4X68A

Crystal structure of op0595 complexed with ampc
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
357
structure length
357
Chain Sequence
MDRLKALVDAAVQPVMKANDIPGLAVAISLKGEPHYFSYGLASKEDGRRVTPETLFEIGSVSKTFTATLAGYALTQDKMRLDDRASQHWPALQGSRFDGISLLDLATYTAGGLPLQFPDSVQKDQAQIRDYYRQWQPTYAPGSQRLYSNPSIGLFGYLAARSLGQPFERLMEQQVFPALGLEQTHLDVPEAALAQYAQGYGKDDRPLRVGPGPLDAEGYGVKTSAADLLRFVDANLHPERLDRPWAQALDATHRGYYKVGDMTQGLGWEAYDWPISLKRLQAGNSTPMALQPHRIARLPAPQALEGQRLLNKTGSTNGFGAYVAFVPGRDLGLVILANRNYPNAERVKIAYAILSGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Beta-lactamase
publication title OP0595, a new diazabicyclooctane: mode of action as a serine beta-lactamase inhibitor, antibiotic and beta-lactam 'enhancer'
pubmed doi rcsb
source organism Pseudomonas aeruginosa
total genus 122
structure length 357
sequence length 357
chains with identical sequence B
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2014-12-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 4x68A00
3ZGAB 4NK3A 3ZCZA 5KSCA 2ZQ7A 5FQ9A 4LV0A 4UA9A 3C4PA 4WELA 2ZQAA 2Y2LA 1PW1A 1MXOA 4D2OA 3JYIA 2XEPA 2QZ6A 4LV1A 3E2LA 1FCMA 3NI9A 5AQ9A 2RCXA 4MLLA 4DE1A 4MBKA 3UE0A 4PM5A 1NJ4A 3HLWA 2XQZA 3GTCA 3IH8A 1PW8A 3G2ZA 3ITBA 4Y0TA 4OPZA 3FZCA 5CGXA 2IWBA 1YLYA 1G6AA 4K0XA 2WGIA 2ZC3B 3VOYA 2J9PA 4GNUA 3BFFA 2J9OA 1KE4A 1JWZA 3HVFA 1YLTA 3HLBA 1KGGA 4N9LA 4OH0A 5EE8A 4OOMA 2OSUA 1JWVA 1LL9A 1K6RA 3HUOA 3NY4A 4GB7A 4OVDA 2ZM8A 1BULA 1SDNA 2HDQA 5CECA 3P09A 4EWFA 3A3JA 1TDLA 5KMWA 5HARA 2QPNA 4ZJ3A 3SOIA 3ZVTA 1ZC2A 1GA9A 3O88A 2Q9MA 3W4PA 1DJCA 3N4IA 3IXDA 5GHZA 4IEDA 4R3BA 1AXBA 5CTNA 3S22A 3GSGA 3HLEA 2PU4A 3IF6C 1KDWA 4FH2A 3UDXA 5FAQA 2VGKA 3HLCA 1XP4A 3VP4A 1IKGA 1GHIA 1K54A 1GA0A 1SHVA 1ERMA 5DF8A 5EPHA 4KZAA 1C3BA 2Y2JA 1MY8A 4IBRA 1K57C 1CEFA 3HUNA 4KQRA 3RXXA 3BLSA 5FDHA 4OQIA 4E3JA 1K25A 5KZHA 4BL3A 3HLDA 1VQQA 1HTZA 2ZC4B 3A3EA 1JTDA 2WAEA 3OPPA 3MFDA 1LL5A 3RJUA 5CHJA 4ZJ2A 1MWRA 4IVKA 2XH9A 4XUXA 2JBFA 1K55A 2EX9A 1ZG4A 1W8YA 4Y0UA 3MZFA 3WS1A 3TG9A 4WBGA 1BLPA 1NYMA 2G2UA 5EVIC 2Z2LB 3FKVA 4UHUA 1PI5A 4X53A 4EBLA 2OLUA 3CJMA 1K6SA 3PBQA 2I72A 1DY6A 4WZ5C 4KQOA 4PPRA 1Y54A 4S2KA 4XUZA 4X56A 3TSGA 5HAQA 1PI4A 3N8SA 1H8ZA 4Z9QA 5FI6A 1J9MA 5G18A 3ZG5A 4RX2A 5E2GA 1XA7A 3S4XA 4QHCA 1XA1A 4DE2A 2ZQ9A 3IT9A 3Q1FA 3DWKA 3SH9A 4KZBA 4OP5A 2H0TA 3V5MA 5JYOA 4JXSA 3OCLA 4KZ4A 5EUAA 3M2JA 3UN7A 2Y2IA 4KZ9A 1WYBA 4QB8A 3BEBA 3GMWA 1K4EA 4ZTKA 5HL1A 3IWIA 5L2FA 1PWGA 2HDRA 3O3VA 1YM1A 5CXWA 4U3TA 4GDBA 1L0DA 1W7FA 3IXHA 1JVJA 1FSYA 3M6BA 3NBLA 4R23A 1ES2A 5EVID 3PAEA 2H0YA 3SH7A 1BLHA 3DTMA 2EX2A 4K91A 3Q07A 4OONA 1QMFA 5CHMA 3UDFA 1BTLA 2WGVA 4QY5A 5DTKA 4S2OA 4FD8A 2WYXA 4BJPA 2X01A 3PBTA 2J7VA 3WS0A 4S2MA 4S2NA 4BD0A 5FI7A 1DJBA 2Y4AA 4JBFA 2Y2OA 2WGWA 4ID4A 3BYDA 4ZBEA 3ZG0A 5FQJA 5F1GA 1Q2PA 3UY6A 2Y91A 3Q7VB 1XX2A 5HX9A 1W5DA 5DTTA 1RP5A 1ZG6A 2XGNA 3CG5A 2OV5A 2WKHA 1SDEA 2PU2A 4KZ7A 5FQQA 3VFHA 3A3IA 3VSLA 2HP9A 4X69A 1TEMA 3AGEA 5A92A 3UDIA 1RGZA 2J8YA 1EI5A 1XKZA 3IXGA 3GR2A 4KQQA 1L0FA 2WAFA 4OPRA 1E3UA 3VP1A 2ZD8A 4LENA 1ALQA 3QNCA 2P9VA 5J8XA 3UPOA 2B5RA 1PIOA 3CMZA 3M2KA 4EBPA 3VMAA 2FFFB 3BFGA 3IHAA 4LCMA 3MKEA 5E43A 4E3IA 5FAOA 1YLZA 2HPBA 3HUMA 1MWTA 3G35A 4N1XA 4OPYA 4CJNA 3UO9A 1W79A 2V2FF 5AQAA 3HREA 4WZ4A 4EUZA 4OLGA 3O86A 3N7WA 2DCFA 3Q7ZA 1ZKJA 4C6YA 2RL3A 3IF5A 4WMCD 4B88A 1WE4A 4KG6A 1DJAA 3MKFA 1N4OA 1PWCA 3LY3A 2E8IA 4DXBA 5FASA 4QU3A 5FQIA 2WGWB 5A91A 1K38A 3VFFA 3LEZA 1EWZA 2H5SA 4OOLA 4K0WA 2DNSA 3TOIA 3D4FA 4KZ3A 5FQMA 2ZJ9A 3IF6A 3BFDA 1I5QA 3MXSA 3FV7A 5E2HA 4FH4A 3ZHHA 2QMIA 3EQUA 3WS4A 1KVLA 3BECA 4KENB 4YFMA 4DXCA 3BM6A 3OPLA 4JXVA 5CTMA 1JWPA 5GLBA 5CRFA 2HDUA 3FYZA 1K56D 3FKWA 4OQHA 1XGIA 2XD1A 4HESA 4X55A 5GLDA 1YT4A 3M6HA 4UA7A 4GD8A 2EXBA 5EVLA 4P6BA 1PWDA 5BOHA 1BLCA 1CEGA 3GV9A 1ESIA 2H10A 4H8RA 1IYOA 2JCHA 3E2KA 3N8LA 1XGJA 1NRFA 4GZBA 4E3KA 5I94A 3NCKA 4N9KA 4JF5A 2IWDA 1NZOA 1BSGA 2A49A 4U0XA 4UAAA 1TVFA 2C5WB 4RVAA 2C6WB 4ZAMA 1K54C 1Z6FA 3DWZA 2EX6A 3IHBA 5TFQA 4E3MA 5M19A 2HP6A 4KG2A 3A3FA 5EOOA 1FSWA 3LCEA 3NDEA 1HZOA 5DVAA 1GHMA 1TDGA 4E3LA 4P85A 3ISGA 4R4SA 5HFOA 1W8QA 3SS4A 4C75A 2V1ZA 1LHYA 4GKUA 1S0WA 5HW3A 2HDSA 3PBSA 3GVBA 4DDYA 3N8RA 1Q2QA 4FCFA 2ZM2A 3C5AA 1L2SA 1MWSA 1QMEA 4DDSA 1IEMA 3BFEA 3A3DA 3G31A 4N1HA 5CGWA 1IKIA 1K55C 1ESUA 3BLMA 2EFUA 1XXMA 2BG1A 1M6KA 3W8KA 3Q82A 3IH9A 3OPRA 4HBTA 4JF4A 5E2FA 3O87A 2UWXA 3C7UA 4MBFA 5DF7A 4PM6A 3HLFA 4RX3A 4Y7PA 1ES5A 3IWOA 4DE0A 3V50A 2Y2NA 4JXGA 5DF9A 5JYPA 3G34A 4KZ6A 1FR6A 3G30A 2WKIA 3ZVWA 5CEBA 1YLJA 3MZEA 1O7EA 1RGYA 1PZOA 1CK3A 4PM9A 3HBRA 4WYYA 3VP3A 4E6XA 3SS5A 5EOEA 1L0EA 3PBNA 1ES3A 2WZXA 1H5XA 2HP5A 4O7DA 3VP2A 1GHPA 1IYPA 3GRJA 4FSFA 4QD4A 5F1FA 1FCNA 1XPBA 2DRWA 3I7JA 5FAPA 1FOFA 4X68A 1G68A 3WRTA 4NETA 5F83A 4QJGA 3G32A 4JXWA 4IBXA 4P87A 3DW0A 1FCOA 4BLMA 1GCEA 3NC8A 5TGFA 1E4DA 2Y2KA 4OOYA 3UE1A 2XF3A 3EQVA 3PBRA 3VSKA 5CEDA 1KDSA 3ZG9B 3QHYA 4HEFA 3ZG8B 4DRTA 1FQGA 1KE3A 4GDNA 2WADA 1RCJA 5M1AA 4C3QA 3FWLA 2XK1A 4S2NC 4DE3A 5CGSA 1K4FA 3G4PA 4S2IA 3W4OA 1IELA 4MNRA 1I2SA 1KGEA 2Y59A 3ZNTA 4EV4A 3Q81A 1EROA 3OZHA 1MKIA 4KZ5A 2V20A 2Y2QA 4MBHA 4OKPA 3VP0A 4R4RA 4PMAA 4HBUA 1M40A 4BQMA 2ZMAA 4GD6A 2Y2GA 2OLVA 5D3OA 1ES4A 3V39A 1MWUA 2JE5A 4BENA 3WWXA 2XDMA 3PTEA 1KVMA 2XFSA 1H8YA 2R9WA 1OMEA 4DKIA 5HAPA 3C4OA 5EECA 5GLAA 5A93A 1BT5A 4A5RA 2GDNA 4ZDXA 1O07A 5KSHA 1YLPA 5AQ7A 4EBNA 4GN2A 4LCLA 4U0TA 1HD8A 4PM7A 1NXYA 1S6RA 1HVBA 1K57A 4LV3A 4M3KA 5AQBA 4S2JA 4CPKA 4S2PA 3MXRA 3NDGA 4JF6A 4B4XA 2P9VB 4OP8A 3C7VA 3V3RA 2EX8A 3P98A 2XD5A 4DF6A 4LV2A 4R0QA 3HLGA 4OPQA 2WKEA 5FSRA 1ONHA 3MZDA 1ERQA 5CHUA 4R3JA 5GHXA 1BZAA 4E3OA 2P74A 2XR0A 1BLSA 1KE0A 5IHVA 1E3UD 1N9BA 1IYQA 2ZLYA 2A3UA 5EVIA 2X71A 2FFYA 4XXRA 3S1YA 1KGFA 3AGDA 1NYYA 1PYYA 1YMXA 1LI0A 4WZ5A 1NZUA 2XFTA 5TR7A 4Q8IA 4OQ0A 1CI8A 4WEKA 2XLNA 2ZQDA 3ZG7B 3IF6B 4BD1A 4IVIA 1LLBA 5FQKA 3UPPA 1SKFA 1WYCA 3BRMA 3ITAA 4PM8A 3WRZA 2BLSA 1FR1A 3G2YA 2X02A 1LI9A 3VOZA 3ZFZA 2WUQA 1VM1A 2Y2PA 5HAIA 2Y2HA 4JKTA 4YINA 2ZC6B 2ZC7A 4UA6A 4EQIA 2Y2MA 3OCNA 2IWCA 5FATA 5U47A 4WEJA 3UNWA 1IYSA 2ZM0A 4R1GA 2Q9NA 1JTGA 3RXWA 3Q7VA 4RA7A 2G2WA 3ZNYA 4B4ZA 1BUEA 3LY4A 4JLFA 3IWQA 2VGJA 1ONGA 2EXAA 2ZQCA 3MBZA 4N92A 2ZQ8A 1SCWA 3OC2A 3UPNA 5DTSA 2Z2MB 4ZJ1A 3ZDJA 4E6WA 3QNBA 1U60A 5EVIB 2CC1A 5CERA 1MBLA 1MPLA 1YMSA 2WZZA 3LO7A 4RYEA 5F82A 5GLCA 1I2WA 3B3XA 3N6IA 3WS5A 3WS2A 2R9XA 2EFXA 4JPMA 4WMCA 3AGFA 2WK0A 5A90A 2PBYA 1L0GA 4BL2A 3NIAA 4L0LA 3GQZA 3PAGA 5GL9A 4F94A 3CZDA 4MEZA 3OPHA 4KZ8A 2ZC5B 5E2EA 3V3SA 1YQSA 1CI9A 3IQAA 5FA7A 2Y55A 2JC7A 1PZPA 3HL9A 3IXBA 5GHYA 3SH8A 3UE3A 4E3NA 1E25A 4OQGA 4QY6A 4WM9A 1NY0A 3SS3A 5FI2A 1YLWA 3PBOA 4S2LA 3BFCA 3W4QA 1K56A 4KG5A 4GOGA 4OLDA 4X6TA 4Y0OA 4P0MA 5M18A
chains in the Genus database with same CATH superfamily
2W3FA 5KSCA 4WELA 1F2KA 3QP1A 3FPWA 1PW1A 1MXOA 4LRXC 5FEGA 4LV1A 3NI9A 4DE1A 4MBKA 2XQZA 3FZCA 2IWBA 1G6AA 2ZC3B 2J9PA 4NEED 5L09A 2G7UA 1KGGA 4G3VA 4N9LA 5EE8A 2IA2A 4WUJA 1SKOB 5CECA 3EWKA 3A3JA 3PR6A 4ZJ3A 3ZVTA 2JKTM 1GA9A 3W4PA 2Q9MA 2OWHA 1AXBA 5CTNA 3HLEA 1IFQA 3UDXA 3HLCA 3VP4A 2ZOIA 1K54A 1SHVA 1ERMA 5DF8A 4KZAA 1MY8A 1K57C 2BASA 3HLDA 1HTZA 3A3EA 3EEAA 3RJUA 4ZJ2A 4LRZE 1K55A 3MZFA 4WBGA 1BLPA 1NYMA 2Z2LB 3FKVA 2H28A 5DKKA 2INWA 2I72A 4KQOA 1TF1A 1XJ3A 1HLUP 3N8SA 5FI6A 3K3CA 4RX2A 3S4XA 4DE2A 5HDSA 3Q1FA 3SH9A 4H6JB 4KZ4A 3M2JA 2Y2IA 1S4SA 4UEYA 3BEBA 1XFQA 4ZTKA 3IWIA 5L2FA 3O3VA 4R70A 1XJ6A 1XJ4A 2W3HA 4EESA 1JVJA 2ZMVA 3NBLA 4R23A 1VHMA 4OONA 5CHMA 3UDFA 2WGVA 4QY5A 3JPUA 1D7EA 2X01A 4K08A 4S2NA 2Y4AA 2Y2OA 2WGWA 4ID4A 1NLYA 3UY6A 4G3KA 3IS2B 2Y91A 2OV5A 2HGVA 2HP9A 2Y8HA 5A92A 1RGZA 1EI5A 3GR2A 1E3UA 1ALQA 3QNCA 2P9VA 2B5RA 1PFLA 3VMAA 5E43A 2JHEA 2HPBA 3LI9A 3QP2A 4LGWA 4N1XA 3UO9A 3HREA 1ZKJA 4C6YA 2VA0A 2RL3A 4R38A 4WMCD 4KG6A 5FASA 1P9RA 4QU3A 4HIAA 4Q0HA 1D1JA 2KX6A 4K0WA 2ZJ9A 4IHQA 1I5QA 5E2HA 3EQUA 4KENB 3QP6A 3T4TA 1JWPA 1Z09A 3TJZC 2HDUA 1K56D 4HESA 4X55A 5F68A 1YT4A 4HP9A 1F98A 1S1YA 1PWDA 1ESIA 2V1AA 2H10A 1IYOA 3E2KA 3N8LA 4BBUA 2IWDA 4NKPA 2A49A 4UAAA 4RVAA 4ZAMA 1K54C 4R3AA 3IHBA 5M19A 3A3FA 1FSWA 3LCEA 3NDEA 3MQQA 3OBFA 1GHMA 1TDGA 3F1OA 3ISGA 3SS4A 4HOIA 2XA7S 3O5YA 1IEMA 4CLCE 4N1HA 1K55C 2EFUA 3W8KA 5EM0A 4JF4A 5E2FA 2UWXA 1TS7A 3V50A 2OAQ1 1PZOA 3NHQA 4E6XA 3SS5A 2WZXA 2HP5A 4FSFA 1IYPA 4E04A 2V0UA 2V1BA 5L10A 4NETA 5F83A 3CUEA 1GCEA 4PHTA 3UE1A 3EQVA 3VSKA 3UB7A 3TRCA 4HEFA 4DRTA 1OT6A 4GDNA 2WADA 1VETA 4S2NC 2A2LA 4S2IA 4HI4A 3ZNTA 1IELA 4MNRA 3KSIA 2V20A 3BW6A 1M40A 2Y2GA 4KUKA 2OLVA 1MWUA 4MCWA 4XT2A 4CQHA 3EGXC 3WWXA 2OWJA 1KVMA 1NWZA 1H8YA 3R7WB 3C4OA 1UWNX 5GLAA 2GDNA 4ZDXA 5DKLA 5AQ7A 2O9CA 1HD8A 1T1BA 4JGOA 4LV3A 5J3WA 5G4ZA 4CPKA 4S2PA 3NDGA 3T4QA 2P9VB 3C7VA 2QJ5A 3KX0X 3P98A 4HH2A 4OPQA 3CHWP 2KDKA 5FSRA 3LGOA 1BZAA 4E3OA 1KE0A 2JKGA 1IYQA 1S1ZA 2UV0E 1BYWA 4YNRA 1PYYA 3ICYA 4OQ0A 5HD3A 3CITA 3A0RA 1SKFA 4PM8A 3WRZA 2JKRI 1FR1A 4YINA 4UA6A 2QHKA 5U47A 1IYSA 3Q7VA 1BUEA 4JLFA 2Q0OA 3IWQA 3QP5A 5F69A 1ONGA 4Q0JA 2PYPA 3JVUA 3ZDJA 3E98A 3C38A 3KYZA 3VE3A 2EFXA 4WMCA 2WK0A 5A90A 3E4PA 4L0LA 1P9WA 3OPHA 4GCZA 3KSFA 1YQSA 4Y3IA 2Y55A 2JC7A 5GHYA 4E3NA 1E25A 4QY6A 1NY0A 3SS3A 5EVEA 3W4QA 1K56A 4X6TA 4Y15A 5KIZA 4P0MA 2ZQ7A 5FQ9A 3CUEC 4RQ9A 4WN5A 3A0SA 5AQ9A 2RCXA 2GX5A 1NJ4A 3GTCA 1PW8A 3ITBA 4K0XA 2WGIA 4DJ2A 3BFFA 2J9OA 1KE4A 1JWZA 2B02A 4OOMA 4LPZA 4GB7A 4OVDA 1TS0A 2ZM8A 3P09A 3MS6A 1TDLA 1VETB 5KMWA 3MXQA 2QPNA 4P6ZS 1ZC2A 3LUQA 1D06A 1NLZA 5AJGA 3IF6C 2I9VA 1KDWA 4FH2A 3LR4A 1XP4A 1IKGA 1GHIA 1C3BA 1CEFA 4XT2B 1IOUA 3MFXA 4E3JA 4GLQA 3BY8A 4BL3A 3B42A 1VQQA 3CAXA 2K7SA 1JTDA 2WAEA 4IVKA 2XH9A 4XUXA 4CLCB 3T1RA 2EX9A 1ZG4A 1W8YA 4UHUA 2WKQA 5EV0A 5FEFA 3PBQA 4PPRA 3T4OA 3H7WB 3TSGA 5HAQA 2PR5A 5G18A 1A0KA 2ZQ9A 4MMNA 1UWPX 3K2NA 2Y79A 4OP5A 5JYOA 4GHIB 5EUAA 4KZ9A 2CMNA 3GMWA 1K4EA 2HDRA 1YM1A 5IT5A 4NXFA 5HL6A 4HNBA 2B18A 3M6BA 1ES2A 2V8CA 1BLHA 3DTMA 2EX2A 4K91A 1BTLA 4FD8A 2WYXA 3PBTA 4BD0A 5MC7A 2PHYA 5F1GA 1YKDA 5HX9A 3Q7VB 1W5DA 1RP5A 3CG5A 2WKHA 2PU2A 5LBRA 3VSLA 2VX8A 2J8YA 3IXGA 3M2KA 3UB5P 1LT0A 3SZTA 1W79A 5AQAA 2P7JA 4NG2A 3O86A 3Q7ZA 3LIDA 1N4OA 3LY3A 4DXBA 1K38A 2O9BA 3VFFA 4OOLA 3T1QB 1S66L 2DNSA 4EU0A 2WKPA 2QMIA 4PKYG 2W3GA 3RFBA 4DXCA 3BM6A 3OPLA 3KSGA 2XA7M 3FYZA 4FTXA 5GLDA 1V9ZA 4UA7A 5EVLA 2EXBA 5BOHA 1BLCA 1CEGA 3GV9A 3F1NA 4H8RA 2JCHA 1XGJA 1NRFA 5I94A 1NZOA 4U0XA 1SZVA 1Z6FA 4FOFA 1T19A 4E3MA 4BWIA 4ESPA 3UMDA 4E3LA 4R4SA 1W8QA 1LHYA 4CLCD 5HW3A 2HDSA 4FCFA 3N8RA 2ZM2A 1L2SA 4DDSA 3BFEA 3T4SA 1PRQA 1ESUA 3BLMA 3KYQA 3Q82A 3IH9A 3C7UA 5DF7A 4MBFA 4PM6A 3IWOA 2Y2NA 4JXGA 1MZUA 5JYPA 1Y4OA 1OJ5A 4KZ6A 1FR6A 4PM9A 3HBRA 2EWVA 1ES3A 1H5XA 1OTDA 2VEAA 1OJGA 2DRWA 5FAPA 3R7WA 3WRTA 3G32A 4JXWA 3F1PA 4IBXA 4L9EA 1N9OA 2M7UA 4BLMA 2PT7A 2J3TD 4B9OA 3QHYA 1FQGA 3H82B 3NJAA 4HJ3A 3KSHA 1FILA 2Y59A 5C5KA 4NXGA 3Q81A 1EROA 3OZHA 1MKIA 4OKPA 1J3WA 1VB6A 3VP0A 4HBUA 4QWOA 2JE5A 2NUTC 2XFSA 2PYRA 4BBVA 3LI8A 1DP8A 1YSQA 1O07A 4EERA 5KSHA 4GN2A 1S6RA 1HVBA 1MKMA 5AQBA 4I39A 3MXRA 4JF6A 4NXEA 2A24B 3BQAA 4LV2A 3T1XA 2ZL1B 2VLGA 2WKEA 4L9GA 5CHUA 2XR0A 5IHVA 2FH5A 2GJ3A 4DJ3A 2A3UA 2X71A 2FFYA 3S1YA 3AGDA 3NOUC 1LI0A 4WZ5A 1NZUA 2XFTA 1N9LA 4Q8IA 3DAVA 4WEKA 2XLNA 4EETB 3D3OA 3UPPA 3RH8B 4X1LA 2PRFA 2X02A 5HAIA 4I3IA 2O0YA 4Y17A 2W1TB 2IWCA 4WEJA 2ZM0A 5DFXA 3RXWA 4RA7A 2G2WA 4B4ZA 3LY4A 3F1NB 2EXAA 1P97A 3E4QA 2Z2MB 3QNBA 5EVIB 3VE4A 3B47A 1YMSA 2WZZA 3LO7A 4RYEA 1I2WA 3N6IA 3WS2A 4WL9A 2PBYA 4BL2A 1AWIA 4BMWA 4GJ4A 5GL9A 3S7QA 1CI9A 3P7NA 1PZPA 3IXBA 3UE3A 2W0NA 1ZHHB 4Y0OA 4NK3A 4Y2FA 1EW0A 1PNEA 4P6ZM 5HWVA 4EQ1A 2K31A 4UA9A 3C4PA 2ZQAA 3S7NA 4D2OA 2QZ6A 3BJNA 3E2LA 1FCMA 4MLLA 5CX7A 3UE0A 3TE8A 3HLWA 3IH8A 2D02A 2O9AA 4Y0TA 4OPZA 5CGXA 3NOTC 4M4XA 4GW9A 3VOYA 3F1PB 3HVFA 1YLTA 3HLBA 2HF6A 3EGDC 4CLCA 2OSUA 1JWVA 1K6RA 2W27A 3HUOA 3NY4A 1BULA 4LFUA 4EWFA 2VV7A 1XJ2A 5HARA 3IX8A 3SOIA 3N4IA 1VEUB 3MR0A 2P04A 3MSHA 3GSGA 3H7WA 2VGKA 2WKRA 3JVVA 5EFWA 4LLOB 1GA0A 5TJJA 4UQIS 4GHIA 2Y2JA 3HUNA 4EW7A 3SW1A 5K5BA 4HJ4A 3OPPA 3MFDA 2E8JA 3B33A 1TS6A 3H9WA 2B95A 2QYBA 4Y0UA 3WS1A 3VV4A 2G2UA 4EBLA 2OLUA 4WLAA 3CJMA 1K6SA 4WZ5C 2VK3A 4S2KA 3OLOA 4XUZA 1PI4A 1H8ZA 4KUOA 1OPXA 1J9MA 3ZG5A 5E2GA 1XA7A 3R4KA 2QJ7A 3IT9A 2JKFA 3DWKA 4KZBA 1FIKA 3MF0A 3OCLA 3UN7A 1WYBA 5HL1A 1DP9A 5CXWA 4GDBA 1L0DA 1OTAA 1W7FA 3T4LA 3FC7A 5EVID 1JNUA 2HJ9C 1QMFA 5DTKA 3C2WA 4BJPA 1LL8A 2J7VA 3LR5A 4JBFA 3BYDA 4ZBEA 5FQJA 1Q2PA 3E4OA 1XX2A 3KYEA 5DTTA 2XGNA 4KZ7A 3VFHA 3EEHA 5FQQA 2M7VA 4X69A 3AGEA 3UDIA 4HHDA 2Z6DA 3LIEA 3UE6A 1L0FA 4OPRA 3VP1A 4LENA 3UPOA 1PIOA 3LEQA 3IHAA 3MKEA 4E3IA 2GZAA 1YLZA 3HUMA 1MWTA 4OPYA 4CJNA 2QWSA 2V2FF 4EUZA 5DJUA 3IF5A 1WE4A 2PD8A 2E8IA 3LICA 5FQIA 5A91A 2H5SA 3TOIA 3D4FA 2ZBBA 3MXSA 3FV7A 3ZHHA 4IJGA 3LIAA 3WS4A 1KVLA 3BECA 4YFMA 2VJWA 1T1AA 3W2ZA 4JXVA 5GLBA 5G4YA 4CLCC 1OT9A 2OOLA 4OQHA 1XGIA 2XD1A 3UB8A 2ZOHA 1F9IA 1V9YA 2PD7A 2NUPC 2W3EA 4E3KA 4GZBA 4AFIA 2VKSA 2C5WB 2C6WB 5TFQA 3DTIA 2HP6A 4KG2A 3MQ0A 5HFOA 4C75A 2V1ZA 3PBSA 3GVBA 4DDYA 3CI6A 1MWSA 3DBAA 1QMEA 3A3DA 3G31A 5CGWA 3H82A 4HBTA 2J3TC 3O87A 1LSWA 3HLFA 4EEPA 2W3DA 5DF9A 3G34A 4MDZA 2WKIA 3ZVWA 2JKTI 4ETXA 4GS9A 1O7EA 1RGYA 3GECA 5EOEA 1ODVA 3TW8A 3VP2A 4QD4A 5F1FA 2D01A 4R6LA 4X68A 2YKFA 3ZQ5A 2DMWA 3DW0A 1FCOA 3NC8A 2ZMFA 2Y2KA 1ACFA 3PBRA 5CEDA 1KDSA 2VZWA 4HH3A 4QPRA 3LIFA 1RCJA 5HWTA 5M1AA 2A24A 4C3QA 4JGQA 4DE3A 2ZL1A 3W4OA 1I2SA 3IX3A 5FL3A 4KZ5A 4PMAA 4BQMA 5A8BA 3FG8A 4GD6A 5D3OA 1CQAA 4PAUA 4BENA 2XDMA 4ME4A 2R9WA 1OMEA 1DP6A 4DKIA 1G6OA 5HAPA 5EECA 1BT5A 2HZ5A 1YLPA 5I5LA 5F6AA 1H8MA 1LSXA 2W1TA 2VGLS 2XD5A 3HLGA 1ERQA 3CPTA 4R3JA 2P74A 3IBRA 3UB6A 4YOFA 5EVIA 1W63M 1NYYA 2PAVP 1YMXA 2XSSA 2W1RA 5TR7A 3KO6A 1CI8A 3ZG7B 4BD1A 4IVIA 1LLBA 5FQKA 1WYCA 3BRMA 4F3LB 2BLSA 1OTBA 1LI9A 3IBJA 3ZFZA 3E0YA 1YSPA 2WUQA 1VM1A 2Y2PA 3UMEA 2ZC6B 5HD5A 5FATA 3OCNA 4R1GA 2Q9NA 1JTGA 3C30A 3L7HA 3ZNYA 4YWZA 3PYPA 1YPRA 4N92A 2ZQ8A 4WF0A 3OC2A 3UPNA 2Z6CA 5DTSA 3T12B 3NECA 4ZJ1A 4E6WA 2CC1A 1MBLA 1MPLA 4IUKA 5F82A 3B3XA 3WS5A 4L9FA 1L0GA 4IUHA 3NIAA 4F94A 4MEZA 2ZC5B 3V3SA 3RTYA 5J7EA 3HCYA 1W63Q 2VV8A 3HL9A 1XFNA 1K0KA 4OQGA 3MMHA 4DMZA 3LYXA 1YLWA 3PBOA 4S2LA 3BFCA 4O8GA 3ZGAB 1VEUA 3ZCZA 4LV0A 4GS9B 2Y2LA 3JYIA 2XEPA 3V67A 3HJKA 1G28A 4UQIM 4PM5A 1CF0A 3G2ZA 1YLYA 2LB5A 3BWLA 1LSVA 4GNUA 3T50A 1CJFA 4KQDA 4OH0A 1LL9A 1X0OA 1T18A 1SDNA 2HDQA 4O01A 5DJTA 3GDIA 3C8CA 3UB9A 3O88A 1DJCA 1G5UA 5GHZA 3DTKA 3IXDA 3LIBA 3OOVA 4IEDA 5TBMA 4R3BA 3S22A 1S67L 2PU4A 5HSQA 5FAQA 4Y13A 5EPHA 5J4EA 4I38A 4IBRA 4KQRA 2EA9A 3RXXA 3BLSA 5HPFA 5FDHA 4OQIA 1K25A 5KZHA 3U4LP 2ZC4B 5DFYA 1F5MA 3BQ8A 1LL5A 5CHJA 1MWRA 2EWWA 4Y5FA 2R78A 2JBFA 4EEUA 1WA9A 3TG9A 5EVIC 1PI5A 4X53A 2GNXA 2ACGA 1DY6A 1Y54A 4EUVA 2M1CA 3QP8A 4X56A 3CPTB 2XROA 4Z9QA 2HJEA 4QHCA 1XA1A 3ZYTA 4JGPA 4ETZA 2H0TA 3V5MA 4JXSA 2V8FA 4BBTA 4QB8A 1PWGA 4U3TA 4MN5A 3IX4A 3IXHA 4O0PA 1FSYA 1GSXA 3PAEA 2H0YA 3SH7A 5HDCA 3Q07A 1NRJA 3LR0A 4S2OA 2LB9A 3WS0A 3A0VA 4S2MA 5FI7A 1DJBA 4B93A 4G3WA 3ZG0A 2KOIA 2QKPA 2XRNA 3T1SA 4DN0A 4ARZA 1ZG6A 4HP4A 1SDEA 3A3IA 1TEMA 1XKZA 3FPVA 4HY8A 4KQQA 2WAFA 2ZD8A 1OTIA 1GSVA 2K2NA 5J8XA 3CMZA 4EBPA 2FFFB 3BFGA 1OTEA 4LCMA 5FAOA 3T4KA 3CLOA 3G35A 1STZA 4WZ4A 4OLGA 3N7WA 2DCFA 4B88A 3HJIA 1DJAA 3MKFA 1PWCA 4I3AA 2MJ6A 2JN7A 2WGWB 3LEZA 4HQAA 1EWZA 1GSWA 4KZ3A 3MJQA 5FQMA 3IF6A 3BFDA 4FH4A 2BTFP 5CTMA 5HZHA 4I3JA 5CRFA 3FKWA 3M6HA 4NXBA 4GD8A 4P6BA 5HDDA 3NCKA 4N9KA 2PR6A 4JF5A 4MN6A 1BSGA 1TVFA 3DWZA 2EX6A 5EOOA 3BY9A 5IS1A 1HZOA 2L0WA 5DVAA 4P85A 5TBMB 2AVXA 4GKUA 2J3WA 1L3LA 1S0WA 2V9AA 1Q2QA 2O99A 3PHYA 3C5AA 1S4RA 3ULFA 1IKIA 5L07A 4D60A 1TS8A 1XXMA 2BG1A 1M6KA 2V0WA 3D9YA 3OPRA 1N9NA 4RX3A 4Y7PA 1ES5A 4DE0A 4I5SA 3G30A 5CEBA 1YLJA 3MZEA 1CK3A 3D72A 3LFVA 4WYYA 3VP3A 1L0EA 3PBNA 3DTEA 2FZ0A 4O7DA 1GHPA 3GRJA 3S7PA 1FCNA 2YKHA 1XPBA 3F1OB 3I7JA 1FOFA 4II7A 1G68A 4QJGA 4P87A 5TGFA 1E4DA 4OOYA 2XF3A 1H3QA 2L1MA 3ZG9B 3ZG8B 1SKOA 1KE3A 5L8MA 3FWLA 2XK1A 2JKRM 5CGSA 1K4FA 3G4PA 5AVFA 5IU1A 5HWWA 2VGLM 4EV4A 1KGEA 2Y2QA 4MBHA 5AVEA 2J80A 4R4RA 2HV1A 2ZMAA 3P01A 1ES4A 3V39A 5HPIA 3PXPA 3PTEA 1KOUA 4ARZB 5A93A 4A5RA 1Y28A 4F3LA 2VV6A 4EBNA 4LCLA 4U0TA 4PM7A 1NXYA 1YAXA 3NULA 1K57A 3CWFA 4M3KA 1MC0A 4FUWA 4JGRA 4S2JA 4HJ6A 4B4XA 2PBDP 4OP8A 3V3RA 3K3DA 2EX8A 1T1CA 4DF6A 3L9KA 4R0QA 2OAP1 1H0MA 3T4JA 1ONHA 3MZDA 4LRYC 5GHXA 4PKYA 1BLSA 1E3UD 1N9BA 2ZLYA 2PDRA 4H6JA 4XXRA 2KLIA 1KGFA 3S7OA 4X25A 4Z1WA 3EOIA 1ZTUA 4Q0IA 2ZQDA 3IF6B 3VOLA 3ITAA 3U2AA 5FDSA 1UGUA 1P0ZA 3G2YA 3VOZA 3LR3A 4MN7A 5EM1A 2Y2HA 4JKTA 2L4RA 2ZC7A 4EQIA 2Y2MA 3UNWA 3IS2A 2VGJA 2ZQCA 3MBZA 2P08A 1SCWA 3NOPC 1U60A 5CERA 5F5YA 5GLCA 2R9XA 4JPMA 3AGFA 3QP4A 4ZRRA 3GQZA 3PAGA 4X1MA 3CZDA 5E2EA 4KZ8A 3IQAA 5FA7A 3SH8A 4WM9A 1DRMA 4EXOA 3G6OA 5FI2A 4KG5A 4GOGA 4OLDA 3MQOA 5M18A 1TD5A
chains in the Genus database with same CATH topology
3ZGAB 4NK3A 3ZCZA 5KSCA 2ZQ7A 5FQ9A 4LV0A 4UA9A 3C4PA 4WELA 2ZQAA 2Y2LA 1PW1A 1MXOA 4D2OA 3JYIA 2XEPA 2QZ6A 4LV1A 3E2LA 1FCMA 3NI9A 5AQ9A 2RCXA 4MLLA 4DE1A 4MBKA 3UE0A 4PM5A 1NJ4A 3HLWA 2XQZA 3GTCA 3IH8A 1PW8A 3G2ZA 3ITBA 4Y0TA 4OPZA 3FZCA 5CGXA 2IWBA 1YLYA 1G6AA 4K0XA 2WGIA 2ZC3B 3VOYA 2J9PA 4GNUA 3BFFA 2J9OA 1KE4A 1JWZA 3HVFA 1YLTA 3HLBA 1KGGA 4N9LA 4OH0A 5EE8A 4OOMA 2OSUA 1JWVA 1LL9A 1K6RA 3HUOA 3NY4A 4GB7A 4OVDA 2ZM8A 1BULA 1SDNA 2HDQA 5CECA 3P09A 4EWFA 3A3JA 1TDLA 5KMWA 5HARA 2QPNA 4ZJ3A 3SOIA 3ZVTA 1ZC2A 1GA9A 3O88A 2Q9MA 3W4PA 1DJCA 3N4IA 3IXDA 5GHZA 4IEDA 4R3BA 1AXBA 5CTNA 3S22A 3GSGA 3HLEA 2PU4A 3IF6C 1KDWA 4FH2A 3UDXA 5FAQA 2VGKA 3HLCA 1XP4A 3VP4A 1IKGA 1GHIA 1K54A 1GA0A 1SHVA 1ERMA 5DF8A 5EPHA 4KZAA 1C3BA 2Y2JA 1MY8A 4IBRA 1K57C 1CEFA 3HUNA 4KQRA 3RXXA 3BLSA 5FDHA 4OQIA 4E3JA 1K25A 5KZHA 4BL3A 3HLDA 1VQQA 1HTZA 2ZC4B 3A3EA 1JTDA 2WAEA 3OPPA 3MFDA 1LL5A 3RJUA 5CHJA 4ZJ2A 1MWRA 4IVKA 2XH9A 4XUXA 2JBFA 1K55A 2EX9A 1ZG4A 1W8YA 4Y0UA 3MZFA 3WS1A 3TG9A 4WBGA 1BLPA 1NYMA 2G2UA 5EVIC 2Z2LB 3FKVA 4UHUA 1PI5A 4X53A 4EBLA 2OLUA 3CJMA 1K6SA 3PBQA 2I72A 1DY6A 4WZ5C 4KQOA 4PPRA 1Y54A 4S2KA 4XUZA 4X56A 3TSGA 5HAQA 1PI4A 3N8SA 1H8ZA 4Z9QA 5FI6A 1J9MA 5G18A 3ZG5A 4RX2A 5E2GA 1XA7A 3S4XA 4QHCA 1XA1A 4DE2A 2ZQ9A 3IT9A 3Q1FA 3DWKA 3SH9A 4KZBA 4OP5A 2H0TA 3V5MA 5JYOA 4JXSA 3OCLA 4KZ4A 5EUAA 3M2JA 3UN7A 2Y2IA 4KZ9A 1WYBA 4QB8A 3BEBA 3GMWA 1K4EA 4ZTKA 5HL1A 3IWIA 5L2FA 1PWGA 2HDRA 3O3VA 1YM1A 5CXWA 4U3TA 4GDBA 1L0DA 1W7FA 3IXHA 1JVJA 1FSYA 3M6BA 3NBLA 4R23A 1ES2A 5EVID 3PAEA 2H0YA 3SH7A 1BLHA 3DTMA 2EX2A 4K91A 3Q07A 4OONA 1QMFA 5CHMA 3UDFA 1BTLA 2WGVA 4QY5A 5DTKA 4S2OA 4FD8A 2WYXA 4BJPA 2X01A 3PBTA 2J7VA 3WS0A 4S2MA 4S2NA 4BD0A 5FI7A 1DJBA 2Y4AA 4JBFA 2Y2OA 2WGWA 4ID4A 3BYDA 4ZBEA 3ZG0A 5FQJA 5F1GA 1Q2PA 3UY6A 2Y91A 3Q7VB 1XX2A 5HX9A 1W5DA 5DTTA 1RP5A 1ZG6A 2XGNA 3CG5A 2OV5A 2WKHA 1SDEA 2PU2A 4KZ7A 5FQQA 3VFHA 3A3IA 3VSLA 2HP9A 4X69A 1TEMA 3AGEA 5A92A 3UDIA 1RGZA 2J8YA 1EI5A 1XKZA 3IXGA 3GR2A 4KQQA 1L0FA 2WAFA 4OPRA 1E3UA 3VP1A 2ZD8A 4LENA 1ALQA 3QNCA 2P9VA 5J8XA 3UPOA 2B5RA 1PIOA 3CMZA 3M2KA 4EBPA 3VMAA 2FFFB 3BFGA 3IHAA 4LCMA 3MKEA 5E43A 4E3IA 5FAOA 1YLZA 2HPBA 3HUMA 1MWTA 3G35A 4N1XA 4OPYA 4CJNA 3UO9A 1W79A 2V2FF 5AQAA 3HREA 4WZ4A 4EUZA 4OLGA 3O86A 3N7WA 2DCFA 3Q7ZA 1ZKJA 4C6YA 2RL3A 3IF5A 4WMCD 4B88A 1WE4A 4KG6A 1DJAA 3MKFA 1N4OA 1PWCA 3LY3A 2E8IA 4DXBA 5FASA 4QU3A 5FQIA 2WGWB 5A91A 1K38A 3VFFA 3LEZA 1EWZA 2H5SA 4OOLA 4K0WA 2DNSA 3TOIA 3D4FA 4KZ3A 5FQMA 2ZJ9A 3IF6A 3BFDA 1I5QA 3MXSA 3FV7A 5E2HA 4FH4A 3ZHHA 2QMIA 3EQUA 3WS4A 1KVLA 3BECA 4KENB 4YFMA 4DXCA 3BM6A 3OPLA 4JXVA 5CTMA 1JWPA 5GLBA 5CRFA 2HDUA 3FYZA 1K56D 3FKWA 4OQHA 1XGIA 2XD1A 4HESA 4X55A 5GLDA 1YT4A 3M6HA 4UA7A 4GD8A 2EXBA 5EVLA 4P6BA 1PWDA 5BOHA 1BLCA 1CEGA 3GV9A 1ESIA 2H10A 4H8RA 1IYOA 2JCHA 3E2KA 3N8LA 1XGJA 1NRFA 4GZBA 4E3KA 5I94A 3NCKA 4N9KA 4JF5A 2IWDA 1NZOA 1BSGA 2A49A 4U0XA 4UAAA 1TVFA 2C5WB 4RVAA 2C6WB 4ZAMA 1K54C 1Z6FA 3DWZA 2EX6A 3IHBA 5TFQA 4E3MA 5M19A 2HP6A 4KG2A 3A3FA 5EOOA 1FSWA 3LCEA 3NDEA 1HZOA 5DVAA 1GHMA 1TDGA 4E3LA 4P85A 3ISGA 4R4SA 5HFOA 1W8QA 3SS4A 4C75A 2V1ZA 1LHYA 4GKUA 1S0WA 5HW3A 2HDSA 3PBSA 3GVBA 4DDYA 3N8RA 1Q2QA 4FCFA 2ZM2A 3C5AA 1L2SA 1MWSA 1QMEA 4DDSA 1IEMA 3BFEA 3A3DA 3G31A 4N1HA 5CGWA 1IKIA 1K55C 1ESUA 3BLMA 2EFUA 1XXMA 2BG1A 1M6KA 3W8KA 3Q82A 3IH9A 3OPRA 4HBTA 4JF4A 5E2FA 3O87A 2UWXA 3C7UA 4MBFA 5DF7A 4PM6A 3HLFA 4RX3A 4Y7PA 1ES5A 3IWOA 4DE0A 3V50A 2Y2NA 4JXGA 5DF9A 5JYPA 3G34A 4KZ6A 1FR6A 3G30A 2WKIA 3ZVWA 5CEBA 1YLJA 3MZEA 1O7EA 1RGYA 1PZOA 1CK3A 4PM9A 3HBRA 4WYYA 3VP3A 4E6XA 3SS5A 5EOEA 1L0EA 3PBNA 1ES3A 2WZXA 1H5XA 2HP5A 4O7DA 3VP2A 1GHPA 1IYPA 3GRJA 4FSFA 4QD4A 5F1FA 1FCNA 1XPBA 2DRWA 3I7JA 5FAPA 1FOFA 4X68A 1G68A 3WRTA 4NETA 5F83A 4QJGA 3G32A 4JXWA 4IBXA 4P87A 3DW0A 1FCOA 4BLMA 1GCEA 3NC8A 5TGFA 1E4DA 2Y2KA 4OOYA 3UE1A 2XF3A 3EQVA 3PBRA 3VSKA 5CEDA 1KDSA 3ZG9B 3QHYA 4HEFA 3ZG8B 4DRTA 1FQGA 1KE3A 4GDNA 2WADA 1RCJA 5M1AA 4C3QA 3FWLA 2XK1A 4S2NC 4DE3A 5CGSA 1K4FA 3G4PA 4S2IA 3W4OA 1IELA 4MNRA 1I2SA 1KGEA 2Y59A 3ZNTA 4EV4A 3Q81A 1EROA 3OZHA 1MKIA 4KZ5A 2V20A 2Y2QA 4MBHA 4OKPA 3VP0A 4R4RA 4PMAA 4HBUA 1M40A 4BQMA 2ZMAA 4GD6A 2Y2GA 2OLVA 5D3OA 1ES4A 3V39A 1MWUA 2JE5A 4BENA 3WWXA 2XDMA 3PTEA 1KVMA 2XFSA 1H8YA 2R9WA 1OMEA 4DKIA 5HAPA 3C4OA 5EECA 5GLAA 5A93A 1BT5A 4A5RA 2GDNA 4ZDXA 1O07A 5KSHA 1YLPA 5AQ7A 4EBNA 4GN2A 4LCLA 4U0TA 1HD8A 4PM7A 1NXYA 1S6RA 1HVBA 1K57A 4LV3A 4M3KA 5AQBA 4S2JA 4CPKA 4S2PA 3MXRA 3NDGA 4JF6A 4B4XA 2P9VB 4OP8A 3C7VA 3V3RA 2EX8A 3P98A 2XD5A 4DF6A 4LV2A 4R0QA 3HLGA 4OPQA 2WKEA 5FSRA 1ONHA 3MZDA 1ERQA 5CHUA 4R3JA 5GHXA 1BZAA 4E3OA 2P74A 2XR0A 1BLSA 1KE0A 5IHVA 1E3UD 1N9BA 1IYQA 2ZLYA 2A3UA 5EVIA 2X71A 2FFYA 4XXRA 3S1YA 1KGFA 3AGDA 1NYYA 1PYYA 1YMXA 1LI0A 4WZ5A 1NZUA 2XFTA 5TR7A 4Q8IA 4OQ0A 1CI8A 4WEKA 2XLNA 2ZQDA 3ZG7B 3IF6B 4BD1A 4IVIA 1LLBA 5FQKA 3UPPA 1SKFA 1WYCA 3BRMA 3ITAA 4PM8A 3WRZA 2BLSA 1FR1A 3G2YA 2X02A 1LI9A 3VOZA 3ZFZA 2WUQA 1VM1A 2Y2PA 5HAIA 2Y2HA 4JKTA 4YINA 2ZC6B 2ZC7A 4UA6A 4EQIA 2Y2MA 3OCNA 2IWCA 5FATA 5U47A 4WEJA 3UNWA 1IYSA 2ZM0A 4R1GA 2Q9NA 1JTGA 3RXWA 3Q7VA 4RA7A 2G2WA 3ZNYA 4B4ZA 1BUEA 3LY4A 4JLFA 3IWQA 2VGJA 1ONGA 2EXAA 2ZQCA 3MBZA 4N92A 2ZQ8A 1SCWA 3OC2A 3UPNA 5DTSA 2Z2MB 4ZJ1A 3ZDJA 4E6WA 3QNBA 1U60A 5EVIB 2CC1A 5CERA 1MBLA 1MPLA 1YMSA 2WZZA 3LO7A 4RYEA 5F82A 5GLCA 1I2WA 3B3XA 3N6IA 3WS5A 3WS2A 2R9XA 2EFXA 4JPMA 4WMCA 3AGFA 2WK0A 5A90A 2PBYA 1L0GA 4BL2A 3NIAA 4L0LA 3GQZA 3PAGA 5GL9A 4F94A 3CZDA 4MEZA 3OPHA 4KZ8A 2ZC5B 5E2EA 3V3SA 1YQSA 1CI9A 3IQAA 5FA7A 2Y55A 2JC7A 1PZPA 3HL9A 3IXBA 5GHYA 3SH8A 3UE3A 4E3NA 1E25A 4OQGA 4QY6A 4WM9A 1NY0A 3SS3A 5FI2A 1YLWA 3PBOA 4S2LA 3BFCA 3W4QA 1K56A 4KG5A 4GOGA 4OLDA 4X6TA 4Y0OA 4P0MA 5M18A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZGA B;  4NK3 A;  3ZCZ A;  5KSC A;  2ZQ7 A;  5FQ9 A;  4LV0 A;  4UA9 A;  3C4P A;  4WEL A;  2ZQA A;  2Y2L A;  1PW1 A;  1MXO A;  4D2O A;  3JYI A;  2XEP A;  2QZ6 A;  4LV1 A;  3E2L A;  1FCM A;  3NI9 A;  5AQ9 A;  2RCX A;  4MLL A;  4DE1 A;  4MBK A;  3UE0 A;  4PM5 A;  1NJ4 A;  3HLW A;  2XQZ A;  3GTC A;  3IH8 A;  1PW8 A;  3G2Z A;  3ITB A;  4Y0T A;  4OPZ A;  3FZC A;  5CGX A;  2IWB A;  1YLY A;  1G6A A;  4K0X A;  2WGI A;  2ZC3 B;  3VOY A;  2J9P A;  4GNU A;  3BFF A;  2J9O A;  1KE4 A;  1JWZ A;  3HVF A;  1YLT A;  3HLB A;  1KGG A;  4N9L A;  4OH0 A;  5EE8 A;  4OOM A;  2OSU A;  1JWV A;  1LL9 A;  1K6R A;  3HUO A;  3NY4 A;  4GB7 A;  4OVD A;  2ZM8 A;  1BUL A;  1SDN A;  2HDQ A;  5CEC A;  3P09 A;  4EWF A;  3A3J A;  1TDL A;  5KMW A;  5HAR A;  2QPN A;  4ZJ3 A;  3SOI A;  3ZVT A;  1ZC2 A;  1GA9 A;  3O88 A;  2Q9M A;  3W4P A;  1DJC A;  3N4I A;  3IXD A;  5GHZ A;  4IED A;  4R3B A;  1AXB A;  5CTN A;  3S22 A;  3GSG A;  3HLE A;  2PU4 A;  3IF6 C;  1KDW A;  4FH2 A;  3UDX A;  5FAQ A;  2VGK A;  3HLC A;  1XP4 A;  3VP4 A;  1IKG A;  1GHI A;  1K54 A;  1GA0 A;  1SHV A;  1ERM A;  5DF8 A;  5EPH A;  4KZA A;  1C3B A;  2Y2J A;  1MY8 A;  4IBR A;  1K57 C;  1CEF A;  3HUN A;  4KQR A;  3RXX A;  3BLS A;  5FDH A;  4OQI A;  4E3J A;  1K25 A;  5KZH A;  4BL3 A;  3HLD A;  1VQQ A;  1HTZ A;  2ZC4 B;  3A3E A;  1JTD A;  2WAE A;  3OPP A;  3MFD A;  1LL5 A;  3RJU A;  5CHJ A;  4ZJ2 A;  1MWR A;  4IVK A;  2XH9 A;  4XUX A;  2JBF A;  1K55 A;  2EX9 A;  1ZG4 A;  1W8Y A;  4Y0U A;  3MZF A;  3WS1 A;  3TG9 A;  4WBG A;  1BLP A;  1NYM A;  2G2U A;  5EVI C;  2Z2L B;  3FKV A;  4UHU A;  1PI5 A;  4X53 A;  4EBL A;  2OLU A;  3CJM A;  1K6S A;  3PBQ A;  2I72 A;  1DY6 A;  4WZ5 C;  4KQO A;  4PPR A;  1Y54 A;  4S2K A;  4XUZ A;  4X56 A;  3TSG A;  5HAQ A;  1PI4 A;  3N8S A;  1H8Z A;  4Z9Q A;  5FI6 A;  1J9M A;  5G18 A;  3ZG5 A;  4RX2 A;  5E2G A;  1XA7 A;  3S4X A;  4QHC A;  1XA1 A;  4DE2 A;  2ZQ9 A;  3IT9 A;  3Q1F A;  3DWK A;  3SH9 A;  4KZB A;  4OP5 A;  2H0T A;  3V5M A;  5JYO A;  4JXS A;  3OCL A;  4KZ4 A;  5EUA A;  3M2J A;  3UN7 A;  2Y2I A;  4KZ9 A;  1WYB A;  4QB8 A;  3BEB A;  3GMW A;  1K4E A;  4ZTK A;  5HL1 A;  3IWI A;  5L2F A;  1PWG A;  2HDR A;  3O3V A;  1YM1 A;  5CXW A;  4U3T A;  4GDB A;  1L0D A;  1W7F A;  3IXH A;  1JVJ A;  1FSY A;  3M6B A;  3NBL A;  4R23 A;  1ES2 A;  5EVI D;  3PAE A;  2H0Y A;  3SH7 A;  1BLH A;  3DTM A;  2EX2 A;  4K91 A;  3Q07 A;  4OON A;  1QMF A;  5CHM A;  3UDF A;  1BTL A;  2WGV A;  4QY5 A;  5DTK A;  4S2O A;  4FD8 A;  2WYX A;  4BJP A;  2X01 A;  3PBT A;  2J7V A;  3WS0 A;  4S2M A;  4S2N A;  4BD0 A;  5FI7 A;  1DJB A;  2Y4A A;  4JBF A;  2Y2O A;  2WGW A;  4ID4 A;  3BYD A;  4ZBE A;  3ZG0 A;  5FQJ A;  5F1G A;  1Q2P A;  3UY6 A;  2Y91 A;  3Q7V B;  1XX2 A;  5HX9 A;  1W5D A;  5DTT A;  1RP5 A;  1ZG6 A;  2XGN A;  3CG5 A;  2OV5 A;  2WKH A;  1SDE A;  2PU2 A;  4KZ7 A;  5FQQ A;  3VFH A;  3A3I A;  3VSL A;  2HP9 A;  4X69 A;  1TEM A;  3AGE A;  5A92 A;  3UDI A;  1RGZ A;  2J8Y A;  1EI5 A;  1XKZ A;  3IXG A;  3GR2 A;  4KQQ A;  1L0F A;  2WAF A;  4OPR A;  1E3U A;  3VP1 A;  2ZD8 A;  4LEN A;  1ALQ A;  3QNC A;  2P9V A;  5J8X A;  3UPO A;  2B5R A;  1PIO A;  3CMZ A;  3M2K A;  4EBP A;  3VMA A;  2FFF B;  3BFG A;  3IHA A;  4LCM A;  3MKE A;  5E43 A;  4E3I A;  5FAO A;  1YLZ A;  2HPB A;  3HUM A;  1MWT A;  3G35 A;  4N1X A;  4OPY A;  4CJN A;  3UO9 A;  1W79 A;  2V2F F;  5AQA A;  3HRE A;  4WZ4 A;  4EUZ A;  4OLG A;  3O86 A;  3N7W A;  2DCF A;  3Q7Z A;  1ZKJ A;  4C6Y A;  2RL3 A;  3IF5 A;  4WMC D;  4B88 A;  1WE4 A;  4KG6 A;  1DJA A;  3MKF A;  1N4O A;  1PWC A;  3LY3 A;  2E8I A;  4DXB A;  5FAS A;  4QU3 A;  5FQI A;  2WGW B;  5A91 A;  1K38 A;  3VFF A;  3LEZ A;  1EWZ A;  2H5S A;  4OOL A;  4K0W A;  2DNS A;  3TOI A;  3D4F A;  4KZ3 A;  5FQM A;  2ZJ9 A;  3IF6 A;  3BFD A;  1I5Q A;  3MXS A;  3FV7 A;  5E2H A;  4FH4 A;  3ZHH A;  2QMI A;  3EQU A;  3WS4 A;  1KVL A;  3BEC A;  4KEN B;  4YFM A;  4DXC A;  3BM6 A;  3OPL A;  4JXV A;  5CTM A;  1JWP A;  5GLB A;  5CRF A;  2HDU A;  3FYZ A;  1K56 D;  3FKW A;  4OQH A;  1XGI A;  2XD1 A;  4HES A;  4X55 A;  5GLD A;  1YT4 A;  3M6H A;  4UA7 A;  4GD8 A;  2EXB A;  5EVL A;  4P6B A;  1PWD A;  5BOH A;  1BLC A;  1CEG A;  3GV9 A;  1ESI A;  2H10 A;  4H8R A;  1IYO A;  2JCH A;  3E2K A;  3N8L A;  1XGJ A;  1NRF A;  4GZB A;  4E3K A;  5I94 A;  3NCK A;  4N9K A;  4JF5 A;  2IWD A;  1NZO A;  1BSG A;  2A49 A;  4U0X A;  4UAA A;  1TVF A;  2C5W B;  4RVA A;  2C6W B;  4ZAM A;  1K54 C;  1Z6F A;  3DWZ A;  2EX6 A;  3IHB A;  5TFQ A;  4E3M A;  5M19 A;  2HP6 A;  4KG2 A;  3A3F A;  5EOO A;  1FSW A;  3LCE A;  3NDE A;  1HZO A;  5DVA A;  1GHM A;  1TDG A;  4E3L A;  4P85 A;  3ISG A;  4R4S A;  5HFO A;  1W8Q A;  3SS4 A;  4C75 A;  2V1Z A;  1LHY A;  4GKU A;  1S0W A;  5HW3 A;  2HDS A;  3PBS A;  3GVB A;  4DDY A;  3N8R A;  1Q2Q A;  4FCF A;  2ZM2 A;  3C5A A;  1L2S A;  1MWS A;  1QME A;  4DDS A;  1IEM A;  3BFE A;  3A3D A;  3G31 A;  4N1H A;  5CGW A;  1IKI A;  1K55 C;  1ESU A;  3BLM A;  2EFU A;  1XXM A;  2BG1 A;  1M6K A;  3W8K A;  3Q82 A;  3IH9 A;  3OPR A;  4HBT A;  4JF4 A;  5E2F A;  3O87 A;  2UWX A;  3C7U A;  4MBF A;  5DF7 A;  4PM6 A;  3HLF A;  4RX3 A;  4Y7P A;  1ES5 A;  3IWO A;  4DE0 A;  3V50 A;  2Y2N A;  4JXG A;  5DF9 A;  5JYP A;  3G34 A;  4KZ6 A;  1FR6 A;  3G30 A;  2WKI A;  3ZVW A;  5CEB A;  1YLJ A;  3MZE A;  1O7E A;  1RGY A;  1PZO A;  1CK3 A;  4PM9 A;  3HBR A;  4WYY A;  3VP3 A;  4E6X A;  3SS5 A;  5EOE A;  1L0E A;  3PBN A;  1ES3 A;  2WZX A;  1H5X A;  2HP5 A;  4O7D A;  3VP2 A;  1GHP A;  1IYP A;  3GRJ A;  4FSF A;  4QD4 A;  5F1F A;  1FCN A;  1XPB A;  2DRW A;  3I7J A;  5FAP A;  1FOF A;  4X68 A;  1G68 A;  3WRT A;  4NET A;  5F83 A;  4QJG A;  3G32 A;  4JXW A;  4IBX A;  4P87 A;  3DW0 A;  1FCO A;  4BLM A;  1GCE A;  3NC8 A;  5TGF A;  1E4D A;  2Y2K A;  4OOY A;  3UE1 A;  2XF3 A;  3EQV A;  3PBR A;  3VSK A;  5CED A;  1KDS A;  3ZG9 B;  3QHY A;  4HEF A;  3ZG8 B;  4DRT A;  1FQG A;  1KE3 A;  4GDN A;  2WAD A;  1RCJ A;  5M1A A;  4C3Q A;  3FWL A;  2XK1 A;  4S2N C;  4DE3 A;  5CGS A;  1K4F A;  3G4P A;  4S2I A;  3W4O A;  1IEL A;  4MNR A;  1I2S A;  1KGE A;  2Y59 A;  3ZNT A;  4EV4 A;  3Q81 A;  1ERO A;  3OZH A;  1MKI A;  4KZ5 A;  2V20 A;  2Y2Q A;  4MBH A;  4OKP A;  3VP0 A;  4R4R A;  4PMA A;  4HBU A;  1M40 A;  4BQM A;  2ZMA A;  4GD6 A;  2Y2G A;  2OLV A;  5D3O A;  1ES4 A;  3V39 A;  1MWU A;  2JE5 A;  4BEN A;  3WWX A;  2XDM A;  3PTE A;  1KVM A;  2XFS A;  1H8Y A;  2R9W A;  1OME A;  4DKI A;  5HAP A;  3C4O A;  5EEC A;  5GLA A;  5A93 A;  1BT5 A;  4A5R A;  2GDN A;  4ZDX A;  1O07 A;  5KSH A;  1YLP A;  5AQ7 A;  4EBN A;  4GN2 A;  4LCL A;  4U0T A;  1HD8 A;  4PM7 A;  1NXY A;  1S6R A;  1HVB A;  1K57 A;  4LV3 A;  4M3K A;  5AQB A;  4S2J A;  4CPK A;  4S2P A;  3MXR A;  3NDG A;  4JF6 A;  4B4X A;  2P9V B;  4OP8 A;  3C7V A;  3V3R A;  2EX8 A;  3P98 A;  2XD5 A;  4DF6 A;  4LV2 A;  4R0Q A;  3HLG A;  4OPQ A;  2WKE A;  5FSR A;  1ONH A;  3MZD A;  1ERQ A;  5CHU A;  4R3J A;  5GHX A;  1BZA A;  4E3O A;  2P74 A;  2XR0 A;  1BLS A;  1KE0 A;  5IHV A;  1E3U D;  1N9B A;  1IYQ A;  2ZLY A;  2A3U A;  5EVI A;  2X71 A;  2FFY A;  4XXR A;  3S1Y A;  1KGF A;  3AGD A;  1NYY A;  1PYY A;  1YMX A;  1LI0 A;  4WZ5 A;  1NZU A;  2XFT A;  5TR7 A;  4Q8I A;  4OQ0 A;  1CI8 A;  4WEK A;  2XLN A;  2ZQD A;  3ZG7 B;  3IF6 B;  4BD1 A;  4IVI A;  1LLB A;  5FQK A;  3UPP A;  1SKF A;  1WYC A;  3BRM A;  3ITA A;  4PM8 A;  3WRZ A;  2BLS A;  1FR1 A;  3G2Y A;  2X02 A;  1LI9 A;  3VOZ A;  3ZFZ A;  2WUQ A;  1VM1 A;  2Y2P A;  5HAI A;  2Y2H A;  4JKT A;  4YIN A;  2ZC6 B;  2ZC7 A;  4UA6 A;  4EQI A;  2Y2M A;  3OCN A;  2IWC A;  5FAT A;  5U47 A;  4WEJ A;  3UNW A;  1IYS A;  2ZM0 A;  4R1G A;  2Q9N A;  1JTG A;  3RXW A;  3Q7V A;  4RA7 A;  2G2W A;  3ZNY A;  4B4Z A;  1BUE A;  3LY4 A;  4JLF A;  3IWQ A;  2VGJ A;  1ONG A;  2EXA A;  2ZQC A;  3MBZ A;  4N92 A;  2ZQ8 A;  1SCW A;  3OC2 A;  3UPN A;  5DTS A;  2Z2M B;  4ZJ1 A;  3ZDJ A;  4E6W A;  3QNB A;  1U60 A;  5EVI B;  2CC1 A;  5CER A;  1MBL A;  1MPL A;  1YMS A;  2WZZ A;  3LO7 A;  4RYE A;  5F82 A;  5GLC A;  1I2W A;  3B3X A;  3N6I A;  3WS5 A;  3WS2 A;  2R9X A;  2EFX A;  4JPM A;  4WMC A;  3AGF A;  2WK0 A;  5A90 A;  2PBY A;  1L0G A;  4BL2 A;  3NIA A;  4L0L A;  3GQZ A;  3PAG A;  5GL9 A;  4F94 A;  3CZD A;  4MEZ A;  3OPH A;  4KZ8 A;  2ZC5 B;  5E2E A;  3V3S A;  1YQS A;  1CI9 A;  3IQA A;  5FA7 A;  2Y55 A;  2JC7 A;  1PZP A;  3HL9 A;  3IXB A;  5GHY A;  3SH8 A;  3UE3 A;  4E3N A;  1E25 A;  4OQG A;  4QY6 A;  4WM9 A;  1NY0 A;  3SS3 A;  5FI2 A;  1YLW A;  3PBO A;  4S2L A;  3BFC A;  3W4Q A;  1K56 A;  4KG5 A;  4GOG A;  4OLD A;  4X6T A;  4Y0O A;  4P0M A;  5M18 A; 
#chains in the Genus database with same CATH topology
 2W3F A;  5KSC A;  4WEL A;  1F2K A;  3QP1 A;  3FPW A;  1PW1 A;  1MXO A;  4LRX C;  5FEG A;  4LV1 A;  3NI9 A;  4DE1 A;  4MBK A;  2XQZ A;  3FZC A;  2IWB A;  1G6A A;  2ZC3 B;  2J9P A;  4NEE D;  5L09 A;  2G7U A;  1KGG A;  4G3V A;  4N9L A;  5EE8 A;  2IA2 A;  4WUJ A;  1SKO B;  5CEC A;  3EWK A;  3A3J A;  3PR6 A;  4ZJ3 A;  3ZVT A;  2JKT M;  1GA9 A;  3W4P A;  2Q9M A;  2OWH A;  1AXB A;  5CTN A;  3HLE A;  1IFQ A;  3UDX A;  3HLC A;  3VP4 A;  2ZOI A;  1K54 A;  1SHV A;  1ERM A;  5DF8 A;  4KZA A;  1MY8 A;  1K57 C;  2BAS A;  3HLD A;  1HTZ A;  3A3E A;  3EEA A;  3RJU A;  4ZJ2 A;  4LRZ E;  1K55 A;  3MZF A;  4WBG A;  1BLP A;  1NYM A;  2Z2L B;  3FKV A;  2H28 A;  5DKK A;  2INW A;  2I72 A;  4KQO A;  1TF1 A;  1XJ3 A;  1HLU P;  3N8S A;  5FI6 A;  3K3C A;  4RX2 A;  3S4X A;  4DE2 A;  5HDS A;  3Q1F A;  3SH9 A;  4H6J B;  4KZ4 A;  3M2J A;  2Y2I A;  1S4S A;  4UEY A;  3BEB A;  1XFQ A;  4ZTK A;  3IWI A;  5L2F A;  3O3V A;  4R70 A;  1XJ6 A;  1XJ4 A;  2W3H A;  4EES A;  1JVJ A;  2ZMV A;  3NBL A;  4R23 A;  1VHM A;  4OON A;  5CHM A;  3UDF A;  2WGV A;  4QY5 A;  3JPU A;  1D7E A;  2X01 A;  4K08 A;  4S2N A;  2Y4A A;  2Y2O A;  2WGW A;  4ID4 A;  1NLY A;  3UY6 A;  4G3K A;  3IS2 B;  2Y91 A;  2OV5 A;  2HGV A;  2HP9 A;  2Y8H A;  5A92 A;  1RGZ A;  1EI5 A;  3GR2 A;  1E3U A;  1ALQ A;  3QNC A;  2P9V A;  2B5R A;  1PFL A;  3VMA A;  5E43 A;  2JHE A;  2HPB A;  3LI9 A;  3QP2 A;  4LGW A;  4N1X A;  3UO9 A;  3HRE A;  1ZKJ A;  4C6Y A;  2VA0 A;  2RL3 A;  4R38 A;  4WMC D;  4KG6 A;  5FAS A;  1P9R A;  4QU3 A;  4HIA A;  4Q0H A;  1D1J A;  2KX6 A;  4K0W A;  2ZJ9 A;  4IHQ A;  1I5Q A;  5E2H A;  3EQU A;  4KEN B;  3QP6 A;  3T4T A;  1JWP A;  1Z09 A;  3TJZ C;  2HDU A;  1K56 D;  4HES A;  4X55 A;  5F68 A;  1YT4 A;  4HP9 A;  1F98 A;  1S1Y A;  1PWD A;  1ESI A;  2V1A A;  2H10 A;  1IYO A;  3E2K A;  3N8L A;  4BBU A;  2IWD A;  4NKP A;  2A49 A;  4UAA A;  4RVA A;  4ZAM A;  1K54 C;  4R3A A;  3IHB A;  5M19 A;  3A3F A;  1FSW A;  3LCE A;  3NDE A;  3MQQ A;  3OBF A;  1GHM A;  1TDG A;  3F1O A;  3ISG A;  3SS4 A;  4HOI A;  2XA7 S;  3O5Y A;  1IEM A;  4CLC E;  4N1H A;  1K55 C;  2EFU A;  3W8K A;  5EM0 A;  4JF4 A;  5E2F A;  2UWX A;  1TS7 A;  3V50 A;  2OAQ 1;  1PZO A;  3NHQ A;  4E6X A;  3SS5 A;  2WZX A;  2HP5 A;  4FSF A;  1IYP A;  4E04 A;  2V0U A;  2V1B A;  5L10 A;  4NET A;  5F83 A;  3CUE A;  1GCE A;  4PHT A;  3UE1 A;  3EQV A;  3VSK A;  3UB7 A;  3TRC A;  4HEF A;  4DRT A;  1OT6 A;  4GDN A;  2WAD A;  1VET A;  4S2N C;  2A2L A;  4S2I A;  4HI4 A;  3ZNT A;  1IEL A;  4MNR A;  3KSI A;  2V20 A;  3BW6 A;  1M40 A;  2Y2G A;  4KUK A;  2OLV A;  1MWU A;  4MCW A;  4XT2 A;  4CQH A;  3EGX C;  3WWX A;  2OWJ A;  1KVM A;  1NWZ A;  1H8Y A;  3R7W B;  3C4O A;  1UWN X;  5GLA A;  2GDN A;  4ZDX A;  5DKL A;  5AQ7 A;  2O9C A;  1HD8 A;  1T1B A;  4JGO A;  4LV3 A;  5J3W A;  5G4Z A;  4CPK A;  4S2P A;  3NDG A;  3T4Q A;  2P9V B;  3C7V A;  2QJ5 A;  3KX0 X;  3P98 A;  4HH2 A;  4OPQ A;  3CHW P;  2KDK A;  5FSR A;  3LGO A;  1BZA A;  4E3O A;  1KE0 A;  2JKG A;  1IYQ A;  1S1Z A;  2UV0 E;  1BYW A;  4YNR A;  1PYY A;  3ICY A;  4OQ0 A;  5HD3 A;  3CIT A;  3A0R A;  1SKF A;  4PM8 A;  3WRZ A;  2JKR I;  1FR1 A;  4YIN A;  4UA6 A;  2QHK A;  5U47 A;  1IYS A;  3Q7V A;  1BUE A;  4JLF A;  2Q0O A;  3IWQ A;  3QP5 A;  5F69 A;  1ONG A;  4Q0J A;  2PYP A;  3JVU A;  3ZDJ A;  3E98 A;  3C38 A;  3KYZ A;  3VE3 A;  2EFX A;  4WMC A;  2WK0 A;  5A90 A;  3E4P A;  4L0L A;  1P9W A;  3OPH A;  4GCZ A;  3KSF A;  1YQS A;  4Y3I A;  2Y55 A;  2JC7 A;  5GHY A;  4E3N A;  1E25 A;  4QY6 A;  1NY0 A;  3SS3 A;  5EVE A;  3W4Q A;  1K56 A;  4X6T A;  4Y15 A;  5KIZ A;  4P0M A;  2ZQ7 A;  5FQ9 A;  3CUE C;  4RQ9 A;  4WN5 A;  3A0S A;  5AQ9 A;  2RCX A;  2GX5 A;  1NJ4 A;  3GTC A;  1PW8 A;  3ITB A;  4K0X A;  2WGI A;  4DJ2 A;  3BFF A;  2J9O A;  1KE4 A;  1JWZ A;  2B02 A;  4OOM A;  4LPZ A;  4GB7 A;  4OVD A;  1TS0 A;  2ZM8 A;  3P09 A;  3MS6 A;  1TDL A;  1VET B;  5KMW A;  3MXQ A;  2QPN A;  4P6Z S;  1ZC2 A;  3LUQ A;  1D06 A;  1NLZ A;  5AJG A;  3IF6 C;  2I9V A;  1KDW A;  4FH2 A;  3LR4 A;  1XP4 A;  1IKG A;  1GHI A;  1C3B A;  1CEF A;  4XT2 B;  1IOU A;  3MFX A;  4E3J A;  4GLQ A;  3BY8 A;  4BL3 A;  3B42 A;  1VQQ A;  3CAX A;  2K7S A;  1JTD A;  2WAE A;  4IVK A;  2XH9 A;  4XUX A;  4CLC B;  3T1R A;  2EX9 A;  1ZG4 A;  1W8Y A;  4UHU A;  2WKQ A;  5EV0 A;  5FEF A;  3PBQ A;  4PPR A;  3T4O A;  3H7W B;  3TSG A;  5HAQ A;  2PR5 A;  5G18 A;  1A0K A;  2ZQ9 A;  4MMN A;  1UWP X;  3K2N A;  2Y79 A;  4OP5 A;  5JYO A;  4GHI B;  5EUA A;  4KZ9 A;  2CMN A;  3GMW A;  1K4E A;  2HDR A;  1YM1 A;  5IT5 A;  4NXF A;  5HL6 A;  4HNB A;  2B18 A;  3M6B A;  1ES2 A;  2V8C A;  1BLH A;  3DTM A;  2EX2 A;  4K91 A;  1BTL A;  4FD8 A;  2WYX A;  3PBT A;  4BD0 A;  5MC7 A;  2PHY A;  5F1G A;  1YKD A;  5HX9 A;  3Q7V B;  1W5D A;  1RP5 A;  3CG5 A;  2WKH A;  2PU2 A;  5LBR A;  3VSL A;  2VX8 A;  2J8Y A;  3IXG A;  3M2K A;  3UB5 P;  1LT0 A;  3SZT A;  1W79 A;  5AQA A;  2P7J A;  4NG2 A;  3O86 A;  3Q7Z A;  3LID A;  1N4O A;  3LY3 A;  4DXB A;  1K38 A;  2O9B A;  3VFF A;  4OOL A;  3T1Q B;  1S66 L;  2DNS A;  4EU0 A;  2WKP A;  2QMI A;  4PKY G;  2W3G A;  3RFB A;  4DXC A;  3BM6 A;  3OPL A;  3KSG A;  2XA7 M;  3FYZ A;  4FTX A;  5GLD A;  1V9Z A;  4UA7 A;  5EVL A;  2EXB A;  5BOH A;  1BLC A;  1CEG A;  3GV9 A;  3F1N A;  4H8R A;  2JCH A;  1XGJ A;  1NRF A;  5I94 A;  1NZO A;  4U0X A;  1SZV A;  1Z6F A;  4FOF A;  1T19 A;  4E3M A;  4BWI A;  4ESP A;  3UMD A;  4E3L A;  4R4S A;  1W8Q A;  1LHY A;  4CLC D;  5HW3 A;  2HDS A;  4FCF A;  3N8R A;  2ZM2 A;  1L2S A;  4DDS A;  3BFE A;  3T4S A;  1PRQ A;  1ESU A;  3BLM A;  3KYQ A;  3Q82 A;  3IH9 A;  3C7U A;  5DF7 A;  4MBF A;  4PM6 A;  3IWO A;  2Y2N A;  4JXG A;  1MZU A;  5JYP A;  1Y4O A;  1OJ5 A;  4KZ6 A;  1FR6 A;  4PM9 A;  3HBR A;  2EWV A;  1ES3 A;  1H5X A;  1OTD A;  2VEA A;  1OJG A;  2DRW A;  5FAP A;  3R7W A;  3WRT A;  3G32 A;  4JXW A;  3F1P A;  4IBX A;  4L9E A;  1N9O A;  2M7U A;  4BLM A;  2PT7 A;  2J3T D;  4B9O A;  3QHY A;  1FQG A;  3H82 B;  3NJA A;  4HJ3 A;  3KSH A;  1FIL A;  2Y59 A;  5C5K A;  4NXG A;  3Q81 A;  1ERO A;  3OZH A;  1MKI A;  4OKP A;  1J3W A;  1VB6 A;  3VP0 A;  4HBU A;  4QWO A;  2JE5 A;  2NUT C;  2XFS A;  2PYR A;  4BBV A;  3LI8 A;  1DP8 A;  1YSQ A;  1O07 A;  4EER A;  5KSH A;  4GN2 A;  1S6R A;  1HVB A;  1MKM A;  5AQB A;  4I39 A;  3MXR A;  4JF6 A;  4NXE A;  2A24 B;  3BQA A;  4LV2 A;  3T1X A;  2ZL1 B;  2VLG A;  2WKE A;  4L9G A;  5CHU A;  2XR0 A;  5IHV A;  2FH5 A;  2GJ3 A;  4DJ3 A;  2A3U A;  2X71 A;  2FFY A;  3S1Y A;  3AGD A;  3NOU C;  1LI0 A;  4WZ5 A;  1NZU A;  2XFT A;  1N9L A;  4Q8I A;  3DAV A;  4WEK A;  2XLN A;  4EET B;  3D3O A;  3UPP A;  3RH8 B;  4X1L A;  2PRF A;  2X02 A;  5HAI A;  4I3I A;  2O0Y A;  4Y17 A;  2W1T B;  2IWC A;  4WEJ A;  2ZM0 A;  5DFX A;  3RXW A;  4RA7 A;  2G2W A;  4B4Z A;  3LY4 A;  3F1N B;  2EXA A;  1P97 A;  3E4Q A;  2Z2M B;  3QNB A;  5EVI B;  3VE4 A;  3B47 A;  1YMS A;  2WZZ A;  3LO7 A;  4RYE A;  1I2W A;  3N6I A;  3WS2 A;  4WL9 A;  2PBY A;  4BL2 A;  1AWI A;  4BMW A;  4GJ4 A;  5GL9 A;  3S7Q A;  1CI9 A;  3P7N A;  1PZP A;  3IXB A;  3UE3 A;  2W0N A;  1ZHH B;  4Y0O A;  4NK3 A;  4Y2F A;  1EW0 A;  1PNE A;  4P6Z M;  5HWV A;  4EQ1 A;  2K31 A;  4UA9 A;  3C4P A;  2ZQA A;  3S7N A;  4D2O A;  2QZ6 A;  3BJN A;  3E2L A;  1FCM A;  4MLL A;  5CX7 A;  3UE0 A;  3TE8 A;  3HLW A;  3IH8 A;  2D02 A;  2O9A A;  4Y0T A;  4OPZ A;  5CGX A;  3NOT C;  4M4X A;  4GW9 A;  3VOY A;  3F1P B;  3HVF A;  1YLT A;  3HLB A;  2HF6 A;  3EGD C;  4CLC A;  2OSU A;  1JWV A;  1K6R A;  2W27 A;  3HUO A;  3NY4 A;  1BUL A;  4LFU A;  4EWF A;  2VV7 A;  1XJ2 A;  5HAR A;  3IX8 A;  3SOI A;  3N4I A;  1VEU B;  3MR0 A;  2P04 A;  3MSH A;  3GSG A;  3H7W A;  2VGK A;  2WKR A;  3JVV A;  5EFW A;  4LLO B;  1GA0 A;  5TJJ A;  4UQI S;  4GHI A;  2Y2J A;  3HUN A;  4EW7 A;  3SW1 A;  5K5B A;  4HJ4 A;  3OPP A;  3MFD A;  2E8J A;  3B33 A;  1TS6 A;  3H9W A;  2B95 A;  2QYB A;  4Y0U A;  3WS1 A;  3VV4 A;  2G2U A;  4EBL A;  2OLU A;  4WLA A;  3CJM A;  1K6S A;  4WZ5 C;  2VK3 A;  4S2K A;  3OLO A;  4XUZ A;  1PI4 A;  1H8Z A;  4KUO A;  1OPX A;  1J9M A;  3ZG5 A;  5E2G A;  1XA7 A;  3R4K A;  2QJ7 A;  3IT9 A;  2JKF A;  3DWK A;  4KZB A;  1FIK A;  3MF0 A;  3OCL A;  3UN7 A;  1WYB A;  5HL1 A;  1DP9 A;  5CXW A;  4GDB A;  1L0D A;  1OTA A;  1W7F A;  3T4L A;  3FC7 A;  5EVI D;  1JNU A;  2HJ9 C;  1QMF A;  5DTK A;  3C2W A;  4BJP A;  1LL8 A;  2J7V A;  3LR5 A;  4JBF A;  3BYD A;  4ZBE A;  5FQJ A;  1Q2P A;  3E4O A;  1XX2 A;  3KYE A;  5DTT A;  2XGN A;  4KZ7 A;  3VFH A;  3EEH A;  5FQQ A;  2M7V A;  4X69 A;  3AGE A;  3UDI A;  4HHD A;  2Z6D A;  3LIE A;  3UE6 A;  1L0F A;  4OPR A;  3VP1 A;  4LEN A;  3UPO A;  1PIO A;  3LEQ A;  3IHA A;  3MKE A;  4E3I A;  2GZA A;  1YLZ A;  3HUM A;  1MWT A;  4OPY A;  4CJN A;  2QWS A;  2V2F F;  4EUZ A;  5DJU A;  3IF5 A;  1WE4 A;  2PD8 A;  2E8I A;  3LIC A;  5FQI A;  5A91 A;  2H5S A;  3TOI A;  3D4F A;  2ZBB A;  3MXS A;  3FV7 A;  3ZHH A;  4IJG A;  3LIA A;  3WS4 A;  1KVL A;  3BEC A;  4YFM A;  2VJW A;  1T1A A;  3W2Z A;  4JXV A;  5GLB A;  5G4Y A;  4CLC C;  1OT9 A;  2OOL A;  4OQH A;  1XGI A;  2XD1 A;  3UB8 A;  2ZOH A;  1F9I A;  1V9Y A;  2PD7 A;  2NUP C;  2W3E A;  4E3K A;  4GZB A;  4AFI A;  2VKS A;  2C5W B;  2C6W B;  5TFQ A;  3DTI A;  2HP6 A;  4KG2 A;  3MQ0 A;  5HFO A;  4C75 A;  2V1Z A;  3PBS A;  3GVB A;  4DDY A;  3CI6 A;  1MWS A;  3DBA A;  1QME A;  3A3D A;  3G31 A;  5CGW A;  3H82 A;  4HBT A;  2J3T C;  3O87 A;  1LSW A;  3HLF A;  4EEP A;  2W3D A;  5DF9 A;  3G34 A;  4MDZ A;  2WKI A;  3ZVW A;  2JKT I;  4ETX A;  4GS9 A;  1O7E A;  1RGY A;  3GEC A;  5EOE A;  1ODV A;  3TW8 A;  3VP2 A;  4QD4 A;  5F1F A;  2D01 A;  4R6L A;  4X68 A;  2YKF A;  3ZQ5 A;  2DMW A;  3DW0 A;  1FCO A;  3NC8 A;  2ZMF A;  2Y2K A;  1ACF A;  3PBR A;  5CED A;  1KDS A;  2VZW A;  4HH3 A;  4QPR A;  3LIF A;  1RCJ A;  5HWT A;  5M1A A;  2A24 A;  4C3Q A;  4JGQ A;  4DE3 A;  2ZL1 A;  3W4O A;  1I2S A;  3IX3 A;  5FL3 A;  4KZ5 A;  4PMA A;  4BQM A;  5A8B A;  3FG8 A;  4GD6 A;  5D3O A;  1CQA A;  4PAU A;  4BEN A;  2XDM A;  4ME4 A;  2R9W A;  1OME A;  1DP6 A;  4DKI A;  1G6O A;  5HAP A;  5EEC A;  1BT5 A;  2HZ5 A;  1YLP A;  5I5L A;  5F6A A;  1H8M A;  1LSX A;  2W1T A;  2VGL S;  2XD5 A;  3HLG A;  1ERQ A;  3CPT A;  4R3J A;  2P74 A;  3IBR A;  3UB6 A;  4YOF A;  5EVI A;  1W63 M;  1NYY A;  2PAV P;  1YMX A;  2XSS A;  2W1R A;  5TR7 A;  3KO6 A;  1CI8 A;  3ZG7 B;  4BD1 A;  4IVI A;  1LLB A;  5FQK A;  1WYC A;  3BRM A;  4F3L B;  2BLS A;  1OTB A;  1LI9 A;  3IBJ A;  3ZFZ A;  3E0Y A;  1YSP A;  2WUQ A;  1VM1 A;  2Y2P A;  3UME A;  2ZC6 B;  5HD5 A;  5FAT A;  3OCN A;  4R1G A;  2Q9N A;  1JTG A;  3C30 A;  3L7H A;  3ZNY A;  4YWZ A;  3PYP A;  1YPR A;  4N92 A;  2ZQ8 A;  4WF0 A;  3OC2 A;  3UPN A;  2Z6C A;  5DTS A;  3T12 B;  3NEC A;  4ZJ1 A;  4E6W A;  2CC1 A;  1MBL A;  1MPL A;  4IUK A;  5F82 A;  3B3X A;  3WS5 A;  4L9F A;  1L0G A;  4IUH A;  3NIA A;  4F94 A;  4MEZ A;  2ZC5 B;  3V3S A;  3RTY A;  5J7E A;  3HCY A;  1W63 Q;  2VV8 A;  3HL9 A;  1XFN A;  1K0K A;  4OQG A;  3MMH A;  4DMZ A;  3LYX A;  1YLW A;  3PBO A;  4S2L A;  3BFC A;  4O8G A;  3ZGA B;  1VEU A;  3ZCZ A;  4LV0 A;  4GS9 B;  2Y2L A;  3JYI A;  2XEP A;  3V67 A;  3HJK A;  1G28 A;  4UQI M;  4PM5 A;  1CF0 A;  3G2Z A;  1YLY A;  2LB5 A;  3BWL A;  1LSV A;  4GNU A;  3T50 A;  1CJF A;  4KQD A;  4OH0 A;  1LL9 A;  1X0O A;  1T18 A;  1SDN A;  2HDQ A;  4O01 A;  5DJT A;  3GDI A;  3C8C A;  3UB9 A;  3O88 A;  1DJC A;  1G5U A;  5GHZ A;  3DTK A;  3IXD A;  3LIB A;  3OOV A;  4IED A;  5TBM A;  4R3B A;  3S22 A;  1S67 L;  2PU4 A;  5HSQ A;  5FAQ A;  4Y13 A;  5EPH A;  5J4E A;  4I38 A;  4IBR A;  4KQR A;  2EA9 A;  3RXX A;  3BLS A;  5HPF A;  5FDH A;  4OQI A;  1K25 A;  5KZH A;  3U4L P;  2ZC4 B;  5DFY A;  1F5M A;  3BQ8 A;  1LL5 A;  5CHJ A;  1MWR A;  2EWW A;  4Y5F A;  2R78 A;  2JBF A;  4EEU A;  1WA9 A;  3TG9 A;  5EVI C;  1PI5 A;  4X53 A;  2GNX A;  2ACG A;  1DY6 A;  1Y54 A;  4EUV A;  2M1C A;  3QP8 A;  4X56 A;  3CPT B;  2XRO A;  4Z9Q A;  2HJE A;  4QHC A;  1XA1 A;  3ZYT A;  4JGP A;  4ETZ A;  2H0T A;  3V5M A;  4JXS A;  2V8F A;  4BBT A;  4QB8 A;  1PWG A;  4U3T A;  4MN5 A;  3IX4 A;  3IXH A;  4O0P A;  1FSY A;  1GSX A;  3PAE A;  2H0Y A;  3SH7 A;  5HDC A;  3Q07 A;  1NRJ A;  3LR0 A;  4S2O A;  2LB9 A;  3WS0 A;  3A0V A;  4S2M A;  5FI7 A;  1DJB A;  4B93 A;  4G3W A;  3ZG0 A;  2KOI A;  2QKP A;  2XRN A;  3T1S A;  4DN0 A;  4ARZ A;  1ZG6 A;  4HP4 A;  1SDE A;  3A3I A;  1TEM A;  1XKZ A;  3FPV A;  4HY8 A;  4KQQ A;  2WAF A;  2ZD8 A;  1OTI A;  1GSV A;  2K2N A;  5J8X A;  3CMZ A;  4EBP A;  2FFF B;  3BFG A;  1OTE A;  4LCM A;  5FAO A;  3T4K A;  3CLO A;  3G35 A;  1STZ A;  4WZ4 A;  4OLG A;  3N7W A;  2DCF A;  4B88 A;  3HJI A;  1DJA A;  3MKF A;  1PWC A;  4I3A A;  2MJ6 A;  2JN7 A;  2WGW B;  3LEZ A;  4HQA A;  1EWZ A;  1GSW A;  4KZ3 A;  3MJQ A;  5FQM A;  3IF6 A;  3BFD A;  4FH4 A;  2BTF P;  5CTM A;  5HZH A;  4I3J A;  5CRF A;  3FKW A;  3M6H A;  4NXB A;  4GD8 A;  4P6B A;  5HDD A;  3NCK A;  4N9K A;  2PR6 A;  4JF5 A;  4MN6 A;  1BSG A;  1TVF A;  3DWZ A;  2EX6 A;  5EOO A;  3BY9 A;  5IS1 A;  1HZO A;  2L0W A;  5DVA A;  4P85 A;  5TBM B;  2AVX A;  4GKU A;  2J3W A;  1L3L A;  1S0W A;  2V9A A;  1Q2Q A;  2O99 A;  3PHY A;  3C5A A;  1S4R A;  3ULF A;  1IKI A;  5L07 A;  4D60 A;  1TS8 A;  1XXM A;  2BG1 A;  1M6K A;  2V0W A;  3D9Y A;  3OPR A;  1N9N A;  4RX3 A;  4Y7P A;  1ES5 A;  4DE0 A;  4I5S A;  3G30 A;  5CEB A;  1YLJ A;  3MZE A;  1CK3 A;  3D72 A;  3LFV A;  4WYY A;  3VP3 A;  1L0E A;  3PBN A;  3DTE A;  2FZ0 A;  4O7D A;  1GHP A;  3GRJ A;  3S7P A;  1FCN A;  2YKH A;  1XPB A;  3F1O B;  3I7J A;  1FOF A;  4II7 A;  1G68 A;  4QJG A;  4P87 A;  5TGF A;  1E4D A;  4OOY A;  2XF3 A;  1H3Q A;  2L1M A;  3ZG9 B;  3ZG8 B;  1SKO A;  1KE3 A;  5L8M A;  3FWL A;  2XK1 A;  2JKR M;  5CGS A;  1K4F A;  3G4P A;  5AVF A;  5IU1 A;  5HWW A;  2VGL M;  4EV4 A;  1KGE A;  2Y2Q A;  4MBH A;  5AVE A;  2J80 A;  4R4R A;  2HV1 A;  2ZMA A;  3P01 A;  1ES4 A;  3V39 A;  5HPI A;  3PXP A;  3PTE A;  1KOU A;  4ARZ B;  5A93 A;  4A5R A;  1Y28 A;  4F3L A;  2VV6 A;  4EBN A;  4LCL A;  4U0T A;  4PM7 A;  1NXY A;  1YAX A;  3NUL A;  1K57 A;  3CWF A;  4M3K A;  1MC0 A;  4FUW A;  4JGR A;  4S2J A;  4HJ6 A;  4B4X A;  2PBD P;  4OP8 A;  3V3R A;  3K3D A;  2EX8 A;  1T1C A;  4DF6 A;  3L9K A;  4R0Q A;  2OAP 1;  1H0M A;  3T4J A;  1ONH A;  3MZD A;  4LRY C;  5GHX A;  4PKY A;  1BLS A;  1E3U D;  1N9B A;  2ZLY A;  2PDR A;  4H6J A;  4XXR A;  2KLI A;  1KGF A;  3S7O A;  4X25 A;  4Z1W A;  3EOI A;  1ZTU A;  4Q0I A;  2ZQD A;  3IF6 B;  3VOL A;  3ITA A;  3U2A A;  5FDS A;  1UGU A;  1P0Z A;  3G2Y A;  3VOZ A;  3LR3 A;  4MN7 A;  5EM1 A;  2Y2H A;  4JKT A;  2L4R A;  2ZC7 A;  4EQI A;  2Y2M A;  3UNW A;  3IS2 A;  2VGJ A;  2ZQC A;  3MBZ A;  2P08 A;  1SCW A;  3NOP C;  1U60 A;  5CER A;  5F5Y A;  5GLC A;  2R9X A;  4JPM A;  3AGF A;  3QP4 A;  4ZRR A;  3GQZ A;  3PAG A;  4X1M A;  3CZD A;  5E2E A;  4KZ8 A;  3IQA A;  5FA7 A;  3SH8 A;  4WM9 A;  1DRM A;  4EXO A;  3G6O A;  5FI2 A;  4KG5 A;  4GOG A;  4OLD A;  3MQO A;  5M18 A;  1TD5 A; 
#chains in the Genus database with same CATH homology
 3ZGA B;  4NK3 A;  3ZCZ A;  5KSC A;  2ZQ7 A;  5FQ9 A;  4LV0 A;  4UA9 A;  3C4P A;  4WEL A;  2ZQA A;  2Y2L A;  1PW1 A;  1MXO A;  4D2O A;  3JYI A;  2XEP A;  2QZ6 A;  4LV1 A;  3E2L A;  1FCM A;  3NI9 A;  5AQ9 A;  2RCX A;  4MLL A;  4DE1 A;  4MBK A;  3UE0 A;  4PM5 A;  1NJ4 A;  3HLW A;  2XQZ A;  3GTC A;  3IH8 A;  1PW8 A;  3G2Z A;  3ITB A;  4Y0T A;  4OPZ A;  3FZC A;  5CGX A;  2IWB A;  1YLY A;  1G6A A;  4K0X A;  2WGI A;  2ZC3 B;  3VOY A;  2J9P A;  4GNU A;  3BFF A;  2J9O A;  1KE4 A;  1JWZ A;  3HVF A;  1YLT A;  3HLB A;  1KGG A;  4N9L A;  4OH0 A;  5EE8 A;  4OOM A;  2OSU A;  1JWV A;  1LL9 A;  1K6R A;  3HUO A;  3NY4 A;  4GB7 A;  4OVD A;  2ZM8 A;  1BUL A;  1SDN A;  2HDQ A;  5CEC A;  3P09 A;  4EWF A;  3A3J A;  1TDL A;  5KMW A;  5HAR A;  2QPN A;  4ZJ3 A;  3SOI A;  3ZVT A;  1ZC2 A;  1GA9 A;  3O88 A;  2Q9M A;  3W4P A;  1DJC A;  3N4I A;  3IXD A;  5GHZ A;  4IED A;  4R3B A;  1AXB A;  5CTN A;  3S22 A;  3GSG A;  3HLE A;  2PU4 A;  3IF6 C;  1KDW A;  4FH2 A;  3UDX A;  5FAQ A;  2VGK A;  3HLC A;  1XP4 A;  3VP4 A;  1IKG A;  1GHI A;  1K54 A;  1GA0 A;  1SHV A;  1ERM A;  5DF8 A;  5EPH A;  4KZA A;  1C3B A;  2Y2J A;  1MY8 A;  4IBR A;  1K57 C;  1CEF A;  3HUN A;  4KQR A;  3RXX A;  3BLS A;  5FDH A;  4OQI A;  4E3J A;  1K25 A;  5KZH A;  4BL3 A;  3HLD A;  1VQQ A;  1HTZ A;  2ZC4 B;  3A3E A;  1JTD A;  2WAE A;  3OPP A;  3MFD A;  1LL5 A;  3RJU A;  5CHJ A;  4ZJ2 A;  1MWR A;  4IVK A;  2XH9 A;  4XUX A;  2JBF A;  1K55 A;  2EX9 A;  1ZG4 A;  1W8Y A;  4Y0U A;  3MZF A;  3WS1 A;  3TG9 A;  4WBG A;  1BLP A;  1NYM A;  2G2U A;  5EVI C;  2Z2L B;  3FKV A;  4UHU A;  1PI5 A;  4X53 A;  4EBL A;  2OLU A;  3CJM A;  1K6S A;  3PBQ A;  2I72 A;  1DY6 A;  4WZ5 C;  4KQO A;  4PPR A;  1Y54 A;  4S2K A;  4XUZ A;  4X56 A;  3TSG A;  5HAQ A;  1PI4 A;  3N8S A;  1H8Z A;  4Z9Q A;  5FI6 A;  1J9M A;  5G18 A;  3ZG5 A;  4RX2 A;  5E2G A;  1XA7 A;  3S4X A;  4QHC A;  1XA1 A;  4DE2 A;  2ZQ9 A;  3IT9 A;  3Q1F A;  3DWK A;  3SH9 A;  4KZB A;  4OP5 A;  2H0T A;  3V5M A;  5JYO A;  4JXS A;  3OCL A;  4KZ4 A;  5EUA A;  3M2J A;  3UN7 A;  2Y2I A;  4KZ9 A;  1WYB A;  4QB8 A;  3BEB A;  3GMW A;  1K4E A;  4ZTK A;  5HL1 A;  3IWI A;  5L2F A;  1PWG A;  2HDR A;  3O3V A;  1YM1 A;  5CXW A;  4U3T A;  4GDB A;  1L0D A;  1W7F A;  3IXH A;  1JVJ A;  1FSY A;  3M6B A;  3NBL A;  4R23 A;  1ES2 A;  5EVI D;  3PAE A;  2H0Y A;  3SH7 A;  1BLH A;  3DTM A;  2EX2 A;  4K91 A;  3Q07 A;  4OON A;  1QMF A;  5CHM A;  3UDF A;  1BTL A;  2WGV A;  4QY5 A;  5DTK A;  4S2O A;  4FD8 A;  2WYX A;  4BJP A;  2X01 A;  3PBT A;  2J7V A;  3WS0 A;  4S2M A;  4S2N A;  4BD0 A;  5FI7 A;  1DJB A;  2Y4A A;  4JBF A;  2Y2O A;  2WGW A;  4ID4 A;  3BYD A;  4ZBE A;  3ZG0 A;  5FQJ A;  5F1G A;  1Q2P A;  3UY6 A;  2Y91 A;  3Q7V B;  1XX2 A;  5HX9 A;  1W5D A;  5DTT A;  1RP5 A;  1ZG6 A;  2XGN A;  3CG5 A;  2OV5 A;  2WKH A;  1SDE A;  2PU2 A;  4KZ7 A;  5FQQ A;  3VFH A;  3A3I A;  3VSL A;  2HP9 A;  4X69 A;  1TEM A;  3AGE A;  5A92 A;  3UDI A;  1RGZ A;  2J8Y A;  1EI5 A;  1XKZ A;  3IXG A;  3GR2 A;  4KQQ A;  1L0F A;  2WAF A;  4OPR A;  1E3U A;  3VP1 A;  2ZD8 A;  4LEN A;  1ALQ A;  3QNC A;  2P9V A;  5J8X A;  3UPO A;  2B5R A;  1PIO A;  3CMZ A;  3M2K A;  4EBP A;  3VMA A;  2FFF B;  3BFG A;  3IHA A;  4LCM A;  3MKE A;  5E43 A;  4E3I A;  5FAO A;  1YLZ A;  2HPB A;  3HUM A;  1MWT A;  3G35 A;  4N1X A;  4OPY A;  4CJN A;  3UO9 A;  1W79 A;  2V2F F;  5AQA A;  3HRE A;  4WZ4 A;  4EUZ A;  4OLG A;  3O86 A;  3N7W A;  2DCF A;  3Q7Z A;  1ZKJ A;  4C6Y A;  2RL3 A;  3IF5 A;  4WMC D;  4B88 A;  1WE4 A;  4KG6 A;  1DJA A;  3MKF A;  1N4O A;  1PWC A;  3LY3 A;  2E8I A;  4DXB A;  5FAS A;  4QU3 A;  5FQI A;  2WGW B;  5A91 A;  1K38 A;  3VFF A;  3LEZ A;  1EWZ A;  2H5S A;  4OOL A;  4K0W A;  2DNS A;  3TOI A;  3D4F A;  4KZ3 A;  5FQM A;  2ZJ9 A;  3IF6 A;  3BFD A;  1I5Q A;  3MXS A;  3FV7 A;  5E2H A;  4FH4 A;  3ZHH A;  2QMI A;  3EQU A;  3WS4 A;  1KVL A;  3BEC A;  4KEN B;  4YFM A;  4DXC A;  3BM6 A;  3OPL A;  4JXV A;  5CTM A;  1JWP A;  5GLB A;  5CRF A;  2HDU A;  3FYZ A;  1K56 D;  3FKW A;  4OQH A;  1XGI A;  2XD1 A;  4HES A;  4X55 A;  5GLD A;  1YT4 A;  3M6H A;  4UA7 A;  4GD8 A;  2EXB A;  5EVL A;  4P6B A;  1PWD A;  5BOH A;  1BLC A;  1CEG A;  3GV9 A;  1ESI A;  2H10 A;  4H8R A;  1IYO A;  2JCH A;  3E2K A;  3N8L A;  1XGJ A;  1NRF A;  4GZB A;  4E3K A;  5I94 A;  3NCK A;  4N9K A;  4JF5 A;  2IWD A;  1NZO A;  1BSG A;  2A49 A;  4U0X A;  4UAA A;  1TVF A;  2C5W B;  4RVA A;  2C6W B;  4ZAM A;  1K54 C;  1Z6F A;  3DWZ A;  2EX6 A;  3IHB A;  5TFQ A;  4E3M A;  5M19 A;  2HP6 A;  4KG2 A;  3A3F A;  5EOO A;  1FSW A;  3LCE A;  3NDE A;  1HZO A;  5DVA A;  1GHM A;  1TDG A;  4E3L A;  4P85 A;  3ISG A;  4R4S A;  5HFO A;  1W8Q A;  3SS4 A;  4C75 A;  2V1Z A;  1LHY A;  4GKU A;  1S0W A;  5HW3 A;  2HDS A;  3PBS A;  3GVB A;  4DDY A;  3N8R A;  1Q2Q A;  4FCF A;  2ZM2 A;  3C5A A;  1L2S A;  1MWS A;  1QME A;  4DDS A;  1IEM A;  3BFE A;  3A3D A;  3G31 A;  4N1H A;  5CGW A;  1IKI A;  1K55 C;  1ESU A;  3BLM A;  2EFU A;  1XXM A;  2BG1 A;  1M6K A;  3W8K A;  3Q82 A;  3IH9 A;  3OPR A;  4HBT A;  4JF4 A;  5E2F A;  3O87 A;  2UWX A;  3C7U A;  4MBF A;  5DF7 A;  4PM6 A;  3HLF A;  4RX3 A;  4Y7P A;  1ES5 A;  3IWO A;  4DE0 A;  3V50 A;  2Y2N A;  4JXG A;  5DF9 A;  5JYP A;  3G34 A;  4KZ6 A;  1FR6 A;  3G30 A;  2WKI A;  3ZVW A;  5CEB A;  1YLJ A;  3MZE A;  1O7E A;  1RGY A;  1PZO A;  1CK3 A;  4PM9 A;  3HBR A;  4WYY A;  3VP3 A;  4E6X A;  3SS5 A;  5EOE A;  1L0E A;  3PBN A;  1ES3 A;  2WZX A;  1H5X A;  2HP5 A;  4O7D A;  3VP2 A;  1GHP A;  1IYP A;  3GRJ A;  4FSF A;  4QD4 A;  5F1F A;  1FCN A;  1XPB A;  2DRW A;  3I7J A;  5FAP A;  1FOF A;  4X68 A;  1G68 A;  3WRT A;  4NET A;  5F83 A;  4QJG A;  3G32 A;  4JXW A;  4IBX A;  4P87 A;  3DW0 A;  1FCO A;  4BLM A;  1GCE A;  3NC8 A;  5TGF A;  1E4D A;  2Y2K A;  4OOY A;  3UE1 A;  2XF3 A;  3EQV A;  3PBR A;  3VSK A;  5CED A;  1KDS A;  3ZG9 B;  3QHY A;  4HEF A;  3ZG8 B;  4DRT A;  1FQG A;  1KE3 A;  4GDN A;  2WAD A;  1RCJ A;  5M1A A;  4C3Q A;  3FWL A;  2XK1 A;  4S2N C;  4DE3 A;  5CGS A;  1K4F A;  3G4P A;  4S2I A;  3W4O A;  1IEL A;  4MNR A;  1I2S A;  1KGE A;  2Y59 A;  3ZNT A;  4EV4 A;  3Q81 A;  1ERO A;  3OZH A;  1MKI A;  4KZ5 A;  2V20 A;  2Y2Q A;  4MBH A;  4OKP A;  3VP0 A;  4R4R A;  4PMA A;  4HBU A;  1M40 A;  4BQM A;  2ZMA A;  4GD6 A;  2Y2G A;  2OLV A;  5D3O A;  1ES4 A;  3V39 A;  1MWU A;  2JE5 A;  4BEN A;  3WWX A;  2XDM A;  3PTE A;  1KVM A;  2XFS A;  1H8Y A;  2R9W A;  1OME A;  4DKI A;  5HAP A;  3C4O A;  5EEC A;  5GLA A;  5A93 A;  1BT5 A;  4A5R A;  2GDN A;  4ZDX A;  1O07 A;  5KSH A;  1YLP A;  5AQ7 A;  4EBN A;  4GN2 A;  4LCL A;  4U0T A;  1HD8 A;  4PM7 A;  1NXY A;  1S6R A;  1HVB A;  1K57 A;  4LV3 A;  4M3K A;  5AQB A;  4S2J A;  4CPK A;  4S2P A;  3MXR A;  3NDG A;  4JF6 A;  4B4X A;  2P9V B;  4OP8 A;  3C7V A;  3V3R A;  2EX8 A;  3P98 A;  2XD5 A;  4DF6 A;  4LV2 A;  4R0Q A;  3HLG A;  4OPQ A;  2WKE A;  5FSR A;  1ONH A;  3MZD A;  1ERQ A;  5CHU A;  4R3J A;  5GHX A;  1BZA A;  4E3O A;  2P74 A;  2XR0 A;  1BLS A;  1KE0 A;  5IHV A;  1E3U D;  1N9B A;  1IYQ A;  2ZLY A;  2A3U A;  5EVI A;  2X71 A;  2FFY A;  4XXR A;  3S1Y A;  1KGF A;  3AGD A;  1NYY A;  1PYY A;  1YMX A;  1LI0 A;  4WZ5 A;  1NZU A;  2XFT A;  5TR7 A;  4Q8I A;  4OQ0 A;  1CI8 A;  4WEK A;  2XLN A;  2ZQD A;  3ZG7 B;  3IF6 B;  4BD1 A;  4IVI A;  1LLB A;  5FQK A;  3UPP A;  1SKF A;  1WYC A;  3BRM A;  3ITA A;  4PM8 A;  3WRZ A;  2BLS A;  1FR1 A;  3G2Y A;  2X02 A;  1LI9 A;  3VOZ A;  3ZFZ A;  2WUQ A;  1VM1 A;  2Y2P A;  5HAI A;  2Y2H A;  4JKT A;  4YIN A;  2ZC6 B;  2ZC7 A;  4UA6 A;  4EQI A;  2Y2M A;  3OCN A;  2IWC A;  5FAT A;  5U47 A;  4WEJ A;  3UNW A;  1IYS A;  2ZM0 A;  4R1G A;  2Q9N A;  1JTG A;  3RXW A;  3Q7V A;  4RA7 A;  2G2W A;  3ZNY A;  4B4Z A;  1BUE A;  3LY4 A;  4JLF A;  3IWQ A;  2VGJ A;  1ONG A;  2EXA A;  2ZQC A;  3MBZ A;  4N92 A;  2ZQ8 A;  1SCW A;  3OC2 A;  3UPN A;  5DTS A;  2Z2M B;  4ZJ1 A;  3ZDJ A;  4E6W A;  3QNB A;  1U60 A;  5EVI B;  2CC1 A;  5CER A;  1MBL A;  1MPL A;  1YMS A;  2WZZ A;  3LO7 A;  4RYE A;  5F82 A;  5GLC A;  1I2W A;  3B3X A;  3N6I A;  3WS5 A;  3WS2 A;  2R9X A;  2EFX A;  4JPM A;  4WMC A;  3AGF A;  2WK0 A;  5A90 A;  2PBY A;  1L0G A;  4BL2 A;  3NIA A;  4L0L A;  3GQZ A;  3PAG A;  5GL9 A;  4F94 A;  3CZD A;  4MEZ A;  3OPH A;  4KZ8 A;  2ZC5 B;  5E2E A;  3V3S A;  1YQS A;  1CI9 A;  3IQA A;  5FA7 A;  2Y55 A;  2JC7 A;  1PZP A;  3HL9 A;  3IXB A;  5GHY A;  3SH8 A;  3UE3 A;  4E3N A;  1E25 A;  4OQG A;  4QY6 A;  4WM9 A;  1NY0 A;  3SS3 A;  5FI2 A;  1YLW A;  3PBO A;  4S2L A;  3BFC A;  3W4Q A;  1K56 A;  4KG5 A;  4GOG A;  4OLD A;  4X6T A;  4Y0O A;  4P0M A;  5M18 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...