4X68A

Crystal structure of op0595 complexed with ampc
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
357
structure length
357
Chain Sequence
MDRLKALVDAAVQPVMKANDIPGLAVAISLKGEPHYFSYGLASKEDGRRVTPETLFEIGSVSKTFTATLAGYALTQDKMRLDDRASQHWPALQGSRFDGISLLDLATYTAGGLPLQFPDSVQKDQAQIRDYYRQWQPTYAPGSQRLYSNPSIGLFGYLAARSLGQPFERLMEQQVFPALGLEQTHLDVPEAALAQYAQGYGKDDRPLRVGPGPLDAEGYGVKTSAADLLRFVDANLHPERLDRPWAQALDATHRGYYKVGDMTQGLGWEAYDWPISLKRLQAGNSTPMALQPHRIARLPAPQALEGQRLLNKTGSTNGFGAYVAFVPGRDLGLVILANRNYPNAERVKIAYAILSGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactamase
publication title OP0595, a new diazabicyclooctane: mode of action as a serine beta-lactamase inhibitor, antibiotic and beta-lactam 'enhancer'
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Hydrolase/hydrolase inhibitor
total genus 122
structure length 357
sequence length 357
chains with identical sequence B
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2014-12-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 4x68A00
4WZ5A 1I2SA 3CMZA 2Y59A 1N4OA 4OQHA 4LCLA 5FA7A 4ZJ3A 2G2UA 2ZQ7A 1BULA 3Q82A 5A90A 3VSLA 1BLHA 1KDSA 3G31A 3RXWA 4GDBA 1DJCA 2EFUA 4OKPA 3OPHA 3BECA 5G18A 1ONHA 3E2LA 2DNSA 4DF6A 3N8RA 1BT5A 4PMAA 4EWFA 3FYZA 3S1YA 3IT9A 5FAPA 5HX9A 1W8YA 1ERMA 1H8YA 1O07A 3OPLA 4E6WA 3V3SA 3NDEA 3AGFA 2J9OA 3A3DA 3ZVTA 4OLGA 1PYYA 3ISGA 1K4EA 3V39A 1KGGA 1KVMA 4FCFA 3LO7A 4WEJA 2X71A 1ERQA 2Y2KA 3IHBA 4M3KA 1XP4A 3ZG0A 1M40A 3EQUA 4OPZA 5KZHA 3VP2A 3G34A 4GKUA 4LV1A 1ESUA 3G32A 2WZZA 2Y2LA 3UPOA 1TVFA 1WE4A 2ZQ8A 2FFFB 4OPQA 3HUNA 4P87A 3WRZA 5FQMA 4JF4A 1C3BA 3WS5A 1BLCA 2HDRA 1S6RA 3UNWA 1FR1A 2JBFA 1YLYA 4OQ0A 2Q9NA 1BLSA 3OCLA 2XF3A 3B3XA 3IHAA 5CTMA 4BENA 1G68A 4QJGA 1PW8A 4DXBA 1NYMA 4N9KA 3N6IA 4WMCD 3GVBA 5EVIA 2WGVA 1RP5A 3I7JA 4WZ4A 1K57C 1PIOA 2Y2OA 5FQJA 1KE3A 2QPNA 3Q7VB 3HL9A 3OC2A 3BFEA 3W4OA 2I72A 4GZBA 3ZNYA 1QMEA 5GHZA 3SH8A 3MZFA 3RXXA 2ZC6B 5HARA 1VM1A 4S2MA 5A91A 3ZCZA 3PBRA 4BLMA 3IWOA 4WYYA 5FASA 4PM6A 1IKIA 4Y0UA 3S22A 4KG6A 5FAOA 3E2KA 4QU3A 2OSUA 3IF6B 1WYCA 3PBSA 5TFQA 1KE0A 2P9VB 5L2FA 3HLCA 2HDSA 4KZ8A 1MWSA 5EVID 3ITAA 2E8IA 3HBRA 3IXHA 4BJPA 4NK3A 4A5RA 4F94A 5IHVA 3IH8A 3ZG7B 1J9MA 3PAEA 1GHPA 5CEDA 3G2YA 2BLSA 3LEZA 1PZOA 3OPPA 4CJNA 3A3FA 2GDNA 4RX3A 4UAAA 1IYPA 3UY6A 1ZC2A 5F1GA 4U3TA 4HBTA 3VP1A 4PM9A 2ZQAA 3M2JA 1GCEA 4ZAMA 5FI6A 5GHXA 3VSKA 3IF6A 3PBNA 2V2FF 3VP3A 1LI9A 5CGSA 4R4RA 4U0XA 4R1GA 2ZQ9A 3FKWA 1PW1A 3P09A 2C5WB 3O86A 4LV0A 4LV2A 5CHUA 3LCEA 4KZ9A 2WGWB 3BYDA 1K6SA 3HUMA 4K0XA 3VOYA 5DF9A 3WS2A 1H5XA 1L0GA 3WS0A 4QY5A 5CRFA 1SDNA 4DE1A 4N92A 3NCKA 1YMSA 3N7WA 3N4IA 1CEFA 3GQZA 4KZ5A 2EX9A 3BM6A 5FI7A 5E2EA 1NYYA 1MKIA 1K56A 2FFYA 1PWDA 3NDGA 1JWVA 4LCMA 2EFXA 3D4FA 4C75A 1W79A 1FSYA 3V3RA 1FOFA 3SH9A 3PBTA 1K57A 3MXSA 1RGZA 2B5RA 2WGWA 3HLFA 4H8RA 4B88A 4GN2A 5FATA 4OQGA 4DRTA 5GL9A 1ES3A 3MKFA 3A3JA 2V1ZA 2J8YA 3O87A 4S2NC 3TG9A 1PWGA 4E3MA 4KQOA 1MY8A 1TDGA 1Y54A 4WBGA 2ZM2A 2WYXA 5FDHA 4B4ZA 2RL3A 1CK3A 2R9XA 1K56D 4JF5A 1E3UA 2XQZA 4S2LA 1EROA 1ESIA 1O7EA 2H0TA 1SHVA 1QMFA 3GTCA 4OQIA 5AQ9A 4ZJ1A 2Y91A 4Y7PA 3QNBA 1L0DA 1YMXA 3PBQA 1ONGA 4BD1A 1K55A 4WMCA 3PAGA 2WADA 3PBOA 5EVIB 5BOHA 4JBFA 5HW3A 2Y2QA 1H8ZA 1SCWA 3ZDJA 3ZGAB 1IEMA 3VP0A 4N1HA 1K54C 3UE3A 1GHIA 2XEPA 5DF8A 4IVKA 4GB7A 4X53A 4EUZA 1E3UD 2EXAA 5HAQA 1XXMA 4RX2A 4DE3A 2ZC4B 3BFGA 1IKGA 3M6HA 1BUEA 4KZ4A 1DY6A 1JTDA 2G2WA 4S2OA 3VOZA 2V20A 2OLUA 1FCMA 2Y2NA 2XR0A 3HVFA 4K0WA 1XA7A 3NI9A 4DDSA 4OP5A 3IXGA 1NZOA 4MEZA 5EUAA 1NY0A 1XX2A 4OOYA 4BD0A 1ES2A 2XFSA 4R0QA 5D3OA 3OZHA 5GLBA 2CC1A 3UPPA 4IEDA 2H10A 4OPYA 4WELA 3Q1FA 1TDLA 4OLDA 3C4OA 1K6RA 2DRWA 5FQKA 3HUOA 1KE4A 2A49A 1I5QA 4XUZA 1BLPA 4BL3A 4S2KA 3BLMA 4E3KA 1K38A 2HPBA 4PM5A 3MXRA 2Y2IA 4OPRA 3FZCA 3IWIA 5HAPA 4EQIA 4EV4A 3LY4A 1G6AA 3IXBA 5DTKA 5DF7A 1XPBA 2ZQDA 2Y2HA 3AGEA 3ZG5A 4CPKA 4KZAA 3G30A 1KGEA 4PM7A 1IYQA 4S2NA 5CEBA 3G4PA 4JXSA 3MZEA 5U47A 3CZDA 3TSGA 4EBLA 3WS1A 1HTZA 1LI0A 1RCJA 3A3IA 3SH7A 2XH9A 4OOLA 3Q81A 1S0WA 2ZQCA 4KQRA 4P85A 3ZNTA 2H5SA 5FAQA 1MXOA 2EX8A 4N9LA 1ES4A 2Y2JA 4FH4A 1FQGA 4IVIA 4HBUA 1FCNA 4WM9A 1HZOA 4YINA 5FSRA 3NC8A 4UA6A 4XUXA 2Y2GA 3NIAA 1XKZA 2VGJA 3LY3A 4QY6A 5EECA 5EOEA 4JXGA 3HLWA 4RA7A 2EX2A 3OPRA 3WWXA 3GR2A 1NXYA 4OVDA 1YM1A 1XGIA 2ZLYA 4JXWA 2HDQA 1BSGA 2JE5A 3ZVWA 1U60A 3G35A 2X01A 3ZG9B 4DE2A 2XDMA 3JYIA 4E3OA 2PBYA 3DW0A 2WGIA 3IH9A 4GOGA 4MLLA 2Y2PA 4OOMA 3M2KA 3RJUA 4E3LA 4YFMA 1LL9A 5AQ7A 3WRTA 1ALQA 4KZBA 3ITBA 3UO9A 5A92A 1JTGA 1YLTA 1W5DA 2WK0A 1YT4A 2PU4A 1N9BA 5CHMA 3FWLA 3UDXA 3V5MA 4K91A 1CI9A 3UE0A 3UN7A 4GDNA 3ZG8B 4P0MA 3WS4A 4L0LA 1CEGA 4LENA 2DCFA 5JYPA 4EBNA 5FQIA 2P74A 4PM8A 1IYOA 2ZC7A 4FH2A 3ZHHA 4BL2A 5E43A 4E3IA 2WKHA 1NRFA 3W8KA 2ZMAA 5E2GA 1MWRA 2XD5A 3FKVA 4UA9A 5FQ9A 1NJ4A 4E3JA 3HLGA 1MWUA 5DTTA 4HESA 3OCNA 1SKFA 3VFFA 4ZBEA 2X02A 4X69A 4QB8A 5GLDA 2EX6A 3M6BA 4R3JA 3SS5A 4ZDXA 2Y55A 1I2WA 1RGYA 5KMWA 1OMEA 4N1XA 2EXBA 3SS3A 1PWCA 5GHYA 3IWQA 4UA7A 5TR7A 1ZG6A 1LL5A 1MPLA 4GNUA 4FD8A 4Z9QA 4EBPA 1LHYA 1JWZA 2XK1A 2ZJ9A 3IF6C 4B4XA 4MNRA 4E6XA 5E2FA 2WZXA 4UHUA 4C6YA 5CGXA 2C6WB 3Q07A 4RVAA 3CJMA 3G2ZA 1W8QA 3NBLA 3VFHA 5KSCA 3W4PA 1YLJA 4KZ3A 4U0TA 5AQBA 4ID4A 1YQSA 1Z6FA 1TEMA 2HP6A 3TOIA 4JXVA 4OP8A 1DJAA 5AQAA 4QHCA 3C7UA 4BQMA 4QD4A 4DE0A 1IYSA 3AGDA 3C4PA 4LV3A 2J9PA 5GLAA 4Y0TA 4IBXA 2Z2LB 3UDIA 2XD1A 1MBLA 2ZM8A 3N8LA 4HEFA 3SOIA 1L0EA 3HREA 2JCHA 2RCXA 2WKEA 4JPMA 3O3VA 4KENB 3MBZA 5CHJA 4R23A 3DTMA 5E2HA 4JF6A 5HFOA 3S4XA 2J7VA 3FV7A 4PPRA 5I94A 4WZ5C 2R9WA 1HD8A 3EQVA 1M6KA 2XGNA 1IELA 1GA0A 2PU2A 1E4DA 3MZDA 5CXWA 2Q9MA 5KSHA 1GHMA 4XXRA 2HP5A 3N8SA 1EWZA 4GD6A 2QMIA 2IWBA 3BRMA 4DDYA 5DVAA 3IF5A 1K25A 2Y2MA 4X55A 3VP4A 3HLBA 4IBRA 4D2OA 4WEKA 2WAFA 5F82A 1W7FA 1XGJA 2IWCA 3NY4A 3SS4A 2OV5A 1ZKJA 4KQQA 3W4QA 3BLSA 5HL1A 5J8XA 1E25A 4KZ6A 1L2SA 1HVBA 5EVLA 4ZJ2A 2XFTA 5JYOA 4S2PA 1YLWA 3C5AA 5CGWA 1CI8A 1JVJA 5F83A 2OLVA 4S2JA 5GLCA 5TGFA 4JKTA 5FI2A 4FSFA 1LLBA 3ZFZA 1DJBA 1Q2PA 2QZ6A 1FR6A 2XLNA 1MWTA 1FCOA 4C3QA 1K55C 1KVLA 1XA1A 4KG2A 3BFDA 3Q7ZA 3VMAA 1L0FA 2ZD8A 1BZAA 2Z2MB 3Q7VA 4S2IA 3P98A 3MKEA 5CECA 5EE8A 4X68A 4MBKA 2ZM0A 4Y0OA 4MBHA 5FQQA 1PI5A 3CG5A 5A93A 4KG5A 3UPNA 4OH0A 2HP9A 5HAIA 3QNCA 4OONA 2ZC5B 4R4SA 1FSWA 1K54A 1KGFA 3C7VA 4ZTKA 5CTNA 2IWDA 2JC7A 2Y4AA 3DWKA 4MBFA 1BTLA 1WYBA 5EOOA 4X6TA 4P6BA 2P9VA 4R3BA 1JWPA 3IXDA 3BFFA 1AXBA 2UWXA 3HLDA 3QHYA 1YLPA 2ZC3B 3IQAA 5EPHA 4DKIA 1ES5A 4Q8IA 1KDWA 4E3NA 5EVIC 3PTEA 3HLEA 1ZG4A 2WUQA 5M1AA 4DXCA 1PI4A 3MFDA 3DWZA 1Q2QA 2H0YA 2WAEA 4X56A 5M19A 5DTSA 2WKIA 1NZUA 4JLFA 5CERA 1PZPA 3GMWA 2BG1A 4NETA 1SDEA 2A3UA 2HDUA 3BEBA 1GA9A 3O88A 5M18A 3UDFA 3GRJA 4RYEA 3V50A 4O7DA 3A3EA 1K4FA 3GSGA 4KZ7A 1YLZA 3BFCA 1EI5A 4GD8A 1VQQA 2VGKA 5F1FA 3UE1A 3GV9A
chains in the Genus database with same CATH superfamily
5EFWA 4F3LA 2O9BA 2NUTC 2G2UA 2ZQ7A 5A90A 1KOUA 1KDSA 4G3KA 3RXWA 1TS7A 1DJCA 4OKPA 3LUQA 4DF6A 2QJ5A 4MN7A 5DKLA 3OPLA 3NDEA 3QP6A 3KYEA 1K4EA 1ERQA 3ZG0A 3UB7A 4NXBA 1XFQA 4WL9A 2Y2LA 2M7VA 4EXOA 2FFFB 3MJQA 3OLOA 4AFIA 1C3BA 1BLCA 3UNWA 1YLYA 3GDIA 4BENA 5CTMA 1G68A 4DXBA 3EWKA 5EVIA 4LLOB 5FQJA 4GZBA 1QMEA 2J3TC 3VOLA 3MZFA 1VM1A 4S2MA 3MQOA 3S22A 2ACGA 5FAOA 3E2KA 3KSIA 3IF6B 1WYCA 5L2FA 2P9VB 3B47A 4MCWA 3ITAA 4BJPA 3GECA 4A5RA 3PAEA 3LEZA 1PZOA 4UQIM 3S7OA 3A3FA 3PYPA 4UAAA 3UY6A 3CAXA 2ZQAA 3M2JA 1P97A 2V2FF 3LEQA 3IBRA 1G6OA 4R1GA 5CHUA 4KZ9A 3BYDA 1K6SA 2NUPC 3VOYA 3WS2A 2QYBA 1OT6A 2O9AA 2PT7A 1YMSA 2ZBBA 1NRJA 1YSPA 3A0VA 2I9VA 1K57A 1RGZA 3UE6A 4B88A 1VEUB 3A0SA 5GL9A 3A3JA 3LI8A 1Y54A 4WBGA 4PKYA 2RL3A 1CK3A 2R9XA 3K3CA 1E3UA 1ESIA 1O7EA 3QP5A 3QNBA 3TRCA 4BD1A 5IS1A 2WADA 3PBOA 2K2NA 3NECA 5J7EA 3ZDJA 3IS2A 3VP0A 2J3TD 2XEPA 4IVKA 1YSQA 3F1NB 4HOIA 2ZC4B 2XSSA 1JTDA 2G2WA 1DP9A 2OLUA 2XR0A 3NI9A 1T1AA 5EUAA 1NZOA 4PKYG 2XFSA 5D3OA 3UB6A 2W3HA 3CUEA 2AVXA 4OPYA 3T4OA 4OLDA 3ZQ5A 5MC7A 1KE4A 4YOFA 5HWVA 2VX8A 1P9WA 3H82B 3P01A 2HPBA 5HAPA 4EQIA 3IXBA 5DF7A 1XPBA 2Y2HA 4CPKA 2JKRM 3DTKA 3MZEA 3CZDA 4EBLA 2FZ0A 3A3IA 1VHMA 1RCJA 4OOLA 4KQRA 1S66L 2H5SA 4O8GA 1ES4A 4FH4A 1LT0A 4IVIA 2VGJA 4QY6A 4JXGA 1XGIA 5HDDA 2ZLYA 4JXWA 3EOIA 2X01A 2PAVP 4DE2A 3C30A 2PBYA 4Y3IA 4YNRA 4MLLA 4OOMA 3WRTA 3T4SA 4KZBA 3ITBA 2P04A 2WK0A 2PU4A 1N9BA 4II7A 3FWLA 3V5MA 4Y17A 3ZG8B 3EEHA 3WS4A 4L0LA 2DCFA 4EBNA 3SZTA 5HDCA 4IJGA 5E43A 4E3IA 3E4PA 5FQ9A 4E3JA 1NLZA 3UB8A 1SKFA 4M4XA 2X02A 4QB8A 4E04A 2EXBA 3JVUA 1ZG6A 1TS6A 4GNUA 4EBPA 2ZJ9A 2WZXA 1LSVA 3ULFA 1W8QA 5HL6A 3VFHA 3W4PA 5AQBA 1Z6FA 3D9YA 3UMDA 2CMNA 3C7UA 4QHCA 4HQAA 4QD4A 3AGDA 5GLAA 1OTAA 4PHTA 2Z2LB 2JKFA 3SOIA 1MBLA 2PD8A 3N8LA 5CHJA 4ME4A 4EQ1A 5E2HA 4JF6A 3FV7A 4PPRA 2IA2A 3A0RA 1FIKA 5CXWA 1E4DA 2PU2A 3T4QA 3QP1A 2HP5A 3N8SA 1EWZA 1YAXA 5DVAA 3LIFA 4WEKA 2WAFA 5F82A 3SS4A 3NY4A 2GZAA 4KQQA 3BLSA 4R70A 4RQ9A 1GSWA 2M1CA 5AVEA 1YLWA 4IUHA 1CI8A 1V9YA 3ZFZA 3CITA 3BY8A 2QZ6A 2XLNA 1XA1A 2GX5A 3BFDA 3LR5A 3VMAA 4BWIA 1BZAA 2Z2MB 3MKEA 4MBHA 4B93A 4OONA 4Y15A 4JGOA 2O0YA 2JC7A 4MBFA 1BTLA 2R78A 2P9VA 4R3BA 1JWPA 3IQAA 4DKIA 5EPHA 1ES5A 2W0NA 4Q8IA 4E3NA 5EVIC 1XJ4A 3ICYA 1Q2QA 4H6JB 1NZUA 3GMWA 4NETA 2A3UA 3BEBA 3GRJA 3IX4A 2W3DA 3A3EA 3KYZA 4BBVA 3GSGA 4KZ7A 1VQQA 4ESPA 2PYPA 3UMEA 4WZ5A 1I2SA 3CMZA 1N4OA 1BULA 5J3WA 2EFUA 3BECA 3N8RA 4EWFA 5FAPA 1ERMA 1O07A 3AGFA 4JGPA 2OWHA 1JNUA 4GS9A 3EEAA 2W3FA 3LO7A 3T4KA 2ZOHA 1XP4A 3EQUA 3BQ8A 4OPZA 3VP2A 1VEUA 1S67L 4LV1A 3C2WA 1TVFA 1A0KA 2HDRA 3B33A 1FR1A 3FPWA 2ZOIA 4EU0A 3B3XA 3IHAA 5FL3A 4QJGA 3BWLA 1PW8A 1NYMA 2WGVA 2PDRA 1K57C 4CLCB 4EETB 2QPNA 3Q7VB 3HL9A 3OC2A 3W4OA 4MDZA 2I72A 3IX8A 5GHZA 1T1BA 2L4RA 3F1NA 5A91A 3ZCZA 5FASA 1IKIA 3VE4A 2Y79A 3FPVA 3K3DA 2OSUA 3R4KA 4EEPA 1KE0A 2XA7S 2HDSA 4KZ8A 5EVID 2VJWA 2E8IA 3HBRA 3NOUC 3U4LP 3PHYA 3ZG7B 3MS6A 3F1OB 4L9FA 2L0WA 3OPPA 4CJNA 2GDNA 4RX3A 1ZC2A 1DP8A 4HBTA 5FI6A 5GHXA 5F5YA 3H82A 1H8MA 4U0XA 1F2KA 2ZQ9A 3P09A 4BBTA 2OAP1 3O86A 3CUEC 5DF9A 2JHEA 4N92A 1T18A 3GQZA 2EX9A 3BM6A 5DJTA 1K56A 3T1SA 2FFYA 1PWDA 3E0YA 1JWVA 2PR5A 3PBTA 2WGWA 4H8RA 3VV4A 4GN2A 3O87A 2V1ZA 2J8YA 4E3MA 2VA0A 1TDGA 2J3WA 2ZM2A 3H7WB 5FDSA 4CLCE 2OOLA 4EEUA 4CLCC 1SHVA 4ZJ1A 2Y91A 4LRYC 4Y7PA 3PBQA 2G7UA 3ZGAB 5AJGA 1IEMA 4N1HA 4R6LA 1OTDA 5DF8A 4GB7A 3D3OA 3KSFA 1E3UD 2EXAA 5EVEA 5HAQA 2OWJA 3BW6A 5G4YA 2V8CA 3VOZA 3T1RA 1OPXA 4LPZA 2Y2NA 2PHYA 3MFXA 1MKMA 3F1PB 3UB5P 5LBRA 1N9OA 4R0QA 3LYXA 5EM0A 2CC1A 3Q1FA 1TDLA 1BLPA 2QJ7A 3BLMA 5IT5A 4GW9A 4PM5A 3MXRA 1F5MA 3LY4A 1G6AA 1WA9A 4MMNA 4UQIS 4S2NA 1IYQA 5CEBA 1VETB 4GCZA 3TSGA 4WN5A 5L09A 1LI0A 3SH7A 2XH9A 3Q81A 3QP8A 3CI6A 3ZNTA 4HJ3A 1MXOA 1FQGA 1FCNA 4HJ6A 1HZOA 4UA6A 4X1LA 1XKZA 4O01A 5EECA 5EOEA 3HLWA 2EX2A 3OPRA 4OVDA 1YM1A 2JE5A 4DJ2A 1U60A 3JYIA 3DW0A 3M2KA 3RJUA 1ALQA 2JN7A 3UO9A 2VLGA 5A92A 2J80A 4QPRA 1W5DA 5CHMA 1CI9A 3UE0A 4GDNA 2PD7A 4P0MA 1CEGA 5JYPA 1H0MA 4PM8A 4FH2A 4BL2A 2JKTM 2VGLM 5E2GA 2XD5A 4KQDA 2P7JA 1NJ4A 3HLGA 4HESA 3OCNA 3VFFA 4ZRRA 5GLDA 1TF1A 4H6JA 3SS5A 1OMEA 3VE3A 1OT9A 3UB9A 3IWQA 1MPLA 2BASA 2Q0OA 4FD8A 4Z9QA 2H28A 3RH8B 1PFLA 3IF6C 4EERA 3CPTB 4MNRA 3CWFA 5E2FA 4UHUA 4C6YA 4RVAA 3CJMA 3NBLA 4X25A 4U0TA 1YQSA 2XROA 1TEMA 4DJ3A 4DE0A 4IBXA 2VK3A 3UDIA 2XD1A 4HEFA 3MQ0A 3HREA 2JCHA 2RCXA 4KENB 4R23A 4DMZA 5I94A 1LSWA 4WZ5C 2R9WA 1IELA 2P08A 3MZDA 5KSHA 4XXRA 3S7PA 2V0WA 1SKOB 3BRMA 5HSQA 1K25A 2Y2MA 4X55A 3VP4A 3HLBA 5HL1A 5J8XA 1L2SA 1HVBA 5EVLA 4ZJ2A 5HWWA 4I39A 5F83A 5GLCA 4I38A 1Q2PA 1FR6A 4NEED 4L9EA 4KUOA 1FCOA 4C3QA 2QKPA 1N9NA 1D7EA 3Q7ZA 4CLCA 3CLOA 3Q7VA 4X68A 4Y0OA 1UGUA 1PI5A 2WKRA 2W27A 3UPNA 3QNCA 2ZC5B 4R4SA 1XJ6A 4WLAA 5CTNA 2Y4AA 5EOOA 4P6BA 3BQAA 2ZC3B 1XJ3A 1KDWA 4BMWA 3HLEA 2WUQA 2EA9A 1OTEA 3MFDA 2H0YA 4JLFA 5CERA 1PZPA 4IUKA 1GA9A 3E4OA 3T4LA 2V8FA 2LB9A 1EI5A 4I5SA 5F1FA 3GV9A 3KSHA 2Y59A 4OQHA 3LICA 4LCLA 5FA7A 4ZJ3A 3NULA 5J4EA 4GDBA 5IU1A 2V9AA 5G18A 1ONHA 3E2LA 2DNSA 3MMHA 3LGOA 3FYZA 5HX9A 4NXGA 4KUKA 3V3SA 1OTIA 3A3DA 3ZVTA 3V39A 3IBJA 1KGGA 2X71A 2Y2KA 2GNXA 3MSHA 1M40A 3W2ZA 3G34A 5K5BA 3G32A 2WZZA 5HWTA 1D1JA 3UPOA 3H7WA 2Y8HA 3RFBA 1IOUA 2VV6A 4XT2B 5FQMA 3WS5A 3V67A 4EESA 2JBFA 2Q9NA 3OCLA 3N6IA 4WMCD 3GVBA 1CQAA 2JKGA 1RP5A 3I7JA 4WZ4A 1PIOA 1KE3A 3BFEA 3EGDC 3TJZC 3BJNA 1VB6A 4BLMA 3LR4A 4WYYA 4PM6A 4JGQA 4Z1WA 4KG6A 5TBMB 5TFQA 4LRZE 2OAQ1 3CHWP 4HY8A 3IXHA 4NK3A 5F68A 3F1PA 3IH8A 1J9MA 3G2YA 2MJ6A 1Z09A 3LR3A 1DP6A 2D01A 2HJEA 4Q0IA 3QP4A 1YPRA 1TS0A 4GLQA 2WKQA 4U3TA 4Q0HA 3S7NA 4PM9A 1GCEA 4ZAMA 1STZA 3IF6A 3PBNA 1UWPX 2HZ5A 3VP3A 1LI9A 2HJ9C 2B18A 4HI4A 3FKWA 1PW1A 3OBFA 4LV2A 1H5XA 2Z6CA 1L0GA 1VETA 5CRFA 3T4TA 4DE1A 1CJFA 1S4RA 3N4IA 4KZ5A 5HZHA 1Y4OA 2E8JA 4D60A 4HH3A 3D4FA 4C75A 3V3RA 1FOFA 3SH9A 3MXSA 3HLFA 2B5RA 2UV0E 1N9LA 4DRTA 1ES3A 3MKFA 4S2NC 2ZL1B 1PWGA 1XJ2A 1ACFA 3HJIA 4UEYA 2WYXA 5FDHA 3R7WB 1NLYA 1K56D 4Y13A 4JF5A 3GTCA 1QMFA 1L0DA 1FILA 4ARZB 1ONGA 3RTYA 4WMCA 3PAGA 5BOHA 4JBFA 1SCWA 1K54C 2HGVA 3UE3A 1GHIA 1ZHHB 4EUZA 3LR0A 4RX2A 3BFGA 3M6HA 1BUEA 4KZ4A 4FTXA 2V20A 1FCMA 3HVFA 4K0WA 1XA7A 4OP5A 1XX2A 4BD0A 2GJ3A 3CPTA 3S7QA 3E98A 4LFUA 2HF6A 3MR0A 3C4OA 1K6RA 4G3VA 2DRWA 3HUOA 2A49A 4XUZA 4BL3A 1L3LA 1K38A 4WF0A 4IHQA 2Y2IA 4OPRA 3FZCA 4EV4A 4QWOA 5F6AA 4G3WA 1OJGA 3ZG5A 3G30A 1KGEA 4PM7A 3G4PA 4JXSA 3LIEA 3DTEA 1SZVA 3WS1A 1HTZA 2VV8A 4P85A 2WKPA 5FAQA 1SKOA 4HP4A 4R3AA 4HBUA 1ZTUA 4YINA 5FSRA 2Y2GA 3E4QA 3WWXA 2VEAA 2PYRA 3ZG9B 2XDMA 4GOGA 2Y2PA 1F98A 4E3LA 2KOIA 4YFMA 1JTGA 1YLTA 5HDSA 1YT4A 2KX6A 3UDXA 3UN7A 4P6ZM 5FQIA 2ZC7A 3ZHHA 3QP2A 2WKHA 3W8KA 2ZMAA 3K2NA 1MWRA 4O0PA 5DJUA 1MWUA 4ZBEA 2W3EA 4NKPA 2EX6A 3M6BA 4R3JA 4ZDXA 2Y55A 5KMWA 4GHIB 4NG2A 5TR7A 1JWZA 4MN5A 1YKDA 4B4XA 3PR6A 3LIBA 4NXEA 5G4ZA 5CGXA 3Q07A 3G2ZA 1LSXA 4KZ3A 1F9IA 3TOIA 4JXVA 1IFQA 1DJAA 4BQMA 3C4PA 4HH2A 2J9PA 2A24B 1CF0A 5HD5A 1L0EA 2V1AA 4JPMA 2WKEA 3MBZA 3DTMA 5HFOA 3DTIA 3EQVA 1HD8A 1M6KA 2XGNA 4CQHA 1GA0A 3P7NA 2QMIA 2W1TB 4IBRA 4D2OA 1XGJA 1ZKJA 3W4QA 2O99A 1E25A 4XT2A 4KZ6A 2XFTA 5JYOA 3G6OA 3C5AA 1PRQA 1JVJA 2JKRI 2OLVA 1G28A 4JKTA 5FI2A 1LLBA 2FH5A 1S4SA 4KG2A 1K55C 1KVLA 2LB5A 5C5KA 2ZD8A 4S2IA 2B02A 2ZM0A 5FQQA 3DAVA 1GSXA 3CG5A 5A93A 4OH0A 2HP9A 3MF0A 1FSWA 1K54A 1KGFA 3C7VA 2IWDA 5TBMA 4X6TA 3BFFA 1AXBA 2UWXA 3HLDA 3NOPC 3PTEA 4CLCD 5M1AA 4HP9A 5FEFA 1PI4A 3H9WA 4X56A 5M19A 5DTSA 2WKIA 4BBUA 2HDUA 2D02A 3V50A 4O7DA 3KO6A 3L9KA 1YLZA 3BFCA 2VGLS 4GD8A 2VGKA 5L07A 1OJ5A 3UE1A 4GS9B 3HCYA 3NOTC 3Q82A 3VSLA 1BLHA 3G31A 4LGWA 3OPHA 1BT5A 4PMAA 2VV7A 3IT9A 3S1YA 2PRFA 1W8YA 1H8YA 4E6WA 2ZMVA 2J9OA 2V0UA 1W63Q 4OLGA 1PYYA 3ISGA 4FCFA 1KVMA 1LL8A 4WEJA 3IHBA 4M3KA 5KZHA 5DFXA 4GKUA 2ZL1A 1W63M 1ESUA 1P0ZA 1PNEA 3OOVA 1WE4A 2ZQ8A 3R7WA 4OPQA 3ZYTA 3HUNA 4P87A 3WRZA 4JF4A 1S6RA 2L1MA 4OQ0A 1BLSA 2XF3A 1EW0A 4ARZA 4GJ4A 5EV0A 4N9KA 2EWVA 2Y2OA 3PXPA 3ZNYA 3SH8A 3RXXA 2ZC6B 5HARA 3PBRA 3IWOA 4Y0UA 1D06A 4QU3A 3PBSA 3HLCA 3JPUA 1MWSA 2QHKA 3HJKA 4F94A 5IHVA 1GHPA 4Y5FA 5CEDA 2BLSA 4Y2FA 1IYPA 5F1GA 3VP1A 3KSGA 3VSKA 3SW1A 5TJJA 1MC0A 2Z6DA 4I3JA 5CGSA 4R4RA 1DRMA 3F1OA 4F3LB 5FEGA 2C5WB 4LV0A 4EW7A 3LCEA 2WGWB 4K0XA 3TE8A 3HUMA 3WS0A 4QY5A 1SDNA 3NCKA 3N7WA 1CEFA 2VKSA 5FI7A 5E2EA 1NYYA 1MKIA 3NDGA 2QWSA 3KYQA 4HNBA 4LCMA 2EFXA 1J3WA 5KIZA 1W79A 1FSYA 3T1XA 3LIAA 2YKHA 5FATA 2ZMFA 4OQGA 1P9RA 3TG9A 4KQOA 1MY8A 4B4ZA 2XQZA 4S2LA 1EROA 5AQ9A 2H0TA 2W1RA 1Y28A 3KX0X 4OQIA 4PAUA 1YMXA 3EGXC 1K55A 5EVIB 5HW3A 2Y2QA 1H8ZA 5HD3A 1TD5A 4JGRA 3T4JA 2INWA 1K0KA 4B9OA 1T1CA 4X53A 2YKFA 1XXMA 4DE3A 4R38A 1IKGA 1DY6A 4S2OA 4GHIA 2K31A 1XFNA 4DDSA 3IXGA 4MEZA 1NY0A 4OOYA 1ES2A 3OZHA 3JVVA 5GLBA 3UPPA 3FG8A 4IEDA 1H3QA 4FOFA 2H10A 4WELA 5FQKA 2O9CA 1ODVA 1I5QA 3D72A 4WUJA 4S2KA 4E3KA 3IWIA 2A24A 4EUVA 4HIAA 1BYWA 5DTKA 2ZQDA 3AGEA 4KZAA 1MZUA 1S1YA 5U47A 3O5YA 3FC7A 1S0WA 2ZQCA 2EX8A 4N9LA 5L8MA 2Y2JA 2W1TA 4WM9A 4I3AA 4ETXA 3NC8A 4K08A 4XUXA 3NIAA 3LY3A 1TS8A 4NXFA 5F69A 4RA7A 2KDKA 3BY9A 1NXYA 3GR2A 3ZVWA 2HDQA 1BSGA 5L10A 1NWZA 3G35A 3T1QB 4E3OA 5HPIA 2WGIA 3IH9A 3L7HA 3LFVA 5DKKA 1LL9A 5AQ7A 2PR6A 1S1ZA 2DMWA 4X1MA 2V1BA 4K91A 3C8CA 5EM1A 4LENA 2B95A 2P74A 1IYOA 3IS2B 2BTFP 1NRFA 3C38A 4FUWA 1UWNX 3FKVA 4UA9A 2W3GA 3LIDA 4I3IA 5DTTA 3U2AA 4X69A 1G5UA 5A8BA 1I2WA 1RGYA 3DBAA 4N1XA 3SS3A 1PWCA 5GHYA 4UA7A 4MN6A 1LL5A 1AWIA 1LHYA 4HHDA 2XK1A 2A2LA 2XRNA 2VZWA 4LRXC 4E6XA 2C6WB 3IX3A 5KSCA 1YLJA 4ID4A 3MXQA 3NJAA 2HP6A 3NHQA 4OP8A 5AQAA 5I5LA 1IYSA 4Y0TA 4LV3A 5DFYA 2ZM8A 2HV1A 3O3VA 3S4XA 2J7VA 1GSVA 4ETZA 1X0OA 2Q9MA 1GHMA 4GD6A 2IWBA 3LI9A 4DDYA 1T19A 3IF5A 1W7FA 2IWCA 2OV5A 1V9ZA 4S2PA 5CGWA 5TGFA 4S2JA 4FSFA 2EWWA 2XA7M 3T12B 1DJBA 1MWTA 4HJ4A 4L9GA 5HPFA 1L0FA 3P98A 5CECA 5EE8A 3T50A 4MBKA 2M7UA 4KG5A 2K7SA 5HAIA 5AVFA 3TW8A 4ZTKA 3DWKA 1WYBA 3QHYA 3IXDA 2PBDP 1YLPA 4YWZA 1OTBA 4DXCA 1ZG4A 4DN0A 3DWZA 2WAEA 2BG1A 1SDEA 1HLUP 3O88A 3B42A 5M18A 3UDFA 4P6ZS 5CX7A 4RYEA 3MQQA 1K4FA 4Q0JA 2JKTI 2KLIA
chains in the Genus database with same CATH topology
4WZ5A 1I2SA 3CMZA 2Y59A 1N4OA 4OQHA 4LCLA 5FA7A 4ZJ3A 2G2UA 2ZQ7A 1BULA 3Q82A 5A90A 3VSLA 1BLHA 1KDSA 3G31A 3RXWA 4GDBA 1DJCA 2EFUA 4OKPA 3OPHA 3BECA 5G18A 1ONHA 3E2LA 2DNSA 4DF6A 3N8RA 1BT5A 4PMAA 4EWFA 3FYZA 3S1YA 3IT9A 5FAPA 5HX9A 1W8YA 1ERMA 1H8YA 1O07A 3OPLA 4E6WA 3V3SA 3NDEA 3AGFA 2J9OA 3A3DA 3ZVTA 4OLGA 1PYYA 3ISGA 1K4EA 3V39A 1KGGA 1KVMA 4FCFA 3LO7A 4WEJA 2X71A 1ERQA 2Y2KA 3IHBA 4M3KA 1XP4A 3ZG0A 1M40A 3EQUA 4OPZA 5KZHA 3VP2A 3G34A 4GKUA 4LV1A 1ESUA 3G32A 2WZZA 2Y2LA 3UPOA 1TVFA 1WE4A 2ZQ8A 2FFFB 4OPQA 3HUNA 4P87A 3WRZA 5FQMA 4JF4A 1C3BA 3WS5A 1BLCA 2HDRA 1S6RA 3UNWA 1FR1A 2JBFA 1YLYA 4OQ0A 2Q9NA 1BLSA 3OCLA 2XF3A 3B3XA 3IHAA 5CTMA 4BENA 1G68A 4QJGA 1PW8A 4DXBA 1NYMA 4N9KA 3N6IA 4WMCD 3GVBA 5EVIA 2WGVA 1RP5A 3I7JA 4WZ4A 1K57C 1PIOA 2Y2OA 5FQJA 1KE3A 2QPNA 3Q7VB 3HL9A 3OC2A 3BFEA 3W4OA 2I72A 4GZBA 3ZNYA 1QMEA 5GHZA 3SH8A 3MZFA 3RXXA 2ZC6B 5HARA 1VM1A 4S2MA 5A91A 3ZCZA 3PBRA 4BLMA 3IWOA 4WYYA 5FASA 4PM6A 1IKIA 4Y0UA 3S22A 4KG6A 5FAOA 3E2KA 4QU3A 2OSUA 3IF6B 1WYCA 3PBSA 5TFQA 1KE0A 2P9VB 5L2FA 3HLCA 2HDSA 4KZ8A 1MWSA 5EVID 3ITAA 2E8IA 3HBRA 3IXHA 4BJPA 4NK3A 4A5RA 4F94A 5IHVA 3IH8A 3ZG7B 1J9MA 3PAEA 1GHPA 5CEDA 3G2YA 2BLSA 3LEZA 1PZOA 3OPPA 4CJNA 3A3FA 2GDNA 4RX3A 4UAAA 1IYPA 3UY6A 1ZC2A 5F1GA 4U3TA 4HBTA 3VP1A 4PM9A 2ZQAA 3M2JA 1GCEA 4ZAMA 5FI6A 5GHXA 3VSKA 3IF6A 3PBNA 2V2FF 3VP3A 1LI9A 5CGSA 4R4RA 4U0XA 4R1GA 2ZQ9A 3FKWA 1PW1A 3P09A 2C5WB 3O86A 4LV0A 4LV2A 5CHUA 3LCEA 4KZ9A 2WGWB 3BYDA 1K6SA 3HUMA 4K0XA 3VOYA 5DF9A 3WS2A 1H5XA 1L0GA 3WS0A 4QY5A 5CRFA 1SDNA 4DE1A 4N92A 3NCKA 1YMSA 3N7WA 3N4IA 1CEFA 3GQZA 4KZ5A 2EX9A 3BM6A 5FI7A 5E2EA 1NYYA 1MKIA 1K56A 2FFYA 1PWDA 3NDGA 1JWVA 4LCMA 2EFXA 3D4FA 4C75A 1W79A 1FSYA 3V3RA 1FOFA 3SH9A 3PBTA 1K57A 3MXSA 1RGZA 2B5RA 2WGWA 3HLFA 4H8RA 4B88A 4GN2A 5FATA 4OQGA 4DRTA 5GL9A 1ES3A 3MKFA 3A3JA 2V1ZA 2J8YA 3O87A 4S2NC 3TG9A 1PWGA 4E3MA 4KQOA 1MY8A 1TDGA 1Y54A 4WBGA 2ZM2A 2WYXA 5FDHA 4B4ZA 2RL3A 1CK3A 2R9XA 1K56D 4JF5A 1E3UA 2XQZA 4S2LA 1EROA 1ESIA 1O7EA 2H0TA 1SHVA 1QMFA 3GTCA 4OQIA 5AQ9A 4ZJ1A 2Y91A 4Y7PA 3QNBA 1L0DA 1YMXA 3PBQA 1ONGA 4BD1A 1K55A 4WMCA 3PAGA 2WADA 3PBOA 5EVIB 5BOHA 4JBFA 5HW3A 2Y2QA 1H8ZA 1SCWA 3ZDJA 3ZGAB 1IEMA 3VP0A 4N1HA 1K54C 3UE3A 1GHIA 2XEPA 5DF8A 4IVKA 4GB7A 4X53A 4EUZA 1E3UD 2EXAA 5HAQA 1XXMA 4RX2A 4DE3A 2ZC4B 3BFGA 1IKGA 3M6HA 1BUEA 4KZ4A 1DY6A 1JTDA 2G2WA 4S2OA 3VOZA 2V20A 2OLUA 1FCMA 2Y2NA 2XR0A 3HVFA 4K0WA 1XA7A 3NI9A 4DDSA 4OP5A 3IXGA 1NZOA 4MEZA 5EUAA 1NY0A 1XX2A 4OOYA 4BD0A 1ES2A 2XFSA 4R0QA 5D3OA 3OZHA 5GLBA 2CC1A 3UPPA 4IEDA 2H10A 4OPYA 4WELA 3Q1FA 1TDLA 4OLDA 3C4OA 1K6RA 2DRWA 5FQKA 3HUOA 1KE4A 2A49A 1I5QA 4XUZA 1BLPA 4BL3A 4S2KA 3BLMA 4E3KA 1K38A 2HPBA 4PM5A 3MXRA 2Y2IA 4OPRA 3FZCA 3IWIA 5HAPA 4EQIA 4EV4A 3LY4A 1G6AA 3IXBA 5DTKA 5DF7A 1XPBA 2ZQDA 2Y2HA 3AGEA 3ZG5A 4CPKA 4KZAA 3G30A 1KGEA 4PM7A 1IYQA 4S2NA 5CEBA 3G4PA 4JXSA 3MZEA 5U47A 3CZDA 3TSGA 4EBLA 3WS1A 1HTZA 1LI0A 1RCJA 3A3IA 3SH7A 2XH9A 4OOLA 3Q81A 1S0WA 2ZQCA 4KQRA 4P85A 3ZNTA 2H5SA 5FAQA 1MXOA 2EX8A 4N9LA 1ES4A 2Y2JA 4FH4A 1FQGA 4IVIA 4HBUA 1FCNA 4WM9A 1HZOA 4YINA 5FSRA 3NC8A 4UA6A 4XUXA 2Y2GA 3NIAA 1XKZA 2VGJA 3LY3A 4QY6A 5EECA 5EOEA 4JXGA 3HLWA 4RA7A 2EX2A 3OPRA 3WWXA 3GR2A 1NXYA 4OVDA 1YM1A 1XGIA 2ZLYA 4JXWA 2HDQA 1BSGA 2JE5A 3ZVWA 1U60A 3G35A 2X01A 3ZG9B 4DE2A 2XDMA 3JYIA 4E3OA 2PBYA 3DW0A 2WGIA 3IH9A 4GOGA 4MLLA 2Y2PA 4OOMA 3M2KA 3RJUA 4E3LA 4YFMA 1LL9A 5AQ7A 3WRTA 1ALQA 4KZBA 3ITBA 3UO9A 5A92A 1JTGA 1YLTA 1W5DA 2WK0A 1YT4A 2PU4A 1N9BA 5CHMA 3FWLA 3UDXA 3V5MA 4K91A 1CI9A 3UE0A 3UN7A 4GDNA 3ZG8B 4P0MA 3WS4A 4L0LA 1CEGA 4LENA 2DCFA 5JYPA 4EBNA 5FQIA 2P74A 4PM8A 1IYOA 2ZC7A 4FH2A 3ZHHA 4BL2A 5E43A 4E3IA 2WKHA 1NRFA 3W8KA 2ZMAA 5E2GA 1MWRA 2XD5A 3FKVA 4UA9A 5FQ9A 1NJ4A 4E3JA 3HLGA 1MWUA 5DTTA 4HESA 3OCNA 1SKFA 3VFFA 4ZBEA 2X02A 4X69A 4QB8A 5GLDA 2EX6A 3M6BA 4R3JA 3SS5A 4ZDXA 2Y55A 1I2WA 1RGYA 5KMWA 1OMEA 4N1XA 2EXBA 3SS3A 1PWCA 5GHYA 3IWQA 4UA7A 5TR7A 1ZG6A 1LL5A 1MPLA 4GNUA 4FD8A 4Z9QA 4EBPA 1LHYA 1JWZA 2XK1A 2ZJ9A 3IF6C 4B4XA 4MNRA 4E6XA 5E2FA 2WZXA 4UHUA 4C6YA 5CGXA 2C6WB 3Q07A 4RVAA 3CJMA 3G2ZA 1W8QA 3NBLA 3VFHA 5KSCA 3W4PA 1YLJA 4KZ3A 4U0TA 5AQBA 4ID4A 1YQSA 1Z6FA 1TEMA 2HP6A 3TOIA 4JXVA 4OP8A 1DJAA 5AQAA 4QHCA 3C7UA 4BQMA 4QD4A 4DE0A 1IYSA 3AGDA 3C4PA 4LV3A 2J9PA 5GLAA 4Y0TA 4IBXA 2Z2LB 3UDIA 2XD1A 1MBLA 2ZM8A 3N8LA 4HEFA 3SOIA 1L0EA 3HREA 2JCHA 2RCXA 2WKEA 4JPMA 3O3VA 4KENB 3MBZA 5CHJA 4R23A 3DTMA 5E2HA 4JF6A 5HFOA 3S4XA 2J7VA 3FV7A 4PPRA 5I94A 4WZ5C 2R9WA 1HD8A 3EQVA 1M6KA 2XGNA 1IELA 1GA0A 2PU2A 1E4DA 3MZDA 5CXWA 2Q9MA 5KSHA 1GHMA 4XXRA 2HP5A 3N8SA 1EWZA 4GD6A 2QMIA 2IWBA 3BRMA 4DDYA 5DVAA 3IF5A 1K25A 2Y2MA 4X55A 3VP4A 3HLBA 4IBRA 4D2OA 4WEKA 2WAFA 5F82A 1W7FA 1XGJA 2IWCA 3NY4A 3SS4A 2OV5A 1ZKJA 4KQQA 3W4QA 3BLSA 5HL1A 5J8XA 1E25A 4KZ6A 1L2SA 1HVBA 5EVLA 4ZJ2A 2XFTA 5JYOA 4S2PA 1YLWA 3C5AA 5CGWA 1CI8A 1JVJA 5F83A 2OLVA 4S2JA 5GLCA 5TGFA 4JKTA 5FI2A 4FSFA 1LLBA 3ZFZA 1DJBA 1Q2PA 2QZ6A 1FR6A 2XLNA 1MWTA 1FCOA 4C3QA 1K55C 1KVLA 1XA1A 4KG2A 3BFDA 3Q7ZA 3VMAA 1L0FA 2ZD8A 1BZAA 2Z2MB 3Q7VA 4S2IA 3P98A 3MKEA 5CECA 5EE8A 4X68A 4MBKA 2ZM0A 4Y0OA 4MBHA 5FQQA 1PI5A 3CG5A 5A93A 4KG5A 3UPNA 4OH0A 2HP9A 5HAIA 3QNCA 4OONA 2ZC5B 4R4SA 1FSWA 1K54A 1KGFA 3C7VA 4ZTKA 5CTNA 2IWDA 2JC7A 2Y4AA 3DWKA 4MBFA 1BTLA 1WYBA 5EOOA 4X6TA 4P6BA 2P9VA 4R3BA 1JWPA 3IXDA 3BFFA 1AXBA 2UWXA 3HLDA 3QHYA 1YLPA 2ZC3B 3IQAA 5EPHA 4DKIA 1ES5A 4Q8IA 1KDWA 4E3NA 5EVIC 3PTEA 3HLEA 1ZG4A 2WUQA 5M1AA 4DXCA 1PI4A 3MFDA 3DWZA 1Q2QA 2H0YA 2WAEA 4X56A 5M19A 5DTSA 2WKIA 1NZUA 4JLFA 5CERA 1PZPA 3GMWA 2BG1A 4NETA 1SDEA 2A3UA 2HDUA 3BEBA 1GA9A 3O88A 5M18A 3UDFA 3GRJA 4RYEA 3V50A 4O7DA 3A3EA 1K4FA 3GSGA 4KZ7A 1YLZA 3BFCA 1EI5A 4GD8A 1VQQA 2VGKA 5F1FA 3UE1A 3GV9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WZ5 A;  1I2S A;  3CMZ A;  2Y59 A;  1N4O A;  4OQH A;  4LCL A;  5FA7 A;  4ZJ3 A;  2G2U A;  2ZQ7 A;  1BUL A;  3Q82 A;  5A90 A;  3VSL A;  1BLH A;  1KDS A;  3G31 A;  3RXW A;  4GDB A;  1DJC A;  2EFU A;  4OKP A;  3OPH A;  3BEC A;  5G18 A;  1ONH A;  3E2L A;  2DNS A;  4DF6 A;  3N8R A;  1BT5 A;  4PMA A;  4EWF A;  3FYZ A;  3S1Y A;  3IT9 A;  5FAP A;  5HX9 A;  1W8Y A;  1ERM A;  1H8Y A;  1O07 A;  3OPL A;  4E6W A;  3V3S A;  3NDE A;  3AGF A;  2J9O A;  3A3D A;  3ZVT A;  4OLG A;  1PYY A;  3ISG A;  1K4E A;  3V39 A;  1KGG A;  1KVM A;  4FCF A;  3LO7 A;  4WEJ A;  2X71 A;  1ERQ A;  2Y2K A;  3IHB A;  4M3K A;  1XP4 A;  3ZG0 A;  1M40 A;  3EQU A;  4OPZ A;  5KZH A;  3VP2 A;  3G34 A;  4GKU A;  4LV1 A;  1ESU A;  3G32 A;  2WZZ A;  2Y2L A;  3UPO A;  1TVF A;  1WE4 A;  2ZQ8 A;  2FFF B;  4OPQ A;  3HUN A;  4P87 A;  3WRZ A;  5FQM A;  4JF4 A;  1C3B A;  3WS5 A;  1BLC A;  2HDR A;  1S6R A;  3UNW A;  1FR1 A;  2JBF A;  1YLY A;  4OQ0 A;  2Q9N A;  1BLS A;  3OCL A;  2XF3 A;  3B3X A;  3IHA A;  5CTM A;  4BEN A;  1G68 A;  4QJG A;  1PW8 A;  4DXB A;  1NYM A;  4N9K A;  3N6I A;  4WMC D;  3GVB A;  5EVI A;  2WGV A;  1RP5 A;  3I7J A;  4WZ4 A;  1K57 C;  1PIO A;  2Y2O A;  5FQJ A;  1KE3 A;  2QPN A;  3Q7V B;  3HL9 A;  3OC2 A;  3BFE A;  3W4O A;  2I72 A;  4GZB A;  3ZNY A;  1QME A;  5GHZ A;  3SH8 A;  3MZF A;  3RXX A;  2ZC6 B;  5HAR A;  1VM1 A;  4S2M A;  5A91 A;  3ZCZ A;  3PBR A;  4BLM A;  3IWO A;  4WYY A;  5FAS A;  4PM6 A;  1IKI A;  4Y0U A;  3S22 A;  4KG6 A;  5FAO A;  3E2K A;  4QU3 A;  2OSU A;  3IF6 B;  1WYC A;  3PBS A;  5TFQ A;  1KE0 A;  2P9V B;  5L2F A;  3HLC A;  2HDS A;  4KZ8 A;  1MWS A;  5EVI D;  3ITA A;  2E8I A;  3HBR A;  3IXH A;  4BJP A;  4NK3 A;  4A5R A;  4F94 A;  5IHV A;  3IH8 A;  3ZG7 B;  1J9M A;  3PAE A;  1GHP A;  5CED A;  3G2Y A;  2BLS A;  3LEZ A;  1PZO A;  3OPP A;  4CJN A;  3A3F A;  2GDN A;  4RX3 A;  4UAA A;  1IYP A;  3UY6 A;  1ZC2 A;  5F1G A;  4U3T A;  4HBT A;  3VP1 A;  4PM9 A;  2ZQA A;  3M2J A;  1GCE A;  4ZAM A;  5FI6 A;  5GHX A;  3VSK A;  3IF6 A;  3PBN A;  2V2F F;  3VP3 A;  1LI9 A;  5CGS A;  4R4R A;  4U0X A;  4R1G A;  2ZQ9 A;  3FKW A;  1PW1 A;  3P09 A;  2C5W B;  3O86 A;  4LV0 A;  4LV2 A;  5CHU A;  3LCE A;  4KZ9 A;  2WGW B;  3BYD A;  1K6S A;  3HUM A;  4K0X A;  3VOY A;  5DF9 A;  3WS2 A;  1H5X A;  1L0G A;  3WS0 A;  4QY5 A;  5CRF A;  1SDN A;  4DE1 A;  4N92 A;  3NCK A;  1YMS A;  3N7W A;  3N4I A;  1CEF A;  3GQZ A;  4KZ5 A;  2EX9 A;  3BM6 A;  5FI7 A;  5E2E A;  1NYY A;  1MKI A;  1K56 A;  2FFY A;  1PWD A;  3NDG A;  1JWV A;  4LCM A;  2EFX A;  3D4F A;  4C75 A;  1W79 A;  1FSY A;  3V3R A;  1FOF A;  3SH9 A;  3PBT A;  1K57 A;  3MXS A;  1RGZ A;  2B5R A;  2WGW A;  3HLF A;  4H8R A;  4B88 A;  4GN2 A;  5FAT A;  4OQG A;  4DRT A;  5GL9 A;  1ES3 A;  3MKF A;  3A3J A;  2V1Z A;  2J8Y A;  3O87 A;  4S2N C;  3TG9 A;  1PWG A;  4E3M A;  4KQO A;  1MY8 A;  1TDG A;  1Y54 A;  4WBG A;  2ZM2 A;  2WYX A;  5FDH A;  4B4Z A;  2RL3 A;  1CK3 A;  2R9X A;  1K56 D;  4JF5 A;  1E3U A;  2XQZ A;  4S2L A;  1ERO A;  1ESI A;  1O7E A;  2H0T A;  1SHV A;  1QMF A;  3GTC A;  4OQI A;  5AQ9 A;  4ZJ1 A;  2Y91 A;  4Y7P A;  3QNB A;  1L0D A;  1YMX A;  3PBQ A;  1ONG A;  4BD1 A;  1K55 A;  4WMC A;  3PAG A;  2WAD A;  3PBO A;  5EVI B;  5BOH A;  4JBF A;  5HW3 A;  2Y2Q A;  1H8Z A;  1SCW A;  3ZDJ A;  3ZGA B;  1IEM A;  3VP0 A;  4N1H A;  1K54 C;  3UE3 A;  1GHI A;  2XEP A;  5DF8 A;  4IVK A;  4GB7 A;  4X53 A;  4EUZ A;  1E3U D;  2EXA A;  5HAQ A;  1XXM A;  4RX2 A;  4DE3 A;  2ZC4 B;  3BFG A;  1IKG A;  3M6H A;  1BUE A;  4KZ4 A;  1DY6 A;  1JTD A;  2G2W A;  4S2O A;  3VOZ A;  2V20 A;  2OLU A;  1FCM A;  2Y2N A;  2XR0 A;  3HVF A;  4K0W A;  1XA7 A;  3NI9 A;  4DDS A;  4OP5 A;  3IXG A;  1NZO A;  4MEZ A;  5EUA A;  1NY0 A;  1XX2 A;  4OOY A;  4BD0 A;  1ES2 A;  2XFS A;  4R0Q A;  5D3O A;  3OZH A;  5GLB A;  2CC1 A;  3UPP A;  4IED A;  2H10 A;  4OPY A;  4WEL A;  3Q1F A;  1TDL A;  4OLD A;  3C4O A;  1K6R A;  2DRW A;  5FQK A;  3HUO A;  1KE4 A;  2A49 A;  1I5Q A;  4XUZ A;  1BLP A;  4BL3 A;  4S2K A;  3BLM A;  4E3K A;  1K38 A;  2HPB A;  4PM5 A;  3MXR A;  2Y2I A;  4OPR A;  3FZC A;  3IWI A;  5HAP A;  4EQI A;  4EV4 A;  3LY4 A;  1G6A A;  3IXB A;  5DTK A;  5DF7 A;  1XPB A;  2ZQD A;  2Y2H A;  3AGE A;  3ZG5 A;  4CPK A;  4KZA A;  3G30 A;  1KGE A;  4PM7 A;  1IYQ A;  4S2N A;  5CEB A;  3G4P A;  4JXS A;  3MZE A;  5U47 A;  3CZD A;  3TSG A;  4EBL A;  3WS1 A;  1HTZ A;  1LI0 A;  1RCJ A;  3A3I A;  3SH7 A;  2XH9 A;  4OOL A;  3Q81 A;  1S0W A;  2ZQC A;  4KQR A;  4P85 A;  3ZNT A;  2H5S A;  5FAQ A;  1MXO A;  2EX8 A;  4N9L A;  1ES4 A;  2Y2J A;  4FH4 A;  1FQG A;  4IVI A;  4HBU A;  1FCN A;  4WM9 A;  1HZO A;  4YIN A;  5FSR A;  3NC8 A;  4UA6 A;  4XUX A;  2Y2G A;  3NIA A;  1XKZ A;  2VGJ A;  3LY3 A;  4QY6 A;  5EEC A;  5EOE A;  4JXG A;  3HLW A;  4RA7 A;  2EX2 A;  3OPR A;  3WWX A;  3GR2 A;  1NXY A;  4OVD A;  1YM1 A;  1XGI A;  2ZLY A;  4JXW A;  2HDQ A;  1BSG A;  2JE5 A;  3ZVW A;  1U60 A;  3G35 A;  2X01 A;  3ZG9 B;  4DE2 A;  2XDM A;  3JYI A;  4E3O A;  2PBY A;  3DW0 A;  2WGI A;  3IH9 A;  4GOG A;  4MLL A;  2Y2P A;  4OOM A;  3M2K A;  3RJU A;  4E3L A;  4YFM A;  1LL9 A;  5AQ7 A;  3WRT A;  1ALQ A;  4KZB A;  3ITB A;  3UO9 A;  5A92 A;  1JTG A;  1YLT A;  1W5D A;  2WK0 A;  1YT4 A;  2PU4 A;  1N9B A;  5CHM A;  3FWL A;  3UDX A;  3V5M A;  4K91 A;  1CI9 A;  3UE0 A;  3UN7 A;  4GDN A;  3ZG8 B;  4P0M A;  3WS4 A;  4L0L A;  1CEG A;  4LEN A;  2DCF A;  5JYP A;  4EBN A;  5FQI A;  2P74 A;  4PM8 A;  1IYO A;  2ZC7 A;  4FH2 A;  3ZHH A;  4BL2 A;  5E43 A;  4E3I A;  2WKH A;  1NRF A;  3W8K A;  2ZMA A;  5E2G A;  1MWR A;  2XD5 A;  3FKV A;  4UA9 A;  5FQ9 A;  1NJ4 A;  4E3J A;  3HLG A;  1MWU A;  5DTT A;  4HES A;  3OCN A;  1SKF A;  3VFF A;  4ZBE A;  2X02 A;  4X69 A;  4QB8 A;  5GLD A;  2EX6 A;  3M6B A;  4R3J A;  3SS5 A;  4ZDX A;  2Y55 A;  1I2W A;  1RGY A;  5KMW A;  1OME A;  4N1X A;  2EXB A;  3SS3 A;  1PWC A;  5GHY A;  3IWQ A;  4UA7 A;  5TR7 A;  1ZG6 A;  1LL5 A;  1MPL A;  4GNU A;  4FD8 A;  4Z9Q A;  4EBP A;  1LHY A;  1JWZ A;  2XK1 A;  2ZJ9 A;  3IF6 C;  4B4X A;  4MNR A;  4E6X A;  5E2F A;  2WZX A;  4UHU A;  4C6Y A;  5CGX A;  2C6W B;  3Q07 A;  4RVA A;  3CJM A;  3G2Z A;  1W8Q A;  3NBL A;  3VFH A;  5KSC A;  3W4P A;  1YLJ A;  4KZ3 A;  4U0T A;  5AQB A;  4ID4 A;  1YQS A;  1Z6F A;  1TEM A;  2HP6 A;  3TOI A;  4JXV A;  4OP8 A;  1DJA A;  5AQA A;  4QHC A;  3C7U A;  4BQM A;  4QD4 A;  4DE0 A;  1IYS A;  3AGD A;  3C4P A;  4LV3 A;  2J9P A;  5GLA A;  4Y0T A;  4IBX A;  2Z2L B;  3UDI A;  2XD1 A;  1MBL A;  2ZM8 A;  3N8L A;  4HEF A;  3SOI A;  1L0E A;  3HRE A;  2JCH A;  2RCX A;  2WKE A;  4JPM A;  3O3V A;  4KEN B;  3MBZ A;  5CHJ A;  4R23 A;  3DTM A;  5E2H A;  4JF6 A;  5HFO A;  3S4X A;  2J7V A;  3FV7 A;  4PPR A;  5I94 A;  4WZ5 C;  2R9W A;  1HD8 A;  3EQV A;  1M6K A;  2XGN A;  1IEL A;  1GA0 A;  2PU2 A;  1E4D A;  3MZD A;  5CXW A;  2Q9M A;  5KSH A;  1GHM A;  4XXR A;  2HP5 A;  3N8S A;  1EWZ A;  4GD6 A;  2QMI A;  2IWB A;  3BRM A;  4DDY A;  5DVA A;  3IF5 A;  1K25 A;  2Y2M A;  4X55 A;  3VP4 A;  3HLB A;  4IBR A;  4D2O A;  4WEK A;  2WAF A;  5F82 A;  1W7F A;  1XGJ A;  2IWC A;  3NY4 A;  3SS4 A;  2OV5 A;  1ZKJ A;  4KQQ A;  3W4Q A;  3BLS A;  5HL1 A;  5J8X A;  1E25 A;  4KZ6 A;  1L2S A;  1HVB A;  5EVL A;  4ZJ2 A;  2XFT A;  5JYO A;  4S2P A;  1YLW A;  3C5A A;  5CGW A;  1CI8 A;  1JVJ A;  5F83 A;  2OLV A;  4S2J A;  5GLC A;  5TGF A;  4JKT A;  5FI2 A;  4FSF A;  1LLB A;  3ZFZ A;  1DJB A;  1Q2P A;  2QZ6 A;  1FR6 A;  2XLN A;  1MWT A;  1FCO A;  4C3Q A;  1K55 C;  1KVL A;  1XA1 A;  4KG2 A;  3BFD A;  3Q7Z A;  3VMA A;  1L0F A;  2ZD8 A;  1BZA A;  2Z2M B;  3Q7V A;  4S2I A;  3P98 A;  3MKE A;  5CEC A;  5EE8 A;  4X68 A;  4MBK A;  2ZM0 A;  4Y0O A;  4MBH A;  5FQQ A;  1PI5 A;  3CG5 A;  5A93 A;  4KG5 A;  3UPN A;  4OH0 A;  2HP9 A;  5HAI A;  3QNC A;  4OON A;  2ZC5 B;  4R4S A;  1FSW A;  1K54 A;  1KGF A;  3C7V A;  4ZTK A;  5CTN A;  2IWD A;  2JC7 A;  2Y4A A;  3DWK A;  4MBF A;  1BTL A;  1WYB A;  5EOO A;  4X6T A;  4P6B A;  2P9V A;  4R3B A;  1JWP A;  3IXD A;  3BFF A;  1AXB A;  2UWX A;  3HLD A;  3QHY A;  1YLP A;  2ZC3 B;  3IQA A;  5EPH A;  4DKI A;  1ES5 A;  4Q8I A;  1KDW A;  4E3N A;  5EVI C;  3PTE A;  3HLE A;  1ZG4 A;  2WUQ A;  5M1A A;  4DXC A;  1PI4 A;  3MFD A;  3DWZ A;  1Q2Q A;  2H0Y A;  2WAE A;  4X56 A;  5M19 A;  5DTS A;  2WKI A;  1NZU A;  4JLF A;  5CER A;  1PZP A;  3GMW A;  2BG1 A;  4NET A;  1SDE A;  2A3U A;  2HDU A;  3BEB A;  1GA9 A;  3O88 A;  5M18 A;  3UDF A;  3GRJ A;  4RYE A;  3V50 A;  4O7D A;  3A3E A;  1K4F A;  3GSG A;  4KZ7 A;  1YLZ A;  3BFC A;  1EI5 A;  4GD8 A;  1VQQ A;  2VGK A;  5F1F A;  3UE1 A;  3GV9 A; 
#chains in the Genus database with same CATH topology
 5EFW A;  4F3L A;  2O9B A;  2NUT C;  2G2U A;  2ZQ7 A;  5A90 A;  1KOU A;  1KDS A;  4G3K A;  3RXW A;  1TS7 A;  1DJC A;  4OKP A;  3LUQ A;  4DF6 A;  2QJ5 A;  4MN7 A;  5DKL A;  3OPL A;  3NDE A;  3QP6 A;  3KYE A;  1K4E A;  1ERQ A;  3ZG0 A;  3UB7 A;  4NXB A;  1XFQ A;  4WL9 A;  2Y2L A;  2M7V A;  4EXO A;  2FFF B;  3MJQ A;  3OLO A;  4AFI A;  1C3B A;  1BLC A;  3UNW A;  1YLY A;  3GDI A;  4BEN A;  5CTM A;  1G68 A;  4DXB A;  3EWK A;  5EVI A;  4LLO B;  5FQJ A;  4GZB A;  1QME A;  2J3T C;  3VOL A;  3MZF A;  1VM1 A;  4S2M A;  3MQO A;  3S22 A;  2ACG A;  5FAO A;  3E2K A;  3KSI A;  3IF6 B;  1WYC A;  5L2F A;  2P9V B;  3B47 A;  4MCW A;  3ITA A;  4BJP A;  3GEC A;  4A5R A;  3PAE A;  3LEZ A;  1PZO A;  4UQI M;  3S7O A;  3A3F A;  3PYP A;  4UAA A;  3UY6 A;  3CAX A;  2ZQA A;  3M2J A;  1P97 A;  2V2F F;  3LEQ A;  3IBR A;  1G6O A;  4R1G A;  5CHU A;  4KZ9 A;  3BYD A;  1K6S A;  2NUP C;  3VOY A;  3WS2 A;  2QYB A;  1OT6 A;  2O9A A;  2PT7 A;  1YMS A;  2ZBB A;  1NRJ A;  1YSP A;  3A0V A;  2I9V A;  1K57 A;  1RGZ A;  3UE6 A;  4B88 A;  1VEU B;  3A0S A;  5GL9 A;  3A3J A;  3LI8 A;  1Y54 A;  4WBG A;  4PKY A;  2RL3 A;  1CK3 A;  2R9X A;  3K3C A;  1E3U A;  1ESI A;  1O7E A;  3QP5 A;  3QNB A;  3TRC A;  4BD1 A;  5IS1 A;  2WAD A;  3PBO A;  2K2N A;  3NEC A;  5J7E A;  3ZDJ A;  3IS2 A;  3VP0 A;  2J3T D;  2XEP A;  4IVK A;  1YSQ A;  3F1N B;  4HOI A;  2ZC4 B;  2XSS A;  1JTD A;  2G2W A;  1DP9 A;  2OLU A;  2XR0 A;  3NI9 A;  1T1A A;  5EUA A;  1NZO A;  4PKY G;  2XFS A;  5D3O A;  3UB6 A;  2W3H A;  3CUE A;  2AVX A;  4OPY A;  3T4O A;  4OLD A;  3ZQ5 A;  5MC7 A;  1KE4 A;  4YOF A;  5HWV A;  2VX8 A;  1P9W A;  3H82 B;  3P01 A;  2HPB A;  5HAP A;  4EQI A;  3IXB A;  5DF7 A;  1XPB A;  2Y2H A;  4CPK A;  2JKR M;  3DTK A;  3MZE A;  3CZD A;  4EBL A;  2FZ0 A;  3A3I A;  1VHM A;  1RCJ A;  4OOL A;  4KQR A;  1S66 L;  2H5S A;  4O8G A;  1ES4 A;  4FH4 A;  1LT0 A;  4IVI A;  2VGJ A;  4QY6 A;  4JXG A;  1XGI A;  5HDD A;  2ZLY A;  4JXW A;  3EOI A;  2X01 A;  2PAV P;  4DE2 A;  3C30 A;  2PBY A;  4Y3I A;  4YNR A;  4MLL A;  4OOM A;  3WRT A;  3T4S A;  4KZB A;  3ITB A;  2P04 A;  2WK0 A;  2PU4 A;  1N9B A;  4II7 A;  3FWL A;  3V5M A;  4Y17 A;  3ZG8 B;  3EEH A;  3WS4 A;  4L0L A;  2DCF A;  4EBN A;  3SZT A;  5HDC A;  4IJG A;  5E43 A;  4E3I A;  3E4P A;  5FQ9 A;  4E3J A;  1NLZ A;  3UB8 A;  1SKF A;  4M4X A;  2X02 A;  4QB8 A;  4E04 A;  2EXB A;  3JVU A;  1ZG6 A;  1TS6 A;  4GNU A;  4EBP A;  2ZJ9 A;  2WZX A;  1LSV A;  3ULF A;  1W8Q A;  5HL6 A;  3VFH A;  3W4P A;  5AQB A;  1Z6F A;  3D9Y A;  3UMD A;  2CMN A;  3C7U A;  4QHC A;  4HQA A;  4QD4 A;  3AGD A;  5GLA A;  1OTA A;  4PHT A;  2Z2L B;  2JKF A;  3SOI A;  1MBL A;  2PD8 A;  3N8L A;  5CHJ A;  4ME4 A;  4EQ1 A;  5E2H A;  4JF6 A;  3FV7 A;  4PPR A;  2IA2 A;  3A0R A;  1FIK A;  5CXW A;  1E4D A;  2PU2 A;  3T4Q A;  3QP1 A;  2HP5 A;  3N8S A;  1EWZ A;  1YAX A;  5DVA A;  3LIF A;  4WEK A;  2WAF A;  5F82 A;  3SS4 A;  3NY4 A;  2GZA A;  4KQQ A;  3BLS A;  4R70 A;  4RQ9 A;  1GSW A;  2M1C A;  5AVE A;  1YLW A;  4IUH A;  1CI8 A;  1V9Y A;  3ZFZ A;  3CIT A;  3BY8 A;  2QZ6 A;  2XLN A;  1XA1 A;  2GX5 A;  3BFD A;  3LR5 A;  3VMA A;  4BWI A;  1BZA A;  2Z2M B;  3MKE A;  4MBH A;  4B93 A;  4OON A;  4Y15 A;  4JGO A;  2O0Y A;  2JC7 A;  4MBF A;  1BTL A;  2R78 A;  2P9V A;  4R3B A;  1JWP A;  3IQA A;  4DKI A;  5EPH A;  1ES5 A;  2W0N A;  4Q8I A;  4E3N A;  5EVI C;  1XJ4 A;  3ICY A;  1Q2Q A;  4H6J B;  1NZU A;  3GMW A;  4NET A;  2A3U A;  3BEB A;  3GRJ A;  3IX4 A;  2W3D A;  3A3E A;  3KYZ A;  4BBV A;  3GSG A;  4KZ7 A;  1VQQ A;  4ESP A;  2PYP A;  3UME A;  4WZ5 A;  1I2S A;  3CMZ A;  1N4O A;  1BUL A;  5J3W A;  2EFU A;  3BEC A;  3N8R A;  4EWF A;  5FAP A;  1ERM A;  1O07 A;  3AGF A;  4JGP A;  2OWH A;  1JNU A;  4GS9 A;  3EEA A;  2W3F A;  3LO7 A;  3T4K A;  2ZOH A;  1XP4 A;  3EQU A;  3BQ8 A;  4OPZ A;  3VP2 A;  1VEU A;  1S67 L;  4LV1 A;  3C2W A;  1TVF A;  1A0K A;  2HDR A;  3B33 A;  1FR1 A;  3FPW A;  2ZOI A;  4EU0 A;  3B3X A;  3IHA A;  5FL3 A;  4QJG A;  3BWL A;  1PW8 A;  1NYM A;  2WGV A;  2PDR A;  1K57 C;  4CLC B;  4EET B;  2QPN A;  3Q7V B;  3HL9 A;  3OC2 A;  3W4O A;  4MDZ A;  2I72 A;  3IX8 A;  5GHZ A;  1T1B A;  2L4R A;  3F1N A;  5A91 A;  3ZCZ A;  5FAS A;  1IKI A;  3VE4 A;  2Y79 A;  3FPV A;  3K3D A;  2OSU A;  3R4K A;  4EEP A;  1KE0 A;  2XA7 S;  2HDS A;  4KZ8 A;  5EVI D;  2VJW A;  2E8I A;  3HBR A;  3NOU C;  3U4L P;  3PHY A;  3ZG7 B;  3MS6 A;  3F1O B;  4L9F A;  2L0W A;  3OPP A;  4CJN A;  2GDN A;  4RX3 A;  1ZC2 A;  1DP8 A;  4HBT A;  5FI6 A;  5GHX A;  5F5Y A;  3H82 A;  1H8M A;  4U0X A;  1F2K A;  2ZQ9 A;  3P09 A;  4BBT A;  2OAP 1;  3O86 A;  3CUE C;  5DF9 A;  2JHE A;  4N92 A;  1T18 A;  3GQZ A;  2EX9 A;  3BM6 A;  5DJT A;  1K56 A;  3T1S A;  2FFY A;  1PWD A;  3E0Y A;  1JWV A;  2PR5 A;  3PBT A;  2WGW A;  4H8R A;  3VV4 A;  4GN2 A;  3O87 A;  2V1Z A;  2J8Y A;  4E3M A;  2VA0 A;  1TDG A;  2J3W A;  2ZM2 A;  3H7W B;  5FDS A;  4CLC E;  2OOL A;  4EEU A;  4CLC C;  1SHV A;  4ZJ1 A;  2Y91 A;  4LRY C;  4Y7P A;  3PBQ A;  2G7U A;  3ZGA B;  5AJG A;  1IEM A;  4N1H A;  4R6L A;  1OTD A;  5DF8 A;  4GB7 A;  3D3O A;  3KSF A;  1E3U D;  2EXA A;  5EVE A;  5HAQ A;  2OWJ A;  3BW6 A;  5G4Y A;  2V8C A;  3VOZ A;  3T1R A;  1OPX A;  4LPZ A;  2Y2N A;  2PHY A;  3MFX A;  1MKM A;  3F1P B;  3UB5 P;  5LBR A;  1N9O A;  4R0Q A;  3LYX A;  5EM0 A;  2CC1 A;  3Q1F A;  1TDL A;  1BLP A;  2QJ7 A;  3BLM A;  5IT5 A;  4GW9 A;  4PM5 A;  3MXR A;  1F5M A;  3LY4 A;  1G6A A;  1WA9 A;  4MMN A;  4UQI S;  4S2N A;  1IYQ A;  5CEB A;  1VET B;  4GCZ A;  3TSG A;  4WN5 A;  5L09 A;  1LI0 A;  3SH7 A;  2XH9 A;  3Q81 A;  3QP8 A;  3CI6 A;  3ZNT A;  4HJ3 A;  1MXO A;  1FQG A;  1FCN A;  4HJ6 A;  1HZO A;  4UA6 A;  4X1L A;  1XKZ A;  4O01 A;  5EEC A;  5EOE A;  3HLW A;  2EX2 A;  3OPR A;  4OVD A;  1YM1 A;  2JE5 A;  4DJ2 A;  1U60 A;  3JYI A;  3DW0 A;  3M2K A;  3RJU A;  1ALQ A;  2JN7 A;  3UO9 A;  2VLG A;  5A92 A;  2J80 A;  4QPR A;  1W5D A;  5CHM A;  1CI9 A;  3UE0 A;  4GDN A;  2PD7 A;  4P0M A;  1CEG A;  5JYP A;  1H0M A;  4PM8 A;  4FH2 A;  4BL2 A;  2JKT M;  2VGL M;  5E2G A;  2XD5 A;  4KQD A;  2P7J A;  1NJ4 A;  3HLG A;  4HES A;  3OCN A;  3VFF A;  4ZRR A;  5GLD A;  1TF1 A;  4H6J A;  3SS5 A;  1OME A;  3VE3 A;  1OT9 A;  3UB9 A;  3IWQ A;  1MPL A;  2BAS A;  2Q0O A;  4FD8 A;  4Z9Q A;  2H28 A;  3RH8 B;  1PFL A;  3IF6 C;  4EER A;  3CPT B;  4MNR A;  3CWF A;  5E2F A;  4UHU A;  4C6Y A;  4RVA A;  3CJM A;  3NBL A;  4X25 A;  4U0T A;  1YQS A;  2XRO A;  1TEM A;  4DJ3 A;  4DE0 A;  4IBX A;  2VK3 A;  3UDI A;  2XD1 A;  4HEF A;  3MQ0 A;  3HRE A;  2JCH A;  2RCX A;  4KEN B;  4R23 A;  4DMZ A;  5I94 A;  1LSW A;  4WZ5 C;  2R9W A;  1IEL A;  2P08 A;  3MZD A;  5KSH A;  4XXR A;  3S7P A;  2V0W A;  1SKO B;  3BRM A;  5HSQ A;  1K25 A;  2Y2M A;  4X55 A;  3VP4 A;  3HLB A;  5HL1 A;  5J8X A;  1L2S A;  1HVB A;  5EVL A;  4ZJ2 A;  5HWW A;  4I39 A;  5F83 A;  5GLC A;  4I38 A;  1Q2P A;  1FR6 A;  4NEE D;  4L9E A;  4KUO A;  1FCO A;  4C3Q A;  2QKP A;  1N9N A;  1D7E A;  3Q7Z A;  4CLC A;  3CLO A;  3Q7V A;  4X68 A;  4Y0O A;  1UGU A;  1PI5 A;  2WKR A;  2W27 A;  3UPN A;  3QNC A;  2ZC5 B;  4R4S A;  1XJ6 A;  4WLA A;  5CTN A;  2Y4A A;  5EOO A;  4P6B A;  3BQA A;  2ZC3 B;  1XJ3 A;  1KDW A;  4BMW A;  3HLE A;  2WUQ A;  2EA9 A;  1OTE A;  3MFD A;  2H0Y A;  4JLF A;  5CER A;  1PZP A;  4IUK A;  1GA9 A;  3E4O A;  3T4L A;  2V8F A;  2LB9 A;  1EI5 A;  4I5S A;  5F1F A;  3GV9 A;  3KSH A;  2Y59 A;  4OQH A;  3LIC A;  4LCL A;  5FA7 A;  4ZJ3 A;  3NUL A;  5J4E A;  4GDB A;  5IU1 A;  2V9A A;  5G18 A;  1ONH A;  3E2L A;  2DNS A;  3MMH A;  3LGO A;  3FYZ A;  5HX9 A;  4NXG A;  4KUK A;  3V3S A;  1OTI A;  3A3D A;  3ZVT A;  3V39 A;  3IBJ A;  1KGG A;  2X71 A;  2Y2K A;  2GNX A;  3MSH A;  1M40 A;  3W2Z A;  3G34 A;  5K5B A;  3G32 A;  2WZZ A;  5HWT A;  1D1J A;  3UPO A;  3H7W A;  2Y8H A;  3RFB A;  1IOU A;  2VV6 A;  4XT2 B;  5FQM A;  3WS5 A;  3V67 A;  4EES A;  2JBF A;  2Q9N A;  3OCL A;  3N6I A;  4WMC D;  3GVB A;  1CQA A;  2JKG A;  1RP5 A;  3I7J A;  4WZ4 A;  1PIO A;  1KE3 A;  3BFE A;  3EGD C;  3TJZ C;  3BJN A;  1VB6 A;  4BLM A;  3LR4 A;  4WYY A;  4PM6 A;  4JGQ A;  4Z1W A;  4KG6 A;  5TBM B;  5TFQ A;  4LRZ E;  2OAQ 1;  3CHW P;  4HY8 A;  3IXH A;  4NK3 A;  5F68 A;  3F1P A;  3IH8 A;  1J9M A;  3G2Y A;  2MJ6 A;  1Z09 A;  3LR3 A;  1DP6 A;  2D01 A;  2HJE A;  4Q0I A;  3QP4 A;  1YPR A;  1TS0 A;  4GLQ A;  2WKQ A;  4U3T A;  4Q0H A;  3S7N A;  4PM9 A;  1GCE A;  4ZAM A;  1STZ A;  3IF6 A;  3PBN A;  1UWP X;  2HZ5 A;  3VP3 A;  1LI9 A;  2HJ9 C;  2B18 A;  4HI4 A;  3FKW A;  1PW1 A;  3OBF A;  4LV2 A;  1H5X A;  2Z6C A;  1L0G A;  1VET A;  5CRF A;  3T4T A;  4DE1 A;  1CJF A;  1S4R A;  3N4I A;  4KZ5 A;  5HZH A;  1Y4O A;  2E8J A;  4D60 A;  4HH3 A;  3D4F A;  4C75 A;  3V3R A;  1FOF A;  3SH9 A;  3MXS A;  3HLF A;  2B5R A;  2UV0 E;  1N9L A;  4DRT A;  1ES3 A;  3MKF A;  4S2N C;  2ZL1 B;  1PWG A;  1XJ2 A;  1ACF A;  3HJI A;  4UEY A;  2WYX A;  5FDH A;  3R7W B;  1NLY A;  1K56 D;  4Y13 A;  4JF5 A;  3GTC A;  1QMF A;  1L0D A;  1FIL A;  4ARZ B;  1ONG A;  3RTY A;  4WMC A;  3PAG A;  5BOH A;  4JBF A;  1SCW A;  1K54 C;  2HGV A;  3UE3 A;  1GHI A;  1ZHH B;  4EUZ A;  3LR0 A;  4RX2 A;  3BFG A;  3M6H A;  1BUE A;  4KZ4 A;  4FTX A;  2V20 A;  1FCM A;  3HVF A;  4K0W A;  1XA7 A;  4OP5 A;  1XX2 A;  4BD0 A;  2GJ3 A;  3CPT A;  3S7Q A;  3E98 A;  4LFU A;  2HF6 A;  3MR0 A;  3C4O A;  1K6R A;  4G3V A;  2DRW A;  3HUO A;  2A49 A;  4XUZ A;  4BL3 A;  1L3L A;  1K38 A;  4WF0 A;  4IHQ A;  2Y2I A;  4OPR A;  3FZC A;  4EV4 A;  4QWO A;  5F6A A;  4G3W A;  1OJG A;  3ZG5 A;  3G30 A;  1KGE A;  4PM7 A;  3G4P A;  4JXS A;  3LIE A;  3DTE A;  1SZV A;  3WS1 A;  1HTZ A;  2VV8 A;  4P85 A;  2WKP A;  5FAQ A;  1SKO A;  4HP4 A;  4R3A A;  4HBU A;  1ZTU A;  4YIN A;  5FSR A;  2Y2G A;  3E4Q A;  3WWX A;  2VEA A;  2PYR A;  3ZG9 B;  2XDM A;  4GOG A;  2Y2P A;  1F98 A;  4E3L A;  2KOI A;  4YFM A;  1JTG A;  1YLT A;  5HDS A;  1YT4 A;  2KX6 A;  3UDX A;  3UN7 A;  4P6Z M;  5FQI A;  2ZC7 A;  3ZHH A;  3QP2 A;  2WKH A;  3W8K A;  2ZMA A;  3K2N A;  1MWR A;  4O0P A;  5DJU A;  1MWU A;  4ZBE A;  2W3E A;  4NKP A;  2EX6 A;  3M6B A;  4R3J A;  4ZDX A;  2Y55 A;  5KMW A;  4GHI B;  4NG2 A;  5TR7 A;  1JWZ A;  4MN5 A;  1YKD A;  4B4X A;  3PR6 A;  3LIB A;  4NXE A;  5G4Z A;  5CGX A;  3Q07 A;  3G2Z A;  1LSX A;  4KZ3 A;  1F9I A;  3TOI A;  4JXV A;  1IFQ A;  1DJA A;  4BQM A;  3C4P A;  4HH2 A;  2J9P A;  2A24 B;  1CF0 A;  5HD5 A;  1L0E A;  2V1A A;  4JPM A;  2WKE A;  3MBZ A;  3DTM A;  5HFO A;  3DTI A;  3EQV A;  1HD8 A;  1M6K A;  2XGN A;  4CQH A;  1GA0 A;  3P7N A;  2QMI A;  2W1T B;  4IBR A;  4D2O A;  1XGJ A;  1ZKJ A;  3W4Q A;  2O99 A;  1E25 A;  4XT2 A;  4KZ6 A;  2XFT A;  5JYO A;  3G6O A;  3C5A A;  1PRQ A;  1JVJ A;  2JKR I;  2OLV A;  1G28 A;  4JKT A;  5FI2 A;  1LLB A;  2FH5 A;  1S4S A;  4KG2 A;  1K55 C;  1KVL A;  2LB5 A;  5C5K A;  2ZD8 A;  4S2I A;  2B02 A;  2ZM0 A;  5FQQ A;  3DAV A;  1GSX A;  3CG5 A;  5A93 A;  4OH0 A;  2HP9 A;  3MF0 A;  1FSW A;  1K54 A;  1KGF A;  3C7V A;  2IWD A;  5TBM A;  4X6T A;  3BFF A;  1AXB A;  2UWX A;  3HLD A;  3NOP C;  3PTE A;  4CLC D;  5M1A A;  4HP9 A;  5FEF A;  1PI4 A;  3H9W A;  4X56 A;  5M19 A;  5DTS A;  2WKI A;  4BBU A;  2HDU A;  2D02 A;  3V50 A;  4O7D A;  3KO6 A;  3L9K A;  1YLZ A;  3BFC A;  2VGL S;  4GD8 A;  2VGK A;  5L07 A;  1OJ5 A;  3UE1 A;  4GS9 B;  3HCY A;  3NOT C;  3Q82 A;  3VSL A;  1BLH A;  3G31 A;  4LGW A;  3OPH A;  1BT5 A;  4PMA A;  2VV7 A;  3IT9 A;  3S1Y A;  2PRF A;  1W8Y A;  1H8Y A;  4E6W A;  2ZMV A;  2J9O A;  2V0U A;  1W63 Q;  4OLG A;  1PYY A;  3ISG A;  4FCF A;  1KVM A;  1LL8 A;  4WEJ A;  3IHB A;  4M3K A;  5KZH A;  5DFX A;  4GKU A;  2ZL1 A;  1W63 M;  1ESU A;  1P0Z A;  1PNE A;  3OOV A;  1WE4 A;  2ZQ8 A;  3R7W A;  4OPQ A;  3ZYT A;  3HUN A;  4P87 A;  3WRZ A;  4JF4 A;  1S6R A;  2L1M A;  4OQ0 A;  1BLS A;  2XF3 A;  1EW0 A;  4ARZ A;  4GJ4 A;  5EV0 A;  4N9K A;  2EWV A;  2Y2O A;  3PXP A;  3ZNY A;  3SH8 A;  3RXX A;  2ZC6 B;  5HAR A;  3PBR A;  3IWO A;  4Y0U A;  1D06 A;  4QU3 A;  3PBS A;  3HLC A;  3JPU A;  1MWS A;  2QHK A;  3HJK A;  4F94 A;  5IHV A;  1GHP A;  4Y5F A;  5CED A;  2BLS A;  4Y2F A;  1IYP A;  5F1G A;  3VP1 A;  3KSG A;  3VSK A;  3SW1 A;  5TJJ A;  1MC0 A;  2Z6D A;  4I3J A;  5CGS A;  4R4R A;  1DRM A;  3F1O A;  4F3L B;  5FEG A;  2C5W B;  4LV0 A;  4EW7 A;  3LCE A;  2WGW B;  4K0X A;  3TE8 A;  3HUM A;  3WS0 A;  4QY5 A;  1SDN A;  3NCK A;  3N7W A;  1CEF A;  2VKS A;  5FI7 A;  5E2E A;  1NYY A;  1MKI A;  3NDG A;  2QWS A;  3KYQ A;  4HNB A;  4LCM A;  2EFX A;  1J3W A;  5KIZ A;  1W79 A;  1FSY A;  3T1X A;  3LIA A;  2YKH A;  5FAT A;  2ZMF A;  4OQG A;  1P9R A;  3TG9 A;  4KQO A;  1MY8 A;  4B4Z A;  2XQZ A;  4S2L A;  1ERO A;  5AQ9 A;  2H0T A;  2W1R A;  1Y28 A;  3KX0 X;  4OQI A;  4PAU A;  1YMX A;  3EGX C;  1K55 A;  5EVI B;  5HW3 A;  2Y2Q A;  1H8Z A;  5HD3 A;  1TD5 A;  4JGR A;  3T4J A;  2INW A;  1K0K A;  4B9O A;  1T1C A;  4X53 A;  2YKF A;  1XXM A;  4DE3 A;  4R38 A;  1IKG A;  1DY6 A;  4S2O A;  4GHI A;  2K31 A;  1XFN A;  4DDS A;  3IXG A;  4MEZ A;  1NY0 A;  4OOY A;  1ES2 A;  3OZH A;  3JVV A;  5GLB A;  3UPP A;  3FG8 A;  4IED A;  1H3Q A;  4FOF A;  2H10 A;  4WEL A;  5FQK A;  2O9C A;  1ODV A;  1I5Q A;  3D72 A;  4WUJ A;  4S2K A;  4E3K A;  3IWI A;  2A24 A;  4EUV A;  4HIA A;  1BYW A;  5DTK A;  2ZQD A;  3AGE A;  4KZA A;  1MZU A;  1S1Y A;  5U47 A;  3O5Y A;  3FC7 A;  1S0W A;  2ZQC A;  2EX8 A;  4N9L A;  5L8M A;  2Y2J A;  2W1T A;  4WM9 A;  4I3A A;  4ETX A;  3NC8 A;  4K08 A;  4XUX A;  3NIA A;  3LY3 A;  1TS8 A;  4NXF A;  5F69 A;  4RA7 A;  2KDK A;  3BY9 A;  1NXY A;  3GR2 A;  3ZVW A;  2HDQ A;  1BSG A;  5L10 A;  1NWZ A;  3G35 A;  3T1Q B;  4E3O A;  5HPI A;  2WGI A;  3IH9 A;  3L7H A;  3LFV A;  5DKK A;  1LL9 A;  5AQ7 A;  2PR6 A;  1S1Z A;  2DMW A;  4X1M A;  2V1B A;  4K91 A;  3C8C A;  5EM1 A;  4LEN A;  2B95 A;  2P74 A;  1IYO A;  3IS2 B;  2BTF P;  1NRF A;  3C38 A;  4FUW A;  1UWN X;  3FKV A;  4UA9 A;  2W3G A;  3LID A;  4I3I A;  5DTT A;  3U2A A;  4X69 A;  1G5U A;  5A8B A;  1I2W A;  1RGY A;  3DBA A;  4N1X A;  3SS3 A;  1PWC A;  5GHY A;  4UA7 A;  4MN6 A;  1LL5 A;  1AWI A;  1LHY A;  4HHD A;  2XK1 A;  2A2L A;  2XRN A;  2VZW A;  4LRX C;  4E6X A;  2C6W B;  3IX3 A;  5KSC A;  1YLJ A;  4ID4 A;  3MXQ A;  3NJA A;  2HP6 A;  3NHQ A;  4OP8 A;  5AQA A;  5I5L A;  1IYS A;  4Y0T A;  4LV3 A;  5DFY A;  2ZM8 A;  2HV1 A;  3O3V A;  3S4X A;  2J7V A;  1GSV A;  4ETZ A;  1X0O A;  2Q9M A;  1GHM A;  4GD6 A;  2IWB A;  3LI9 A;  4DDY A;  1T19 A;  3IF5 A;  1W7F A;  2IWC A;  2OV5 A;  1V9Z A;  4S2P A;  5CGW A;  5TGF A;  4S2J A;  4FSF A;  2EWW A;  2XA7 M;  3T12 B;  1DJB A;  1MWT A;  4HJ4 A;  4L9G A;  5HPF A;  1L0F A;  3P98 A;  5CEC A;  5EE8 A;  3T50 A;  4MBK A;  2M7U A;  4KG5 A;  2K7S A;  5HAI A;  5AVF A;  3TW8 A;  4ZTK A;  3DWK A;  1WYB A;  3QHY A;  3IXD A;  2PBD P;  1YLP A;  4YWZ A;  1OTB A;  4DXC A;  1ZG4 A;  4DN0 A;  3DWZ A;  2WAE A;  2BG1 A;  1SDE A;  1HLU P;  3O88 A;  3B42 A;  5M18 A;  3UDF A;  4P6Z S;  5CX7 A;  4RYE A;  3MQQ A;  1K4F A;  4Q0J A;  2JKT I;  2KLI A; 
#chains in the Genus database with same CATH homology
 4WZ5 A;  1I2S A;  3CMZ A;  2Y59 A;  1N4O A;  4OQH A;  4LCL A;  5FA7 A;  4ZJ3 A;  2G2U A;  2ZQ7 A;  1BUL A;  3Q82 A;  5A90 A;  3VSL A;  1BLH A;  1KDS A;  3G31 A;  3RXW A;  4GDB A;  1DJC A;  2EFU A;  4OKP A;  3OPH A;  3BEC A;  5G18 A;  1ONH A;  3E2L A;  2DNS A;  4DF6 A;  3N8R A;  1BT5 A;  4PMA A;  4EWF A;  3FYZ A;  3S1Y A;  3IT9 A;  5FAP A;  5HX9 A;  1W8Y A;  1ERM A;  1H8Y A;  1O07 A;  3OPL A;  4E6W A;  3V3S A;  3NDE A;  3AGF A;  2J9O A;  3A3D A;  3ZVT A;  4OLG A;  1PYY A;  3ISG A;  1K4E A;  3V39 A;  1KGG A;  1KVM A;  4FCF A;  3LO7 A;  4WEJ A;  2X71 A;  1ERQ A;  2Y2K A;  3IHB A;  4M3K A;  1XP4 A;  3ZG0 A;  1M40 A;  3EQU A;  4OPZ A;  5KZH A;  3VP2 A;  3G34 A;  4GKU A;  4LV1 A;  1ESU A;  3G32 A;  2WZZ A;  2Y2L A;  3UPO A;  1TVF A;  1WE4 A;  2ZQ8 A;  2FFF B;  4OPQ A;  3HUN A;  4P87 A;  3WRZ A;  5FQM A;  4JF4 A;  1C3B A;  3WS5 A;  1BLC A;  2HDR A;  1S6R A;  3UNW A;  1FR1 A;  2JBF A;  1YLY A;  4OQ0 A;  2Q9N A;  1BLS A;  3OCL A;  2XF3 A;  3B3X A;  3IHA A;  5CTM A;  4BEN A;  1G68 A;  4QJG A;  1PW8 A;  4DXB A;  1NYM A;  4N9K A;  3N6I A;  4WMC D;  3GVB A;  5EVI A;  2WGV A;  1RP5 A;  3I7J A;  4WZ4 A;  1K57 C;  1PIO A;  2Y2O A;  5FQJ A;  1KE3 A;  2QPN A;  3Q7V B;  3HL9 A;  3OC2 A;  3BFE A;  3W4O A;  2I72 A;  4GZB A;  3ZNY A;  1QME A;  5GHZ A;  3SH8 A;  3MZF A;  3RXX A;  2ZC6 B;  5HAR A;  1VM1 A;  4S2M A;  5A91 A;  3ZCZ A;  3PBR A;  4BLM A;  3IWO A;  4WYY A;  5FAS A;  4PM6 A;  1IKI A;  4Y0U A;  3S22 A;  4KG6 A;  5FAO A;  3E2K A;  4QU3 A;  2OSU A;  3IF6 B;  1WYC A;  3PBS A;  5TFQ A;  1KE0 A;  2P9V B;  5L2F A;  3HLC A;  2HDS A;  4KZ8 A;  1MWS A;  5EVI D;  3ITA A;  2E8I A;  3HBR A;  3IXH A;  4BJP A;  4NK3 A;  4A5R A;  4F94 A;  5IHV A;  3IH8 A;  3ZG7 B;  1J9M A;  3PAE A;  1GHP A;  5CED A;  3G2Y A;  2BLS A;  3LEZ A;  1PZO A;  3OPP A;  4CJN A;  3A3F A;  2GDN A;  4RX3 A;  4UAA A;  1IYP A;  3UY6 A;  1ZC2 A;  5F1G A;  4U3T A;  4HBT A;  3VP1 A;  4PM9 A;  2ZQA A;  3M2J A;  1GCE A;  4ZAM A;  5FI6 A;  5GHX A;  3VSK A;  3IF6 A;  3PBN A;  2V2F F;  3VP3 A;  1LI9 A;  5CGS A;  4R4R A;  4U0X A;  4R1G A;  2ZQ9 A;  3FKW A;  1PW1 A;  3P09 A;  2C5W B;  3O86 A;  4LV0 A;  4LV2 A;  5CHU A;  3LCE A;  4KZ9 A;  2WGW B;  3BYD A;  1K6S A;  3HUM A;  4K0X A;  3VOY A;  5DF9 A;  3WS2 A;  1H5X A;  1L0G A;  3WS0 A;  4QY5 A;  5CRF A;  1SDN A;  4DE1 A;  4N92 A;  3NCK A;  1YMS A;  3N7W A;  3N4I A;  1CEF A;  3GQZ A;  4KZ5 A;  2EX9 A;  3BM6 A;  5FI7 A;  5E2E A;  1NYY A;  1MKI A;  1K56 A;  2FFY A;  1PWD A;  3NDG A;  1JWV A;  4LCM A;  2EFX A;  3D4F A;  4C75 A;  1W79 A;  1FSY A;  3V3R A;  1FOF A;  3SH9 A;  3PBT A;  1K57 A;  3MXS A;  1RGZ A;  2B5R A;  2WGW A;  3HLF A;  4H8R A;  4B88 A;  4GN2 A;  5FAT A;  4OQG A;  4DRT A;  5GL9 A;  1ES3 A;  3MKF A;  3A3J A;  2V1Z A;  2J8Y A;  3O87 A;  4S2N C;  3TG9 A;  1PWG A;  4E3M A;  4KQO A;  1MY8 A;  1TDG A;  1Y54 A;  4WBG A;  2ZM2 A;  2WYX A;  5FDH A;  4B4Z A;  2RL3 A;  1CK3 A;  2R9X A;  1K56 D;  4JF5 A;  1E3U A;  2XQZ A;  4S2L A;  1ERO A;  1ESI A;  1O7E A;  2H0T A;  1SHV A;  1QMF A;  3GTC A;  4OQI A;  5AQ9 A;  4ZJ1 A;  2Y91 A;  4Y7P A;  3QNB A;  1L0D A;  1YMX A;  3PBQ A;  1ONG A;  4BD1 A;  1K55 A;  4WMC A;  3PAG A;  2WAD A;  3PBO A;  5EVI B;  5BOH A;  4JBF A;  5HW3 A;  2Y2Q A;  1H8Z A;  1SCW A;  3ZDJ A;  3ZGA B;  1IEM A;  3VP0 A;  4N1H A;  1K54 C;  3UE3 A;  1GHI A;  2XEP A;  5DF8 A;  4IVK A;  4GB7 A;  4X53 A;  4EUZ A;  1E3U D;  2EXA A;  5HAQ A;  1XXM A;  4RX2 A;  4DE3 A;  2ZC4 B;  3BFG A;  1IKG A;  3M6H A;  1BUE A;  4KZ4 A;  1DY6 A;  1JTD A;  2G2W A;  4S2O A;  3VOZ A;  2V20 A;  2OLU A;  1FCM A;  2Y2N A;  2XR0 A;  3HVF A;  4K0W A;  1XA7 A;  3NI9 A;  4DDS A;  4OP5 A;  3IXG A;  1NZO A;  4MEZ A;  5EUA A;  1NY0 A;  1XX2 A;  4OOY A;  4BD0 A;  1ES2 A;  2XFS A;  4R0Q A;  5D3O A;  3OZH A;  5GLB A;  2CC1 A;  3UPP A;  4IED A;  2H10 A;  4OPY A;  4WEL A;  3Q1F A;  1TDL A;  4OLD A;  3C4O A;  1K6R A;  2DRW A;  5FQK A;  3HUO A;  1KE4 A;  2A49 A;  1I5Q A;  4XUZ A;  1BLP A;  4BL3 A;  4S2K A;  3BLM A;  4E3K A;  1K38 A;  2HPB A;  4PM5 A;  3MXR A;  2Y2I A;  4OPR A;  3FZC A;  3IWI A;  5HAP A;  4EQI A;  4EV4 A;  3LY4 A;  1G6A A;  3IXB A;  5DTK A;  5DF7 A;  1XPB A;  2ZQD A;  2Y2H A;  3AGE A;  3ZG5 A;  4CPK A;  4KZA A;  3G30 A;  1KGE A;  4PM7 A;  1IYQ A;  4S2N A;  5CEB A;  3G4P A;  4JXS A;  3MZE A;  5U47 A;  3CZD A;  3TSG A;  4EBL A;  3WS1 A;  1HTZ A;  1LI0 A;  1RCJ A;  3A3I A;  3SH7 A;  2XH9 A;  4OOL A;  3Q81 A;  1S0W A;  2ZQC A;  4KQR A;  4P85 A;  3ZNT A;  2H5S A;  5FAQ A;  1MXO A;  2EX8 A;  4N9L A;  1ES4 A;  2Y2J A;  4FH4 A;  1FQG A;  4IVI A;  4HBU A;  1FCN A;  4WM9 A;  1HZO A;  4YIN A;  5FSR A;  3NC8 A;  4UA6 A;  4XUX A;  2Y2G A;  3NIA A;  1XKZ A;  2VGJ A;  3LY3 A;  4QY6 A;  5EEC A;  5EOE A;  4JXG A;  3HLW A;  4RA7 A;  2EX2 A;  3OPR A;  3WWX A;  3GR2 A;  1NXY A;  4OVD A;  1YM1 A;  1XGI A;  2ZLY A;  4JXW A;  2HDQ A;  1BSG A;  2JE5 A;  3ZVW A;  1U60 A;  3G35 A;  2X01 A;  3ZG9 B;  4DE2 A;  2XDM A;  3JYI A;  4E3O A;  2PBY A;  3DW0 A;  2WGI A;  3IH9 A;  4GOG A;  4MLL A;  2Y2P A;  4OOM A;  3M2K A;  3RJU A;  4E3L A;  4YFM A;  1LL9 A;  5AQ7 A;  3WRT A;  1ALQ A;  4KZB A;  3ITB A;  3UO9 A;  5A92 A;  1JTG A;  1YLT A;  1W5D A;  2WK0 A;  1YT4 A;  2PU4 A;  1N9B A;  5CHM A;  3FWL A;  3UDX A;  3V5M A;  4K91 A;  1CI9 A;  3UE0 A;  3UN7 A;  4GDN A;  3ZG8 B;  4P0M A;  3WS4 A;  4L0L A;  1CEG A;  4LEN A;  2DCF A;  5JYP A;  4EBN A;  5FQI A;  2P74 A;  4PM8 A;  1IYO A;  2ZC7 A;  4FH2 A;  3ZHH A;  4BL2 A;  5E43 A;  4E3I A;  2WKH A;  1NRF A;  3W8K A;  2ZMA A;  5E2G A;  1MWR A;  2XD5 A;  3FKV A;  4UA9 A;  5FQ9 A;  1NJ4 A;  4E3J A;  3HLG A;  1MWU A;  5DTT A;  4HES A;  3OCN A;  1SKF A;  3VFF A;  4ZBE A;  2X02 A;  4X69 A;  4QB8 A;  5GLD A;  2EX6 A;  3M6B A;  4R3J A;  3SS5 A;  4ZDX A;  2Y55 A;  1I2W A;  1RGY A;  5KMW A;  1OME A;  4N1X A;  2EXB A;  3SS3 A;  1PWC A;  5GHY A;  3IWQ A;  4UA7 A;  5TR7 A;  1ZG6 A;  1LL5 A;  1MPL A;  4GNU A;  4FD8 A;  4Z9Q A;  4EBP A;  1LHY A;  1JWZ A;  2XK1 A;  2ZJ9 A;  3IF6 C;  4B4X A;  4MNR A;  4E6X A;  5E2F A;  2WZX A;  4UHU A;  4C6Y A;  5CGX A;  2C6W B;  3Q07 A;  4RVA A;  3CJM A;  3G2Z A;  1W8Q A;  3NBL A;  3VFH A;  5KSC A;  3W4P A;  1YLJ A;  4KZ3 A;  4U0T A;  5AQB A;  4ID4 A;  1YQS A;  1Z6F A;  1TEM A;  2HP6 A;  3TOI A;  4JXV A;  4OP8 A;  1DJA A;  5AQA A;  4QHC A;  3C7U A;  4BQM A;  4QD4 A;  4DE0 A;  1IYS A;  3AGD A;  3C4P A;  4LV3 A;  2J9P A;  5GLA A;  4Y0T A;  4IBX A;  2Z2L B;  3UDI A;  2XD1 A;  1MBL A;  2ZM8 A;  3N8L A;  4HEF A;  3SOI A;  1L0E A;  3HRE A;  2JCH A;  2RCX A;  2WKE A;  4JPM A;  3O3V A;  4KEN B;  3MBZ A;  5CHJ A;  4R23 A;  3DTM A;  5E2H A;  4JF6 A;  5HFO A;  3S4X A;  2J7V A;  3FV7 A;  4PPR A;  5I94 A;  4WZ5 C;  2R9W A;  1HD8 A;  3EQV A;  1M6K A;  2XGN A;  1IEL A;  1GA0 A;  2PU2 A;  1E4D A;  3MZD A;  5CXW A;  2Q9M A;  5KSH A;  1GHM A;  4XXR A;  2HP5 A;  3N8S A;  1EWZ A;  4GD6 A;  2QMI A;  2IWB A;  3BRM A;  4DDY A;  5DVA A;  3IF5 A;  1K25 A;  2Y2M A;  4X55 A;  3VP4 A;  3HLB A;  4IBR A;  4D2O A;  4WEK A;  2WAF A;  5F82 A;  1W7F A;  1XGJ A;  2IWC A;  3NY4 A;  3SS4 A;  2OV5 A;  1ZKJ A;  4KQQ A;  3W4Q A;  3BLS A;  5HL1 A;  5J8X A;  1E25 A;  4KZ6 A;  1L2S A;  1HVB A;  5EVL A;  4ZJ2 A;  2XFT A;  5JYO A;  4S2P A;  1YLW A;  3C5A A;  5CGW A;  1CI8 A;  1JVJ A;  5F83 A;  2OLV A;  4S2J A;  5GLC A;  5TGF A;  4JKT A;  5FI2 A;  4FSF A;  1LLB A;  3ZFZ A;  1DJB A;  1Q2P A;  2QZ6 A;  1FR6 A;  2XLN A;  1MWT A;  1FCO A;  4C3Q A;  1K55 C;  1KVL A;  1XA1 A;  4KG2 A;  3BFD A;  3Q7Z A;  3VMA A;  1L0F A;  2ZD8 A;  1BZA A;  2Z2M B;  3Q7V A;  4S2I A;  3P98 A;  3MKE A;  5CEC A;  5EE8 A;  4X68 A;  4MBK A;  2ZM0 A;  4Y0O A;  4MBH A;  5FQQ A;  1PI5 A;  3CG5 A;  5A93 A;  4KG5 A;  3UPN A;  4OH0 A;  2HP9 A;  5HAI A;  3QNC A;  4OON A;  2ZC5 B;  4R4S A;  1FSW A;  1K54 A;  1KGF A;  3C7V A;  4ZTK A;  5CTN A;  2IWD A;  2JC7 A;  2Y4A A;  3DWK A;  4MBF A;  1BTL A;  1WYB A;  5EOO A;  4X6T A;  4P6B A;  2P9V A;  4R3B A;  1JWP A;  3IXD A;  3BFF A;  1AXB A;  2UWX A;  3HLD A;  3QHY A;  1YLP A;  2ZC3 B;  3IQA A;  5EPH A;  4DKI A;  1ES5 A;  4Q8I A;  1KDW A;  4E3N A;  5EVI C;  3PTE A;  3HLE A;  1ZG4 A;  2WUQ A;  5M1A A;  4DXC A;  1PI4 A;  3MFD A;  3DWZ A;  1Q2Q A;  2H0Y A;  2WAE A;  4X56 A;  5M19 A;  5DTS A;  2WKI A;  1NZU A;  4JLF A;  5CER A;  1PZP A;  3GMW A;  2BG1 A;  4NET A;  1SDE A;  2A3U A;  2HDU A;  3BEB A;  1GA9 A;  3O88 A;  5M18 A;  3UDF A;  3GRJ A;  4RYE A;  3V50 A;  4O7D A;  3A3E A;  1K4F A;  3GSG A;  4KZ7 A;  1YLZ A;  3BFC A;  1EI5 A;  4GD8 A;  1VQQ A;  2VGK A;  5F1F A;  3UE1 A;  3GV9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...