3T50A

X-ray structure of the lov domain from the lov-hk sensory protein from brucella abortus (dark state).
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
115
structure length
115
Chain Sequence
ASEFTLMPMLITNPHLPDNPIVFANPAFLKLTGYEADEVMGRNCRFLQGHGTDPAHVRAIKSAIAAEKPIDIDIINYKKSGEAFWNRLHISPVHNANGRLQHFVSSQLDVTLELV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Blue-light-activated histidine kinase
publication title The Beta-Scaffold of the LOV Domain of the Brucella Light-Activated Histidine Kinase Is a Key Element for Signal Transduction
pubmed doi rcsb
source organism Brucella melitensis
total genus 37
structure length 115
sequence length 115
chains with identical sequence B
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2011-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13426 PAS_9 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3t50A00
4PKYG 4HI4A 2Z6DA 4F3LB 2I9VA 2GJ3A 4HIAA 4WLAA 1NWZA 2D02A 4L9FA 1F98A 3LIFA 4LRZE 4YWZA 4L9EA 3ZQ5A 3IS2B 1S1ZA 3P7NA 3BY8A 1ODVA 2ZOHA 5DKLA 3NJAA 1TS6A 3UE6A 3K3DA 2EA9A 4GS9B 2BASA 3UB6A 4I3JA 3H7WA 2H28A 1V9YA 4I5SA 1S66L 1N9NA 5HWWA 4XT2B 3LIEA 4LRXC 3BWLA 4EEUA 1GSWA 1MZUA 3UB9A 4JGOA 3IBRA 3A0VA 2INWA 4I3IA 4I39A 2PYPA 1T1BA 4I38A 2PD8A 1T18A 3G6OA 5I5LA 1EW0A 3MQQA 5F68A 3E4PA 3PYPA 2PYRA 4BBUA 4WF0A 3LYXA 2KX6A 2KDKA 4H6JB 3VE3A 1OTDA 3F1PB 2JN7A 2ZBBA 1GSXA 1XJ6A 3F1NB 4DJ3A 3MR0A 3NOUC 1WA9A 2PDRA 1D7EA 1LSWA 3LIAA 4KUOA 2A24A 2WKRA 4RQ9A 1X0OA 2JHEA 3NOTC 5HDCA 1S67L 1P0ZA 5G4YA 2L0WA 4HH3A 5IS1A 5HWVA 4NXGA 4HP9A 4PKYA 1OTEA 5KIZA 3MJQA 1OTBA 4HQAA 2V0WA 4LRYC 5HDDA 4BBTA 2M1CA 1T19A 5F5YA 4BBVA 3K3CA 1D06A 2V9AA 1OTAA 3H82A 5HD5A 5F69A 1T1AA 4HHDA 3GDIA 3NOPC 3LUQA 3GECA 4GHIB 4MN6A 1S4RA 4GCZA 4F3LA 4R3AA 1OT6A 1LL8A 1LSVA 3LIDA 2R78A 4EETB 1JNUA 2VEAA 4M4XA 4HOIA 5TBMB 4R38A 2VV7A 4EESA 3IS2A 4B9OA 5HSQA 4WL9A 2W0NA 3HJIA 2QJ5A 1UWPX 4HJ3A 4EXOA 4KQDA 4HP4A 3CLOA 4KUKA 4GS9A 1N9LA 2VLGA 2ZOIA 3SW1A 1OJGA 3LIBA 2D01A 3LICA 2Z6CA 2OWHA 1S4SA 3HJKA 1N9OA 5A8BA 2VV6A 4XT2A 4WUJA 5EFWA 3VOLA 1G28A 1UWNX 3LI9A 3RTYA 3OLOA 1DP9A 2K7SA 5HZHA 1TS0A 4NXEA 3D72A 4EQ1A 2WKPA 3A0RA 2PHYA 3T50A 4K08A 4LLOB 5HDSA 5HD3A 1V9ZA 1XFQA 3H9WA 2W27A 3MXQA 4HJ6A 4H6JA 4L9GA 3F1PA 3MFXA 1KOUA 1T1CA 3F1NA 5G4ZA 2YKHA 4GW9A 2HV1A 4LPZA 1OJ5A 4I3AA 3UMEA 2QWSA 3H7WB 3PHYA 1DRMA 1F9IA 3ICYA 2VV8A 3EEHA 5IU1A 4EEPA 3VE4A 1OT9A 3UMDA 4NXBA 3C8CA 5DJUA 5F6AA 1UGUA 3UB7A 3E4QA 4HJ4A 3E4OA 5AVEA 1BYWA 4EERA 3FG8A 5J4EA 3F1OB 3CWFA 3EWKA 2CMNA 2QKPA 2V1AA 1XJ3A 2L1MA 1DP8A 3MQOA 2P7JA 3KX0X 1TS8A 2V0UA 3NHQA 4R70A 4E04A 2A24B 2PR6A 5J7EA 4GHIA 3BY9A 2PD7A 2YKFA 4DJ2A 1DP6A 1LT0A 2OWJA 2J80A 2B02A 2QJ7A 4HH2A 4HY8A 1S1YA 4MN5A 5TBMA 1XJ2A 2PR5A 2L4RA 3F1OA 3RH8B 3LI8A 2V1BA 1Y28A 3ULFA 5DJTA 1P97A 3CAXA 1XFNA 4JGRA 1GSVA 4JGPA 1VB6A 3FC7A 1LSXA 4WN5A 4HNBA 3A0SA 4R6LA 5DKKA 5J3WA 3H82B 5HWTA 3UB8A 4JGQA 1TS7A 1XJ4A 3B33A 2OOLA 4NXFA 1OTIA 5AVFA 3C2WA 4EW7A 2WKQA 2QHKA
chains in the Genus database with same CATH superfamily
4JF4A 2EFUA 4N9LA 3PXPA 4F3LB 2GDNA 3T4LA 5J8XA 1VEUB 5CRFA 3RXWA 4S2KA 2XD5A 3PAEA 1MWSA 3T1QB 3LIFA 4LRZE 5HFOA 4YWZA 5HPFA 1E4DA 1XGIA 2E8JA 1IKGA 3A3JA 3P7NA 4Y13A 2G2UA 3BY8A 4WYYA 3VOYA 3WS4A 3ZG7B 2DRWA 2JC7A 3K3DA 3BQAA 2BASA 2ZC6B 3WRTA 1PRQA 1SKOA 4LGWA 4EBLA 1YLTA 4KZ5A 1K0KA 4E3LA 4I5SA 2XA7M 5TR7A 1N9NA 5HWWA 4LRXC 1GSWA 5F1FA 3UB9A 3JVUA 2VK3A 4K0XA 2Q9NA 3A3DA 3NDEA 1ERQA 5GL9A 4P85A 2OV5A 2INWA 2W1RA 4I3IA 2O9CA 5DFYA 2PYPA 3CG5A 1YLYA 1EW0A 3R4KA 3MQQA 5CXWA 5JYOA 3GQZA 3BJNA 3E4PA 2IWCA 1MKMA 2WZXA 2W1TA 2J3TD 2H0TA 5AQAA 5CGSA 2GZAA 3HUNA 1ES4A 4K0WA 1XKZA 2W3GA 3IF6C 1YM1A 3NOUC 3QNBA 5EVLA 4M3KA 3P01A 3IH8A 1WYBA 1KGGA 2A24A 4XUXA 4QU3A 3FV7A 3HL9A 1IYPA 1P0ZA 1MXOA 4Q0IA 2GX5A 3G32A 2ZC7A 4OQHA 5CGXA 3C4OA 4NXGA 1OMEA 2K31A 3W4OA 4QY6A 1OTBA 4Y3IA 1SDNA 3HLCA 3NDGA 4LRYC 1NJ4A 5HDDA 3BW6A 3S7QA 3O87A 1NY0A 2M1CA 1T19A 4X1MA 1IEMA 3S7NA 1FSWA 1BTLA 3K3CA 4ZTKA 1FCMA 1NYMA 4KZ8A 2V9AA 3ISGA 1XA1A 4ID4A 4ZDXA 5F69A 1RP5A 1GA9A 4HHDA 3GDIA 3NOPC 3LFVA 4RVAA 1H8YA 2PU4A 3W4PA 3GECA 2XEPA 3KSIA 4EBPA 3SH8A 3V39A 1S4RA 2WKEA 3I7JA 3VSLA 4JF6A 3GMWA 3LR4A 2QPNA 2A49A 1JNUA 4M4XA 1FSYA 3A3IA 1IYOA 4R38A 2J9OA 5KZHA 4GJ4A 4EESA 3N8SA 3IS2A 4B9OA 5HSQA 1GA0A 4WL9A 4X68A 1CI9A 2JKTM 4F94A 1UWPX 4OQGA 4KQDA 4HP4A 2JKGA 4RA7A 3AGDA 3CLOA 1TD5A 3OC2A 2E8IA 1N9LA 3MKFA 2ZOIA 1OJGA 2V8CA 5K5BA 3HLEA 4YFMA 3M2JA 2OAQ1 2OWHA 3C7UA 4QY5A 1ESIA 1ES3A 3IH9A 1H5XA 2UV0E 2HDRA 3L9KA 5A8BA 2VV6A 3HREA 1K38A 1H8MA 4XT2A 4WUJA 4X1LA 1YLPA 2EX6A 1KE0A 3TE8A 3SS5A 1UWNX 2JCHA 3BFCA 3KYQA 1ZTUA 4UHUA 4P0MA 5GLDA 3CZDA 4KZ9A 1DP9A 1TS0A 4NXEA 1XP4A 5CHJA 4CLCA 4EQ1A 2J8YA 3Q1FA 3UN7A 2PHYA 2Y2GA 4PPRA 1W7FA 3KYEA 3EGDC 5HDSA 1LL9A 2W27A 5CEDA 3JYIA 4S2PA 4H6JA 3QP8A 3G2ZA 3DTKA 5MC7A 2OAP1 5DVAA 4ETZA 2HF6A 3G4PA 3IWQA 4WZ5C 3G30A 3H7WB 4CLCD 1FOFA 4Y2FA 1DRMA 4JXGA 3RJUA 4QD4A 2Y59A 4R0QA 3O3VA 4Y5FA 3BFFA 3CMZA 2HPBA 4X53A 5IU1A 4YNRA 3FZCA 4UA7A 2P08A 4ZJ2A 4NXBA 4N1XA 4KQQA 4NEED 2IWDA 5DJUA 3IWIA 1NXYA 3UB7A 1XGJA 2PBDP 4HJ4A 2XD1A 4EERA 5EVEA 3FG8A 1EI5A 1A0KA 2XK1A 4ZRRA 5EVIC 2JE5A 2HGVA 1EROA 3MQ0A 3CJMA 3FYZA 2CMNA 1FIKA 4RX2A 3VP1A 2VX8A 2P7JA 5FAPA 1FILA 2EX8A 2EXBA 3T4KA 1K56A 3V50A 4OKPA 3CITA 5J7EA 2P9VA 4DMZA 4FTXA 4GHIA 1NRJA 3B3XA 3RXXA 4II7A 4LV3A 3GR2A 1YSQA 2PAVP 2Y2LA 4IBXA 3O5YA 1KE3A 4CPKA 2X01A 4HY8A 1K4EA 3IF5A 1XJ2A 3CUEA 2KOIA 5HAQA 1XX2A 2V1BA 1PZOA 3JVVA 4X69A 4E3NA 4WEJA 3CAXA 1K56D 4QB8A 1CEFA 1XFNA 1K55A 4JGRA 2Y55A 2WGWB 2Y4AA 3HLFA 3VP4A 4KQRA 3NI9A 5BOHA 1LSXA 3A0SA 3LCEA 4Z1WA 3B47A 3CPTB 4IHQA 1XJ4A 1MKIA 5FI2A 4OOLA 4NXFA 3MXSA 1K6RA 5AVFA 3E98A 4EW7A 5FQJA 2WAFA 3FPWA 1BLSA 5D3OA 3UPNA 3LY4A 3FPVA 3GV9A 2GJ3A 4WLAA 2WAEA 1FCOA 1MY8A 2D02A 4OH0A 1F98A 3N6IA 3S7OA 1ESUA 2KLIA 3IXBA 1BLCA 1S1ZA 3R7WB 2Y2QA 1KE4A 3CHWP 3BEBA 1ODVA 2ZOHA 5DKLA 5M18A 2Y2NA 2ZQAA 5F1GA 2EA9A 2ZC3B 1Y4OA 4GS9B 3SH7A 1YMSA 4MBKA 5EM0A 2XRNA 4ARZA 4MLLA 3ZNTA 4I3JA 1K54C 1V9YA 2G7UA 4WMCD 3LIEA 2ZM8A 3D3OA 2ZQ8A 4JGOA 4XUZA 1BLHA 3IBRA 4EQIA 3BFDA 1I2SA 4DXCA 3A0VA 1Z6FA 2HJEA 2W3DA 4GNUA 4I39A 4KZ4A 4I38A 1HLUP 2M7UA 1NLZA 4UA6A 1T18A 1ACFA 1VHMA 3OPHA 3HUOA 5FSRA 5F68A 3TJZC 1BSGA 1BUEA 2WKIA 3N4IA 3PYPA 5E2EA 4G3VA 1KVLA 3VFHA 2XA7S 2OSUA 3VE3A 1IELA 2DNSA 2X02A 4C3QA 1GSXA 5EECA 3F1NB 4R4SA 4S2JA 4O8GA 1SKFA 3MR0A 2PDRA 1D7EA 3LR5A 3MF0A 4OVDA 4WM9A 4QJGA 2WGVA 2XGNA 4DE2A 2WKRA 4RQ9A 1U60A 1X0OA 2JHEA 5KSCA 2EFXA 3OPRA 5KMWA 2ZD8A 3TSGA 1S67L 5G4YA 1FR1A 1G6OA 2V8FA 3IHBA 4B4XA 3QP6A 4KZBA 2R9XA 2ZMVA 4HP9A 1OTEA 5KIZA 1YAXA 2A2LA 5DFXA 5M1AA 4HQAA 2QYBA 1I5QA 5CTNA 4BBTA 4HEFA 5F5YA 5A90A 1FR6A 1CEGA 1D06A 1GHPA 3QP1A 3V5MA 3LO7A 1L2SA 4EV4A 2VGJA 3WS1A 2XR0A 1ZG6A 1OTAA 2QMIA 3WWXA 1ES5A 4WZ5A 5HD5A 2VKSA 2XFTA 1T1AA 3C7VA 4GD8A 2ZMAA 4S2OA 5GLAA 5FASA 2DCFA 5FA7A 2HZ5A 3DBAA 3N8RA 4QHCA 3ZG9B 1LL8A 4DE1A 1LSVA 4GZBA 1H0MA 2VEAA 4HOIA 5EUAA 2J7VA 3M6BA 1PI4A 4E3JA 4U0XA 2W0NA 4Y17A 4JPMA 4OP5A 4JLFA 2XH9A 4KUKA 5EVIA 3IBJA 1G5UA 3LICA 2B95A 2Z6CA 3Q7VB 3PBOA 4LENA 3DW0A 1N9OA 2XF3A 4BQMA 1F5MA 5EE8A 1PW8A 4MBHA 3V67A 2IA2A 4Q0HA 4ETXA 2WZZA 4ZJ1A 3BM6A 3FWLA 4WELA 3JPUA 1PWCA 5HZHA 3IX4A 2ZJ9A 3D72A 3G31A 4IVKA 4LV2A 1W63M 2WKPA 2ZC4B 3ZG5A 5EPHA 5DF8A 2Y2IA 5HD3A 3PTEA 5E43A 1XFQA 1KVMA 3D9YA 4OP8A 1BT5A 3GRJA 3FKVA 4HJ6A 3C4PA 1PWDA 3T4OA 3F1PA 3Q82A 4WBGA 5AQ7A 3E2LA 3AGEA 2V2FF 3W4QA 2YKHA 1SKOB 2HV1A 1YLJA 5I94A 1OJ5A 2Z2MB 2LB9A 4I3AA 2QWSA 3PHYA 4LFUA 1S0WA 1F9IA 4QPRA 3IQAA 2VV8A 4C6YA 4FOFA 2HDSA 1HVBA 4GDBA 4R4RA 3SS4A 4EEPA 4OONA 3UMDA 3UPOA 3MKEA 3UDIA 4BL3A 5FATA 3UY6A 3C8CA 3NY4A 1MBLA 4ZJ3A 3OOVA 3P09A 5FQMA 5AJGA 3BRMA 1SCWA 4IEDA 3GTCA 4B93A 3E4OA 4GN2A 1K57A 1PYYA 2W1TB 5AVEA 4HBTA 4B4ZA 2A3UA 2BTFP 5AQBA 3F1OB 3CWFA 3EWKA 1SHVA 5HL6A 3KYZA 3RFBA 3W8KA 3SZTA 1XJ3A 3PBSA 1IKIA 5FEGA 1K4FA 1DP8A 2AVXA 3LY3A 4PM5A 5EM1A 4G3KA 3NHQA 4R70A 3EEAA 4B88A 2A24B 2PR6A 3BY9A 1Q2QA 2YKFA 1PWGA 1Q2PA 1LT0A 2V20A 3ZCZA 4UQIM 4KZ7A 4HH2A 3NBLA 2G2WA 2JKRI 4H8RA 1S1YA 5TBMA 1BLPA 1J3WA 1Y28A 3C5AA 1ERMA 3V3RA 4U3TA 3MZDA 3O86A 2XSSA 3MZFA 5DF9A 2Y79A 1N9BA 5FDHA 2B18A 2ZL1A 4WN5A 4HNBA 4PAUA 1N4OA 4OLDA 5J3WA 5U47A 3SOIA 2R9WA 4IUHA 3UB8A 4O0PA 3B33A 5CERA 2OOLA 4C75A 1OPXA 3EQVA 1CJFA 1OTIA 2WKQA 4UA9A 3IXGA 3QP5A 4HI4A 3HVFA 2Z6DA 2I9VA 3QHYA 5FAOA 4CLCE 1ZHHB 1VETA 3PBTA 2WGIA 1NWZA 3WS2A 1D1JA 4NK3A 1TVFA 1NZUA 4L9EA 3BLMA 4OLGA 4A5RA 3IS2B 3UE1A 2M7VA 4FUWA 3OBFA 2HP9A 5IHVA 3NCKA 3NJAA 1TF1A 4NKPA 5FQ9A 3CPTA 2J3TC 2O9AA 3UB6A 2HP6A 1O07A 1JVJA 5FQKA 5HAIA 4PMAA 2FZ0A 1H3QA 2H28A 4BWIA 5IT5A 1CI8A 3DTMA 3EQUA 4XT2B 3ITAA 3MFDA 3Q07A 4EEUA 5F83A 5CEBA 3ZDJA 1MZUA 1CQAA 2H10A 1GCEA 4YOFA 1W63Q 4GD6A 1G68A 4KG6A 4O01A 1T1BA 4N9KA 4FSFA 4CLCB 1C3BA 2PD8A 4MDZA 2OLUA 4PHTA 1TDGA 4AFIA 4EWFA 4YINA 5A91A 4N1HA 3T1SA 4MBFA 1EWZA 2KX6A 1L0DA 2HDUA 2KDKA 4H6JB 4L0LA 2ZQDA 1XJ6A 3TOIA 4KENB 3EGXC 4DJ3A 1P9WA 3QP4A 3QP2A 2BLSA 5GLBA 3HBRA 1K25A 1I2WA 3TW8A 3LGOA 4R23A 3IF6A 3NOTC 5HDCA 1TEMA 2MJ6A 4JXSA 2L0WA 5EOOA 3LR0A 2W3EA 5FQQA 3DWKA 3S22A 4PKYA 3M2KA 1M6KA 3MJQA 3HLGA 2V0WA 2WADA 4OQIA 3N8LA 3ZFZA 3KSFA 3S7PA 4XXRA 3NECA 5KSHA 4WZ4A 3Q81A 1HZOA 1Y54A 1JTGA 4R3BA 4E3KA 1L3LA 3H82A 3NC8A 3S4XA 1IYQA 1W5DA 2B5RA 4NETA 4S2MA 2P9VB 5FL3A 4GHIB 1E3UA 4GCZA 4E3IA 4F3LA 4FD8A 4OPZA 1VEUA 3LIDA 2R78A 1DJAA 4EETB 2LB5A 4DKIA 1VQQA 2ZQCA 3O88A 1STZA 4GDNA 4D2OA 5GHYA 1YQSA 4Y7PA 2QJ5A 4N92A 4CQHA 2ZM0A 1IFQA 2XQZA 3PBNA 2DMWA 1E3UD 2WYXA 3SW1A 2FH5A 3LIBA 4E6WA 3SS3A 4RYEA 3HJKA 2EX9A 1G28A 1NLYA 3EOIA 5CECA 4CLCC 3RTYA 2W3FA 2GNXA 3NIAA 4BD1A 4S2LA 3D4FA 4LCMA 2XFSA 3T4TA 2O99A 3MMHA 3A0RA 2WUQA 1ONGA 4G3WA 1JWZA 3T50A 3OCNA 3H9WA 2Y8HA 4L9GA 5EV0A 5HL1A 2XLNA 5HW3A 1KOUA 5G4ZA 4GW9A 3ZG0A 4ARZB 4LPZA 3IXDA 5CHUA 1L0GA 3UMEA 4FCFA 4X56A 3KSGA 1VM1A 4Y0TA 2VGLM 3T4JA 3T1XA 3ZNYA 3T4QA 3VE4A 1OT9A 4WEKA 2Q9MA 2Y2JA 1WYCA 1XPBA 1YSPA 1DY6A 4DDYA 5CHMA 1NYYA 5F6AA 1WE4A 4Q8IA 4JBFA 3SH9A 3LEQA 2HP5A 4Q0JA 3HLDA 5G18A 5J4EA 4GLQA 2VA0A 2ZQ9A 1S6RA 5HPIA 5L09A 2PT7A 4BL2A 3B42A 3IWOA 4JXVA 2NUTC 2QKPA 2EWVA 4X6TA 4X55A 4EUVA 3MQOA 3KO6A 1TS8A 1L0EA 1HTZA 4P6ZM 3VOZA 1Z09A 3DTIA 1GHMA 1LL5A 5GHXA 1NZOA 3CUEC 3ZG8B 3OPPA 4IJGA 1PZPA 2J80A 4X25A 4PM7A 4S2NC 3QNCA 3M6HA 4CJNA 3S1YA 3WRZA 3MS6A 5FI7A 4D60A 2W3HA 4MN5A 4KG2A 1K55C 3DTEA 2L4RA 3F1OA 3RH8B 1MWUA 4PM9A 5CTMA 5EVID 4LV0A 5DJTA 1AWIA 1G6AA 3OCLA 1BZAA 4IVIA 1VB6A 2P04A 2CC1A 4JXWA 4DXBA 2Y2MA 4PM6A 4Y0OA 5E2HA 1DJBA 5FAQA 4UQIS 3C2WA 2QHKA 5M19A 4PKYG 5TJJA 2VGKA 3UE0A 2ZMFA 4HIAA 1PFLA 3CI6A 4ME4A 1TDLA 1KGEA 5TGFA 4L9FA 3C30A 5FQIA 3E0YA 3IX3A 3VFFA 2QZ6A 3VP3A 3DWZA 4O7DA 3ZQ5A 1CK3A 3GVBA 4DN0A 3OPLA 5L10A 5L2FA 1W8QA 5EOEA 1XA7A 1TS6A 4P87A 5GLCA 3UE6A 2OLVA 5EVIB 5E2GA 2RCXA 4OQ0A 3T4SA 1O7EA 5F82A 4OPRA 5DTSA 3Q7ZA 4OOMA 1M40A 3H7WA 3VV4A 1S66L 1FQGA 1LI0A 2JKTI 2X71A 2Y2HA 3MBZA 1DJCA 4DE0A 3BWLA 4HESA 2RL3A 1K54A 3MSHA 4MCWA 1J9MA 3VP2A 4FH4A 5L8MA 3WS5A 4LV1A 4KZAA 1W79A 3WS0A 2ZC5B 3G6OA 5I5LA 3BFGA 4EUZA 1LHYA 3IHAA 4KZ6A 2PU2A 3A3FA 2PYRA 4BBUA 5A92A 4MNRA 1SZVA 3LYXA 4WF0A 4EU0A 4IUKA 5GHZA 3UPPA 1OTDA 4QWOA 3F1PB 2JBFA 2JN7A 2FFYA 2ZBBA 4UEYA 1E25A 1YT4A 1L0FA 3HLWA 2JKRM 3L7HA 3G35A 1WA9A 2HDQA 1KGFA 3MZEA 1LSWA 1MPLA 3LIAA 4KUOA 1QMFA 3TRCA 2Y91A 5JYPA 2C6WB 3UO9A 4MN7A 1LI9A 4HH3A 1MC0A 5IS1A 5HWVA 1IYSA 5DTKA 3OZHA 1QMEA 3MXRA 3K2NA 4KZ3A 3VP0A 1PNEA 5L07A 1ES2A 1BULA 1KDWA 4BBVA 2WGWA 2O0YA 1AXBA 3PBQA 2Y2PA 5DTTA 1CF0A 1JWVA 1K6SA 3E2KA 1RCJA 4OPQA 5CGWA 4UAAA 4Z9QA 3ZYTA 1HD8A 3LUQA 2Z2LB 1YMXA 5HX9A 3ZGAB 4MN6A 3NULA 4R3AA 1OT6A 4PM8A 2H0YA 3C38A 1XXMA 3U2AA 1PI5A 3P98A 5HARA 1YLZA 4LCLA 5AQ9A 4K91A 5TBMB 2VV7A 2WKHA 4JKTA 3IX8A 3HJIA 3LEZA 5FI6A 3R7WA 3G34A 3HLBA 4HJ3A 3GSGA 4GKUA 4EXOA 3AGFA 3HUMA 4DDSA 4GS9A 1MWRA 2VLGA 1SDEA 1ALQA 2ZL1B 2D01A 3TG9A 2XDMA 4ZBEA 2Q0OA 1PIOA 1W8YA 1S4SA 2H5SA 2ZM2A 3ZVWA 5EFWA 3BQ8A 3VOLA 4BLMA 3V3SA 2EWWA 4E3OA 4RX3A 4DRTA 5E2FA 2UWXA 3LI9A 3PBRA 4MMNA 3OLOA 2PBYA 3DAVA 1LLBA 1VETB 2K7SA 4S2NA 3HCYA 4IBRA 5LBRA 3U4LP 3UDXA 1F2KA 4K08A 4NG2A 2ZLYA 4LLOB 1V9ZA 4BJPA 3W2ZA 3ITBA 4S2IA 3BLSA 3MXQA 4KG5A 4MEZA 4FH2A 3MFXA 1YPRA 3T12B 3A3EA 5FEFA 1T1CA 2I72A 1YLWA 3F1NA 3PR6A 1RGYA 3N7WA 3UB5P 2VZWA 5HAPA 1ZC2A 4Y0UA 4Y15A 2ACGA 3IT9A 4ESPA 3ICYA 4WMCA 4E6XA 3EEHA 4ZAMA 2C5WB 2PRFA 4BMWA 1H8ZA 3FKWA 3BYDA 4EBNA 3VSKA 2O9BA 1K57C 4P6BA 4R1GA 2Y2KA 4JF5A 4DE3A 1RGZA 1MWTA 2K2NA 3G2YA 1ONHA 4KQOA 2EXAA 2Y2OA 2ZQ7A 1UGUA 3E4QA 4DF6A 1BYWA 4GOGA 1GHIA 3UE3A 2VGLS 1P9RA 2P74A 3T1RA 2V1AA 5FDSA 4GB7A 2L1MA 3PAGA 3KX0X 2NUPC 1JTDA 3LR3A 2XROA 2V0UA 4E04A 1NRFA 2BG1A 3IF6B 2PD7A 4DJ2A 1DP6A 2OWJA 5TFQA 5C5KA 4OPYA 2VJWA 3ZHHA 2J9PA 2B02A 2QJ7A 1KDSA 1PW1A 4BENA 4OOYA 2WK0A 2PR5A 3IXHA 2JKFA 2FFFB 3LI8A 4R3JA 3VMAA 3ULFA 1P97A 4E3MA 1YKDA 3BFEA 2V1ZA 1GSVA 2IWBA 3UNWA 2EX2A 4JGPA 4P6ZS 3FC7A 1ZG4A 1JWPA 4R6LA 4U0TA 3KSHA 1FCNA 2J3WA 3Q7VA 5DKKA 4BD0A 4HBUA 3H82B 5HWTA 3UDFA 4JGQA 1TS7A 3BECA 5CX7A 3ZVTA 1IOUA 5DF7A 1ZKJA 2HJ9C 5A93A
chains in the Genus database with same CATH topology
4PKYG 4HI4A 3FPWA 5TJJA 2Z6DA 3PXPA 4F3LB 2I9VA 3FPVA 3T4LA 4CLCE 2GJ3A 1ZHHB 2ZMFA 4HIAA 4WLAA 3CI6A 4ME4A 3PBTA 1NWZA 2D02A 4L9FA 3C30A 1F98A 3LIFA 4LRZE 3S7OA 3E0YA 4YWZA 5HPFA 2KLIA 4L9EA 3ZQ5A 3IS2B 1S1ZA 4DN0A 3P7NA 2M7VA 3R7WB 3OBFA 3BY8A 1ODVA 2ZOHA 5DKLA 3NJAA 1TF1A 1TS6A 4NKPA 3UE6A 3K3DA 2EA9A 3BQAA 4GS9B 2BASA 2J3TC 2O9AA 3UB6A 2XRNA 3T4SA 4ARZA 2FZ0A 4I3JA 4OOMA 1H3QA 3H7WA 2H28A 4BWIA 1V9YA 2G7UA 4I5SA 3VV4A 1S66L 2JKTI 2XA7M 5IT5A 1N9NA 3EQUA 5HWWA 4XT2B 3LIEA 4LRXC 3BWLA 4EEUA 1GSWA 1MZUA 4YOFA 3D3OA 3UB9A 4JGOA 3JVUA 1W63Q 3IBRA 4MCWA 3A0VA 2INWA 2HJEA 2W1RA 2W3DA 4I3IA 5L8MA 4I39A 2O9CA 5DFYA 2PYPA 4O01A 1T1BA 4I38A 4FSFA 2M7UA 1NLZA 4CLCB 2PD8A 1T18A 4MDZA 4PHTA 3G6OA 5I5LA 1VHMA 1EW0A 3R4KA 3MQQA 4AFIA 5F68A 3TJZC 3BJNA 3E4PA 3PYPA 2PYRA 4BBUA 1MKMA 2W1TA 3LYXA 4G3VA 4WF0A 2J3TD 4EU0A 2GZAA 2KX6A 4IUKA 2XA7S 2KDKA 4H6JB 3VE3A 1OTDA 3F1PB 4L0LA 2JN7A 2ZBBA 4UEYA 1GSXA 1XJ6A 2W3GA 3F1NB 4O8GA 3EGXC 4DJ3A 2JKRM 3MR0A 3NOUC 1P9WA 1WA9A 2PDRA 1D7EA 3LR5A 3MF0A 3P01A 1LSWA 3LIAA 4KUOA 2A24A 2WKRA 4RQ9A 3TW8A 1X0OA 2JHEA 3TRCA 3NOTC 5HDCA 1S67L 1P0ZA 2MJ6A 5G4YA 4Q0IA 2GX5A 2L0WA 3LR0A 1G6OA 4MN7A 2W3EA 4HH3A 1MC0A 5IS1A 5HWVA 4NXGA 2ZMVA 4HP9A 4PKYA 1OTEA 2K31A 5KIZA 1YAXA 3MJQA 2A2LA 3K2NA 1OTBA 5DFXA 4Y3IA 4HQAA 2V0WA 2QYBA 4LRYC 5HDDA 3BW6A 3KSFA 3S7QA 3S7PA 4BBTA 2M1CA 1T19A 5KSHA 5F5YA 3S7NA 4BBVA 2O0YA 3K3CA 1D06A 3PBQA 2V9AA 1OTAA 3H82A 5HD5A 5F69A 2VKSA 1T1AA 4HHDA 3GDIA 3ZYTA 3NOPC 3LFVA 3LUQA 3GECA 3KSIA 5FL3A 4GHIB 4MN6A 1S4RA 4GCZA 4F3LA 3DBAA 4R3AA 1OT6A 1LL8A 3LR4A 3C38A 1LSVA 3LIDA 3U2AA 2R78A 4EETB 2LB5A 1JNUA 2VEAA 4M4XA 4HOIA 5TBMB 4R38A 1STZA 2VV7A 4GJ4A 4EESA 3IS2A 4B9OA 5HSQA 4WL9A 2W0NA 3HJIA 3R7WA 2QJ5A 2JKTM 1UWPX 4HJ3A 4EXOA 4KQDA 4CQHA 4HP4A 1IFQA 3CLOA 1TD5A 3OC2A 3PBNA 4KUKA 2DMWA 4GS9A 1N9LA 2VLGA 2ZOIA 3SW1A 2FH5A 3IBJA 1OJGA 3LIBA 2D01A 5K5BA 3LICA 2Z6CA 3PBOA 2OAQ1 2OWHA 1S4SA 3HJKA 1N9OA 5A8BA 2VV6A 1H8MA 4XT2A 4WUJA 5EFWA 3BQ8A 1F5MA 3VOLA 1G28A 1NLYA 3EOIA 3TE8A 2EWWA 3V67A 1UWNX 4CLCC 2IA2A 3KYQA 3LI9A 4Q0HA 2W3FA 3RTYA 1ZTUA 2GNXA 3PBRA 3OLOA 4MMNA 4ETXA 4WELA 1DP9A 2K7SA 5HZHA 1TS0A 4NXEA 3HCYA 3D72A 4EQ1A 4CLCA 3T4TA 5LBRA 2O99A 1W63M 3MMHA 2WKPA 3A0RA 2PHYA 4G3WA 3T50A 4K08A 3OCNA 4LLOB 5HDSA 3EGDC 5HD3A 1V9ZA 1XFQA 4BJPA 3H9WA 3W2ZA 2W27A 3MXQA 4HJ6A 4H6JA 3T4OA 2Y8HA 4L9GA 3F1PA 5MC7A 3MFXA 2OAP1 1KOUA 1T1CA 3F1NA 5G4ZA 4ETZA 2YKHA 3PR6A 4GW9A 2HF6A 2HV1A 4ARZB 4LPZA 1OJ5A 2LB9A 2VZWA 4I3AA 3UMEA 2QWSA 3H7WB 4CLCD 3KSGA 3PHYA 4Y2FA 1DRMA 1F9IA 4QPRA 3ICYA 2VGLM 4Y5FA 3T4JA 2VV8A 4FOFA 3EEHA 3T4QA 5IU1A 4BMWA 4EEPA 4YNRA 3VE4A 1OT9A 3UMDA 4WEKA 2P08A 4NXBA 4NEED 2O9BA 3C8CA 1YSPA 5DJUA 5F6AA 2K2NA 3OOVA 4KQOA 5AJGA 1UGUA 3UB7A 4Q0JA 4B93A 3E4QA 4HJ4A 3E4OA 5AVEA 2W1TB 1BYWA 4EERA 3FG8A 5J4EA 4GLQA 2VA0A 3F1OB 4ZRRA 5HPIA 3CWFA 3EWKA 2PT7A 5HL6A 2HGVA 3UE3A 3MQ0A 2VGLS 3B42A 1P9RA 3KYZA 2CMNA 3RFBA 2NUTC 2QKPA 2V1AA 1XJ3A 3PBSA 2EWVA 2VX8A 2L1MA 1DP8A 4EUVA 3MQOA 2P7JA 3KX0X 2NUPC 2XROA 3KO6A 3LR3A 1TS8A 4G3KA 2V0UA 3NHQA 4R70A 3T4KA 4E04A 4P6ZM 3EEAA 2A24B 2PR6A 3CITA 5J7EA 4DMZA 4GHIA 3BY9A 1NRJA 2PD7A 2YKFA 3CUEC 4DJ2A 1DP6A 1LT0A 4II7A 2OWJA 5C5KA 1YSQA 4IJGA 2VJWA 2J80A 4UQIM 2B02A 2QJ7A 3O5YA 4HH2A 2JKRI 4HY8A 1S1YA 2W3HA 4MN5A 5TBMA 1XJ2A 3CUEA 2KOIA 2PR5A 2L4RA 3F1OA 3RH8B 3LI8A 2V1BA 1Y28A 3ULFA 3JVVA 5DJTA 1P97A 4WEJA 3CAXA 1XFNA 1YKDA 2XSSA 4JGRA 1GSVA 3OCLA 5DF9A 2Y79A 4JGPA 4P6ZS 2B18A 1VB6A 3FC7A 2P04A 1LSXA 4WN5A 4HNBA 4PAUA 3A0SA 4R6LA 4Z1WA 3KSHA 5DKKA 2J3WA 3B47A 5J3WA 3H82B 4IUHA 5HWTA 3UB8A 4JGQA 1TS7A 4O0PA 4IHQA 1XJ4A 3B33A 2OOLA 5CX7A 1IOUA 1OPXA 3EQVA 4OOLA 2HJ9C 4UQIS 4NXFA 1OTIA 5AVFA 3E98A 3C2WA 4EW7A 2WKQA 2QHKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PKY G;  4HI4 A;  2Z6D A;  4F3L B;  2I9V A;  2GJ3 A;  4HIA A;  4WLA A;  1NWZ A;  2D02 A;  4L9F A;  1F98 A;  3LIF A;  4LRZ E;  4YWZ A;  4L9E A;  3ZQ5 A;  3IS2 B;  1S1Z A;  3P7N A;  3BY8 A;  1ODV A;  2ZOH A;  5DKL A;  3NJA A;  1TS6 A;  3UE6 A;  3K3D A;  2EA9 A;  4GS9 B;  2BAS A;  3UB6 A;  4I3J A;  3H7W A;  2H28 A;  1V9Y A;  4I5S A;  1S66 L;  1N9N A;  5HWW A;  4XT2 B;  3LIE A;  4LRX C;  3BWL A;  4EEU A;  1GSW A;  1MZU A;  3UB9 A;  4JGO A;  3IBR A;  3A0V A;  2INW A;  4I3I A;  4I39 A;  2PYP A;  1T1B A;  4I38 A;  2PD8 A;  1T18 A;  3G6O A;  5I5L A;  1EW0 A;  3MQQ A;  5F68 A;  3E4P A;  3PYP A;  2PYR A;  4BBU A;  4WF0 A;  3LYX A;  2KX6 A;  2KDK A;  4H6J B;  3VE3 A;  1OTD A;  3F1P B;  2JN7 A;  2ZBB A;  1GSX A;  1XJ6 A;  3F1N B;  4DJ3 A;  3MR0 A;  3NOU C;  1WA9 A;  2PDR A;  1D7E A;  1LSW A;  3LIA A;  4KUO A;  2A24 A;  2WKR A;  4RQ9 A;  1X0O A;  2JHE A;  3NOT C;  5HDC A;  1S67 L;  1P0Z A;  5G4Y A;  2L0W A;  4HH3 A;  5IS1 A;  5HWV A;  4NXG A;  4HP9 A;  4PKY A;  1OTE A;  5KIZ A;  3MJQ A;  1OTB A;  4HQA A;  2V0W A;  4LRY C;  5HDD A;  4BBT A;  2M1C A;  1T19 A;  5F5Y A;  4BBV A;  3K3C A;  1D06 A;  2V9A A;  1OTA A;  3H82 A;  5HD5 A;  5F69 A;  1T1A A;  4HHD A;  3GDI A;  3NOP C;  3LUQ A;  3GEC A;  4GHI B;  4MN6 A;  1S4R A;  4GCZ A;  4F3L A;  4R3A A;  1OT6 A;  1LL8 A;  1LSV A;  3LID A;  2R78 A;  4EET B;  1JNU A;  2VEA A;  4M4X A;  4HOI A;  5TBM B;  4R38 A;  2VV7 A;  4EES A;  3IS2 A;  4B9O A;  5HSQ A;  4WL9 A;  2W0N A;  3HJI A;  2QJ5 A;  1UWP X;  4HJ3 A;  4EXO A;  4KQD A;  4HP4 A;  3CLO A;  4KUK A;  4GS9 A;  1N9L A;  2VLG A;  2ZOI A;  3SW1 A;  1OJG A;  3LIB A;  2D01 A;  3LIC A;  2Z6C A;  2OWH A;  1S4S A;  3HJK A;  1N9O A;  5A8B A;  2VV6 A;  4XT2 A;  4WUJ A;  5EFW A;  3VOL A;  1G28 A;  1UWN X;  3LI9 A;  3RTY A;  3OLO A;  1DP9 A;  2K7S A;  5HZH A;  1TS0 A;  4NXE A;  3D72 A;  4EQ1 A;  2WKP A;  3A0R A;  2PHY A;  3T50 A;  4K08 A;  4LLO B;  5HDS A;  5HD3 A;  1V9Z A;  1XFQ A;  3H9W A;  2W27 A;  3MXQ A;  4HJ6 A;  4H6J A;  4L9G A;  3F1P A;  3MFX A;  1KOU A;  1T1C A;  3F1N A;  5G4Z A;  2YKH A;  4GW9 A;  2HV1 A;  4LPZ A;  1OJ5 A;  4I3A A;  3UME A;  2QWS A;  3H7W B;  3PHY A;  1DRM A;  1F9I A;  3ICY A;  2VV8 A;  3EEH A;  5IU1 A;  4EEP A;  3VE4 A;  1OT9 A;  3UMD A;  4NXB A;  3C8C A;  5DJU A;  5F6A A;  1UGU A;  3UB7 A;  3E4Q A;  4HJ4 A;  3E4O A;  5AVE A;  1BYW A;  4EER A;  3FG8 A;  5J4E A;  3F1O B;  3CWF A;  3EWK A;  2CMN A;  2QKP A;  2V1A A;  1XJ3 A;  2L1M A;  1DP8 A;  3MQO A;  2P7J A;  3KX0 X;  1TS8 A;  2V0U A;  3NHQ A;  4R70 A;  4E04 A;  2A24 B;  2PR6 A;  5J7E A;  4GHI A;  3BY9 A;  2PD7 A;  2YKF A;  4DJ2 A;  1DP6 A;  1LT0 A;  2OWJ A;  2J80 A;  2B02 A;  2QJ7 A;  4HH2 A;  4HY8 A;  1S1Y A;  4MN5 A;  5TBM A;  1XJ2 A;  2PR5 A;  2L4R A;  3F1O A;  3RH8 B;  3LI8 A;  2V1B A;  1Y28 A;  3ULF A;  5DJT A;  1P97 A;  3CAX A;  1XFN A;  4JGR A;  1GSV A;  4JGP A;  1VB6 A;  3FC7 A;  1LSX A;  4WN5 A;  4HNB A;  3A0S A;  4R6L A;  5DKK A;  5J3W A;  3H82 B;  5HWT A;  3UB8 A;  4JGQ A;  1TS7 A;  1XJ4 A;  3B33 A;  2OOL A;  4NXF A;  1OTI A;  5AVF A;  3C2W A;  4EW7 A;  2WKQ A;  2QHK A; 
#chains in the Genus database with same CATH topology
 4JF4 A;  2EFU A;  4N9L A;  3PXP A;  4F3L B;  2GDN A;  3T4L A;  5J8X A;  1VEU B;  5CRF A;  3RXW A;  4S2K A;  2XD5 A;  3PAE A;  1MWS A;  3T1Q B;  3LIF A;  4LRZ E;  5HFO A;  4YWZ A;  5HPF A;  1E4D A;  1XGI A;  2E8J A;  1IKG A;  3A3J A;  3P7N A;  4Y13 A;  2G2U A;  3BY8 A;  4WYY A;  3VOY A;  3WS4 A;  3ZG7 B;  2DRW A;  2JC7 A;  3K3D A;  3BQA A;  2BAS A;  2ZC6 B;  3WRT A;  1PRQ A;  1SKO A;  4LGW A;  4EBL A;  1YLT A;  4KZ5 A;  1K0K A;  4E3L A;  4I5S A;  2XA7 M;  5TR7 A;  1N9N A;  5HWW A;  4LRX C;  1GSW A;  5F1F A;  3UB9 A;  3JVU A;  2VK3 A;  4K0X A;  2Q9N A;  3A3D A;  3NDE A;  1ERQ A;  5GL9 A;  4P85 A;  2OV5 A;  2INW A;  2W1R A;  4I3I A;  2O9C A;  5DFY A;  2PYP A;  3CG5 A;  1YLY A;  1EW0 A;  3R4K A;  3MQQ A;  5CXW A;  5JYO A;  3GQZ A;  3BJN A;  3E4P A;  2IWC A;  1MKM A;  2WZX A;  2W1T A;  2J3T D;  2H0T A;  5AQA A;  5CGS A;  2GZA A;  3HUN A;  1ES4 A;  4K0W A;  1XKZ A;  2W3G A;  3IF6 C;  1YM1 A;  3NOU C;  3QNB A;  5EVL A;  4M3K A;  3P01 A;  3IH8 A;  1WYB A;  1KGG A;  2A24 A;  4XUX A;  4QU3 A;  3FV7 A;  3HL9 A;  1IYP A;  1P0Z A;  1MXO A;  4Q0I A;  2GX5 A;  3G32 A;  2ZC7 A;  4OQH A;  5CGX A;  3C4O A;  4NXG A;  1OME A;  2K31 A;  3W4O A;  4QY6 A;  1OTB A;  4Y3I A;  1SDN A;  3HLC A;  3NDG A;  4LRY C;  1NJ4 A;  5HDD A;  3BW6 A;  3S7Q A;  3O87 A;  1NY0 A;  2M1C A;  1T19 A;  4X1M A;  1IEM A;  3S7N A;  1FSW A;  1BTL A;  3K3C A;  4ZTK A;  1FCM A;  1NYM A;  4KZ8 A;  2V9A A;  3ISG A;  1XA1 A;  4ID4 A;  4ZDX A;  5F69 A;  1RP5 A;  1GA9 A;  4HHD A;  3GDI A;  3NOP C;  3LFV A;  4RVA A;  1H8Y A;  2PU4 A;  3W4P A;  3GEC A;  2XEP A;  3KSI A;  4EBP A;  3SH8 A;  3V39 A;  1S4R A;  2WKE A;  3I7J A;  3VSL A;  4JF6 A;  3GMW A;  3LR4 A;  2QPN A;  2A49 A;  1JNU A;  4M4X A;  1FSY A;  3A3I A;  1IYO A;  4R38 A;  2J9O A;  5KZH A;  4GJ4 A;  4EES A;  3N8S A;  3IS2 A;  4B9O A;  5HSQ A;  1GA0 A;  4WL9 A;  4X68 A;  1CI9 A;  2JKT M;  4F94 A;  1UWP X;  4OQG A;  4KQD A;  4HP4 A;  2JKG A;  4RA7 A;  3AGD A;  3CLO A;  1TD5 A;  3OC2 A;  2E8I A;  1N9L A;  3MKF A;  2ZOI A;  1OJG A;  2V8C A;  5K5B A;  3HLE A;  4YFM A;  3M2J A;  2OAQ 1;  2OWH A;  3C7U A;  4QY5 A;  1ESI A;  1ES3 A;  3IH9 A;  1H5X A;  2UV0 E;  2HDR A;  3L9K A;  5A8B A;  2VV6 A;  3HRE A;  1K38 A;  1H8M A;  4XT2 A;  4WUJ A;  4X1L A;  1YLP A;  2EX6 A;  1KE0 A;  3TE8 A;  3SS5 A;  1UWN X;  2JCH A;  3BFC A;  3KYQ A;  1ZTU A;  4UHU A;  4P0M A;  5GLD A;  3CZD A;  4KZ9 A;  1DP9 A;  1TS0 A;  4NXE A;  1XP4 A;  5CHJ A;  4CLC A;  4EQ1 A;  2J8Y A;  3Q1F A;  3UN7 A;  2PHY A;  2Y2G A;  4PPR A;  1W7F A;  3KYE A;  3EGD C;  5HDS A;  1LL9 A;  2W27 A;  5CED A;  3JYI A;  4S2P A;  4H6J A;  3QP8 A;  3G2Z A;  3DTK A;  5MC7 A;  2OAP 1;  5DVA A;  4ETZ A;  2HF6 A;  3G4P A;  3IWQ A;  4WZ5 C;  3G30 A;  3H7W B;  4CLC D;  1FOF A;  4Y2F A;  1DRM A;  4JXG A;  3RJU A;  4QD4 A;  2Y59 A;  4R0Q A;  3O3V A;  4Y5F A;  3BFF A;  3CMZ A;  2HPB A;  4X53 A;  5IU1 A;  4YNR A;  3FZC A;  4UA7 A;  2P08 A;  4ZJ2 A;  4NXB A;  4N1X A;  4KQQ A;  4NEE D;  2IWD A;  5DJU A;  3IWI A;  1NXY A;  3UB7 A;  1XGJ A;  2PBD P;  4HJ4 A;  2XD1 A;  4EER A;  5EVE A;  3FG8 A;  1EI5 A;  1A0K A;  2XK1 A;  4ZRR A;  5EVI C;  2JE5 A;  2HGV A;  1ERO A;  3MQ0 A;  3CJM A;  3FYZ A;  2CMN A;  1FIK A;  4RX2 A;  3VP1 A;  2VX8 A;  2P7J A;  5FAP A;  1FIL A;  2EX8 A;  2EXB A;  3T4K A;  1K56 A;  3V50 A;  4OKP A;  3CIT A;  5J7E A;  2P9V A;  4DMZ A;  4FTX A;  4GHI A;  1NRJ A;  3B3X A;  3RXX A;  4II7 A;  4LV3 A;  3GR2 A;  1YSQ A;  2PAV P;  2Y2L A;  4IBX A;  3O5Y A;  1KE3 A;  4CPK A;  2X01 A;  4HY8 A;  1K4E A;  3IF5 A;  1XJ2 A;  3CUE A;  2KOI A;  5HAQ A;  1XX2 A;  2V1B A;  1PZO A;  3JVV A;  4X69 A;  4E3N A;  4WEJ A;  3CAX A;  1K56 D;  4QB8 A;  1CEF A;  1XFN A;  1K55 A;  4JGR A;  2Y55 A;  2WGW B;  2Y4A A;  3HLF A;  3VP4 A;  4KQR A;  3NI9 A;  5BOH A;  1LSX A;  3A0S A;  3LCE A;  4Z1W A;  3B47 A;  3CPT B;  4IHQ A;  1XJ4 A;  1MKI A;  5FI2 A;  4OOL A;  4NXF A;  3MXS A;  1K6R A;  5AVF A;  3E98 A;  4EW7 A;  5FQJ A;  2WAF A;  3FPW A;  1BLS A;  5D3O A;  3UPN A;  3LY4 A;  3FPV A;  3GV9 A;  2GJ3 A;  4WLA A;  2WAE A;  1FCO A;  1MY8 A;  2D02 A;  4OH0 A;  1F98 A;  3N6I A;  3S7O A;  1ESU A;  2KLI A;  3IXB A;  1BLC A;  1S1Z A;  3R7W B;  2Y2Q A;  1KE4 A;  3CHW P;  3BEB A;  1ODV A;  2ZOH A;  5DKL A;  5M18 A;  2Y2N A;  2ZQA A;  5F1G A;  2EA9 A;  2ZC3 B;  1Y4O A;  4GS9 B;  3SH7 A;  1YMS A;  4MBK A;  5EM0 A;  2XRN A;  4ARZ A;  4MLL A;  3ZNT A;  4I3J A;  1K54 C;  1V9Y A;  2G7U A;  4WMC D;  3LIE A;  2ZM8 A;  3D3O A;  2ZQ8 A;  4JGO A;  4XUZ A;  1BLH A;  3IBR A;  4EQI A;  3BFD A;  1I2S A;  4DXC A;  3A0V A;  1Z6F A;  2HJE A;  2W3D A;  4GNU A;  4I39 A;  4KZ4 A;  4I38 A;  1HLU P;  2M7U A;  1NLZ A;  4UA6 A;  1T18 A;  1ACF A;  1VHM A;  3OPH A;  3HUO A;  5FSR A;  5F68 A;  3TJZ C;  1BSG A;  1BUE A;  2WKI A;  3N4I A;  3PYP A;  5E2E A;  4G3V A;  1KVL A;  3VFH A;  2XA7 S;  2OSU A;  3VE3 A;  1IEL A;  2DNS A;  2X02 A;  4C3Q A;  1GSX A;  5EEC A;  3F1N B;  4R4S A;  4S2J A;  4O8G A;  1SKF A;  3MR0 A;  2PDR A;  1D7E A;  3LR5 A;  3MF0 A;  4OVD A;  4WM9 A;  4QJG A;  2WGV A;  2XGN A;  4DE2 A;  2WKR A;  4RQ9 A;  1U60 A;  1X0O A;  2JHE A;  5KSC A;  2EFX A;  3OPR A;  5KMW A;  2ZD8 A;  3TSG A;  1S67 L;  5G4Y A;  1FR1 A;  1G6O A;  2V8F A;  3IHB A;  4B4X A;  3QP6 A;  4KZB A;  2R9X A;  2ZMV A;  4HP9 A;  1OTE A;  5KIZ A;  1YAX A;  2A2L A;  5DFX A;  5M1A A;  4HQA A;  2QYB A;  1I5Q A;  5CTN A;  4BBT A;  4HEF A;  5F5Y A;  5A90 A;  1FR6 A;  1CEG A;  1D06 A;  1GHP A;  3QP1 A;  3V5M A;  3LO7 A;  1L2S A;  4EV4 A;  2VGJ A;  3WS1 A;  2XR0 A;  1ZG6 A;  1OTA A;  2QMI A;  3WWX A;  1ES5 A;  4WZ5 A;  5HD5 A;  2VKS A;  2XFT A;  1T1A A;  3C7V A;  4GD8 A;  2ZMA A;  4S2O A;  5GLA A;  5FAS A;  2DCF A;  5FA7 A;  2HZ5 A;  3DBA A;  3N8R A;  4QHC A;  3ZG9 B;  1LL8 A;  4DE1 A;  1LSV A;  4GZB A;  1H0M A;  2VEA A;  4HOI A;  5EUA A;  2J7V A;  3M6B A;  1PI4 A;  4E3J A;  4U0X A;  2W0N A;  4Y17 A;  4JPM A;  4OP5 A;  4JLF A;  2XH9 A;  4KUK A;  5EVI A;  3IBJ A;  1G5U A;  3LIC A;  2B95 A;  2Z6C A;  3Q7V B;  3PBO A;  4LEN A;  3DW0 A;  1N9O A;  2XF3 A;  4BQM A;  1F5M A;  5EE8 A;  1PW8 A;  4MBH A;  3V67 A;  2IA2 A;  4Q0H A;  4ETX A;  2WZZ A;  4ZJ1 A;  3BM6 A;  3FWL A;  4WEL A;  3JPU A;  1PWC A;  5HZH A;  3IX4 A;  2ZJ9 A;  3D72 A;  3G31 A;  4IVK A;  4LV2 A;  1W63 M;  2WKP A;  2ZC4 B;  3ZG5 A;  5EPH A;  5DF8 A;  2Y2I A;  5HD3 A;  3PTE A;  5E43 A;  1XFQ A;  1KVM A;  3D9Y A;  4OP8 A;  1BT5 A;  3GRJ A;  3FKV A;  4HJ6 A;  3C4P A;  1PWD A;  3T4O A;  3F1P A;  3Q82 A;  4WBG A;  5AQ7 A;  3E2L A;  3AGE A;  2V2F F;  3W4Q A;  2YKH A;  1SKO B;  2HV1 A;  1YLJ A;  5I94 A;  1OJ5 A;  2Z2M B;  2LB9 A;  4I3A A;  2QWS A;  3PHY A;  4LFU A;  1S0W A;  1F9I A;  4QPR A;  3IQA A;  2VV8 A;  4C6Y A;  4FOF A;  2HDS A;  1HVB A;  4GDB A;  4R4R A;  3SS4 A;  4EEP A;  4OON A;  3UMD A;  3UPO A;  3MKE A;  3UDI A;  4BL3 A;  5FAT A;  3UY6 A;  3C8C A;  3NY4 A;  1MBL A;  4ZJ3 A;  3OOV A;  3P09 A;  5FQM A;  5AJG A;  3BRM A;  1SCW A;  4IED A;  3GTC A;  4B93 A;  3E4O A;  4GN2 A;  1K57 A;  1PYY A;  2W1T B;  5AVE A;  4HBT A;  4B4Z A;  2A3U A;  2BTF P;  5AQB A;  3F1O B;  3CWF A;  3EWK A;  1SHV A;  5HL6 A;  3KYZ A;  3RFB A;  3W8K A;  3SZT A;  1XJ3 A;  3PBS A;  1IKI A;  5FEG A;  1K4F A;  1DP8 A;  2AVX A;  3LY3 A;  4PM5 A;  5EM1 A;  4G3K A;  3NHQ A;  4R70 A;  3EEA A;  4B88 A;  2A24 B;  2PR6 A;  3BY9 A;  1Q2Q A;  2YKF A;  1PWG A;  1Q2P A;  1LT0 A;  2V20 A;  3ZCZ A;  4UQI M;  4KZ7 A;  4HH2 A;  3NBL A;  2G2W A;  2JKR I;  4H8R A;  1S1Y A;  5TBM A;  1BLP A;  1J3W A;  1Y28 A;  3C5A A;  1ERM A;  3V3R A;  4U3T A;  3MZD A;  3O86 A;  2XSS A;  3MZF A;  5DF9 A;  2Y79 A;  1N9B A;  5FDH A;  2B18 A;  2ZL1 A;  4WN5 A;  4HNB A;  4PAU A;  1N4O A;  4OLD A;  5J3W A;  5U47 A;  3SOI A;  2R9W A;  4IUH A;  3UB8 A;  4O0P A;  3B33 A;  5CER A;  2OOL A;  4C75 A;  1OPX A;  3EQV A;  1CJF A;  1OTI A;  2WKQ A;  4UA9 A;  3IXG A;  3QP5 A;  4HI4 A;  3HVF A;  2Z6D A;  2I9V A;  3QHY A;  5FAO A;  4CLC E;  1ZHH B;  1VET A;  3PBT A;  2WGI A;  1NWZ A;  3WS2 A;  1D1J A;  4NK3 A;  1TVF A;  1NZU A;  4L9E A;  3BLM A;  4OLG A;  4A5R A;  3IS2 B;  3UE1 A;  2M7V A;  4FUW A;  3OBF A;  2HP9 A;  5IHV A;  3NCK A;  3NJA A;  1TF1 A;  4NKP A;  5FQ9 A;  3CPT A;  2J3T C;  2O9A A;  3UB6 A;  2HP6 A;  1O07 A;  1JVJ A;  5FQK A;  5HAI A;  4PMA A;  2FZ0 A;  1H3Q A;  2H28 A;  4BWI A;  5IT5 A;  1CI8 A;  3DTM A;  3EQU A;  4XT2 B;  3ITA A;  3MFD A;  3Q07 A;  4EEU A;  5F83 A;  5CEB A;  3ZDJ A;  1MZU A;  1CQA A;  2H10 A;  1GCE A;  4YOF A;  1W63 Q;  4GD6 A;  1G68 A;  4KG6 A;  4O01 A;  1T1B A;  4N9K A;  4FSF A;  4CLC B;  1C3B A;  2PD8 A;  4MDZ A;  2OLU A;  4PHT A;  1TDG A;  4AFI A;  4EWF A;  4YIN A;  5A91 A;  4N1H A;  3T1S A;  4MBF A;  1EWZ A;  2KX6 A;  1L0D A;  2HDU A;  2KDK A;  4H6J B;  4L0L A;  2ZQD A;  1XJ6 A;  3TOI A;  4KEN B;  3EGX C;  4DJ3 A;  1P9W A;  3QP4 A;  3QP2 A;  2BLS A;  5GLB A;  3HBR A;  1K25 A;  1I2W A;  3TW8 A;  3LGO A;  4R23 A;  3IF6 A;  3NOT C;  5HDC A;  1TEM A;  2MJ6 A;  4JXS A;  2L0W A;  5EOO A;  3LR0 A;  2W3E A;  5FQQ A;  3DWK A;  3S22 A;  4PKY A;  3M2K A;  1M6K A;  3MJQ A;  3HLG A;  2V0W A;  2WAD A;  4OQI A;  3N8L A;  3ZFZ A;  3KSF A;  3S7P A;  4XXR A;  3NEC A;  5KSH A;  4WZ4 A;  3Q81 A;  1HZO A;  1Y54 A;  1JTG A;  4R3B A;  4E3K A;  1L3L A;  3H82 A;  3NC8 A;  3S4X A;  1IYQ A;  1W5D A;  2B5R A;  4NET A;  4S2M A;  2P9V B;  5FL3 A;  4GHI B;  1E3U A;  4GCZ A;  4E3I A;  4F3L A;  4FD8 A;  4OPZ A;  1VEU A;  3LID A;  2R78 A;  1DJA A;  4EET B;  2LB5 A;  4DKI A;  1VQQ A;  2ZQC A;  3O88 A;  1STZ A;  4GDN A;  4D2O A;  5GHY A;  1YQS A;  4Y7P A;  2QJ5 A;  4N92 A;  4CQH A;  2ZM0 A;  1IFQ A;  2XQZ A;  3PBN A;  2DMW A;  1E3U D;  2WYX A;  3SW1 A;  2FH5 A;  3LIB A;  4E6W A;  3SS3 A;  4RYE A;  3HJK A;  2EX9 A;  1G28 A;  1NLY A;  3EOI A;  5CEC A;  4CLC C;  3RTY A;  2W3F A;  2GNX A;  3NIA A;  4BD1 A;  4S2L A;  3D4F A;  4LCM A;  2XFS A;  3T4T A;  2O99 A;  3MMH A;  3A0R A;  2WUQ A;  1ONG A;  4G3W A;  1JWZ A;  3T50 A;  3OCN A;  3H9W A;  2Y8H A;  4L9G A;  5EV0 A;  5HL1 A;  2XLN A;  5HW3 A;  1KOU A;  5G4Z A;  4GW9 A;  3ZG0 A;  4ARZ B;  4LPZ A;  3IXD A;  5CHU A;  1L0G A;  3UME A;  4FCF A;  4X56 A;  3KSG A;  1VM1 A;  4Y0T A;  2VGL M;  3T4J A;  3T1X A;  3ZNY A;  3T4Q A;  3VE4 A;  1OT9 A;  4WEK A;  2Q9M A;  2Y2J A;  1WYC A;  1XPB A;  1YSP A;  1DY6 A;  4DDY A;  5CHM A;  1NYY A;  5F6A A;  1WE4 A;  4Q8I A;  4JBF A;  3SH9 A;  3LEQ A;  2HP5 A;  4Q0J A;  3HLD A;  5G18 A;  5J4E A;  4GLQ A;  2VA0 A;  2ZQ9 A;  1S6R A;  5HPI A;  5L09 A;  2PT7 A;  4BL2 A;  3B42 A;  3IWO A;  4JXV A;  2NUT C;  2QKP A;  2EWV A;  4X6T A;  4X55 A;  4EUV A;  3MQO A;  3KO6 A;  1TS8 A;  1L0E A;  1HTZ A;  4P6Z M;  3VOZ A;  1Z09 A;  3DTI A;  1GHM A;  1LL5 A;  5GHX A;  1NZO A;  3CUE C;  3ZG8 B;  3OPP A;  4IJG A;  1PZP A;  2J80 A;  4X25 A;  4PM7 A;  4S2N C;  3QNC A;  3M6H A;  4CJN A;  3S1Y A;  3WRZ A;  3MS6 A;  5FI7 A;  4D60 A;  2W3H A;  4MN5 A;  4KG2 A;  1K55 C;  3DTE A;  2L4R A;  3F1O A;  3RH8 B;  1MWU A;  4PM9 A;  5CTM A;  5EVI D;  4LV0 A;  5DJT A;  1AWI A;  1G6A A;  3OCL A;  1BZA A;  4IVI A;  1VB6 A;  2P04 A;  2CC1 A;  4JXW A;  4DXB A;  2Y2M A;  4PM6 A;  4Y0O A;  5E2H A;  1DJB A;  5FAQ A;  4UQI S;  3C2W A;  2QHK A;  5M19 A;  4PKY G;  5TJJ A;  2VGK A;  3UE0 A;  2ZMF A;  4HIA A;  1PFL A;  3CI6 A;  4ME4 A;  1TDL A;  1KGE A;  5TGF A;  4L9F A;  3C30 A;  5FQI A;  3E0Y A;  3IX3 A;  3VFF A;  2QZ6 A;  3VP3 A;  3DWZ A;  4O7D A;  3ZQ5 A;  1CK3 A;  3GVB A;  4DN0 A;  3OPL A;  5L10 A;  5L2F A;  1W8Q A;  5EOE A;  1XA7 A;  1TS6 A;  4P87 A;  5GLC A;  3UE6 A;  2OLV A;  5EVI B;  5E2G A;  2RCX A;  4OQ0 A;  3T4S A;  1O7E A;  5F82 A;  4OPR A;  5DTS A;  3Q7Z A;  4OOM A;  1M40 A;  3H7W A;  3VV4 A;  1S66 L;  1FQG A;  1LI0 A;  2JKT I;  2X71 A;  2Y2H A;  3MBZ A;  1DJC A;  4DE0 A;  3BWL A;  4HES A;  2RL3 A;  1K54 A;  3MSH A;  4MCW A;  1J9M A;  3VP2 A;  4FH4 A;  5L8M A;  3WS5 A;  4LV1 A;  4KZA A;  1W79 A;  3WS0 A;  2ZC5 B;  3G6O A;  5I5L A;  3BFG A;  4EUZ A;  1LHY A;  3IHA A;  4KZ6 A;  2PU2 A;  3A3F A;  2PYR A;  4BBU A;  5A92 A;  4MNR A;  1SZV A;  3LYX A;  4WF0 A;  4EU0 A;  4IUK A;  5GHZ A;  3UPP A;  1OTD A;  4QWO A;  3F1P B;  2JBF A;  2JN7 A;  2FFY A;  2ZBB A;  4UEY A;  1E25 A;  1YT4 A;  1L0F A;  3HLW A;  2JKR M;  3L7H A;  3G35 A;  1WA9 A;  2HDQ A;  1KGF A;  3MZE A;  1LSW A;  1MPL A;  3LIA A;  4KUO A;  1QMF A;  3TRC A;  2Y91 A;  5JYP A;  2C6W B;  3UO9 A;  4MN7 A;  1LI9 A;  4HH3 A;  1MC0 A;  5IS1 A;  5HWV A;  1IYS A;  5DTK A;  3OZH A;  1QME A;  3MXR A;  3K2N A;  4KZ3 A;  3VP0 A;  1PNE A;  5L07 A;  1ES2 A;  1BUL A;  1KDW A;  4BBV A;  2WGW A;  2O0Y A;  1AXB A;  3PBQ A;  2Y2P A;  5DTT A;  1CF0 A;  1JWV A;  1K6S A;  3E2K A;  1RCJ A;  4OPQ A;  5CGW A;  4UAA A;  4Z9Q A;  3ZYT A;  1HD8 A;  3LUQ A;  2Z2L B;  1YMX A;  5HX9 A;  3ZGA B;  4MN6 A;  3NUL A;  4R3A A;  1OT6 A;  4PM8 A;  2H0Y A;  3C38 A;  1XXM A;  3U2A A;  1PI5 A;  3P98 A;  5HAR A;  1YLZ A;  4LCL A;  5AQ9 A;  4K91 A;  5TBM B;  2VV7 A;  2WKH A;  4JKT A;  3IX8 A;  3HJI A;  3LEZ A;  5FI6 A;  3R7W A;  3G34 A;  3HLB A;  4HJ3 A;  3GSG A;  4GKU A;  4EXO A;  3AGF A;  3HUM A;  4DDS A;  4GS9 A;  1MWR A;  2VLG A;  1SDE A;  1ALQ A;  2ZL1 B;  2D01 A;  3TG9 A;  2XDM A;  4ZBE A;  2Q0O A;  1PIO A;  1W8Y A;  1S4S A;  2H5S A;  2ZM2 A;  3ZVW A;  5EFW A;  3BQ8 A;  3VOL A;  4BLM A;  3V3S A;  2EWW A;  4E3O A;  4RX3 A;  4DRT A;  5E2F A;  2UWX A;  3LI9 A;  3PBR A;  4MMN A;  3OLO A;  2PBY A;  3DAV A;  1LLB A;  1VET B;  2K7S A;  4S2N A;  3HCY A;  4IBR A;  5LBR A;  3U4L P;  3UDX A;  1F2K A;  4K08 A;  4NG2 A;  2ZLY A;  4LLO B;  1V9Z A;  4BJP A;  3W2Z A;  3ITB A;  4S2I A;  3BLS A;  3MXQ A;  4KG5 A;  4MEZ A;  4FH2 A;  3MFX A;  1YPR A;  3T12 B;  3A3E A;  5FEF A;  1T1C A;  2I72 A;  1YLW A;  3F1N A;  3PR6 A;  1RGY A;  3N7W A;  3UB5 P;  2VZW A;  5HAP A;  1ZC2 A;  4Y0U A;  4Y15 A;  2ACG A;  3IT9 A;  4ESP A;  3ICY A;  4WMC A;  4E6X A;  3EEH A;  4ZAM A;  2C5W B;  2PRF A;  4BMW A;  1H8Z A;  3FKW A;  3BYD A;  4EBN A;  3VSK A;  2O9B A;  1K57 C;  4P6B A;  4R1G A;  2Y2K A;  4JF5 A;  4DE3 A;  1RGZ A;  1MWT A;  2K2N A;  3G2Y A;  1ONH A;  4KQO A;  2EXA A;  2Y2O A;  2ZQ7 A;  1UGU A;  3E4Q A;  4DF6 A;  1BYW A;  4GOG A;  1GHI A;  3UE3 A;  2VGL S;  1P9R A;  2P74 A;  3T1R A;  2V1A A;  5FDS A;  4GB7 A;  2L1M A;  3PAG A;  3KX0 X;  2NUP C;  1JTD A;  3LR3 A;  2XRO A;  2V0U A;  4E04 A;  1NRF A;  2BG1 A;  3IF6 B;  2PD7 A;  4DJ2 A;  1DP6 A;  2OWJ A;  5TFQ A;  5C5K A;  4OPY A;  2VJW A;  3ZHH A;  2J9P A;  2B02 A;  2QJ7 A;  1KDS A;  1PW1 A;  4BEN A;  4OOY A;  2WK0 A;  2PR5 A;  3IXH A;  2JKF A;  2FFF B;  3LI8 A;  4R3J A;  3VMA A;  3ULF A;  1P97 A;  4E3M A;  1YKD A;  3BFE A;  2V1Z A;  1GSV A;  2IWB A;  3UNW A;  2EX2 A;  4JGP A;  4P6Z S;  3FC7 A;  1ZG4 A;  1JWP A;  4R6L A;  4U0T A;  3KSH A;  1FCN A;  2J3W A;  3Q7V A;  5DKK A;  4BD0 A;  4HBU A;  3H82 B;  5HWT A;  3UDF A;  4JGQ A;  1TS7 A;  3BEC A;  5CX7 A;  3ZVT A;  1IOU A;  5DF7 A;  1ZKJ A;  2HJ9 C;  5A93 A; 
#chains in the Genus database with same CATH homology
 4PKY G;  4HI4 A;  3FPW A;  5TJJ A;  2Z6D A;  3PXP A;  4F3L B;  2I9V A;  3FPV A;  3T4L A;  4CLC E;  2GJ3 A;  1ZHH B;  2ZMF A;  4HIA A;  4WLA A;  3CI6 A;  4ME4 A;  3PBT A;  1NWZ A;  2D02 A;  4L9F A;  3C30 A;  1F98 A;  3LIF A;  4LRZ E;  3S7O A;  3E0Y A;  4YWZ A;  5HPF A;  2KLI A;  4L9E A;  3ZQ5 A;  3IS2 B;  1S1Z A;  4DN0 A;  3P7N A;  2M7V A;  3R7W B;  3OBF A;  3BY8 A;  1ODV A;  2ZOH A;  5DKL A;  3NJA A;  1TF1 A;  1TS6 A;  4NKP A;  3UE6 A;  3K3D A;  2EA9 A;  3BQA A;  4GS9 B;  2BAS A;  2J3T C;  2O9A A;  3UB6 A;  2XRN A;  3T4S A;  4ARZ A;  2FZ0 A;  4I3J A;  4OOM A;  1H3Q A;  3H7W A;  2H28 A;  4BWI A;  1V9Y A;  2G7U A;  4I5S A;  3VV4 A;  1S66 L;  2JKT I;  2XA7 M;  5IT5 A;  1N9N A;  3EQU A;  5HWW A;  4XT2 B;  3LIE A;  4LRX C;  3BWL A;  4EEU A;  1GSW A;  1MZU A;  4YOF A;  3D3O A;  3UB9 A;  4JGO A;  3JVU A;  1W63 Q;  3IBR A;  4MCW A;  3A0V A;  2INW A;  2HJE A;  2W1R A;  2W3D A;  4I3I A;  5L8M A;  4I39 A;  2O9C A;  5DFY A;  2PYP A;  4O01 A;  1T1B A;  4I38 A;  4FSF A;  2M7U A;  1NLZ A;  4CLC B;  2PD8 A;  1T18 A;  4MDZ A;  4PHT A;  3G6O A;  5I5L A;  1VHM A;  1EW0 A;  3R4K A;  3MQQ A;  4AFI A;  5F68 A;  3TJZ C;  3BJN A;  3E4P A;  3PYP A;  2PYR A;  4BBU A;  1MKM A;  2W1T A;  3LYX A;  4G3V A;  4WF0 A;  2J3T D;  4EU0 A;  2GZA A;  2KX6 A;  4IUK A;  2XA7 S;  2KDK A;  4H6J B;  3VE3 A;  1OTD A;  3F1P B;  4L0L A;  2JN7 A;  2ZBB A;  4UEY A;  1GSX A;  1XJ6 A;  2W3G A;  3F1N B;  4O8G A;  3EGX C;  4DJ3 A;  2JKR M;  3MR0 A;  3NOU C;  1P9W A;  1WA9 A;  2PDR A;  1D7E A;  3LR5 A;  3MF0 A;  3P01 A;  1LSW A;  3LIA A;  4KUO A;  2A24 A;  2WKR A;  4RQ9 A;  3TW8 A;  1X0O A;  2JHE A;  3TRC A;  3NOT C;  5HDC A;  1S67 L;  1P0Z A;  2MJ6 A;  5G4Y A;  4Q0I A;  2GX5 A;  2L0W A;  3LR0 A;  1G6O A;  4MN7 A;  2W3E A;  4HH3 A;  1MC0 A;  5IS1 A;  5HWV A;  4NXG A;  2ZMV A;  4HP9 A;  4PKY A;  1OTE A;  2K31 A;  5KIZ A;  1YAX A;  3MJQ A;  2A2L A;  3K2N A;  1OTB A;  5DFX A;  4Y3I A;  4HQA A;  2V0W A;  2QYB A;  4LRY C;  5HDD A;  3BW6 A;  3KSF A;  3S7Q A;  3S7P A;  4BBT A;  2M1C A;  1T19 A;  5KSH A;  5F5Y A;  3S7N A;  4BBV A;  2O0Y A;  3K3C A;  1D06 A;  3PBQ A;  2V9A A;  1OTA A;  3H82 A;  5HD5 A;  5F69 A;  2VKS A;  1T1A A;  4HHD A;  3GDI A;  3ZYT A;  3NOP C;  3LFV A;  3LUQ A;  3GEC A;  3KSI A;  5FL3 A;  4GHI B;  4MN6 A;  1S4R A;  4GCZ A;  4F3L A;  3DBA A;  4R3A A;  1OT6 A;  1LL8 A;  3LR4 A;  3C38 A;  1LSV A;  3LID A;  3U2A A;  2R78 A;  4EET B;  2LB5 A;  1JNU A;  2VEA A;  4M4X A;  4HOI A;  5TBM B;  4R38 A;  1STZ A;  2VV7 A;  4GJ4 A;  4EES A;  3IS2 A;  4B9O A;  5HSQ A;  4WL9 A;  2W0N A;  3HJI A;  3R7W A;  2QJ5 A;  2JKT M;  1UWP X;  4HJ3 A;  4EXO A;  4KQD A;  4CQH A;  4HP4 A;  1IFQ A;  3CLO A;  1TD5 A;  3OC2 A;  3PBN A;  4KUK A;  2DMW A;  4GS9 A;  1N9L A;  2VLG A;  2ZOI A;  3SW1 A;  2FH5 A;  3IBJ A;  1OJG A;  3LIB A;  2D01 A;  5K5B A;  3LIC A;  2Z6C A;  3PBO A;  2OAQ 1;  2OWH A;  1S4S A;  3HJK A;  1N9O A;  5A8B A;  2VV6 A;  1H8M A;  4XT2 A;  4WUJ A;  5EFW A;  3BQ8 A;  1F5M A;  3VOL A;  1G28 A;  1NLY A;  3EOI A;  3TE8 A;  2EWW A;  3V67 A;  1UWN X;  4CLC C;  2IA2 A;  3KYQ A;  3LI9 A;  4Q0H A;  2W3F A;  3RTY A;  1ZTU A;  2GNX A;  3PBR A;  3OLO A;  4MMN A;  4ETX A;  4WEL A;  1DP9 A;  2K7S A;  5HZH A;  1TS0 A;  4NXE A;  3HCY A;  3D72 A;  4EQ1 A;  4CLC A;  3T4T A;  5LBR A;  2O99 A;  1W63 M;  3MMH A;  2WKP A;  3A0R A;  2PHY A;  4G3W A;  3T50 A;  4K08 A;  3OCN A;  4LLO B;  5HDS A;  3EGD C;  5HD3 A;  1V9Z A;  1XFQ A;  4BJP A;  3H9W A;  3W2Z A;  2W27 A;  3MXQ A;  4HJ6 A;  4H6J A;  3T4O A;  2Y8H A;  4L9G A;  3F1P A;  5MC7 A;  3MFX A;  2OAP 1;  1KOU A;  1T1C A;  3F1N A;  5G4Z A;  4ETZ A;  2YKH A;  3PR6 A;  4GW9 A;  2HF6 A;  2HV1 A;  4ARZ B;  4LPZ A;  1OJ5 A;  2LB9 A;  2VZW A;  4I3A A;  3UME A;  2QWS A;  3H7W B;  4CLC D;  3KSG A;  3PHY A;  4Y2F A;  1DRM A;  1F9I A;  4QPR A;  3ICY A;  2VGL M;  4Y5F A;  3T4J A;  2VV8 A;  4FOF A;  3EEH A;  3T4Q A;  5IU1 A;  4BMW A;  4EEP A;  4YNR A;  3VE4 A;  1OT9 A;  3UMD A;  4WEK A;  2P08 A;  4NXB A;  4NEE D;  2O9B A;  3C8C A;  1YSP A;  5DJU A;  5F6A A;  2K2N A;  3OOV A;  4KQO A;  5AJG A;  1UGU A;  3UB7 A;  4Q0J A;  4B93 A;  3E4Q A;  4HJ4 A;  3E4O A;  5AVE A;  2W1T B;  1BYW A;  4EER A;  3FG8 A;  5J4E A;  4GLQ A;  2VA0 A;  3F1O B;  4ZRR A;  5HPI A;  3CWF A;  3EWK A;  2PT7 A;  5HL6 A;  2HGV A;  3UE3 A;  3MQ0 A;  2VGL S;  3B42 A;  1P9R A;  3KYZ A;  2CMN A;  3RFB A;  2NUT C;  2QKP A;  2V1A A;  1XJ3 A;  3PBS A;  2EWV A;  2VX8 A;  2L1M A;  1DP8 A;  4EUV A;  3MQO A;  2P7J A;  3KX0 X;  2NUP C;  2XRO A;  3KO6 A;  3LR3 A;  1TS8 A;  4G3K A;  2V0U A;  3NHQ A;  4R70 A;  3T4K A;  4E04 A;  4P6Z M;  3EEA A;  2A24 B;  2PR6 A;  3CIT A;  5J7E A;  4DMZ A;  4GHI A;  3BY9 A;  1NRJ A;  2PD7 A;  2YKF A;  3CUE C;  4DJ2 A;  1DP6 A;  1LT0 A;  4II7 A;  2OWJ A;  5C5K A;  1YSQ A;  4IJG A;  2VJW A;  2J80 A;  4UQI M;  2B02 A;  2QJ7 A;  3O5Y A;  4HH2 A;  2JKR I;  4HY8 A;  1S1Y A;  2W3H A;  4MN5 A;  5TBM A;  1XJ2 A;  3CUE A;  2KOI A;  2PR5 A;  2L4R A;  3F1O A;  3RH8 B;  3LI8 A;  2V1B A;  1Y28 A;  3ULF A;  3JVV A;  5DJT A;  1P97 A;  4WEJ A;  3CAX A;  1XFN A;  1YKD A;  2XSS A;  4JGR A;  1GSV A;  3OCL A;  5DF9 A;  2Y79 A;  4JGP A;  4P6Z S;  2B18 A;  1VB6 A;  3FC7 A;  2P04 A;  1LSX A;  4WN5 A;  4HNB A;  4PAU A;  3A0S A;  4R6L A;  4Z1W A;  3KSH A;  5DKK A;  2J3W A;  3B47 A;  5J3W A;  3H82 B;  4IUH A;  5HWT A;  3UB8 A;  4JGQ A;  1TS7 A;  4O0P A;  4IHQ A;  1XJ4 A;  3B33 A;  2OOL A;  5CX7 A;  1IOU A;  1OPX A;  3EQV A;  4OOL A;  2HJ9 C;  4UQI S;  4NXF A;  1OTI A;  5AVF A;  3E98 A;  3C2W A;  4EW7 A;  2WKQ A;  2QHK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...