3UMEA

Structure of pb intermediate of photoactive yellow protein (pyp) at ph 7
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
125
structure length
125
Chain Sequence
b'MEHVAFGSEDIENTLAKMDDGQLDGLAFGAIQLDGDGNILQYNAAEGDITGRDPKQVIGKNFFKDVAPCTDSPEFYGKFKEGVASGNLNTMFEYTFDYQMTPTKVKVHMKKALSGDSYWVFVKRV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Photoactive yellow protein
publication title pH Dependence of the Photoactive Yellow Protein Photocycle Investigated by Time-Resolved Crystallography.
pubmed doi rcsb
molecule tags Protein binding
total genus 30
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2011-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00989 PAS PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3umeA00
3EEHA 5AVEA 3UB8A 1F9IA 4GS9B 4JGPA 4YWZA 2OWHA 5F68A 3MR0A 4MN6A 4HP4A 2V0UA 3FG8A 2PDRA 1ODVA 3F1NA 1LSXA 4MN5A 2HV1A 4NXGA 4GCZA 4EXOA 4M4XA 3BY8A 2KDKA 3ZQ5A 4LLOB 3B33A 3UB7A 4HH2A 3CLOA 1UWPX 4EERA 1VB6A 4F3LB 4H6JA 1LT0A 4R38A 4EEUA 1UWNX 1DRMA 1X0OA 4GS9A 1XJ3A 2VLGA 3F1PB 1N9OA 4WL9A 1P0ZA 2K7SA 2VEAA 5HD5A 2WKPA 2WKQA 1T1BA 2B02A 3LIAA 4NXBA 1TS8A 2W0NA 4BBTA 5J3WA 3D72A 3VE4A 3HJKA 3K3CA 3BWLA 3UMEA 1D06A 4XT2B 1S1ZA 3LIBA 4HNBA 1OTEA 5DKLA 3RH8B 3LIEA 3LIFA 4HJ3A 1OT9A 4HI4A 5HZHA 2Z6DA 2VV7A 2PD7A 3E4OA 4F3LA 3ULFA 5TBMB 1TS6A 2QKPA 1T18A 3GECA 4HIAA 1S1YA 1OTDA 3F1PA 1T1AA 4NXFA 5HWWA 5AVFA 3LI9A 5HSQA 4EETB 3MXQA 3VE3A 4EEPA 5F69A 5G4YA 2JN7A 4HJ4A 3LIDA 1V9ZA 1T1CA 2A24B 1Y28A 2GJ3A 3H7WB 4HP9A 3F1OB 4KUKA 3VOLA 3UB6A 3SW1A 1LSWA 4LRXC 4KQDA 2D02A 5TBMA 2R78A 2PYPA 3NOTC 2QJ5A 2V1AA 5HDSA 1OTIA 4LRZE 3NOPC 5HWTA 2BASA 4KUOA 2VV8A 1N9NA 4E04A 5J4EA 4GHIB 3UB9A 1OT6A 1LL8A 1S4RA 1LSVA 4HJ6A 4WLAA 3A0VA 2A24A 2OWJA 1TS0A 3H7WA 3NJAA 4I3JA 2JHEA 2PR6A 4EQ1A 3F1OA 3LICA 2V9AA 2OOLA 4HOIA 4PKYA 1P97A 5IU1A 4JGOA 5G4ZA 2P7JA 3FC7A 4R70A 2J80A 4EESA 2PHYA 4GW9A 1GSWA 4GHIA 3P7NA 1BYWA 1GSXA 1XFNA 4HH3A 2H28A 3H9WA 5DKKA 4DJ3A 4EW7A 3UMDA 4PKYG 5A8BA 4L9EA 3MQQA 5F5YA 2QJ7A 3PHYA 3LYXA 1T19A 4RQ9A 2PD8A 4HHDA 3NOUC 1EW0A 3NHQA 1UGUA 4R3AA 3H82B 3MFXA 3BY9A 1G28A 3MQOA 5HD3A 2EA9A 5F6AA 3A0SA 1DP8A 4XT2A 2Z6CA 3UE6A 2L4RA 1OJGA 2L0WA 1S67L 4HY8A 4DJ2A 4L9FA 3CAXA 2V1BA 1OTBA 3C8CA 2INWA 4K08A 3H82A 1OJ5A 2W27A 4LPZA 3IBRA 4R6LA 1F98A 3IS2B 2D01A 3PYPA 2KX6A 3A0RA 2QWSA 1KOUA 4I38A 4JGRA 4JGQA 1OTAA 3RTYA 2ZBBA 4WF0A 4I3AA 4NXEA 5HDCA 1XJ4A 1S4SA 1XFQA 3G6OA 4B9OA 3LI8A 5KIZA 2V0WA 4WN5A 5DJUA 4I3IA 1TS7A 1S66L 2PR5A 3GDIA 5IS1A 2ZOHA 3IS2A 2QHKA 1DP6A 3LUQA 5HDDA 1GSVA 2L1MA 5DJTA 1XJ2A 3EWKA 3KX0X 1JNUA 3E4PA 1MZUA 4I5SA 3MJQA 1V9YA 2YKFA 3E4QA 3OLOA 2I9VA 1NWZA 3K3DA 4WUJA 4HQAA 3C2WA 3ICYA 1D7EA 2ZOIA 5I5LA 2WKRA 4BBUA 4LRYC 3F1NB 1DP9A 3CWFA 5HWVA 1XJ6A 3HJIA 2YKHA 2M1CA 4BBVA 4L9GA 2CMNA 2VV6A 4I39A 5J7EA 1N9LA 3T50A 2PYRA 4H6JB 5EFWA 1WA9A
chains in the Genus database with same CATH superfamily
1ALQA 1O7EA 3GMWA 5F68A 3MR0A 1MBLA 3CPTB 4HP4A 1W63M 1YLYA 3QP6A 4QU3A 4EXOA 4NETA 3BY8A 2KDKA 2PAVP 3L9KA 3ZQ5A 3IT9A 3HBRA 1ZG4A 3KO6A 4N9LA 3UB7A 4CLCD 2KOIA 2V20A 3PTEA 1K55C 4IVIA 4PM6A 1GA0A 3T1QB 4F3LB 2Y8HA 3M6HA 4KG5A 1KVLA 1KDWA 5HW3A 4R38A 1TDGA 1DRMA 4P85A 4S2IA 1XJ3A 2VLGA 2ZC3B 4MBHA 3NDGA 2WAEA 4ZRRA 1N9OA 4WL9A 1P0ZA 2W1RA 3IH8A 2ACGA 1FCNA 3W2ZA 2WKQA 1T1BA 3LIAA 3EQVA 1K4EA 3HLBA 1BLHA 4BBTA 1SDEA 5GHYA 4BMWA 1K25A 3NULA 3BWLA 2WKHA 2O9BA 2WAFA 1OTEA 4HNBA 3G31A 4HJ3A 4ETXA 2PU4A 2Z6DA 2VV7A 4NG2A 3ULFA 5TBMB 4MNRA 5F1FA 3IWQA 2OAP1 3BFCA 3G34A 1MC0A 4JXVA 5A90A 1PWDA 4Q8IA 2IWDA 2JKFA 5AVFA 4R3JA 5HSQA 3MXQA 2Y2PA 3BQAA 4EEPA 4YNRA 2VKSA 1H5XA 5G4YA 3IF6B 1IELA 1MXOA 1V9ZA 3HLDA 3CUEC 4WZ5A 4R4RA 4OP8A 3MMHA 4E3IA 4LRXC 4K0WA 5FQKA 1ES3A 3ZFZA 2HGVA 5L07A 3ZG5A 1EI5A 2HJ9C 5HDSA 4LRZE 5HWTA 3RXWA 2DCFA 3WRZA 2VV8A 1N9NA 3IH9A 4N9KA 1LL8A 5AQ9A 4B4XA 5FEFA 1K6RA 5TFQA 1VETB 1XA1A 2V8CA 4WLAA 4ARZA 2OWJA 5KSCA 4UA7A 2Y2HA 3LGOA 3UB5P 2EFUA 2JHEA 3IF5A 2H0TA 3F1OA 3BFFA 4OKPA 3LICA 1W7FA 5CEDA 1VQQA 1WYCA 2G2WA 2OOLA 4Z9QA 1ES2A 4BD1A 4BWIA 4PKYA 4EWFA 2PBDP 2WYXA 2NUPC 4KZ9A 1FSYA 1P9WA 4YFMA 2XROA 1P9RA 4CLCE 2P7JA 4Y5FA 5G4ZA 2PRFA 2Y2MA 1BYWA 4IJGA 3T1RA 4PMAA 5L10A 3P01A 1YM1A 3MZDA 3E2KA 4R23A 4OP5A 4KQOA 3MQQA 2FH5A 2HF6A 4Q0IA 3DW0A 3PHYA 2ZM8A 4ZJ3A 3V50A 2PD8A 1GHIA 2P9VB 4WYYA 5EE8A 4R3AA 3H82B 3CHWP 4KQQA 3IF6C 3BY9A 1G28A 1YQSA 1IYOA 2EA9A 1H3QA 3T4OA 1DP8A 2C5WB 1MWRA 4BLMA 4K0XA 3UE6A 5FAPA 3W4PA 4DE0A 2ZMFA 3ZG9B 3WS4A 2L0WA 3FKVA 1DJAA 3TE8A 1PWCA 1G6OA 4R1GA 2Y4AA 5DF9A 3RXXA 1YKDA 5FI6A 1KE0A 4ZDXA 3LCEA 4MBFA 5EOEA 4MEZA 4C3QA 1OTBA 1I2WA 2J3TC 1WE4A 3FZCA 4ZJ1A 5C5KA 3C30A 3O86A 4S2OA 4LPZA 3MKEA 4PHTA 3IS2B 1I5QA 2W3FA 3PYPA 3DTMA 1Q2QA 2QWSA 3E2LA 2UWXA 4E3NA 1W79A 1PNEA 1OTAA 3RTYA 1DJBA 1BT5A 4KENB 1BUEA 3NIAA 2LB9A 1S4SA 5HPIA 4EBPA 1XFQA 5GHXA 3Q1FA 4CLCB 1TF1A 4QHCA 2V0WA 2W3DA 3QHYA 1NRJA 4I3IA 4IUHA 1MKMA 3VSKA 3BLSA 4U3TA 2G7UA 2JC7A 1YMXA 2H0YA 4S2NC 4G3WA 2ZOHA 3R7WA 3TJZC 4LENA 5FDHA 1E3UA 3ZHHA 4EUVA 2WZZA 2Y59A 1XJ2A 2JKRM 3KSIA 1HLUP 3E4PA 4E3MA 3E98A 3OLOA 2I9VA 3K3DA 3VSLA 3HUOA 4HQAA 2QYBA 3V39A 3ICYA 4PM8A 3MKFA 3FYZA 4WEKA 3QP4A 1EROA 1K56D 4Y0OA 1NLZA 1DP9A 2VGKA 4WELA 2ZMVA 5IHVA 1JWZA 5FQQA 4DDSA 5HAQA 4BBVA 1KGFA 4L9GA 1KE3A 4I39A 3MZEA 1CJFA 4G3KA 1WA9A 1KVMA 5E2FA 1PWGA 5TJJA 2W3HA 5CEBA 3EEHA 3UB8A 1ZG6A 1Y4OA 5EVIA 4JGPA 3MSHA 2OWHA 3O5YA 3TRCA 3ITAA 2ZQCA 5FI7A 3ZCZA 3OZHA 1RP5A 2V0UA 4DDYA 1I2SA 5GLAA 2PDRA 3KYQA 4MN5A 2FFYA 2HV1A 4GCZA 3ZNYA 1ERQA 1YSPA 4X55A 1LLBA 2O0YA 4Q0HA 2XH9A 4HH2A 3OC2A 3CLOA 3OPLA 4WM9A 1MKIA 5CERA 4JLFA 3CZDA 5E2HA 1SDNA 4EERA 5CTMA 1VB6A 2E8JA 4CLCC 3V3SA 2IWBA 1K38A 4KG6A 2Y55A 2UV0E 3MBZA 4P87A 3ZVWA 4LV2A 4Y3IA 5CXWA 5A93A 5HD5A 2EXBA 4F94A 2WKPA 3BQ8A 4N1HA 1OPXA 4E3OA 1E25A 4IUKA 1CF0A 5J3WA 1FOFA 4QY6A 1TVFA 3HJKA 3UMEA 3LEQA 4EBNA 4EQIA 5DKLA 4D2OA 4QWOA 3T4SA 4HI4A 3A3DA 4P6ZS 5HZHA 3IHBA 2FZ0A 2JKGA 4UQIM 3E4OA 3SH9A 1NZUA 3G35A 3BRMA 1T18A 1MWUA 1VEUA 4HIAA 5EOOA 2XA7S 1GA9A 3OCNA 3VFHA 3OBFA 2K31A 2Y2QA 3GVBA 2XK1A 5EM0A 3VE3A 5FQIA 2JN7A 5M19A 4HJ4A 4DXCA 2JE5A 1SCWA 1T1CA 3BW6A 4ARZB 3D3OA 1Y28A 1ZTUA 2GJ3A 4Y15A 5IT5A 3F1OB 4KUKA 2IWCA 3OOVA 5DF7A 1J3WA 2VA0A 3TW8A 3N4IA 4KQDA 4S2PA 2W3EA 4XUZA 1BULA 2R78A 1JTDA 3VMAA 4OONA 1A0KA 2QJ5A 2V1AA 2PT7A 1HZOA 2ZQ7A 2WGVA 2BASA 2OLUA 4KUOA 2Y2IA 4ID4A 3QP1A 2ZC4B 4S2LA 3UB9A 2EX6A 4OPQA 1LSVA 5FQJA 1YMSA 3UDFA 4HJ6A 2A24A 3H7WA 4EQ1A 4OOYA 2V9AA 3DTIA 2EXAA 5BOHA 3N8RA 4IVKA 5IU1A 3N8SA 4JGOA 3S4XA 1LL9A 2ZL1A 1FILA 4U0TA 3C38A 5GLDA 4IEDA 4E6WA 2P04A 3D4FA 4GB7A 2WUQA 2IA2A 4WZ5C 3L7HA 2WGIA 3VP4A 2XEPA 1GSXA 4HH3A 3ITBA 3S7QA 3UE1A 1MY8A 4JBFA 4DJ3A 3T4TA 4YOFA 3ZNTA 5A8BA 1H8YA 4ZBEA 4JF6A 4QY5A 1CI9A 3DWZA 2O9AA 4EU0A 4E3LA 4KZ3A 1GHMA 3HREA 2CC1A 2VJWA 1XGJA 1Q2PA 1VM1A 2K2NA 3QP5A 1MPLA 4JXSA 2H10A 2KLIA 1SZVA 4FH4A 3N8LA 3MQOA 2ZQ8A 1ZHHB 5FEGA 2ZC7A 3HLFA 3PBSA 2Q9MA 5E2EA 2L4RA 5EUAA 4QPRA 1OJGA 1YT4A 5M18A 2Z2MB 4GDBA 4JXGA 4OQGA 3LY3A 4L9FA 5DFXA 4MCWA 3TSGA 3CITA 5JYPA 2XFSA 4JXWA 4Y0UA 1GCEA 3DTKA 3R7WB 4R6LA 3Q7ZA 1BTLA 1TDLA 4E3KA 1LI0A 4OOMA 4A5RA 3JVVA 1BLPA 4I38A 4JGRA 3IHAA 4Y13A 4LGWA 5F83A 1XGIA 3G4PA 5GLBA 4OPYA 4MMNA 2ZQAA 2HDRA 4AFIA 3CUEA 2Q9NA 1H0MA 2RCXA 1STZA 5HDCA 4WMCA 1PI5A 4R0QA 5FAOA 1NRFA 1SKOA 3Q82A 5DJUA 1TS7A 3BJNA 5CHUA 1S66L 3SS5A 3QNBA 3ZG0A 3ZYTA 3IXGA 3KYEA 4O01A 1CEGA 3CG5A 4GLQA 3QP8A 5DVAA 3GDIA 3VP2A 3LR3A 2EX2A 3NI9A 1DP6A 3LUQA 5FQ9A 2J8YA 2JKTI 2XSSA 4OLDA 5KZHA 1IFQA 4PM7A 5FDSA 2WADA 1JWVA 4I5SA 1J9MA 2XGNA 5CX7A 5FAQA 5EVIB 4G3VA 3MJQA 1V9YA 2YKFA 3PXPA 1ES5A 3EQUA 1NWZA 4RX3A 1NYMA 5M1AA 5HX9A 1K4FA 3D9YA 3BFGA 3IX8A 4LCMA 4HESA 1YLWA 4ZJ2A 2WKRA 5K5BA 1PI4A 2GDNA 4KZAA 4Q0JA 2X01A 4WMCD 3P09A 3NDEA 3ZG8B 5HWVA 4S2MA 3UPOA 3OPRA 3HJIA 5FQMA 4UA6A 2WZXA 2M1CA 1W8YA 3VOZA 3IX3A 2XQZA 2PYRA 5KSHA 5EFWA 1YPRA 4OOLA 5E2GA 4GJ4A 3G2YA 5AVEA 5FI2A 1F9IA 3PBQA 3UY6A 4X6TA 4ESPA 5CGSA 3PBRA 3FKWA 1YLTA 4ZAMA 4M3KA 4JF4A 5F82A 3FG8A 1ODVA 4GD8A 3AGFA 3T4LA 3R4KA 4M4XA 2A2LA 4GD6A 2XD5A 5CTNA 3B33A 4X1MA 1ONHA 1FSWA 3HVFA 3IWIA 1G6AA 5HL6A 5AQAA 4E6XA 3IQAA 2PU2A 4H6JA 4X68A 3LR4A 1LT0A 1VEUB 4EEUA 2MJ6A 1X0OA 1Z09A 4GS9A 4WZ4A 4EBLA 4OPZA 2K7SA 3UPNA 2VEAA 4D60A 1K54C 2WK0A 1XA7A 4N1XA 2B02A 1PZPA 3WRTA 5EECA 1W63Q 2XRNA 4GNUA 1ONGA 1F5MA 3A3IA 2ZJ9A 3G30A 4FUWA 3GR2A 3K3CA 4LV3A 3MXRA 4XT2B 1S1ZA 3LIBA 3WS1A 3RH8B 2J7VA 2VZWA 3LIFA 1OT9A 1GHPA 3MF0A 3B47A 1TS6A 1ACFA 3A3JA 3NBLA 2QKPA 1ERMA 2XFTA 5HAIA 3F1PA 1T1AA 4NXFA 5HWWA 1NJ4A 5L09A 4DE2A 3LI9A 3SH7A 4EETB 2HP5A 3Q7VA 5F69A 5CRFA 1CQAA 4C6YA 4FSFA 4B4ZA 3FPVA 2A24B 4ZTKA 3H7WB 3ISGA 3MZFA 1TD5A 3G2ZA 3HLWA 1FIKA 1LSWA 3WWXA 3EOIA 2Y2JA 4QB8A 3UE3A 4Y2FA 4BENA 5TGFA 5HARA 1LL5A 2PYPA 1E3UD 2DMWA 3T4KA 5EV0A 3SS4A 5MC7A 3C4PA 3NOPC 1AWIA 2ZL1B 4HEFA 2Q0OA 3W4OA 3KSFA 2QZ6A 2XD1A 1RGZA 5EVEA 1OMEA 1OT6A 1ESUA 2VGLM 1BZAA 5TR7A 4MLLA 1ZC2A 2J9OA 3BFEA 2ZQ9A 4WEJA 3N7WA 2PR6A 5FL3A 1LHYA 4DN0A 3CMZA 5A92A 3HLEA 2BG1A 2Y79A 4RVAA 3NY4A 4DE1A 1K57A 4DKIA 2J80A 4BQMA 2ZC5B 3JVUA 3MXSA 2PHYA 3KSHA 3BEBA 3VFFA 1GSWA 1IYQA 5EVID 4GHIA 2ZD8A 1PW1A 2V1ZA 3S1YA 3P7NA 1NY0A 4X1LA 1L0EA 1XFNA 2H28A 2OAQ1 1XXMA 4EW7A 4QD4A 4PKYG 3N6IA 2QJ7A 5J8XA 3PBTA 5DFYA 1MWSA 4XUXA 3LEZA 1L3LA 4FOFA 3UO9A 1SHVA 2B18A 4HHDA 1EW0A 3NHQA 2EX8A 1UGUA 3S22A 3MFXA 3IX4A 4O0PA 3P98A 1FCOA 1IKGA 1L0FA 1YLJA 4XT2A 1L2SA 2Z6CA 2G2UA 1FCMA 4S2KA 3SOIA 2XLNA 2HP6A 1IYSA 4DJ2A 1SKOB 1VHMA 3RJUA 2JCHA 5DTKA 3U4LP 1JVJA 3LO7A 4EUZA 3CJMA 3CAXA 5HPFA 2WGWA 3C8CA 1L0DA 1L0GA 2HDUA 1AXBA 1M40A 4JKTA 4K08A 1OJ5A 2M7VA 2W27A 3IBRA 1F98A 3A0RA 3OPHA 1KOUA 4IBRA 4PM5A 3V67A 3BM6A 3Q81A 2P74A 4JGQA 4WF0A 3UPPA 1PRQA 5G18A 4LV1A 2HP9A 1XJ4A 5GLCA 4GN2A 5L2FA 1IEMA 1XX2A 3EGDC 4WN5A 3ZG7B 2XF3A 4H8RA 2PBYA 1PZOA 4CJNA 2Y2LA 3G32A 1NXYA 3O88A 5IS1A 5AQBA 2QHKA 4KG2A 2EWVA 1GSVA 2L1MA 2HPBA 4DRTA 3E0YA 3T1XA 3EWKA 5HFOA 4ME4A 1XP4A 3WS2A 3MS6A 1N4OA 1K55A 4C75A 4KZ7A 3A3EA 5D3OA 1BLSA 3E4QA 3LFVA 2V8FA 4BD0A 5EM1A 3VOYA 1LI9A 4OQIA 1D7EA 2BTFP 3KYZA 2WKIA 2O9CA 5JYOA 5I5LA 5A91A 4KZBA 3BECA 3HLCA 2AVXA 2Y2OA 1JWPA 3B3XA 3WS0A 3CWFA 1WYBA 1NLYA 4PPRA 2YKHA 4HBTA 3CI6A 5F1GA 5AQ7A 2CMNA 2OSUA 1KE4A 5J7EA 3UDIA 4GOGA 4H6JB 4KZ6A 3QNCA 4O7DA 2B95A 4GS9B 4YWZA 4PAUA 1W5DA 2W1TA 4MN6A 4O8GA 2VX8A 3GV9A 5DTTA 1W8QA 3F1NA 1LSXA 3PBOA 4ETZA 4NXGA 4HBUA 2X02A 4KQRA 1Z6FA 1O07A 3FWLA 2DRWA 3HLGA 4LLOB 3FV7A 3WS5A 3IXHA 2NUTC 1UWPX 4NK3A 3HCYA 3S7NA 1PIOA 3U2AA 1Y54A 2Z2LB 1QMFA 4WBGA 3DBAA 4KZ8A 3MFDA 1FQGA 1UWNX 3GQZA 4GKUA 4Y17A 1E4DA 3F1PB 4LV0A 4E3JA 3ZGAB 3Q7VB 3CPTA 2VK3A 3SZTA 5I94A 2EFXA 1QMEA 3DAVA 4NXBA 1TS8A 2W0NA 4EV4A 3D72A 3VE4A 4MDZA 4II7A 2JKTM 3PAEA 1D06A 1HD8A 3W4QA 3A3FA 3SS3A 4PM9A 4X25A 3LIEA 3HUMA 4Z1WA 2PD7A 4F3LA 3IXDA 5EVLA 1MWTA 3W8KA 3GECA 5DTSA 1DY6A 1S1YA 4KZ4A 3LY4A 1ZKJA 3FPWA 1BSGA 3AGEA 5HL1A 1OTDA 4N92A 3I7JA 3S7PA 1DJCA 1XKZA 3GTCA 3M6BA 1RGYA 4Y0TA 3UE0A 1HTZA 2HDQA 4R4SA 4GZBA 4BJPA 1PYYA 3V5MA 2J9PA 3LIDA 3VP1A 3PAGA 3EEAA 2C6WB 3IBJA 3C7UA 2X71A 3BFDA 1F2KA 3GRJA 1IOUA 4HP9A 5GL9A 5GHZA 3VOLA 3UB6A 3SW1A 1BLCA 1U60A 3T1SA 2H5SA 1HVBA 5FSRA 1NYYA 2D02A 5TBMA 2ZC6B 2O99A 1KGEA 3HUNA 3JYIA 4OVDA 2XR0A 2FFFB 3NOTC 4FH2A 4NEED 2P08A 1OTIA 1CK3A 2RL3A 4X56A 2Y2GA 4LFUA 5J4EA 4E04A 2BLSA 4GHIB 5CHMA 1S4RA 3IF6A 4XXRA 1PW8A 4JF5A 4FD8A 1JTGA 2XDMA 3A0VA 1YSQA 2ZMAA 4U0XA 3DTEA 1H8ZA 1TS0A 4CQHA 3NJAA 4I3JA 3ZVTA 3C5AA 5CECA 4OQ0A 4LCLA 4NKPA 1K56A 4HOIA 3IXBA 5FATA 2HDSA 1P97A 2VGJA 1EWZA 3RFBA 5CGWA 4DE3A 3GSGA 3FC7A 2HJEA 4R70A 4BL2A 4EESA 3B42A 4GW9A 1CEFA 1M6KA 3HL9A 2V2FF 4X53A 3EGXC 5L8MA 4RYEA 1VETA 3UDXA 1K6SA 5EVIC 3H9WA 1IYPA 5DKKA 3PBNA 2R9XA 3UMDA 3MQ0A 2JKRI 3OCLA 4OPRA 3TOIA 4L9EA 3M2JA 2HZ5A 5F5YA 2R9WA 1YLPA 3LYXA 4UA9A 3T4QA 4BL3A 1T19A 4RQ9A 3BLMA 3M2KA 2WGWB 3NOUC 4OLGA 4B93A 4MN7A 4FCFA 3UNWA 1N9BA 3ZDJA 4MBKA 2QPNA 5HD3A 2Y2NA 2W3GA 4UAAA 5F6AA 3VV4A 3A0SA 4S2NA 4X69A 1K54A 3DWKA 5FASA 2VGLS 2J3WA 1S67L 4HY8A 1K0KA 4S2JA 4R3BA 2B5RA 1G5UA 2E8IA 1NZOA 2J3TD 3Q07A 5DF8A 4UEYA 4K91A 2ZM2A 4OQHA 1K57C 2V1BA 1IKIA 2A3UA 2P9VA 3SH8A 2GNXA 3LR5A 2INWA 3H82A 1ESIA 2QMIA 3PR6A 2ZQDA 2D01A 3QP2A 3UN7A 2KX6A 4JPMA 5AJGA 1PFLA 5E43A 1ES4A 4IBXA 2ZM0A 3T4JA 3VP3A 3KSGA 1FR1A 2ZBBA 3O3VA 4I3AA 4UHUA 2Y2KA 4NXEA 3O87A 2A49A 1G68A 1RCJA 4UQIS 5HAPA 3G6OA 3LR0A 1XPBA 4B9OA 5CGXA 3LI8A 5KIZA 2GZAA 5KMWA 3S7OA 4Y7PA 5U47A 2M7UA 2I72A 3VP0A 2PR5A 1CI8A 4CPKA 3BYDA 4OH0A 5FA7A 4RA7A 1H8MA 4RX2A 1S0WA 3IWOA 1KDSA 3IS2A 1S6RA 2EWWA 1KGGA 2EX9A 5LBRA 5HDDA 4GDNA 2GX5A 5DJTA 5CHJA 3KX0X 5EPHA 1JNUA 3C7VA 1MZUA 3JPUA 4CLCA 4DF6A 3TG9A 4WUJA 3OPPA 2DNSA 4P0MA 4YINA 2W1TB 3C2WA 1TEMA 3K2NA 1SKFA 1C3BA 2ZOIA 4DXBA 1YAXA 1FR6A 4BBUA 4LRYC 2Y91A 4L0LA 3F1NB 4IHQA 2LB5A 1D1JA 4FTXA 4DMZA 3NCKA 2JBFA 2ZLYA 3V3RA 4KZ5A 1YLZA 1XJ6A 2OV5A 4B88A 3NC8A 4P6ZM 3AGDA 3T12B 4QJGA 2VV6A 4P6BA 1N9LA 3NECA 2OLVA 3T50A 3C4OA 2WKEA 2XA7M
chains in the Genus database with same CATH topology
5TJJA 2W3HA 3EEHA 5AVEA 3UB8A 1F9IA 3PBQA 4GS9B 4JGPA 4YWZA 2OWHA 3O5YA 3PBRA 3TRCA 5F68A 3MR0A 4PAUA 2W1TA 4MN6A 4HP4A 2V0UA 3FG8A 4O8GA 1W63M 2PDRA 2VX8A 1ODVA 3F1NA 3KYQA 1LSXA 3PBOA 4MN5A 2HV1A 4NXGA 4GCZA 3T4LA 4ETZA 3R4KA 4EXOA 4M4XA 3BY8A 2KDKA 3ZQ5A 2A2LA 4LLOB 1YSPA 2O0YA 3B33A 3KO6A 4Q0HA 3UB7A 2KOIA 4HH2A 4CLCD 3OC2A 3CLOA 2NUTC 1UWPX 3HCYA 3S7NA 5HL6A 4EERA 1VB6A 4F3LB 2Y8HA 4CLCC 3U2AA 4H6JA 3LR4A 1LT0A 3DBAA 4R38A 4EEUA 1UWNX 2MJ6A 1DRMA 1X0OA 4GS9A 1XJ3A 2VLGA 3F1PB 4ZRRA 4Y3IA 1N9OA 2K7SA 1P0ZA 2W1RA 4WL9A 2VEAA 5HD5A 2WKPA 3BQ8A 3W2ZA 2WKQA 1T1BA 2B02A 1OPXA 3LIAA 4NXBA 3EQVA 1W63Q 1TS8A 2W0NA 2XRNA 4IUKA 4BBTA 1F5MA 5J3WA 4BMWA 3D72A 3VE4A 4MDZA 3HJKA 4II7A 2JKTM 3K3CA 3BWLA 3UMEA 1D06A 4XT2B 1S1ZA 2O9BA 3LIBA 1OTEA 4HNBA 5DKLA 3RH8B 2VZWA 3LIEA 3LIFA 4HJ3A 1OT9A 4Z1WA 3T4SA 4ETXA 4HI4A 4P6ZS 5HZHA 3MF0A 2FZ0A 2Z6DA 2VV7A 2PD7A 4UQIM 3B47A 3E4OA 4F3LA 3ULFA 5TBMB 1TS6A 2QKPA 2OAP1 1T18A 1MC0A 3GECA 4HIAA 1S1YA 2XA7S 3FPWA 1OTDA 3S7PA 3F1PA 1T1AA 4NXFA 5HWWA 5AVFA 3OCNA 3LI9A 5HSQA 4EETB 3MXQA 3BQAA 3OBFA 2K31A 3VE3A 4EEPA 4YNRA 5F69A 2VKSA 4BJPA 5G4YA 2JN7A 4HJ4A 3LIDA 1V9ZA 3EEAA 3IBJA 3CUEC 1T1CA 3BW6A 4FSFA 3FPVA 4ARZB 2A24B 3D3OA 1Y28A 1ZTUA 2GJ3A 1IOUA 3H7WB 4HP9A 5IT5A 3F1OB 4KUKA 1TD5A 3VOLA 3UB6A 3MMHA 3OOVA 3SW1A 1LSWA 4LRXC 2VA0A 3TW8A 3EOIA 3UE3A 4KQDA 4Y2FA 2HGVA 2D02A 2W3EA 5TBMA 2R78A 2O99A 2PYPA 3NOTC 2DMWA 3T4KA 2QJ5A 2V1AA 2HJ9C 2PT7A 4NEED 2P08A 1OTIA 4LRZE 5HDSA 5MC7A 3NOPC 5HWTA 2BASA 4KUOA 3KSFA 2VV8A 1N9NA 4E04A 5J4EA 1OT6A 4GHIB 1LL8A 3UB9A 1S4RA 2VGLM 1LSVA 4HJ6A 4WLAA 3A0VA 2A24A 4ARZA 2OWJA 1YSQA 4WEJA 1TS0A 4CQHA 3H7WA 3NJAA 4I3JA 2JHEA 2PR6A 5FL3A 4EQ1A 3F1OA 3LICA 2V9AA 4DN0A 4NKPA 2OOLA 4HOIA 4BWIA 4PKYA 1P97A 3RFBA 2NUPC 2Y79A 5IU1A 4JGOA 1P9WA 2XROA 1P9RA 4CLCE 2P7JA 3FC7A 4Y5FA 5G4ZA 2HJEA 4R70A 2J80A 4EESA 3JVUA 3C38A 2PHYA 3KSHA 3B42A 4GW9A 2P04A 1GSWA 2IA2A 4GHIA 3EGXC 5L8MA 3P7NA 1BYWA 1GSXA 4IJGA 1XFNA 4HH3A 2H28A 3H9WA 3P01A 3S7QA 2OAQ1 5DKKA 3PBNA 4DJ3A 4EW7A 3T4TA 3UMDA 3MQ0A 4PKYG 4YOFA 2JKRI 5A8BA 3OCLA 4L9EA 4KQOA 3MQQA 2FH5A 2HF6A 5F5YA 4Q0IA 2QJ7A 3PHYA 3LYXA 2O9AA 3T4QA 3PBTA 5DFYA 4EU0A 1T19A 4RQ9A 2PD8A 4FOFA 2B18A 4HHDA 3NOUC 2VJWA 1EW0A 3NHQA 4MN7A 4B93A 2K2NA 1UGUA 4R3AA 3H82B 3MFXA 2KLIA 4O0PA 3BY9A 1G28A 3MQOA 5HD3A 2W3GA 2EA9A 5F6AA 3VV4A 1H3QA 1ZHHB 1DP8A 3A0SA 3T4OA 4XT2A 3PBSA 2VGLS 2Z6CA 3UE6A 2L4RA 2ZMFA 2J3WA 4QPRA 1OJGA 2L0WA 1S67L 3TE8A 4HY8A 1G6OA 5DF9A 4DJ2A 1YKDA 1VHMA 2J3TD 4L9FA 5DFXA 4MCWA 4UEYA 3CITA 3CAXA 2V1BA 5HPFA 1OTBA 3C8CA 2J3TC 2GNXA 5C5KA 3C30A 3LR5A 2INWA 4K08A 3H82A 1OJ5A 2M7VA 2W27A 4LPZA 3IBRA 3R7WB 4R6LA 3PR6A 4PHTA 1F98A 3IS2B 2D01A 2W3FA 3PYPA 2KX6A 3A0RA 4OOMA 2QWSA 1KOUA 5AJGA 3JVVA 4I38A 3T4JA 4JGRA 3V67A 3KSGA 4JGQA 1OTAA 4MMNA 3RTYA 2ZBBA 4WF0A 4AFIA 3CUEA 4I3AA 4NXEA 1STZA 1XJ4A 5HDCA 2LB9A 1S4SA 5HPIA 1XFQA 4UQIS 3G6OA 3LR0A 4B9OA 4CLCB 3LI8A 1TF1A 3EGDC 5KIZA 2GZAA 2V0WA 2W3DA 4WN5A 1NRJA 5DJUA 3S7OA 4I3IA 1TS7A 3BJNA 1S66L 2M7UA 4IUHA 3ZYTA 2PR5A 1MKMA 4O01A 4GLQA 2G7UA 3GDIA 1H8MA 4G3WA 3LR3A 5IS1A 2ZOHA 3R7WA 3IS2A 3TJZC 2EWWA 2QHKA 1DP6A 3LUQA 2EWVA 4EUVA 5LBRA 5HDDA 1GSVA 2GX5A 2L1MA 5DJTA 3E0YA 1XJ2A 3EWKA 2JKTI 2XSSA 2JKRM 3KX0X 3KSIA 1IFQA 4ME4A 1JNUA 3E4PA 1MZUA 4I5SA 3E98A 5CX7A 4G3VA 3MJQA 1V9YA 2YKFA 3E4QA 3OLOA 2I9VA 3PXPA 4CLCA 3LFVA 3EQUA 1NWZA 3K3DA 4WUJA 4HQAA 2QYBA 2W1TB 3C2WA 3ICYA 1D7EA 3K2NA 3KYZA 2O9CA 2ZOIA 5I5LA 1YAXA 2WKRA 5K5BA 4BBUA 4LRYC 4WEKA 4L0LA 3F1NB 4IHQA 4Q0JA 2LB5A 4DMZA 1NLZA 1DP9A 4WELA 2ZMVA 3CWFA 5HWVA 1XJ6A 3HJIA 1NLYA 4P6ZM 2YKHA 2M1CA 4BBVA 3CI6A 4L9GA 2CMNA 2VV6A 4I39A 5J7EA 1N9LA 3T50A 4G3KA 2PYRA 5KSHA 4H6JB 5EFWA 1WA9A 4OOLA 4GJ4A 2XA7M
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EEH A;  5AVE A;  3UB8 A;  1F9I A;  4GS9 B;  4JGP A;  4YWZ A;  2OWH A;  5F68 A;  3MR0 A;  4MN6 A;  4HP4 A;  2V0U A;  3FG8 A;  2PDR A;  1ODV A;  3F1N A;  1LSX A;  4MN5 A;  2HV1 A;  4NXG A;  4GCZ A;  4EXO A;  4M4X A;  3BY8 A;  2KDK A;  3ZQ5 A;  4LLO B;  3B33 A;  3UB7 A;  4HH2 A;  3CLO A;  1UWP X;  4EER A;  1VB6 A;  4F3L B;  4H6J A;  1LT0 A;  4R38 A;  4EEU A;  1UWN X;  1DRM A;  1X0O A;  4GS9 A;  1XJ3 A;  2VLG A;  3F1P B;  1N9O A;  4WL9 A;  1P0Z A;  2K7S A;  2VEA A;  5HD5 A;  2WKP A;  2WKQ A;  1T1B A;  2B02 A;  3LIA A;  4NXB A;  1TS8 A;  2W0N A;  4BBT A;  5J3W A;  3D72 A;  3VE4 A;  3HJK A;  3K3C A;  3BWL A;  3UME A;  1D06 A;  4XT2 B;  1S1Z A;  3LIB A;  4HNB A;  1OTE A;  5DKL A;  3RH8 B;  3LIE A;  3LIF A;  4HJ3 A;  1OT9 A;  4HI4 A;  5HZH A;  2Z6D A;  2VV7 A;  2PD7 A;  3E4O A;  4F3L A;  3ULF A;  5TBM B;  1TS6 A;  2QKP A;  1T18 A;  3GEC A;  4HIA A;  1S1Y A;  1OTD A;  3F1P A;  1T1A A;  4NXF A;  5HWW A;  5AVF A;  3LI9 A;  5HSQ A;  4EET B;  3MXQ A;  3VE3 A;  4EEP A;  5F69 A;  5G4Y A;  2JN7 A;  4HJ4 A;  3LID A;  1V9Z A;  1T1C A;  2A24 B;  1Y28 A;  2GJ3 A;  3H7W B;  4HP9 A;  3F1O B;  4KUK A;  3VOL A;  3UB6 A;  3SW1 A;  1LSW A;  4LRX C;  4KQD A;  2D02 A;  5TBM A;  2R78 A;  2PYP A;  3NOT C;  2QJ5 A;  2V1A A;  5HDS A;  1OTI A;  4LRZ E;  3NOP C;  5HWT A;  2BAS A;  4KUO A;  2VV8 A;  1N9N A;  4E04 A;  5J4E A;  4GHI B;  3UB9 A;  1OT6 A;  1LL8 A;  1S4R A;  1LSV A;  4HJ6 A;  4WLA A;  3A0V A;  2A24 A;  2OWJ A;  1TS0 A;  3H7W A;  3NJA A;  4I3J A;  2JHE A;  2PR6 A;  4EQ1 A;  3F1O A;  3LIC A;  2V9A A;  2OOL A;  4HOI A;  4PKY A;  1P97 A;  5IU1 A;  4JGO A;  5G4Z A;  2P7J A;  3FC7 A;  4R70 A;  2J80 A;  4EES A;  2PHY A;  4GW9 A;  1GSW A;  4GHI A;  3P7N A;  1BYW A;  1GSX A;  1XFN A;  4HH3 A;  2H28 A;  3H9W A;  5DKK A;  4DJ3 A;  4EW7 A;  3UMD A;  4PKY G;  5A8B A;  4L9E A;  3MQQ A;  5F5Y A;  2QJ7 A;  3PHY A;  3LYX A;  1T19 A;  4RQ9 A;  2PD8 A;  4HHD A;  3NOU C;  1EW0 A;  3NHQ A;  1UGU A;  4R3A A;  3H82 B;  3MFX A;  3BY9 A;  1G28 A;  3MQO A;  5HD3 A;  2EA9 A;  5F6A A;  3A0S A;  1DP8 A;  4XT2 A;  2Z6C A;  3UE6 A;  2L4R A;  1OJG A;  2L0W A;  1S67 L;  4HY8 A;  4DJ2 A;  4L9F A;  3CAX A;  2V1B A;  1OTB A;  3C8C A;  2INW A;  4K08 A;  3H82 A;  1OJ5 A;  2W27 A;  4LPZ A;  3IBR A;  4R6L A;  1F98 A;  3IS2 B;  2D01 A;  3PYP A;  2KX6 A;  3A0R A;  2QWS A;  1KOU A;  4I38 A;  4JGR A;  4JGQ A;  1OTA A;  3RTY A;  2ZBB A;  4WF0 A;  4I3A A;  4NXE A;  5HDC A;  1XJ4 A;  1S4S A;  1XFQ A;  3G6O A;  4B9O A;  3LI8 A;  5KIZ A;  2V0W A;  4WN5 A;  5DJU A;  4I3I A;  1TS7 A;  1S66 L;  2PR5 A;  3GDI A;  5IS1 A;  2ZOH A;  3IS2 A;  2QHK A;  1DP6 A;  3LUQ A;  5HDD A;  1GSV A;  2L1M A;  5DJT A;  1XJ2 A;  3EWK A;  3KX0 X;  1JNU A;  3E4P A;  1MZU A;  4I5S A;  3MJQ A;  1V9Y A;  2YKF A;  3E4Q A;  3OLO A;  2I9V A;  1NWZ A;  3K3D A;  4WUJ A;  4HQA A;  3C2W A;  3ICY A;  1D7E A;  2ZOI A;  5I5L A;  2WKR A;  4BBU A;  4LRY C;  3F1N B;  1DP9 A;  3CWF A;  5HWV A;  1XJ6 A;  3HJI A;  2YKH A;  2M1C A;  4BBV A;  4L9G A;  2CMN A;  2VV6 A;  4I39 A;  5J7E A;  1N9L A;  3T50 A;  2PYR A;  4H6J B;  5EFW A;  1WA9 A; 
#chains in the Genus database with same CATH topology
 1ALQ A;  1O7E A;  3GMW A;  5F68 A;  3MR0 A;  1MBL A;  3CPT B;  4HP4 A;  1W63 M;  1YLY A;  3QP6 A;  4QU3 A;  4EXO A;  4NET A;  3BY8 A;  2KDK A;  2PAV P;  3L9K A;  3ZQ5 A;  3IT9 A;  3HBR A;  1ZG4 A;  3KO6 A;  4N9L A;  3UB7 A;  4CLC D;  2KOI A;  2V20 A;  3PTE A;  1K55 C;  4IVI A;  4PM6 A;  1GA0 A;  3T1Q B;  4F3L B;  2Y8H A;  3M6H A;  4KG5 A;  1KVL A;  1KDW A;  5HW3 A;  4R38 A;  1TDG A;  1DRM A;  4P85 A;  4S2I A;  1XJ3 A;  2VLG A;  2ZC3 B;  4MBH A;  3NDG A;  2WAE A;  4ZRR A;  1N9O A;  4WL9 A;  1P0Z A;  2W1R A;  3IH8 A;  2ACG A;  1FCN A;  3W2Z A;  2WKQ A;  1T1B A;  3LIA A;  3EQV A;  1K4E A;  3HLB A;  1BLH A;  4BBT A;  1SDE A;  5GHY A;  4BMW A;  1K25 A;  3NUL A;  3BWL A;  2WKH A;  2O9B A;  2WAF A;  1OTE A;  4HNB A;  3G31 A;  4HJ3 A;  4ETX A;  2PU4 A;  2Z6D A;  2VV7 A;  4NG2 A;  3ULF A;  5TBM B;  4MNR A;  5F1F A;  3IWQ A;  2OAP 1;  3BFC A;  3G34 A;  1MC0 A;  4JXV A;  5A90 A;  1PWD A;  4Q8I A;  2IWD A;  2JKF A;  5AVF A;  4R3J A;  5HSQ A;  3MXQ A;  2Y2P A;  3BQA A;  4EEP A;  4YNR A;  2VKS A;  1H5X A;  5G4Y A;  3IF6 B;  1IEL A;  1MXO A;  1V9Z A;  3HLD A;  3CUE C;  4WZ5 A;  4R4R A;  4OP8 A;  3MMH A;  4E3I A;  4LRX C;  4K0W A;  5FQK A;  1ES3 A;  3ZFZ A;  2HGV A;  5L07 A;  3ZG5 A;  1EI5 A;  2HJ9 C;  5HDS A;  4LRZ E;  5HWT A;  3RXW A;  2DCF A;  3WRZ A;  2VV8 A;  1N9N A;  3IH9 A;  4N9K A;  1LL8 A;  5AQ9 A;  4B4X A;  5FEF A;  1K6R A;  5TFQ A;  1VET B;  1XA1 A;  2V8C A;  4WLA A;  4ARZ A;  2OWJ A;  5KSC A;  4UA7 A;  2Y2H A;  3LGO A;  3UB5 P;  2EFU A;  2JHE A;  3IF5 A;  2H0T A;  3F1O A;  3BFF A;  4OKP A;  3LIC A;  1W7F A;  5CED A;  1VQQ A;  1WYC A;  2G2W A;  2OOL A;  4Z9Q A;  1ES2 A;  4BD1 A;  4BWI A;  4PKY A;  4EWF A;  2PBD P;  2WYX A;  2NUP C;  4KZ9 A;  1FSY A;  1P9W A;  4YFM A;  2XRO A;  1P9R A;  4CLC E;  2P7J A;  4Y5F A;  5G4Z A;  2PRF A;  2Y2M A;  1BYW A;  4IJG A;  3T1R A;  4PMA A;  5L10 A;  3P01 A;  1YM1 A;  3MZD A;  3E2K A;  4R23 A;  4OP5 A;  4KQO A;  3MQQ A;  2FH5 A;  2HF6 A;  4Q0I A;  3DW0 A;  3PHY A;  2ZM8 A;  4ZJ3 A;  3V50 A;  2PD8 A;  1GHI A;  2P9V B;  4WYY A;  5EE8 A;  4R3A A;  3H82 B;  3CHW P;  4KQQ A;  3IF6 C;  3BY9 A;  1G28 A;  1YQS A;  1IYO A;  2EA9 A;  1H3Q A;  3T4O A;  1DP8 A;  2C5W B;  1MWR A;  4BLM A;  4K0X A;  3UE6 A;  5FAP A;  3W4P A;  4DE0 A;  2ZMF A;  3ZG9 B;  3WS4 A;  2L0W A;  3FKV A;  1DJA A;  3TE8 A;  1PWC A;  1G6O A;  4R1G A;  2Y4A A;  5DF9 A;  3RXX A;  1YKD A;  5FI6 A;  1KE0 A;  4ZDX A;  3LCE A;  4MBF A;  5EOE A;  4MEZ A;  4C3Q A;  1OTB A;  1I2W A;  2J3T C;  1WE4 A;  3FZC A;  4ZJ1 A;  5C5K A;  3C30 A;  3O86 A;  4S2O A;  4LPZ A;  3MKE A;  4PHT A;  3IS2 B;  1I5Q A;  2W3F A;  3PYP A;  3DTM A;  1Q2Q A;  2QWS A;  3E2L A;  2UWX A;  4E3N A;  1W79 A;  1PNE A;  1OTA A;  3RTY A;  1DJB A;  1BT5 A;  4KEN B;  1BUE A;  3NIA A;  2LB9 A;  1S4S A;  5HPI A;  4EBP A;  1XFQ A;  5GHX A;  3Q1F A;  4CLC B;  1TF1 A;  4QHC A;  2V0W A;  2W3D A;  3QHY A;  1NRJ A;  4I3I A;  4IUH A;  1MKM A;  3VSK A;  3BLS A;  4U3T A;  2G7U A;  2JC7 A;  1YMX A;  2H0Y A;  4S2N C;  4G3W A;  2ZOH A;  3R7W A;  3TJZ C;  4LEN A;  5FDH A;  1E3U A;  3ZHH A;  4EUV A;  2WZZ A;  2Y59 A;  1XJ2 A;  2JKR M;  3KSI A;  1HLU P;  3E4P A;  4E3M A;  3E98 A;  3OLO A;  2I9V A;  3K3D A;  3VSL A;  3HUO A;  4HQA A;  2QYB A;  3V39 A;  3ICY A;  4PM8 A;  3MKF A;  3FYZ A;  4WEK A;  3QP4 A;  1ERO A;  1K56 D;  4Y0O A;  1NLZ A;  1DP9 A;  2VGK A;  4WEL A;  2ZMV A;  5IHV A;  1JWZ A;  5FQQ A;  4DDS A;  5HAQ A;  4BBV A;  1KGF A;  4L9G A;  1KE3 A;  4I39 A;  3MZE A;  1CJF A;  4G3K A;  1WA9 A;  1KVM A;  5E2F A;  1PWG A;  5TJJ A;  2W3H A;  5CEB A;  3EEH A;  3UB8 A;  1ZG6 A;  1Y4O A;  5EVI A;  4JGP A;  3MSH A;  2OWH A;  3O5Y A;  3TRC A;  3ITA A;  2ZQC A;  5FI7 A;  3ZCZ A;  3OZH A;  1RP5 A;  2V0U A;  4DDY A;  1I2S A;  5GLA A;  2PDR A;  3KYQ A;  4MN5 A;  2FFY A;  2HV1 A;  4GCZ A;  3ZNY A;  1ERQ A;  1YSP A;  4X55 A;  1LLB A;  2O0Y A;  4Q0H A;  2XH9 A;  4HH2 A;  3OC2 A;  3CLO A;  3OPL A;  4WM9 A;  1MKI A;  5CER A;  4JLF A;  3CZD A;  5E2H A;  1SDN A;  4EER A;  5CTM A;  1VB6 A;  2E8J A;  4CLC C;  3V3S A;  2IWB A;  1K38 A;  4KG6 A;  2Y55 A;  2UV0 E;  3MBZ A;  4P87 A;  3ZVW A;  4LV2 A;  4Y3I A;  5CXW A;  5A93 A;  5HD5 A;  2EXB A;  4F94 A;  2WKP A;  3BQ8 A;  4N1H A;  1OPX A;  4E3O A;  1E25 A;  4IUK A;  1CF0 A;  5J3W A;  1FOF A;  4QY6 A;  1TVF A;  3HJK A;  3UME A;  3LEQ A;  4EBN A;  4EQI A;  5DKL A;  4D2O A;  4QWO A;  3T4S A;  4HI4 A;  3A3D A;  4P6Z S;  5HZH A;  3IHB A;  2FZ0 A;  2JKG A;  4UQI M;  3E4O A;  3SH9 A;  1NZU A;  3G35 A;  3BRM A;  1T18 A;  1MWU A;  1VEU A;  4HIA A;  5EOO A;  2XA7 S;  1GA9 A;  3OCN A;  3VFH A;  3OBF A;  2K31 A;  2Y2Q A;  3GVB A;  2XK1 A;  5EM0 A;  3VE3 A;  5FQI A;  2JN7 A;  5M19 A;  4HJ4 A;  4DXC A;  2JE5 A;  1SCW A;  1T1C A;  3BW6 A;  4ARZ B;  3D3O A;  1Y28 A;  1ZTU A;  2GJ3 A;  4Y15 A;  5IT5 A;  3F1O B;  4KUK A;  2IWC A;  3OOV A;  5DF7 A;  1J3W A;  2VA0 A;  3TW8 A;  3N4I A;  4KQD A;  4S2P A;  2W3E A;  4XUZ A;  1BUL A;  2R78 A;  1JTD A;  3VMA A;  4OON A;  1A0K A;  2QJ5 A;  2V1A A;  2PT7 A;  1HZO A;  2ZQ7 A;  2WGV A;  2BAS A;  2OLU A;  4KUO A;  2Y2I A;  4ID4 A;  3QP1 A;  2ZC4 B;  4S2L A;  3UB9 A;  2EX6 A;  4OPQ A;  1LSV A;  5FQJ A;  1YMS A;  3UDF A;  4HJ6 A;  2A24 A;  3H7W A;  4EQ1 A;  4OOY A;  2V9A A;  3DTI A;  2EXA A;  5BOH A;  3N8R A;  4IVK A;  5IU1 A;  3N8S A;  4JGO A;  3S4X A;  1LL9 A;  2ZL1 A;  1FIL A;  4U0T A;  3C38 A;  5GLD A;  4IED A;  4E6W A;  2P04 A;  3D4F A;  4GB7 A;  2WUQ A;  2IA2 A;  4WZ5 C;  3L7H A;  2WGI A;  3VP4 A;  2XEP A;  1GSX A;  4HH3 A;  3ITB A;  3S7Q A;  3UE1 A;  1MY8 A;  4JBF A;  4DJ3 A;  3T4T A;  4YOF A;  3ZNT A;  5A8B A;  1H8Y A;  4ZBE A;  4JF6 A;  4QY5 A;  1CI9 A;  3DWZ A;  2O9A A;  4EU0 A;  4E3L A;  4KZ3 A;  1GHM A;  3HRE A;  2CC1 A;  2VJW A;  1XGJ A;  1Q2P A;  1VM1 A;  2K2N A;  3QP5 A;  1MPL A;  4JXS A;  2H10 A;  2KLI A;  1SZV A;  4FH4 A;  3N8L A;  3MQO A;  2ZQ8 A;  1ZHH B;  5FEG A;  2ZC7 A;  3HLF A;  3PBS A;  2Q9M A;  5E2E A;  2L4R A;  5EUA A;  4QPR A;  1OJG A;  1YT4 A;  5M18 A;  2Z2M B;  4GDB A;  4JXG A;  4OQG A;  3LY3 A;  4L9F A;  5DFX A;  4MCW A;  3TSG A;  3CIT A;  5JYP A;  2XFS A;  4JXW A;  4Y0U A;  1GCE A;  3DTK A;  3R7W B;  4R6L A;  3Q7Z A;  1BTL A;  1TDL A;  4E3K A;  1LI0 A;  4OOM A;  4A5R A;  3JVV A;  1BLP A;  4I38 A;  4JGR A;  3IHA A;  4Y13 A;  4LGW A;  5F83 A;  1XGI A;  3G4P A;  5GLB A;  4OPY A;  4MMN A;  2ZQA A;  2HDR A;  4AFI A;  3CUE A;  2Q9N A;  1H0M A;  2RCX A;  1STZ A;  5HDC A;  4WMC A;  1PI5 A;  4R0Q A;  5FAO A;  1NRF A;  1SKO A;  3Q82 A;  5DJU A;  1TS7 A;  3BJN A;  5CHU A;  1S66 L;  3SS5 A;  3QNB A;  3ZG0 A;  3ZYT A;  3IXG A;  3KYE A;  4O01 A;  1CEG A;  3CG5 A;  4GLQ A;  3QP8 A;  5DVA A;  3GDI A;  3VP2 A;  3LR3 A;  2EX2 A;  3NI9 A;  1DP6 A;  3LUQ A;  5FQ9 A;  2J8Y A;  2JKT I;  2XSS A;  4OLD A;  5KZH A;  1IFQ A;  4PM7 A;  5FDS A;  2WAD A;  1JWV A;  4I5S A;  1J9M A;  2XGN A;  5CX7 A;  5FAQ A;  5EVI B;  4G3V A;  3MJQ A;  1V9Y A;  2YKF A;  3PXP A;  1ES5 A;  3EQU A;  1NWZ A;  4RX3 A;  1NYM A;  5M1A A;  5HX9 A;  1K4F A;  3D9Y A;  3BFG A;  3IX8 A;  4LCM A;  4HES A;  1YLW A;  4ZJ2 A;  2WKR A;  5K5B A;  1PI4 A;  2GDN A;  4KZA A;  4Q0J A;  2X01 A;  4WMC D;  3P09 A;  3NDE A;  3ZG8 B;  5HWV A;  4S2M A;  3UPO A;  3OPR A;  3HJI A;  5FQM A;  4UA6 A;  2WZX A;  2M1C A;  1W8Y A;  3VOZ A;  3IX3 A;  2XQZ A;  2PYR A;  5KSH A;  5EFW A;  1YPR A;  4OOL A;  5E2G A;  4GJ4 A;  3G2Y A;  5AVE A;  5FI2 A;  1F9I A;  3PBQ A;  3UY6 A;  4X6T A;  4ESP A;  5CGS A;  3PBR A;  3FKW A;  1YLT A;  4ZAM A;  4M3K A;  4JF4 A;  5F82 A;  3FG8 A;  1ODV A;  4GD8 A;  3AGF A;  3T4L A;  3R4K A;  4M4X A;  2A2L A;  4GD6 A;  2XD5 A;  5CTN A;  3B33 A;  4X1M A;  1ONH A;  1FSW A;  3HVF A;  3IWI A;  1G6A A;  5HL6 A;  5AQA A;  4E6X A;  3IQA A;  2PU2 A;  4H6J A;  4X68 A;  3LR4 A;  1LT0 A;  1VEU B;  4EEU A;  2MJ6 A;  1X0O A;  1Z09 A;  4GS9 A;  4WZ4 A;  4EBL A;  4OPZ A;  2K7S A;  3UPN A;  2VEA A;  4D60 A;  1K54 C;  2WK0 A;  1XA7 A;  4N1X A;  2B02 A;  1PZP A;  3WRT A;  5EEC A;  1W63 Q;  2XRN A;  4GNU A;  1ONG A;  1F5M A;  3A3I A;  2ZJ9 A;  3G30 A;  4FUW A;  3GR2 A;  3K3C A;  4LV3 A;  3MXR A;  4XT2 B;  1S1Z A;  3LIB A;  3WS1 A;  3RH8 B;  2J7V A;  2VZW A;  3LIF A;  1OT9 A;  1GHP A;  3MF0 A;  3B47 A;  1TS6 A;  1ACF A;  3A3J A;  3NBL A;  2QKP A;  1ERM A;  2XFT A;  5HAI A;  3F1P A;  1T1A A;  4NXF A;  5HWW A;  1NJ4 A;  5L09 A;  4DE2 A;  3LI9 A;  3SH7 A;  4EET B;  2HP5 A;  3Q7V A;  5F69 A;  5CRF A;  1CQA A;  4C6Y A;  4FSF A;  4B4Z A;  3FPV A;  2A24 B;  4ZTK A;  3H7W B;  3ISG A;  3MZF A;  1TD5 A;  3G2Z A;  3HLW A;  1FIK A;  1LSW A;  3WWX A;  3EOI A;  2Y2J A;  4QB8 A;  3UE3 A;  4Y2F A;  4BEN A;  5TGF A;  5HAR A;  1LL5 A;  2PYP A;  1E3U D;  2DMW A;  3T4K A;  5EV0 A;  3SS4 A;  5MC7 A;  3C4P A;  3NOP C;  1AWI A;  2ZL1 B;  4HEF A;  2Q0O A;  3W4O A;  3KSF A;  2QZ6 A;  2XD1 A;  1RGZ A;  5EVE A;  1OME A;  1OT6 A;  1ESU A;  2VGL M;  1BZA A;  5TR7 A;  4MLL A;  1ZC2 A;  2J9O A;  3BFE A;  2ZQ9 A;  4WEJ A;  3N7W A;  2PR6 A;  5FL3 A;  1LHY A;  4DN0 A;  3CMZ A;  5A92 A;  3HLE A;  2BG1 A;  2Y79 A;  4RVA A;  3NY4 A;  4DE1 A;  1K57 A;  4DKI A;  2J80 A;  4BQM A;  2ZC5 B;  3JVU A;  3MXS A;  2PHY A;  3KSH A;  3BEB A;  3VFF A;  1GSW A;  1IYQ A;  5EVI D;  4GHI A;  2ZD8 A;  1PW1 A;  2V1Z A;  3S1Y A;  3P7N A;  1NY0 A;  4X1L A;  1L0E A;  1XFN A;  2H28 A;  2OAQ 1;  1XXM A;  4EW7 A;  4QD4 A;  4PKY G;  3N6I A;  2QJ7 A;  5J8X A;  3PBT A;  5DFY A;  1MWS A;  4XUX A;  3LEZ A;  1L3L A;  4FOF A;  3UO9 A;  1SHV A;  2B18 A;  4HHD A;  1EW0 A;  3NHQ A;  2EX8 A;  1UGU A;  3S22 A;  3MFX A;  3IX4 A;  4O0P A;  3P98 A;  1FCO A;  1IKG A;  1L0F A;  1YLJ A;  4XT2 A;  1L2S A;  2Z6C A;  2G2U A;  1FCM A;  4S2K A;  3SOI A;  2XLN A;  2HP6 A;  1IYS A;  4DJ2 A;  1SKO B;  1VHM A;  3RJU A;  2JCH A;  5DTK A;  3U4L P;  1JVJ A;  3LO7 A;  4EUZ A;  3CJM A;  3CAX A;  5HPF A;  2WGW A;  3C8C A;  1L0D A;  1L0G A;  2HDU A;  1AXB A;  1M40 A;  4JKT A;  4K08 A;  1OJ5 A;  2M7V A;  2W27 A;  3IBR A;  1F98 A;  3A0R A;  3OPH A;  1KOU A;  4IBR A;  4PM5 A;  3V67 A;  3BM6 A;  3Q81 A;  2P74 A;  4JGQ A;  4WF0 A;  3UPP A;  1PRQ A;  5G18 A;  4LV1 A;  2HP9 A;  1XJ4 A;  5GLC A;  4GN2 A;  5L2F A;  1IEM A;  1XX2 A;  3EGD C;  4WN5 A;  3ZG7 B;  2XF3 A;  4H8R A;  2PBY A;  1PZO A;  4CJN A;  2Y2L A;  3G32 A;  1NXY A;  3O88 A;  5IS1 A;  5AQB A;  2QHK A;  4KG2 A;  2EWV A;  1GSV A;  2L1M A;  2HPB A;  4DRT A;  3E0Y A;  3T1X A;  3EWK A;  5HFO A;  4ME4 A;  1XP4 A;  3WS2 A;  3MS6 A;  1N4O A;  1K55 A;  4C75 A;  4KZ7 A;  3A3E A;  5D3O A;  1BLS A;  3E4Q A;  3LFV A;  2V8F A;  4BD0 A;  5EM1 A;  3VOY A;  1LI9 A;  4OQI A;  1D7E A;  2BTF P;  3KYZ A;  2WKI A;  2O9C A;  5JYO A;  5I5L A;  5A91 A;  4KZB A;  3BEC A;  3HLC A;  2AVX A;  2Y2O A;  1JWP A;  3B3X A;  3WS0 A;  3CWF A;  1WYB A;  1NLY A;  4PPR A;  2YKH A;  4HBT A;  3CI6 A;  5F1G A;  5AQ7 A;  2CMN A;  2OSU A;  1KE4 A;  5J7E A;  3UDI A;  4GOG A;  4H6J B;  4KZ6 A;  3QNC A;  4O7D A;  2B95 A;  4GS9 B;  4YWZ A;  4PAU A;  1W5D A;  2W1T A;  4MN6 A;  4O8G A;  2VX8 A;  3GV9 A;  5DTT A;  1W8Q A;  3F1N A;  1LSX A;  3PBO A;  4ETZ A;  4NXG A;  4HBU A;  2X02 A;  4KQR A;  1Z6F A;  1O07 A;  3FWL A;  2DRW A;  3HLG A;  4LLO B;  3FV7 A;  3WS5 A;  3IXH A;  2NUT C;  1UWP X;  4NK3 A;  3HCY A;  3S7N A;  1PIO A;  3U2A A;  1Y54 A;  2Z2L B;  1QMF A;  4WBG A;  3DBA A;  4KZ8 A;  3MFD A;  1FQG A;  1UWN X;  3GQZ A;  4GKU A;  4Y17 A;  1E4D A;  3F1P B;  4LV0 A;  4E3J A;  3ZGA B;  3Q7V B;  3CPT A;  2VK3 A;  3SZT A;  5I94 A;  2EFX A;  1QME A;  3DAV A;  4NXB A;  1TS8 A;  2W0N A;  4EV4 A;  3D72 A;  3VE4 A;  4MDZ A;  4II7 A;  2JKT M;  3PAE A;  1D06 A;  1HD8 A;  3W4Q A;  3A3F A;  3SS3 A;  4PM9 A;  4X25 A;  3LIE A;  3HUM A;  4Z1W A;  2PD7 A;  4F3L A;  3IXD A;  5EVL A;  1MWT A;  3W8K A;  3GEC A;  5DTS A;  1DY6 A;  1S1Y A;  4KZ4 A;  3LY4 A;  1ZKJ A;  3FPW A;  1BSG A;  3AGE A;  5HL1 A;  1OTD A;  4N92 A;  3I7J A;  3S7P A;  1DJC A;  1XKZ A;  3GTC A;  3M6B A;  1RGY A;  4Y0T A;  3UE0 A;  1HTZ A;  2HDQ A;  4R4S A;  4GZB A;  4BJP A;  1PYY A;  3V5M A;  2J9P A;  3LID A;  3VP1 A;  3PAG A;  3EEA A;  2C6W B;  3IBJ A;  3C7U A;  2X71 A;  3BFD A;  1F2K A;  3GRJ A;  1IOU A;  4HP9 A;  5GL9 A;  5GHZ A;  3VOL A;  3UB6 A;  3SW1 A;  1BLC A;  1U60 A;  3T1S A;  2H5S A;  1HVB A;  5FSR A;  1NYY A;  2D02 A;  5TBM A;  2ZC6 B;  2O99 A;  1KGE A;  3HUN A;  3JYI A;  4OVD A;  2XR0 A;  2FFF B;  3NOT C;  4FH2 A;  4NEE D;  2P08 A;  1OTI A;  1CK3 A;  2RL3 A;  4X56 A;  2Y2G A;  4LFU A;  5J4E A;  4E04 A;  2BLS A;  4GHI B;  5CHM A;  1S4R A;  3IF6 A;  4XXR A;  1PW8 A;  4JF5 A;  4FD8 A;  1JTG A;  2XDM A;  3A0V A;  1YSQ A;  2ZMA A;  4U0X A;  3DTE A;  1H8Z A;  1TS0 A;  4CQH A;  3NJA A;  4I3J A;  3ZVT A;  3C5A A;  5CEC A;  4OQ0 A;  4LCL A;  4NKP A;  1K56 A;  4HOI A;  3IXB A;  5FAT A;  2HDS A;  1P97 A;  2VGJ A;  1EWZ A;  3RFB A;  5CGW A;  4DE3 A;  3GSG A;  3FC7 A;  2HJE A;  4R70 A;  4BL2 A;  4EES A;  3B42 A;  4GW9 A;  1CEF A;  1M6K A;  3HL9 A;  2V2F F;  4X53 A;  3EGX C;  5L8M A;  4RYE A;  1VET A;  3UDX A;  1K6S A;  5EVI C;  3H9W A;  1IYP A;  5DKK A;  3PBN A;  2R9X A;  3UMD A;  3MQ0 A;  2JKR I;  3OCL A;  4OPR A;  3TOI A;  4L9E A;  3M2J A;  2HZ5 A;  5F5Y A;  2R9W A;  1YLP A;  3LYX A;  4UA9 A;  3T4Q A;  4BL3 A;  1T19 A;  4RQ9 A;  3BLM A;  3M2K A;  2WGW B;  3NOU C;  4OLG A;  4B93 A;  4MN7 A;  4FCF A;  3UNW A;  1N9B A;  3ZDJ A;  4MBK A;  2QPN A;  5HD3 A;  2Y2N A;  2W3G A;  4UAA A;  5F6A A;  3VV4 A;  3A0S A;  4S2N A;  4X69 A;  1K54 A;  3DWK A;  5FAS A;  2VGL S;  2J3W A;  1S67 L;  4HY8 A;  1K0K A;  4S2J A;  4R3B A;  2B5R A;  1G5U A;  2E8I A;  1NZO A;  2J3T D;  3Q07 A;  5DF8 A;  4UEY A;  4K91 A;  2ZM2 A;  4OQH A;  1K57 C;  2V1B A;  1IKI A;  2A3U A;  2P9V A;  3SH8 A;  2GNX A;  3LR5 A;  2INW A;  3H82 A;  1ESI A;  2QMI A;  3PR6 A;  2ZQD A;  2D01 A;  3QP2 A;  3UN7 A;  2KX6 A;  4JPM A;  5AJG A;  1PFL A;  5E43 A;  1ES4 A;  4IBX A;  2ZM0 A;  3T4J A;  3VP3 A;  3KSG A;  1FR1 A;  2ZBB A;  3O3V A;  4I3A A;  4UHU A;  2Y2K A;  4NXE A;  3O87 A;  2A49 A;  1G68 A;  1RCJ A;  4UQI S;  5HAP A;  3G6O A;  3LR0 A;  1XPB A;  4B9O A;  5CGX A;  3LI8 A;  5KIZ A;  2GZA A;  5KMW A;  3S7O A;  4Y7P A;  5U47 A;  2M7U A;  2I72 A;  3VP0 A;  2PR5 A;  1CI8 A;  4CPK A;  3BYD A;  4OH0 A;  5FA7 A;  4RA7 A;  1H8M A;  4RX2 A;  1S0W A;  3IWO A;  1KDS A;  3IS2 A;  1S6R A;  2EWW A;  1KGG A;  2EX9 A;  5LBR A;  5HDD A;  4GDN A;  2GX5 A;  5DJT A;  5CHJ A;  3KX0 X;  5EPH A;  1JNU A;  3C7V A;  1MZU A;  3JPU A;  4CLC A;  4DF6 A;  3TG9 A;  4WUJ A;  3OPP A;  2DNS A;  4P0M A;  4YIN A;  2W1T B;  3C2W A;  1TEM A;  3K2N A;  1SKF A;  1C3B A;  2ZOI A;  4DXB A;  1YAX A;  1FR6 A;  4BBU A;  4LRY C;  2Y91 A;  4L0L A;  3F1N B;  4IHQ A;  2LB5 A;  1D1J A;  4FTX A;  4DMZ A;  3NCK A;  2JBF A;  2ZLY A;  3V3R A;  4KZ5 A;  1YLZ A;  1XJ6 A;  2OV5 A;  4B88 A;  3NC8 A;  4P6Z M;  3AGD A;  3T12 B;  4QJG A;  2VV6 A;  4P6B A;  1N9L A;  3NEC A;  2OLV A;  3T50 A;  3C4O A;  2WKE A;  2XA7 M; 
#chains in the Genus database with same CATH homology
 5TJJ A;  2W3H A;  3EEH A;  5AVE A;  3UB8 A;  1F9I A;  3PBQ A;  4GS9 B;  4JGP A;  4YWZ A;  2OWH A;  3O5Y A;  3PBR A;  3TRC A;  5F68 A;  3MR0 A;  4PAU A;  2W1T A;  4MN6 A;  4HP4 A;  2V0U A;  3FG8 A;  4O8G A;  1W63 M;  2PDR A;  2VX8 A;  1ODV A;  3F1N A;  3KYQ A;  1LSX A;  3PBO A;  4MN5 A;  2HV1 A;  4NXG A;  4GCZ A;  3T4L A;  4ETZ A;  3R4K A;  4EXO A;  4M4X A;  3BY8 A;  2KDK A;  3ZQ5 A;  2A2L A;  4LLO B;  1YSP A;  2O0Y A;  3B33 A;  3KO6 A;  4Q0H A;  3UB7 A;  2KOI A;  4HH2 A;  4CLC D;  3OC2 A;  3CLO A;  2NUT C;  1UWP X;  3HCY A;  3S7N A;  5HL6 A;  4EER A;  1VB6 A;  4F3L B;  2Y8H A;  4CLC C;  3U2A A;  4H6J A;  3LR4 A;  1LT0 A;  3DBA A;  4R38 A;  4EEU A;  1UWN X;  2MJ6 A;  1DRM A;  1X0O A;  4GS9 A;  1XJ3 A;  2VLG A;  3F1P B;  4ZRR A;  4Y3I A;  1N9O A;  2K7S A;  1P0Z A;  2W1R A;  4WL9 A;  2VEA A;  5HD5 A;  2WKP A;  3BQ8 A;  3W2Z A;  2WKQ A;  1T1B A;  2B02 A;  1OPX A;  3LIA A;  4NXB A;  3EQV A;  1W63 Q;  1TS8 A;  2W0N A;  2XRN A;  4IUK A;  4BBT A;  1F5M A;  5J3W A;  4BMW A;  3D72 A;  3VE4 A;  4MDZ A;  3HJK A;  4II7 A;  2JKT M;  3K3C A;  3BWL A;  3UME A;  1D06 A;  4XT2 B;  1S1Z A;  2O9B A;  3LIB A;  1OTE A;  4HNB A;  5DKL A;  3RH8 B;  2VZW A;  3LIE A;  3LIF A;  4HJ3 A;  1OT9 A;  4Z1W A;  3T4S A;  4ETX A;  4HI4 A;  4P6Z S;  5HZH A;  3MF0 A;  2FZ0 A;  2Z6D A;  2VV7 A;  2PD7 A;  4UQI M;  3B47 A;  3E4O A;  4F3L A;  3ULF A;  5TBM B;  1TS6 A;  2QKP A;  2OAP 1;  1T18 A;  1MC0 A;  3GEC A;  4HIA A;  1S1Y A;  2XA7 S;  3FPW A;  1OTD A;  3S7P A;  3F1P A;  1T1A A;  4NXF A;  5HWW A;  5AVF A;  3OCN A;  3LI9 A;  5HSQ A;  4EET B;  3MXQ A;  3BQA A;  3OBF A;  2K31 A;  3VE3 A;  4EEP A;  4YNR A;  5F69 A;  2VKS A;  4BJP A;  5G4Y A;  2JN7 A;  4HJ4 A;  3LID A;  1V9Z A;  3EEA A;  3IBJ A;  3CUE C;  1T1C A;  3BW6 A;  4FSF A;  3FPV A;  4ARZ B;  2A24 B;  3D3O A;  1Y28 A;  1ZTU A;  2GJ3 A;  1IOU A;  3H7W B;  4HP9 A;  5IT5 A;  3F1O B;  4KUK A;  1TD5 A;  3VOL A;  3UB6 A;  3MMH A;  3OOV A;  3SW1 A;  1LSW A;  4LRX C;  2VA0 A;  3TW8 A;  3EOI A;  3UE3 A;  4KQD A;  4Y2F A;  2HGV A;  2D02 A;  2W3E A;  5TBM A;  2R78 A;  2O99 A;  2PYP A;  3NOT C;  2DMW A;  3T4K A;  2QJ5 A;  2V1A A;  2HJ9 C;  2PT7 A;  4NEE D;  2P08 A;  1OTI A;  4LRZ E;  5HDS A;  5MC7 A;  3NOP C;  5HWT A;  2BAS A;  4KUO A;  3KSF A;  2VV8 A;  1N9N A;  4E04 A;  5J4E A;  1OT6 A;  4GHI B;  1LL8 A;  3UB9 A;  1S4R A;  2VGL M;  1LSV A;  4HJ6 A;  4WLA A;  3A0V A;  2A24 A;  4ARZ A;  2OWJ A;  1YSQ A;  4WEJ A;  1TS0 A;  4CQH A;  3H7W A;  3NJA A;  4I3J A;  2JHE A;  2PR6 A;  5FL3 A;  4EQ1 A;  3F1O A;  3LIC A;  2V9A A;  4DN0 A;  4NKP A;  2OOL A;  4HOI A;  4BWI A;  4PKY A;  1P97 A;  3RFB A;  2NUP C;  2Y79 A;  5IU1 A;  4JGO A;  1P9W A;  2XRO A;  1P9R A;  4CLC E;  2P7J A;  3FC7 A;  4Y5F A;  5G4Z A;  2HJE A;  4R70 A;  2J80 A;  4EES A;  3JVU A;  3C38 A;  2PHY A;  3KSH A;  3B42 A;  4GW9 A;  2P04 A;  1GSW A;  2IA2 A;  4GHI A;  3EGX C;  5L8M A;  3P7N A;  1BYW A;  1GSX A;  4IJG A;  1XFN A;  4HH3 A;  2H28 A;  3H9W A;  3P01 A;  3S7Q A;  2OAQ 1;  5DKK A;  3PBN A;  4DJ3 A;  4EW7 A;  3T4T A;  3UMD A;  3MQ0 A;  4PKY G;  4YOF A;  2JKR I;  5A8B A;  3OCL A;  4L9E A;  4KQO A;  3MQQ A;  2FH5 A;  2HF6 A;  5F5Y A;  4Q0I A;  2QJ7 A;  3PHY A;  3LYX A;  2O9A A;  3T4Q A;  3PBT A;  5DFY A;  4EU0 A;  1T19 A;  4RQ9 A;  2PD8 A;  4FOF A;  2B18 A;  4HHD A;  3NOU C;  2VJW A;  1EW0 A;  3NHQ A;  4MN7 A;  4B93 A;  2K2N A;  1UGU A;  4R3A A;  3H82 B;  3MFX A;  2KLI A;  4O0P A;  3BY9 A;  1G28 A;  3MQO A;  5HD3 A;  2W3G A;  2EA9 A;  5F6A A;  3VV4 A;  1H3Q A;  1ZHH B;  1DP8 A;  3A0S A;  3T4O A;  4XT2 A;  3PBS A;  2VGL S;  2Z6C A;  3UE6 A;  2L4R A;  2ZMF A;  2J3W A;  4QPR A;  1OJG A;  2L0W A;  1S67 L;  3TE8 A;  4HY8 A;  1G6O A;  5DF9 A;  4DJ2 A;  1YKD A;  1VHM A;  2J3T D;  4L9F A;  5DFX A;  4MCW A;  4UEY A;  3CIT A;  3CAX A;  2V1B A;  5HPF A;  1OTB A;  3C8C A;  2J3T C;  2GNX A;  5C5K A;  3C30 A;  3LR5 A;  2INW A;  4K08 A;  3H82 A;  1OJ5 A;  2M7V A;  2W27 A;  4LPZ A;  3IBR A;  3R7W B;  4R6L A;  3PR6 A;  4PHT A;  1F98 A;  3IS2 B;  2D01 A;  2W3F A;  3PYP A;  2KX6 A;  3A0R A;  4OOM A;  2QWS A;  1KOU A;  5AJG A;  3JVV A;  4I38 A;  3T4J A;  4JGR A;  3V67 A;  3KSG A;  4JGQ A;  1OTA A;  4MMN A;  3RTY A;  2ZBB A;  4WF0 A;  4AFI A;  3CUE A;  4I3A A;  4NXE A;  1STZ A;  1XJ4 A;  5HDC A;  2LB9 A;  1S4S A;  5HPI A;  1XFQ A;  4UQI S;  3G6O A;  3LR0 A;  4B9O A;  4CLC B;  3LI8 A;  1TF1 A;  3EGD C;  5KIZ A;  2GZA A;  2V0W A;  2W3D A;  4WN5 A;  1NRJ A;  5DJU A;  3S7O A;  4I3I A;  1TS7 A;  3BJN A;  1S66 L;  2M7U A;  4IUH A;  3ZYT A;  2PR5 A;  1MKM A;  4O01 A;  4GLQ A;  2G7U A;  3GDI A;  1H8M A;  4G3W A;  3LR3 A;  5IS1 A;  2ZOH A;  3R7W A;  3IS2 A;  3TJZ C;  2EWW A;  2QHK A;  1DP6 A;  3LUQ A;  2EWV A;  4EUV A;  5LBR A;  5HDD A;  1GSV A;  2GX5 A;  2L1M A;  5DJT A;  3E0Y A;  1XJ2 A;  3EWK A;  2JKT I;  2XSS A;  2JKR M;  3KX0 X;  3KSI A;  1IFQ A;  4ME4 A;  1JNU A;  3E4P A;  1MZU A;  4I5S A;  3E98 A;  5CX7 A;  4G3V A;  3MJQ A;  1V9Y A;  2YKF A;  3E4Q A;  3OLO A;  2I9V A;  3PXP A;  4CLC A;  3LFV A;  3EQU A;  1NWZ A;  3K3D A;  4WUJ A;  4HQA A;  2QYB A;  2W1T B;  3C2W A;  3ICY A;  1D7E A;  3K2N A;  3KYZ A;  2O9C A;  2ZOI A;  5I5L A;  1YAX A;  2WKR A;  5K5B A;  4BBU A;  4LRY C;  4WEK A;  4L0L A;  3F1N B;  4IHQ A;  4Q0J A;  2LB5 A;  4DMZ A;  1NLZ A;  1DP9 A;  4WEL A;  2ZMV A;  3CWF A;  5HWV A;  1XJ6 A;  3HJI A;  1NLY A;  4P6Z M;  2YKH A;  2M1C A;  4BBV A;  3CI6 A;  4L9G A;  2CMN A;  2VV6 A;  4I39 A;  5J7E A;  1N9L A;  3T50 A;  4G3K A;  2PYR A;  5KSH A;  4H6J B;  5EFW A;  1WA9 A;  4OOL A;  4GJ4 A;  2XA7 M; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...