3UMEA

Structure of pb intermediate of photoactive yellow protein (pyp) at ph 7
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
125
structure length
125
Chain Sequence
MEHVAFGSEDIENTLAKMDDGQLDGLAFGAIQLDGDGNILQYNAAEGDITGRDPKQVIGKNFFKDVAPCTDSPEFYGKFKEGVASGNLNTMFEYTFDYQMTPTKVKVHMKKALSGDSYWVFVKRV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Photoactive yellow protein
publication title pH Dependence of the Photoactive Yellow Protein Photocycle Investigated by Time-Resolved Crystallography.
pubmed doi rcsb
molecule tags Protein binding
total genus 30
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2011-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00989 PAS PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3umeA00
3H9WA 4JGRA 5KIZA 3MQOA 1V9YA 2D01A 2YKFA 4XT2B 2QKPA 1DP6A 3LI9A 5HWVA 1EW0A 3P7NA 2ZOHA 5F68A 3UMDA 4EERA 2INWA 2K7SA 4WUJA 1OJGA 5J3WA 1VB6A 5HD3A 4HI4A 5AVFA 1ODVA 1UWNX 5HSQA 2VLGA 3MR0A 3F1PB 3MQQA 4BBUA 4WL9A 2Z6DA 1D7EA 3H7WA 4LRZE 1T1BA 3F1NA 1OTIA 3LICA 3B33A 2L4RA 4H6JB 2QWSA 3E4PA 3LIAA 1OTAA 5J7EA 3VE4A 5IU1A 1G28A 2QJ7A 4R3AA 5HDSA 5HDCA 4EEUA 2HV1A 5HD5A 3BWLA 3NOTC 4R38A 3MFXA 3ICYA 3LIDA 1LSVA 4WN5A 3UMEA 4HQAA 4HH3A 2P7JA 2QHKA 3F1OA 1S4SA 3UB9A 1S66L 1OTBA 2A24A 4NXBA 4GS9B 3PYPA 1DP9A 4EESA 4L9GA 1XFNA 3A0SA 1F9IA 2OWJA 3G6OA 1KOUA 2W0NA 1XFQA 4BBVA 3K3CA 1S67L 3NOUC 5EFWA 1T1CA 4EW7A 2PR5A 4XT2A 3H82A 2VV6A 4HJ4A 1T19A 3ZQ5A 2J80A 4HIAA 2PD8A 2BASA 4HOIA 1N9LA 4WF0A 4I3IA 2V0WA 1D06A 1BYWA 4LRYC 4E04A 2Z6CA 3UB6A 3CWFA 2V0UA 1S1YA 3MXQA 5F69A 1OJ5A 1XJ2A 4RQ9A 3RH8B 2V1AA 4PKYA 4WLAA 4R6LA 3EEHA 4I3JA 1T18A 2PR6A 2WKRA 4L9EA 2ZOIA 4HJ6A 2YKHA 2KX6A 4H6JA 2L1MA 3HJIA 3LI8A 3LIFA 1LT0A 1UGUA 5AVEA 2OWHA 3BY8A 2VV8A 4MN5A 1LSWA 4NXEA 4DJ3A 2KDKA 2V1BA 5DJUA 3OLOA 3NJAA 2R78A 2JN7A 1DRMA 3HJKA 4HP9A 1V9ZA 3LIEA 2VEAA 4GHIB 2PD7A 5I5LA 2WKQA 5DJTA 5G4ZA 4EQ1A 1LL8A 1NWZA 4YWZA 4K08A 2CMNA 3UE6A 5HZHA 3E4QA 4HY8A 4F3LB 2WKPA 5F5YA 4L9FA 2A24B 4HJ3A 2VV7A 5DKKA 3VE3A 2ZBBA 1X0OA 2M1CA 3IS2B 3K3DA 5DKLA 2V9AA 3E4OA 1OTDA 1GSWA 3A0RA 4JGOA 1S1ZA 4KUKA 5TBMB 1TS0A 3PHYA 5F6AA 3NOPC 4I5SA 1F98A 3CLOA 4NXFA 1XJ6A 2W27A 5A8BA 3H82B 4LRXC 4GW9A 2H28A 5G4YA 3GECA 2PHYA 3UB7A 3GDIA 1XJ3A 2OOLA 4HH2A 3F1PA 4R70A 4EETB 4KQDA 3T50A 3EWKA 3LUQA 1XJ4A 1TS7A 1GSVA 1TS6A 1P0ZA 2I9VA 4MN6A 4PKYG 4EEPA 2PYRA 3C2WA 4I39A 4EXOA 1UWPX 2B02A 3H7WB 3KX0X 3LIBA 2EA9A 5HWTA 5HDDA 1OT6A 1LSXA 3F1NB 3IBRA 3LYXA 4JGQA 1N9NA 2QJ5A 1S4RA 1T1AA 1P97A 4GHIA 2JHEA 3FG8A 1Y28A 1OTEA 3UB8A 3FC7A 4I38A 3NHQA 1DP8A 4GS9A 1GSXA 2D02A 4JGPA 4HNBA 4BBTA 4F3LA 4I3AA 1WA9A 3CAXA 1JNUA 3F1OB 2L0WA 3BY9A 4M4XA 4HHDA 3RTYA 4B9OA 4KUOA 5HWWA 4DJ2A 3MJQA 4GCZA 1N9OA 2GJ3A 1OT9A 1MZUA 3D72A 3IS2A 3VOLA 4LLOB 4NXGA 3C8CA 2PYPA 5TBMA 2PDRA 5J4EA 3SW1A 3ULFA 4HP4A 4LPZA 1TS8A 3A0VA 5IS1A
chains in the Genus database with same CATH superfamily
2A3UA 4UA7A 1KVMA 3LR5A 5KIZA 3A3FA 1O07A 1V9YA 3VP3A 3V5MA 5BOHA 2HF6A 2KOIA 4DDSA 1DP6A 1BULA 1EW0A 4K0WA 4JPMA 2ZOHA 3S7QA 4GJ4A 5GLDA 3MSHA 1P9WA 3UMDA 1G5UA 4JXVA 5A91A 3BFCA 3S4XA 1VB6A 4H8RA 5AVFA 1ODVA 3CUEC 4P6BA 4ZJ2A 5EVIB 3N8SA 1HLUP 3MR0A 2VKSA 3F1PB 2EFUA 3MQQA 4PM8A 4Y7PA 1OMEA 1D7EA 3H7WA 3ZYTA 2Y8HA 2E8IA 1T1BA 1GHPA 4KG5A 4UQIS 1NY0A 1Y4OA 3F1NA 4YFMA 4LV3A 4DRTA 1JWVA 4KZ3A 4BMWA 5IT5A 3B33A 2QMIA 3MQ0A 3E2KA 2WKEA 3ZVWA 2QWSA 5JYPA 3VP4A 2HZ5A 3DW0A 3VE4A 3IXBA 3G35A 4X6TA 4IUHA 4R4RA 1W63Q 2HDSA 4OLDA 4ZAMA 4S2NA 1ZHHB 1L0EA 4S2OA 5HDCA 3NOTC 1K54A 5KZHA 2H10A 4X55A 4PPRA 3T1SA 3IXDA 3UMEA 2P7JA 1PWDA 1S4SA 4LV2A 3UB9A 1NYYA 3DAVA 1ONHA 1FQGA 1MXOA 4EWFA 4E3NA 4EESA 1CEFA 1MC0A 1KGGA 4ZRRA 3U4LP 3OPHA 4S2MA 1XFNA 4LFUA 3IXHA 4CLCD 2EX8A 4GOGA 5HPFA 3MKEA 2W0NA 2M7VA 1XFQA 2HDRA 3G32A 3PBQA 5EFWA 3BJNA 5DFXA 1HVBA 3G2ZA 4QY5A 1I2WA 3FV7A 4MN7A 4JF5A 4HIAA 5KMWA 2G2WA 1XGIA 3OPLA 2ZM2A 1N9LA 1J3WA 5IHVA 3LFVA 1XX2A 4I3IA 1K4FA 1PW1A 4GD6A 4QU3A 1FR6A 2V8FA 3KSHA 1H8MA 4QD4A 1MPLA 4KZ4A 1ZG4A 5FSRA 1ESIA 1NZUA 4KQRA 1FCMA 4P6ZS 2V0UA 4MLLA 3LCEA 1XJ2A 2OSUA 4ID4A 3BYDA 4YOFA 3OOVA 2WKHA 2PR6A 4L9EA 2ZOIA 4IEDA 4DE3A 5FEGA 1STZA 3UE0A 4ETZA 1VEUB 4H6JA 2HDUA 4NKPA 1PW8A 4YNRA 3GTCA 1VETA 1K4EA 3TRCA 1IYOA 2PBDP 3EQUA 2J9OA 5FI2A 2RCXA 2ZC3B 5CEBA 4ZBEA 3HUOA 5GL9A 4PM6A 2KDKA 4UA6A 4GDNA 5F83A 3O88A 5DJUA 2ZC5B 3OLOA 3N6IA 5CECA 5DVAA 4UHUA 2JN7A 3CI6A 3KYQA 2ZQ9A 1SDEA 3HREA 3RXXA 3LY3A 4KZAA 4GHIB 2PD7A 2XFSA 3D3OA 5DF9A 2K2NA 5G4ZA 4YWZA 1F5MA 4DN0A 2CC1A 4R4SA 4LCMA 4JF6A 3C7UA 3PXPA 2ZD8A 3W2ZA 2P9VB 3O86A 4GDBA 3M6HA 1YLYA 4NEED 2JKRM 1PI4A 3ZFZA 1FIKA 3EOIA 2XGNA 3HUNA 3D9YA 1ALQA 2EX9A 3UY6A 1JTDA 2ZBBA 1W5DA 4WYYA 3BLMA 1X0OA 2HJ9C 3BFFA 1S1ZA 4EUZA 4Y0TA 3HBRA 4KUKA 4MCWA 4I5SA 3UE1A 3MF0A 2J3TC 2W27A 4IJGA 1HZOA 5TFQA 3TJZC 4GW9A 1YLJA 2R9WA 5G4YA 3GECA 1XPBA 1Q2QA 3NCKA 1KDSA 3MZEA 4S2KA 4HH2A 4GKUA 4ARZA 1LI9A 5AQAA 4HEFA 1PI5A 2XSSA 3O87A 4XUXA 4CLCA 3LUQA 1TS7A 1GSVA 2XA7M 2JE5A 3RFBA 3PBRA 3BQAA 1TS6A 4EUVA 4JXWA 2O0YA 1QMEA 2UWXA 2PYRA 4N92A 3C2WA 1K38A 2GDNA 1LI0A 2B02A 4A5RA 3LO7A 3LIBA 4JKTA 5HWTA 4FSFA 4LGWA 5KSHA 4OOLA 4KZ6A 1NRFA 3CITA 1L0FA 2WK0A 1S4RA 3LR4A 2O9CA 1P97A 5D3OA 3IHBA 3HLWA 1L2SA 2ZLYA 5EM0A 1OTEA 4P85A 5E2FA 2ZL1B 3HLCA 4Q0JA 4B4ZA 1GSXA 4HNBA 1FOFA 4FD8A 3UN7A 4IBRA 3HLBA 1K57A 2KLIA 1TVFA 2Y2PA 5EVLA 1RGZA 4Y5FA 3N8RA 3C4OA 1N9OA 1DJAA 1FSWA 1OT9A 3CPTB 3OZHA 3C30A 3DTIA 3LEZA 3E2LA 4JXGA 3C8CA 5CHJA 2EXAA 4HBUA 5M19A 1K6RA 4IUKA 1BZAA 4LPZA 1TS8A 3L7HA 4Y15A 3MQOA 3QHYA 2YKFA 4XT2B 2QKPA 3JVUA 2Y2OA 3LI9A 3ZNYA 1K6SA 3P7NA 4Q8IA 3PBSA 3VFFA 1M6KA 3QP6A 3WRTA 4WUJA 5HD3A 5L07A 1UWNX 2VJWA 5HSQA 1IELA 1W8QA 2O99A 1E3UD 4DDYA 1E25A 2PU2A 3P09A 4OVDA 1NZOA 1EROA 3JPUA 5EOEA 2EFXA 1K55A 4GD8A 5FI7A 5MC7A 3O5YA 5CEDA 2VGJA 3A3JA 5FI6A 3E4PA 3EQVA 3KSFA 3LIAA 4Y13A 1OTAA 5J7EA 2W3EA 3IH9A 5CHUA 5DFYA 1PZPA 3HLDA 5IU1A 1G28A 5F1FA 1XA1A 2QJ7A 4R3AA 5HDSA 3UO9A 4EEUA 2HV1A 2WGVA 3UDFA 3Q81A 3LIDA 4HQAA 2VZWA 2HP6A 2HJEA 3IWOA 5FDSA 2ZM8A 3A3DA 3IXGA 4NETA 4PAUA 1VM1A 2VGLM 3DTMA 5CX7A 2UV0E 4L0LA 1H5XA 3VSLA 2EXBA 3IF5A 3A0SA 4ESPA 3V3SA 1TD5A 4WELA 2FFFB 4DE0A 5F1GA 1KOUA 3EGXC 1NXYA 4LENA 2OV5A 3DTKA 5J8XA 3A3IA 4LV0A 2V2FF 3GSGA 5EV0A 1T1CA 2V1ZA 2XF3A 3G30A 3UDIA 2XFTA 2G2UA 1PNEA 1FILA 4S2NC 4U3TA 4G3KA 1YSQA 2WAFA 3NIAA 2OAP1 1W7FA 4OOYA 3BEBA 5DTSA 1K54C 2FZ0A 3VOZA 4BLMA 4D2OA 3G2YA 3MS6A 4WEJA 1QMFA 5HW3A 1KE3A 5FAOA 2V0WA 4LRYC 1LHYA 3C38A 3PAEA 3UB6A 2DCFA 1TDLA 5E2EA 1WE4A 3MBZA 3VP1A 2Y2MA 3HCYA 3RH8B 4PM9A 4PKYA 1CQAA 4DE1A 4OQGA 3EEHA 3GR2A 1T18A 4OQIA 5FA7A 2H5SA 1DJCA 1SHVA 3SS5A 5GLBA 4MBHA 1IYQA 4IHQA 3LI8A 2ACGA 4Z9QA 1TEMA 5AVEA 2Z2MB 1BT5A 2DRWA 2VV8A 4II7A 2XQZA 3ZNTA 3S22A 1LSWA 4Y2FA 5FL3A 1XGJA 2V8CA 2V1BA 3SH9A 4O8GA 1DRMA 3HJKA 4HP9A 1WYBA 4BD0A 2VEAA 1MBLA 4PM5A 1YLWA 1J9MA 3W8KA 4P0MA 4KZ5A 1LL8A 2HPBA 2QZ6A 4DE2A 4R3BA 1E3UA 4K08A 2CMNA 3UE6A 1ZG6A 3NBLA 2BG1A 2IWBA 4F3LB 1HTZA 2WZZA 2Y2NA 5CERA 2Q9NA 2NUPC 1PZOA 3UPPA 3EGDC 2J9PA 1MWTA 3VE3A 1SKOA 4XUZA 1PWCA 2PU4A 3L9KA 1VQQA 4JF4A 2M1CA 3WS0A 1CF0A 3IS2B 2JKFA 3ZVTA 4RA7A 2Y91A 4G3VA 2V9AA 4BJPA 1KVLA 1GSWA 2W3HA 3CZDA 3NY4A 3LY4A 4PM7A 5E2HA 5FQQA 4QPRA 1L3LA 5A8BA 3T1QB 1IOUA 3BM6A 2H28A 5A92A 3QNBA 5AQBA 2WUQA 2EWVA 1ESUA 2OOLA 3ZDJA 4KQOA 5G18A 3UPOA 4KQDA 4UA9A 2PAVP 3IH8A 5I94A 1N9BA 5L8MA 2P74A 2XK1A 3M2KA 2Y2IA 3KYEA 4PKYG 5GLAA 4E3OA 4EBNA 2XR0A 5F82A 4MNRA 4EXOA 1IYPA 3H7WB 2ZQ8A 2EA9A 1KE4A 5EM1A 3ZG7B 3N7WA 3F1NB 2W1RA 5GLCA 3V3RA 1ZC2A 1F2KA 1T1AA 2ZM0A 2B5RA 3CMZA 2XROA 3ZG8B 3MZDA 4U0TA 3FG8A 3TE8A 3Q7VA 2RL3A 3FC7A 4I38A 3QP2A 3NHQA 1YSPA 2W1TA 5A90A 4BBTA 4KZ8A 2ZMAA 2C6WB 4GLQA 1L0GA 3VOYA 4M3KA 4MEZA 2P04A 3BY9A 5EVID 2XA7S 4CLCC 1E4DA 4DJ2A 4GCZA 2GJ3A 3FPVA 5TJJA 3D72A 5GHYA 2JKRI 2ZMFA 4HESA 4LLOB 2WGWA 1XP4A 4N1HA 1SCWA 3CHWP 3VFHA 5M18A 5TBMA 4E3IA 3KO6A 1ES3A 5J4EA 4C3QA 4HP4A 1SKOB 2JKTI 2NUTC 1YAXA 2X71A 1ZKJA 3HLEA 4JGRA 2D01A 1ES4A 4GB7A 2Y2KA 3W4QA 5HWVA 4ZJ1A 2IWCA 1CEGA 4WMCD 2PRFA 4WZ5C 4KQQA 5F68A 1ACFA 1G6OA 4PHTA 3C7VA 2K7SA 3UB5P 2XLNA 5J3WA 3NECA 3BFGA 4HI4A 3T4KA 1K57C 1DJBA 3FKVA 1O7EA 3IT9A 3QP8A 1PRQA 3IF6A 4OONA 2MJ6A 1W79A 5KSCA 5EECA 2XDMA 3U2AA 4RVAA 3WS4A 2OLUA 4WL9A 2Z6DA 4LRZE 3MFDA 2R9XA 2Y2QA 2H0TA 4ZDXA 1H0MA 3K2NA 3GV9A 3LICA 2L4RA 4H6JB 3WS2A 4Z1WA 4Q0IA 1VETB 1MWRA 3SS4A 5FQIA 3QP1A 3VV4A 3WRZA 1YQSA 5HD5A 1IYSA 4E3JA 3IQAA 4R38A 1G68A 5FQKA 4FCFA 1ES5A 4OP8A 4P87A 2LB9A 4HH3A 3F1OA 5EUAA 1VHMA 1WYCA 1S66L 1ERMA 1RGYA 4YINA 5IS1A 4Y0OA 1GHIA 1BLPA 4L9GA 1GHMA 3SH8A 3AGFA 2ZQ7A 1JWZA 1FR1A 1K55C 3G6OA 4C75A 4BBVA 2PBYA 4WBGA 5C5KA 1S67L 3M2JA 4CJNA 2FH5A 1RCJA 2Y59A 2G7UA 2AVXA 2PR5A 3SH7A 3RJUA 3H82A 2VV6A 1EI5A 1T19A 1LLBA 3ZQ5A 2W3FA 4PMAA 4ETXA 2J80A 3CG5A 2PD8A 1MKMA 4B88A 2BASA 3OCLA 4E3KA 4MBFA 3E98A 4X56A 2Y2HA 5HPIA 4GNUA 5CXWA 1Z09A 4CLCE 3DTEA 5DF7A 1BYWA 4B93A 2Z6CA 3BFEA 2X02A 5EVIA 5FATA 2VGLS 1BUEA 1S1YA 3MXQA 5F69A 1OJ5A 4EV4A 5EOOA 4QY6A 1FCNA 1K25A 1YM1A 2V1AA 4N9KA 4ARZB 5L10A 4I3JA 2ZC6B 4EU0A 5AQ9A 1IKIA 1BLSA 4CLCB 2YKHA 1LL5A 4KENB 2EX2A 3PBOA 3IBJA 4K0XA 2JCHA 2KX6A 2Y2GA 3HJIA 4R3JA 4RX2A 2XD1A 1EWZA 4S2IA 4FTXA 3I7JA 3LIFA 3WS5A 1LT0A 1Q2PA 2OLVA 4MBKA 1UGUA 2OWHA 1M40A 1IKGA 2C5WB 4MN5A 4NXEA 4DJ3A 2OAQ1 4WMCA 3T4TA 2R78A 4O01A 3AGDA 2XRNA 1V9ZA 3LIEA 2Y79A 4N9LA 3ZG9B 5GHZA 5HX9A 3JYIA 3R7WA 5DJTA 1AWIA 3KYZA 4EQ1A 1PFLA 3E4QA 3UDXA 3UE3A 4HY8A 4N1XA 2B95A 3VP0A 4E3MA 4OP5A 5F5YA 3VSKA 3Q1FA 4L9FA 5EE8A 2ZQAA 4HJ3A 5E2GA 4X25A 4EBPA 4X69A 2A2LA 3G4PA 3IWIA 1YLTA 1CK3A 3K3DA 1BLCA 5FAPA 3E4OA 1OTDA 3BLSA 3BECA 2Y2LA 4F94A 5AQ7A 3V50A 2HGVA 3T1XA 1PIOA 3PHYA 3DWKA 4DXCA 4X1LA 3CLOA 3SOIA 4JXSA 3H82B 5FQ9A 3UB7A 3W4PA 3MKFA 3G34A 1CI9A 4KZ7A 3DBAA 4OH0A 1MY8A 2ZQDA 4OPYA 1KGEA 4R70A 5TGFA 4EETB 3V67A 5A93A 1BLHA 3T50A 2W3DA 4LV1A 1CI8A 1XJ4A 3S7NA 1VEUA 3GVBA 1PYYA 3IX4A 4OQHA 2IWDA 2XH9A 3PR6A 4BENA 4QJGA 2I9VA 3DWZA 1XKZA 5HAQA 4EEPA 1MWSA 3VMAA 4D60A 1NRJA 3GMWA 3HUMA 4I39A 3KX0X 3HLGA 5HDDA 1OT6A 4B4XA 1JWPA 4AFIA 1LSXA 2VK3A 1U60A 3LYXA 1N9NA 2QJ5A 3P98A 1KDWA 3NI9A 5CHMA 4GHIA 3S1YA 4EBLA 3B47A 1K56D 2JHEA 1Y28A 3EEAA 1DP8A 4GS9A 3ZCZA 2BLSA 2D02A 2J7VA 4JGPA 3HLFA 4R0QA 2P9VA 1WA9A 4OKPA 3CAXA 3CUEA 2ZC4B 3BRMA 3UPNA 2QPNA 2L0WA 4M4XA 5CTNA 2W3GA 3RTYA 2WKIA 3R7WB 2Y4AA 3LEQA 3OPPA 3WS1A 3T4OA 4E6XA 1YPRA 3C4PA 3FKWA 1LL9A 4Q0HA 4CPKA 4DF6A 4IBXA 3LR0A 4S2PA 5JYOA 4UQIM 2J8YA 2PYPA 4IVIA 2PDRA 4O7DA 3SW1A 1NJ4A 3ULFA 3TSGA 4NK3A 1MWUA 3A0VA 4G3WA 1A0KA 3H9WA 2IA2A 4UEYA 4X53A 1XXMA 3ZG0A 2P08A 2J3TD 4EERA 5CRFA 1MKIA 4OPQA 2INWA 2M7UA 2VA0A 4FOFA 1OJGA 5HL1A 5HARA 2Q9MA 2VLGA 1H8ZA 2I72A 1XA7A 5HAIA 2JKGA 1L0DA 1FCOA 3N8LA 2HP5A 1PWGA 3A3EA 4BBUA 1IFQA 3ZG5A 2EX6A 2V20A 1YLZA 1ZTUA 3OC2A 4E6WA 5CGSA 4NG2A 5GHXA 2EWWA 1OTIA 4BWIA 3PAGA 2QYBA 1OPXA 3R4KA 1ES2A 4E3LA 5HFOA 2ZC7A 3NDEA 1TDGA 4DKIA 1NYMA 4X1MA 2JC7A 2ZL1A 4ZTKA 2VX8A 3BWLA 4OPRA 4JLFA 4OOMA 3MFXA 3ICYA 2O9BA 1LSVA 3PBNA 4WN5A 2QHKA 1YMSA 2ZJ9A 3T4SA 1OTBA 2DMWA 2A24A 1I2SA 1IEMA 4NXBA 4P6ZM 3OPRA 3IF6C 4Y17A 3TG9A 4GS9B 2K31A 3PYPA 1DP9A 3CPTA 5E43A 2PT7A 3HL9A 4OPZA 3AGEA 1F9IA 2HP9A 2OWJA 3FPWA 4S2LA 5FASA 3N4IA 5LBRA 3CJMA 2Q0OA 3K3CA 5L2FA 1KGFA 3NOUC 5DF8A 1C3BA 2JKTM 4EW7A 4XT2A 1NLYA 2VGKA 4HJ4A 3FWLA 2J3WA 1W8YA 3WWXA 5EVEA 3UNWA 1K56A 5FQJA 4GN2A 4FH2A 4CQHA 2DNSA 2XEPA 4HOIA 4WF0A 1NLZA 5FEFA 3M6BA 2WZXA 3NULA 3G31A 1JVJA 1D06A 4E04A 1SKFA 4MDZA 3CWFA 2GNXA 2LB5A 4RQ9A 3BFDA 3MZFA 3O3VA 4O0PA 2E8JA 3V39A 2ZMVA 4R6LA 4WLAA 3BQ8A 2WKRA 4HBTA 4HJ6A 4KG2A 3D4FA 4JBFA 5U47A 2FFYA 3LR3A 3W4OA 3T4JA 3MXRA 4WM9A 2L1MA 3ITBA 2WYXA 3RXWA 1CJFA 2X01A 4BL2A 4Y0UA 3MMHA 4S2JA 3BY8A 3S7PA 3HVFA 4RX3A 4WZ4A 2H0YA 3NJAA 2BTFP 4BD1A 4BQMA 3TW8A 1S0WA 3B3XA 3QNCA 4WZ5A 5FDHA 3T12B 2HDQA 5I5LA 3T4QA 2WKQA 1W63M 1TF1A 3Q7VB 3NDGA 1NWZA 3TOIA 3QP4A 1BSGA 3GRJA 5EVIC 2W1TB 3B42A 4ME4A 4X68A 5HZHA 4U0XA 1K0KA 2WKPA 1P9RA 3C5AA 3NC8A 3VP2A 3JVVA 1I5QA 4Y3IA 2ZQCA 2A24B 1G6AA 2VV7A 5DKKA 4MMNA 5K5BA 3Q7ZA 4XXRA 3SZTA 3Q07A 4DMZA 2GX5A 1DY6A 5DKLA 2WGWB 2GZAA 3P01A 5HAPA 3A0RA 3E0YA 4JGOA 4GZBA 4K91A 2JBFA 1JTGA 5TBMB 1TS0A 1H8YA 5F6AA 4LCLA 4FH4A 3NOPC 4EQIA 4R23A 3LGOA 3PBTA 1F98A 4NXFA 3KSGA 4C6YA 2Y55A 1XJ6A 1GA9A 1N4OA 1AXBA 5M1AA 4LRXC 1YT4A 1BTLA 2PHYA 5HL6A 4RYEA 3GDIA 4FUWA 1XJ3A 3BW6A 3OCNA 1ERQA 1GCEA 1SZVA 4BL3A 3IHAA 3F1PA 4QWOA 3KSIA 4IVKA 3ISGA 3PTEA 1KE0A 3T4LA 3T1RA 3EWKA 4KZBA 3IF6B 1P0ZA 3QP5A 3S7OA 5EPHA 1ONGA 4MN6A 2WAEA 4QB8A 3GQZA 1UWPX 1YKDA 5AJGA 2A49A 2WGIA 3ZGAB 1YLPA 3IBRA 4JGQA 3ZHHA 2O9AA 3MXSA 1H3QA 3Q82A 5L09A 4QHCA 4ZJ3A 4OQ0A 4KZ9A 3UB8A 1SDNA 5CTMA 5FAQA 2WADA 5CGWA 1Y54A 4F3LA 4I3AA 1D1JA 4UAAA 1JNUA 5DTTA 2B18A 1YMXA 3F1OB 5DTKA 5TR7A 4HHDA 1Z6FA 4B9OA 4KUOA 5HWWA 3MJQA 1FSYA 3FYZA 3FZCA 3SS3A 1S6RA 1MZUA 3IS2A 3IX8A 3VOLA 1GA0A 1HD8A 4NXGA 2XD5A 2Z2LB 5CGXA 2Y2JA 3OBFA 1RP5A 3IX3A 3ITAA 3IWQA 4OLGA 4DXBA 4R1GA 5FQMA 4KG6A 4WEKA
chains in the Genus database with same CATH topology
3H9WA 2IA2A 3LR5A 4JGRA 5KIZA 3MQOA 1V9YA 4UEYA 2D01A 2YKFA 4XT2B 2HF6A 2KOIA 2QKPA 3JVUA 1DP6A 3LI9A 5HWVA 1EW0A 3P7NA 3PBSA 2ZOHA 3S7QA 4GJ4A 5F68A 2P08A 1G6OA 2J3TD 1P9WA 4PHTA 3UMDA 4EERA 2INWA 2K7SA 2M7UA 2VA0A 4WUJA 4FOFA 1OJGA 5J3WA 1VB6A 5HD3A 4HI4A 5AVFA 3T4KA 1ODVA 1UWNX 3CUEC 2VJWA 5HSQA 2VLGA 2O99A 2MJ6A 3U2AA 3MR0A 2VKSA 3F1PB 3MQQA 4BBUA 1IFQA 4WEKA 4WL9A 2Z6DA 1D7EA 3H7WA 4LRZE 3ZYTA 2Y8HA 1ZTUA 3OC2A 1T1BA 5MC7A 4UQIS 3F1NA 2EWWA 1OTIA 3K2NA 3LICA 3O5YA 4BMWA 5IT5A 4BWIA 3B33A 2L4RA 4H6JB 3MQ0A 2QYBA 2QWSA 3EQVA 3KSFA 3E4PA 1OPXA 4Z1WA 3R4KA 3LIAA 1OTAA 4Q0IA 5J7EA 2W3EA 5DFYA 3VE4A 4IUHA 1W63Q 3VV4A 1ZHHB 5IU1A 1G28A 2QJ7A 4R3AA 5HDSA 2VX8A 5HDCA 4EEUA 2HV1A 5HD5A 3BWLA 3NOTC 4OOMA 4R38A 3MFXA 3ICYA 2O9BA 3LIDA 1LSVA 3PBNA 4WN5A 3UMEA 4HQAA 2LB9A 2VZWA 4HH3A 2P7JA 2QHKA 2HJEA 3F1OA 1S4SA 3UB9A 1VHMA 3T4SA 1S66L 1OTBA 2DMWA 4PAUA 2A24A 5IS1A 4NXBA 4P6ZM 2VGLM 4GS9B 2K31A 3PYPA 1DP9A 5CX7A 4EESA 4L0LA 1MC0A 4ZRRA 4L9GA 2PT7A 1XFNA 3A0SA 1F9IA 4CLCD 1TD5A 4WELA 2OWJA 3FPWA 5LBRA 5HPFA 3G6OA 1KOUA 3EGXC 2W0NA 2M7VA 1XFQA 4BBVA 3K3CA 5C5KA 1S67L 3NOUC 2FH5A 3PBQA 5EFWA 1T1CA 2JKTM 2G7UA 4EW7A 3BJNA 5DFXA 2PR5A 4XT2A 1NLYA 3H82A 2VV6A 4HJ4A 1T19A 2J3WA 3ZQ5A 2W3FA 4ETXA 4MN7A 2J80A 4HIAA 2PD8A 4G3KA 1YSQA 1MKMA 2OAP1 4CQHA 2BASA 3OCLA 4HOIA 1N9LA 4WF0A 2FZ0A 1NLZA 3E98A 3LFVA 4I3IA 5HPIA 4WEJA 2V0WA 1D06A 3KSHA 4CLCE 1H8MA 1BYWA 4LRYC 4B93A 4E04A 2Z6CA 4MDZA 3C38A 3UB6A 4P6ZS 2VGLS 3CWFA 2V0UA 1S1YA 3MXQA 5F69A 1OJ5A 1XJ2A 2GNXA 2LB5A 3HCYA 4RQ9A 3RH8B 2V1AA 4O0PA 4PKYA 4YOFA 4ARZB 2ZMVA 3OOVA 4R6LA 4WLAA 3BQ8A 3EEHA 4I3JA 1T18A 2PR6A 2WKRA 4L9EA 2ZOIA 4HJ6A 4EU0A 1STZA 4CLCB 2YKHA 4ETZA 3LR3A 3PBOA 3IBJA 2KX6A 3T4JA 4H6JA 2L1MA 4NKPA 3HJIA 4YNRA 4IHQA 3LI8A 3TRCA 3MMHA 3EQUA 3LIFA 1LT0A 1UGUA 5AVEA 2OWHA 3BY8A 3S7PA 2VV8A 4II7A 4MN5A 1LSWA 4NXEA 4Y2FA 2KDKA 5FL3A 4DJ3A 2OAQ1 2V1BA 5DJUA 3OLOA 3T4TA 3NJAA 2R78A 4O01A 3TW8A 2JN7A 3CI6A 4O8GA 3KYQA 1DRMA 3HJKA 2XRNA 4HP9A 1V9ZA 3LIEA 2Y79A 2VEAA 4GHIB 2PD7A 3D3OA 5DF9A 5I5LA 3R7WA 3T4QA 2WKQA 1W63M 2K2NA 5DJTA 1TF1A 5G4ZA 3KYZA 4EQ1A 1LL8A 1NWZA 4YWZA 1F5MA 4DN0A 2W1TB 3B42A 4K08A 2CMNA 4ME4A 3UE6A 5HZHA 3E4QA 3PXPA 3UE3A 3W2ZA 4HY8A 4F3LB 2WKPA 4NEED 1P9RA 2JKRM 2NUPC 5F5YA 3JVVA 3EOIA 4Y3IA 4L9FA 3EGDC 2A24B 4HJ3A 2VV7A 5DKKA 3VE3A 4MMNA 5K5BA 2ZBBA 2A2LA 1X0OA 2M1CA 4DMZA 3IS2B 3K3DA 2GX5A 2HJ9C 5DKLA 4G3VA 2GZAA 2V9AA 3E4OA 4BJPA 1OTDA 3P01A 1GSWA 2W3HA 3A0RA 3E0YA 4JGOA 1S1ZA 2HGVA 4KUKA 5TBMB 1TS0A 3PHYA 5F6AA 4MCWA 3NOPC 4I5SA 3PBTA 3MF0A 1F98A 3CLOA 4NXFA 4QPRA 3KSGA 2J3TC 1XJ6A 2W27A 4IJGA 5A8BA 3H82B 4LRXC 3TJZC 4GW9A 1IOUA 2H28A 5G4YA 3GECA 2PHYA 3UB7A 5HL6A 3GDIA 1XJ3A 3BW6A 3OCNA 3DBAA 2EWVA 2OOLA 4HH2A 3F1PA 4R70A 4KQOA 4ARZA 4EETB 3KSIA 3V67A 4KQDA 3T4LA 2XSSA 3T50A 3EWKA 5L8MA 2W3DA 4CLCA 3LUQA 1XJ4A 3S7NA 1TS7A 1GSVA 2XA7M 3RFBA 3PBRA 3PR6A 3BQAA 1TS6A 1P0ZA 3S7OA 4EUVA 2I9VA 2O0YA 4MN6A 4PKYG 4EEPA 2PYRA 3C2WA 1NRJA 4I39A 4EXOA 1UWPX 2B02A 3H7WB 1YKDA 3KX0X 5AJGA 3LIBA 2EA9A 5HWTA 5HDDA 1OT6A 4AFIA 1LSXA 3F1NB 4FSFA 2W1RA 3IBRA 3LYXA 4JGQA 1N9NA 2QJ5A 5KSHA 4OOLA 2O9AA 3CITA 1H3QA 1S4RA 1T1AA 3LR4A 2O9CA 1P97A 4GHIA 3B47A 2XROA 2JHEA 3FG8A 3TE8A 1Y28A 3EEAA 1OTEA 3UB8A 3FC7A 4I38A 3NHQA 1DP8A 4GS9A 4Q0JA 1YSPA 2W1TA 1GSXA 2D02A 4JGPA 4HNBA 4BBTA 4F3LA 4I3AA 1WA9A 4GLQA 3CAXA 2KLIA 1JNUA 3CUEA 2B18A 3F1OB 2L0WA 4Y5FA 2P04A 3BY9A 4M4XA 4CLCC 2XA7S 2W3GA 4HHDA 3RTYA 4B9OA 3R7WB 4KUOA 5HWWA 4DJ2A 3MJQA 4GCZA 1N9OA 2GJ3A 3T4OA 1OT9A 3FPVA 1MZUA 5TJJA 3D72A 3IS2A 2JKRI 2ZMFA 3VOLA 3C30A 4LLOB 4NXGA 4Q0HA 3OBFA 3LR0A 4UQIM 3C8CA 2PYPA 5TBMA 2PDRA 3KO6A 5J4EA 3SW1A 3ULFA 4IUKA 4HP4A 2JKTI 4LPZA 2NUTC 1TS8A 3A0VA 1YAXA 4G3WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3H9W A;  4JGR A;  5KIZ A;  3MQO A;  1V9Y A;  2D01 A;  2YKF A;  4XT2 B;  2QKP A;  1DP6 A;  3LI9 A;  5HWV A;  1EW0 A;  3P7N A;  2ZOH A;  5F68 A;  3UMD A;  4EER A;  2INW A;  2K7S A;  4WUJ A;  1OJG A;  5J3W A;  1VB6 A;  5HD3 A;  4HI4 A;  5AVF A;  1ODV A;  1UWN X;  5HSQ A;  2VLG A;  3MR0 A;  3F1P B;  3MQQ A;  4BBU A;  4WL9 A;  2Z6D A;  1D7E A;  3H7W A;  4LRZ E;  1T1B A;  3F1N A;  1OTI A;  3LIC A;  3B33 A;  2L4R A;  4H6J B;  2QWS A;  3E4P A;  3LIA A;  1OTA A;  5J7E A;  3VE4 A;  5IU1 A;  1G28 A;  2QJ7 A;  4R3A A;  5HDS A;  5HDC A;  4EEU A;  2HV1 A;  5HD5 A;  3BWL A;  3NOT C;  4R38 A;  3MFX A;  3ICY A;  3LID A;  1LSV A;  4WN5 A;  3UME A;  4HQA A;  4HH3 A;  2P7J A;  2QHK A;  3F1O A;  1S4S A;  3UB9 A;  1S66 L;  1OTB A;  2A24 A;  4NXB A;  4GS9 B;  3PYP A;  1DP9 A;  4EES A;  4L9G A;  1XFN A;  3A0S A;  1F9I A;  2OWJ A;  3G6O A;  1KOU A;  2W0N A;  1XFQ A;  4BBV A;  3K3C A;  1S67 L;  3NOU C;  5EFW A;  1T1C A;  4EW7 A;  2PR5 A;  4XT2 A;  3H82 A;  2VV6 A;  4HJ4 A;  1T19 A;  3ZQ5 A;  2J80 A;  4HIA A;  2PD8 A;  2BAS A;  4HOI A;  1N9L A;  4WF0 A;  4I3I A;  2V0W A;  1D06 A;  1BYW A;  4LRY C;  4E04 A;  2Z6C A;  3UB6 A;  3CWF A;  2V0U A;  1S1Y A;  3MXQ A;  5F69 A;  1OJ5 A;  1XJ2 A;  4RQ9 A;  3RH8 B;  2V1A A;  4PKY A;  4WLA A;  4R6L A;  3EEH A;  4I3J A;  1T18 A;  2PR6 A;  2WKR A;  4L9E A;  2ZOI A;  4HJ6 A;  2YKH A;  2KX6 A;  4H6J A;  2L1M A;  3HJI A;  3LI8 A;  3LIF A;  1LT0 A;  1UGU A;  5AVE A;  2OWH A;  3BY8 A;  2VV8 A;  4MN5 A;  1LSW A;  4NXE A;  4DJ3 A;  2KDK A;  2V1B A;  5DJU A;  3OLO A;  3NJA A;  2R78 A;  2JN7 A;  1DRM A;  3HJK A;  4HP9 A;  1V9Z A;  3LIE A;  2VEA A;  4GHI B;  2PD7 A;  5I5L A;  2WKQ A;  5DJT A;  5G4Z A;  4EQ1 A;  1LL8 A;  1NWZ A;  4YWZ A;  4K08 A;  2CMN A;  3UE6 A;  5HZH A;  3E4Q A;  4HY8 A;  4F3L B;  2WKP A;  5F5Y A;  4L9F A;  2A24 B;  4HJ3 A;  2VV7 A;  5DKK A;  3VE3 A;  2ZBB A;  1X0O A;  2M1C A;  3IS2 B;  3K3D A;  5DKL A;  2V9A A;  3E4O A;  1OTD A;  1GSW A;  3A0R A;  4JGO A;  1S1Z A;  4KUK A;  5TBM B;  1TS0 A;  3PHY A;  5F6A A;  3NOP C;  4I5S A;  1F98 A;  3CLO A;  4NXF A;  1XJ6 A;  2W27 A;  5A8B A;  3H82 B;  4LRX C;  4GW9 A;  2H28 A;  5G4Y A;  3GEC A;  2PHY A;  3UB7 A;  3GDI A;  1XJ3 A;  2OOL A;  4HH2 A;  3F1P A;  4R70 A;  4EET B;  4KQD A;  3T50 A;  3EWK A;  3LUQ A;  1XJ4 A;  1TS7 A;  1GSV A;  1TS6 A;  1P0Z A;  2I9V A;  4MN6 A;  4PKY G;  4EEP A;  2PYR A;  3C2W A;  4I39 A;  4EXO A;  1UWP X;  2B02 A;  3H7W B;  3KX0 X;  3LIB A;  2EA9 A;  5HWT A;  5HDD A;  1OT6 A;  1LSX A;  3F1N B;  3IBR A;  3LYX A;  4JGQ A;  1N9N A;  2QJ5 A;  1S4R A;  1T1A A;  1P97 A;  4GHI A;  2JHE A;  3FG8 A;  1Y28 A;  1OTE A;  3UB8 A;  3FC7 A;  4I38 A;  3NHQ A;  1DP8 A;  4GS9 A;  1GSX A;  2D02 A;  4JGP A;  4HNB A;  4BBT A;  4F3L A;  4I3A A;  1WA9 A;  3CAX A;  1JNU A;  3F1O B;  2L0W A;  3BY9 A;  4M4X A;  4HHD A;  3RTY A;  4B9O A;  4KUO A;  5HWW A;  4DJ2 A;  3MJQ A;  4GCZ A;  1N9O A;  2GJ3 A;  1OT9 A;  1MZU A;  3D72 A;  3IS2 A;  3VOL A;  4LLO B;  4NXG A;  3C8C A;  2PYP A;  5TBM A;  2PDR A;  5J4E A;  3SW1 A;  3ULF A;  4HP4 A;  4LPZ A;  1TS8 A;  3A0V A;  5IS1 A; 
#chains in the Genus database with same CATH topology
 2A3U A;  4UA7 A;  1KVM A;  3LR5 A;  5KIZ A;  3A3F A;  1O07 A;  1V9Y A;  3VP3 A;  3V5M A;  5BOH A;  2HF6 A;  2KOI A;  4DDS A;  1DP6 A;  1BUL A;  1EW0 A;  4K0W A;  4JPM A;  2ZOH A;  3S7Q A;  4GJ4 A;  5GLD A;  3MSH A;  1P9W A;  3UMD A;  1G5U A;  4JXV A;  5A91 A;  3BFC A;  3S4X A;  1VB6 A;  4H8R A;  5AVF A;  1ODV A;  3CUE C;  4P6B A;  4ZJ2 A;  5EVI B;  3N8S A;  1HLU P;  3MR0 A;  2VKS A;  3F1P B;  2EFU A;  3MQQ A;  4PM8 A;  4Y7P A;  1OME A;  1D7E A;  3H7W A;  3ZYT A;  2Y8H A;  2E8I A;  1T1B A;  1GHP A;  4KG5 A;  4UQI S;  1NY0 A;  1Y4O A;  3F1N A;  4YFM A;  4LV3 A;  4DRT A;  1JWV A;  4KZ3 A;  4BMW A;  5IT5 A;  3B33 A;  2QMI A;  3MQ0 A;  3E2K A;  2WKE A;  3ZVW A;  2QWS A;  5JYP A;  3VP4 A;  2HZ5 A;  3DW0 A;  3VE4 A;  3IXB A;  3G35 A;  4X6T A;  4IUH A;  4R4R A;  1W63 Q;  2HDS A;  4OLD A;  4ZAM A;  4S2N A;  1ZHH B;  1L0E A;  4S2O A;  5HDC A;  3NOT C;  1K54 A;  5KZH A;  2H10 A;  4X55 A;  4PPR A;  3T1S A;  3IXD A;  3UME A;  2P7J A;  1PWD A;  1S4S A;  4LV2 A;  3UB9 A;  1NYY A;  3DAV A;  1ONH A;  1FQG A;  1MXO A;  4EWF A;  4E3N A;  4EES A;  1CEF A;  1MC0 A;  1KGG A;  4ZRR A;  3U4L P;  3OPH A;  4S2M A;  1XFN A;  4LFU A;  3IXH A;  4CLC D;  2EX8 A;  4GOG A;  5HPF A;  3MKE A;  2W0N A;  2M7V A;  1XFQ A;  2HDR A;  3G32 A;  3PBQ A;  5EFW A;  3BJN A;  5DFX A;  1HVB A;  3G2Z A;  4QY5 A;  1I2W A;  3FV7 A;  4MN7 A;  4JF5 A;  4HIA A;  5KMW A;  2G2W A;  1XGI A;  3OPL A;  2ZM2 A;  1N9L A;  1J3W A;  5IHV A;  3LFV A;  1XX2 A;  4I3I A;  1K4F A;  1PW1 A;  4GD6 A;  4QU3 A;  1FR6 A;  2V8F A;  3KSH A;  1H8M A;  4QD4 A;  1MPL A;  4KZ4 A;  1ZG4 A;  5FSR A;  1ESI A;  1NZU A;  4KQR A;  1FCM A;  4P6Z S;  2V0U A;  4MLL A;  3LCE A;  1XJ2 A;  2OSU A;  4ID4 A;  3BYD A;  4YOF A;  3OOV A;  2WKH A;  2PR6 A;  4L9E A;  2ZOI A;  4IED A;  4DE3 A;  5FEG A;  1STZ A;  3UE0 A;  4ETZ A;  1VEU B;  4H6J A;  2HDU A;  4NKP A;  1PW8 A;  4YNR A;  3GTC A;  1VET A;  1K4E A;  3TRC A;  1IYO A;  2PBD P;  3EQU A;  2J9O A;  5FI2 A;  2RCX A;  2ZC3 B;  5CEB A;  4ZBE A;  3HUO A;  5GL9 A;  4PM6 A;  2KDK A;  4UA6 A;  4GDN A;  5F83 A;  3O88 A;  5DJU A;  2ZC5 B;  3OLO A;  3N6I A;  5CEC A;  5DVA A;  4UHU A;  2JN7 A;  3CI6 A;  3KYQ A;  2ZQ9 A;  1SDE A;  3HRE A;  3RXX A;  3LY3 A;  4KZA A;  4GHI B;  2PD7 A;  2XFS A;  3D3O A;  5DF9 A;  2K2N A;  5G4Z A;  4YWZ A;  1F5M A;  4DN0 A;  2CC1 A;  4R4S A;  4LCM A;  4JF6 A;  3C7U A;  3PXP A;  2ZD8 A;  3W2Z A;  2P9V B;  3O86 A;  4GDB A;  3M6H A;  1YLY A;  4NEE D;  2JKR M;  1PI4 A;  3ZFZ A;  1FIK A;  3EOI A;  2XGN A;  3HUN A;  3D9Y A;  1ALQ A;  2EX9 A;  3UY6 A;  1JTD A;  2ZBB A;  1W5D A;  4WYY A;  3BLM A;  1X0O A;  2HJ9 C;  3BFF A;  1S1Z A;  4EUZ A;  4Y0T A;  3HBR A;  4KUK A;  4MCW A;  4I5S A;  3UE1 A;  3MF0 A;  2J3T C;  2W27 A;  4IJG A;  1HZO A;  5TFQ A;  3TJZ C;  4GW9 A;  1YLJ A;  2R9W A;  5G4Y A;  3GEC A;  1XPB A;  1Q2Q A;  3NCK A;  1KDS A;  3MZE A;  4S2K A;  4HH2 A;  4GKU A;  4ARZ A;  1LI9 A;  5AQA A;  4HEF A;  1PI5 A;  2XSS A;  3O87 A;  4XUX A;  4CLC A;  3LUQ A;  1TS7 A;  1GSV A;  2XA7 M;  2JE5 A;  3RFB A;  3PBR A;  3BQA A;  1TS6 A;  4EUV A;  4JXW A;  2O0Y A;  1QME A;  2UWX A;  2PYR A;  4N92 A;  3C2W A;  1K38 A;  2GDN A;  1LI0 A;  2B02 A;  4A5R A;  3LO7 A;  3LIB A;  4JKT A;  5HWT A;  4FSF A;  4LGW A;  5KSH A;  4OOL A;  4KZ6 A;  1NRF A;  3CIT A;  1L0F A;  2WK0 A;  1S4R A;  3LR4 A;  2O9C A;  1P97 A;  5D3O A;  3IHB A;  3HLW A;  1L2S A;  2ZLY A;  5EM0 A;  1OTE A;  4P85 A;  5E2F A;  2ZL1 B;  3HLC A;  4Q0J A;  4B4Z A;  1GSX A;  4HNB A;  1FOF A;  4FD8 A;  3UN7 A;  4IBR A;  3HLB A;  1K57 A;  2KLI A;  1TVF A;  2Y2P A;  5EVL A;  1RGZ A;  4Y5F A;  3N8R A;  3C4O A;  1N9O A;  1DJA A;  1FSW A;  1OT9 A;  3CPT B;  3OZH A;  3C30 A;  3DTI A;  3LEZ A;  3E2L A;  4JXG A;  3C8C A;  5CHJ A;  2EXA A;  4HBU A;  5M19 A;  1K6R A;  4IUK A;  1BZA A;  4LPZ A;  1TS8 A;  3L7H A;  4Y15 A;  3MQO A;  3QHY A;  2YKF A;  4XT2 B;  2QKP A;  3JVU A;  2Y2O A;  3LI9 A;  3ZNY A;  1K6S A;  3P7N A;  4Q8I A;  3PBS A;  3VFF A;  1M6K A;  3QP6 A;  3WRT A;  4WUJ A;  5HD3 A;  5L07 A;  1UWN X;  2VJW A;  5HSQ A;  1IEL A;  1W8Q A;  2O99 A;  1E3U D;  4DDY A;  1E25 A;  2PU2 A;  3P09 A;  4OVD A;  1NZO A;  1ERO A;  3JPU A;  5EOE A;  2EFX A;  1K55 A;  4GD8 A;  5FI7 A;  5MC7 A;  3O5Y A;  5CED A;  2VGJ A;  3A3J A;  5FI6 A;  3E4P A;  3EQV A;  3KSF A;  3LIA A;  4Y13 A;  1OTA A;  5J7E A;  2W3E A;  3IH9 A;  5CHU A;  5DFY A;  1PZP A;  3HLD A;  5IU1 A;  1G28 A;  5F1F A;  1XA1 A;  2QJ7 A;  4R3A A;  5HDS A;  3UO9 A;  4EEU A;  2HV1 A;  2WGV A;  3UDF A;  3Q81 A;  3LID A;  4HQA A;  2VZW A;  2HP6 A;  2HJE A;  3IWO A;  5FDS A;  2ZM8 A;  3A3D A;  3IXG A;  4NET A;  4PAU A;  1VM1 A;  2VGL M;  3DTM A;  5CX7 A;  2UV0 E;  4L0L A;  1H5X A;  3VSL A;  2EXB A;  3IF5 A;  3A0S A;  4ESP A;  3V3S A;  1TD5 A;  4WEL A;  2FFF B;  4DE0 A;  5F1G A;  1KOU A;  3EGX C;  1NXY A;  4LEN A;  2OV5 A;  3DTK A;  5J8X A;  3A3I A;  4LV0 A;  2V2F F;  3GSG A;  5EV0 A;  1T1C A;  2V1Z A;  2XF3 A;  3G30 A;  3UDI A;  2XFT A;  2G2U A;  1PNE A;  1FIL A;  4S2N C;  4U3T A;  4G3K A;  1YSQ A;  2WAF A;  3NIA A;  2OAP 1;  1W7F A;  4OOY A;  3BEB A;  5DTS A;  1K54 C;  2FZ0 A;  3VOZ A;  4BLM A;  4D2O A;  3G2Y A;  3MS6 A;  4WEJ A;  1QMF A;  5HW3 A;  1KE3 A;  5FAO A;  2V0W A;  4LRY C;  1LHY A;  3C38 A;  3PAE A;  3UB6 A;  2DCF A;  1TDL A;  5E2E A;  1WE4 A;  3MBZ A;  3VP1 A;  2Y2M A;  3HCY A;  3RH8 B;  4PM9 A;  4PKY A;  1CQA A;  4DE1 A;  4OQG A;  3EEH A;  3GR2 A;  1T18 A;  4OQI A;  5FA7 A;  2H5S A;  1DJC A;  1SHV A;  3SS5 A;  5GLB A;  4MBH A;  1IYQ A;  4IHQ A;  3LI8 A;  2ACG A;  4Z9Q A;  1TEM A;  5AVE A;  2Z2M B;  1BT5 A;  2DRW A;  2VV8 A;  4II7 A;  2XQZ A;  3ZNT A;  3S22 A;  1LSW A;  4Y2F A;  5FL3 A;  1XGJ A;  2V8C A;  2V1B A;  3SH9 A;  4O8G A;  1DRM A;  3HJK A;  4HP9 A;  1WYB A;  4BD0 A;  2VEA A;  1MBL A;  4PM5 A;  1YLW A;  1J9M A;  3W8K A;  4P0M A;  4KZ5 A;  1LL8 A;  2HPB A;  2QZ6 A;  4DE2 A;  4R3B A;  1E3U A;  4K08 A;  2CMN A;  3UE6 A;  1ZG6 A;  3NBL A;  2BG1 A;  2IWB A;  4F3L B;  1HTZ A;  2WZZ A;  2Y2N A;  5CER A;  2Q9N A;  2NUP C;  1PZO A;  3UPP A;  3EGD C;  2J9P A;  1MWT A;  3VE3 A;  1SKO A;  4XUZ A;  1PWC A;  2PU4 A;  3L9K A;  1VQQ A;  4JF4 A;  2M1C A;  3WS0 A;  1CF0 A;  3IS2 B;  2JKF A;  3ZVT A;  4RA7 A;  2Y91 A;  4G3V A;  2V9A A;  4BJP A;  1KVL A;  1GSW A;  2W3H A;  3CZD A;  3NY4 A;  3LY4 A;  4PM7 A;  5E2H A;  5FQQ A;  4QPR A;  1L3L A;  5A8B A;  3T1Q B;  1IOU A;  3BM6 A;  2H28 A;  5A92 A;  3QNB A;  5AQB A;  2WUQ A;  2EWV A;  1ESU A;  2OOL A;  3ZDJ A;  4KQO A;  5G18 A;  3UPO A;  4KQD A;  4UA9 A;  2PAV P;  3IH8 A;  5I94 A;  1N9B A;  5L8M A;  2P74 A;  2XK1 A;  3M2K A;  2Y2I A;  3KYE A;  4PKY G;  5GLA A;  4E3O A;  4EBN A;  2XR0 A;  5F82 A;  4MNR A;  4EXO A;  1IYP A;  3H7W B;  2ZQ8 A;  2EA9 A;  1KE4 A;  5EM1 A;  3ZG7 B;  3N7W A;  3F1N B;  2W1R A;  5GLC A;  3V3R A;  1ZC2 A;  1F2K A;  1T1A A;  2ZM0 A;  2B5R A;  3CMZ A;  2XRO A;  3ZG8 B;  3MZD A;  4U0T A;  3FG8 A;  3TE8 A;  3Q7V A;  2RL3 A;  3FC7 A;  4I38 A;  3QP2 A;  3NHQ A;  1YSP A;  2W1T A;  5A90 A;  4BBT A;  4KZ8 A;  2ZMA A;  2C6W B;  4GLQ A;  1L0G A;  3VOY A;  4M3K A;  4MEZ A;  2P04 A;  3BY9 A;  5EVI D;  2XA7 S;  4CLC C;  1E4D A;  4DJ2 A;  4GCZ A;  2GJ3 A;  3FPV A;  5TJJ A;  3D72 A;  5GHY A;  2JKR I;  2ZMF A;  4HES A;  4LLO B;  2WGW A;  1XP4 A;  4N1H A;  1SCW A;  3CHW P;  3VFH A;  5M18 A;  5TBM A;  4E3I A;  3KO6 A;  1ES3 A;  5J4E A;  4C3Q A;  4HP4 A;  1SKO B;  2JKT I;  2NUT C;  1YAX A;  2X71 A;  1ZKJ A;  3HLE A;  4JGR A;  2D01 A;  1ES4 A;  4GB7 A;  2Y2K A;  3W4Q A;  5HWV A;  4ZJ1 A;  2IWC A;  1CEG A;  4WMC D;  2PRF A;  4WZ5 C;  4KQQ A;  5F68 A;  1ACF A;  1G6O A;  4PHT A;  3C7V A;  2K7S A;  3UB5 P;  2XLN A;  5J3W A;  3NEC A;  3BFG A;  4HI4 A;  3T4K A;  1K57 C;  1DJB A;  3FKV A;  1O7E A;  3IT9 A;  3QP8 A;  1PRQ A;  3IF6 A;  4OON A;  2MJ6 A;  1W79 A;  5KSC A;  5EEC A;  2XDM A;  3U2A A;  4RVA A;  3WS4 A;  2OLU A;  4WL9 A;  2Z6D A;  4LRZ E;  3MFD A;  2R9X A;  2Y2Q A;  2H0T A;  4ZDX A;  1H0M A;  3K2N A;  3GV9 A;  3LIC A;  2L4R A;  4H6J B;  3WS2 A;  4Z1W A;  4Q0I A;  1VET B;  1MWR A;  3SS4 A;  5FQI A;  3QP1 A;  3VV4 A;  3WRZ A;  1YQS A;  5HD5 A;  1IYS A;  4E3J A;  3IQA A;  4R38 A;  1G68 A;  5FQK A;  4FCF A;  1ES5 A;  4OP8 A;  4P87 A;  2LB9 A;  4HH3 A;  3F1O A;  5EUA A;  1VHM A;  1WYC A;  1S66 L;  1ERM A;  1RGY A;  4YIN A;  5IS1 A;  4Y0O A;  1GHI A;  1BLP A;  4L9G A;  1GHM A;  3SH8 A;  3AGF A;  2ZQ7 A;  1JWZ A;  1FR1 A;  1K55 C;  3G6O A;  4C75 A;  4BBV A;  2PBY A;  4WBG A;  5C5K A;  1S67 L;  3M2J A;  4CJN A;  2FH5 A;  1RCJ A;  2Y59 A;  2G7U A;  2AVX A;  2PR5 A;  3SH7 A;  3RJU A;  3H82 A;  2VV6 A;  1EI5 A;  1T19 A;  1LLB A;  3ZQ5 A;  2W3F A;  4PMA A;  4ETX A;  2J80 A;  3CG5 A;  2PD8 A;  1MKM A;  4B88 A;  2BAS A;  3OCL A;  4E3K A;  4MBF A;  3E98 A;  4X56 A;  2Y2H A;  5HPI A;  4GNU A;  5CXW A;  1Z09 A;  4CLC E;  3DTE A;  5DF7 A;  1BYW A;  4B93 A;  2Z6C A;  3BFE A;  2X02 A;  5EVI A;  5FAT A;  2VGL S;  1BUE A;  1S1Y A;  3MXQ A;  5F69 A;  1OJ5 A;  4EV4 A;  5EOO A;  4QY6 A;  1FCN A;  1K25 A;  1YM1 A;  2V1A A;  4N9K A;  4ARZ B;  5L10 A;  4I3J A;  2ZC6 B;  4EU0 A;  5AQ9 A;  1IKI A;  1BLS A;  4CLC B;  2YKH A;  1LL5 A;  4KEN B;  2EX2 A;  3PBO A;  3IBJ A;  4K0X A;  2JCH A;  2KX6 A;  2Y2G A;  3HJI A;  4R3J A;  4RX2 A;  2XD1 A;  1EWZ A;  4S2I A;  4FTX A;  3I7J A;  3LIF A;  3WS5 A;  1LT0 A;  1Q2P A;  2OLV A;  4MBK A;  1UGU A;  2OWH A;  1M40 A;  1IKG A;  2C5W B;  4MN5 A;  4NXE A;  4DJ3 A;  2OAQ 1;  4WMC A;  3T4T A;  2R78 A;  4O01 A;  3AGD A;  2XRN A;  1V9Z A;  3LIE A;  2Y79 A;  4N9L A;  3ZG9 B;  5GHZ A;  5HX9 A;  3JYI A;  3R7W A;  5DJT A;  1AWI A;  3KYZ A;  4EQ1 A;  1PFL A;  3E4Q A;  3UDX A;  3UE3 A;  4HY8 A;  4N1X A;  2B95 A;  3VP0 A;  4E3M A;  4OP5 A;  5F5Y A;  3VSK A;  3Q1F A;  4L9F A;  5EE8 A;  2ZQA A;  4HJ3 A;  5E2G A;  4X25 A;  4EBP A;  4X69 A;  2A2L A;  3G4P A;  3IWI A;  1YLT A;  1CK3 A;  3K3D A;  1BLC A;  5FAP A;  3E4O A;  1OTD A;  3BLS A;  3BEC A;  2Y2L A;  4F94 A;  5AQ7 A;  3V50 A;  2HGV A;  3T1X A;  1PIO A;  3PHY A;  3DWK A;  4DXC A;  4X1L A;  3CLO A;  3SOI A;  4JXS A;  3H82 B;  5FQ9 A;  3UB7 A;  3W4P A;  3MKF A;  3G34 A;  1CI9 A;  4KZ7 A;  3DBA A;  4OH0 A;  1MY8 A;  2ZQD A;  4OPY A;  1KGE A;  4R70 A;  5TGF A;  4EET B;  3V67 A;  5A93 A;  1BLH A;  3T50 A;  2W3D A;  4LV1 A;  1CI8 A;  1XJ4 A;  3S7N A;  1VEU A;  3GVB A;  1PYY A;  3IX4 A;  4OQH A;  2IWD A;  2XH9 A;  3PR6 A;  4BEN A;  4QJG A;  2I9V A;  3DWZ A;  1XKZ A;  5HAQ A;  4EEP A;  1MWS A;  3VMA A;  4D60 A;  1NRJ A;  3GMW A;  3HUM A;  4I39 A;  3KX0 X;  3HLG A;  5HDD A;  1OT6 A;  4B4X A;  1JWP A;  4AFI A;  1LSX A;  2VK3 A;  1U60 A;  3LYX A;  1N9N A;  2QJ5 A;  3P98 A;  1KDW A;  3NI9 A;  5CHM A;  4GHI A;  3S1Y A;  4EBL A;  3B47 A;  1K56 D;  2JHE A;  1Y28 A;  3EEA A;  1DP8 A;  4GS9 A;  3ZCZ A;  2BLS A;  2D02 A;  2J7V A;  4JGP A;  3HLF A;  4R0Q A;  2P9V A;  1WA9 A;  4OKP A;  3CAX A;  3CUE A;  2ZC4 B;  3BRM A;  3UPN A;  2QPN A;  2L0W A;  4M4X A;  5CTN A;  2W3G A;  3RTY A;  2WKI A;  3R7W B;  2Y4A A;  3LEQ A;  3OPP A;  3WS1 A;  3T4O A;  4E6X A;  1YPR A;  3C4P A;  3FKW A;  1LL9 A;  4Q0H A;  4CPK A;  4DF6 A;  4IBX A;  3LR0 A;  4S2P A;  5JYO A;  4UQI M;  2J8Y A;  2PYP A;  4IVI A;  2PDR A;  4O7D A;  3SW1 A;  1NJ4 A;  3ULF A;  3TSG A;  4NK3 A;  1MWU A;  3A0V A;  4G3W A;  1A0K A;  3H9W A;  2IA2 A;  4UEY A;  4X53 A;  1XXM A;  3ZG0 A;  2P08 A;  2J3T D;  4EER A;  5CRF A;  1MKI A;  4OPQ A;  2INW A;  2M7U A;  2VA0 A;  4FOF A;  1OJG A;  5HL1 A;  5HAR A;  2Q9M A;  2VLG A;  1H8Z A;  2I72 A;  1XA7 A;  5HAI A;  2JKG A;  1L0D A;  1FCO A;  3N8L A;  2HP5 A;  1PWG A;  3A3E A;  4BBU A;  1IFQ A;  3ZG5 A;  2EX6 A;  2V20 A;  1YLZ A;  1ZTU A;  3OC2 A;  4E6W A;  5CGS A;  4NG2 A;  5GHX A;  2EWW A;  1OTI A;  4BWI A;  3PAG A;  2QYB A;  1OPX A;  3R4K A;  1ES2 A;  4E3L A;  5HFO A;  2ZC7 A;  3NDE A;  1TDG A;  4DKI A;  1NYM A;  4X1M A;  2JC7 A;  2ZL1 A;  4ZTK A;  2VX8 A;  3BWL A;  4OPR A;  4JLF A;  4OOM A;  3MFX A;  3ICY A;  2O9B A;  1LSV A;  3PBN A;  4WN5 A;  2QHK A;  1YMS A;  2ZJ9 A;  3T4S A;  1OTB A;  2DMW A;  2A24 A;  1I2S A;  1IEM A;  4NXB A;  4P6Z M;  3OPR A;  3IF6 C;  4Y17 A;  3TG9 A;  4GS9 B;  2K31 A;  3PYP A;  1DP9 A;  3CPT A;  5E43 A;  2PT7 A;  3HL9 A;  4OPZ A;  3AGE A;  1F9I A;  2HP9 A;  2OWJ A;  3FPW A;  4S2L A;  5FAS A;  3N4I A;  5LBR A;  3CJM A;  2Q0O A;  3K3C A;  5L2F A;  1KGF A;  3NOU C;  5DF8 A;  1C3B A;  2JKT M;  4EW7 A;  4XT2 A;  1NLY A;  2VGK A;  4HJ4 A;  3FWL A;  2J3W A;  1W8Y A;  3WWX A;  5EVE A;  3UNW A;  1K56 A;  5FQJ A;  4GN2 A;  4FH2 A;  4CQH A;  2DNS A;  2XEP A;  4HOI A;  4WF0 A;  1NLZ A;  5FEF A;  3M6B A;  2WZX A;  3NUL A;  3G31 A;  1JVJ A;  1D06 A;  4E04 A;  1SKF A;  4MDZ A;  3CWF A;  2GNX A;  2LB5 A;  4RQ9 A;  3BFD A;  3MZF A;  3O3V A;  4O0P A;  2E8J A;  3V39 A;  2ZMV A;  4R6L A;  4WLA A;  3BQ8 A;  2WKR A;  4HBT A;  4HJ6 A;  4KG2 A;  3D4F A;  4JBF A;  5U47 A;  2FFY A;  3LR3 A;  3W4O A;  3T4J A;  3MXR A;  4WM9 A;  2L1M A;  3ITB A;  2WYX A;  3RXW A;  1CJF A;  2X01 A;  4BL2 A;  4Y0U A;  3MMH A;  4S2J A;  3BY8 A;  3S7P A;  3HVF A;  4RX3 A;  4WZ4 A;  2H0Y A;  3NJA A;  2BTF P;  4BD1 A;  4BQM A;  3TW8 A;  1S0W A;  3B3X A;  3QNC A;  4WZ5 A;  5FDH A;  3T12 B;  2HDQ A;  5I5L A;  3T4Q A;  2WKQ A;  1W63 M;  1TF1 A;  3Q7V B;  3NDG A;  1NWZ A;  3TOI A;  3QP4 A;  1BSG A;  3GRJ A;  5EVI C;  2W1T B;  3B42 A;  4ME4 A;  4X68 A;  5HZH A;  4U0X A;  1K0K A;  2WKP A;  1P9R A;  3C5A A;  3NC8 A;  3VP2 A;  3JVV A;  1I5Q A;  4Y3I A;  2ZQC A;  2A24 B;  1G6A A;  2VV7 A;  5DKK A;  4MMN A;  5K5B A;  3Q7Z A;  4XXR A;  3SZT A;  3Q07 A;  4DMZ A;  2GX5 A;  1DY6 A;  5DKL A;  2WGW B;  2GZA A;  3P01 A;  5HAP A;  3A0R A;  3E0Y A;  4JGO A;  4GZB A;  4K91 A;  2JBF A;  1JTG A;  5TBM B;  1TS0 A;  1H8Y A;  5F6A A;  4LCL A;  4FH4 A;  3NOP C;  4EQI A;  4R23 A;  3LGO A;  3PBT A;  1F98 A;  4NXF A;  3KSG A;  4C6Y A;  2Y55 A;  1XJ6 A;  1GA9 A;  1N4O A;  1AXB A;  5M1A A;  4LRX C;  1YT4 A;  1BTL A;  2PHY A;  5HL6 A;  4RYE A;  3GDI A;  4FUW A;  1XJ3 A;  3BW6 A;  3OCN A;  1ERQ A;  1GCE A;  1SZV A;  4BL3 A;  3IHA A;  3F1P A;  4QWO A;  3KSI A;  4IVK A;  3ISG A;  3PTE A;  1KE0 A;  3T4L A;  3T1R A;  3EWK A;  4KZB A;  3IF6 B;  1P0Z A;  3QP5 A;  3S7O A;  5EPH A;  1ONG A;  4MN6 A;  2WAE A;  4QB8 A;  3GQZ A;  1UWP X;  1YKD A;  5AJG A;  2A49 A;  2WGI A;  3ZGA B;  1YLP A;  3IBR A;  4JGQ A;  3ZHH A;  2O9A A;  3MXS A;  1H3Q A;  3Q82 A;  5L09 A;  4QHC A;  4ZJ3 A;  4OQ0 A;  4KZ9 A;  3UB8 A;  1SDN A;  5CTM A;  5FAQ A;  2WAD A;  5CGW A;  1Y54 A;  4F3L A;  4I3A A;  1D1J A;  4UAA A;  1JNU A;  5DTT A;  2B18 A;  1YMX A;  3F1O B;  5DTK A;  5TR7 A;  4HHD A;  1Z6F A;  4B9O A;  4KUO A;  5HWW A;  3MJQ A;  1FSY A;  3FYZ A;  3FZC A;  3SS3 A;  1S6R A;  1MZU A;  3IS2 A;  3IX8 A;  3VOL A;  1GA0 A;  1HD8 A;  4NXG A;  2XD5 A;  2Z2L B;  5CGX A;  2Y2J A;  3OBF A;  1RP5 A;  3IX3 A;  3ITA A;  3IWQ A;  4OLG A;  4DXB A;  4R1G A;  5FQM A;  4KG6 A;  4WEK A; 
#chains in the Genus database with same CATH homology
 3H9W A;  2IA2 A;  3LR5 A;  4JGR A;  5KIZ A;  3MQO A;  1V9Y A;  4UEY A;  2D01 A;  2YKF A;  4XT2 B;  2HF6 A;  2KOI A;  2QKP A;  3JVU A;  1DP6 A;  3LI9 A;  5HWV A;  1EW0 A;  3P7N A;  3PBS A;  2ZOH A;  3S7Q A;  4GJ4 A;  5F68 A;  2P08 A;  1G6O A;  2J3T D;  1P9W A;  4PHT A;  3UMD A;  4EER A;  2INW A;  2K7S A;  2M7U A;  2VA0 A;  4WUJ A;  4FOF A;  1OJG A;  5J3W A;  1VB6 A;  5HD3 A;  4HI4 A;  5AVF A;  3T4K A;  1ODV A;  1UWN X;  3CUE C;  2VJW A;  5HSQ A;  2VLG A;  2O99 A;  2MJ6 A;  3U2A A;  3MR0 A;  2VKS A;  3F1P B;  3MQQ A;  4BBU A;  1IFQ A;  4WEK A;  4WL9 A;  2Z6D A;  1D7E A;  3H7W A;  4LRZ E;  3ZYT A;  2Y8H A;  1ZTU A;  3OC2 A;  1T1B A;  5MC7 A;  4UQI S;  3F1N A;  2EWW A;  1OTI A;  3K2N A;  3LIC A;  3O5Y A;  4BMW A;  5IT5 A;  4BWI A;  3B33 A;  2L4R A;  4H6J B;  3MQ0 A;  2QYB A;  2QWS A;  3EQV A;  3KSF A;  3E4P A;  1OPX A;  4Z1W A;  3R4K A;  3LIA A;  1OTA A;  4Q0I A;  5J7E A;  2W3E A;  5DFY A;  3VE4 A;  4IUH A;  1W63 Q;  3VV4 A;  1ZHH B;  5IU1 A;  1G28 A;  2QJ7 A;  4R3A A;  5HDS A;  2VX8 A;  5HDC A;  4EEU A;  2HV1 A;  5HD5 A;  3BWL A;  3NOT C;  4OOM A;  4R38 A;  3MFX A;  3ICY A;  2O9B A;  3LID A;  1LSV A;  3PBN A;  4WN5 A;  3UME A;  4HQA A;  2LB9 A;  2VZW A;  4HH3 A;  2P7J A;  2QHK A;  2HJE A;  3F1O A;  1S4S A;  3UB9 A;  1VHM A;  3T4S A;  1S66 L;  1OTB A;  2DMW A;  4PAU A;  2A24 A;  5IS1 A;  4NXB A;  4P6Z M;  2VGL M;  4GS9 B;  2K31 A;  3PYP A;  1DP9 A;  5CX7 A;  4EES A;  4L0L A;  1MC0 A;  4ZRR A;  4L9G A;  2PT7 A;  1XFN A;  3A0S A;  1F9I A;  4CLC D;  1TD5 A;  4WEL A;  2OWJ A;  3FPW A;  5LBR A;  5HPF A;  3G6O A;  1KOU A;  3EGX C;  2W0N A;  2M7V A;  1XFQ A;  4BBV A;  3K3C A;  5C5K A;  1S67 L;  3NOU C;  2FH5 A;  3PBQ A;  5EFW A;  1T1C A;  2JKT M;  2G7U A;  4EW7 A;  3BJN A;  5DFX A;  2PR5 A;  4XT2 A;  1NLY A;  3H82 A;  2VV6 A;  4HJ4 A;  1T19 A;  2J3W A;  3ZQ5 A;  2W3F A;  4ETX A;  4MN7 A;  2J80 A;  4HIA A;  2PD8 A;  4G3K A;  1YSQ A;  1MKM A;  2OAP 1;  4CQH A;  2BAS A;  3OCL A;  4HOI A;  1N9L A;  4WF0 A;  2FZ0 A;  1NLZ A;  3E98 A;  3LFV A;  4I3I A;  5HPI A;  4WEJ A;  2V0W A;  1D06 A;  3KSH A;  4CLC E;  1H8M A;  1BYW A;  4LRY C;  4B93 A;  4E04 A;  2Z6C A;  4MDZ A;  3C38 A;  3UB6 A;  4P6Z S;  2VGL S;  3CWF A;  2V0U A;  1S1Y A;  3MXQ A;  5F69 A;  1OJ5 A;  1XJ2 A;  2GNX A;  2LB5 A;  3HCY A;  4RQ9 A;  3RH8 B;  2V1A A;  4O0P A;  4PKY A;  4YOF A;  4ARZ B;  2ZMV A;  3OOV A;  4R6L A;  4WLA A;  3BQ8 A;  3EEH A;  4I3J A;  1T18 A;  2PR6 A;  2WKR A;  4L9E A;  2ZOI A;  4HJ6 A;  4EU0 A;  1STZ A;  4CLC B;  2YKH A;  4ETZ A;  3LR3 A;  3PBO A;  3IBJ A;  2KX6 A;  3T4J A;  4H6J A;  2L1M A;  4NKP A;  3HJI A;  4YNR A;  4IHQ A;  3LI8 A;  3TRC A;  3MMH A;  3EQU A;  3LIF A;  1LT0 A;  1UGU A;  5AVE A;  2OWH A;  3BY8 A;  3S7P A;  2VV8 A;  4II7 A;  4MN5 A;  1LSW A;  4NXE A;  4Y2F A;  2KDK A;  5FL3 A;  4DJ3 A;  2OAQ 1;  2V1B A;  5DJU A;  3OLO A;  3T4T A;  3NJA A;  2R78 A;  4O01 A;  3TW8 A;  2JN7 A;  3CI6 A;  4O8G A;  3KYQ A;  1DRM A;  3HJK A;  2XRN A;  4HP9 A;  1V9Z A;  3LIE A;  2Y79 A;  2VEA A;  4GHI B;  2PD7 A;  3D3O A;  5DF9 A;  5I5L A;  3R7W A;  3T4Q A;  2WKQ A;  1W63 M;  2K2N A;  5DJT A;  1TF1 A;  5G4Z A;  3KYZ A;  4EQ1 A;  1LL8 A;  1NWZ A;  4YWZ A;  1F5M A;  4DN0 A;  2W1T B;  3B42 A;  4K08 A;  2CMN A;  4ME4 A;  3UE6 A;  5HZH A;  3E4Q A;  3PXP A;  3UE3 A;  3W2Z A;  4HY8 A;  4F3L B;  2WKP A;  4NEE D;  1P9R A;  2JKR M;  2NUP C;  5F5Y A;  3JVV A;  3EOI A;  4Y3I A;  4L9F A;  3EGD C;  2A24 B;  4HJ3 A;  2VV7 A;  5DKK A;  3VE3 A;  4MMN A;  5K5B A;  2ZBB A;  2A2L A;  1X0O A;  2M1C A;  4DMZ A;  3IS2 B;  3K3D A;  2GX5 A;  2HJ9 C;  5DKL A;  4G3V A;  2GZA A;  2V9A A;  3E4O A;  4BJP A;  1OTD A;  3P01 A;  1GSW A;  2W3H A;  3A0R A;  3E0Y A;  4JGO A;  1S1Z A;  2HGV A;  4KUK A;  5TBM B;  1TS0 A;  3PHY A;  5F6A A;  4MCW A;  3NOP C;  4I5S A;  3PBT A;  3MF0 A;  1F98 A;  3CLO A;  4NXF A;  4QPR A;  3KSG A;  2J3T C;  1XJ6 A;  2W27 A;  4IJG A;  5A8B A;  3H82 B;  4LRX C;  3TJZ C;  4GW9 A;  1IOU A;  2H28 A;  5G4Y A;  3GEC A;  2PHY A;  3UB7 A;  5HL6 A;  3GDI A;  1XJ3 A;  3BW6 A;  3OCN A;  3DBA A;  2EWV A;  2OOL A;  4HH2 A;  3F1P A;  4R70 A;  4KQO A;  4ARZ A;  4EET B;  3KSI A;  3V67 A;  4KQD A;  3T4L A;  2XSS A;  3T50 A;  3EWK A;  5L8M A;  2W3D A;  4CLC A;  3LUQ A;  1XJ4 A;  3S7N A;  1TS7 A;  1GSV A;  2XA7 M;  3RFB A;  3PBR A;  3PR6 A;  3BQA A;  1TS6 A;  1P0Z A;  3S7O A;  4EUV A;  2I9V A;  2O0Y A;  4MN6 A;  4PKY G;  4EEP A;  2PYR A;  3C2W A;  1NRJ A;  4I39 A;  4EXO A;  1UWP X;  2B02 A;  3H7W B;  1YKD A;  3KX0 X;  5AJG A;  3LIB A;  2EA9 A;  5HWT A;  5HDD A;  1OT6 A;  4AFI A;  1LSX A;  3F1N B;  4FSF A;  2W1R A;  3IBR A;  3LYX A;  4JGQ A;  1N9N A;  2QJ5 A;  5KSH A;  4OOL A;  2O9A A;  3CIT A;  1H3Q A;  1S4R A;  1T1A A;  3LR4 A;  2O9C A;  1P97 A;  4GHI A;  3B47 A;  2XRO A;  2JHE A;  3FG8 A;  3TE8 A;  1Y28 A;  3EEA A;  1OTE A;  3UB8 A;  3FC7 A;  4I38 A;  3NHQ A;  1DP8 A;  4GS9 A;  4Q0J A;  1YSP A;  2W1T A;  1GSX A;  2D02 A;  4JGP A;  4HNB A;  4BBT A;  4F3L A;  4I3A A;  1WA9 A;  4GLQ A;  3CAX A;  2KLI A;  1JNU A;  3CUE A;  2B18 A;  3F1O B;  2L0W A;  4Y5F A;  2P04 A;  3BY9 A;  4M4X A;  4CLC C;  2XA7 S;  2W3G A;  4HHD A;  3RTY A;  4B9O A;  3R7W B;  4KUO A;  5HWW A;  4DJ2 A;  3MJQ A;  4GCZ A;  1N9O A;  2GJ3 A;  3T4O A;  1OT9 A;  3FPV A;  1MZU A;  5TJJ A;  3D72 A;  3IS2 A;  2JKR I;  2ZMF A;  3VOL A;  3C30 A;  4LLO B;  4NXG A;  4Q0H A;  3OBF A;  3LR0 A;  4UQI M;  3C8C A;  2PYP A;  5TBM A;  2PDR A;  3KO6 A;  5J4E A;  3SW1 A;  3ULF A;  4IUK A;  4HP4 A;  2JKT I;  4LPZ A;  2NUT C;  1TS8 A;  3A0V A;  1YAX A;  4G3W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...