XA 3UPOA
chains in the Genus database with same CATH superfamily
2PYPA 5HARA 4JF6A 3VSKA 1EWZA 4Q0JA 1SKFA 4R23A 5A92A 3SZTA 3PTEA 1JWPA 2R78A 3IHAA 5CTMA 1ES4A 3OZHA 1OTEA 5HL6A 3KYZA 3UE1A 2VV8A 4LV1A 1H8YA 1ZC2A 5L10A 4KZ9A 1G5UA 5HFOA 1I5QA 3LIEA 5EE8A 4KQRA 1YLJA 3F1PB 1WYBA 5EVIA 5J7EA 3DW0A 1Y28A 2EFXA 1HTZA 4G3WA 5F6AA 3UE3A 4DF6A 4BL3A 1VM1A 1L3LA 2ZOHA 3T4TA 2PHYA 1FSYA 1W7FA 3N8LA 1HLUP 1VQQA 3LIFA 4KZAA 4NK3A 4PHTA 3VOLA 1H8ZA 4WEKA 1E4DA 1F9IA 3LI9A 3LR0A 3SH7A 4UQIS 2EFUA 3A0VA 2R9XA 4WN5A 2PBYA 3IT9A 3C30A 2PD8A 3PR6A 4HJ3A 1FILA 5J8XA 3LICA 4HP4A 4N9LA 4JGRA 1TDGA 2H5SA 4MN6A 1L0DA 2QJ7A 3S7QA 1E3UD 2Q9NA 3T4QA 2ZD8A 1PW8A 3TW8A 4EBNA 3V5MA 2Y8HA 3HJIA 3QP1A 2XA7S 4QWOA 4HESA 4OOLA 2WKHA 2Q9MA 2Y2MA 5HWVA 5L09A 5CRFA 1G6AA 4FUWA 1LI9A 1KVLA 2JKRI 2Y79A 3MXQA 5CXWA 3F1NB 2HDQA 4CLCC 1EROA 4ZJ3A 1S1YA 3V39A 3R4KA 1RGYA 2VA0A 3KSHA 5G4ZA 4GD8A 3LO7A 3Q81A 3OPLA 4S2MA 3SS3A 1N9LA 2XK1A 5G18A 1RGZA 4JGOA 1LT0A 4NETA 4X68A 2WKPA 5HDDA 3CI6A 2D01A 3DWKA 1ES5A 4OVDA 3P7NA 3EQVA 3WWXA 1GHPA 2XRNA 5DKKA 2WADA 3NDEA 1N4OA 2OLVA 4X1MA 1K25A 3BQAA 3K3DA 4KZ5A 5AVEA 4Y7PA 1CEGA 2O9CA 2ZQ9A 1SKOB 4KZ7A 4C3QA 1LL9A 4GDBA 5CECA 1CQAA 1YM1A 3ZHHA 1U60A 1VEUB 1YMXA 4EWFA 4PMAA 3N8RA 3LGOA 4WM9A 2M7VA 5FEFA 2A49A 2ZOIA 3RXXA 2M1CA 1Y54A 5F83A 3HBRA 2ZM2A 3E4PA 4KQDA 2PDRA 5FQQA 3N7WA 1XPBA 2ACGA 3CMZA 3DTMA 4A5RA 1WA9A 1S6RA 5F68A 4LRYC 4BBTA 2HPBA 3G32A 4OPQA 3RH8B 4C6YA 2GDNA 3HLCA 3VOZA 3L9KA 3LR4A 1TD5A 1XJ2A 4PM6A 3SOIA 3ZG9B 3UY6A 2EWVA 4UA9A 3NDGA 5GL9A 4DE1A 1XA1A 4CLCE 3S1YA 3PBRA 4DDYA 5L2FA 3HCYA 2JBFA 5FA7A 3UE0A 5HPFA 3OOVA 3OCNA 2JKTM 1TS8A 1K0KA 3VP1A 5EM1A 4EXOA 5IT5A 4R3AA 4Y0UA 1K4EA 3G30A 4BWIA 2LB9A 1L0FA 2Y2IA 4YINA 4OQHA 1T1BA 4WZ4A 4UA6A 1E3UA 4IUHA 3V67A 1ODVA 1YLWA 2J3TC 4RVAA 1YLZA 5I5LA 1P9RA 3LIDA 3N8SA 2NUPC 3CPTA 2D02A 5F5YA 3LI8A 3Q07A 1KE4A 3BRMA 5KSHA 2BASA 2G7UA 4WZ5C 4R70A 2C6WB 5FI7A 4PM5A 3GR2A 2K31A 2QHKA 5E2EA 5M19A 1XFNA 4UAAA 3D3OA 2HDRA 2H0YA 2GZAA 4GHIA 1EI5A 1BUEA 4IBRA 4N1HA 5EOOA 1S4RA 2QMIA 5L8MA 4S2JA 5HWWA 5AQBA 1XGIA 3C4PA 2ZBBA 4QD4A 4WZ5A 2ZL1B 1PFLA 4GS9B 4E3LA 2KOIA 1I2SA 3OC2A 2WUQA 1NYYA 2XFSA 3TOIA 4ZAMA 3TE8A 5DVAA 4E3MA 1LI0A 2ZQCA 3PYPA 1M6KA 5EVLA 2W3GA 4GD6A 4E3OA 2VX8A 1NY0A 4KQQA 3C4OA 2HF6A 1BT5A 2PR5A 1T1AA 4NXFA 4MEZA 4QY6A 4S2PA 2GJ3A 1VETA 4DE2A 1UWNX 4S2IA 4DJ2A 1PWCA 1Z09A 2P7JA 1GHIA 3D9YA 3W4PA 4N1XA 4EEUA 3IWOA 2OWJA 3BY8A 3WS1A 3Q7VA 2Y59A 4ZBEA 5HDCA 3R7WA 4EBLA 4DJ3A 2WK0A 3W4OA 4ARZA 3ZNYA 4UHUA 5CHMA 3E4OA 2Y2LA 1EW0A 1KGEA 4Y3IA 3VE4A 3KO6A 1ZG4A 2XDMA 2ZLYA 1SDNA 4XUZA 5U47A 5HSQA 1SDEA 1JTGA 4EUVA 4GCZA 4JXVA 2E8JA 3TG9A 2Y91A 3MF0A 1D1JA 3ITBA 1CK3A 2GX5A 4R6LA 4WF0A 4QHCA 4EEPA 2EX9A 2DMWA 3HREA 5FEGA 4MBFA 1QMEA 3WRTA 5E43A 3P01A 1T19A 3F1PA 4IVIA 5FATA 1YKDA 2W0NA 2CMNA 5A8BA 1PI5A 1TS6A 2Y2PA 1PNEA 1PWGA 4GDNA 2P04A 3ZG5A 4P6ZM 4R3BA 2WAFA 4MN7A 1PIOA 1LL5A 2JN7A 3BEBA 3HLDA 4HNBA 1L0GA 3MQOA 1W8YA 4S2NA 4HHDA 4CLCD 4Q0HA 2VGJA 1ESIA 2ZMVA 3ZG7B 2OOLA 2B18A 4WLAA 5CGSA 4H6JA 1NZOA 3OCLA 4X69A 1FCNA 3CAXA 4OP5A 3LEZA 3IWQA 2JKRM 4RYEA 5DJUA 3FKVA 2Y55A 2M7UA 3MFDA 5HD3A 1K54C 2OLUA 4WELA 3A3EA 1ESUA 1KE3A 2O9AA 1N9OA 1ERQA 4MBHA 3MS6A 2X02A 5FQ9A 4MNRA 1M40A 1YT4A 1ES3A 2CC1A 3T4OA 2K2NA 1H0MA 3VP2A 4WL9A 3PBOA 5FASA 2MJ6A 5FL3A 2IWDA 1MWUA 2PBDP 3IXBA 4ZRRA 3UB8A 2W27A 4BENA 3NHQA 1FIKA 4PAUA 1CJFA 1KDWA 4FCFA 4HJ6A 1NYMA 4IUKA 3UDIA 2V1AA 2Y2NA 4OLGA 4EESA 1KOUA 1LSXA 4I3IA 1L0EA 1DRMA 3M6BA 2W3DA 5EM0A 4OP8A 1IFQA 1W5DA 3WS5A 3PXPA 4PKYG 3C8CA 4DMZA 3UB5P 4XT2B 4F3LB 3MXRA 5A91A 4WMCD 4G3KA 4HH3A 3BFGA 3OBFA 5GLDA 2ZC7A 4O8GA 2HJEA 1TS7A 4DXBA 3S7OA 4EETB 4F94A 5LBRA 3EQUA 2B5RA 2OV5A 3O3VA 3G35A 4S2OA 3W2ZA 3D72A 5EVID 3ZYTA 1FCMA 1SZVA 3V50A 4BL2A 5EV0A 5JYOA 2IA2A 1YSPA 3RTYA 3LYXA 4BBVA 1YSQA 1G28A 3BQ8A 4EERA 3MZDA 3LEQA 4LRXC 2WYXA 3PHYA 3MR0A 3UE6A 3N4IA 1P0ZA 3UPPA 1V9YA 4XUXA 1O07A 3F1OA 3MQ0A 3C7VA 1KE0A 5AVFA 4ESPA 4I38A 3CHWP 4HH2A 2J80A 2XD1A 4MN5A 1DP6A 1IKIA 3T4SA 4KG6A 1IELA 3BW6A 1H8MA 2J3WA 5DTKA 3SH9A 2XLNA 4II7A 3U2AA 3UDXA 4YOFA 3V3SA 2Y2HA 4R0QA 4E3NA 3UMEA 1SKOA 2P9VB 1OTIA 1BULA 4S2KA 1MWRA 2A24A 5FI6A 4IVKA 3N6IA 3BFDA 3BLSA 3FYZA 4NXEA 2HP5A 4EU0A 1F5MA 2P08A 4OPYA 4OH0A 3BWLA 1N9NA 3MMHA 1D06A 1XJ3A 4EV4A 3VP4A 4BLMA 3OLOA 2G2WA 3S7PA 4FOFA 2E8IA 5DF7A 4LPZA 1DP9A 2LB5A 2V9AA 1S0WA 5DF8A 1XFQA 2WGWA 3PAGA 3QP6A 3MKFA 3LFVA 4OONA 2XH9A 1LSVA 4ZDXA 4KG5A 3DTEA 5DF9A 5CEDA 1K57A 3RFBA 3VOYA 2OAP1 2JE5A 3S22A 2INWA 2W1RA 1TDLA 5HWTA 1PZOA 1XA7A 4H8RA 2HV1A 3IWIA 4R38A 5EVEA 5FQKA 1GSVA 5HDSA 1DJAA 1NLYA 1IYSA 3O86A 1ALQA 2EWWA 2V1BA 3IXDA 3LCEA 1FR6A 3NC8A 5TBMA 4QU3A 2X71A 4OPZA 1DJBA 3BFCA 2JC7A 3B47A 4S2LA 3FG8A 4M3KA 5AQ7A 5M1AA 1SCWA 1CI9A 3HJKA 1Z6FA 2WZXA 2ZC6B 1ACFA 4L9EA 4Q8IA 3TRCA 3LIAA 2VV7A 3EGDC 1F98A 4WUJA 3T12B 3SS4A 1K54A 4IBXA 1XKZA 1HZOA 4R4SA 5KMWA 3AGFA 3VSLA 4D2OA 3MSHA 1FQGA 4U0XA 3FV7A 3UPOA 4GOGA 4BBUA 1STZA 1PYYA 4JXWA 2R9WA 4B9OA 3CUEA 1WYCA 2PU4A 3C5AA 1BYWA 3FPVA 4Y5FA 2W1TB 2Y2GA 3E4QA 1Y4OA 1K6RA 3KYEA 3CZDA 2J3TD 5EOEA 2XSSA 4LRZE 4DRTA 3GDIA 4BQMA 4QJGA 3BJNA 3TSGA 3F1OB 4P85A 4EBPA 5AJGA 4GJ4A 4WBGA 4AFIA 4R1GA 4OLDA 3PBTA 1P9WA 2HDUA 1T18A 3GECA 5GHYA 1F2KA 5F82A 1K56A 4PM9A 3MKEA 1NXYA 1YLTA 3M6HA 2EXBA 2P9VA 1VHMA 1NRJA 4YWZA 2QZ6A 4RQ9A 5HD5A 1BLSA 1S66L 3ZVTA 4E04A 1K4FA 3DAVA 4B4ZA 4JKTA 1YLPA 5FI2A 3LY3A 4HEFA 4KZ3A 3SH8A 1VB6A 3A0RA 2UV0E 4GKUA 4IEDA 2HDSA 3OPRA 1ONGA 3Q1FA 2ZC3B 5E2FA 1PWDA 4GZBA 4P6BA 1XXMA 1MC0A 5EVIB 3NI9A 2HZ5A 4EQIA 3L7HA 1P97A 2W3HA 4MMNA 2PAVP 3O87A 5F1FA 3FC7A 1ZHHB 4JGQA 5FAPA 1E25A 1FCOA 1SHVA 4HP9A 2QYBA 2JHEA 2QWSA 4HBTA 2RL3A 2PYRA 4OKPA 3RXWA 1J3WA 4Q0IA 4DE3A 4N92A 2KDKA 1OPXA 1YLYA 4P87A 1L2SA 4B88A 4L9FA 2O9BA 4RX2A 3H7WA 3IS2B 2L0WA 3BECA 4GNUA 3K3CA 4UA7A 4JF4A 2H10A 4KZ8A 2VK3A 5GLCA 2XD5A 3FPWA 4LV3A 1OTAA 2JCHA 1GSXA 2PR6A 3LUQA 2WKQA 4IJGA 5E2HA 4BMWA 2XF3A 3IF5A 5CERA 4WEJA 1ZTUA 4EW7A 1DP8A 5J4EA 3LR3A 3V3RA 1IYQA 3ZCZA 2J9OA 3FZCA 1AXBA 3WS2A 5CX7A 3W4QA 5GHXA 3NBLA 4HI4A 5EUAA 3S4XA 1BZAA 1NLZA 3UPNA 1I2WA 5TGFA 4MDZA 3HLBA 1RCJA 2BLSA 2HJ9C 4ZJ1A 3JVUA 3BFFA 3Q7ZA 5IU1A 3DTKA 3NCKA 4IHQA 1YAXA 3IXGA 3S7NA 1V9ZA 3EEAA 3LY4A 4G3VA 4FH2A 3QP2A 3E2KA 2L1MA 2WAEA 1OJ5A 3M2KA 2JKFA 1IEMA 3MBZA 4R4RA 3W8KA 5E2GA 1IKGA 1DJCA 1KVMA 3UDFA 3B3XA 1YPRA 2Z2MB 5DTTA 1OTBA 4Y17A 2Y4AA 3ISGA 4NKPA 1O7EA 2Y2OA 2JKGA 4XT2A 4DDSA 3HLEA 3IH9A 4L9GA 1H3QA 2EX8A 4I3AA 2W3FA 3UB9A 3QP8A 1K6SA 3E98A 3FKWA 3DWZA 3T50A 1Q2QA 4X56A 3NIAA 4CLCB 5FQJA 3WS4A 1K57C 1QMFA 2FFFB 4E3JA 4O7DA 5FQMA 1JWZA 2Y2KA 3ULFA 1JVJA 3RJUA 3LIBA 2WKEA 3Q82A 4E3IA 1S1ZA 3ZG8B 4S2NC 1XJ6A 1JTDA 3HUOA 4KENB 2KX6A 3HLGA 1ES2A 4CPKA 3U4LP 3KSGA 5CHUA 5FQIA 4P0MA 2VGKA 2P74A 3BLMA 5EECA 4LCLA 5EFWA 3NJAA 2ZMAA 2ZQ7A 3UO9A 3T4JA 5F69A 3G2YA 2FZ0A 4QPRA 3IQAA 4WYYA 1PW1A 3PBNA 2VJWA 1ERMA 3IF6C 2WKRA 4JLFA 4N9KA 4UQIM 3PBQA 1TVFA 1CEFA 2OSUA 3IXHA 4Z9QA 1XX2A 3UN7A 3O88A 3M2JA 3NOPC 1NWZA 1IOUA 5DFXA 4R3JA 3H7WB 3IS2A 4JGPA 4RA7A 1RP5A 4P6ZS 5KSCA 3C7UA 1Q2PA 4DXCA 3P09A 1BLCA 4O01A 5DFYA 1XJ4A 2XA7M 2WGWB 3ZFZA 3IX8A 2EX2A 3JPUA 3H82B 4QB8A 3VP0A 1S4SA 1KGGA 3DBAA 3T4LA 2EXAA 2Y2QA 3MXSA 3VV4A 4LENA 3I7JA 1J9MA 1PI4A 3ZDJA 3O5YA 5HZHA 3MZEA 4Z1WA 4EQ1A 5D3OA 5C5KA 4ZJ2A 4X1LA 4ETXA 3GV9A 1S67L 4HY8A 4NG2A 3HVFA 1G68A 4KZBA 2A24B 4BJPA 3E2LA 2H28A 5FDHA 1FOFA 3KYQA 5L07A 3BM6A 3PBSA 1JNUA 3VE3A 4ME4A 3FWLA 4DN0A 1OT9A 3GRJA 3SW1A 2B95A 4LLOB 5FSRA 2J8YA 3VFHA 4WMCA 1UWPX 3MFXA 2PT7A 5JYPA 2QJ5A 2B02A 3D4FA 1K38A 4PKYA 4PM7A 2G2UA 5MC7A 1PZPA 4YFMA 3CUEC 1GA9A 3HUMA 3UMDA 4K0XA 2ZQ8A 2FH5A 3KSIA 3E0YA 3GTCA 3UB7A 4FD8A 3MJQA 1N9BA 2ZMFA 1MWTA 3NOUC 4H6JB 3JYIA 3QNCA 4ZTKA 2EX6A 3H9WA 5TFQA 4K08A 1NJ4A 4K91A 1TS0A 4OPRA 1W79A 1MBLA 3ITAA 4OQIA 4NEED 1MPLA 4KG2A 5DTSA 5EPHA 5HAQA 2WKIA 1MWSA 4PM8A 1D7EA 3BFEA 3P98A 3BYDA 3PAEA 4KQOA 1TF1A 3VFFA 2VKSA 1BSGA 4QY5A 2GNXA 3ICYA 3A3FA 2I9VA 3CJMA 3ZGAB 3IBRA 4HJ4A 1ZKJA 3IBJA 3T1RA 5GLBA 2XQZA 1HVBA 2A3UA 2NUTC 3CWFA 4M4XA 2XROA 4X53A 2HGVA 1JWVA 3HUNA 4HIAA 4NXGA 2WGVA 1K55A 5FAQA 3T1XA 3G34A 2O0YA 3IHBA 3SS5A 2XFTA 3VMAA 4OOYA 1LL8A 2PU2A 5IS1A 4CQHA 1IYOA 3GVBA 1NRFA 2J9PA 3F1NA 2X01A 2ZC4B 1BTLA 4OOMA 3IF6A 3AGEA 2W1TA 3MZFA 3G31A 4FSFA 4Y0OA 1VEUA 3ZVWA 1CF0A 3VP3A 1W8QA 2Y2JA 2OAQ1 5AQAA 4CJNA 2V0WA 2WZZA 3GMWA 3G4PA 1MKMA 3QNBA 5A90A 3C2WA 4GN2A 5CTNA 1BLPA 4O0PA 1IYPA 2VLGA 4FH4A 4F3LA 5TR7A 2W3EA 2JKTI 1LLBA 4HOIA 2BTFP 1MZUA 2VGLM 2KLIA 3HL9A 3NY4A 5K5BA 2WGIA 5I94A 2YKFA 4Y13A 1GHMA 3B42A 2Z6DA 3G6OA 5CHJA 2HP9A 4BD1A 2IWBA 5M18A 3NECA 5HAPA 5CGWA 4UEYA 4GLQA 2OWHA 4FTXA 2ZJ9A 3G2ZA 1XGJA 5KZHA 1FSWA 5HPIA 2VGLS 5HW3A 4X55A 5GHZA 3EGXC 3UNWA 3MQQA 4BD0A 5AQ9A 3CITA 4GB7A 3HLWA 4XXRA 4KUKA 4LV0A 5TJJA 1C3BA 4KZ4A 3QP4A 1BLHA 4OQ0A 3LR5A 2V2FF 2C5WB 2Z2LB 2V20A 3JVVA 3A3DA 4NXBA 2HP6A 3DTIA 3IH8A 3NOTC 3ZQ5A 2Z6CA 1K56D 1G6OA 4PPRA 3CPTB 4U3TA 2DNSA 1MY8A 5DKLA 1NZUA 4I5SA 4ETZA 4JXGA 4JXSA 4LV2A 5CGXA 3AGDA 2RCXA 4KUOA 1OMEA 3A0SA 2VEAA 4Y0TA 3CLOA 1WE4A 2FFYA 2V0UA 5KIZA 1KGFA 1YQSA 3KSFA 1GCEA 1HD8A 3WS0A 1OJGA 5A93A 5FDSA 3OPHA 2IWCA 4HQAA 4MBKA 4E6XA 2XGNA 2VV6A 4L0LA 2ZL1A 2ZQAA 2J7VA 4Y2FA 5IHVA 4I3JA 4JBFA 4K0WA 3QP5A 4Y15A 5GLAA 5CEBA 5HX9A 1ZG6A 3B33A 4D60A 2XR0A 4I39A 4C75A 1AWIA 2YKHA 2A2LA 2QKPA 1XP4A 4LGWA 4DE0A 5TBMB 2O99A 1X0OA 5G4YA 5EVIC 2EA9A 2ZM0A 3IF6B 3IX4A 1GSWA 5J3WA 4ID4A 3EOIA 4EUZA 5HAIA 5DJTA 1FR1A 4GHIB 4GW9A 4HBUA 3K2NA 2I72A 4MLLA 2QPNA 3HLFA 1MKIA 1A0KA 2AVXA 1W63M 3Q7VB 2V8CA 2BG1A 2ZC5B 4GS9A 2DCFA 4X25A 2DRWA 3ZNTA 2K7SA 3EEHA 2PD7A 1K55C 4B93A 2PRFA 3OPPA 4KZ6A 1ONHA 4X6TA 2ZQDA 4JPMA 3QHYA 2ZM8A 4E6WA 4CLCA 1UGUA 1OTDA 5FAOA 2H0TA 3C38A 3TJZC 1T1CA 1LHYA 1MXOA 1VETB 1CI8A 3T1QB 4JF5A 2V8FA 3IX3A 1KDSA 3UB6A 1OT6A 3CG5A 3A3JA 2XEPA 2UWXA 3WRZA 1PRQA 3NULA 1W63Q 3GSGA 4RX3A 4YNRA 3ZG0A 4E3KA 3EWKA 4OQGA 3R7WB 2V1ZA 4U0TA 3KX0X 4LFUA 2L4RA 3A3IA 4ARZB 4MCWA 3H82A 3BY9A 5F1GA 2Q0OA 1DY6A 2VZWA 4DKIA 1TEMA 4B4XA 5HL1A 3T1SA 1YMSA 1LSWA 5BOHA 3T4KA 4LCMA 3GQZA 1GA0A 1H5XA
chains in the Genus database with same CATH topology
3W4PA 4GOGA 4N1XA 3D4FA 1K38A 5HARA 3IWOA 4JF6A 3VSKA 1EWZA 4PM7A 2G2UA 1PZPA 4YFMA 1SKFA 3WS1A 3Q7VA 1GA9A 2Y59A 1PYYA 3HUMA 4R23A 4ZBEA 5A92A 4JXWA 2R9WA 4EBLA 4K0XA 3PTEA 1JWPA 2ZQ8A 3IHAA 5CTMA 2WK0A 3W4OA 1ES4A 1WYCA 3OZHA 2PU4A 3C5AA 3ZNYA 4UHUA 3GTCA 3UE1A 2Y2GA 4FD8A 5CHMA 1K6RA 4LV1A 2Y2LA 1H8YA 1N9BA 1KGEA 1ZC2A 1MWTA 3CZDA 4KZ9A 5HFOA 1I5QA 5EE8A 5EOEA 1ZG4A 4KQRA 1YLJA 4DRTA 2XDMA 1WYBA 5EVIA 3JYIA 2ZLYA 3QNCA 4BQMA 4ZTKA 4QJGA 3DW0A 1SDNA 2EFXA 2EX6A 4XUZA 5U47A 5TFQA 1SDEA 3TSGA 1HTZA 4P85A 1NJ4A 1JTGA 4EBPA 3UE3A 4JXVA 4WBGA 4K91A 4OPRA 1W79A 4DF6A 4R1GA 4OLDA 3TG9A 2Y91A 1MBLA 3ITAA 4BL3A 1VM1A 3PBTA 2HDUA 4OQIA 1MPLA 4KG2A 5DTSA 5EPHA 5HAQA 2WKIA 1MWSA 3ITBA 4PM8A 1CK3A 1FSYA 1W7FA 3BFEA 5GHYA 4QHCA 3P98A 2EX9A 3N8LA 5F82A 3HREA 1K56A 4PM9A 4MBFA 1VQQA 3BYDA 3MKEA 1NXYA 3PAEA 4KQOA 1QMEA 3WRTA 5E43A 1YLTA 3M6HA 4KZAA 4IVIA 3VFFA 2EXBA 2P9VA 4NK3A 5FATA 1BSGA 4QY5A 1H8ZA 4U0XA 4WEKA 3A3FA 3CJMA 3ZGAB 2QZ6A 1E4DA 1ZKJA 5GLBA 1BLSA 2XQZA 1HVBA 1PI5A 3SH7A 3ZVTA 1K4FA 2A3UA 2Y2PA 4X53A 4B4ZA 4JKTA 1YLPA 1PWGA 4GDNA 5FI2A 3ZG5A 2EFUA 3LY3A 1JWVA 3HUNA 2R9XA 2WAFA 4HEFA 4R3BA 4KZ3A 1PIOA 2WGVA 1LL5A 3SH8A 1K55A 2PBYA 3BEBA 3G34A 3HLDA 3IT9A 4GKUA 5FAQA 1L0GA 1W8YA 4IEDA 4S2NA 3IHBA 2HDSA 3OPRA 3SS5A 1ONGA 2XFTA 3VMAA 4OOYA 2VGJA 3Q1FA 2ZC3B 5J8XA 5E2FA 1PWDA 4GZBA 4P6BA 1ESIA 2PU2A 4N9LA 3ZG7B 1XXMA 1TDGA 1IYOA 2H5SA 3GVBA 5CGSA 5EVIB 3NI9A 1NZOA 1L0DA 1NRFA 2J9PA 1E3UD 2Q9NA 4EQIA 2X01A 3OCLA 2ZC4B 1PW8A 2ZD8A 1BTLA 4EBNA 4OOMA 3V5MA 3IF6A 1FCNA 4X69A 3AGEA 4OP5A 3MZFA 3LEZA 3IWQA 3O87A 3G31A 4FSFA 4Y0OA 4RYEA 4HESA 3ZVWA 5F1FA 3VP3A 1W8QA 4OOLA 2Y2JA 5AQAA 4CJNA 2WZZA 3FKVA 3GMWA 3G4PA 2Y55A 3QNBA 5FAPA 1E25A 3MFDA 5A90A 4GN2A 1FCOA 1K54C 1SHVA 2OLUA 2WKHA 5CTNA 4WELA 2Q9MA 1BLPA 2Y2MA 4HBTA 2RL3A 1IYPA 3A3EA 5CRFA 1G6AA 4OKPA 1LI9A 3RXWA 1KVLA 1ESUA 4FH4A 1KE3A 4DE3A 5TR7A 1LLBA 4N92A 1YLYA 4P87A 1L2SA 1ERQA 4MBHA 5CXWA 4B88A 3HL9A 3NY4A 2HDQA 1EROA 4RX2A 2X02A 2WGIA 5I94A 5FQ9A 3BECA 4ZJ3A 4MNRA 4GNUA 3V39A 1M40A 1RGYA 1YT4A 4UA7A 4JF4A 1GHMA 1ES3A 2CC1A 2H10A 4KZ8A 5CHJA 2HP9A 4BD1A 5GLCA 2IWBA 5M18A 2XD5A 4GD8A 3LO7A 4LV3A 3VP2A 3Q81A 3OPLA 4S2MA 5CGWA 3PBOA 2JCHA 5HAPA 5FASA 3SS3A 2ZJ9A 5E2HA 2XK1A 2XF3A 3IF5A 5G18A 5CERA 1RGZA 4WEJA 2IWDA 1MWUA 3G2ZA 4NETA 4X68A 3IXBA 3V3RA 1XGJA 1IYQA 4BENA 3DWKA 3ZCZA 2J9OA 1ES5A 5KZHA 1FSWA 3FZCA 1AXBA 1KDWA 4FCFA 3WS2A 4OVDA 3W4QA 3EQVA 3WWXA 1GHPA 5GHXA 3NBLA 5HW3A 4X55A 5EUAA 5GHZA 3S4XA 1BZAA 2WADA 1NYMA 3NDEA 1N4OA 2OLVA 3UDIA 3UNWA 3UPNA 1K25A 1I2WA 4BD0A 2Y2NA 4OLGA 5TGFA 5AQ9A 3HLBA 1RCJA 1L0EA 2BLSA 4GB7A 3HLWA 3M6BA 4KZ5A 4XXRA 4Y7PA 1CEGA 4ZJ1A 4OP8A 2ZQ9A 4LV0A 1W5DA 4KZ7A 3BFFA 3Q7ZA 3WS5A 3NCKA 1C3BA 4C3QA 1LL9A 4KZ4A 3IXGA 4GDBA 5CECA 3LY4A 1BLHA 3MXRA 4OQ0A 5A91A 1YM1A 4WMCD 4FH2A 3ZHHA 1U60A 1YMXA 3E2KA 2V2FF 4EWFA 2C5WB 3BFGA 3N8RA 4PMAA 4WM9A 2Z2LB 5GLDA 2V20A 2ZC7A 2A49A 3A3DA 2HP6A 2WAEA 3IH8A 3RXXA 3M2KA 1Y54A 4DXBA 1K56D 4PPRA 1IEMA 4U3TA 3MBZA 4R4RA 5F83A 3W8KA 2DNSA 4F94A 3EQUA 5E2GA 1MY8A 2B5RA 2ZM2A 3HBRA 3O3VA 1IKGA 1DJCA 1KVMA 2OV5A 3UDFA 3G35A 3B3XA 4S2OA 5FQQA 2Z2MB 5EVID 3N7WA 5DTTA 1XPBA 1FCMA 2Y4AA 3V50A 3ISGA 3CMZA 1NZUA 3DTMA 4BL2A 1O7EA 2Y2OA 4A5RA 5JYOA 1S6RA 4JXGA 4JXSA 4DDSA 4LV2A 5CGXA 3HLEA 3AGDA 3IH9A 2HPBA 2RCXA 3G32A 4OPQA 1OMEA 4C6YA 2EX8A 2GDNA 3MZDA 4Y0TA 3HLCA 3VOZA 1WE4A 2FFYA 2WYXA 1K6SA 4PM6A 3SOIA 1KGFA 3ZG9B 1YQSA 3FKWA 3N4IA 3UY6A 1GCEA 3UPPA 3DWZA 1HD8A 1O07A 4UA9A 3NDGA 4XUXA 3WS0A 1Q2QA 5GL9A 4DE1A 1XA1A 4X56A 3NIAA 3C7VA 1KE0A 5FQJA 3S1YA 3WS4A 5A93A 3PBRA 4DDYA 1K57C 1QMFA 5L2FA 3OPHA 2JBFA 2FFFB 5FA7A 3UE0A 2IWCA 2XD1A 4E3JA 4MBKA 4E6XA 1IKIA 4O7DA 2XGNA 4KG6A 3OCNA 1IELA 5FQMA 4L0LA 2ZQAA 3VP1A 2J7VA 5IHVA 1JWZA 5DTKA 3SH9A 2Y2KA 2XLNA 1JVJA 3RJUA 4JBFA 4Y0UA 2WKEA 3Q82A 3UDXA 4K0WA 4E3IA 3V3SA 2Y2HA 4R0QA 3ZG8B 4S2NC 4E3NA 1JTDA 5GLAA 3HUOA 5CEBA 5HX9A 1K4EA 2P9VB 3G30A 1ZG6A 4KENB 1BULA 1ES2A 2XR0A 3HLGA 4S2KA 4CPKA 1MWRA 1L0FA 4C75A 5FI6A 4IVKA 2Y2IA 1XP4A 3N6IA 3BFDA 3BLSA 3FYZA 4DE0A 4YINA 4OQHA 2HP5A 4WZ4A 4UA6A 5CHUA 5FQIA 4P0MA 2VGKA 2P74A 4OPYA 1E3UA 3BLMA 4OH0A 5EECA 4LCLA 2ZMAA 1YLWA 5EVIC 4EV4A 2ZQ7A 4RVAA 2ZM0A 3IF6B 3VP4A 1YLZA 4BLMA 2G2WA 3N8SA 3UO9A 3G2YA 4ID4A 4EUZA 3IQAA 2E8IA 5HAIA 4WYYA 5DF7A 1FR1A 1PW1A 3PBNA 4HBUA 1S0WA 1ERMA 2I72A 3IF6C 4JLFA 4MLLA 2WGWA 4N9KA 5DF8A 3Q07A 1KE4A 3PAGA 2QPNA 3PBQA 1TVFA 3HLFA 3MKFA 3BRMA 1MKIA 5KSHA 1CEFA 2OSUA 4OONA 3IXHA 4Z9QA 2XH9A 1XX2A 3Q7VB 4WZ5C 3UN7A 4ZDXA 4KG5A 2BG1A 2C6WB 3O88A 5FI7A 4PM5A 2ZC5B 5DF9A 5CEDA 3GR2A 3M2JA 2DCFA 5E2EA 1K57A 2DRWA 3ZNTA 3VOYA 4R3JA 5M19A 1K55C 2JE5A 4UAAA 4RA7A 3S22A 3OPPA 1TDLA 4KZ6A 1RP5A 1ONHA 1PZOA 4X6TA 5KSCA 2HDRA 3C7UA 2ZQDA 4JPMA 1XA7A 4H8RA 3QHYA 2ZM8A 3IWIA 1Q2PA 2H0YA 3P09A 1BLCA 4IBRA 1EI5A 1BUEA 4DXCA 5FQKA 4E6WA 2H0TA 4N1HA 5EOOA 1DJAA 2QMIA 1IYSA 3O86A 4S2JA 5FAOA 2WGWB 1ALQA 3ZFZA 5AQBA 1XGIA 1LHYA 2EX2A 3C4PA 4QD4A 1MXOA 3IXDA 3LCEA 1CI8A 4QB8A 1FR6A 3VP0A 3NC8A 4WZ5A 4QU3A 1KGGA 4JF5A 2X71A 4E3LA 2EXAA 1I2SA 2Y2QA 3MXSA 4OPZA 3OC2A 4LENA 1KDSA 3I7JA 1J9MA 1DJBA 2WUQA 1PI4A 1NYYA 3A3JA 3CG5A 2XFSA 3ZDJA 3MZEA 3TOIA 2XEPA 4ZAMA 5D3OA 3BFCA 2JC7A 2UWXA 4ZJ2A 4S2LA 3GV9A 5DVAA 3WRZA 4E3MA 1LI0A 3HVFA 1G68A 2ZQCA 1M6KA 4KZBA 4M3KA 3GSGA 4RX3A 5AQ7A 5M1AA 5EVLA 3ZG0A 4BJPA 1SCWA 1CI9A 3E2LA 4GD6A 5FDHA 4E3KA 4E3OA 4OQGA 1FOFA 1NY0A 1Z6FA 4KQQA 2WZXA 2V1ZA 2ZC6B 3BM6A 3PBSA 3C4OA 4U0TA 3FWLA 1BT5A 3GRJA 4MEZA 3A3IA 4QY6A 4S2PA 4Q8IA 4DE2A 5FSRA 5F1GA 2J8YA 3VFHA 4WMCA 1DY6A 4DKIA 1TEMA 3SS4A 1K54A 4S2IA 4IBXA 4B4XA 1XKZA 5HL1A 1HZOA 4R4SA 5KMWA 3AGFA 1PWCA 3VSLA 1YMSA 4D2OA 1GHIA 5BOHA 4LCMA 5JYPA 1FQGA 3GQZA 1GA0A 3FV7A 1H5XA 3UPOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3W4P A;  4GOG A;  4N1X A;  3D4F A;  1K38 A;  5HAR A;  3IWO A;  4JF6 A;  3VSK A;  1EWZ A;  4PM7 A;  2G2U A;  1PZP A;  4YFM A;  1SKF A;  3WS1 A;  3Q7V A;  1GA9 A;  2Y59 A;  1PYY A;  3HUM A;  4R23 A;  4ZBE A;  5A92 A;  4JXW A;  2R9W A;  4EBL A;  4K0X A;  3PTE A;  1JWP A;  2ZQ8 A;  3IHA A;  5CTM A;  2WK0 A;  3W4O A;  1ES4 A;  1WYC A;  3OZH A;  2PU4 A;  3C5A A;  3ZNY A;  4UHU A;  3GTC A;  3UE1 A;  2Y2G A;  4FD8 A;  5CHM A;  1K6R A;  4LV1 A;  2Y2L A;  1H8Y A;  1N9B A;  1KGE A;  1ZC2 A;  1MWT A;  3CZD A;  4KZ9 A;  5HFO A;  1I5Q A;  5EE8 A;  5EOE A;  1ZG4 A;  4KQR A;  1YLJ A;  4DRT A;  2XDM A;  1WYB A;  5EVI A;  3JYI A;  2ZLY A;  3QNC A;  4BQM A;  4ZTK A;  4QJG A;  3DW0 A;  1SDN A;  2EFX A;  2EX6 A;  4XUZ A;  5U47 A;  5TFQ A;  1SDE A;  3TSG A;  1HTZ A;  4P85 A;  1NJ4 A;  1JTG A;  4EBP A;  3UE3 A;  4JXV A;  4WBG A;  4K91 A;  4OPR A;  1W79 A;  4DF6 A;  4R1G A;  4OLD A;  3TG9 A;  2Y91 A;  1MBL A;  3ITA A;  4BL3 A;  1VM1 A;  3PBT A;  2HDU A;  4OQI A;  1MPL A;  4KG2 A;  5DTS A;  5EPH A;  5HAQ A;  2WKI A;  1MWS A;  3ITB A;  4PM8 A;  1CK3 A;  1FSY A;  1W7F A;  3BFE A;  5GHY A;  4QHC A;  3P98 A;  2EX9 A;  3N8L A;  5F82 A;  3HRE A;  1K56 A;  4PM9 A;  4MBF A;  1VQQ A;  3BYD A;  3MKE A;  1NXY A;  3PAE A;  4KQO A;  1QME A;  3WRT A;  5E43 A;  1YLT A;  3M6H A;  4KZA A;  4IVI A;  3VFF A;  2EXB A;  2P9V A;  4NK3 A;  5FAT A;  1BSG A;  4QY5 A;  1H8Z A;  4U0X A;  4WEK A;  3A3F A;  3CJM A;  3ZGA B;  2QZ6 A;  1E4D A;  1ZKJ A;  5GLB A;  1BLS A;  2XQZ A;  1HVB A;  1PI5 A;  3SH7 A;  3ZVT A;  1K4F A;  2A3U A;  2Y2P A;  4X53 A;  4B4Z A;  4JKT A;  1YLP A;  1PWG A;  4GDN A;  5FI2 A;  3ZG5 A;  2EFU A;  3LY3 A;  1JWV A;  3HUN A;  2R9X A;  2WAF A;  4HEF A;  4R3B A;  4KZ3 A;  1PIO A;  2WGV A;  1LL5 A;  3SH8 A;  1K55 A;  2PBY A;  3BEB A;  3G34 A;  3HLD A;  3IT9 A;  4GKU A;  5FAQ A;  1L0G A;  1W8Y A;  4IED A;  4S2N A;  3IHB A;  2HDS A;  3OPR A;  3SS5 A;  1ONG A;  2XFT A;  3VMA A;  4OOY A;  2VGJ A;  3Q1F A;  2ZC3 B;  5J8X A;  5E2F A;  1PWD A;  4GZB A;  4P6B A;  1ESI A;  2PU2 A;  4N9L A;  3ZG7 B;  1XXM A;  1TDG A;  1IYO A;  2H5S A;  3GVB A;  5CGS A;  5EVI B;  3NI9 A;  1NZO A;  1L0D A;  1NRF A;  2J9P A;  1E3U D;  2Q9N A;  4EQI A;  2X01 A;  3OCL A;  2ZC4 B;  1PW8 A;  2ZD8 A;  1BTL A;  4EBN A;  4OOM A;  3V5M A;  3IF6 A;  1FCN A;  4X69 A;  3AGE A;  4OP5 A;  3MZF A;  3LEZ A;  3IWQ A;  3O87 A;  3G31 A;  4FSF A;  4Y0O A;  4RYE A;  4HES A;  3ZVW A;  5F1F A;  3VP3 A;  1W8Q A;  4OOL A;  2Y2J A;  5AQA A;  4CJN A;  2WZZ A;  3FKV A;  3GMW A;  3G4P A;  2Y55 A;  3QNB A;  5FAP A;  1E25 A;  3MFD A;  5A90 A;  4GN2 A;  1FCO A;  1K54 C;  1SHV A;  2OLU A;  2WKH A;  5CTN A;  4WEL A;  2Q9M A;  1BLP A;  2Y2M A;  4HBT A;  2RL3 A;  1IYP A;  3A3E A;  5CRF A;  1G6A A;  4OKP A;  1LI9 A;  3RXW A;  1KVL A;  1ESU A;  4FH4 A;  1KE3 A;  4DE3 A;  5TR7 A;  1LLB A;  4N92 A;  1YLY A;  4P87 A;  1L2S A;  1ERQ A;  4MBH A;  5CXW A;  4B88 A;  3HL9 A;  3NY4 A;  2HDQ A;  1ERO A;  4RX2 A;  2X02 A;  2WGI A;  5I94 A;  5FQ9 A;  3BEC A;  4ZJ3 A;  4MNR A;  4GNU A;  3V39 A;  1M40 A;  1RGY A;  1YT4 A;  4UA7 A;  4JF4 A;  1GHM A;  1ES3 A;  2CC1 A;  2H10 A;  4KZ8 A;  5CHJ A;  2HP9 A;  4BD1 A;  5GLC A;  2IWB A;  5M18 A;  2XD5 A;  4GD8 A;  3LO7 A;  4LV3 A;  3VP2 A;  3Q81 A;  3OPL A;  4S2M A;  5CGW A;  3PBO A;  2JCH A;  5HAP A;  5FAS A;  3SS3 A;  2ZJ9 A;  5E2H A;  2XK1 A;  2XF3 A;  3IF5 A;  5G18 A;  5CER A;  1RGZ A;  4WEJ A;  2IWD A;  1MWU A;  3G2Z A;  4NET A;  4X68 A;  3IXB A;  3V3R A;  1XGJ A;  1IYQ A;  4BEN A;  3DWK A;  3ZCZ A;  2J9O A;  1ES5 A;  5KZH A;  1FSW A;  3FZC A;  1AXB A;  1KDW A;  4FCF A;  3WS2 A;  4OVD A;  3W4Q A;  3EQV A;  3WWX A;  1GHP A;  5GHX A;  3NBL A;  5HW3 A;  4X55 A;  5EUA A;  5GHZ A;  3S4X A;  1BZA A;  2WAD A;  1NYM A;  3NDE A;  1N4O A;  2OLV A;  3UDI A;  3UNW A;  3UPN A;  1K25 A;  1I2W A;  4BD0 A;  2Y2N A;  4OLG A;  5TGF A;  5AQ9 A;  3HLB A;  1RCJ A;  1L0E A;  2BLS A;  4GB7 A;  3HLW A;  3M6B A;  4KZ5 A;  4XXR A;  4Y7P A;  1CEG A;  4ZJ1 A;  4OP8 A;  2ZQ9 A;  4LV0 A;  1W5D A;  4KZ7 A;  3BFF A;  3Q7Z A;  3WS5 A;  3NCK A;  1C3B A;  4C3Q A;  1LL9 A;  4KZ4 A;  3IXG A;  4GDB A;  5CEC A;  3LY4 A;  1BLH A;  3MXR A;  4OQ0 A;  5A91 A;  1YM1 A;  4WMC D;  4FH2 A;  3ZHH A;  1U60 A;  1YMX A;  3E2K A;  2V2F F;  4EWF A;  2C5W B;  3BFG A;  3N8R A;  4PMA A;  4WM9 A;  2Z2L B;  5GLD A;  2V20 A;  2ZC7 A;  2A49 A;  3A3D A;  2HP6 A;  2WAE A;  3IH8 A;  3RXX A;  3M2K A;  1Y54 A;  4DXB A;  1K56 D;  4PPR A;  1IEM A;  4U3T A;  3MBZ A;  4R4R A;  5F83 A;  3W8K A;  2DNS A;  4F94 A;  3EQU A;  5E2G A;  1MY8 A;  2B5R A;  2ZM2 A;  3HBR A;  3O3V A;  1IKG A;  1DJC A;  1KVM A;  2OV5 A;  3UDF A;  3G35 A;  3B3X A;  4S2O A;  5FQQ A;  2Z2M B;  5EVI D;  3N7W A;  5DTT A;  1XPB A;  1FCM A;  2Y4A A;  3V50 A;  3ISG A;  3CMZ A;  1NZU A;  3DTM A;  4BL2 A;  1O7E A;  2Y2O A;  4A5R A;  5JYO A;  1S6R A;  4JXG A;  4JXS A;  4DDS A;  4LV2 A;  5CGX A;  3HLE A;  3AGD A;  3IH9 A;  2HPB A;  2RCX A;  3G32 A;  4OPQ A;  1OME A;  4C6Y A;  2EX8 A;  2GDN A;  3MZD A;  4Y0T A;  3HLC A;  3VOZ A;  1WE4 A;  2FFY A;  2WYX A;  1K6S A;  4PM6 A;  3SOI A;  1KGF A;  3ZG9 B;  1YQS A;  3FKW A;  3N4I A;  3UY6 A;  1GCE A;  3UPP A;  3DWZ A;  1HD8 A;  1O07 A;  4UA9 A;  3NDG A;  4XUX A;  3WS0 A;  1Q2Q A;  5GL9 A;  4DE1 A;  1XA1 A;  4X56 A;  3NIA A;  3C7V A;  1KE0 A;  5FQJ A;  3S1Y A;  3WS4 A;  5A93 A;  3PBR A;  4DDY A;  1K57 C;  1QMF A;  5L2F A;  3OPH A;  2JBF A;  2FFF B;  5FA7 A;  3UE0 A;  2IWC A;  2XD1 A;  4E3J A;  4MBK A;  4E6X A;  1IKI A;  4O7D A;  2XGN A;  4KG6 A;  3OCN A;  1IEL A;  5FQM A;  4L0L A;  2ZQA A;  3VP1 A;  2J7V A;  5IHV A;  1JWZ A;  5DTK A;  3SH9 A;  2Y2K A;  2XLN A;  1JVJ A;  3RJU A;  4JBF A;  4Y0U A;  2WKE A;  3Q82 A;  3UDX A;  4K0W A;  4E3I A;  3V3S A;  2Y2H A;  4R0Q A;  3ZG8 B;  4S2N C;  4E3N A;  1JTD A;  5GLA A;  3HUO A;  5CEB A;  5HX9 A;  1K4E A;  2P9V B;  3G30 A;  1ZG6 A;  4KEN B;  1BUL A;  1ES2 A;  2XR0 A;  3HLG A;  4S2K A;  4CPK A;  1MWR A;  1L0F A;  4C75 A;  5FI6 A;  4IVK A;  2Y2I A;  1XP4 A;  3N6I A;  3BFD A;  3BLS A;  3FYZ A;  4DE0 A;  4YIN A;  4OQH A;  2HP5 A;  4WZ4 A;  4UA6 A;  5CHU A;  5FQI A;  4P0M A;  2VGK A;  2P74 A;  4OPY A;  1E3U A;  3BLM A;  4OH0 A;  5EEC A;  4LCL A;  2ZMA A;  1YLW A;  5EVI C;  4EV4 A;  2ZQ7 A;  4RVA A;  2ZM0 A;  3IF6 B;  3VP4 A;  1YLZ A;  4BLM A;  2G2W A;  3N8S A;  3UO9 A;  3G2Y A;  4ID4 A;  4EUZ A;  3IQA A;  2E8I A;  5HAI A;  4WYY A;  5DF7 A;  1FR1 A;  1PW1 A;  3PBN A;  4HBU A;  1S0W A;  1ERM A;  2I72 A;  3IF6 C;  4JLF A;  4MLL A;  2WGW A;  4N9K A;  5DF8 A;  3Q07 A;  1KE4 A;  3PAG A;  2QPN A;  3PBQ A;  1TVF A;  3HLF A;  3MKF A;  3BRM A;  1MKI A;  5KSH A;  1CEF A;  2OSU A;  4OON A;  3IXH A;  4Z9Q A;  2XH9 A;  1XX2 A;  3Q7V B;  4WZ5 C;  3UN7 A;  4ZDX A;  4KG5 A;  2BG1 A;  2C6W B;  3O88 A;  5FI7 A;  4PM5 A;  2ZC5 B;  5DF9 A;  5CED A;  3GR2 A;  3M2J A;  2DCF A;  5E2E A;  1K57 A;  2DRW A;  3ZNT A;  3VOY A;  4R3J A;  5M19 A;  1K55 C;  2JE5 A;  4UAA A;  4RA7 A;  3S22 A;  3OPP A;  1TDL A;  4KZ6 A;  1RP5 A;  1ONH A;  1PZO A;  4X6T A;  5KSC A;  2HDR A;  3C7U A;  2ZQD A;  4JPM A;  1XA7 A;  4H8R A;  3QHY A;  2ZM8 A;  3IWI A;  1Q2P A;  2H0Y A;  3P09 A;  1BLC A;  4IBR A;  1EI5 A;  1BUE A;  4DXC A;  5FQK A;  4E6W A;  2H0T A;  4N1H A;  5EOO A;  1DJA A;  2QMI A;  1IYS A;  3O86 A;  4S2J A;  5FAO A;  2WGW B;  1ALQ A;  3ZFZ A;  5AQB A;  1XGI A;  1LHY A;  2EX2 A;  3C4P A;  4QD4 A;  1MXO A;  3IXD A;  3LCE A;  1CI8 A;  4QB8 A;  1FR6 A;  3VP0 A;  3NC8 A;  4WZ5 A;  4QU3 A;  1KGG A;  4JF5 A;  2X71 A;  4E3L A;  2EXA A;  1I2S A;  2Y2Q A;  3MXS A;  4OPZ A;  3OC2 A;  4LEN A;  1KDS A;  3I7J A;  1J9M A;  1DJB A;  2WUQ A;  1PI4 A;  1NYY A;  3A3J A;  3CG5 A;  2XFS A;  3ZDJ A;  3MZE A;  3TOI A;  2XEP A;  4ZAM A;  5D3O A;  3BFC A;  2JC7 A;  2UWX A;  4ZJ2 A;  4S2L A;  3GV9 A;  5DVA A;  3WRZ A;  4E3M A;  1LI0 A;  3HVF A;  1G68 A;  2ZQC A;  1M6K A;  4KZB A;  4M3K A;  3GSG A;  4RX3 A;  5AQ7 A;  5M1A A;  5EVL A;  3ZG0 A;  4BJP A;  1SCW A;  1CI9 A;  3E2L A;  4GD6 A;  5FDH A;  4E3K A;  4E3O A;  4OQG A;  1FOF A;  1NY0 A;  1Z6F A;  4KQQ A;  2WZX A;  2V1Z A;  2ZC6 B;  3BM6 A;  3PBS A;  3C4O A;  4U0T A;  3FWL A;  1BT5 A;  3GRJ A;  4MEZ A;  3A3I A;  4QY6 A;  4S2P A;  4Q8I A;  4DE2 A;  5FSR A;  5F1G A;  2J8Y A;  3VFH A;  4WMC A;  1DY6 A;  4DKI A;  1TEM A;  3SS4 A;  1K54 A;  4S2I A;  4IBX A;  4B4X A;  1XKZ A;  5HL1 A;  1HZO A;  4R4S A;  5KMW A;  3AGF A;  1PWC A;  3VSL A;  1YMS A;  4D2O A;  1GHI A;  5BOH A;  4LCM A;  5JYP A;  1FQG A;  3GQZ A;  1GA0 A;  3FV7 A;  1H5X A;  3UPO A; 
#chains in the Genus database with same CATH topology
 2PYP A;  5HAR A;  4JF6 A;  3VSK A;  1EWZ A;  4Q0J A;  1SKF A;  4R23 A;  5A92 A;  3SZT A;  3PTE A;  1JWP A;  2R78 A;  3IHA A;  5CTM A;  1ES4 A;  3OZH A;  1OTE A;  5HL6 A;  3KYZ A;  3UE1 A;  2VV8 A;  4LV1 A;  1H8Y A;  1ZC2 A;  5L10 A;  4KZ9 A;  1G5U A;  5HFO A;  1I5Q A;  3LIE A;  5EE8 A;  4KQR A;  1YLJ A;  3F1P B;  1WYB A;  5EVI A;  5J7E A;  3DW0 A;  1Y28 A;  2EFX A;  1HTZ A;  4G3W A;  5F6A A;  3UE3 A;  4DF6 A;  4BL3 A;  1VM1 A;  1L3L A;  2ZOH A;  3T4T A;  2PHY A;  1FSY A;  1W7F A;  3N8L A;  1HLU P;  1VQQ A;  3LIF A;  4KZA A;  4NK3 A;  4PHT A;  3VOL A;  1H8Z A;  4WEK A;  1E4D A;  1F9I A;  3LI9 A;  3LR0 A;  3SH7 A;  4UQI S;  2EFU A;  3A0V A;  2R9X A;  4WN5 A;  2PBY A;  3IT9 A;  3C30 A;  2PD8 A;  3PR6 A;  4HJ3 A;  1FIL A;  5J8X A;  3LIC A;  4HP4 A;  4N9L A;  4JGR A;  1TDG A;  2H5S A;  4MN6 A;  1L0D A;  2QJ7 A;  3S7Q A;  1E3U D;  2Q9N A;  3T4Q A;  2ZD8 A;  1PW8 A;  3TW8 A;  4EBN A;  3V5M A;  2Y8H A;  3HJI A;  3QP1 A;  2XA7 S;  4QWO A;  4HES A;  4OOL A;  2WKH A;  2Q9M A;  2Y2M A;  5HWV A;  5L09 A;  5CRF A;  1G6A A;  4FUW A;  1LI9 A;  1KVL A;  2JKR I;  2Y79 A;  3MXQ A;  5CXW A;  3F1N B;  2HDQ A;  4CLC C;  1ERO A;  4ZJ3 A;  1S1Y A;  3V39 A;  3R4K A;  1RGY A;  2VA0 A;  3KSH A;  5G4Z A;  4GD8 A;  3LO7 A;  3Q81 A;  3OPL A;  4S2M A;  3SS3 A;  1N9L A;  2XK1 A;  5G18 A;  1RGZ A;  4JGO A;  1LT0 A;  4NET A;  4X68 A;  2WKP A;  5HDD A;  3CI6 A;  2D01 A;  3DWK A;  1ES5 A;  4OVD A;  3P7N A;  3EQV A;  3WWX A;  1GHP A;  2XRN A;  5DKK A;  2WAD A;  3NDE A;  1N4O A;  2OLV A;  4X1M A;  1K25 A;  3BQA A;  3K3D A;  4KZ5 A;  5AVE A;  4Y7P A;  1CEG A;  2O9C A;  2ZQ9 A;  1SKO B;  4KZ7 A;  4C3Q A;  1LL9 A;  4GDB A;  5CEC A;  1CQA A;  1YM1 A;  3ZHH A;  1U60 A;  1VEU B;  1YMX A;  4EWF A;  4PMA A;  3N8R A;  3LGO A;  4WM9 A;  2M7V A;  5FEF A;  2A49 A;  2ZOI A;  3RXX A;  2M1C A;  1Y54 A;  5F83 A;  3HBR A;  2ZM2 A;  3E4P A;  4KQD A;  2PDR A;  5FQQ A;  3N7W A;  1XPB A;  2ACG A;  3CMZ A;  3DTM A;  4A5R A;  1WA9 A;  1S6R A;  5F68 A;  4LRY C;  4BBT A;  2HPB A;  3G32 A;  4OPQ A;  3RH8 B;  4C6Y A;  2GDN A;  3HLC A;  3VOZ A;  3L9K A;  3LR4 A;  1TD5 A;  1XJ2 A;  4PM6 A;  3SOI A;  3ZG9 B;  3UY6 A;  2EWV A;  4UA9 A;  3NDG A;  5GL9 A;  4DE1 A;  1XA1 A;  4CLC E;  3S1Y A;  3PBR A;  4DDY A;  5L2F A;  3HCY A;  2JBF A;  5FA7 A;  3UE0 A;  5HPF A;  3OOV A;  3OCN A;  2JKT M;  1TS8 A;  1K0K A;  3VP1 A;  5EM1 A;  4EXO A;  5IT5 A;  4R3A A;  4Y0U A;  1K4E A;  3G30 A;  4BWI A;  2LB9 A;  1L0F A;  2Y2I A;  4YIN A;  4OQH A;  1T1B A;  4WZ4 A;  4UA6 A;  1E3U A;  4IUH A;  3V67 A;  1ODV A;  1YLW A;  2J3T C;  4RVA A;  1YLZ A;  5I5L A;  1P9R A;  3LID A;  3N8S A;  2NUP C;  3CPT A;  2D02 A;  5F5Y A;  3LI8 A;  3Q07 A;  1KE4 A;  3BRM A;  5KSH A;  2BAS A;  2G7U A;  4WZ5 C;  4R70 A;  2C6W B;  5FI7 A;  4PM5 A;  3GR2 A;  2K31 A;  2QHK A;  5E2E A;  5M19 A;  1XFN A;  4UAA A;  3D3O A;  2HDR A;  2H0Y A;  2GZA A;  4GHI A;  1EI5 A;  1BUE A;  4IBR A;  4N1H A;  5EOO A;  1S4R A;  2QMI A;  5L8M A;  4S2J A;  5HWW A;  5AQB A;  1XGI A;  3C4P A;  2ZBB A;  4QD4 A;  4WZ5 A;  2ZL1 B;  1PFL A;  4GS9 B;  4E3L A;  2KOI A;  1I2S A;  3OC2 A;  2WUQ A;  1NYY A;  2XFS A;  3TOI A;  4ZAM A;  3TE8 A;  5DVA A;  4E3M A;  1LI0 A;  2ZQC A;  3PYP A;  1M6K A;  5EVL A;  2W3G A;  4GD6 A;  4E3O A;  2VX8 A;  1NY0 A;  4KQQ A;  3C4O A;  2HF6 A;  1BT5 A;  2PR5 A;  1T1A A;  4NXF A;  4MEZ A;  4QY6 A;  4S2P A;  2GJ3 A;  1VET A;  4DE2 A;  1UWN X;  4S2I A;  4DJ2 A;  1PWC A;  1Z09 A;  2P7J A;  1GHI A;  3D9Y A;  3W4P A;  4N1X A;  4EEU A;  3IWO A;  2OWJ A;  3BY8 A;  3WS1 A;  3Q7V A;  2Y59 A;  4ZBE A;  5HDC A;  3R7W A;  4EBL A;  4DJ3 A;  2WK0 A;  3W4O A;  4ARZ A;  3ZNY A;  4UHU A;  5CHM A;  3E4O A;  2Y2L A;  1EW0 A;  1KGE A;  4Y3I A;  3VE4 A;  3KO6 A;  1ZG4 A;  2XDM A;  2ZLY A;  1SDN A;  4XUZ A;  5U47 A;  5HSQ A;  1SDE A;  1JTG A;  4EUV A;  4GCZ A;  4JXV A;  2E8J A;  3TG9 A;  2Y91 A;  3MF0 A;  1D1J A;  3ITB A;  1CK3 A;  2GX5 A;  4R6L A;  4WF0 A;  4QHC A;  4EEP A;  2EX9 A;  2DMW A;  3HRE A;  5FEG A;  4MBF A;  1QME A;  3WRT A;  5E43 A;  3P01 A;  1T19 A;  3F1P A;  4IVI A;  5FAT A;  1YKD A;  2W0N A;  2CMN A;  5A8B A;  1PI5 A;  1TS6 A;  2Y2P A;  1PNE A;  1PWG A;  4GDN A;  2P04 A;  3ZG5 A;  4P6Z M;  4R3B A;  2WAF A;  4MN7 A;  1PIO A;  1LL5 A;  2JN7 A;  3BEB A;  3HLD A;  4HNB A;  1L0G A;  3MQO A;  1W8Y A;  4S2N A;  4HHD A;  4CLC D;  4Q0H A;  2VGJ A;  1ESI A;  2ZMV A;  3ZG7 B;  2OOL A;  2B18 A;  4WLA A;  5CGS A;  4H6J A;  1NZO A;  3OCL A;  4X69 A;  1FCN A;  3CAX A;  4OP5 A;  3LEZ A;  3IWQ A;  2JKR M;  4RYE A;  5DJU A;  3FKV A;  2Y55 A;  2M7U A;  3MFD A;  5HD3 A;  1K54 C;  2OLU A;  4WEL A;  3A3E A;  1ESU A;  1KE3 A;  2O9A A;  1N9O A;  1ERQ A;  4MBH A;  3MS6 A;  2X02 A;  5FQ9 A;  4MNR A;  1M40 A;  1YT4 A;  1ES3 A;  2CC1 A;  3T4O A;  2K2N A;  1H0M A;  3VP2 A;  4WL9 A;  3PBO A;  5FAS A;  2MJ6 A;  5FL3 A;  2IWD A;  1MWU A;  2PBD P;  3IXB A;  4ZRR A;  3UB8 A;  2W27 A;  4BEN A;  3NHQ A;  1FIK A;  4PAU A;  1CJF A;  1KDW A;  4FCF A;  4HJ6 A;  1NYM A;  4IUK A;  3UDI A;  2V1A A;  2Y2N A;  4OLG A;  4EES A;  1KOU A;  1LSX A;  4I3I A;  1L0E A;  1DRM A;  3M6B A;  2W3D A;  5EM0 A;  4OP8 A;  1IFQ A;  1W5D A;  3WS5 A;  3PXP A;  4PKY G;  3C8C A;  4DMZ A;  3UB5 P;  4XT2 B;  4F3L B;  3MXR A;  5A91 A;  4WMC D;  4G3K A;  4HH3 A;  3BFG A;  3OBF A;  5GLD A;  2ZC7 A;  4O8G A;  2HJE A;  1TS7 A;  4DXB A;  3S7O A;  4EET B;  4F94 A;  5LBR A;  3EQU A;  2B5R A;  2OV5 A;  3O3V A;  3G35 A;  4S2O A;  3W2Z A;  3D72 A;  5EVI D;  3ZYT A;  1FCM A;  1SZV A;  3V50 A;  4BL2 A;  5EV0 A;  5JYO A;  2IA2 A;  1YSP A;  3RTY A;  3LYX A;  4BBV A;  1YSQ A;  1G28 A;  3BQ8 A;  4EER A;  3MZD A;  3LEQ A;  4LRX C;  2WYX A;  3PHY A;  3MR0 A;  3UE6 A;  3N4I A;  1P0Z A;  3UPP A;  1V9Y A;  4XUX A;  1O07 A;  3F1O A;  3MQ0 A;  3C7V A;  1KE0 A;  5AVF A;  4ESP A;  4I38 A;  3CHW P;  4HH2 A;  2J80 A;  2XD1 A;  4MN5 A;  1DP6 A;  1IKI A;  3T4S A;  4KG6 A;  1IEL A;  3BW6 A;  1H8M A;  2J3W A;  5DTK A;  3SH9 A;  2XLN A;  4II7 A;  3U2A A;  3UDX A;  4YOF A;  3V3S A;  2Y2H A;  4R0Q A;  4E3N A;  3UME A;  1SKO A;  2P9V B;  1OTI A;  1BUL A;  4S2K A;  1MWR A;  2A24 A;  5FI6 A;  4IVK A;  3N6I A;  3BFD A;  3BLS A;  3FYZ A;  4NXE A;  2HP5 A;  4EU0 A;  1F5M A;  2P08 A;  4OPY A;  4OH0 A;  3BWL A;  1N9N A;  3MMH A;  1D06 A;  1XJ3 A;  4EV4 A;  3VP4 A;  4BLM A;  3OLO A;  2G2W A;  3S7P A;  4FOF A;  2E8I A;  5DF7 A;  4LPZ A;  1DP9 A;  2LB5 A;  2V9A A;  1S0W A;  5DF8 A;  1XFQ A;  2WGW A;  3PAG A;  3QP6 A;  3MKF A;  3LFV A;  4OON A;  2XH9 A;  1LSV A;  4ZDX A;  4KG5 A;  3DTE A;  5DF9 A;  5CED A;  1K57 A;  3RFB A;  3VOY A;  2OAP 1;  2JE5 A;  3S22 A;  2INW A;  2W1R A;  1TDL A;  5HWT A;  1PZO A;  1XA7 A;  4H8R A;  2HV1 A;  3IWI A;  4R38 A;  5EVE A;  5FQK A;  1GSV A;  5HDS A;  1DJA A;  1NLY A;  1IYS A;  3O86 A;  1ALQ A;  2EWW A;  2V1B A;  3IXD A;  3LCE A;  1FR6 A;  3NC8 A;  5TBM A;  4QU3 A;  2X71 A;  4OPZ A;  1DJB A;  3BFC A;  2JC7 A;  3B47 A;  4S2L A;  3FG8 A;  4M3K A;  5AQ7 A;  5M1A A;  1SCW A;  1CI9 A;  3HJK A;  1Z6F A;  2WZX A;  2ZC6 B;  1ACF A;  4L9E A;  4Q8I A;  3TRC A;  3LIA A;  2VV7 A;  3EGD C;  1F98 A;  4WUJ A;  3T12 B;  3SS4 A;  1K54 A;  4IBX A;  1XKZ A;  1HZO A;  4R4S A;  5KMW A;  3AGF A;  3VSL A;  4D2O A;  3MSH A;  1FQG A;  4U0X A;  3FV7 A;  3UPO A;  4GOG A;  4BBU A;  1STZ A;  1PYY A;  4JXW A;  2R9W A;  4B9O A;  3CUE A;  1WYC A;  2PU4 A;  3C5A A;  1BYW A;  3FPV A;  4Y5F A;  2W1T B;  2Y2G A;  3E4Q A;  1Y4O A;  1K6R A;  3KYE A;  3CZD A;  2J3T D;  5EOE A;  2XSS A;  4LRZ E;  4DRT A;  3GDI A;  4BQM A;  4QJG A;  3BJN A;  3TSG A;  3F1O B;  4P85 A;  4EBP A;  5AJG A;  4GJ4 A;  4WBG A;  4AFI A;  4R1G A;  4OLD A;  3PBT A;  1P9W A;  2HDU A;  1T18 A;  3GEC A;  5GHY A;  1F2K A;  5F82 A;  1K56 A;  4PM9 A;  3MKE A;  1NXY A;  1YLT A;  3M6H A;  2EXB A;  2P9V A;  1VHM A;  1NRJ A;  4YWZ A;  2QZ6 A;  4RQ9 A;  5HD5 A;  1BLS A;  1S66 L;  3ZVT A;  4E04 A;  1K4F A;  3DAV A;  4B4Z A;  4JKT A;  1YLP A;  5FI2 A;  3LY3 A;  4HEF A;  4KZ3 A;  3SH8 A;  1VB6 A;  3A0R A;  2UV0 E;  4GKU A;  4IED A;  2HDS A;  3OPR A;  1ONG A;  3Q1F A;  2ZC3 B;  5E2F A;  1PWD A;  4GZB A;  4P6B A;  1XXM A;  1MC0 A;  5EVI B;  3NI9 A;  2HZ5 A;  4EQI A;  3L7H A;  1P97 A;  2W3H A;  4MMN A;  2PAV P;  3O87 A;  5F1F A;  3FC7 A;  1ZHH B;  4JGQ A;  5FAP A;  1E25 A;  1FCO A;  1SHV A;  4HP9 A;  2QYB A;  2JHE A;  2QWS A;  4HBT A;  2RL3 A;  2PYR A;  4OKP A;  3RXW A;  1J3W A;  4Q0I A;  4DE3 A;  4N92 A;  2KDK A;  1OPX A;  1YLY A;  4P87 A;  1L2S A;  4B88 A;  4L9F A;  2O9B A;  4RX2 A;  3H7W A;  3IS2 B;  2L0W A;  3BEC A;  4GNU A;  3K3C A;  4UA7 A;  4JF4 A;  2H10 A;  4KZ8 A;  2VK3 A;  5GLC A;  2XD5 A;  3FPW A;  4LV3 A;  1OTA A;  2JCH A;  1GSX A;  2PR6 A;  3LUQ A;  2WKQ A;  4IJG A;  5E2H A;  4BMW A;  2XF3 A;  3IF5 A;  5CER A;  4WEJ A;  1ZTU A;  4EW7 A;  1DP8 A;  5J4E A;  3LR3 A;  3V3R A;  1IYQ A;  3ZCZ A;  2J9O A;  3FZC A;  1AXB A;  3WS2 A;  5CX7 A;  3W4Q A;  5GHX A;  3NBL A;  4HI4 A;  5EUA A;  3S4X A;  1BZA A;  1NLZ A;  3UPN A;  1I2W A;  5TGF A;  4MDZ A;  3HLB A;  1RCJ A;  2BLS A;  2HJ9 C;  4ZJ1 A;  3JVU A;  3BFF A;  3Q7Z A;  5IU1 A;  3DTK A;  3NCK A;  4IHQ A;  1YAX A;  3IXG A;  3S7N A;  1V9Z A;  3EEA A;  3LY4 A;  4G3V A;  4FH2 A;  3QP2 A;  3E2K A;  2L1M A;  2WAE A;  1OJ5 A;  3M2K A;  2JKF A;  1IEM A;  3MBZ A;  4R4R A;  3W8K A;  5E2G A;  1IKG A;  1DJC A;  1KVM A;  3UDF A;  3B3X A;  1YPR A;  2Z2M B;  5DTT A;  1OTB A;  4Y17 A;  2Y4A A;  3ISG A;  4NKP A;  1O7E A;  2Y2O A;  2JKG A;  4XT2 A;  4DDS A;  3HLE A;  3IH9 A;  4L9G A;  1H3Q A;  2EX8 A;  4I3A A;  2W3F A;  3UB9 A;  3QP8 A;  1K6S A;  3E98 A;  3FKW A;  3DWZ A;  3T50 A;  1Q2Q A;  4X56 A;  3NIA A;  4CLC B;  5FQJ A;  3WS4 A;  1K57 C;  1QMF A;  2FFF B;  4E3J A;  4O7D A;  5FQM A;  1JWZ A;  2Y2K A;  3ULF A;  1JVJ A;  3RJU A;  3LIB A;  2WKE A;  3Q82 A;  4E3I A;  1S1Z A;  3ZG8 B;  4S2N C;  1XJ6 A;  1JTD A;  3HUO A;  4KEN B;  2KX6 A;  3HLG A;  1ES2 A;  4CPK A;  3U4L P;  3KSG A;  5CHU A;  5FQI A;  4P0M A;  2VGK A;  2P74 A;  3BLM A;  5EEC A;  4LCL A;  5EFW A;  3NJA A;  2ZMA A;  2ZQ7 A;  3UO9 A;  3T4J A;  5F69 A;  3G2Y A;  2FZ0 A;  4QPR A;  3IQA A;  4WYY A;  1PW1 A;  3PBN A;  2VJW A;  1ERM A;  3IF6 C;  2WKR A;  4JLF A;  4N9K A;  4UQI M;  3PBQ A;  1TVF A;  1CEF A;  2OSU A;  3IXH A;  4Z9Q A;  1XX2 A;  3UN7 A;  3O88 A;  3M2J A;  3NOP C;  1NWZ A;  1IOU A;  5DFX A;  4R3J A;  3H7W B;  3IS2 A;  4JGP A;  4RA7 A;  1RP5 A;  4P6Z S;  5KSC A;  3C7U A;  1Q2P A;  4DXC A;  3P09 A;  1BLC A;  4O01 A;  5DFY A;  1XJ4 A;  2XA7 M;  2WGW B;  3ZFZ A;  3IX8 A;  2EX2 A;  3JPU A;  3H82 B;  4QB8 A;  3VP0 A;  1S4S A;  1KGG A;  3DBA A;  3T4L A;  2EXA A;  2Y2Q A;  3MXS A;  3VV4 A;  4LEN A;  3I7J A;  1J9M A;  1PI4 A;  3ZDJ A;  3O5Y A;  5HZH A;  3MZE A;  4Z1W A;  4EQ1 A;  5D3O A;  5C5K A;  4ZJ2 A;  4X1L A;  4ETX A;  3GV9 A;  1S67 L;  4HY8 A;  4NG2 A;  3HVF A;  1G68 A;  4KZB A;  2A24 B;  4BJP A;  3E2L A;  2H28 A;  5FDH A;  1FOF A;  3KYQ A;  5L07 A;  3BM6 A;  3PBS A;  1JNU A;  3VE3 A;  4ME4 A;  3FWL A;  4DN0 A;  1OT9 A;  3GRJ A;  3SW1 A;  2B95 A;  4LLO B;  5FSR A;  2J8Y A;  3VFH A;  4WMC A;  1UWP X;  3MFX A;  2PT7 A;  5JYP A;  2QJ5 A;  2B02 A;  3D4F A;  1K38 A;  4PKY A;  4PM7 A;  2G2U A;  5MC7 A;  1PZP A;  4YFM A;  3CUE C;  1GA9 A;  3HUM A;  3UMD A;  4K0X A;  2ZQ8 A;  2FH5 A;  3KSI A;  3E0Y A;  3GTC A;  3UB7 A;  4FD8 A;  3MJQ A;  1N9B A;  2ZMF A;  1MWT A;  3NOU C;  4H6J B;  3JYI A;  3QNC A;  4ZTK A;  2EX6 A;  3H9W A;  5TFQ A;  4K08 A;  1NJ4 A;  4K91 A;  1TS0 A;  4OPR A;  1W79 A;  1MBL A;  3ITA A;  4OQI A;  4NEE D;  1MPL A;  4KG2 A;  5DTS A;  5EPH A;  5HAQ A;  2WKI A;  1MWS A;  4PM8 A;  1D7E A;  3BFE A;  3P98 A;  3BYD A;  3PAE A;  4KQO A;  1TF1 A;  3VFF A;  2VKS A;  1BSG A;  4QY5 A;  2GNX A;  3ICY A;  3A3F A;  2I9V A;  3CJM A;  3ZGA B;  3IBR A;  4HJ4 A;  1ZKJ A;  3IBJ A;  3T1R A;  5GLB A;  2XQZ A;  1HVB A;  2A3U A;  2NUT C;  3CWF A;  4M4X A;  2XRO A;  4X53 A;  2HGV A;  1JWV A;  3HUN A;  4HIA A;  4NXG A;  2WGV A;  1K55 A;  5FAQ A;  3T1X A;  3G34 A;  2O0Y A;  3IHB A;  3SS5 A;  2XFT A;  3VMA A;  4OOY A;  1LL8 A;  2PU2 A;  5IS1 A;  4CQH A;  1IYO A;  3GVB A;  1NRF A;  2J9P A;  3F1N A;  2X01 A;  2ZC4 B;  1BTL A;  4OOM A;  3IF6 A;  3AGE A;  2W1T A;  3MZF A;  3G31 A;  4FSF A;  4Y0O A;  1VEU A;  3ZVW A;  1CF0 A;  3VP3 A;  1W8Q A;  2Y2J A;  2OAQ 1;  5AQA A;  4CJN A;  2V0W A;  2WZZ A;  3GMW A;  3G4P A;  1MKM A;  3QNB A;  5A90 A;  3C2W A;  4GN2 A;  5CTN A;  1BLP A;  4O0P A;  1IYP A;  2VLG A;  4FH4 A;  4F3L A;  5TR7 A;  2W3E A;  2JKT I;  1LLB A;  4HOI A;  2BTF P;  1MZU A;  2VGL M;  2KLI A;  3HL9 A;  3NY4 A;  5K5B A;  2WGI A;  5I94 A;  2YKF A;  4Y13 A;  1GHM A;  3B42 A;  2Z6D A;  3G6O A;  5CHJ A;  2HP9 A;  4BD1 A;  2IWB A;  5M18 A;  3NEC A;  5HAP A;  5CGW A;  4UEY A;  4GLQ A;  2OWH A;  4FTX A;  2ZJ9 A;  3G2Z A;  1XGJ A;  5KZH A;  1FSW A;  5HPI A;  2VGL S;  5HW3 A;  4X55 A;  5GHZ A;  3EGX C;  3UNW A;  3MQQ A;  4BD0 A;  5AQ9 A;  3CIT A;  4GB7 A;  3HLW A;  4XXR A;  4KUK A;  4LV0 A;  5TJJ A;  1C3B A;  4KZ4 A;  3QP4 A;  1BLH A;  4OQ0 A;  3LR5 A;  2V2F F;  2C5W B;  2Z2L B;  2V20 A;  3JVV A;  3A3D A;  4NXB A;  2HP6 A;  3DTI A;  3IH8 A;  3NOT C;  3ZQ5 A;  2Z6C A;  1K56 D;  1G6O A;  4PPR A;  3CPT B;  4U3T A;  2DNS A;  1MY8 A;  5DKL A;  1NZU A;  4I5S A;  4ETZ A;  4JXG A;  4JXS A;  4LV2 A;  5CGX A;  3AGD A;  2RCX A;  4KUO A;  1OME A;  3A0S A;  2VEA A;  4Y0T A;  3CLO A;  1WE4 A;  2FFY A;  2V0U A;  5KIZ A;  1KGF A;  1YQS A;  3KSF A;  1GCE A;  1HD8 A;  3WS0 A;  1OJG A;  5A93 A;  5FDS A;  3OPH A;  2IWC A;  4HQA A;  4MBK A;  4E6X A;  2XGN A;  2VV6 A;  4L0L A;  2ZL1 A;  2ZQA A;  2J7V A;  4Y2F A;  5IHV A;  4I3J A;  4JBF A;  4K0W A;  3QP5 A;  4Y15 A;  5GLA A;  5CEB A;  5HX9 A;  1ZG6 A;  3B33 A;  4D60 A;  2XR0 A;  4I39 A;  4C75 A;  1AWI A;  2YKH A;  2A2L A;  2QKP A;  1XP4 A;  4LGW A;  4DE0 A;  5TBM B;  2O99 A;  1X0O A;  5G4Y A;  5EVI C;  2EA9 A;  2ZM0 A;  3IF6 B;  3IX4 A;  1GSW A;  5J3W A;  4ID4 A;  3EOI A;  4EUZ A;  5HAI A;  5DJT A;  1FR1 A;  4GHI B;  4GW9 A;  4HBU A;  3K2N A;  2I72 A;  4MLL A;  2QPN A;  3HLF A;  1MKI A;  1A0K A;  2AVX A;  1W63 M;  3Q7V B;  2V8C A;  2BG1 A;  2ZC5 B;  4GS9 A;  2DCF A;  4X25 A;  2DRW A;  3ZNT A;  2K7S A;  3EEH A;  2PD7 A;  1K55 C;  4B93 A;  2PRF A;  3OPP A;  4KZ6 A;  1ONH A;  4X6T A;  2ZQD A;  4JPM A;  3QHY A;  2ZM8 A;  4E6W A;  4CLC A;  1UGU A;  1OTD A;  5FAO A;  2H0T A;  3C38 A;  3TJZ C;  1T1C A;  1LHY A;  1MXO A;  1VET B;  1CI8 A;  3T1Q B;  4JF5 A;  2V8F A;  3IX3 A;  1KDS A;  3UB6 A;  1OT6 A;  3CG5 A;  3A3J A;  2XEP A;  2UWX A;  3WRZ A;  1PRQ A;  3NUL A;  1W63 Q;  3GSG A;  4RX3 A;  4YNR A;  3ZG0 A;  4E3K A;  3EWK A;  4OQG A;  3R7W B;  2V1Z A;  4U0T A;  3KX0 X;  4LFU A;  2L4R A;  3A3I A;  4ARZ B;  4MCW A;  3H82 A;  3BY9 A;  5F1G A;  2Q0O A;  1DY6 A;  2VZW A;  4DKI A;  1TEM A;  4B4X A;  5HL1 A;  3T1S A;  1YMS A;  1LSW A;  5BOH A;  3T4K A;  4LCM A;  3GQZ A;  1GA0 A;  1H5X A; 
#chains in the Genus database with same CATH homology
 3W4P A;  4GOG A;  4N1X A;  3D4F A;  1K38 A;  5HAR A;  3IWO A;  4JF6 A;  3VSK A;  1EWZ A;  4PM7 A;  2G2U A;  1PZP A;  4YFM A;  1SKF A;  3WS1 A;  3Q7V A;  1GA9 A;  2Y59 A;  1PYY A;  3HUM A;  4R23 A;  4ZBE A;  5A92 A;  4JXW A;  2R9W A;  4EBL A;  4K0X A;  3PTE A;  1JWP A;  2ZQ8 A;  3IHA A;  5CTM A;  2WK0 A;  3W4O A;  1ES4 A;  1WYC A;  3OZH A;  2PU4 A;  3C5A A;  3ZNY A;  4UHU A;  3GTC A;  3UE1 A;  2Y2G A;  4FD8 A;  5CHM A;  1K6R A;  4LV1 A;  2Y2L A;  1H8Y A;  1N9B A;  1KGE A;  1ZC2 A;  1MWT A;  3CZD A;  4KZ9 A;  5HFO A;  1I5Q A;  5EE8 A;  5EOE A;  1ZG4 A;  4KQR A;  1YLJ A;  4DRT A;  2XDM A;  1WYB A;  5EVI A;  3JYI A;  2ZLY A;  3QNC A;  4BQM A;  4ZTK A;  4QJG A;  3DW0 A;  1SDN A;  2EFX A;  2EX6 A;  4XUZ A;  5U47 A;  5TFQ A;  1SDE A;  3TSG A;  1HTZ A;  4P85 A;  1NJ4 A;  1JTG A;  4EBP A;  3UE3 A;  4JXV A;  4WBG A;  4K91 A;  4OPR A;  1W79 A;  4DF6 A;  4R1G A;  4OLD A;  3TG9 A;  2Y91 A;  1MBL A;  3ITA A;  4BL3 A;  1VM1 A;  3PBT A;  2HDU A;  4OQI A;  1MPL A;  4KG2 A;  5DTS A;  5EPH A;  5HAQ A;  2WKI A;  1MWS A;  3ITB A;  4PM8 A;  1CK3 A;  1FSY A;  1W7F A;  3BFE A;  5GHY A;  4QHC A;  3P98 A;  2EX9 A;  3N8L A;  5F82 A;  3HRE A;  1K56 A;  4PM9 A;  4MBF A;  1VQQ A;  3BYD A;  3MKE A;  1NXY A;  3PAE A;  4KQO A;  1QME A;  3WRT A;  5E43 A;  1YLT A;  3M6H A;  4KZA A;  4IVI A;  3VFF A;  2EXB A;  2P9V A;  4NK3 A;  5FAT A;  1BSG A;  4QY5 A;  1H8Z A;  4U0X A;  4WEK A;  3A3F A;  3CJM A;  3ZGA B;  2QZ6 A;  1E4D A;  1ZKJ A;  5GLB A;  1BLS A;  2XQZ A;  1HVB A;  1PI5 A;  3SH7 A;  3ZVT A;  1K4F A;  2A3U A;  2Y2P A;  4X53 A;  4B4Z A;  4JKT A;  1YLP A;  1PWG A;  4GDN A;  5FI2 A;  3ZG5 A;  2EFU A;  3LY3 A;  1JWV A;  3HUN A;  2R9X A;  2WAF A;  4HEF A;  4R3B A;  4KZ3 A;  1PIO A;  2WGV A;  1LL5 A;  3SH8 A;  1K55 A;  2PBY A;  3BEB A;  3G34 A;  3HLD A;  3IT9 A;  4GKU A;  5FAQ A;  1L0G A;  1W8Y A;  4IED A;  4S2N A;  3IHB A;  2HDS A;  3OPR A;  3SS5 A;  1ONG A;  2XFT A;  3VMA A;  4OOY A;  2VGJ A;  3Q1F A;  2ZC3 B;  5J8X A;  5E2F A;  1PWD A;  4GZB A;  4P6B A;  1ESI A;  2PU2 A;  4N9L A;  3ZG7 B;  1XXM A;  1TDG A;  1IYO A;  2H5S A;  3GVB A;  5CGS A;  5EVI B;  3NI9 A;  1NZO A;  1L0D A;  1NRF A;  2J9P A;  1E3U D;  2Q9N A;  4EQI A;  2X01 A;  3OCL A;  2ZC4 B;  1PW8 A;  2ZD8 A;  1BTL A;  4EBN A;  4OOM A;  3V5M A;  3IF6 A;  1FCN A;  4X69 A;  3AGE A;  4OP5 A;  3MZF A;  3LEZ A;  3IWQ A;  3O87 A;  3G31 A;  4FSF A;  4Y0O A;  4RYE A;  4HES A;  3ZVW A;  5F1F A;  3VP3 A;  1W8Q A;  4OOL A;  2Y2J A;  5AQA A;  4CJN A;  2WZZ A;  3FKV A;  3GMW A;  3G4P A;  2Y55 A;  3QNB A;  5FAP A;  1E25 A;  3MFD A;  5A90 A;  4GN2 A;  1FCO A;  1K54 C;  1SHV A;  2OLU A;  2WKH A;  5CTN A;  4WEL A;  2Q9M A;  1BLP A;  2Y2M A;  4HBT A;  2RL3 A;  1IYP A;  3A3E A;  5CRF A;  1G6A A;  4OKP A;  1LI9 A;  3RXW A;  1KVL A;  1ESU A;  4FH4 A;  1KE3 A;  4DE3 A;  5TR7 A;  1LLB A;  4N92 A;  1YLY A;  4P87 A;  1L2S A;  1ERQ A;  4MBH A;  5CXW A;  4B88 A;  3HL9 A;  3NY4 A;  2HDQ A;  1ERO A;  4RX2 A;  2X02 A;  2WGI A;  5I94 A;  5FQ9 A;  3BEC A;  4ZJ3 A;  4MNR A;  4GNU A;  3V39 A;  1M40 A;  1RGY A;  1YT4 A;  4UA7 A;  4JF4 A;  1GHM A;  1ES3 A;  2CC1 A;  2H10 A;  4KZ8 A;  5CHJ A;  2HP9 A;  4BD1 A;  5GLC A;  2IWB A;  5M18 A;  2XD5 A;  4GD8 A;  3LO7 A;  4LV3 A;  3VP2 A;  3Q81 A;  3OPL A;  4S2M A;  5CGW A;  3PBO A;  2JCH A;  5HAP A;  5FAS A;  3SS3 A;  2ZJ9 A;  5E2H A;  2XK1 A;  2XF3 A;  3IF5 A;  5G18 A;  5CER A;  1RGZ A;  4WEJ A;  2IWD A;  1MWU A;  3G2Z A;  4NET A;  4X68 A;  3IXB A;  3V3R A;  1XGJ A;  1IYQ A;  4BEN A;  3DWK A;  3ZCZ A;  2J9O A;  1ES5 A;  5KZH A;  1FSW A;  3FZC A;  1AXB A;  1KDW A;  4FCF A;  3WS2 A;  4OVD A;  3W4Q A;  3EQV A;  3WWX A;  1GHP A;  5GHX A;  3NBL A;  5HW3 A;  4X55 A;  5EUA A;  5GHZ A;  3S4X A;  1BZA A;  2WAD A;  1NYM A;  3NDE A;  1N4O A;  2OLV A;  3UDI A;  3UNW A;  3UPN A;  1K25 A;  1I2W A;  4BD0 A;  2Y2N A;  4OLG A;  5TGF A;  5AQ9 A;  3HLB A;  1RCJ A;  1L0E A;  2BLS A;  4GB7 A;  3HLW A;  3M6B A;  4KZ5 A;  4XXR A;  4Y7P A;  1CEG A;  4ZJ1 A;  4OP8 A;  2ZQ9 A;  4LV0 A;  1W5D A;  4KZ7 A;  3BFF A;  3Q7Z A;  3WS5 A;  3NCK A;  1C3B A;  4C3Q A;  1LL9 A;  4KZ4 A;  3IXG A;  4GDB A;  5CEC A;  3LY4 A;  1BLH A;  3MXR A;  4OQ0 A;  5A91 A;  1YM1 A;  4WMC D;  4FH2 A;  3ZHH A;  1U60 A;  1YMX A;  3E2K A;  2V2F F;  4EWF A;  2C5W B;  3BFG A;  3N8R A;  4PMA A;  4WM9 A;  2Z2L B;  5GLD A;  2V20 A;  2ZC7 A;  2A49 A;  3A3D A;  2HP6 A;  2WAE A;  3IH8 A;  3RXX A;  3M2K A;  1Y54 A;  4DXB A;  1K56 D;  4PPR A;  1IEM A;  4U3T A;  3MBZ A;  4R4R A;  5F83 A;  3W8K A;  2DNS A;  4F94 A;  3EQU A;  5E2G A;  1MY8 A;  2B5R A;  2ZM2 A;  3HBR A;  3O3V A;  1IKG A;  1DJC A;  1KVM A;  2OV5 A;  3UDF A;  3G35 A;  3B3X A;  4S2O A;  5FQQ A;  2Z2M B;  5EVI D;  3N7W A;  5DTT A;  1XPB A;  1FCM A;  2Y4A A;  3V50 A;  3ISG A;  3CMZ A;  1NZU A;  3DTM A;  4BL2 A;  1O7E A;  2Y2O A;  4A5R A;  5JYO A;  1S6R A;  4JXG A;  4JXS A;  4DDS A;  4LV2 A;  5CGX A;  3HLE A;  3AGD A;  3IH9 A;  2HPB A;  2RCX A;  3G32 A;  4OPQ A;  1OME A;  4C6Y A;  2EX8 A;  2GDN A;  3MZD A;  4Y0T A;  3HLC A;  3VOZ A;  1WE4 A;  2FFY A;  2WYX A;  1K6S A;  4PM6 A;  3SOI A;  1KGF A;  3ZG9 B;  1YQS A;  3FKW A;  3N4I A;  3UY6 A;  1GCE A;  3UPP A;  3DWZ A;  1HD8 A;  1O07 A;  4UA9 A;  3NDG A;  4XUX A;  3WS0 A;  1Q2Q A;  5GL9 A;  4DE1 A;  1XA1 A;  4X56 A;  3NIA A;  3C7V A;  1KE0 A;  5FQJ A;  3S1Y A;  3WS4 A;  5A93 A;  3PBR A;  4DDY A;  1K57 C;  1QMF A;  5L2F A;  3OPH A;  2JBF A;  2FFF B;  5FA7 A;  3UE0 A;  2IWC A;  2XD1 A;  4E3J A;  4MBK A;  4E6X A;  1IKI A;  4O7D A;  2XGN A;  4KG6 A;  3OCN A;  1IEL A;  5FQM A;  4L0L A;  2ZQA A;  3VP1 A;  2J7V A;  5IHV A;  1JWZ A;  5DTK A;  3SH9 A;  2Y2K A;  2XLN A;  1JVJ A;  3RJU A;  4JBF A;  4Y0U A;  2WKE A;  3Q82 A;  3UDX A;  4K0W A;  4E3I A;  3V3S A;  2Y2H A;  4R0Q A;  3ZG8 B;  4S2N C;  4E3N A;  1JTD A;  5GLA A;  3HUO A;  5CEB A;  5HX9 A;  1K4E A;  2P9V B;  3G30 A;  1ZG6 A;  4KEN B;  1BUL A;  1ES2 A;  2XR0 A;  3HLG A;  4S2K A;  4CPK A;  1MWR A;  1L0F A;  4C75 A;  5FI6 A;  4IVK A;  2Y2I A;  1XP4 A;  3N6I A;  3BFD A;  3BLS A;  3FYZ A;  4DE0 A;  4YIN A;  4OQH A;  2HP5 A;  4WZ4 A;  4UA6 A;  5CHU A;  5FQI A;  4P0M A;  2VGK A;  2P74 A;  4OPY A;  1E3U A;  3BLM A;  4OH0 A;  5EEC A;  4LCL A;  2ZMA A;  1YLW A;  5EVI C;  4EV4 A;  2ZQ7 A;  4RVA A;  2ZM0 A;  3IF6 B;  3VP4 A;  1YLZ A;  4BLM A;  2G2W A;  3N8S A;  3UO9 A;  3G2Y A;  4ID4 A;  4EUZ A;  3IQA A;  2E8I A;  5HAI A;  4WYY A;  5DF7 A;  1FR1 A;  1PW1 A;  3PBN A;  4HBU A;  1S0W A;  1ERM A;  2I72 A;  3IF6 C;  4JLF A;  4MLL A;  2WGW A;  4N9K A;  5DF8 A;  3Q07 A;  1KE4 A;  3PAG A;  2QPN A;  3PBQ A;  1TVF A;  3HLF A;  3MKF A;  3BRM A;  1MKI A;  5KSH A;  1CEF A;  2OSU A;  4OON A;  3IXH A;  4Z9Q A;  2XH9 A;  1XX2 A;  3Q7V B;  4WZ5 C;  3UN7 A;  4ZDX A;  4KG5 A;  2BG1 A;  2C6W B;  3O88 A;  5FI7 A;  4PM5 A;  2ZC5 B;  5DF9 A;  5CED A;  3GR2 A;  3M2J A;  2DCF A;  5E2E A;  1K57 A;  2DRW A;  3ZNT A;  3VOY A;  4R3J A;  5M19 A;  1K55 C;  2JE5 A;  4UAA A;  4RA7 A;  3S22 A;  3OPP A;  1TDL A;  4KZ6 A;  1RP5 A;  1ONH A;  1PZO A;  4X6T A;  5KSC A;  2HDR A;  3C7U A;  2ZQD A;  4JPM A;  1XA7 A;  4H8R A;  3QHY A;  2ZM8 A;  3IWI A;  1Q2P A;  2H0Y A;  3P09 A;  1BLC A;  4IBR A;  1EI5 A;  1BUE A;  4DXC A;  5FQK A;  4E6W A;  2H0T A;  4N1H A;  5EOO A;  1DJA A;  2QMI A;  1IYS A;  3O86 A;  4S2J A;  5FAO A;  2WGW B;  1ALQ A;  3ZFZ A;  5AQB A;  1XGI A;  1LHY A;  2EX2 A;  3C4P A;  4QD4 A;  1MXO A;  3IXD A;  3LCE A;  1CI8 A;  4QB8 A;  1FR6 A;  3VP0 A;  3NC8 A;  4WZ5 A;  4QU3 A;  1KGG A;  4JF5 A;  2X71 A;  4E3L A;  2EXA A;  1I2S A;  2Y2Q A;  3MXS A;  4OPZ A;  3OC2 A;  4LEN A;  1KDS A;  3I7J A;  1J9M A;  1DJB A;  2WUQ A;  1PI4 A;  1NYY A;  3A3J A;  3CG5 A;  2XFS A;  3ZDJ A;  3MZE A;  3TOI A;  2XEP A;  4ZAM A;  5D3O A;  3BFC A;  2JC7 A;  2UWX A;  4ZJ2 A;  4S2L A;  3GV9 A;  5DVA A;  3WRZ A;  4E3M A;  1LI0 A;  3HVF A;  1G68 A;  2ZQC A;  1M6K A;  4KZB A;  4M3K A;  3GSG A;  4RX3 A;  5AQ7 A;  5M1A A;  5EVL A;  3ZG0 A;  4BJP A;  1SCW A;  1CI9 A;  3E2L A;  4GD6 A;  5FDH A;  4E3K A;  4E3O A;  4OQG A;  1FOF A;  1NY0 A;  1Z6F A;  4KQQ A;  2WZX A;  2V1Z A;  2ZC6 B;  3BM6 A;  3PBS A;  3C4O A;  4U0T A;  3FWL A;  1BT5 A;  3GRJ A;  4MEZ A;  3A3I A;  4QY6 A;  4S2P A;  4Q8I A;  4DE2 A;  5FSR A;  5F1G A;  2J8Y A;  3VFH A;  4WMC A;  1DY6 A;  4DKI A;  1TEM A;  3SS4 A;  1K54 A;  4S2I A;  4IBX A;  4B4X A;  1XKZ A;  5HL1 A;  1HZO A;  4R4S A;  5KMW A;  3AGF A;  1PWC A;  3VSL A;  1YMS A;  4D2O A;  1GHI A;  5BOH A;  4LCM A;  5JYP A;  1FQG A;  3GQZ A;  1GA0 A;  3FV7 A;  1H5X A;  3UPO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...