3UMEA

Structure of pb intermediate of photoactive yellow protein (pyp) at ph 7
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
125
structure length
125
Chain Sequence
MEHVAFGSEDIENTLAKMDDGQLDGLAFGAIQLDGDGNILQYNAAEGDITGRDPKQVIGKNFFKDVAPCTDSPEFYGKFKEGVASGNLNTMFEYTFDYQMTPTKVKVHMKKALSGDSYWVFVKRV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords Photoactive yellow protein
publication title pH Dependence of the Photoactive Yellow Protein Photocycle Investigated by Time-Resolved Crystallography.
pubmed doi rcsb
total genus 30
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2011-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00989 PAS PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3umeA00
5HWVA 5F69A 3E4QA 4HOIA 4BBUA 3UE6A 1LSWA 5F68A 1DP8A 4GHIB 2P7JA 1XJ4A 1DP9A 1WA9A 2QKPA 1TS6A 4B9OA 2QWSA 3IS2A 2ZOHA 1JNUA 1S67L 4L9EA 1TS7A 2JHEA 3UMEA 2PHYA 3VE3A 1S66L 1LT0A 1OTBA 4EESA 3LUQA 1KOUA 4HY8A 5HZHA 2VV7A 4HNBA 1V9ZA 2K7SA 4E04A 5HDDA 4EEUA 3F1NB 3F1PB 3C2WA 2PR5A 4JGQA 2INWA 3BY9A 1GSXA 2J80A 3P7NA 3H82B 3ICYA 5HDSA 3F1OB 2KX6A 2OOLA 5HSQA 5HD3A 2V0UA 1D7EA 3PYPA 5J4EA 5A8BA 1TS0A 2A24B 3NOPC 1N9NA 1S1YA 4WUJA 4LPZA 3SW1A 1LSXA 5HD5A 2QJ7A 4HI4A 5AVFA 4EXOA 4HJ3A 3UB8A 3LICA 4WN5A 5TBMA 4I39A 4DJ2A 1LSVA 1T1BA 1T1CA 1X0OA 1OT6A 1DRMA 3GDIA 2L4RA 2JN7A 2PD7A 3CLOA 1ODVA 1D06A 5DKLA 2D02A 4MN6A 5F5YA 3C8CA 4WLAA 3LI8A 3EWKA 3LIBA 1N9OA 2QJ5A 1OJ5A 3H9WA 1UGUA 4NXEA 4GHIA 3GECA 2V0WA 2PD8A 4HH3A 1XJ2A 3H7WA 1NWZA 3LIFA 4HHDA 2B02A 3MR0A 2KDKA 2PDRA 3E4OA 2M1CA 4MN5A 3B33A 2Z6DA 4GS9B 4I3AA 3BWLA 1DP6A 3A0SA 3LIAA 1GSWA 2L0WA 3E4PA 3VE4A 2VEAA 3NHQA 4F3LA 1OTDA 4R3AA 4WL9A 2ZOIA 3F1NA 3F1PA 4XT2A 3IBRA 2HV1A 1P0ZA 3PHYA 5J3WA 3H82A 3F1OA 3IS2B 3NOUC 1V9YA 1F9IA 2A24A 1G28A 5HWTA 1MZUA 3UB6A 4YWZA 4RQ9A 3EEHA 2WKRA 3LIEA 4NXBA 4EETB 5G4YA 4KUKA 3VOLA 1OT9A 5IS1A 4BBVA 4HP9A 4LRZE 2W0NA 1XJ3A 4WF0A 4LRYC 5IU1A 2D01A 3A0VA 4R38A 4R6LA 3ZQ5A 3LYXA 3KX0X 4JGRA 3T50A 2VV6A 1S4RA 1VB6A 1Y28A 2YKHA 4BBTA 2QHKA 3G6OA 5HWWA 3RTYA 4H6JB 2WKPA 5I5LA 4LLOB 3ULFA 5TBMB 4JGPA 2PYRA 1T1AA 1T19A 3LIDA 2L1MA 5F6AA 1N9LA 3BY8A 5EFWA 4I38A 2V1AA 2VV8A 5KIZA 4LRXC 3HJIA 1OJGA 1LL8A 3UB7A 4HP4A 5J7EA 3D72A 4JGOA 3MQQA 5AVEA 3H7WB 1GSVA 1T18A 1UWNX 4NXGA 3K3CA 4KUOA 3OLOA 2H28A 3MFXA 3K3DA 2V1BA 1OTEA 3CWFA 3MQOA 2BASA 2OWJA 4M4XA 2PR6A 3UMDA 3NOTC 5DJUA 4F3LB 1P97A 2R78A 2OWHA 2VLGA 5DJTA 1XFQA 5HDCA 2V9AA 2PYPA 2YKFA 4XT2B 3MJQA 4L9GA 4EQ1A 3RH8B 2CMNA 4I5SA 4GW9A 1OTAA 4PKYG 4EEPA 1TS8A 4KQDA 4EW7A 1OTIA 2I9VA 2GJ3A 4GCZA 5DKKA 4HIAA 3UB9A 3CAXA 4R70A 4HJ6A 4K08A 4H6JA 1XFNA 4HH2A 1XJ6A 1UWPX 5G4ZA 2EA9A 3HJKA 2Z6CA 3LI9A 1S1ZA 4I3IA 3NJAA 4EERA 1S4SA 2WKQA 4I3JA 4HJ4A 2W27A 4DJ3A 1F98A 1BYWA 2ZBBA 4L9FA 4PKYA 4NXFA 3FG8A 4HQAA 3MXQA 3A0RA 3FC7A 4GS9A 1EW0A
chains in the Genus database with same CATH superfamily
3CZDA 4DRTA 3OCLA 3V67A 3R7WB 4HOIA 2H0YA 4BBUA 3UE6A 1J3WA 5HAIA 5F68A 4IUHA 3HUNA 4GHIB 2P7JA 1XJ4A 4X69A 2I72A 3S4XA 2PU2A 3MZDA 1IELA 1G68A 4DXCA 5KZHA 2QWSA 3S7OA 1GHMA 3AGEA 3IS2A 3BM6A 2ZOHA 2IWDA 3LR5A 4L9EA 3PR6A 1IYPA 3UMEA 3KSIA 4CPKA 3JYIA 3ZNYA 3RXXA 4R4RA 3W8KA 4HY8A 1CQAA 1P9RA 2ZQ9A 2VV7A 4OVDA 5FL3A 3FV7A 4O7DA 4KZ4A 2H0TA 2PBDP 4JBFA 3QP1A 5GHYA 1DJAA 3C2WA 5G18A 2XFSA 4CQHA 3WS1A 3U2AA 3H82B 1N9BA 4OP8A 2O99A 2OOLA 2XR0A 4Y2FA 4LV0A 1K57C 2V0UA 3PYPA 1IFQA 4IHQA 1PIOA 4OOLA 3LEQA 3DTEA 5I94A 1VETA 3BEBA 4LPZA 4PM9A 1LSXA 4PHTA 2Y2IA 4HI4A 1PYYA 5CGSA 1K6RA 1KVMA 4EXOA 4EUVA 3SH9A 3WS2A 5TBMA 3ZFZA 3CHWP 2HP5A 3V3RA 1BTLA 4K0WA 5EE8A 1O7EA 3CLOA 3PBTA 4Y3IA 1KDSA 1LLBA 3MZFA 4MN6A 2ZL1A 3DWKA 3FKVA 5F5YA 4EBLA 2BTFP 4E3IA 3S7NA 4WLAA 2FZ0A 5A92A 1N9OA 1OJ5A 2WGWA 3A3IA 2LB9A 2Q9NA 3D9YA 4X55A 1SDEA 2O9BA 3B3XA 4F94A 2PD8A 3TW8A 4WMCA 4E3JA 3LIFA 2B02A 3MR0A 4EV4A 2VZWA 3FZCA 1BLCA 5EUAA 4P6ZM 4MN5A 4P6ZS 4PPRA 4QY6A 3HUMA 3UPOA 3B33A 2Z6DA 3SS5A 4YOFA 1DP6A 3LIAA 4FCFA 1BLHA 1GSWA 3MSHA 2L0WA 3KSFA 3JVVA 5F83A 1Z6FA 5DTKA 1H8MA 2J3TC 4IJGA 3F1PA 3IBRA 2HV1A 1P0ZA 3HLWA 1MPLA 4EBNA 3DAVA 3ZDJA 2WZZA 3JVUA 4E6XA 2UWXA 1G28A 1QMEA 4QY5A 2V1ZA 1CK3A 1MZUA 2ZC4B 2FFFB 3VOYA 1FILA 5KSHA 5J8XA 5M19A 3WS0A 1F5MA 2KLIA 5FI2A 1XXMA 3UB5P 1XA7A 4OOYA 2WGIA 4IVIA 4UA9A 2G2UA 4LRZE 2W0NA 4O01A 3CUEC 4LRYC 5IU1A 4R6LA 2Y4AA 3E0YA 5EVIC 4A5RA 5GHZA 1PFLA 3BFFA 3G2ZA 3QP2A 4X1LA 2VV6A 3EOIA 2V2FF 1Y28A 2DMWA 5HWWA 1GCEA 4WZ4A 2HZ5A 4QD4A 1MC0A 5I5LA 3DTKA 1PZPA 4N1XA 4JGPA 2PYRA 1T1AA 3LY4A 3C4PA 1T19A 3LR3A 2H5SA 2CC1A 1HD8A 5IHVA 2L1MA 3NCKA 3MQ0A 1E25A 3SS3A 4BL2A 2V1AA 1PNEA 3ZG7B 3G30A 3GQZA 4LRXC 1H3QA 2XK1A 5CERA 1KE0A 2K2NA 4GZBA 2WUQA 4HP4A 1FSYA 4OP5A 1FIKA 1HLUP 4JGOA 1YPRA 4HESA 1BZAA 1UWNX 3C5AA 1TF1A 1ALQA 3OCNA 2J3TD 4KUOA 4JF4A 2H28A 5A91A 1CEFA 4E3OA 3K3DA 4OOMA 1K38A 4OQ0A 3IWOA 2OWJA 3HCYA 3VSKA 3EEAA 4B4ZA 5F82A 3NOTC 4F3LB 2R78A 2OWHA 5DJTA 3WS4A 1XFQA 5HDCA 2G7UA 4JLFA 5CHUA 3BYDA 4ZBEA 4L9GA 3LEZA 3V3SA 4KZ7A 4EQ1A 3RH8B 1K4EA 3DBAA 4NKPA 4I5SA 5HPIA 3T1RA 5FEGA 2EX6A 1P9WA 1K56D 3WS5A 5CEDA 3P01A 3IF6C 4MLLA 2Y2LA 2Y59A 1S6RA 1C3BA 1OTIA 4LCMA 4UQIM 4GNUA 4HIAA 4UQIS 3UB9A 4GDBA 5FQIA 1ZTUA 5A90A 3CAXA 1FR1A 2WZXA 4R70A 1VETB 1CEGA 3HLCA 5EVID 1JWZA 5HPFA 4DKIA 5CTNA 3SH8A 3T1SA 2O9CA 3HJKA 2Z6CA 1ZKJA 3LI9A 2ZQAA 4OPZA 1KGEA 2NUTC 3BJNA 3OBFA 4I3IA 3QNCA 4BWIA 1S4SA 1W7FA 2O0YA 4EUZA 4N9KA 4L9FA 5CGWA 3IXHA 4DDYA 2HDRA 4NXFA 4Q0IA 2IA2A 4KZ3A 3MKEA 4P6BA 3FC7A 2H10A 1I5QA 1EW0A 3TSGA 2ZC5B 5F69A 1K54C 1EWZA 1LSWA 2XD5A 3GR2A 3IWQA 3LR4A 2OSUA 1GHPA 1DP8A 4WELA 1VEUB 3CMZA 2JKTM 1LI9A 1DP9A 2J3WA 3OPLA 1TS6A 3BLSA 3M2JA 4XUXA 3IX8A 5FATA 1PW8A 2OLVA 1S67L 1TS7A 4X1MA 1NLZA 3VE3A 1S66L 1OTBA 2HDUA 3LUQA 2HJEA 5HZHA 1KGFA 1YAXA 3LO7A 4WBGA 1W63Q 3M6HA 5DF9A 5HAQA 2VGKA 5EOEA 3F1PB 1STZA 4UHUA 1FCOA 3BFGA 3BY9A 4B88A 1WYCA 1E4DA 3VOZA 3ICYA 3MXRA 3JPUA 4NK3A 1D7EA 1YMSA 2OV5A 1TS0A 4GB7A 2PBYA 3DTMA 3NOPC 4FOFA 1N9NA 3SW1A 3T4LA 2OLUA 3TG9A 2QJ7A 4JXVA 4BLMA 5HARA 3MKFA 1J9MA 4HJ3A 3LICA 3FPWA 2ZMFA 3NDGA 5BOHA 1VQQA 4I39A 3T4QA 1OMEA 1W8QA 4ZAMA 2W3HA 4DJ2A 4KZ5A 1BLSA 1T1BA 2WKHA 1D1JA 4B93A 1OT6A 3G34A 1ODVA 3ISGA 5DKLA 2D02A 2XEPA 3EGXC 1NY0A 4N1HA 5L07A 1K6SA 1MWUA 3ZCZA 1AXBA 3S1YA 3ITBA 4ETXA 3EWKA 4R1GA 2XRNA 3H9WA 4JPMA 1W5DA 3MZEA 1HZOA 5DF8A 1XP4A 2DRWA 1YLYA 1BULA 4MBFA 4HHDA 3Q7VB 1IYQA 5KMWA 4ZJ2A 3O88A 2X01A 4I3AA 3KYEA 3BWLA 4GN2A 1PWDA 5TFQA 4ETZA 4JXWA 2B95A 4KZ6A 3E4PA 2VEAA 4F3LA 3KYQA 1K55A 1YLWA 1OTDA 4RX2A 2JCHA 3ZYTA 1L3LA 4YINA 3P98A 3PHYA 3ZG8B 2XDMA 5J3WA 3VP3A 5E2FA 3SZTA 4OKPA 2A24A 2ACGA 3SS4A 1ESIA 3UB6A 4JXSA 4MMNA 4HEFA 1SCWA 4X68A 3FWLA 1YT4A 3VP0A 3NI9A 5G4YA 5C5KA 1OPXA 4OQIA 3A3JA 3DTIA 4LGWA 3VOLA 2Y2OA 5FI7A 2Y2HA 2UV0E 2HP9A 3KSHA 3OPRA 3T12B 4E3MA 4P87A 2VA0A 5CX7A 4NETA 4WF0A 5AJGA 4FH2A 1A0KA 4Y5FA 4R38A 2VGLM 2ZMAA 2VGLS 4KENB 4CJNA 2GDNA 3ZG9B 1W63M 5MC7A 4WYYA 1S4RA 3PAEA 4XXRA 1PWCA 4BBTA 3O86A 3G6OA 5DFYA 2JKGA 4LV2A 2WKPA 3L9KA 1EI5A 1CI9A 2HDQA 4KZAA 3P09A 4PAUA 3FYZA 1VEUA 1NRJA 2WGVA 5FSRA 2Z2MB 3NULA 4MBHA 5M1AA 1TEMA 3BY8A 2Y2QA 4D60A 1ZHHB 5EFWA 3QP5A 3BFEA 2JC7A 2W3EA 3IHAA 3HJIA 1DJCA 4QWOA 1TDLA 4K0XA 3UB7A 4LV3A 1XX2A 4MN7A 4X53A 5J7EA 3TRCA 3M6BA 3MQQA 3C7UA 4ID4A 4U0XA 1GSVA 5D3OA 5EECA 1T18A 3K3CA 1SDNA 3G2YA 4CLCE 1SZVA 3OLOA 4FD8A 2P08A 1ERMA 1W79A 1MWSA 3CWFA 4GOGA 4UA6A 3DW0A 3MF0A 4EWFA 3ZG0A 4MEZA 4LFUA 2VLGA 4DMZA 3GV9A 4OQHA 1BLPA 3UDIA 4ZTKA 4XT2B 1CJFA 4S2MA 1KE4A 3HUOA 1E3UA 3QNBA 1VM1A 2W1RA 5EPHA 1GA9A 2P74A 3ZG5A 4EEPA 5FQ9A 1TS8A 4KQDA 2GX5A 4ZDXA 3Q1FA 1AWIA 3HBRA 3T1XA 3BFCA 4ARZA 3B47A 4QHCA 1PI4A 2GNXA 3G32A 4KZ9A 1Q2QA 4KQOA 4K08A 4H6JA 4BQMA 3SOIA 4D2OA 5CECA 4HH2A 5G4ZA 1JVJA 3NIAA 1S1ZA 1BT5A 3I7JA 2K31A 3NJAA 1I2SA 3BQ8A 3TE8A 2XSSA 4P0MA 4HJ4A 3Q7VA 4DJ3A 4QJGA 4YFMA 1IKGA 1BYWA 2A3UA 2PT7A 2VKSA 4PKYA 1YMXA 3PTEA 4S2LA 5HWVA 2BLSA 1NXYA 2P9VA 3HLDA 5DF7A 2JKRM 2Y2GA 2ZMVA 3QP6A 5FQMA 1ES3A 3CPTA 3OOVA 2J9PA 4RX3A 1WA9A 3T4SA 4S2OA 1ERQA 2HP6A 1ONHA 4Y17A 1CF0A 4UA7A 5DVAA 1JNUA 3N4IA 4MBKA 2JHEA 3Q07A 4RYEA 5EM0A 2PHYA 4WEKA 5AQBA 4WMCD 4EESA 1FSWA 1KOUA 2J7VA 3G35A 4QB8A 1YSQA 5E43A 4JF5A 1V9ZA 3A3EA 1RGZA 2V20A 5FI6A 5CEBA 2WKIA 2ZM0A 2INWA 3O87A 3WRZA 1H8ZA 2XH9A 2OAP1 5CTMA 5HSQA 4C3QA 1IYSA 5J4EA 5A8BA 3D3OA 3HLFA 3OPPA 2A24B 1FCNA 2DNSA 4IUKA 4WUJA 1YSPA 2B18A 1KVLA 4IBRA 1MKIA 5HD5A 3VP4A 2WAFA 3PBRA 4CLCA 2XF3A 2V8CA 4S2JA 1LSVA 1NYMA 1BSGA 1T1CA 1X0OA 1RP5A 2ZQDA 3E2KA 3S22A 3IXGA 2JN7A 2ZQCA 3WWXA 1YKDA 1MWRA 5FA7A 4BENA 3VV4A 1E3UD 1L0GA 4H8RA 2Y2KA 3LI8A 2QJ5A 5FAQA 4C6YA 3FKWA 3IXDA 4WZ5A 4LCLA 1UGUA 5HL1A 5GLDA 4DF6A 4NXEA 4PMAA 4ZRRA 5GLAA 3T4JA 4L0LA 4HH3A 1XJ2A 4BL3A 4R0QA 3W4OA 1PRQA 1PZOA 1RCJA 3SH7A 4WM9A 5CHJA 1FR6A 1ZC2A 3A3FA 3DWZA 4DE2A 3MMHA 1EROA 5DTTA 4GS9B 1L0DA 4JKTA 5HFOA 1YLTA 3AGDA 2VK3A 5DTSA 4N92A 5FDHA 4R3AA 3C38A 4WL9A 5M18A 3F1NA 4S2NA 3Q82A 4XT2A 3B42A 5GL9A 1S0WA 2VX8A 5EVEA 1NLYA 3F1OA 3N8LA 1V9YA 1F9IA 4FSFA 3T1QB 4RVAA 3ZVTA 3UY6A 2ZD8A 4GD6A 4S2PA 3EQVA 2Q9MA 2WKRA 3CITA 3LIEA 4NXBA 4E6WA 3TJZC 4KQQA 4XUZA 3UE1A 1M6KA 3PXPA 2A2LA 1SKFA 3MXSA 4KUKA 1W8YA 1ACFA 2X71A 2JKTI 1OT9A 1RGYA 2R9WA 4BBVA 4IVKA 3IQAA 5CHMA 5L10A 2EX9A 4HP9A 1KDWA 5U47A 2PU4A 2D01A 3A0VA 3PBNA 1DJBA 2WAEA 3ZQ5A 4UAAA 2EFUA 3KX0X 4DE0A 4ARZB 1PWGA 3OC2A 2FH5A 3V50A 1VB6A 3HLBA 1YQSA 5FQKA 1SKOB 4H6JB 4LLOB 5EM1A 4X25A 2W3DA 5GHXA 3ULFA 1IKIA 1XPBA 1I2WA 2WK0A 3LIDA 1NZUA 3M2KA 3IXBA 1SHVA 5AQ7A 5F6AA 3ITAA 3KO6A 1HTZA 4FUWA 3W2ZA 4X6TA 1NJ4A 4QU3A 3CJMA 2XD1A 4OONA 4OPYA 1GHIA 1XGIA 3LFVA 4UEYA 3IX3A 1YLPA 3OPHA 3T4KA 1OJGA 3R4KA 3NBLA 1CI8A 4O8GA 1FOFA 1Q2PA 5AQ9A 4OPQA 3E2LA 2P9VB 1ONGA 3S7QA 3D72A 3H7WB 3BW6A 4HBUA 3CPTB 1K57A 4NXGA 3HL9A 4OLDA 2Q0OA 3MFXA 2XLNA 3G31A 5JYOA 2V1BA 5L2FA 1OTEA 4R23A 3MQOA 2A49A 2BASA 2PR6A 3PAGA 3FPVA 5DJUA 4U0TA 3C30A 3IF5A 3MBZA 2ZJ9A 2C6WB 5A93A 2M7VA 2IWBA 3IF6B 3MJQA 3WRTA 3GSGA 1MBLA 1K55C 4GW9A 5CXWA 2QPNA 3ZGAB 4G3VA 1Z09A 3W4PA 5L8MA 2GJ3A 4ME4A 1MXOA 5HW3A 2EXAA 3ZVWA 4GCZA 5DKKA 3GVBA 4II7A 2GZAA 2PRFA 4OPRA 4HJ6A 4AFIA 3L7HA 3KSGA 3N8RA 2EA9A 3V5MA 3IX4A 1BUEA 4CLCB 1ES2A 3QP4A 4PM8A 2ZC3B 2XFTA 5EOOA 3A3DA 2WKQA 4I3JA 4R3BA 3T4OA 1IOUA 3IHBA 2ZLYA 2ZQ8A 2W3GA 2XA7M 3UE0A 4O0PA 1ES5A 1NYYA 3K2NA 4GD8A 2XA7S 4Q8IA 3MXQA 3E98A 3A0RA 2PAVP 4GS9A 3E4QA 1XA1A 1DY6A 4R4SA 3UPPA 4Y0OA 1TDGA 3UN7A 4KZBA 1L0FA 5EV0A 3NC8A 1JTGA 3N8SA 1ZG4A 2EX2A 3LCEA 2QKPA 2HJ9C 4B9OA 3BQAA 2JKFA 2Y2JA 1FCMA 3LY3A 1PI5A 1MY8A 1LT0A 1XGJA 1K56A 1XKZA 1TD5A 2VGJA 4BD0A 3IH9A 4HNBA 4DN0A 3UO9A 2K7SA 4E04A 5HDDA 4EEUA 3CUEA 4G3WA 3F1NB 4WEJA 3U4LP 1QMFA 2PR5A 4JGQA 4IEDA 1VHMA 5AQAA 5EVIA 5JYPA 4DE1A 2LB5A 2W1TB 1GSXA 3D4FA 3MS6A 4E3KA 2J80A 4KG2A 3P7NA 1L0EA 5HDSA 3F1OB 2KX6A 5E2EA 5HD3A 3IT9A 2MJ6A 4KQRA 1L2SA 1S1YA 4JF6A 3V39A 1JWVA 2QMIA 2WADA 5TGFA 5HAPA 2Y2MA 5CRFA 5AVFA 1SKOA 3UB8A 3HLEA 4WN5A 1H8YA 4Q0JA 1F2KA 3QHYA 3HREA 3LGOA 1DRMA 4LENA 3GDIA 2L4RA 2PD7A 3LR0A 4GKUA 1D06A 1PW1A 3EQUA 3C8CA 4MDZA 3IWIA 2VJWA 3VP2A 1H0MA 4P85A 2RCXA 3R7WA 5FASA 2QZ6A 3LIBA 4KG6A 4ESPA 4BMWA 4Y0UA 4GHIA 3GECA 5FQJA 2V0WA 1YM1A 5CGXA 5FQQA 4Y15A 4Z1WA 3H7WA 1NWZA 4N9LA 3T4TA 1N4OA 2KDKA 4EU0A 2PDRA 1IYOA 1KE3A 3E4OA 4PM6A 2M1CA 1MWTA 1G6AA 3GRJA 4E3NA 2V8FA 1ZG6A 4PM7A 4ZJ3A 3PBOA 4X56A 1JWPA 2XQZA 1U60A 3A0SA 4C75A 3BLMA 3GTCA 3VMAA 2Y91A 1LL9A 3VE4A 4GJ4A 2EWWA 3NHQA 3O5YA 4JXGA 3EGDC 3VFHA 5GLCA 2Y2PA 2ZOIA 3IF6A 5F1GA 1WYBA 3BRMA 2KOIA 1Y4OA 4ZJ1A 3H82A 4Q0HA 2HF6A 3IS2B 4M3KA 5F1FA 3NOUC 4GLQA 4BD1A 5HWTA 4B4XA 1YLZA 5E2HA 3N7WA 5FEFA 1FQGA 2ZC7A 4NG2A 2IWCA 4YWZA 1MKMA 1LHYA 3RJUA 4RQ9A 3VFFA 5KSCA 1K0KA 3EEHA 5E2GA 1JTDA 2JE5A 3W4QA 2JKRI 3QP8A 4EETB 3VSLA 4MCWA 4Z9QA 5IS1A 3C7VA 4S2KA 2DCFA 3S7PA 5FAOA 1GA0A 3UNWA 4NEED 1XJ3A 1YLJA 2X02A 2Y8HA 1ESUA 2G2WA 3LYXA 1IEMA 4JGRA 4FH4A 1K54A 3T50A 2EX8A 4Y13A 3BECA 1TVFA 3KYZA 2YKHA 2HPBA 2OAQ1 2QHKA 2W3FA 4BJPA 4FTXA 5EVLA 3RTYA 2C5WB 4PM5A 4U3TA 5TBMB 3ZHHA 2J9OA 3HVFA 2R9XA 1K4FA 4CLCC 3C4OA 3IH8A 2HGVA 1O07A 3MFDA 4IBXA 5L09A 2Z2LB 3Q81A 3TOIA 2ZL1B 1H5XA 1N9LA 2Y79A 1G5UA 4DXBA 1HVBA 4I38A 3HLGA 2O9AA 3PBQA 2RL3A 2VV8A 3NDEA 5KIZA 3AGFA 3RXWA 2WGWB 1LL8A 4HBTA 3NY4A 1Y54A 1LL5A 3N6IA 4MNRA 4YNRA 4OLGA 1M40A 5AVEA 4WZ5C 2WKEA 2Y2NA 1KGGA 2W1TA 2WYXA 2EFXA 2AVXA 3G4PA 3ZNTA 4E3LA 5IT5A 4M4XA 4R3JA 3UMDA 5LBRA 5TR7A 3UE3A 2ZQ7A 1NRFA 3RFBA 1P97A 4LV1A 4Y0TA 2B5RA 2V9AA 2PYPA 2YKFA 3PBSA 3CG5A 3CI6A 2ZM8A 5K5BA 2CMNA 1OTAA 3Q7ZA 3GMWA 4PKYG 1LI0A 2E8JA 4S2NC 5FAPA 4KZ8A 4KG5A 5EVIB 4EW7A 5FDSA 2P04A 4OQGA 2EWVA 4EBPA 3VP1A 2J8YA 2I9VA 4DE3A 3OZHA 4QPRA 5HX9A 1WE4A 2JBFA 2M7UA 4GDNA 4G3KA 5TJJA 5GLBA 3BFDA 5HL6A 3UDFA 2XGNA 4RA7A 2XROA 3O3VA 2ZC6B 1XFNA 3IBJA 2HDSA 1XJ6A 1UWPX 2NUPC 1G6OA 3NECA 2Y55A 1ES4A 4EERA 4DDSA 2EXBA 4EQIA 1NZOA 3UPNA 3UDXA 2W27A 2QYBA 2FFYA 5DFXA 1F98A 2ZBBA 4OH0A 4S2IA 4CLCD 1K25A 4K91A 3FG8A 2E8IA 4HQAA 4Y7PA 2ZM2A 2BG1A
chains in the Genus database with same CATH topology
5HWVA 5F69A 3OCLA 3E4QA 3V67A 3R7WB 4HOIA 4BBUA 3UE6A 1LSWA 3LR4A 2JKRM 5F68A 2ZMVA 4IUHA 1DP8A 4WELA 4GHIB 2P7JA 1XJ4A 2JKTM 3OOVA 1DP9A 1WA9A 3T4SA 2J3WA 2QKPA 1TS6A 2HJ9C 4B9OA 2QWSA 3S7OA 3IS2A 3BQAA 2ZOHA 3LR5A 1JNUA 1S67L 4L9EA 1TS7A 3PR6A 2JHEA 1NLZA 3KSIA 3UMEA 2PHYA 3VE3A 4WEKA 1S66L 1LT0A 1OTBA 4EESA 3LUQA 1KOUA 1TD5A 2HJEA 4HY8A 1YSQA 5HZHA 1P9RA 2VV7A 1YAXA 4HNBA 4DN0A 1W63Q 5FL3A 1V9ZA 5DF9A 2K7SA 4E04A 5HDDA 4EEUA 3CUEA 4G3WA 3F1NB 4WEJA 3F1PB 3C2WA 2PR5A 4JGQA 1STZA 2INWA 1VHMA 4CQHA 2LB5A 2W1TB 1GSXA 3BY9A 3U2AA 2J80A 3P7NA 3H82B 3ICYA 2O99A 2OAP1 5HDSA 3F1OB 2KX6A 2OOLA 4Y2FA 5HSQA 5HD3A 2V0UA 1D7EA 3PYPA 5J4EA 2MJ6A 1IFQA 3D3OA 5A8BA 4IHQA 1TS0A 2A24B 4OOLA 3NOPC 4FOFA 4IUKA 1N9NA 1S1YA 4WUJA 4LPZA 3SW1A 1YSPA 2B18A 3T4LA 1LSXA 4PHTA 5HD5A 2QJ7A 4HI4A 5AVFA 3PBRA 4CLCA 4EXOA 4EUVA 4HJ3A 3UB8A 3LICA 3FPWA 4WN5A 2ZMFA 5TBMA 4Q0JA 4I39A 3T4QA 2W3HA 4DJ2A 1LSVA 1T1BA 4B93A 1T1CA 1X0OA 1OT6A 1DRMA 3GDIA 2L4RA 2JN7A 2PD7A 3LR0A 3CLOA 3PBTA 1ODVA 1YKDA 1D06A 5DKLA 2D02A 4Y3IA 3EGXC 4MN6A 3VV4A 5F5YA 3EQUA 3C8CA 4MDZA 3S7NA 4WLAA 2VJWA 2FZ0A 3LI8A 3R7WA 4ETXA 3EWKA 3LIBA 1N9OA 2QJ5A 1OJ5A 2XRNA 4BMWA 2LB9A 3H9WA 1UGUA 4NXEA 4ZRRA 4GHIA 2O9BA 3T4JA 4L0LA 3GECA 2V0WA 2PD8A 4HH3A 1XJ2A 3TW8A 4Z1WA 3H7WA 1NWZA 3LIFA 4HHDA 2B02A 3MR0A 3T4TA 2VZWA 2KDKA 4EU0A 2PDRA 3E4OA 2M1CA 4P6ZM 4MN5A 4P6ZS 3MMHA 3B33A 2Z6DA 4GS9B 4I3AA 3BWLA 3PBOA 4YOFA 4ETZA 1DP6A 3A0SA 3LIAA 1GSWA 2L0WA 3KSFA 3JVVA 3E4PA 3VE4A 2VEAA 4GJ4A 2EWWA 3NHQA 3O5YA 3KYQA 4F3LA 3EGDC 1OTDA 4R3AA 3C38A 1H8MA 2J3TC 4WL9A 2ZOIA 3F1NA 4IJGA 3ZYTA 3F1PA 4XT2A 3IBRA 2HV1A 1P0ZA 3B42A 2KOIA 3PHYA 2VX8A 5J3WA 3H82A 4Q0HA 2HF6A 1NLYA 3F1OA 3IS2B 3NOUC 1V9YA 3JVUA 1F9IA 4FSFA 4GLQA 2A24A 1G28A 5HWTA 1MZUA 3UB6A 4MMNA 4YWZA 1MKMA 4RQ9A 3EQVA 3EEHA 5KSHA 2WKRA 3CITA 3LIEA 4NXBA 3TJZC 3PXPA 2A2LA 2JKRI 1F5MA 5G4YA 5C5KA 4EETB 1OPXA 4KUKA 2KLIA 3VOLA 4MCWA 2JKTI 1OT9A 5IS1A 3KSHA 4BBVA 3S7PA 2VA0A 4HP9A 5CX7A 4LRZE 2W0NA 4NEED 1XJ3A 4O01A 4WF0A 5AJGA 3CUEC 4LRYC 5IU1A 4Y5FA 2D01A 3A0VA 2VGLM 3PBNA 2Y8HA 4R38A 4R6LA 3E0YA 3ZQ5A 2VGLS 3LYXA 3KX0X 4JGRA 4ARZB 1W63M 2VV6A 3T50A 3OC2A 5MC7A 2FH5A 3EOIA 1S4RA 1VB6A 1Y28A 3KYZA 2YKHA 2DMWA 2OAQ1 4BBTA 2QHKA 2W3FA 4BJPA 3G6OA 5DFYA 5HWWA 3RTYA 4H6JB 1MC0A 2WKPA 5I5LA 4LLOB 2W3DA 3ULFA 5TBMB 4JGPA 2PYRA 1T1AA 4PAUA 1T19A 3LR3A 4CLCC 3LIDA 2HGVA 1NRJA 2L1MA 5F6AA 3KO6A 1N9LA 2Y79A 3BY8A 3MQ0A 1ZHHB 3W2ZA 5EFWA 4I38A 2O9AA 3PBQA 2V1AA 2W3EA 3LFVA 4UEYA 2VV8A 5KIZA 4LRXC 3HJIA 3T4KA 1H3QA 1OJGA 1LL8A 3R4KA 2K2NA 4O8GA 3UB7A 4MN7A 4HP4A 5J7EA 3TRCA 4YNRA 3S7QA 3D72A 4JGOA 3MQQA 5AVEA 3H7WB 1GSVA 3BW6A 1T18A 1UWNX 1TF1A 4NXGA 3K3CA 3OCNA 2J3TD 4KUOA 4CLCE 3OLOA 2H28A 2W1TA 3MFXA 2P08A 3K3DA 4OOMA 2V1BA 1OTEA 3CWFA 5IT5A 3MQOA 2BASA 2OWJA 3HCYA 4M4XA 2PR6A 3EEAA 3UMDA 3MF0A 5LBRA 3NOTC 3FPVA 5DJUA 3UE3A 3RFBA 4F3LB 1P97A 2R78A 3C30A 2OWHA 2VLGA 5DJTA 4DMZA 1XFQA 5HDCA 2V9AA 2G7UA 2PYPA 2YKFA 3PBSA 3CI6A 4XT2B 2M7VA 3MJQA 4L9GA 4EQ1A 3RH8B 3DBAA 2CMNA 4I5SA 4NKPA 5HPIA 5K5BA 4GW9A 1OTAA 2W1RA 4PKYG 4G3VA 1P9WA 4EEPA 3P01A 1TS8A 4KQDA 4EW7A 2GX5A 2P04A 2EWVA 5L8MA 1OTIA 2I9VA 4QPRA 2GJ3A 4ME4A 4ARZA 4UQIM 2M7UA 3B47A 4G3KA 4GCZA 5DKKA 5TJJA 4HIAA 4UQIS 4II7A 3UB9A 5HL6A 2GZAA 1ZTUA 2GNXA 3CAXA 4R70A 4HJ6A 2XROA 4KQOA 4AFIA 4K08A 4H6JA 5HPFA 3KSGA 1XFNA 4HH2A 3IBJA 1XJ6A 1UWPX 5G4ZA 1G6OA 2EA9A 2O9CA 2NUPC 3HJKA 2Z6CA 3LI9A 1S1ZA 4CLCB 2NUTC 3BJNA 3OBFA 4I3IA 2K31A 3NJAA 4EERA 4BWIA 3BQ8A 1S4SA 3TE8A 2XSSA 2WKQA 4I3JA 4HJ4A 2O0YA 2W27A 3T4OA 2QYBA 1IOUA 5DFXA 4DJ3A 1F98A 1BYWA 2ZBBA 4L9FA 2W3GA 2XA7M 2PT7A 2VKSA 4O0PA 4PKYA 4CLCD 3K2NA 2XA7S 4NXFA 3FG8A 4HQAA 3MXQA 2IA2A 4Q0IA 3E98A 3A0RA 3FC7A 4GS9A 1EW0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HWV A;  5F69 A;  3E4Q A;  4HOI A;  4BBU A;  3UE6 A;  1LSW A;  5F68 A;  1DP8 A;  4GHI B;  2P7J A;  1XJ4 A;  1DP9 A;  1WA9 A;  2QKP A;  1TS6 A;  4B9O A;  2QWS A;  3IS2 A;  2ZOH A;  1JNU A;  1S67 L;  4L9E A;  1TS7 A;  2JHE A;  3UME A;  2PHY A;  3VE3 A;  1S66 L;  1LT0 A;  1OTB A;  4EES A;  3LUQ A;  1KOU A;  4HY8 A;  5HZH A;  2VV7 A;  4HNB A;  1V9Z A;  2K7S A;  4E04 A;  5HDD A;  4EEU A;  3F1N B;  3F1P B;  3C2W A;  2PR5 A;  4JGQ A;  2INW A;  3BY9 A;  1GSX A;  2J80 A;  3P7N A;  3H82 B;  3ICY A;  5HDS A;  3F1O B;  2KX6 A;  2OOL A;  5HSQ A;  5HD3 A;  2V0U A;  1D7E A;  3PYP A;  5J4E A;  5A8B A;  1TS0 A;  2A24 B;  3NOP C;  1N9N A;  1S1Y A;  4WUJ A;  4LPZ A;  3SW1 A;  1LSX A;  5HD5 A;  2QJ7 A;  4HI4 A;  5AVF A;  4EXO A;  4HJ3 A;  3UB8 A;  3LIC A;  4WN5 A;  5TBM A;  4I39 A;  4DJ2 A;  1LSV A;  1T1B A;  1T1C A;  1X0O A;  1OT6 A;  1DRM A;  3GDI A;  2L4R A;  2JN7 A;  2PD7 A;  3CLO A;  1ODV A;  1D06 A;  5DKL A;  2D02 A;  4MN6 A;  5F5Y A;  3C8C A;  4WLA A;  3LI8 A;  3EWK A;  3LIB A;  1N9O A;  2QJ5 A;  1OJ5 A;  3H9W A;  1UGU A;  4NXE A;  4GHI A;  3GEC A;  2V0W A;  2PD8 A;  4HH3 A;  1XJ2 A;  3H7W A;  1NWZ A;  3LIF A;  4HHD A;  2B02 A;  3MR0 A;  2KDK A;  2PDR A;  3E4O A;  2M1C A;  4MN5 A;  3B33 A;  2Z6D A;  4GS9 B;  4I3A A;  3BWL A;  1DP6 A;  3A0S A;  3LIA A;  1GSW A;  2L0W A;  3E4P A;  3VE4 A;  2VEA A;  3NHQ A;  4F3L A;  1OTD A;  4R3A A;  4WL9 A;  2ZOI A;  3F1N A;  3F1P A;  4XT2 A;  3IBR A;  2HV1 A;  1P0Z A;  3PHY A;  5J3W A;  3H82 A;  3F1O A;  3IS2 B;  3NOU C;  1V9Y A;  1F9I A;  2A24 A;  1G28 A;  5HWT A;  1MZU A;  3UB6 A;  4YWZ A;  4RQ9 A;  3EEH A;  2WKR A;  3LIE A;  4NXB A;  4EET B;  5G4Y A;  4KUK A;  3VOL A;  1OT9 A;  5IS1 A;  4BBV A;  4HP9 A;  4LRZ E;  2W0N A;  1XJ3 A;  4WF0 A;  4LRY C;  5IU1 A;  2D01 A;  3A0V A;  4R38 A;  4R6L A;  3ZQ5 A;  3LYX A;  3KX0 X;  4JGR A;  3T50 A;  2VV6 A;  1S4R A;  1VB6 A;  1Y28 A;  2YKH A;  4BBT A;  2QHK A;  3G6O A;  5HWW A;  3RTY A;  4H6J B;  2WKP A;  5I5L A;  4LLO B;  3ULF A;  5TBM B;  4JGP A;  2PYR A;  1T1A A;  1T19 A;  3LID A;  2L1M A;  5F6A A;  1N9L A;  3BY8 A;  5EFW A;  4I38 A;  2V1A A;  2VV8 A;  5KIZ A;  4LRX C;  3HJI A;  1OJG A;  1LL8 A;  3UB7 A;  4HP4 A;  5J7E A;  3D72 A;  4JGO A;  3MQQ A;  5AVE A;  3H7W B;  1GSV A;  1T18 A;  1UWN X;  4NXG A;  3K3C A;  4KUO A;  3OLO A;  2H28 A;  3MFX A;  3K3D A;  2V1B A;  1OTE A;  3CWF A;  3MQO A;  2BAS A;  2OWJ A;  4M4X A;  2PR6 A;  3UMD A;  3NOT C;  5DJU A;  4F3L B;  1P97 A;  2R78 A;  2OWH A;  2VLG A;  5DJT A;  1XFQ A;  5HDC A;  2V9A A;  2PYP A;  2YKF A;  4XT2 B;  3MJQ A;  4L9G A;  4EQ1 A;  3RH8 B;  2CMN A;  4I5S A;  4GW9 A;  1OTA A;  4PKY G;  4EEP A;  1TS8 A;  4KQD A;  4EW7 A;  1OTI A;  2I9V A;  2GJ3 A;  4GCZ A;  5DKK A;  4HIA A;  3UB9 A;  3CAX A;  4R70 A;  4HJ6 A;  4K08 A;  4H6J A;  1XFN A;  4HH2 A;  1XJ6 A;  1UWP X;  5G4Z A;  2EA9 A;  3HJK A;  2Z6C A;  3LI9 A;  1S1Z A;  4I3I A;  3NJA A;  4EER A;  1S4S A;  2WKQ A;  4I3J A;  4HJ4 A;  2W27 A;  4DJ3 A;  1F98 A;  1BYW A;  2ZBB A;  4L9F A;  4PKY A;  4NXF A;  3FG8 A;  4HQA A;  3MXQ A;  3A0R A;  3FC7 A;  4GS9 A;  1EW0 A; 
#chains in the Genus database with same CATH topology
 3CZD A;  4DRT A;  3OCL A;  3V67 A;  3R7W B;  4HOI A;  2H0Y A;  4BBU A;  3UE6 A;  1J3W A;  5HAI A;  5F68 A;  4IUH A;  3HUN A;  4GHI B;  2P7J A;  1XJ4 A;  4X69 A;  2I72 A;  3S4X A;  2PU2 A;  3MZD A;  1IEL A;  1G68 A;  4DXC A;  5KZH A;  2QWS A;  3S7O A;  1GHM A;  3AGE A;  3IS2 A;  3BM6 A;  2ZOH A;  2IWD A;  3LR5 A;  4L9E A;  3PR6 A;  1IYP A;  3UME A;  3KSI A;  4CPK A;  3JYI A;  3ZNY A;  3RXX A;  4R4R A;  3W8K A;  4HY8 A;  1CQA A;  1P9R A;  2ZQ9 A;  2VV7 A;  4OVD A;  5FL3 A;  3FV7 A;  4O7D A;  4KZ4 A;  2H0T A;  2PBD P;  4JBF A;  3QP1 A;  5GHY A;  1DJA A;  3C2W A;  5G18 A;  2XFS A;  4CQH A;  3WS1 A;  3U2A A;  3H82 B;  1N9B A;  4OP8 A;  2O99 A;  2OOL A;  2XR0 A;  4Y2F A;  4LV0 A;  1K57 C;  2V0U A;  3PYP A;  1IFQ A;  4IHQ A;  1PIO A;  4OOL A;  3LEQ A;  3DTE A;  5I94 A;  1VET A;  3BEB A;  4LPZ A;  4PM9 A;  1LSX A;  4PHT A;  2Y2I A;  4HI4 A;  1PYY A;  5CGS A;  1K6R A;  1KVM A;  4EXO A;  4EUV A;  3SH9 A;  3WS2 A;  5TBM A;  3ZFZ A;  3CHW P;  2HP5 A;  3V3R A;  1BTL A;  4K0W A;  5EE8 A;  1O7E A;  3CLO A;  3PBT A;  4Y3I A;  1KDS A;  1LLB A;  3MZF A;  4MN6 A;  2ZL1 A;  3DWK A;  3FKV A;  5F5Y A;  4EBL A;  2BTF P;  4E3I A;  3S7N A;  4WLA A;  2FZ0 A;  5A92 A;  1N9O A;  1OJ5 A;  2WGW A;  3A3I A;  2LB9 A;  2Q9N A;  3D9Y A;  4X55 A;  1SDE A;  2O9B A;  3B3X A;  4F94 A;  2PD8 A;  3TW8 A;  4WMC A;  4E3J A;  3LIF A;  2B02 A;  3MR0 A;  4EV4 A;  2VZW A;  3FZC A;  1BLC A;  5EUA A;  4P6Z M;  4MN5 A;  4P6Z S;  4PPR A;  4QY6 A;  3HUM A;  3UPO A;  3B33 A;  2Z6D A;  3SS5 A;  4YOF A;  1DP6 A;  3LIA A;  4FCF A;  1BLH A;  1GSW A;  3MSH A;  2L0W A;  3KSF A;  3JVV A;  5F83 A;  1Z6F A;  5DTK A;  1H8M A;  2J3T C;  4IJG A;  3F1P A;  3IBR A;  2HV1 A;  1P0Z A;  3HLW A;  1MPL A;  4EBN A;  3DAV A;  3ZDJ A;  2WZZ A;  3JVU A;  4E6X A;  2UWX A;  1G28 A;  1QME A;  4QY5 A;  2V1Z A;  1CK3 A;  1MZU A;  2ZC4 B;  2FFF B;  3VOY A;  1FIL A;  5KSH A;  5J8X A;  5M19 A;  3WS0 A;  1F5M A;  2KLI A;  5FI2 A;  1XXM A;  3UB5 P;  1XA7 A;  4OOY A;  2WGI A;  4IVI A;  4UA9 A;  2G2U A;  4LRZ E;  2W0N A;  4O01 A;  3CUE C;  4LRY C;  5IU1 A;  4R6L A;  2Y4A A;  3E0Y A;  5EVI C;  4A5R A;  5GHZ A;  1PFL A;  3BFF A;  3G2Z A;  3QP2 A;  4X1L A;  2VV6 A;  3EOI A;  2V2F F;  1Y28 A;  2DMW A;  5HWW A;  1GCE A;  4WZ4 A;  2HZ5 A;  4QD4 A;  1MC0 A;  5I5L A;  3DTK A;  1PZP A;  4N1X A;  4JGP A;  2PYR A;  1T1A A;  3LY4 A;  3C4P A;  1T19 A;  3LR3 A;  2H5S A;  2CC1 A;  1HD8 A;  5IHV A;  2L1M A;  3NCK A;  3MQ0 A;  1E25 A;  3SS3 A;  4BL2 A;  2V1A A;  1PNE A;  3ZG7 B;  3G30 A;  3GQZ A;  4LRX C;  1H3Q A;  2XK1 A;  5CER A;  1KE0 A;  2K2N A;  4GZB A;  2WUQ A;  4HP4 A;  1FSY A;  4OP5 A;  1FIK A;  1HLU P;  4JGO A;  1YPR A;  4HES A;  1BZA A;  1UWN X;  3C5A A;  1TF1 A;  1ALQ A;  3OCN A;  2J3T D;  4KUO A;  4JF4 A;  2H28 A;  5A91 A;  1CEF A;  4E3O A;  3K3D A;  4OOM A;  1K38 A;  4OQ0 A;  3IWO A;  2OWJ A;  3HCY A;  3VSK A;  3EEA A;  4B4Z A;  5F82 A;  3NOT C;  4F3L B;  2R78 A;  2OWH A;  5DJT A;  3WS4 A;  1XFQ A;  5HDC A;  2G7U A;  4JLF A;  5CHU A;  3BYD A;  4ZBE A;  4L9G A;  3LEZ A;  3V3S A;  4KZ7 A;  4EQ1 A;  3RH8 B;  1K4E A;  3DBA A;  4NKP A;  4I5S A;  5HPI A;  3T1R A;  5FEG A;  2EX6 A;  1P9W A;  1K56 D;  3WS5 A;  5CED A;  3P01 A;  3IF6 C;  4MLL A;  2Y2L A;  2Y59 A;  1S6R A;  1C3B A;  1OTI A;  4LCM A;  4UQI M;  4GNU A;  4HIA A;  4UQI S;  3UB9 A;  4GDB A;  5FQI A;  1ZTU A;  5A90 A;  3CAX A;  1FR1 A;  2WZX A;  4R70 A;  1VET B;  1CEG A;  3HLC A;  5EVI D;  1JWZ A;  5HPF A;  4DKI A;  5CTN A;  3SH8 A;  3T1S A;  2O9C A;  3HJK A;  2Z6C A;  1ZKJ A;  3LI9 A;  2ZQA A;  4OPZ A;  1KGE A;  2NUT C;  3BJN A;  3OBF A;  4I3I A;  3QNC A;  4BWI A;  1S4S A;  1W7F A;  2O0Y A;  4EUZ A;  4N9K A;  4L9F A;  5CGW A;  3IXH A;  4DDY A;  2HDR A;  4NXF A;  4Q0I A;  2IA2 A;  4KZ3 A;  3MKE A;  4P6B A;  3FC7 A;  2H10 A;  1I5Q A;  1EW0 A;  3TSG A;  2ZC5 B;  5F69 A;  1K54 C;  1EWZ A;  1LSW A;  2XD5 A;  3GR2 A;  3IWQ A;  3LR4 A;  2OSU A;  1GHP A;  1DP8 A;  4WEL A;  1VEU B;  3CMZ A;  2JKT M;  1LI9 A;  1DP9 A;  2J3W A;  3OPL A;  1TS6 A;  3BLS A;  3M2J A;  4XUX A;  3IX8 A;  5FAT A;  1PW8 A;  2OLV A;  1S67 L;  1TS7 A;  4X1M A;  1NLZ A;  3VE3 A;  1S66 L;  1OTB A;  2HDU A;  3LUQ A;  2HJE A;  5HZH A;  1KGF A;  1YAX A;  3LO7 A;  4WBG A;  1W63 Q;  3M6H A;  5DF9 A;  5HAQ A;  2VGK A;  5EOE A;  3F1P B;  1STZ A;  4UHU A;  1FCO A;  3BFG A;  3BY9 A;  4B88 A;  1WYC A;  1E4D A;  3VOZ A;  3ICY A;  3MXR A;  3JPU A;  4NK3 A;  1D7E A;  1YMS A;  2OV5 A;  1TS0 A;  4GB7 A;  2PBY A;  3DTM A;  3NOP C;  4FOF A;  1N9N A;  3SW1 A;  3T4L A;  2OLU A;  3TG9 A;  2QJ7 A;  4JXV A;  4BLM A;  5HAR A;  3MKF A;  1J9M A;  4HJ3 A;  3LIC A;  3FPW A;  2ZMF A;  3NDG A;  5BOH A;  1VQQ A;  4I39 A;  3T4Q A;  1OME A;  1W8Q A;  4ZAM A;  2W3H A;  4DJ2 A;  4KZ5 A;  1BLS A;  1T1B A;  2WKH A;  1D1J A;  4B93 A;  1OT6 A;  3G34 A;  1ODV A;  3ISG A;  5DKL A;  2D02 A;  2XEP A;  3EGX C;  1NY0 A;  4N1H A;  5L07 A;  1K6S A;  1MWU A;  3ZCZ A;  1AXB A;  3S1Y A;  3ITB A;  4ETX A;  3EWK A;  4R1G A;  2XRN A;  3H9W A;  4JPM A;  1W5D A;  3MZE A;  1HZO A;  5DF8 A;  1XP4 A;  2DRW A;  1YLY A;  1BUL A;  4MBF A;  4HHD A;  3Q7V B;  1IYQ A;  5KMW A;  4ZJ2 A;  3O88 A;  2X01 A;  4I3A A;  3KYE A;  3BWL A;  4GN2 A;  1PWD A;  5TFQ A;  4ETZ A;  4JXW A;  2B95 A;  4KZ6 A;  3E4P A;  2VEA A;  4F3L A;  3KYQ A;  1K55 A;  1YLW A;  1OTD A;  4RX2 A;  2JCH A;  3ZYT A;  1L3L A;  4YIN A;  3P98 A;  3PHY A;  3ZG8 B;  2XDM A;  5J3W A;  3VP3 A;  5E2F A;  3SZT A;  4OKP A;  2A24 A;  2ACG A;  3SS4 A;  1ESI A;  3UB6 A;  4JXS A;  4MMN A;  4HEF A;  1SCW A;  4X68 A;  3FWL A;  1YT4 A;  3VP0 A;  3NI9 A;  5G4Y A;  5C5K A;  1OPX A;  4OQI A;  3A3J A;  3DTI A;  4LGW A;  3VOL A;  2Y2O A;  5FI7 A;  2Y2H A;  2UV0 E;  2HP9 A;  3KSH A;  3OPR A;  3T12 B;  4E3M A;  4P87 A;  2VA0 A;  5CX7 A;  4NET A;  4WF0 A;  5AJG A;  4FH2 A;  1A0K A;  4Y5F A;  4R38 A;  2VGL M;  2ZMA A;  2VGL S;  4KEN B;  4CJN A;  2GDN A;  3ZG9 B;  1W63 M;  5MC7 A;  4WYY A;  1S4R A;  3PAE A;  4XXR A;  1PWC A;  4BBT A;  3O86 A;  3G6O A;  5DFY A;  2JKG A;  4LV2 A;  2WKP A;  3L9K A;  1EI5 A;  1CI9 A;  2HDQ A;  4KZA A;  3P09 A;  4PAU A;  3FYZ A;  1VEU A;  1NRJ A;  2WGV A;  5FSR A;  2Z2M B;  3NUL A;  4MBH A;  5M1A A;  1TEM A;  3BY8 A;  2Y2Q A;  4D60 A;  1ZHH B;  5EFW A;  3QP5 A;  3BFE A;  2JC7 A;  2W3E A;  3IHA A;  3HJI A;  1DJC A;  4QWO A;  1TDL A;  4K0X A;  3UB7 A;  4LV3 A;  1XX2 A;  4MN7 A;  4X53 A;  5J7E A;  3TRC A;  3M6B A;  3MQQ A;  3C7U A;  4ID4 A;  4U0X A;  1GSV A;  5D3O A;  5EEC A;  1T18 A;  3K3C A;  1SDN A;  3G2Y A;  4CLC E;  1SZV A;  3OLO A;  4FD8 A;  2P08 A;  1ERM A;  1W79 A;  1MWS A;  3CWF A;  4GOG A;  4UA6 A;  3DW0 A;  3MF0 A;  4EWF A;  3ZG0 A;  4MEZ A;  4LFU A;  2VLG A;  4DMZ A;  3GV9 A;  4OQH A;  1BLP A;  3UDI A;  4ZTK A;  4XT2 B;  1CJF A;  4S2M A;  1KE4 A;  3HUO A;  1E3U A;  3QNB A;  1VM1 A;  2W1R A;  5EPH A;  1GA9 A;  2P74 A;  3ZG5 A;  4EEP A;  5FQ9 A;  1TS8 A;  4KQD A;  2GX5 A;  4ZDX A;  3Q1F A;  1AWI A;  3HBR A;  3T1X A;  3BFC A;  4ARZ A;  3B47 A;  4QHC A;  1PI4 A;  2GNX A;  3G32 A;  4KZ9 A;  1Q2Q A;  4KQO A;  4K08 A;  4H6J A;  4BQM A;  3SOI A;  4D2O A;  5CEC A;  4HH2 A;  5G4Z A;  1JVJ A;  3NIA A;  1S1Z A;  1BT5 A;  3I7J A;  2K31 A;  3NJA A;  1I2S A;  3BQ8 A;  3TE8 A;  2XSS A;  4P0M A;  4HJ4 A;  3Q7V A;  4DJ3 A;  4QJG A;  4YFM A;  1IKG A;  1BYW A;  2A3U A;  2PT7 A;  2VKS A;  4PKY A;  1YMX A;  3PTE A;  4S2L A;  5HWV A;  2BLS A;  1NXY A;  2P9V A;  3HLD A;  5DF7 A;  2JKR M;  2Y2G A;  2ZMV A;  3QP6 A;  5FQM A;  1ES3 A;  3CPT A;  3OOV A;  2J9P A;  4RX3 A;  1WA9 A;  3T4S A;  4S2O A;  1ERQ A;  2HP6 A;  1ONH A;  4Y17 A;  1CF0 A;  4UA7 A;  5DVA A;  1JNU A;  3N4I A;  4MBK A;  2JHE A;  3Q07 A;  4RYE A;  5EM0 A;  2PHY A;  4WEK A;  5AQB A;  4WMC D;  4EES A;  1FSW A;  1KOU A;  2J7V A;  3G35 A;  4QB8 A;  1YSQ A;  5E43 A;  4JF5 A;  1V9Z A;  3A3E A;  1RGZ A;  2V20 A;  5FI6 A;  5CEB A;  2WKI A;  2ZM0 A;  2INW A;  3O87 A;  3WRZ A;  1H8Z A;  2XH9 A;  2OAP 1;  5CTM A;  5HSQ A;  4C3Q A;  1IYS A;  5J4E A;  5A8B A;  3D3O A;  3HLF A;  3OPP A;  2A24 B;  1FCN A;  2DNS A;  4IUK A;  4WUJ A;  1YSP A;  2B18 A;  1KVL A;  4IBR A;  1MKI A;  5HD5 A;  3VP4 A;  2WAF A;  3PBR A;  4CLC A;  2XF3 A;  2V8C A;  4S2J A;  1LSV A;  1NYM A;  1BSG A;  1T1C A;  1X0O A;  1RP5 A;  2ZQD A;  3E2K A;  3S22 A;  3IXG A;  2JN7 A;  2ZQC A;  3WWX A;  1YKD A;  1MWR A;  5FA7 A;  4BEN A;  3VV4 A;  1E3U D;  1L0G A;  4H8R A;  2Y2K A;  3LI8 A;  2QJ5 A;  5FAQ A;  4C6Y A;  3FKW A;  3IXD A;  4WZ5 A;  4LCL A;  1UGU A;  5HL1 A;  5GLD A;  4DF6 A;  4NXE A;  4PMA A;  4ZRR A;  5GLA A;  3T4J A;  4L0L A;  4HH3 A;  1XJ2 A;  4BL3 A;  4R0Q A;  3W4O A;  1PRQ A;  1PZO A;  1RCJ A;  3SH7 A;  4WM9 A;  5CHJ A;  1FR6 A;  1ZC2 A;  3A3F A;  3DWZ A;  4DE2 A;  3MMH A;  1ERO A;  5DTT A;  4GS9 B;  1L0D A;  4JKT A;  5HFO A;  1YLT A;  3AGD A;  2VK3 A;  5DTS A;  4N92 A;  5FDH A;  4R3A A;  3C38 A;  4WL9 A;  5M18 A;  3F1N A;  4S2N A;  3Q82 A;  4XT2 A;  3B42 A;  5GL9 A;  1S0W A;  2VX8 A;  5EVE A;  1NLY A;  3F1O A;  3N8L A;  1V9Y A;  1F9I A;  4FSF A;  3T1Q B;  4RVA A;  3ZVT A;  3UY6 A;  2ZD8 A;  4GD6 A;  4S2P A;  3EQV A;  2Q9M A;  2WKR A;  3CIT A;  3LIE A;  4NXB A;  4E6W A;  3TJZ C;  4KQQ A;  4XUZ A;  3UE1 A;  1M6K A;  3PXP A;  2A2L A;  1SKF A;  3MXS A;  4KUK A;  1W8Y A;  1ACF A;  2X71 A;  2JKT I;  1OT9 A;  1RGY A;  2R9W A;  4BBV A;  4IVK A;  3IQA A;  5CHM A;  5L10 A;  2EX9 A;  4HP9 A;  1KDW A;  5U47 A;  2PU4 A;  2D01 A;  3A0V A;  3PBN A;  1DJB A;  2WAE A;  3ZQ5 A;  4UAA A;  2EFU A;  3KX0 X;  4DE0 A;  4ARZ B;  1PWG A;  3OC2 A;  2FH5 A;  3V50 A;  1VB6 A;  3HLB A;  1YQS A;  5FQK A;  1SKO B;  4H6J B;  4LLO B;  5EM1 A;  4X25 A;  2W3D A;  5GHX A;  3ULF A;  1IKI A;  1XPB A;  1I2W A;  2WK0 A;  3LID A;  1NZU A;  3M2K A;  3IXB A;  1SHV A;  5AQ7 A;  5F6A A;  3ITA A;  3KO6 A;  1HTZ A;  4FUW A;  3W2Z A;  4X6T A;  1NJ4 A;  4QU3 A;  3CJM A;  2XD1 A;  4OON A;  4OPY A;  1GHI A;  1XGI A;  3LFV A;  4UEY A;  3IX3 A;  1YLP A;  3OPH A;  3T4K A;  1OJG A;  3R4K A;  3NBL A;  1CI8 A;  4O8G A;  1FOF A;  1Q2P A;  5AQ9 A;  4OPQ A;  3E2L A;  2P9V B;  1ONG A;  3S7Q A;  3D72 A;  3H7W B;  3BW6 A;  4HBU A;  3CPT B;  1K57 A;  4NXG A;  3HL9 A;  4OLD A;  2Q0O A;  3MFX A;  2XLN A;  3G31 A;  5JYO A;  2V1B A;  5L2F A;  1OTE A;  4R23 A;  3MQO A;  2A49 A;  2BAS A;  2PR6 A;  3PAG A;  3FPV A;  5DJU A;  4U0T A;  3C30 A;  3IF5 A;  3MBZ A;  2ZJ9 A;  2C6W B;  5A93 A;  2M7V A;  2IWB A;  3IF6 B;  3MJQ A;  3WRT A;  3GSG A;  1MBL A;  1K55 C;  4GW9 A;  5CXW A;  2QPN A;  3ZGA B;  4G3V A;  1Z09 A;  3W4P A;  5L8M A;  2GJ3 A;  4ME4 A;  1MXO A;  5HW3 A;  2EXA A;  3ZVW A;  4GCZ A;  5DKK A;  3GVB A;  4II7 A;  2GZA A;  2PRF A;  4OPR A;  4HJ6 A;  4AFI A;  3L7H A;  3KSG A;  3N8R A;  2EA9 A;  3V5M A;  3IX4 A;  1BUE A;  4CLC B;  1ES2 A;  3QP4 A;  4PM8 A;  2ZC3 B;  2XFT A;  5EOO A;  3A3D A;  2WKQ A;  4I3J A;  4R3B A;  3T4O A;  1IOU A;  3IHB A;  2ZLY A;  2ZQ8 A;  2W3G A;  2XA7 M;  3UE0 A;  4O0P A;  1ES5 A;  1NYY A;  3K2N A;  4GD8 A;  2XA7 S;  4Q8I A;  3MXQ A;  3E98 A;  3A0R A;  2PAV P;  4GS9 A;  3E4Q A;  1XA1 A;  1DY6 A;  4R4S A;  3UPP A;  4Y0O A;  1TDG A;  3UN7 A;  4KZB A;  1L0F A;  5EV0 A;  3NC8 A;  1JTG A;  3N8S A;  1ZG4 A;  2EX2 A;  3LCE A;  2QKP A;  2HJ9 C;  4B9O A;  3BQA A;  2JKF A;  2Y2J A;  1FCM A;  3LY3 A;  1PI5 A;  1MY8 A;  1LT0 A;  1XGJ A;  1K56 A;  1XKZ A;  1TD5 A;  2VGJ A;  4BD0 A;  3IH9 A;  4HNB A;  4DN0 A;  3UO9 A;  2K7S A;  4E04 A;  5HDD A;  4EEU A;  3CUE A;  4G3W A;  3F1N B;  4WEJ A;  3U4L P;  1QMF A;  2PR5 A;  4JGQ A;  4IED A;  1VHM A;  5AQA A;  5EVI A;  5JYP A;  4DE1 A;  2LB5 A;  2W1T B;  1GSX A;  3D4F A;  3MS6 A;  4E3K A;  2J80 A;  4KG2 A;  3P7N A;  1L0E A;  5HDS A;  3F1O B;  2KX6 A;  5E2E A;  5HD3 A;  3IT9 A;  2MJ6 A;  4KQR A;  1L2S A;  1S1Y A;  4JF6 A;  3V39 A;  1JWV A;  2QMI A;  2WAD A;  5TGF A;  5HAP A;  2Y2M A;  5CRF A;  5AVF A;  1SKO A;  3UB8 A;  3HLE A;  4WN5 A;  1H8Y A;  4Q0J A;  1F2K A;  3QHY A;  3HRE A;  3LGO A;  1DRM A;  4LEN A;  3GDI A;  2L4R A;  2PD7 A;  3LR0 A;  4GKU A;  1D06 A;  1PW1 A;  3EQU A;  3C8C A;  4MDZ A;  3IWI A;  2VJW A;  3VP2 A;  1H0M A;  4P85 A;  2RCX A;  3R7W A;  5FAS A;  2QZ6 A;  3LIB A;  4KG6 A;  4ESP A;  4BMW A;  4Y0U A;  4GHI A;  3GEC A;  5FQJ A;  2V0W A;  1YM1 A;  5CGX A;  5FQQ A;  4Y15 A;  4Z1W A;  3H7W A;  1NWZ A;  4N9L A;  3T4T A;  1N4O A;  2KDK A;  4EU0 A;  2PDR A;  1IYO A;  1KE3 A;  3E4O A;  4PM6 A;  2M1C A;  1MWT A;  1G6A A;  3GRJ A;  4E3N A;  2V8F A;  1ZG6 A;  4PM7 A;  4ZJ3 A;  3PBO A;  4X56 A;  1JWP A;  2XQZ A;  1U60 A;  3A0S A;  4C75 A;  3BLM A;  3GTC A;  3VMA A;  2Y91 A;  1LL9 A;  3VE4 A;  4GJ4 A;  2EWW A;  3NHQ A;  3O5Y A;  4JXG A;  3EGD C;  3VFH A;  5GLC A;  2Y2P A;  2ZOI A;  3IF6 A;  5F1G A;  1WYB A;  3BRM A;  2KOI A;  1Y4O A;  4ZJ1 A;  3H82 A;  4Q0H A;  2HF6 A;  3IS2 B;  4M3K A;  5F1F A;  3NOU C;  4GLQ A;  4BD1 A;  5HWT A;  4B4X A;  1YLZ A;  5E2H A;  3N7W A;  5FEF A;  1FQG A;  2ZC7 A;  4NG2 A;  2IWC A;  4YWZ A;  1MKM A;  1LHY A;  3RJU A;  4RQ9 A;  3VFF A;  5KSC A;  1K0K A;  3EEH A;  5E2G A;  1JTD A;  2JE5 A;  3W4Q A;  2JKR I;  3QP8 A;  4EET B;  3VSL A;  4MCW A;  4Z9Q A;  5IS1 A;  3C7V A;  4S2K A;  2DCF A;  3S7P A;  5FAO A;  1GA0 A;  3UNW A;  4NEE D;  1XJ3 A;  1YLJ A;  2X02 A;  2Y8H A;  1ESU A;  2G2W A;  3LYX A;  1IEM A;  4JGR A;  4FH4 A;  1K54 A;  3T50 A;  2EX8 A;  4Y13 A;  3BEC A;  1TVF A;  3KYZ A;  2YKH A;  2HPB A;  2OAQ 1;  2QHK A;  2W3F A;  4BJP A;  4FTX A;  5EVL A;  3RTY A;  2C5W B;  4PM5 A;  4U3T A;  5TBM B;  3ZHH A;  2J9O A;  3HVF A;  2R9X A;  1K4F A;  4CLC C;  3C4O A;  3IH8 A;  2HGV A;  1O07 A;  3MFD A;  4IBX A;  5L09 A;  2Z2L B;  3Q81 A;  3TOI A;  2ZL1 B;  1H5X A;  1N9L A;  2Y79 A;  1G5U A;  4DXB A;  1HVB A;  4I38 A;  3HLG A;  2O9A A;  3PBQ A;  2RL3 A;  2VV8 A;  3NDE A;  5KIZ A;  3AGF A;  3RXW A;  2WGW B;  1LL8 A;  4HBT A;  3NY4 A;  1Y54 A;  1LL5 A;  3N6I A;  4MNR A;  4YNR A;  4OLG A;  1M40 A;  5AVE A;  4WZ5 C;  2WKE A;  2Y2N A;  1KGG A;  2W1T A;  2WYX A;  2EFX A;  2AVX A;  3G4P A;  3ZNT A;  4E3L A;  5IT5 A;  4M4X A;  4R3J A;  3UMD A;  5LBR A;  5TR7 A;  3UE3 A;  2ZQ7 A;  1NRF A;  3RFB A;  1P97 A;  4LV1 A;  4Y0T A;  2B5R A;  2V9A A;  2PYP A;  2YKF A;  3PBS A;  3CG5 A;  3CI6 A;  2ZM8 A;  5K5B A;  2CMN A;  1OTA A;  3Q7Z A;  3GMW A;  4PKY G;  1LI0 A;  2E8J A;  4S2N C;  5FAP A;  4KZ8 A;  4KG5 A;  5EVI B;  4EW7 A;  5FDS A;  2P04 A;  4OQG A;  2EWV A;  4EBP A;  3VP1 A;  2J8Y A;  2I9V A;  4DE3 A;  3OZH A;  4QPR A;  5HX9 A;  1WE4 A;  2JBF A;  2M7U A;  4GDN A;  4G3K A;  5TJJ A;  5GLB A;  3BFD A;  5HL6 A;  3UDF A;  2XGN A;  4RA7 A;  2XRO A;  3O3V A;  2ZC6 B;  1XFN A;  3IBJ A;  2HDS A;  1XJ6 A;  1UWP X;  2NUP C;  1G6O A;  3NEC A;  2Y55 A;  1ES4 A;  4EER A;  4DDS A;  2EXB A;  4EQI A;  1NZO A;  3UPN A;  3UDX A;  2W27 A;  2QYB A;  2FFY A;  5DFX A;  1F98 A;  2ZBB A;  4OH0 A;  4S2I A;  4CLC D;  1K25 A;  4K91 A;  3FG8 A;  2E8I A;  4HQA A;  4Y7P A;  2ZM2 A;  2BG1 A; 
#chains in the Genus database with same CATH homology
 5HWV A;  5F69 A;  3OCL A;  3E4Q A;  3V67 A;  3R7W B;  4HOI A;  4BBU A;  3UE6 A;  1LSW A;  3LR4 A;  2JKR M;  5F68 A;  2ZMV A;  4IUH A;  1DP8 A;  4WEL A;  4GHI B;  2P7J A;  1XJ4 A;  2JKT M;  3OOV A;  1DP9 A;  1WA9 A;  3T4S A;  2J3W A;  2QKP A;  1TS6 A;  2HJ9 C;  4B9O A;  2QWS A;  3S7O A;  3IS2 A;  3BQA A;  2ZOH A;  3LR5 A;  1JNU A;  1S67 L;  4L9E A;  1TS7 A;  3PR6 A;  2JHE A;  1NLZ A;  3KSI A;  3UME A;  2PHY A;  3VE3 A;  4WEK A;  1S66 L;  1LT0 A;  1OTB A;  4EES A;  3LUQ A;  1KOU A;  1TD5 A;  2HJE A;  4HY8 A;  1YSQ A;  5HZH A;  1P9R A;  2VV7 A;  1YAX A;  4HNB A;  4DN0 A;  1W63 Q;  5FL3 A;  1V9Z A;  5DF9 A;  2K7S A;  4E04 A;  5HDD A;  4EEU A;  3CUE A;  4G3W A;  3F1N B;  4WEJ A;  3F1P B;  3C2W A;  2PR5 A;  4JGQ A;  1STZ A;  2INW A;  1VHM A;  4CQH A;  2LB5 A;  2W1T B;  1GSX A;  3BY9 A;  3U2A A;  2J80 A;  3P7N A;  3H82 B;  3ICY A;  2O99 A;  2OAP 1;  5HDS A;  3F1O B;  2KX6 A;  2OOL A;  4Y2F A;  5HSQ A;  5HD3 A;  2V0U A;  1D7E A;  3PYP A;  5J4E A;  2MJ6 A;  1IFQ A;  3D3O A;  5A8B A;  4IHQ A;  1TS0 A;  2A24 B;  4OOL A;  3NOP C;  4FOF A;  4IUK A;  1N9N A;  1S1Y A;  4WUJ A;  4LPZ A;  3SW1 A;  1YSP A;  2B18 A;  3T4L A;  1LSX A;  4PHT A;  5HD5 A;  2QJ7 A;  4HI4 A;  5AVF A;  3PBR A;  4CLC A;  4EXO A;  4EUV A;  4HJ3 A;  3UB8 A;  3LIC A;  3FPW A;  4WN5 A;  2ZMF A;  5TBM A;  4Q0J A;  4I39 A;  3T4Q A;  2W3H A;  4DJ2 A;  1LSV A;  1T1B A;  4B93 A;  1T1C A;  1X0O A;  1OT6 A;  1DRM A;  3GDI A;  2L4R A;  2JN7 A;  2PD7 A;  3LR0 A;  3CLO A;  3PBT A;  1ODV A;  1YKD A;  1D06 A;  5DKL A;  2D02 A;  4Y3I A;  3EGX C;  4MN6 A;  3VV4 A;  5F5Y A;  3EQU A;  3C8C A;  4MDZ A;  3S7N A;  4WLA A;  2VJW A;  2FZ0 A;  3LI8 A;  3R7W A;  4ETX A;  3EWK A;  3LIB A;  1N9O A;  2QJ5 A;  1OJ5 A;  2XRN A;  4BMW A;  2LB9 A;  3H9W A;  1UGU A;  4NXE A;  4ZRR A;  4GHI A;  2O9B A;  3T4J A;  4L0L A;  3GEC A;  2V0W A;  2PD8 A;  4HH3 A;  1XJ2 A;  3TW8 A;  4Z1W A;  3H7W A;  1NWZ A;  3LIF A;  4HHD A;  2B02 A;  3MR0 A;  3T4T A;  2VZW A;  2KDK A;  4EU0 A;  2PDR A;  3E4O A;  2M1C A;  4P6Z M;  4MN5 A;  4P6Z S;  3MMH A;  3B33 A;  2Z6D A;  4GS9 B;  4I3A A;  3BWL A;  3PBO A;  4YOF A;  4ETZ A;  1DP6 A;  3A0S A;  3LIA A;  1GSW A;  2L0W A;  3KSF A;  3JVV A;  3E4P A;  3VE4 A;  2VEA A;  4GJ4 A;  2EWW A;  3NHQ A;  3O5Y A;  3KYQ A;  4F3L A;  3EGD C;  1OTD A;  4R3A A;  3C38 A;  1H8M A;  2J3T C;  4WL9 A;  2ZOI A;  3F1N A;  4IJG A;  3ZYT A;  3F1P A;  4XT2 A;  3IBR A;  2HV1 A;  1P0Z A;  3B42 A;  2KOI A;  3PHY A;  2VX8 A;  5J3W A;  3H82 A;  4Q0H A;  2HF6 A;  1NLY A;  3F1O A;  3IS2 B;  3NOU C;  1V9Y A;  3JVU A;  1F9I A;  4FSF A;  4GLQ A;  2A24 A;  1G28 A;  5HWT A;  1MZU A;  3UB6 A;  4MMN A;  4YWZ A;  1MKM A;  4RQ9 A;  3EQV A;  3EEH A;  5KSH A;  2WKR A;  3CIT A;  3LIE A;  4NXB A;  3TJZ C;  3PXP A;  2A2L A;  2JKR I;  1F5M A;  5G4Y A;  5C5K A;  4EET B;  1OPX A;  4KUK A;  2KLI A;  3VOL A;  4MCW A;  2JKT I;  1OT9 A;  5IS1 A;  3KSH A;  4BBV A;  3S7P A;  2VA0 A;  4HP9 A;  5CX7 A;  4LRZ E;  2W0N A;  4NEE D;  1XJ3 A;  4O01 A;  4WF0 A;  5AJG A;  3CUE C;  4LRY C;  5IU1 A;  4Y5F A;  2D01 A;  3A0V A;  2VGL M;  3PBN A;  2Y8H A;  4R38 A;  4R6L A;  3E0Y A;  3ZQ5 A;  2VGL S;  3LYX A;  3KX0 X;  4JGR A;  4ARZ B;  1W63 M;  2VV6 A;  3T50 A;  3OC2 A;  5MC7 A;  2FH5 A;  3EOI A;  1S4R A;  1VB6 A;  1Y28 A;  3KYZ A;  2YKH A;  2DMW A;  2OAQ 1;  4BBT A;  2QHK A;  2W3F A;  4BJP A;  3G6O A;  5DFY A;  5HWW A;  3RTY A;  4H6J B;  1MC0 A;  2WKP A;  5I5L A;  4LLO B;  2W3D A;  3ULF A;  5TBM B;  4JGP A;  2PYR A;  1T1A A;  4PAU A;  1T19 A;  3LR3 A;  4CLC C;  3LID A;  2HGV A;  1NRJ A;  2L1M A;  5F6A A;  3KO6 A;  1N9L A;  2Y79 A;  3BY8 A;  3MQ0 A;  1ZHH B;  3W2Z A;  5EFW A;  4I38 A;  2O9A A;  3PBQ A;  2V1A A;  2W3E A;  3LFV A;  4UEY A;  2VV8 A;  5KIZ A;  4LRX C;  3HJI A;  3T4K A;  1H3Q A;  1OJG A;  1LL8 A;  3R4K A;  2K2N A;  4O8G A;  3UB7 A;  4MN7 A;  4HP4 A;  5J7E A;  3TRC A;  4YNR A;  3S7Q A;  3D72 A;  4JGO A;  3MQQ A;  5AVE A;  3H7W B;  1GSV A;  3BW6 A;  1T18 A;  1UWN X;  1TF1 A;  4NXG A;  3K3C A;  3OCN A;  2J3T D;  4KUO A;  4CLC E;  3OLO A;  2H28 A;  2W1T A;  3MFX A;  2P08 A;  3K3D A;  4OOM A;  2V1B A;  1OTE A;  3CWF A;  5IT5 A;  3MQO A;  2BAS A;  2OWJ A;  3HCY A;  4M4X A;  2PR6 A;  3EEA A;  3UMD A;  3MF0 A;  5LBR A;  3NOT C;  3FPV A;  5DJU A;  3UE3 A;  3RFB A;  4F3L B;  1P97 A;  2R78 A;  3C30 A;  2OWH A;  2VLG A;  5DJT A;  4DMZ A;  1XFQ A;  5HDC A;  2V9A A;  2G7U A;  2PYP A;  2YKF A;  3PBS A;  3CI6 A;  4XT2 B;  2M7V A;  3MJQ A;  4L9G A;  4EQ1 A;  3RH8 B;  3DBA A;  2CMN A;  4I5S A;  4NKP A;  5HPI A;  5K5B A;  4GW9 A;  1OTA A;  2W1R A;  4PKY G;  4G3V A;  1P9W A;  4EEP A;  3P01 A;  1TS8 A;  4KQD A;  4EW7 A;  2GX5 A;  2P04 A;  2EWV A;  5L8M A;  1OTI A;  2I9V A;  4QPR A;  2GJ3 A;  4ME4 A;  4ARZ A;  4UQI M;  2M7U A;  3B47 A;  4G3K A;  4GCZ A;  5DKK A;  5TJJ A;  4HIA A;  4UQI S;  4II7 A;  3UB9 A;  5HL6 A;  2GZA A;  1ZTU A;  2GNX A;  3CAX A;  4R70 A;  4HJ6 A;  2XRO A;  4KQO A;  4AFI A;  4K08 A;  4H6J A;  5HPF A;  3KSG A;  1XFN A;  4HH2 A;  3IBJ A;  1XJ6 A;  1UWP X;  5G4Z A;  1G6O A;  2EA9 A;  2O9C A;  2NUP C;  3HJK A;  2Z6C A;  3LI9 A;  1S1Z A;  4CLC B;  2NUT C;  3BJN A;  3OBF A;  4I3I A;  2K31 A;  3NJA A;  4EER A;  4BWI A;  3BQ8 A;  1S4S A;  3TE8 A;  2XSS A;  2WKQ A;  4I3J A;  4HJ4 A;  2O0Y A;  2W27 A;  3T4O A;  2QYB A;  1IOU A;  5DFX A;  4DJ3 A;  1F98 A;  1BYW A;  2ZBB A;  4L9F A;  2W3G A;  2XA7 M;  2PT7 A;  2VKS A;  4O0P A;  4PKY A;  4CLC D;  3K2N A;  2XA7 S;  4NXF A;  3FG8 A;  4HQA A;  3MXQ A;  2IA2 A;  4Q0I A;  3E98 A;  3A0R A;  3FC7 A;  4GS9 A;  1EW0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...