4MN7A

Structural and biochemical analysis of type ii free methionine-r-sulfoxide reductase from thermoplasma acidophilum
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
148
structure length
148
Chain Sequence
b'MDLKEFARSQMQAACQYLKEKNPKYDWVGFYVLEHGKLKLEAFVGEKTDHVEINLGDGLCSLAVLKNDIVNEYDVKSNPKYLASFPSTQSEIVVPVRYQGEPIGEIDIDSDKKAAFSKEDEAMLSSIADLMAPLVHEFFVKLEHHHHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative uncharacterized protein Ta0848
publication title Structural and biochemical analysis of a type II free methionine-R-sulfoxide reductase from Thermoplasma acidophilum
pubmed doi rcsb
source organism Thermoplasma acidophilum
molecule tags Oxidoreductase
total genus 45
structure length 148
sequence length 148
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13185 GAF_2 GAF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.40 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4mn7A00
2W1RA 2ZMFA 2M7UA 2XRNA 4GLQA 2W3EA 3KSHA 4FOFA 2XROA 2VJWA 3MMHA 2K31A 4O0PA 3R4KA 3KSGA 3LFVA 4Q0JA 4RQ9A 1TF1A 3TRCA 2W1TA 5HSQA 1YSPA 4BWIA 2Y8HA 2W3GA 2HGVA 4ETXA 3E98A 2IA2A 4R6LA 3HCYA 4Y2FA 5HPIA 2XSSA 2K2NA 5HL6A 1YSQA 3S7NA 5LBRA 3ZQ5A 4EUVA 4G3WA 1YKDA 3KSIA 3IBRA 4DMZA 2O9BA 4IUHA 1F5MA 2W3FA 3MQ0A 3E0YA 4Y3IA 5DFXA 4ZRRA 2LB9A 4YOFA 2OOLA 3K2NA 4MCWA 4MDZA 2KOIA 3NOUC 5I5LA 4PAUA 1STZA 5K5BA 4YNRA 5DFYA 3DBAA 2W3DA 3OBFA 4LRXC 3S7OA 2O99A 2G7UA 4IUKA 3NOTC 3D3OA 3KO6A 2O0YA 4ETZA 4LRZE 1TD5A 5AJGA 4IJGA 3S7PA 2O9CA 1ZTUA 3BJNA 3G6OA 2W3HA 2W1TB 1MKMA 5TJJA 4Y5FA 2KLIA 3C2WA 3O5YA 2B18A 2VEAA 3S7QA 3VV4A 3OOVA 4Z1WA 4DN0A 4ME4A 4LRYC 5C5KA 4O01A 4G3KA 4EU0A 2Y79A 4O8GA 3MF0A 4R70A 2LB5A 3CITA 3W2ZA 5HPFA 4MMNA 2VKSA 1VHMA 3IBJA 2GX5A 2O9AA 4E04A 3RFBA 2QYBA 4Q0HA 2M7VA 4GW9A 2VZWA 3NOPC 4CQHA 4QPRA 3CI6A 3KSFA 5L8MA 4G3VA 3NHQA 4Q0IA 4MN7A 3EEAA 1MC0A
chains in the Genus database with same CATH superfamily
2W1RA 1UWNX 3OPLA 5CGXA 1UWPX 5FDHA 4OPQA 5EFWA 1OT9A 2Y59A 4MBFA 4X55A 1H3QA 3CUEC 1XP4A 3MR0A 3BYDA 3U4LP 1IELA 3KSGA 4S2MA 1CI9A 3I7JA 3ITBA 1TS6A 3T4SA 3T4OA 2HP5A 3EQUA 4UAAA 1XJ3A 2V0UA 2WGIA 5JYPA 3MQ0A 4S2NA 1HTZA 4MLLA 1PYYA 1K54C 1BSGA 2KOIA 4E3MA 5L07A 4R3AA 1NYYA 3IT9A 4C3QA 2R9WA 1L0GA 1G6AA 1I2WA 3BJNA 4QY5A 2HDSA 3M6HA 4IVKA 1K56A 3LI8A 2QMIA 4UQIM 3HLDA 2J3TC 2ZMVA 4PM8A 1VETB 5AQAA 3SS4A 3EOIA 3V50A 1F98A 4XUXA 4JLFA 1TS0A 3W4OA 3VSKA 2O9AA 2D02A 2INWA 1K56D 3BRMA 1NYMA 3MXRA 3UE3A 2WADA 4Y7PA 4EUZA 3IWIA 4D2OA 2EX2A 5HX9A 5CECA 4FD8A 1IOUA 5G18A 3ZG0A 3LR4A 1Q2QA 3QNBA 2QJ5A 3NIAA 2PYRA 3IWOA 2PBYA 5HDSA 1M40A 4UQIS 4LFUA 4R6LA 3LUQA 3O87A 4EW7A 2Y55A 3P98A 3H82B 1S1YA 3HVFA 4G3WA 2B02A 4DMZA 5TBMA 3MBZA 4EEUA 2ACGA 5CHMA 4RA7A 1K38A 5DTTA 1X0OA 4HH3A 4YNRA 2GNXA 3G4PA 2ZLYA 2VK3A 4GHIA 5HWWA 5TR7A 5FA7A 3KO6A 4I39A 3UPOA 4UA7A 5EVIC 4U3TA 3VOLA 4JPMA 5EECA 1OMEA 3BFEA 5HD3A 2EWVA 3UO9A 4HESA 2KLIA 4WLAA 3BFGA 3UB8A 3CJMA 3MF0A 1V9ZA 3Q82A 2YKHA 5F68A 4MNRA 3OPRA 4ESPA 2NUTC 3GVBA 4RX3A 2ZD8A 2Q0OA 1H8YA 1KVLA 1ZG4A 4X25A 2ZC4B 1S6RA 4KQRA 4OOMA 4EV4A 5EVLA 5HDCA 3UPNA 2JC7A 5HL1A 2H28A 1H5XA 2P08A 2IWCA 4Y15A 1EW0A 4JKTA 4QJGA 4P87A 3MFDA 4OQIA 3LFVA 1PWCA 2W1TA 4S2LA 1G6OA 4LV3A 3HLGA 4BBVA 5EVEA 1HZOA 5A8BA 3UB6A 4BL2A 2O9BA 3DW0A 3UB7A 4ZBEA 4CJNA 3S4XA 4GS9B 4KZ4A 1ZG6A 1G5UA 1XKZA 3BQ8A 1L2SA 3SZTA 4FCFA 2C6WB 3HJKA 4M4XA 2AVXA 4HBTA 3FWLA 1EROA 4HJ3A 4KZ3A 5FQMA 1T1CA 3PBQA 5DJTA 5CRFA 1MWTA 1OT6A 2DNSA 4RX2A 2I9VA 2ZOHA 3WS4A 4LRYC 3DTEA 4O8GA 4R70A 3VSLA 3IX4A 1NLYA 5CEDA 1W5DA 5FEFA 3BFCA 3SH7A 4QY6A 2ZBBA 1DP6A 3N8SA 3VP0A 4GN2A 3BECA 3TE8A 1KOUA 3TG9A 4QPRA 3VOZA 4R0QA 1U60A 2J9OA 2P9VB 3T4LA 1NRJA 2B95A 3HLEA 4X68A 3E2LA 4X69A 2EXAA 4OOYA 4X56A 1GSXA 5CXWA 5KMWA 2Y2OA 2ZMAA 2ZM8A 4WELA 4HBUA 3O88A 5FAOA 2PBDP 4EBLA 3G35A 3IXBA 4KUOA 4S2KA 4KG2A 3WS0A 2JKRI 5DF8A 4JF4A 5HD5A 4R4RA 1K57A 3G32A 3HL9A 2WZZA 1PZPA 2JCHA 3T12B 2VLGA 1ODVA 4Y3IA 3SOIA 5F5YA 2BLSA 5GLDA 1W63M 3DBAA 4E3IA 1IKGA 2WKHA 2A49A 1LL9A 3H7WB 1OTIA 2ZL1B 4QHCA 1TS8A 4JXVA 3B42A 3ZVTA 3KYQA 3V3SA 2Y2NA 2HPBA 4FH4A 1TDGA 1ZKJA 2B18A 3VV4A 2D01A 4R1GA 1GSWA 4QWOA 3MZDA 3OPHA 4PKYG 2LB5A 3F1NA 2A24B 4KZBA 5HAIA 2ZJ9A 4E3OA 3F1PB 4L9FA 1G28A 1T18A 3V3RA 1I5QA 1WE4A 1OPXA 3UY6A 3LCEA 1NZOA 3ISGA 5I94A 3W4PA 4E6WA 2ZQ8A 3LEZA 4DE3A 5CHUA 2OWJA 5EM1A 3SH8A 3G2ZA 3MKEA 2JKTI 4GLQA 2W3EA 3MMHA 3PAGA 3H82A 2A3UA 4EWFA 2H10A 2JE5A 3S22A 3VP1A 5D3OA 1WA9A 4N9LA 1JWZA 4Q8IA 1ESIA 4Y2FA 5L10A 1KVMA 2EA9A 4S2IA 2K2NA 4ZAMA 3DTIA 1D1JA 4OLGA 5J7EA 4HH2A 3RH8B 4GJ4A 1YKDA 2QJ7A 5DVAA 3O86A 2JBFA 4KZ5A 4YWZA 3W8KA 1YT4A 4Y17A 2Y2LA 2ZM2A 4GDBA 4MDZA 3IF6B 3BQAA 2PDRA 5IHVA 5AVEA 1T19A 3MZFA 3FG8A 1YLJA 5EV0A 1Y28A 3BW6A 4II7A 3CMZA 3ZYTA 5G4ZA 2HDQA 4PMAA 2JN7A 2W1TB 3LGOA 3BLSA 3IS2B 2PRFA 3LY3A 4DN0A 1S4RA 4ZJ1A 2CC1A 2WKRA 3IHBA 1OTDA 2Z6CA 5HPFA 2VKSA 3HREA 2H5SA 5HW3A 3AGFA 4OPRA 1K6SA 3UE1A 3OPPA 1A0KA 3BY8A 3B3XA 5BOHA 1ACFA 1MC0A 1XX2A 4NXGA 2VGKA 4EQIA 1ERMA 1H8MA 3PBNA 5GL9A 1C3BA 4FTXA 5DJUA 2WKPA 4WN5A 3NCKA 5CGWA 5GLAA 2H0YA 1YLZA 3C8CA 3MZEA 2Y8HA 4ZTKA 5HFOA 4GS9A 4PM5A 5HL6A 4LV2A 1TDLA 4IVIA 3S7NA 2WKQA 2IWDA 2EXBA 2V8FA 3IXHA 3KSIA 2EX9A 2E8IA 3IF5A 5A92A 2OAQ1 4YOFA 2W27A 3K2NA 4L9EA 4PAUA 1FQGA 2W3DA 4JXWA 1LI9A 5HAQA 2QWSA 4IUKA 5JYOA 1AXBA 4F3LB 4FUWA 4HI4A 4B93A 1AWIA 3S7PA 1Y54A 4K0XA 4LV0A 4ID4A 3NBLA 4OPZA 4O7DA 1XJ4A 1SKFA 4KZ9A 4PHTA 4U0XA 3UE0A 2J3WA 3RXXA 2Y79A 5F6AA 3HLWA 2IWBA 3UNWA 3HJIA 2WGVA 2P9VA 2L1MA 4QD4A 3GMWA 4KQOA 2GX5A 1YLTA 4GD6A 4GW9A 2VZWA 4EBNA 2PR6A 4A5RA 3L9KA 1S4SA 1ALQA 4WZ5A 4BD1A 5FATA 1TVFA 4PM6A 5FSRA 1VEUB 3BWLA 4HJ4A 4HIAA 1OTEA 2V20A 2XD5A 2VJWA 2L0WA 1CJFA 5HWVA 5AQBA 4LENA 1MKIA 1DJCA 3PBOA 3F1NB 4R4SA 2W3GA 5DKKA 3T4TA 3Q81A 2OV5A 1V9YA 3N8RA 3G31A 1F2KA 4E6XA 3IX8A 4JXGA 1W63Q 3H7WA 1DJAA 3MFXA 5TGFA 2ZL1A 1GCEA 4ZRRA 3GQZA 2HV1A 3HUNA 3NECA 3MQOA 5I5LA 4KQDA 2H0TA 1XFNA 2QKPA 3NOTC 2WAEA 3D9YA 2ZC3B 2PYPA 3G6OA 3NI9A 2W3HA 2BG1A 4NXBA 2A24A 3FV7A 2QPNA 4BBUA 3F1PA 1XFQA 1LHYA 1XA7A 2VEAA 1XA1A 2JHEA 4ME4A 2HDUA 1SZVA 2Z2MB 2M1CA 4B4XA 2WGWB 3LIDA 4X6TA 1VHMA 4EESA 4KZ7A 4KZ8A 1ERQA 3T4JA 4Q0HA 1E25A 1HLUP 2ZQ7A 3VMAA 4P6ZM 3SH9A 3K3DA 4Q0IA 3T50A 1JTGA 3QP4A 3NJAA 3C5AA 3QP5A 3EEAA 1NZUA 1CQAA 3O3VA 3IH8A 1LSVA 1YLYA 4N92A 3D4FA 4FOFA 2XROA 1XGIA 1L0FA 5EVIB 1N9LA 2HF6A 2W0NA 2WKIA 5EUAA 4N1HA 1WYCA 4OVDA 1YMSA 1GHPA 2Q9MA 4ETXA 1NXYA 1H8ZA 4LV1A 2XSSA 3JVVA 1YSQA 3IF6A 3ZQ5A 1PW8A 4I38A 1CI8A 4Z9QA 1F5MA 1D06A 5M1AA 4CLCB 2EX6A 4P6ZS 5L2FA 3WRTA 3OBFA 2HJEA 3WS2A 3IS2A 5KSCA 3M2KA 4GB7A 5AJGA 1W7FA 3HUOA 4X1LA 2O9CA 5HWTA 2WUQA 1BT5A 2PU2A 3G30A 4JXSA 3C4PA 3IH9A 1ES4A 3FZCA 1S67L 3PBRA 1KGGA 1KE4A 3OLOA 3MS6A 3DTKA 1ESUA 4IBRA 5E2HA 4DDSA 4OP5A 5GLCA 4E04A 2HDRA 1P9WA 3B33A 4GOGA 3CI6A 4S2NC 2FFYA 4LLOB 4ZJ2A 3PR6A 4MN7A 3RTYA 3C38A 1CF0A 3FPVA 2KDKA 1BZAA 1JWPA 1L0EA 3E4QA 3LEQA 1KDWA 1PNEA 1FCOA 4N1XA 4M3KA 3A3IA 2KX6A 2ZQ9A 1YSPA 4GDNA 1K55A 4NEED 3HBRA 1W8QA 1D7EA 2V0WA 4X1MA 3QHYA 4HHDA 5FQIA 1LSWA 4DXCA 1T1AA 3OCLA 3BFFA 4F3LA 4ZDXA 3H9WA 2P74A 3UB9A 3UMEA 3UMDA 1K4EA 3R7WB 1MWRA 2OOLA 4DJ2A 4HP9A 2ZQDA 1PW1A 2Y2JA 5L09A 3NC8A 3ZFZA 2WAFA 1O7EA 5J4EA 2EX8A 1JNUA 3HLBA 4BL3A 2Y2QA 3EEHA 3A0SA 4OONA 3C2WA 3UDFA 3P01A 5CTMA 5C5KA 2V9AA 1YLWA 1RGYA 4G3KA 3A3JA 3CITA 2RCXA 4LCLA 1M6KA 4UA9A 3KYEA 1VEUA 3FC7A 4RYEA 1T1BA 5FQKA 1K54A 2X71A 2ZC6B 4LGWA 1ES2A 2EFUA 4IHQA 2XA7M 4WBGA 3GRJA 5FEGA 3JVUA 4HNBA 4R23A 1IYSA 4NK3A 4DJ3A 3IHAA 1LI0A 3ULFA 1LLBA 1N9OA 3AGEA 2G2WA 1BTLA 2FZ0A 2ZC5B 4KZAA 1SHVA 2DRWA 1TS7A 2ZOIA 2C5WB 1KDSA 1TEMA 5EOEA 5IU1A 1DY6A 2GDNA 4D60A 3C4OA 2CMNA 3LIFA 1Z6FA 1G68A 3LIAA 3WRZA 3A3FA 1IFQA 3SW1A 2J3TD 1BLSA 2K7SA 1PZOA 3FPWA 4MBHA 1STZA 2XA7S 2BTFP 3WS5A 3PBTA 4UA6A 1KE0A 4KENB 1GHMA 3V67A 1EWZA 5AQ7A 5FI7A 1FCNA 3LO7A 4PM7A 4B88A 4YINA 5CGSA 1MKMA 2WGWA 5IS1A 3NDEA 4Y5FA 2PHYA 4OPYA 1VQQA 5EPHA 2PD8A 4NKPA 2OWHA 2XD1A 3NY4A 4WZ4A 3GDIA 1PWDA 4EU0A 3G2YA 4CLCE 4DRTA 4MMNA 3QNCA 4MEZA 5HDDA 3HUMA 1CEGA 3A0RA 1PRQA 4S2PA 5GHYA 1O07A 3ZVWA 5HAPA 3EGDC 3NOPC 3LR3A 4DE2A 5FQJA 3VP4A 1NLZA 4UHUA 3NHQA 3GECA 5EVIA 5DF7A 2OLUA 4WL9A 1HD8A 4PPRA 4B9OA 3T1XA 4S2OA 2XEPA 4E3NA 2WKEA 2M7UA 4IBXA 3M2JA 4EBPA 4L9GA 5EM0A 3OZHA 4KQQA 2V1BA 1LT0A 3FYZA 5EVID 3CG5A 3VFHA 1TF1A 1J9MA 4OLDA 2HGVA 2HP9A 4CLCA 5DKLA 3UPPA 4CPKA 4OOLA 3WS1A 3HLCA 4I5SA 4C75A 3MQQA 4WMCA 3QP6A 4GKUA 1IYOA 2Z6DA 3IBRA 1GA9A 1PIOA 1SKOB 1W8YA 3T4QA 4OP8A 1ZC2A 1NWZA 1PI5A 3NULA 4CLCD 2J7VA 2HP6A 3Q07A 2PAVP 5HARA 3A0VA 1OJ5A 4WMCD 3Q7VB 2VV6A 1L3LA 3UDXA 1TD5A 1GA0A 4ZJ3A 3QP2A 4HOIA 3BEBA 4XUZA 1K25A 3LY4A 4BENA 3GSGA 3TW8A 1OJGA 3MXQA 3VE3A 5E43A 4BQMA 3ZGAB 3ZCZA 4DDYA 4Z1WA 1L0DA 3PBSA 2XR0A 3ZG5A 3IBJA 1K57C 1K6RA 1WYBA 5E2GA 2M7VA 1IYQA 5FASA 5F82A 5CERA 4G3VA 3CLOA 3CPTA 1FSWA 1FR6A 5F1GA 1MBLA 1GHIA 5AQ9A 1FSYA 3F1OA 4R38A 4OH0A 1CK3A 3RJUA 4DE1A 5HSQA 4BWIA 1OTAA 4WF0A 5DF9A 3MJQA 2IA2A 3IWQA 3R7WA 3HCYA 3VP3A 2ZC7A 3UB5P 2WK0A 2P04A 4EUVA 3MSHA 4R3JA 2W3FA 5DFXA 3N4IA 3DAVA 3B47A 5DTKA 3S7OA 4GD8A 1JTDA 3VP2A 3KX0X 1XPBA 3ZNTA 2Y2HA 4DXBA 1W79A 3N6IA 2HJ9C 4NXEA 1FOFA 2VA0A 3KYZA 1BLPA 2XLNA 2EFXA 5TJJA 1Y4OA 3PYPA 5J3WA 3CHWP 1DRMA 4I3AA 3TOIA 3ZNYA 4UEYA 4XT2A 3K3CA 5DTSA 1N4OA 2I72A 3IXDA 3LIBA 2PR5A 2V8CA 5GHXA 3VE4A 1QMEA 5GLBA 1YMXA 3N7WA 5FQ9A 2Z2LB 5G4YA 5CTNA 3PTEA 3P09A 3KSFA 4B4ZA 3TJZC 1YPRA 2XDMA 2Y2KA 1VB6A 4EEPA 2XQZA 2XGNA 2NUPC 1MZUA 1DJBA 1E3UA 2DMWA 2OLVA 3BM6A 3PXPA 5U47A 3KSHA 3JYIA 2FFFB 4KUKA 5CHJA 1KGEA 4XXRA 3LR5A 4RQ9A 1Q2PA 4FH2A 1E3UD 3V5MA 3RXWA 2VV8A 2VGJA 3E98A 3EQVA 2J80A 5HPIA 1BLHA 4JBFA 5LBRA 2Y2GA 4BLMA 4K0WA 4IUHA 3LI9A 4WEKA 4P85A 4WEJA 5F1FA 5FI6A 2MJ6A 2Q9NA 3D72A 2Y2IA 3OC2A 4CLCC 2O0YA 1BUEA 3LIEA 4LRZE 4Y0OA 2QHKA 4IJGA 5FAPA 3DWZA 3NDGA 3V39A 1ZTUA 3OCNA 5FL3A 1YAXA 2R78A 4DF6A 1LL5A 1XXMA 4YFMA 3LICA 1BULA 5M19A 4R3BA 1E4DA 3O5YA 1VM1A 4ARZB 4O01A 1IKIA 3ZG7B 2Y2MA 4DKIA 4MN6A 1MWUA 4OQHA 4WUJA 4P6BA 1SCWA 1RP5A 1CEFA 4IEDA 3ZG8B 1BYWA 3ICYA 5CEBA 2PD7A 3EGXC 2ZM0A 4FSFA 4L0LA 1FILA 1XJ6A 3T1RA 1F9IA 1FCMA 2XK1A 2JKGA 2P7JA 5E2FA 1ES3A 2G2UA 2J9PA 2XRNA 2V1AA 4OQ0A 2XF3A 5FI2A 2R9XA 4JF5A 1MPLA 4Y0TA 1JWVA 1SKOA 2VGLM 3A3DA 4WYYA 3MXSA 3DTMA 2VV7A 4JGQA 4MN5A 3EWKA 1NRFA 4GNUA 2Y91A 3Q7VA 2J8YA 5KIZA 4H6JA 3CPTB 2LB9A 2Y2PA 3Q7ZA 4GZBA 2WYXA 1XGJA 5F83A 3NOUC 3T4KA 3CWFA 2O99A 2G7UA 4WZ5C 3F1OB 3FKVA 2WZXA 5A90A 2JKFA 4EETB 3GTCA 2PU4A 3QP8A 2XH9A 3T1QB 1XJ2A 4HQAA 2UV0E 1ZHHB 1GSVA 5EOOA 4H8RA 3S7QA 4OQGA 1MY8A 4JGPA 4I3IA 3LR0A 5FDSA 4LCMA 4BJPA 5KZHA 4HY8A 2VGLS 2GZAA 1RGZA 5F69A 1EI5A 4N9KA 1J3WA 1NJ4A 2EWWA 1I2SA 4P0MA 3MKFA 3CUEA 5EE8A 4HJ6A 4JGOA 1FR1A 2QYBA 3TSGA 2QZ6A 3A3EA 2XFSA 3DWKA 4GCZA 4BBTA 1LL8A 2OAP1 4Y0UA 3E2KA 2ZMFA 1N9NA 1PFLA 3UE6A 3N8LA 5A91A 1ES5A 3ZDJA 2K31A 3P7NA 1K0KA 4O0PA 4XT2B 4X53A 4Q0JA 4KZ6A 3UDIA 3C7VA 3UN7A 4NG2A 3CZDA 5J8XA 3BY9A 2V1ZA 4NXFA 2X01A 4DE0A 3VFFA 1MWSA 4KG5A 1VETA 1PI4A 4E3JA 2B5RA 3BLMA 3G34A 4NETA 1DP9A 3W4QA 2VX8A 3AGDA 3BFDA 1NY0A 3IQAA 4MCWA 1IEMA 2JKRM 5K5BA 2OSUA 1OTBA 4Y13A 3IX3A 1KGFA 1SDEA 5M18A 1UGUA 1IYPA 4ETZA 5TBMB 4KG6A 1P97A 1ONHA 3SS5A 4E3KA 4F94A 1HVBA 3FKWA 4GHIB 5FAQA 2ZQCA 1FIKA 4C6YA 1S0WA 5E2EA 3GV9A 1SDNA 3IF6C 3ZG9B 5GHZA 2V2FF 4CQHA 2A2LA 5IT5A 5L8MA 1YLPA 1KE3A 3WWXA 1RCJA 2HZ5A 3U2AA 5CX7A 3PHYA 2DCFA 1P0ZA 3M6BA 1PWGA 4QB8A 4JGRA 5MC7A 4HP4A 4BMWA 2XFTA 3R4KA 4K91A 4S2JA 1JVJA 3E4OA 3TRCA 3GR2A 2GJ3A 2YKFA 1K4FA 1DP8A 3SS3A 4E3LA 2JKTM 5KSHA 3JPUA 3QP1A 3IXGA 1YQSA 3E0YA 1P9RA 4JF6A 1BLCA 3C7UA 3ZHHA 5DFYA 3L7HA 1YM1A 4LRXC 3T1SA 2ZQAA 2UWXA 3PAEA 3D3OA 3E4PA 4RVAA 4QU3A 2X02A 4LPZA 4ARZA 2FH5A 3C30A 3HLFA 5AVFA 2Y4AA 4WM9A 1Z09A 3CAXA 4HEFA 3S1YA 3OOVA 3LYXA 4EERA 4K08A 2L4RA 2PT7A 4OKPA 1K55C 4AFIA 4MBKA 4I3JA 1H0MA 1S66L 3W2ZA 4H6JB 3VOYA 1LSXA 1QMFA 1N9BA 4U0TA 5TFQA 5FQQA 4EQ1A 4PKYA 5A93A 1ONGA 5HZHA 2RL3A 3RFBA 4EXOA 4BD0A 1MXOA 4PM9A 2BASA 1S1ZA 2E8JA 3ITAA 3Q1FA
chains in the Genus database with same CATH topology
2KDKA 2W1RA 1UWNX 3PXPA 3E4QA 1UWPX 2JKTI 4GLQA 5EFWA 2W3EA 1OT9A 3KSHA 4KUKA 3MMHA 1H3QA 3CUEC 3MR0A 3H82A 3KSGA 3LR5A 4RQ9A 2KX6A 1YSPA 4NEED 1TS6A 3T4SA 2VV8A 3T4OA 1WA9A 1D7EA 2J80A 3E98A 3EQVA 3EQUA 4Y2FA 2V0WA 5HPIA 1XJ3A 2EA9A 2V0UA 2K2NA 4HHDA 1LSWA 5LBRA 5J7EA 1T1AA 4HH2A 3RH8B 4GJ4A 1YKDA 3OCLA 2QJ7A 4F3LA 4IUHA 3LI9A 3MQ0A 4WEKA 3H9WA 4YWZA 3UB9A 3UMEA 3UMDA 4WEJA 3R7WB 2OOLA 4MDZA 4DJ2A 2KOIA 4HP9A 3BQAA 2PDRA 2MJ6A 5AVEA 1T19A 3D72A 3OC2A 4CLCC 3FG8A 2O0YA 3LIEA 4LRZE 4R3AA 2QHKA 1Y28A 4IJGA 3BW6A 4II7A 5J4EA 1ZTUA 3OCNA 5G4ZA 3ZYTA 3BJNA 5FL3A 1YAXA 2R78A 1JNUA 2JN7A 2W1TB 3LICA 3EEHA 3IS2B 3A0SA 3C2WA 3LI8A 3O5YA 3P01A 4DN0A 4UQIM 1S4RA 5C5KA 4ARZB 2V9AA 2J3TC 2ZMVA 4O01A 4G3KA 2WKRA 4MN6A 3EOIA 1OTDA 2Z6CA 3CITA 4WUJA 1F98A 5HPFA 2VKSA 1TS0A 2O9AA 2D02A 1BYWA 2INWA 3ICYA 3FC7A 1T1BA 2PD7A 3EGXC 3UE3A 3BY8A 4FSFA 4L0LA 4IHQA 2XA7M 3JVUA 1XJ6A 4HNBA 1MC0A 1F9IA 4DJ3A 4NXGA 3ULFA 1H8MA 1N9OA 3PBNA 2P7JA 1IOUA 5DJUA 2FZ0A 2WKPA 3LR4A 2XRNA 2V1AA 2QJ5A 4WN5A 1TS7A 2ZOIA 2PYRA 5IU1A 5HDSA 3C8CA 2Y8HA 2VGLM 4UQIS 2CMNA 4R6LA 3LUQA 4GS9A 2VV7A 4JGQA 4EW7A 3LIFA 4MN5A 3EWKA 5HL6A 3S7NA 3H82B 2WKQA 1S1YA 3LIAA 4G3WA 3KSIA 2B02A 4DMZA 5KIZA 1IFQA 4H6JA 5TBMA 4EEUA 3SW1A 2J3TD 2K7SA 2OAQ1 2LB9A 4YOFA 2W27A 1X0OA 3K2NA 3FPWA 3NOUC 4L9EA 4PAUA 1STZA 3T4KA 4HH3A 4YNRA 2GNXA 2W3DA 2XA7S 2QWSA 3CWFA 2O99A 2G7UA 4IUKA 4GHIA 5HWWA 3KO6A 4I39A 3PBTA 4F3LB 3F1OB 4HI4A 3V67A 4B93A 3VOLA 3S7PA 4EETB 1XJ2A 1MKMA 5HD3A 2EWVA 4HQAA 5IS1A 1XJ4A 4Y5FA 2PHYA 1ZHHB 2KLIA 1GSVA 3S7QA 4JGPA 4WLAA 4I3IA 3LR0A 2PD8A 4NKPA 2OWHA 4PHTA 3UB8A 4BJPA 3GDIA 4HY8A 2VGLS 2J3WA 4EU0A 2Y79A 3MF0A 5F6AA 4CLCE 3HJIA 2GZAA 1V9ZA 5F69A 2YKHA 5F68A 4MMNA 2L1MA 5HDDA 2EWWA 3A0RA 4KQOA 2GX5A 3CUEA 2NUTC 4HJ6A 4JGOA 2QYBA 4GW9A 2VZWA 3EGDC 3NOPC 2PR6A 3LR3A 1S4SA 1NLZA 4GCZA 3NHQA 4BBTA 1LL8A 3GECA 4WL9A 2OAP1 3BWLA 4HJ4A 4OOMA 4B9OA 4HIAA 1OTEA 2ZMFA 5HDCA 1N9NA 3UE6A 2M7UA 2H28A 4L9GA 2P08A 1EW0A 2VJWA 2L0WA 1LT0A 2V1BA 2K31A 3P7NA 4O0PA 4XT2B 5HWVA 3LFVA 4Q0JA 1TF1A 2W1TA 3PBOA 3F1NB 2W3GA 1G6OA 2HGVA 5DKKA 3T4TA 4CLCA 5DKLA 4OOLA 3BY9A 1V9YA 4NXFA 4I5SA 4BBVA 3MQQA 5A8BA 3UB6A 2Z6DA 3IBRA 2O9BA 1W63Q 3UB7A 3H7WA 3T4QA 3MFXA 4ZRRA 1DP9A 2VX8A 4GS9B 1NWZA 2HV1A 4CLCD 4MCWA 2JKRM 3MQOA 5I5LA 5K5BA 1OTBA 3BQ8A 3A0VA 4KQDA 1OJ5A 1XFNA 2QKPA 3NOTC 1UGUA 2VV6A 3HJKA 4ETZA 4M4XA 5TBMB 1TD5A 1P97A 4HJ3A 2PYPA 4HOIA 3G6OA 2W3HA 1T1CA 3PBQA 4NXBA 5DJTA 2A24A 3TW8A 1OT6A 1OJGA 4BBUA 3F1PA 3MXQA 4GHIB 3VE3A 1XFQA 2I9VA 2VEAA 4Z1WA 2JHEA 2ZOHA 4ME4A 4LRYC 4O8GA 4R70A 1NLYA 2M1CA 3PBSA 3LIDA 1VHMA 2ZBBA 3IBJA 1DP6A 4EESA 3T4JA 4Q0HA 2M7VA 3TE8A 1KOUA 4CQHA 4QPRA 2A2LA 4P6ZM 5IT5A 5L8MA 3K3DA 4G3VA 4Q0IA 3CLOA 3T50A 3T4LA 3NJAA 3EEAA 1NRJA 3U2AA 5CX7A 1LSVA 3PHYA 1P0ZA 1GSXA 4JGRA 3F1OA 4R38A 5MC7A 4FOFA 2XROA 4HP4A 4BMWA 1N9LA 2HF6A 2W0NA 3R4KA 4WELA 3E4OA 3TRCA 5HSQA 4BWIA 1OTAA 4WF0A 4KUOA 5DF9A 4ETXA 2JKRI 3MJQA 2IA2A 2GJ3A 3R7WA 2YKFA 3HCYA 1DP8A 5HD5A 2XSSA 3JVVA 1YSQA 2JKTM 5KSHA 2P04A 3ZQ5A 4EUVA 4I38A 2VLGA 1F5MA 1D06A 2W3FA 1ODVA 3E0YA 4Y3IA 5DFXA 4CLCB 1P9RA 5F5YA 4P6ZS 1W63M 5DFYA 3DBAA 3OBFA 2HJEA 3B47A 4LRXC 3S7OA 3IS2A 3KX0X 3D3OA 3E4PA 3H7WB 1OTIA 5AJGA 1TS8A 2O9CA 4LPZA 4ARZA 3B42A 2FH5A 3C30A 2HJ9C 5HWTA 4NXEA 3KYQA 2VA0A 5AVFA 3KYZA 5TJJA 3CAXA 3PYPA 5J3WA 1S67L 2B18A 1DRMA 3PBRA 4I3AA 3VV4A 3OOVA 3LYXA 2D01A 4EERA 4UEYA 4K08A 2L4RA 2PT7A 4XT2A 3K3CA 1GSWA 3OLOA 4AFIA 4I3JA 1S66L 4PKYG 2LB5A 3F1NA 2A24B 3LIBA 3W2ZA 4H6JB 2PR5A 1LSXA 3F1PB 4L9FA 4EQ1A 1G28A 1T18A 3VE4A 4PKYA 1OPXA 5HZHA 4E04A 3RFBA 4EXOA 5G4YA 1P9WA 3B33A 3CI6A 3KSFA 2BASA 3TJZC 4LLOB 3PR6A 1VB6A 4MN7A 4EEPA 2NUPC 1MZUA 3RTYA 3C38A 2OWJA 1S1ZA 2DMWA 3FPVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2W1R A;  2ZMF A;  2M7U A;  2XRN A;  4GLQ A;  2W3E A;  3KSH A;  4FOF A;  2XRO A;  2VJW A;  3MMH A;  2K31 A;  4O0P A;  3R4K A;  3KSG A;  3LFV A;  4Q0J A;  4RQ9 A;  1TF1 A;  3TRC A;  2W1T A;  5HSQ A;  1YSP A;  4BWI A;  2Y8H A;  2W3G A;  2HGV A;  4ETX A;  3E98 A;  2IA2 A;  4R6L A;  3HCY A;  4Y2F A;  5HPI A;  2XSS A;  2K2N A;  5HL6 A;  1YSQ A;  3S7N A;  5LBR A;  3ZQ5 A;  4EUV A;  4G3W A;  1YKD A;  3KSI A;  3IBR A;  4DMZ A;  2O9B A;  4IUH A;  1F5M A;  2W3F A;  3MQ0 A;  3E0Y A;  4Y3I A;  5DFX A;  4ZRR A;  2LB9 A;  4YOF A;  2OOL A;  3K2N A;  4MCW A;  4MDZ A;  2KOI A;  3NOU C;  5I5L A;  4PAU A;  1STZ A;  5K5B A;  4YNR A;  5DFY A;  3DBA A;  2W3D A;  3OBF A;  4LRX C;  3S7O A;  2O99 A;  2G7U A;  4IUK A;  3NOT C;  3D3O A;  3KO6 A;  2O0Y A;  4ETZ A;  4LRZ E;  1TD5 A;  5AJG A;  4IJG A;  3S7P A;  2O9C A;  1ZTU A;  3BJN A;  3G6O A;  2W3H A;  2W1T B;  1MKM A;  5TJJ A;  4Y5F A;  2KLI A;  3C2W A;  3O5Y A;  2B18 A;  2VEA A;  3S7Q A;  3VV4 A;  3OOV A;  4Z1W A;  4DN0 A;  4ME4 A;  4LRY C;  5C5K A;  4O01 A;  4G3K A;  4EU0 A;  2Y79 A;  4O8G A;  3MF0 A;  4R70 A;  2LB5 A;  3CIT A;  3W2Z A;  5HPF A;  4MMN A;  2VKS A;  1VHM A;  3IBJ A;  2GX5 A;  2O9A A;  4E04 A;  3RFB A;  2QYB A;  4Q0H A;  2M7V A;  4GW9 A;  2VZW A;  3NOP C;  4CQH A;  4QPR A;  3CI6 A;  3KSF A;  5L8M A;  4G3V A;  3NHQ A;  4Q0I A;  4MN7 A;  3EEA A;  1MC0 A; 
#chains in the Genus database with same CATH topology
 2W1R A;  1UWN X;  3OPL A;  5CGX A;  1UWP X;  5FDH A;  4OPQ A;  5EFW A;  1OT9 A;  2Y59 A;  4MBF A;  4X55 A;  1H3Q A;  3CUE C;  1XP4 A;  3MR0 A;  3BYD A;  3U4L P;  1IEL A;  3KSG A;  4S2M A;  1CI9 A;  3I7J A;  3ITB A;  1TS6 A;  3T4S A;  3T4O A;  2HP5 A;  3EQU A;  4UAA A;  1XJ3 A;  2V0U A;  2WGI A;  5JYP A;  3MQ0 A;  4S2N A;  1HTZ A;  4MLL A;  1PYY A;  1K54 C;  1BSG A;  2KOI A;  4E3M A;  5L07 A;  4R3A A;  1NYY A;  3IT9 A;  4C3Q A;  2R9W A;  1L0G A;  1G6A A;  1I2W A;  3BJN A;  4QY5 A;  2HDS A;  3M6H A;  4IVK A;  1K56 A;  3LI8 A;  2QMI A;  4UQI M;  3HLD A;  2J3T C;  2ZMV A;  4PM8 A;  1VET B;  5AQA A;  3SS4 A;  3EOI A;  3V50 A;  1F98 A;  4XUX A;  4JLF A;  1TS0 A;  3W4O A;  3VSK A;  2O9A A;  2D02 A;  2INW A;  1K56 D;  3BRM A;  1NYM A;  3MXR A;  3UE3 A;  2WAD A;  4Y7P A;  4EUZ A;  3IWI A;  4D2O A;  2EX2 A;  5HX9 A;  5CEC A;  4FD8 A;  1IOU A;  5G18 A;  3ZG0 A;  3LR4 A;  1Q2Q A;  3QNB A;  2QJ5 A;  3NIA A;  2PYR A;  3IWO A;  2PBY A;  5HDS A;  1M40 A;  4UQI S;  4LFU A;  4R6L A;  3LUQ A;  3O87 A;  4EW7 A;  2Y55 A;  3P98 A;  3H82 B;  1S1Y A;  3HVF A;  4G3W A;  2B02 A;  4DMZ A;  5TBM A;  3MBZ A;  4EEU A;  2ACG A;  5CHM A;  4RA7 A;  1K38 A;  5DTT A;  1X0O A;  4HH3 A;  4YNR A;  2GNX A;  3G4P A;  2ZLY A;  2VK3 A;  4GHI A;  5HWW A;  5TR7 A;  5FA7 A;  3KO6 A;  4I39 A;  3UPO A;  4UA7 A;  5EVI C;  4U3T A;  3VOL A;  4JPM A;  5EEC A;  1OME A;  3BFE A;  5HD3 A;  2EWV A;  3UO9 A;  4HES A;  2KLI A;  4WLA A;  3BFG A;  3UB8 A;  3CJM A;  3MF0 A;  1V9Z A;  3Q82 A;  2YKH A;  5F68 A;  4MNR A;  3OPR A;  4ESP A;  2NUT C;  3GVB A;  4RX3 A;  2ZD8 A;  2Q0O A;  1H8Y A;  1KVL A;  1ZG4 A;  4X25 A;  2ZC4 B;  1S6R A;  4KQR A;  4OOM A;  4EV4 A;  5EVL A;  5HDC A;  3UPN A;  2JC7 A;  5HL1 A;  2H28 A;  1H5X A;  2P08 A;  2IWC A;  4Y15 A;  1EW0 A;  4JKT A;  4QJG A;  4P87 A;  3MFD A;  4OQI A;  3LFV A;  1PWC A;  2W1T A;  4S2L A;  1G6O A;  4LV3 A;  3HLG A;  4BBV A;  5EVE A;  1HZO A;  5A8B A;  3UB6 A;  4BL2 A;  2O9B A;  3DW0 A;  3UB7 A;  4ZBE A;  4CJN A;  3S4X A;  4GS9 B;  4KZ4 A;  1ZG6 A;  1G5U A;  1XKZ A;  3BQ8 A;  1L2S A;  3SZT A;  4FCF A;  2C6W B;  3HJK A;  4M4X A;  2AVX A;  4HBT A;  3FWL A;  1ERO A;  4HJ3 A;  4KZ3 A;  5FQM A;  1T1C A;  3PBQ A;  5DJT A;  5CRF A;  1MWT A;  1OT6 A;  2DNS A;  4RX2 A;  2I9V A;  2ZOH A;  3WS4 A;  4LRY C;  3DTE A;  4O8G A;  4R70 A;  3VSL A;  3IX4 A;  1NLY A;  5CED A;  1W5D A;  5FEF A;  3BFC A;  3SH7 A;  4QY6 A;  2ZBB A;  1DP6 A;  3N8S A;  3VP0 A;  4GN2 A;  3BEC A;  3TE8 A;  1KOU A;  3TG9 A;  4QPR A;  3VOZ A;  4R0Q A;  1U60 A;  2J9O A;  2P9V B;  3T4L A;  1NRJ A;  2B95 A;  3HLE A;  4X68 A;  3E2L A;  4X69 A;  2EXA A;  4OOY A;  4X56 A;  1GSX A;  5CXW A;  5KMW A;  2Y2O A;  2ZMA A;  2ZM8 A;  4WEL A;  4HBU A;  3O88 A;  5FAO A;  2PBD P;  4EBL A;  3G35 A;  3IXB A;  4KUO A;  4S2K A;  4KG2 A;  3WS0 A;  2JKR I;  5DF8 A;  4JF4 A;  5HD5 A;  4R4R A;  1K57 A;  3G32 A;  3HL9 A;  2WZZ A;  1PZP A;  2JCH A;  3T12 B;  2VLG A;  1ODV A;  4Y3I A;  3SOI A;  5F5Y A;  2BLS A;  5GLD A;  1W63 M;  3DBA A;  4E3I A;  1IKG A;  2WKH A;  2A49 A;  1LL9 A;  3H7W B;  1OTI A;  2ZL1 B;  4QHC A;  1TS8 A;  4JXV A;  3B42 A;  3ZVT A;  3KYQ A;  3V3S A;  2Y2N A;  2HPB A;  4FH4 A;  1TDG A;  1ZKJ A;  2B18 A;  3VV4 A;  2D01 A;  4R1G A;  1GSW A;  4QWO A;  3MZD A;  3OPH A;  4PKY G;  2LB5 A;  3F1N A;  2A24 B;  4KZB A;  5HAI A;  2ZJ9 A;  4E3O A;  3F1P B;  4L9F A;  1G28 A;  1T18 A;  3V3R A;  1I5Q A;  1WE4 A;  1OPX A;  3UY6 A;  3LCE A;  1NZO A;  3ISG A;  5I94 A;  3W4P A;  4E6W A;  2ZQ8 A;  3LEZ A;  4DE3 A;  5CHU A;  2OWJ A;  5EM1 A;  3SH8 A;  3G2Z A;  3MKE A;  2JKT I;  4GLQ A;  2W3E A;  3MMH A;  3PAG A;  3H82 A;  2A3U A;  4EWF A;  2H10 A;  2JE5 A;  3S22 A;  3VP1 A;  5D3O A;  1WA9 A;  4N9L A;  1JWZ A;  4Q8I A;  1ESI A;  4Y2F A;  5L10 A;  1KVM A;  2EA9 A;  4S2I A;  2K2N A;  4ZAM A;  3DTI A;  1D1J A;  4OLG A;  5J7E A;  4HH2 A;  3RH8 B;  4GJ4 A;  1YKD A;  2QJ7 A;  5DVA A;  3O86 A;  2JBF A;  4KZ5 A;  4YWZ A;  3W8K A;  1YT4 A;  4Y17 A;  2Y2L A;  2ZM2 A;  4GDB A;  4MDZ A;  3IF6 B;  3BQA A;  2PDR A;  5IHV A;  5AVE A;  1T19 A;  3MZF A;  3FG8 A;  1YLJ A;  5EV0 A;  1Y28 A;  3BW6 A;  4II7 A;  3CMZ A;  3ZYT A;  5G4Z A;  2HDQ A;  4PMA A;  2JN7 A;  2W1T B;  3LGO A;  3BLS A;  3IS2 B;  2PRF A;  3LY3 A;  4DN0 A;  1S4R A;  4ZJ1 A;  2CC1 A;  2WKR A;  3IHB A;  1OTD A;  2Z6C A;  5HPF A;  2VKS A;  3HRE A;  2H5S A;  5HW3 A;  3AGF A;  4OPR A;  1K6S A;  3UE1 A;  3OPP A;  1A0K A;  3BY8 A;  3B3X A;  5BOH A;  1ACF A;  1MC0 A;  1XX2 A;  4NXG A;  2VGK A;  4EQI A;  1ERM A;  1H8M A;  3PBN A;  5GL9 A;  1C3B A;  4FTX A;  5DJU A;  2WKP A;  4WN5 A;  3NCK A;  5CGW A;  5GLA A;  2H0Y A;  1YLZ A;  3C8C A;  3MZE A;  2Y8H A;  4ZTK A;  5HFO A;  4GS9 A;  4PM5 A;  5HL6 A;  4LV2 A;  1TDL A;  4IVI A;  3S7N A;  2WKQ A;  2IWD A;  2EXB A;  2V8F A;  3IXH A;  3KSI A;  2EX9 A;  2E8I A;  3IF5 A;  5A92 A;  2OAQ 1;  4YOF A;  2W27 A;  3K2N A;  4L9E A;  4PAU A;  1FQG A;  2W3D A;  4JXW A;  1LI9 A;  5HAQ A;  2QWS A;  4IUK A;  5JYO A;  1AXB A;  4F3L B;  4FUW A;  4HI4 A;  4B93 A;  1AWI A;  3S7P A;  1Y54 A;  4K0X A;  4LV0 A;  4ID4 A;  3NBL A;  4OPZ A;  4O7D A;  1XJ4 A;  1SKF A;  4KZ9 A;  4PHT A;  4U0X A;  3UE0 A;  2J3W A;  3RXX A;  2Y79 A;  5F6A A;  3HLW A;  2IWB A;  3UNW A;  3HJI A;  2WGV A;  2P9V A;  2L1M A;  4QD4 A;  3GMW A;  4KQO A;  2GX5 A;  1YLT A;  4GD6 A;  4GW9 A;  2VZW A;  4EBN A;  2PR6 A;  4A5R A;  3L9K A;  1S4S A;  1ALQ A;  4WZ5 A;  4BD1 A;  5FAT A;  1TVF A;  4PM6 A;  5FSR A;  1VEU B;  3BWL A;  4HJ4 A;  4HIA A;  1OTE A;  2V20 A;  2XD5 A;  2VJW A;  2L0W A;  1CJF A;  5HWV A;  5AQB A;  4LEN A;  1MKI A;  1DJC A;  3PBO A;  3F1N B;  4R4S A;  2W3G A;  5DKK A;  3T4T A;  3Q81 A;  2OV5 A;  1V9Y A;  3N8R A;  3G31 A;  1F2K A;  4E6X A;  3IX8 A;  4JXG A;  1W63 Q;  3H7W A;  1DJA A;  3MFX A;  5TGF A;  2ZL1 A;  1GCE A;  4ZRR A;  3GQZ A;  2HV1 A;  3HUN A;  3NEC A;  3MQO A;  5I5L A;  4KQD A;  2H0T A;  1XFN A;  2QKP A;  3NOT C;  2WAE A;  3D9Y A;  2ZC3 B;  2PYP A;  3G6O A;  3NI9 A;  2W3H A;  2BG1 A;  4NXB A;  2A24 A;  3FV7 A;  2QPN A;  4BBU A;  3F1P A;  1XFQ A;  1LHY A;  1XA7 A;  2VEA A;  1XA1 A;  2JHE A;  4ME4 A;  2HDU A;  1SZV A;  2Z2M B;  2M1C A;  4B4X A;  2WGW B;  3LID A;  4X6T A;  1VHM A;  4EES A;  4KZ7 A;  4KZ8 A;  1ERQ A;  3T4J A;  4Q0H A;  1E25 A;  1HLU P;  2ZQ7 A;  3VMA A;  4P6Z M;  3SH9 A;  3K3D A;  4Q0I A;  3T50 A;  1JTG A;  3QP4 A;  3NJA A;  3C5A A;  3QP5 A;  3EEA A;  1NZU A;  1CQA A;  3O3V A;  3IH8 A;  1LSV A;  1YLY A;  4N92 A;  3D4F A;  4FOF A;  2XRO A;  1XGI A;  1L0F A;  5EVI B;  1N9L A;  2HF6 A;  2W0N A;  2WKI A;  5EUA A;  4N1H A;  1WYC A;  4OVD A;  1YMS A;  1GHP A;  2Q9M A;  4ETX A;  1NXY A;  1H8Z A;  4LV1 A;  2XSS A;  3JVV A;  1YSQ A;  3IF6 A;  3ZQ5 A;  1PW8 A;  4I38 A;  1CI8 A;  4Z9Q A;  1F5M A;  1D06 A;  5M1A A;  4CLC B;  2EX6 A;  4P6Z S;  5L2F A;  3WRT A;  3OBF A;  2HJE A;  3WS2 A;  3IS2 A;  5KSC A;  3M2K A;  4GB7 A;  5AJG A;  1W7F A;  3HUO A;  4X1L A;  2O9C A;  5HWT A;  2WUQ A;  1BT5 A;  2PU2 A;  3G30 A;  4JXS A;  3C4P A;  3IH9 A;  1ES4 A;  3FZC A;  1S67 L;  3PBR A;  1KGG A;  1KE4 A;  3OLO A;  3MS6 A;  3DTK A;  1ESU A;  4IBR A;  5E2H A;  4DDS A;  4OP5 A;  5GLC A;  4E04 A;  2HDR A;  1P9W A;  3B33 A;  4GOG A;  3CI6 A;  4S2N C;  2FFY A;  4LLO B;  4ZJ2 A;  3PR6 A;  4MN7 A;  3RTY A;  3C38 A;  1CF0 A;  3FPV A;  2KDK A;  1BZA A;  1JWP A;  1L0E A;  3E4Q A;  3LEQ A;  1KDW A;  1PNE A;  1FCO A;  4N1X A;  4M3K A;  3A3I A;  2KX6 A;  2ZQ9 A;  1YSP A;  4GDN A;  1K55 A;  4NEE D;  3HBR A;  1W8Q A;  1D7E A;  2V0W A;  4X1M A;  3QHY A;  4HHD A;  5FQI A;  1LSW A;  4DXC A;  1T1A A;  3OCL A;  3BFF A;  4F3L A;  4ZDX A;  3H9W A;  2P74 A;  3UB9 A;  3UME A;  3UMD A;  1K4E A;  3R7W B;  1MWR A;  2OOL A;  4DJ2 A;  4HP9 A;  2ZQD A;  1PW1 A;  2Y2J A;  5L09 A;  3NC8 A;  3ZFZ A;  2WAF A;  1O7E A;  5J4E A;  2EX8 A;  1JNU A;  3HLB A;  4BL3 A;  2Y2Q A;  3EEH A;  3A0S A;  4OON A;  3C2W A;  3UDF A;  3P01 A;  5CTM A;  5C5K A;  2V9A A;  1YLW A;  1RGY A;  4G3K A;  3A3J A;  3CIT A;  2RCX A;  4LCL A;  1M6K A;  4UA9 A;  3KYE A;  1VEU A;  3FC7 A;  4RYE A;  1T1B A;  5FQK A;  1K54 A;  2X71 A;  2ZC6 B;  4LGW A;  1ES2 A;  2EFU A;  4IHQ A;  2XA7 M;  4WBG A;  3GRJ A;  5FEG A;  3JVU A;  4HNB A;  4R23 A;  1IYS A;  4NK3 A;  4DJ3 A;  3IHA A;  1LI0 A;  3ULF A;  1LLB A;  1N9O A;  3AGE A;  2G2W A;  1BTL A;  2FZ0 A;  2ZC5 B;  4KZA A;  1SHV A;  2DRW A;  1TS7 A;  2ZOI A;  2C5W B;  1KDS A;  1TEM A;  5EOE A;  5IU1 A;  1DY6 A;  2GDN A;  4D60 A;  3C4O A;  2CMN A;  3LIF A;  1Z6F A;  1G68 A;  3LIA A;  3WRZ A;  3A3F A;  1IFQ A;  3SW1 A;  2J3T D;  1BLS A;  2K7S A;  1PZO A;  3FPW A;  4MBH A;  1STZ A;  2XA7 S;  2BTF P;  3WS5 A;  3PBT A;  4UA6 A;  1KE0 A;  4KEN B;  1GHM A;  3V67 A;  1EWZ A;  5AQ7 A;  5FI7 A;  1FCN A;  3LO7 A;  4PM7 A;  4B88 A;  4YIN A;  5CGS A;  1MKM A;  2WGW A;  5IS1 A;  3NDE A;  4Y5F A;  2PHY A;  4OPY A;  1VQQ A;  5EPH A;  2PD8 A;  4NKP A;  2OWH A;  2XD1 A;  3NY4 A;  4WZ4 A;  3GDI A;  1PWD A;  4EU0 A;  3G2Y A;  4CLC E;  4DRT A;  4MMN A;  3QNC A;  4MEZ A;  5HDD A;  3HUM A;  1CEG A;  3A0R A;  1PRQ A;  4S2P A;  5GHY A;  1O07 A;  3ZVW A;  5HAP A;  3EGD C;  3NOP C;  3LR3 A;  4DE2 A;  5FQJ A;  3VP4 A;  1NLZ A;  4UHU A;  3NHQ A;  3GEC A;  5EVI A;  5DF7 A;  2OLU A;  4WL9 A;  1HD8 A;  4PPR A;  4B9O A;  3T1X A;  4S2O A;  2XEP A;  4E3N A;  2WKE A;  2M7U A;  4IBX A;  3M2J A;  4EBP A;  4L9G A;  5EM0 A;  3OZH A;  4KQQ A;  2V1B A;  1LT0 A;  3FYZ A;  5EVI D;  3CG5 A;  3VFH A;  1TF1 A;  1J9M A;  4OLD A;  2HGV A;  2HP9 A;  4CLC A;  5DKL A;  3UPP A;  4CPK A;  4OOL A;  3WS1 A;  3HLC A;  4I5S A;  4C75 A;  3MQQ A;  4WMC A;  3QP6 A;  4GKU A;  1IYO A;  2Z6D A;  3IBR A;  1GA9 A;  1PIO A;  1SKO B;  1W8Y A;  3T4Q A;  4OP8 A;  1ZC2 A;  1NWZ A;  1PI5 A;  3NUL A;  4CLC D;  2J7V A;  2HP6 A;  3Q07 A;  2PAV P;  5HAR A;  3A0V A;  1OJ5 A;  4WMC D;  3Q7V B;  2VV6 A;  1L3L A;  3UDX A;  1TD5 A;  1GA0 A;  4ZJ3 A;  3QP2 A;  4HOI A;  3BEB A;  4XUZ A;  1K25 A;  3LY4 A;  4BEN A;  3GSG A;  3TW8 A;  1OJG A;  3MXQ A;  3VE3 A;  5E43 A;  4BQM A;  3ZGA B;  3ZCZ A;  4DDY A;  4Z1W A;  1L0D A;  3PBS A;  2XR0 A;  3ZG5 A;  3IBJ A;  1K57 C;  1K6R A;  1WYB A;  5E2G A;  2M7V A;  1IYQ A;  5FAS A;  5F82 A;  5CER A;  4G3V A;  3CLO A;  3CPT A;  1FSW A;  1FR6 A;  5F1G A;  1MBL A;  1GHI A;  5AQ9 A;  1FSY A;  3F1O A;  4R38 A;  4OH0 A;  1CK3 A;  3RJU A;  4DE1 A;  5HSQ A;  4BWI A;  1OTA A;  4WF0 A;  5DF9 A;  3MJQ A;  2IA2 A;  3IWQ A;  3R7W A;  3HCY A;  3VP3 A;  2ZC7 A;  3UB5 P;  2WK0 A;  2P04 A;  4EUV A;  3MSH A;  4R3J A;  2W3F A;  5DFX A;  3N4I A;  3DAV A;  3B47 A;  5DTK A;  3S7O A;  4GD8 A;  1JTD A;  3VP2 A;  3KX0 X;  1XPB A;  3ZNT A;  2Y2H A;  4DXB A;  1W79 A;  3N6I A;  2HJ9 C;  4NXE A;  1FOF A;  2VA0 A;  3KYZ A;  1BLP A;  2XLN A;  2EFX A;  5TJJ A;  1Y4O A;  3PYP A;  5J3W A;  3CHW P;  1DRM A;  4I3A A;  3TOI A;  3ZNY A;  4UEY A;  4XT2 A;  3K3C A;  5DTS A;  1N4O A;  2I72 A;  3IXD A;  3LIB A;  2PR5 A;  2V8C A;  5GHX A;  3VE4 A;  1QME A;  5GLB A;  1YMX A;  3N7W A;  5FQ9 A;  2Z2L B;  5G4Y A;  5CTN A;  3PTE A;  3P09 A;  3KSF A;  4B4Z A;  3TJZ C;  1YPR A;  2XDM A;  2Y2K A;  1VB6 A;  4EEP A;  2XQZ A;  2XGN A;  2NUP C;  1MZU A;  1DJB A;  1E3U A;  2DMW A;  2OLV A;  3BM6 A;  3PXP A;  5U47 A;  3KSH A;  3JYI A;  2FFF B;  4KUK A;  5CHJ A;  1KGE A;  4XXR A;  3LR5 A;  4RQ9 A;  1Q2P A;  4FH2 A;  1E3U D;  3V5M A;  3RXW A;  2VV8 A;  2VGJ A;  3E98 A;  3EQV A;  2J80 A;  5HPI A;  1BLH A;  4JBF A;  5LBR A;  2Y2G A;  4BLM A;  4K0W A;  4IUH A;  3LI9 A;  4WEK A;  4P85 A;  4WEJ A;  5F1F A;  5FI6 A;  2MJ6 A;  2Q9N A;  3D72 A;  2Y2I A;  3OC2 A;  4CLC C;  2O0Y A;  1BUE A;  3LIE A;  4LRZ E;  4Y0O A;  2QHK A;  4IJG A;  5FAP A;  3DWZ A;  3NDG A;  3V39 A;  1ZTU A;  3OCN A;  5FL3 A;  1YAX A;  2R78 A;  4DF6 A;  1LL5 A;  1XXM A;  4YFM A;  3LIC A;  1BUL A;  5M19 A;  4R3B A;  1E4D A;  3O5Y A;  1VM1 A;  4ARZ B;  4O01 A;  1IKI A;  3ZG7 B;  2Y2M A;  4DKI A;  4MN6 A;  1MWU A;  4OQH A;  4WUJ A;  4P6B A;  1SCW A;  1RP5 A;  1CEF A;  4IED A;  3ZG8 B;  1BYW A;  3ICY A;  5CEB A;  2PD7 A;  3EGX C;  2ZM0 A;  4FSF A;  4L0L A;  1FIL A;  1XJ6 A;  3T1R A;  1F9I A;  1FCM A;  2XK1 A;  2JKG A;  2P7J A;  5E2F A;  1ES3 A;  2G2U A;  2J9P A;  2XRN A;  2V1A A;  4OQ0 A;  2XF3 A;  5FI2 A;  2R9X A;  4JF5 A;  1MPL A;  4Y0T A;  1JWV A;  1SKO A;  2VGL M;  3A3D A;  4WYY A;  3MXS A;  3DTM A;  2VV7 A;  4JGQ A;  4MN5 A;  3EWK A;  1NRF A;  4GNU A;  2Y91 A;  3Q7V A;  2J8Y A;  5KIZ A;  4H6J A;  3CPT B;  2LB9 A;  2Y2P A;  3Q7Z A;  4GZB A;  2WYX A;  1XGJ A;  5F83 A;  3NOU C;  3T4K A;  3CWF A;  2O99 A;  2G7U A;  4WZ5 C;  3F1O B;  3FKV A;  2WZX A;  5A90 A;  2JKF A;  4EET B;  3GTC A;  2PU4 A;  3QP8 A;  2XH9 A;  3T1Q B;  1XJ2 A;  4HQA A;  2UV0 E;  1ZHH B;  1GSV A;  5EOO A;  4H8R A;  3S7Q A;  4OQG A;  1MY8 A;  4JGP A;  4I3I A;  3LR0 A;  5FDS A;  4LCM A;  4BJP A;  5KZH A;  4HY8 A;  2VGL S;  2GZA A;  1RGZ A;  5F69 A;  1EI5 A;  4N9K A;  1J3W A;  1NJ4 A;  2EWW A;  1I2S A;  4P0M A;  3MKF A;  3CUE A;  5EE8 A;  4HJ6 A;  4JGO A;  1FR1 A;  2QYB A;  3TSG A;  2QZ6 A;  3A3E A;  2XFS A;  3DWK A;  4GCZ A;  4BBT A;  1LL8 A;  2OAP 1;  4Y0U A;  3E2K A;  2ZMF A;  1N9N A;  1PFL A;  3UE6 A;  3N8L A;  5A91 A;  1ES5 A;  3ZDJ A;  2K31 A;  3P7N A;  1K0K A;  4O0P A;  4XT2 B;  4X53 A;  4Q0J A;  4KZ6 A;  3UDI A;  3C7V A;  3UN7 A;  4NG2 A;  3CZD A;  5J8X A;  3BY9 A;  2V1Z A;  4NXF A;  2X01 A;  4DE0 A;  3VFF A;  1MWS A;  4KG5 A;  1VET A;  1PI4 A;  4E3J A;  2B5R A;  3BLM A;  3G34 A;  4NET A;  1DP9 A;  3W4Q A;  2VX8 A;  3AGD A;  3BFD A;  1NY0 A;  3IQA A;  4MCW A;  1IEM A;  2JKR M;  5K5B A;  2OSU A;  1OTB A;  4Y13 A;  3IX3 A;  1KGF A;  1SDE A;  5M18 A;  1UGU A;  1IYP A;  4ETZ A;  5TBM B;  4KG6 A;  1P97 A;  1ONH A;  3SS5 A;  4E3K A;  4F94 A;  1HVB A;  3FKW A;  4GHI B;  5FAQ A;  2ZQC A;  1FIK A;  4C6Y A;  1S0W A;  5E2E A;  3GV9 A;  1SDN A;  3IF6 C;  3ZG9 B;  5GHZ A;  2V2F F;  4CQH A;  2A2L A;  5IT5 A;  5L8M A;  1YLP A;  1KE3 A;  3WWX A;  1RCJ A;  2HZ5 A;  3U2A A;  5CX7 A;  3PHY A;  2DCF A;  1P0Z A;  3M6B A;  1PWG A;  4QB8 A;  4JGR A;  5MC7 A;  4HP4 A;  4BMW A;  2XFT A;  3R4K A;  4K91 A;  4S2J A;  1JVJ A;  3E4O A;  3TRC A;  3GR2 A;  2GJ3 A;  2YKF A;  1K4F A;  1DP8 A;  3SS3 A;  4E3L A;  2JKT M;  5KSH A;  3JPU A;  3QP1 A;  3IXG A;  1YQS A;  3E0Y A;  1P9R A;  4JF6 A;  1BLC A;  3C7U A;  3ZHH A;  5DFY A;  3L7H A;  1YM1 A;  4LRX C;  3T1S A;  2ZQA A;  2UWX A;  3PAE A;  3D3O A;  3E4P A;  4RVA A;  4QU3 A;  2X02 A;  4LPZ A;  4ARZ A;  2FH5 A;  3C30 A;  3HLF A;  5AVF A;  2Y4A A;  4WM9 A;  1Z09 A;  3CAX A;  4HEF A;  3S1Y A;  3OOV A;  3LYX A;  4EER A;  4K08 A;  2L4R A;  2PT7 A;  4OKP A;  1K55 C;  4AFI A;  4MBK A;  4I3J A;  1H0M A;  1S66 L;  3W2Z A;  4H6J B;  3VOY A;  1LSX A;  1QMF A;  1N9B A;  4U0T A;  5TFQ A;  5FQQ A;  4EQ1 A;  4PKY A;  5A93 A;  1ONG A;  5HZH A;  2RL3 A;  3RFB A;  4EXO A;  4BD0 A;  1MXO A;  4PM9 A;  2BAS A;  1S1Z A;  2E8J A;  3ITA A;  3Q1F A; 
#chains in the Genus database with same CATH homology
 2KDK A;  2W1R A;  1UWN X;  3PXP A;  3E4Q A;  1UWP X;  2JKT I;  4GLQ A;  5EFW A;  2W3E A;  1OT9 A;  3KSH A;  4KUK A;  3MMH A;  1H3Q A;  3CUE C;  3MR0 A;  3H82 A;  3KSG A;  3LR5 A;  4RQ9 A;  2KX6 A;  1YSP A;  4NEE D;  1TS6 A;  3T4S A;  2VV8 A;  3T4O A;  1WA9 A;  1D7E A;  2J80 A;  3E98 A;  3EQV A;  3EQU A;  4Y2F A;  2V0W A;  5HPI A;  1XJ3 A;  2EA9 A;  2V0U A;  2K2N A;  4HHD A;  1LSW A;  5LBR A;  5J7E A;  1T1A A;  4HH2 A;  3RH8 B;  4GJ4 A;  1YKD A;  3OCL A;  2QJ7 A;  4F3L A;  4IUH A;  3LI9 A;  3MQ0 A;  4WEK A;  3H9W A;  4YWZ A;  3UB9 A;  3UME A;  3UMD A;  4WEJ A;  3R7W B;  2OOL A;  4MDZ A;  4DJ2 A;  2KOI A;  4HP9 A;  3BQA A;  2PDR A;  2MJ6 A;  5AVE A;  1T19 A;  3D72 A;  3OC2 A;  4CLC C;  3FG8 A;  2O0Y A;  3LIE A;  4LRZ E;  4R3A A;  2QHK A;  1Y28 A;  4IJG A;  3BW6 A;  4II7 A;  5J4E A;  1ZTU A;  3OCN A;  5G4Z A;  3ZYT A;  3BJN A;  5FL3 A;  1YAX A;  2R78 A;  1JNU A;  2JN7 A;  2W1T B;  3LIC A;  3EEH A;  3IS2 B;  3A0S A;  3C2W A;  3LI8 A;  3O5Y A;  3P01 A;  4DN0 A;  4UQI M;  1S4R A;  5C5K A;  4ARZ B;  2V9A A;  2J3T C;  2ZMV A;  4O01 A;  4G3K A;  2WKR A;  4MN6 A;  3EOI A;  1OTD A;  2Z6C A;  3CIT A;  4WUJ A;  1F98 A;  5HPF A;  2VKS A;  1TS0 A;  2O9A A;  2D02 A;  1BYW A;  2INW A;  3ICY A;  3FC7 A;  1T1B A;  2PD7 A;  3EGX C;  3UE3 A;  3BY8 A;  4FSF A;  4L0L A;  4IHQ A;  2XA7 M;  3JVU A;  1XJ6 A;  4HNB A;  1MC0 A;  1F9I A;  4DJ3 A;  4NXG A;  3ULF A;  1H8M A;  1N9O A;  3PBN A;  2P7J A;  1IOU A;  5DJU A;  2FZ0 A;  2WKP A;  3LR4 A;  2XRN A;  2V1A A;  2QJ5 A;  4WN5 A;  1TS7 A;  2ZOI A;  2PYR A;  5IU1 A;  5HDS A;  3C8C A;  2Y8H A;  2VGL M;  4UQI S;  2CMN A;  4R6L A;  3LUQ A;  4GS9 A;  2VV7 A;  4JGQ A;  4EW7 A;  3LIF A;  4MN5 A;  3EWK A;  5HL6 A;  3S7N A;  3H82 B;  2WKQ A;  1S1Y A;  3LIA A;  4G3W A;  3KSI A;  2B02 A;  4DMZ A;  5KIZ A;  1IFQ A;  4H6J A;  5TBM A;  4EEU A;  3SW1 A;  2J3T D;  2K7S A;  2OAQ 1;  2LB9 A;  4YOF A;  2W27 A;  1X0O A;  3K2N A;  3FPW A;  3NOU C;  4L9E A;  4PAU A;  1STZ A;  3T4K A;  4HH3 A;  4YNR A;  2GNX A;  2W3D A;  2XA7 S;  2QWS A;  3CWF A;  2O99 A;  2G7U A;  4IUK A;  4GHI A;  5HWW A;  3KO6 A;  4I39 A;  3PBT A;  4F3L B;  3F1O B;  4HI4 A;  3V67 A;  4B93 A;  3VOL A;  3S7P A;  4EET B;  1XJ2 A;  1MKM A;  5HD3 A;  2EWV A;  4HQA A;  5IS1 A;  1XJ4 A;  4Y5F A;  2PHY A;  1ZHH B;  2KLI A;  1GSV A;  3S7Q A;  4JGP A;  4WLA A;  4I3I A;  3LR0 A;  2PD8 A;  4NKP A;  2OWH A;  4PHT A;  3UB8 A;  4BJP A;  3GDI A;  4HY8 A;  2VGL S;  2J3W A;  4EU0 A;  2Y79 A;  3MF0 A;  5F6A A;  4CLC E;  3HJI A;  2GZA A;  1V9Z A;  5F69 A;  2YKH A;  5F68 A;  4MMN A;  2L1M A;  5HDD A;  2EWW A;  3A0R A;  4KQO A;  2GX5 A;  3CUE A;  2NUT C;  4HJ6 A;  4JGO A;  2QYB A;  4GW9 A;  2VZW A;  3EGD C;  3NOP C;  2PR6 A;  3LR3 A;  1S4S A;  1NLZ A;  4GCZ A;  3NHQ A;  4BBT A;  1LL8 A;  3GEC A;  4WL9 A;  2OAP 1;  3BWL A;  4HJ4 A;  4OOM A;  4B9O A;  4HIA A;  1OTE A;  2ZMF A;  5HDC A;  1N9N A;  3UE6 A;  2M7U A;  2H28 A;  4L9G A;  2P08 A;  1EW0 A;  2VJW A;  2L0W A;  1LT0 A;  2V1B A;  2K31 A;  3P7N A;  4O0P A;  4XT2 B;  5HWV A;  3LFV A;  4Q0J A;  1TF1 A;  2W1T A;  3PBO A;  3F1N B;  2W3G A;  1G6O A;  2HGV A;  5DKK A;  3T4T A;  4CLC A;  5DKL A;  4OOL A;  3BY9 A;  1V9Y A;  4NXF A;  4I5S A;  4BBV A;  3MQQ A;  5A8B A;  3UB6 A;  2Z6D A;  3IBR A;  2O9B A;  1W63 Q;  3UB7 A;  3H7W A;  3T4Q A;  3MFX A;  4ZRR A;  1DP9 A;  2VX8 A;  4GS9 B;  1NWZ A;  2HV1 A;  4CLC D;  4MCW A;  2JKR M;  3MQO A;  5I5L A;  5K5B A;  1OTB A;  3BQ8 A;  3A0V A;  4KQD A;  1OJ5 A;  1XFN A;  2QKP A;  3NOT C;  1UGU A;  2VV6 A;  3HJK A;  4ETZ A;  4M4X A;  5TBM B;  1TD5 A;  1P97 A;  4HJ3 A;  2PYP A;  4HOI A;  3G6O A;  2W3H A;  1T1C A;  3PBQ A;  4NXB A;  5DJT A;  2A24 A;  3TW8 A;  1OT6 A;  1OJG A;  4BBU A;  3F1P A;  3MXQ A;  4GHI B;  3VE3 A;  1XFQ A;  2I9V A;  2VEA A;  4Z1W A;  2JHE A;  2ZOH A;  4ME4 A;  4LRY C;  4O8G A;  4R70 A;  1NLY A;  2M1C A;  3PBS A;  3LID A;  1VHM A;  2ZBB A;  3IBJ A;  1DP6 A;  4EES A;  3T4J A;  4Q0H A;  2M7V A;  3TE8 A;  1KOU A;  4CQH A;  4QPR A;  2A2L A;  4P6Z M;  5IT5 A;  5L8M A;  3K3D A;  4G3V A;  4Q0I A;  3CLO A;  3T50 A;  3T4L A;  3NJA A;  3EEA A;  1NRJ A;  3U2A A;  5CX7 A;  1LSV A;  3PHY A;  1P0Z A;  1GSX A;  4JGR A;  3F1O A;  4R38 A;  5MC7 A;  4FOF A;  2XRO A;  4HP4 A;  4BMW A;  1N9L A;  2HF6 A;  2W0N A;  3R4K A;  4WEL A;  3E4O A;  3TRC A;  5HSQ A;  4BWI A;  1OTA A;  4WF0 A;  4KUO A;  5DF9 A;  4ETX A;  2JKR I;  3MJQ A;  2IA2 A;  2GJ3 A;  3R7W A;  2YKF A;  3HCY A;  1DP8 A;  5HD5 A;  2XSS A;  3JVV A;  1YSQ A;  2JKT M;  5KSH A;  2P04 A;  3ZQ5 A;  4EUV A;  4I38 A;  2VLG A;  1F5M A;  1D06 A;  2W3F A;  1ODV A;  3E0Y A;  4Y3I A;  5DFX A;  4CLC B;  1P9R A;  5F5Y A;  4P6Z S;  1W63 M;  5DFY A;  3DBA A;  3OBF A;  2HJE A;  3B47 A;  4LRX C;  3S7O A;  3IS2 A;  3KX0 X;  3D3O A;  3E4P A;  3H7W B;  1OTI A;  5AJG A;  1TS8 A;  2O9C A;  4LPZ A;  4ARZ A;  3B42 A;  2FH5 A;  3C30 A;  2HJ9 C;  5HWT A;  4NXE A;  3KYQ A;  2VA0 A;  5AVF A;  3KYZ A;  5TJJ A;  3CAX A;  3PYP A;  5J3W A;  1S67 L;  2B18 A;  1DRM A;  3PBR A;  4I3A A;  3VV4 A;  3OOV A;  3LYX A;  2D01 A;  4EER A;  4UEY A;  4K08 A;  2L4R A;  2PT7 A;  4XT2 A;  3K3C A;  1GSW A;  3OLO A;  4AFI A;  4I3J A;  1S66 L;  4PKY G;  2LB5 A;  3F1N A;  2A24 B;  3LIB A;  3W2Z A;  4H6J B;  2PR5 A;  1LSX A;  3F1P B;  4L9F A;  4EQ1 A;  1G28 A;  1T18 A;  3VE4 A;  4PKY A;  1OPX A;  5HZH A;  4E04 A;  3RFB A;  4EXO A;  5G4Y A;  1P9W A;  3B33 A;  3CI6 A;  3KSF A;  2BAS A;  3TJZ C;  4LLO B;  3PR6 A;  1VB6 A;  4MN7 A;  4EEP A;  2NUP C;  1MZU A;  3RTY A;  3C38 A;  2OWJ A;  1S1Z A;  2DMW A;  3FPV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...