4NXEA

Crystal structure of ilov-i486(2lt) at ph 6.5
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
104
structure length
103
Chain Sequence
KNFVITDPRLPDNPIIFASDGFLELTEYSREEILGRNARFLQGPETDQATVQKIRDAIRDQRETTVQLINYTKSGKKFWNLLHLQPVRDQKGELQYFGVQLDG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Phototropin-2
publication title Significant Expansion of Fluorescent Protein Sensing Ability through the Genetic Incorporation of Superior Photo-Induced Electron-Transfer Quenchers
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Flavoprotein, fluorescent protein
total genus 31
structure length 103
sequence length 104
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2013-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13426 PAS_9 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4nxeA00
3D72A 2VLGA 2ZOHA 4H6JA 5AVFA 4LRZE 2PYRA 1G28A 3NHQA 4MN5A 5AVEA 5F68A 3MR0A 3NJAA 3IS2B 1XFNA 4NXEA 1DP9A 1P0ZA 1GSVA 1TS0A 3K3DA 3NOPC 3F1OB 2J80A 3H82A 4EEPA 3MFXA 3A0RA 1VB6A 1OT9A 4EQ1A 4HI4A 3UMDA 1F9IA 3UB9A 2GJ3A 5HWVA 4XT2B 3UB8A 2D01A 1OTDA 3SW1A 3G6OA 1UWPX 2V9AA 1XJ6A 5F69A 3F1NB 3FG8A 3MQQA 4KUOA 3BY9A 2EA9A 4LPZA 2HV1A 3CAXA 1OJGA 3UB6A 1T1BA 1GSXA 3PYPA 5HWWA 5F6AA 2A24A 3LICA 3ULFA 4NXBA 3EWKA 2L4RA 4GHIB 3H7WA 1S67L 2QKPA 4JGPA 3VOLA 1LSWA 3H7WB 2L1MA 2B02A 4K08A 4EESA 2VV7A 5TBMA 1OTIA 1KOUA 2WKQA 1T19A 3B33A 3EEHA 5G4ZA 3RTYA 2PD8A 3A0VA 2P7JA 3MXQA 4E04A 4KUKA 4LRYC 5HSQA 4GS9A 5HDCA 1WA9A 1OTAA 4HIAA 5G4YA 3MQOA 4NXFA 1F98A 4R3AA 4F3LA 2V0WA 2OWJA 4KQDA 4M4XA 3CWFA 5J7EA 4HP9A 2VV8A 3C8CA 4EEUA 4B9OA 1N9OA 1P97A 4H6JB 1ODVA 1T18A 4PKYG 3VE4A 4GW9A 3MJQA 1UGUA 4BBUA 1OT6A 4WF0A 3H82B 2WKPA 2VV6A 1EW0A 2W0NA 3E4QA 3LI8A 3UB7A 3E4OA 1OTEA 1D06A 2Z6CA 3F1PA 4R38A 2D02A 4JGQA 3NOTC 1S1ZA 5HD5A 2ZOIA 5HDSA 3GDIA 4PKYA 3ICYA 2BASA 1X0OA 3KX0X 2A24B 2I9VA 1NWZA 2YKFA 3LI9A 3OLOA 4RQ9A 3LYXA 4HJ6A 1UWNX 1DP6A 3FC7A 5F5YA 1TS6A 5HD3A 3P7NA 3RH8B 5TBMB 1S4RA 4EETB 4R70A 4HH2A 1BYWA 1V9ZA 1LL8A 4L9FA 4I3AA 3LIDA 1T1CA 2ZBBA 1S66L 3BY8A 4HJ4A 3HJIA 2QWSA 4GS9B 4HJ3A 4HY8A 4HP4A 1LSVA 2PDRA 5KIZA 3GECA 4LLOB 4F3LB 2OOLA 1GSWA 4JGOA 1LT0A 4WL9A 3UMEA 2YKHA 1MZUA 2Z6DA 5DJTA 4MN6A 1T1AA 2QHKA 4BBVA 1N9NA 1S4SA 2L0WA 2CMNA 4JGRA 4I38A 2PHYA 3IS2A 2JN7A 4DJ3A 4I3IA 3E4PA 3PHYA 3F1OA 4HNBA 1XJ4A 3HJKA 5A8BA 3UE6A 1V9YA 1TS8A 2M1CA 1TS7A 3VE3A 2PD7A 3F1PB 4WLAA 5J3WA 2VEAA 1OJ5A 3C2WA 4XT2A 3IBRA 2KDKA 1D7EA 4WN5A 5EFWA 2KX6A 2R78A 4GCZA 2QJ7A 2V1BA 4L9EA 3F1NA 5DKKA 3LIBA 1XFQA 3BWLA 2WKRA 3ZQ5A 4GHIA 5HZHA 3LIAA 4NXGA 1OTBA 2PR5A 1S1YA 3H9WA 3LIEA 4L9GA 4I3JA 3LIFA 4BBTA 1DP8A 5HWTA 3A0SA 4R6LA 2W27A 2PR6A 4HQAA 2PYPA 1XJ2A 5HDDA 1LSXA 5IS1A 4HH3A 1XJ3A 4EXOA 1JNUA 2H28A 3K3CA 4DJ2A 2K7SA 1N9LA 5IU1A 4I5SA 2OWHA 5I5LA 3T50A 4EERA 4YWZA 1DRMA 3CLOA 3NOUC 2JHEA 4I39A 2INWA 4LRXC 5DKLA 2V0UA 3LUQA 2V1AA 1Y28A 2QJ5A 5DJUA 4EW7A 5J4EA 4HHDA 4WUJA 4HOIA
chains in the Genus database with same CATH superfamily
5FAOA 2PYRA 3LEZA 2ZQAA 4QPRA 3LFVA 2FZ0A 3C4OA 1OMEA 1PI5A 2J9OA 3UDXA 3ZDJA 1VM1A 3GTCA 5CERA 4FUWA 3JVVA 5K5BA 4FH2A 1ZHHB 3FYZA 1GCEA 1IYPA 2J80A 2Y2OA 2NUPC 4S2NC 1SKFA 5IHVA 2EXAA 3N4IA 1VB6A 3E2KA 2VGJA 1IKIA 1OT9A 1K54C 3QP6A 1DJAA 1YMXA 3HCYA 4JXVA 3FWLA 3IF6C 3EOIA 3MQ0A 1H8ZA 1L0EA 5HWVA 5AQ7A 4CLCB 4XT2B 4E3KA 5FQ9A 2D01A 1OTDA 1SKOB 3WS2A 3HLFA 1NLYA 3G6OA 1UWPX 2I72A 2V9AA 3F1NB 3ZNTA 5TFQA 3MQQA 4S2KA 5CEDA 2EA9A 4BQMA 2JKTI 3ZNYA 4Q0IA 3BQAA 2A24A 4NXBA 2ZQCA 3EWKA 4O7DA 4IVIA 1S67L 4JGPA 3OPHA 1XGIA 1YAXA 5A92A 2VZWA 5TBMA 1O7EA 1Y4OA 1YM1A 3PBSA 4UHUA 4RX3A 1EROA 1LI0A 1JWPA 5FQKA 3S4XA 3MXQA 1MWUA 3PBNA 1BLHA 3QP1A 5HSQA 3Q82A 1H5XA 3MFDA 1OTAA 5L2FA 4RX2A 4YOFA 3VP2A 3MQOA 4G3WA 3DTKA 4NXFA 3LO7A 2V0WA 4X56A 2IWCA 2W3GA 4EEUA 2EWVA 3ZCZA 3GQZA 1G6OA 5D3OA 4E3OA 2QYBA 4X53A 2QPNA 5L09A 3DWZA 3DW0A 4ETZA 1PZOA 1XA1A 2ZQ9A 3VE4A 4GW9A 1YPRA 5CGSA 5EM1A 3MJQA 4JF4A 1ONGA 1HTZA 4WF0A 1LI9A 4C75A 3LR5A 3ISGA 2VV6A 5HFOA 1K6RA 1ONHA 3LI8A 3E4OA 3WS4A 2Y2HA 5CGXA 5FL3A 2WGWA 3A3DA 4H8RA 2A49A 3MBZA 3JYIA 2W1TA 1YQSA 1KE3A 4Q0HA 4R38A 2X01A 1M6KA 3L9KA 1K56D 5DFXA 4FH4A 4BL2A 1L0GA 5HD5A 2ZOIA 5HDSA 3GDIA 5J8XA 3ICYA 1I2WA 1PIOA 5EVIC 4KZ7A 1X0OA 1IELA 2A24B 5GHXA 1NWZA 4OKPA 1PNEA 3OLOA 4EQIA 4IVKA 2H0YA 2HDQA 3UE0A 2V8CA 4PM9A 3UY6A 1TS6A 5HD3A 1Q2QA 4QY6A 3RH8B 5TBMB 4O8GA 4OP8A 4EETB 2P9VA 3OPRA 2ZM8A 3IT9A 3NULA 2WGVA 1LL8A 4L9FA 4R1GA 5EVID 4EU0A 1O07A 4E6WA 3LIDA 4LV3A 1SDNA 3Q81A 1SZVA 4BENA 4DMZA 1KGEA 3HJIA 4QWOA 4DN0A 2B95A 3I7JA 5HAPA 4OOYA 4U3TA 4HJ3A 1NYMA 1NZOA 4LLOB 3E2LA 2ZJ9A 3BECA 1P9WA 2XQZA 1GSWA 4F94A 1YLJA 4JGOA 3P98A 1FSWA 4LV1A 5DF8A 2Y2IA 3R7WB 4QY5A 4ZAMA 3NDEA 3RXXA 3UPOA 4A5RA 5F1FA 3UO9A 4S2OA 1TVFA 1ESIA 3C7VA 2QHKA 1S4SA 1SDEA 4P6BA 4ZTKA 4X68A 1ES3A 2WYXA 1VETA 4KZ9A 3C4PA 3ZFZA 2HJ9C 5HPIA 2PHYA 5FDHA 4P0MA 2Y59A 4XXRA 5KSHA 3BFDA 4HNBA 4GDNA 1XJ4A 3HUMA 3Q7VA 3ZG7B 2WGWB 1N4OA 4PM5A 2ZD8A 1FQGA 3T4JA 2PD7A 4WLAA 2VEAA 1OJ5A 1HD8A 3S22A 3IBRA 5G18A 2KDKA 4MEZA 3CUEC 5GLAA 4LFUA 1GHIA 3T4OA 3S1YA 3T1SA 5FQQA 2V1BA 4L9EA 1N9BA 5DKKA 1FOFA 4OLDA 3A3IA 4WZ5A 4WELA 2XROA 1BUEA 3BEBA 3KSIA 2Y2MA 4P6ZM 2Y91A 4X1MA 2PR5A 1S1YA 1U60A 2P9VB 4BBTA 3DTIA 4R6LA 4ZRRA 3UDIA 2PR6A 4HQAA 1XJ2A 4EV4A 3U4LP 3IH9A 3GR2A 4HH3A 1Z09A 2VGLS 2H28A 2G2WA 3HLWA 3HUOA 4Z1WA 2K7SA 4RVAA 3WRTA 3HUNA 3Q1FA 2WGIA 5MC7A 3NOUC 1YLTA 5FA7A 2INWA 5CHJA 1K6SA 2WADA 3N8SA 3UDFA 3GV9A 1H8MA 5DKLA 5L07A 3C5AA 5DJUA 4B4ZA 4BD0A 4EW7A 1BLPA 4JF5A 1JWZA 4HOIA 3D72A 5AVFA 4LRZE 3BRMA 1BTLA 1G28A 2J7VA 2GDNA 3W2ZA 3AGEA 1GA9A 3VP4A 1VETB 2PBDP 3N6IA 3PAGA 1BULA 3PBRA 5GHYA 1GSVA 2EXBA 1TS0A 3NOPC 3MFXA 2DRWA 3A0RA 3QP2A 5LBRA 4XUXA 5HX9A 4EQ1A 4PMAA 2VK3A 4NG2A 1K4FA 3OPLA 4Y0OA 3BQ8A 4IBRA 4KENB 3T4SA 3TRCA 1P9RA 1XJ6A 4N9KA 4LPZA 4MMNA 1PWGA 4GB7A 2G2UA 1Y54A 3T1QB 1OJGA 3UB6A 3OZHA 1T1BA 3E0YA 5FQIA 3B3XA 1XX2A 4KZAA 3IF5A 3H7WB 1TF1A 3EGXC 1K55C 3BFCA 1XKZA 4DXBA 4GZBA 2Y55A 5TR7A 3A3JA 3ZGAB 2VGKA 1KE0A 4U0TA 3B33A 4DDSA 3EEHA 5GLBA 5G4ZA 5AJGA 3RTYA 3TSGA 2PD8A 1DJBA 4DKIA 3A0VA 4JPMA 1MWTA 5L8MA 3BM6A 3IHAA 3VV4A 4E04A 2ZM2A 4GLQA 1BT5A 1GHMA 5CRFA 2LB9A 5G4YA 2Y79A 3DWKA 2BTFP 1ES2A 4M4XA 3CWFA 2DMWA 2ZMAA 3FPVA 5J7EA 5DTTA 4HP9A 2RCXA 4MBFA 2HDUA 2XDMA 4WMCD 4S2LA 1A0KA 1NZUA 1N9OA 4R0QA 4HEFA 2OAQ1 5AQ9A 1ODVA 1PW1A 2DNSA 3OBFA 1PFLA 1T18A 5CXWA 1UGUA 1XGJA 3HLEA 2JE5A 4MNRA 1FIKA 2Z2MB 4K91A 1OPXA 1EW0A 4XUZA 3S7OA 2W0NA 4G3KA 2WAEA 3E4QA 3GVBA 2WAFA 3UB7A 2BG1A 5HAIA 3GRJA 2XFTA 3NY4A 4S2PA 4E3JA 3PBTA 5FI6A 1RP5A 1MPLA 3VOYA 4JGQA 2EX6A 2X02A 2W3HA 3T1RA 3UE1A 2P74A 3MZDA 4ESPA 4UA6A 3S7QA 2EX2A 1H8YA 4UA7A 3LR3A 3LI9A 4X25A 1FILA 4JXSA 3LYXA 2XD1A 5A93A 4Y17A 1DP6A 2J8YA 3VOZA 4KG2A 4CLCC 1CQAA 3P7NA 4ZJ3A 1YLZA 5C5KA 1S4RA 4M3KA 4R70A 3ZG0A 2V8FA 4HH2A 1IKGA 3G31A 5E2FA 4E3LA 4I3AA 2JCHA 1T1CA 3RJUA 4E3NA 3BY8A 4HJ4A 3MKEA 2FH5A 2XF3A 1ESUA 1F2KA 2WKEA 2QWSA 4CLCD 4HY8A 5CGWA 5CEBA 2XEPA 4HP4A 2JKGA 5KIZA 1NYYA 1RCJA 2V20A 3T4QA 5HPFA 3R7WA 3K2NA 2YKHA 1CI9A 1ERMA 5TGFA 1ZKJA 3B47A 3CPTA 2KOIA 4UAAA 4BBVA 4LGWA 4OPRA 1PWCA 3MSHA 3HLCA 4UEYA 4FSFA 5E43A 4B93A 4JGRA 3W4OA 3IS2A 2JN7A 1M40A 3W4QA 3TW8A 4KQOA 2OSUA 4WM9A 3F1OA 4DF6A 5F1GA 2WUQA 4N1HA 5AQBA 2R9WA 1F5MA 4S2MA 3UE6A 2EWWA 4JF6A 1TS8A 2M1CA 2PU2A 2J3WA 1ALQA 5J3WA 3C2WA 4WBGA 4LV2A 1D7EA 5EFWA 1W79A 4JLFA 2KX6A 4N9LA 5EV0A 3D9YA 4DDYA 1FCNA 3PXPA 2QJ7A 1E3UA 4IEDA 3T4LA 3UPNA 4GJ4A 2JKRM 3SH7A 3BYDA 2BLSA 5CHMA 1SCWA 1KGFA 2VGLM 2ZC6B 3BFFA 4S2IA 4DE1A 3OCLA 3LIEA 2E8IA 4IHQA 3SS4A 3LIFA 5HWTA 1BSGA 4B4XA 5DFYA 1IFQA 1MBLA 5HDDA 4CPKA 2LB5A 5IS1A 1XJ3A 3ITBA 2HDSA 2HGVA 4QB8A 3AGDA 2M7UA 2JBFA 4KZ4A 4ARZB 4I5SA 5I5LA 1JTGA 5FQJA 1ERQA 1IEMA 3R4KA 1TD5A 2QMIA 3ZVTA 2GZAA 3IWOA 2JC7A 2JHEA 4IJGA 4OOMA 4I39A 4LRXC 1K57A 4Q8IA 5FI7A 3LUQA 3M2JA 3WRZA 1YLWA 1YLPA 5J4EA 4EBPA 4HHDA 4WEJA 4KZ3A 3C7UA 4X6TA 2VLGA 4H6JA 4GDBA 3CPTB 2B18A 4EBNA 1YT4A 4Y15A 1G5UA 3NHQA 3PBOA 5E2HA 5AVEA 3ZHHA 3KSHA 5F68A 4LCLA 2OV5A 3MR0A 4GD8A 2ZQDA 2A3UA 1W5DA 4MBKA 3IS2B 1XFNA 4NXEA 1DP9A 1P0ZA 2V1ZA 1NRJA 2ZL1A 2WK0A 3F1OB 4BJPA 3H82A 4S2JA 2O0YA 3RXWA 2PU4A 3VFFA 3V5MA 3O88A 3IQAA 3GSGA 4JXGA 3FPWA 5EM0A 2M7VA 1EI5A 4E3MA 2H5SA 2FFFB 3ZYTA 2Y2JA 5GLCA 1QMEA 5CTMA 1YMSA 1KDWA 4E3IA 4AFIA 2PRFA 2W1RA 4MDZA 1J9MA 2C5WB 1Z6FA 3BY9A 3IWIA 4II7A 1XXMA 3CAXA 3O5YA 4Y0UA 3FV7A 1EWZA 1FCOA 1GSXA 3PYPA 5HWWA 3ULFA 3W8KA 2L4RA 3H7WA 4Y13A 4PPRA 3Q7ZA 3QP4A 2H10A 4GN2A 4QHCA 1IYSA 2QZ6A 4GNUA 2L1MA 2WZZA 4N92A 4D2OA 4K08A 5DF7A 2VV7A 5FATA 4Z9QA 1W7FA 1CF0A 3G35A 1OTIA 1FSYA 1KE4A 3IXDA 5CHUA 5JYPA 3MXSA 1KGGA 3IBJA 3C30A 4UA9A 3MMHA 4IUHA 4KUKA 2HJEA 4LRYC 4OQHA 5FQMA 2Y4AA 4MN7A 4ETXA 3VSLA 1ACFA 3JPUA 5FSRA 3HL9A 4R3AA 3CMZA 3QHYA 4F3LA 2OWJA 3V3RA 4C3QA 4GKUA 3KYZA 2VV8A 3C8CA 4BLMA 4WYYA 2EX9A 4S2NA 2OLVA 4B9OA 1P97A 4H6JB 1K54A 3HLDA 3IHBA 4PKYG 3IF6A 2J3TC 4Y2FA 3WS1A 4KZ5A 4HBUA 4PM8A 1I2SA 4C6YA 3W4PA 3UPPA 2ZL1B 4E6XA 3H82B 2WKPA 1PZPA 4FD8A 1AWIA 2IA2A 4OP5A 4QJGA 5BOHA 5EE8A 3U2AA 1W8QA 2ZMVA 2J3TD 5EVEA 2HZ5A 2Z6CA 3WWXA 4IUKA 3F1PA 3HLGA 3KYQA 4FTXA 2D02A 3IX4A 5FDSA 3NOTC 2XA7S 3SOIA 1S1ZA 3ITAA 1W8YA 1MKIA 3P09A 1SHVA 3LCEA 1K4EA 3ZG5A 3MS6A 5EOOA 4Y5FA 4UQIS 2HP5A 3FC7A 1PW8A 1CEFA 1C3BA 2OAP1 2OLUA 4ID4A 1ZC2A 2EX8A 3RFBA 4LV0A 4Q0JA 5F82A 1BYWA 3PTEA 2Q0OA 4D60A 1NJ4A 4WZ5C 3D3OA 1TDGA 3O3VA 3EQUA 2Q9NA 1JVJA 3M6HA 3N7WA 1LSVA 2VKSA 2PDRA 3UB5P 3PR6A 1VEUA 3GECA 4CJNA 4F3LB 1E4DA 5IT5A 4KQQA 4U0XA 3UMEA 4EUZA 3SH9A 3TJZC 3T12B 1BLSA 1K56A 1IOUA 4PAUA 3C38A 1MZUA 2Z6DA 4YFMA 5DJTA 3VP1A 4Y7PA 2P08A 1T1AA 2VX8A 4K0XA 5FEGA 3IF6B 4PM6A 1N9NA 2L0WA 2CMNA 2EFXA 1AXBA 3WS5A 3E98A 2A2LA 3NI9A 5TJJA 1H3QA 4JBFA 4R3JA 4DJ3A 3A3EA 4MBHA 2W3EA 4DE2A 4FOFA 4JXWA 1L0DA 2ZMFA 1FR1A 4HBTA 3M2KA 3N8RA 3NDGA 5EVIA 1XA7A 3ZVWA 3BFGA 3CZDA 3LR4A 4RA7A 5A8BA 2Y2QA 2IWBA 3NIAA 4Y3IA 3VE3A 5CECA 3F1PB 5KZHA 4CQHA 1BZAA 3NCKA 3NC8A 4WN5A 3DTEA 4OONA 5EOEA 1VHMA 3FKWA 4GCZA 1IYQA 2EFUA 5DVAA 3BLMA 3SS3A 2PT7A 4ZJ1A 4OPQA 1WE4A 1Q2PA 3CG5A 1NXYA 1XFQA 3LY4A 3OC2A 4KG6A 5KSCA 5M19A 1RGZA 5HARA 2ZQ7A 1NRFA 4NKPA 3O87A 1LLBA 3ZG8B 2WKRA 3ZQ5A 4GHIA 2O99A 5GL9A 5HZHA 1L3LA 4NXGA 3H9WA 4WZ4A 4L9GA 4ZBEA 1DP8A 3A0SA 2P04A 3KYEA 2XR0A 4OVDA 1QMFA 3MF0A 4EXOA 5FAQA 1IYOA 4IBXA 3QNBA 2JKTM 3SZTA 3CJMA 4ARZA 3LEQA 5JYOA 1N9LA 2VJWA 2OWHA 1BLCA 3S7NA 4HESA 2PBYA 4EERA 3IX8A 1H0MA 1VEUB 4YWZA 4NK3A 3CLOA 1WYCA 1TEMA 1JTDA 1HLUP 4MLLA 3HREA 5GLDA 1PWDA 2HPBA 1Y28A 2QJ5A 1CEGA 3LR0A 1YLYA 3B42A 4LENA 5M1AA 4LCMA 3UNWA 2R9XA 2ZOHA 4GOGA 2XK1A 3BFEA 1VQQA 4MN5A 1HVBA 2Z2LB 4DXCA 5DTSA 3UN7A 4WEKA 3NJAA 2ZM0A 4R3BA 4NEED 5DF9A 3CUEA 3K3DA 4EEPA 2Y2GA 2W3DA 2JKRI 1JWVA 3AGFA 1STZA 5EVIB 4PM7A 3LGOA 4HI4A 3SH8A 5EUAA 1YSQA 3UMDA 1F9IA 2FFYA 2W3FA 3UB9A 3PAEA 3A3FA 4BMWA 5EECA 1W63M 2GJ3A 2UV0E 3UB8A 2JKFA 4X69A 3SW1A 1YSPA 2X71A 4BWIA 1NY0A 3EQVA 5F69A 3FG8A 4KUOA 1ZG6A 5M18A 2HV1A 2IWDA 5F6AA 3LICA 4K0WA 4YINA 4GHIB 1XPBA 5I94A 2QKPA 3VOLA 3V39A 1LSWA 1DY6A 5HL1A 3D4FA 2DCFA 2B02A 4EESA 2XLNA 3CITA 1MKMA 4YNRA 2HP6A 3VP0A 1KOUA 1S0WA 2WKQA 1T19A 5FAPA 5CX7A 2J9PA 4DE3A 3QP8A 1PYYA 2XRNA 2O9AA 4R4RA 3G32A 2PAVP 2P7JA 1TDLA 3M6BA 5EPHA 2RL3A 4GS9A 5HDCA 1WA9A 5FASA 3V3SA 4HIAA 3FKVA 1F98A 3TE8A 5A90A 1MXOA 2HDRA 5U47A 3IXHA 4KQDA 3G2YA 3MZEA 1WYBA 4NETA 4P87A 1I5QA 1E25A 2XH9A 4MCWA 3P01A 3SS5A 5CTNA 4RYEA 1ZTUA 3KSGA 2Q9MA 2XFSA 2KLIA 3T1XA 1ZG4A 1G6AA 4BBUA 1OT6A 3TG9A 3T4KA 3QNCA 4X1LA 3VP3A 3NBLA 1GHPA 2B5RA 3QP5A 2XA7M 3Q07A 2MJ6A 3IH8A 4N1XA 5AQAA 4ZDXA 3G4PA 5GHZA 2AVXA 2O9CA 4OPYA 3OOVA 1K25A 1OTEA 1D06A 1LHYA 2ACGA 3V67A 4UQIM 2VA0A 3VFHA 4FCFA 3IWQA 3IX3A 2W1TB 1K55A 4OOLA 2WKHA 4OLGA 4R4SA 3VSKA 1FR6A 4X55A 4PKYA 4BD1A 2BASA 2Y2PA 3JVUA 3DBAA 2WKIA 3KX0X 4KQRA 4OPZA 2I9VA 4WMCA 3FZCA 2ZC5B 5KMWA 4RQ9A 2K31A 5E2GA 2YKFA 3OPPA 4HJ6A 2NUTC 3IXBA 1UWNX 4B88A 4O0PA 5F5YA 3MKFA 4L0LA 1MC0A 2G7UA 3N8LA 1LL5A 5DTKA 3MXRA 4Y0TA 1ES4A 1RGYA 4R23A 1V9ZA 1CK3A 2GX5A 2Y2NA 2HF6A 3IXGA 5FEFA 2ZBBA 1S66L 3CHWP 3GMWA 2K2NA 5HL6A 2WZXA 5E2EA 4BL3A 4GS9B 4EUVA 2CC1A 1K0KA 4ZJ2A 3T4TA 2OOLA 1E3UD 3G30A 3CI6A 3KO6A 1LT0A 4WL9A 1L0FA 3V50A 3O86A 2XD5A 3OCNA 1CJFA 4KZ8A 5A91A 2GNXA 3BLSA 1ES5A 4EWFA 3S7PA 2Y8HA 4MN6A 1YKDA 4OQGA 3HVFA 2ZQ8A 3G2ZA 3BJNA 1KDSA 4I38A 1K57C 3PBQA 1LL9A 4I3IA 3E4PA 3PHYA 4OQ0A 3HLBA 3EGDC 4PHTA 1MY8A 3HJKA 4GD6A 3Q7VB 1V9YA 1G68A 1L2SA 1MWRA 4O01A 3MZFA 1TS7A 2E8JA 1MWSA 4CLCA 4XT2A 1DJCA 1SKOA 5HAQA 3TOIA 4ME4A 2Y2LA 1NLZA 2R78A 2XGNA 4KZ6A 2H0TA 1CI8A 3F1NA 4OQIA 1K38A 3LIBA 4G3VA 3DAVA 2C6WB 2ZC3B 4KZBA 1GA0A 3DTMA 1W63Q 3BWLA 2ZLYA 5HW3A 3KSFA 1KVLA 1XP4A 2ZC4B 2V2FF 4OH0A 5EVLA 3LIAA 1OTBA 4I3JA 3BW6A 2ZC7A 2W27A 4EBLA 3L7HA 4DRTA 3HBRA 2PYPA 4QD4A 1HZOA 1LSXA 4KG5A 2XSSA 2O9BA 1JNUA 3WS0A 1D1JA 3K3CA 4DJ2A 3NECA 2Y2KA 4P6ZS 2HP9A 5IU1A 1PRQA 3LY3A 1S6RA 3T50A 5FI2A 4P85A 4CLCE 1DRMA 5L10A 4QU3A 4JKTA 3ZG9B 3G34A 2UWXA 3VMAA 2V0UA 1FCMA 4DE0A 1J3WA 5F83A 2V1AA 1KVMA 3EEAA 1PI4A 3UE3A 4WUJA
chains in the Genus database with same CATH topology
3D72A 2VLGA 2ZOHA 4H6JA 5AVFA 4LRZE 2PYRA 1G28A 2B18A 3W2ZA 4QPRA 3NHQA 3LFVA 3PBOA 4MN5A 5AVEA 2FZ0A 3KSHA 5F68A 3MR0A 3PBRA 3NJAA 4WEKA 3IS2B 1XFNA 4NEED 4NXEA 3JVVA 1DP9A 1P0ZA 5DF9A 1GSVA 3CUEA 1TS0A 3K3DA 1NRJA 1ZHHB 3NOPC 5K5BA 3F1OB 4BJPA 2J80A 3H82A 2W3DA 2NUPC 4EEPA 2JKRI 3MFXA 2O0YA 3A0RA 1VB6A 5LBRA 1STZA 1OT9A 4EQ1A 4HI4A 1YSQA 2M7VA 3FPWA 3UMDA 1F9IA 2W3FA 3UB9A 3ZYTA 3HCYA 4BMWA 3EOIA 1W63M 3MQ0A 2GJ3A 5HWVA 3BQ8A 4CLCB 4XT2B 3UB8A 2D01A 1OTDA 4AFIA 3T4SA 3SW1A 3TRCA 2W1RA 4MDZA 1YSPA 1P9RA 1NLYA 3G6OA 1UWPX 2V9AA 4BWIA 3EQVA 1XJ6A 5F69A 3F1NB 3FG8A 3MQQA 4KUOA 3BY9A 2EA9A 4II7A 4LPZA 4MMNA 2HV1A 3CAXA 2JKTI 3O5YA 1OJGA 3UB6A 4Q0IA 1T1BA 3BQAA 1GSXA 3PYPA 3E0YA 5HWWA 5F6AA 2A24A 3LICA 3ULFA 4NXBA 3EWKA 2L4RA 4GHIB 3H7WA 1S67L 2QKPA 4JGPA 3VOLA 1LSWA 3H7WB 1TF1A 2L1MA 1YAXA 2B02A 4K08A 2VZWA 4EESA 3EGXC 2VV7A 5TBMA 3CITA 1MKMA 4YNRA 1OTIA 1KOUA 3PBSA 2WKQA 1T19A 5CX7A 3B33A 3EEHA 5G4ZA 5AJGA 3IBJA 3RTYA 3C30A 2XRNA 2O9AA 2PD8A 3A0VA 3MMHA 2P7JA 4IUHA 3MXQA 5L8MA 3VV4A 3PBNA 4E04A 4GLQA 4KUKA 2HJEA 4LRYC 5HSQA 4GS9A 5HDCA 1WA9A 1OTAA 4HIAA 2LB9A 4YOFA 4MN7A 5G4YA 2Y79A 3MQOA 4ETXA 4G3WA 4NXFA 1F98A 3TE8A 4R3AA 4F3LA 2V0WA 2OWJA 4KQDA 4M4XA 3CWFA 2DMWA 3FPVA 5J7EA 3KYZA 4HP9A 2VV8A 2W3GA 3C8CA 4MCWA 4EEUA 2EWVA 1G6OA 4B9OA 1N9OA 3P01A 2OAQ1 1P97A 4H6JB 1ZTUA 3KSGA 2QYBA 1ODVA 3OBFA 4ETZA 1T18A 4PKYG 3VE4A 2KLIA 4GW9A 2J3TC 4Y2FA 3MJQA 1UGUA 4BBUA 1OT6A 3T4KA 4WF0A 3H82B 2WKPA 2XA7M 3LR5A 2MJ6A 1OPXA 2IA2A 2VV6A 1EW0A 3S7OA 2W0NA 4G3KA 3E4QA 2O9CA 3LI8A 3UB7A 3E4OA 3U2AA 5FL3A 3OOVA 1OTEA 1D06A 2ZMVA 3V67A 2J3TD 2Z6CA 4UQIM 3PBTA 4IUKA 2W1TA 3F1PA 2VA0A 4Q0HA 3KYQA 4R38A 2D02A 2W1TB 4JGQA 4OOLA 3NOTC 2XA7S 1S1ZA 5DFXA 5HD5A 2ZOIA 5HDSA 3GDIA 4PKYA 3ICYA 2W3HA 2BASA 3JVUA 3DBAA 1X0OA 3KX0X 3S7QA 2A24B 2I9VA 3LR3A 4Y5FA 1NWZA 2K31A 2YKFA 3LI9A 3OLOA 4RQ9A 4UQIS 3LYXA 2NUTC 4HJ6A 1UWNX 1DP6A 3FC7A 4O0PA 4L0LA 5F5YA 4CLCC 1TS6A 2OAP1 5HD3A 1MC0A 2G7UA 3P7NA 3RH8B 3RFBA 5TBMB 4O8GA 5C5KA 1S4RA 4Q0JA 4EETB 4R70A 4HH2A 1BYWA 1V9ZA 1LL8A 4L9FA 4I3AA 2GX5A 4EU0A 2HF6A 3LIDA 1T1CA 2ZBBA 1S66L 3BY8A 3D3OA 4HJ4A 3EQUA 4DMZA 3HJIA 4DN0A 2FH5A 2K2NA 5HL6A 2QWSA 4CLCD 4GS9B 4EUVA 4HJ3A 4HY8A 4HP4A 1LSVA 2VKSA 2PDRA 5KIZA 3PR6A 3GECA 4LLOB 3T4TA 4F3LB 2OOLA 1P9WA 1GSWA 5IT5A 4JGOA 3CI6A 3KO6A 1LT0A 3T4QA 5HPFA 4WL9A 3R7WA 3K2NA 3UMEA 3TJZC 3OCNA 3R7WB 1IOUA 4PAUA 3C38A 2YKHA 2GNXA 1MZUA 2Z6DA 5DJTA 3S7PA 2Y8HA 4MN6A 2P08A 1T1AA 2VX8A 2QHKA 3B47A 1YKDA 2KOIA 4BBVA 1N9NA 1S4SA 2L0WA 4UEYA 2CMNA 4FSFA 4B93A 3E98A 2A2LA 2HJ9C 5HPIA 3BJNA 4JGRA 4I38A 2PHYA 1H3QA 5TJJA 3PBQA 3IS2A 2JN7A 4DJ3A 4I3IA 4KQOA 3TW8A 3E4PA 3PHYA 2W3EA 4FOFA 3EGDC 3F1OA 5KSHA 2ZMFA 4HNBA 1XJ4A 4PHTA 3HJKA 3LR4A 5A8BA 1F5MA 3UE6A 1V9YA 2EWWA 1TS8A 2M1CA 4O01A 4Y3IA 1TS7A 3VE3A 3T4JA 2J3WA 2PD7A 3F1PB 4WLAA 5J3WA 2VEAA 1OJ5A 3C2WA 4CLCA 4CQHA 4XT2A 3IBRA 2KDKA 1D7EA 4WN5A 5EFWA 1VHMA 2KX6A 3CUEC 4ME4A 1NLZA 2R78A 4GCZA 3T4OA 3PXPA 2QJ7A 2V1BA 4L9EA 3F1NA 5DKKA 3LIBA 4G3VA 3T4LA 4GJ4A 2JKRM 2PT7A 1XFQA 3OC2A 1W63Q 3BWLA 3KSFA 2VGLM 4NKPA 4WELA 2XROA 2WKRA 3ZQ5A 3KSIA 4GHIA 2O99A 4P6ZM 5HZHA 3LIAA 4NXGA 1OTBA 2PR5A 1S1YA 3H9WA 3OCLA 3LIEA 4L9GA 4I3JA 4IHQA 3BW6A 3LIFA 4BBTA 1DP8A 5HWTA 3A0SA 4R6LA 2W27A 5DFYA 4ZRRA 2PR6A 2P04A 4HQAA 1IFQA 2PYPA 1XJ2A 5HDDA 1LSXA 3MF0A 2LB5A 5IS1A 4HH3A 1XJ3A 4EXOA 2XSSA 2O9BA 1JNUA 2JKTM 2HGVA 2VGLS 2H28A 3K3CA 4ARZA 4Z1WA 4DJ2A 2M7UA 2K7SA 1N9LA 4ARZB 4P6ZS 5IU1A 4I5SA 2VJWA 2OWHA 5I5LA 3S7NA 3T50A 4EERA 3R4KA 4YWZA 1TD5A 4CLCE 2GZAA 1DRMA 3CLOA 5MC7A 3NOUC 2JHEA 4IJGA 4OOMA 4I39A 2INWA 4LRXC 1H8MA 5DKLA 2V0UA 3LUQA 2V1AA 1Y28A 2QJ5A 5DJUA 4EW7A 5J4EA 3LR0A 3B42A 4HHDA 3EEAA 4WEJA 3UE3A 4WUJA 4HOIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3D72 A;  2VLG A;  2ZOH A;  4H6J A;  5AVF A;  4LRZ E;  2PYR A;  1G28 A;  3NHQ A;  4MN5 A;  5AVE A;  5F68 A;  3MR0 A;  3NJA A;  3IS2 B;  1XFN A;  4NXE A;  1DP9 A;  1P0Z A;  1GSV A;  1TS0 A;  3K3D A;  3NOP C;  3F1O B;  2J80 A;  3H82 A;  4EEP A;  3MFX A;  3A0R A;  1VB6 A;  1OT9 A;  4EQ1 A;  4HI4 A;  3UMD A;  1F9I A;  3UB9 A;  2GJ3 A;  5HWV A;  4XT2 B;  3UB8 A;  2D01 A;  1OTD A;  3SW1 A;  3G6O A;  1UWP X;  2V9A A;  1XJ6 A;  5F69 A;  3F1N B;  3FG8 A;  3MQQ A;  4KUO A;  3BY9 A;  2EA9 A;  4LPZ A;  2HV1 A;  3CAX A;  1OJG A;  3UB6 A;  1T1B A;  1GSX A;  3PYP A;  5HWW A;  5F6A A;  2A24 A;  3LIC A;  3ULF A;  4NXB A;  3EWK A;  2L4R A;  4GHI B;  3H7W A;  1S67 L;  2QKP A;  4JGP A;  3VOL A;  1LSW A;  3H7W B;  2L1M A;  2B02 A;  4K08 A;  4EES A;  2VV7 A;  5TBM A;  1OTI A;  1KOU A;  2WKQ A;  1T19 A;  3B33 A;  3EEH A;  5G4Z A;  3RTY A;  2PD8 A;  3A0V A;  2P7J A;  3MXQ A;  4E04 A;  4KUK A;  4LRY C;  5HSQ A;  4GS9 A;  5HDC A;  1WA9 A;  1OTA A;  4HIA A;  5G4Y A;  3MQO A;  4NXF A;  1F98 A;  4R3A A;  4F3L A;  2V0W A;  2OWJ A;  4KQD A;  4M4X A;  3CWF A;  5J7E A;  4HP9 A;  2VV8 A;  3C8C A;  4EEU A;  4B9O A;  1N9O A;  1P97 A;  4H6J B;  1ODV A;  1T18 A;  4PKY G;  3VE4 A;  4GW9 A;  3MJQ A;  1UGU A;  4BBU A;  1OT6 A;  4WF0 A;  3H82 B;  2WKP A;  2VV6 A;  1EW0 A;  2W0N A;  3E4Q A;  3LI8 A;  3UB7 A;  3E4O A;  1OTE A;  1D06 A;  2Z6C A;  3F1P A;  4R38 A;  2D02 A;  4JGQ A;  3NOT C;  1S1Z A;  5HD5 A;  2ZOI A;  5HDS A;  3GDI A;  4PKY A;  3ICY A;  2BAS A;  1X0O A;  3KX0 X;  2A24 B;  2I9V A;  1NWZ A;  2YKF A;  3LI9 A;  3OLO A;  4RQ9 A;  3LYX A;  4HJ6 A;  1UWN X;  1DP6 A;  3FC7 A;  5F5Y A;  1TS6 A;  5HD3 A;  3P7N A;  3RH8 B;  5TBM B;  1S4R A;  4EET B;  4R70 A;  4HH2 A;  1BYW A;  1V9Z A;  1LL8 A;  4L9F A;  4I3A A;  3LID A;  1T1C A;  2ZBB A;  1S66 L;  3BY8 A;  4HJ4 A;  3HJI A;  2QWS A;  4GS9 B;  4HJ3 A;  4HY8 A;  4HP4 A;  1LSV A;  2PDR A;  5KIZ A;  3GEC A;  4LLO B;  4F3L B;  2OOL A;  1GSW A;  4JGO A;  1LT0 A;  4WL9 A;  3UME A;  2YKH A;  1MZU A;  2Z6D A;  5DJT A;  4MN6 A;  1T1A A;  2QHK A;  4BBV A;  1N9N A;  1S4S A;  2L0W A;  2CMN A;  4JGR A;  4I38 A;  2PHY A;  3IS2 A;  2JN7 A;  4DJ3 A;  4I3I A;  3E4P A;  3PHY A;  3F1O A;  4HNB A;  1XJ4 A;  3HJK A;  5A8B A;  3UE6 A;  1V9Y A;  1TS8 A;  2M1C A;  1TS7 A;  3VE3 A;  2PD7 A;  3F1P B;  4WLA A;  5J3W A;  2VEA A;  1OJ5 A;  3C2W A;  4XT2 A;  3IBR A;  2KDK A;  1D7E A;  4WN5 A;  5EFW A;  2KX6 A;  2R78 A;  4GCZ A;  2QJ7 A;  2V1B A;  4L9E A;  3F1N A;  5DKK A;  3LIB A;  1XFQ A;  3BWL A;  2WKR A;  3ZQ5 A;  4GHI A;  5HZH A;  3LIA A;  4NXG A;  1OTB A;  2PR5 A;  1S1Y A;  3H9W A;  3LIE A;  4L9G A;  4I3J A;  3LIF A;  4BBT A;  1DP8 A;  5HWT A;  3A0S A;  4R6L A;  2W27 A;  2PR6 A;  4HQA A;  2PYP A;  1XJ2 A;  5HDD A;  1LSX A;  5IS1 A;  4HH3 A;  1XJ3 A;  4EXO A;  1JNU A;  2H28 A;  3K3C A;  4DJ2 A;  2K7S A;  1N9L A;  5IU1 A;  4I5S A;  2OWH A;  5I5L A;  3T50 A;  4EER A;  4YWZ A;  1DRM A;  3CLO A;  3NOU C;  2JHE A;  4I39 A;  2INW A;  4LRX C;  5DKL A;  2V0U A;  3LUQ A;  2V1A A;  1Y28 A;  2QJ5 A;  5DJU A;  4EW7 A;  5J4E A;  4HHD A;  4WUJ A;  4HOI A; 
#chains in the Genus database with same CATH topology
 5FAO A;  2PYR A;  3LEZ A;  2ZQA A;  4QPR A;  3LFV A;  2FZ0 A;  3C4O A;  1OME A;  1PI5 A;  2J9O A;  3UDX A;  3ZDJ A;  1VM1 A;  3GTC A;  5CER A;  4FUW A;  3JVV A;  5K5B A;  4FH2 A;  1ZHH B;  3FYZ A;  1GCE A;  1IYP A;  2J80 A;  2Y2O A;  2NUP C;  4S2N C;  1SKF A;  5IHV A;  2EXA A;  3N4I A;  1VB6 A;  3E2K A;  2VGJ A;  1IKI A;  1OT9 A;  1K54 C;  3QP6 A;  1DJA A;  1YMX A;  3HCY A;  4JXV A;  3FWL A;  3IF6 C;  3EOI A;  3MQ0 A;  1H8Z A;  1L0E A;  5HWV A;  5AQ7 A;  4CLC B;  4XT2 B;  4E3K A;  5FQ9 A;  2D01 A;  1OTD A;  1SKO B;  3WS2 A;  3HLF A;  1NLY A;  3G6O A;  1UWP X;  2I72 A;  2V9A A;  3F1N B;  3ZNT A;  5TFQ A;  3MQQ A;  4S2K A;  5CED A;  2EA9 A;  4BQM A;  2JKT I;  3ZNY A;  4Q0I A;  3BQA A;  2A24 A;  4NXB A;  2ZQC A;  3EWK A;  4O7D A;  4IVI A;  1S67 L;  4JGP A;  3OPH A;  1XGI A;  1YAX A;  5A92 A;  2VZW A;  5TBM A;  1O7E A;  1Y4O A;  1YM1 A;  3PBS A;  4UHU A;  4RX3 A;  1ERO A;  1LI0 A;  1JWP A;  5FQK A;  3S4X A;  3MXQ A;  1MWU A;  3PBN A;  1BLH A;  3QP1 A;  5HSQ A;  3Q82 A;  1H5X A;  3MFD A;  1OTA A;  5L2F A;  4RX2 A;  4YOF A;  3VP2 A;  3MQO A;  4G3W A;  3DTK A;  4NXF A;  3LO7 A;  2V0W A;  4X56 A;  2IWC A;  2W3G A;  4EEU A;  2EWV A;  3ZCZ A;  3GQZ A;  1G6O A;  5D3O A;  4E3O A;  2QYB A;  4X53 A;  2QPN A;  5L09 A;  3DWZ A;  3DW0 A;  4ETZ A;  1PZO A;  1XA1 A;  2ZQ9 A;  3VE4 A;  4GW9 A;  1YPR A;  5CGS A;  5EM1 A;  3MJQ A;  4JF4 A;  1ONG A;  1HTZ A;  4WF0 A;  1LI9 A;  4C75 A;  3LR5 A;  3ISG A;  2VV6 A;  5HFO A;  1K6R A;  1ONH A;  3LI8 A;  3E4O A;  3WS4 A;  2Y2H A;  5CGX A;  5FL3 A;  2WGW A;  3A3D A;  4H8R A;  2A49 A;  3MBZ A;  3JYI A;  2W1T A;  1YQS A;  1KE3 A;  4Q0H A;  4R38 A;  2X01 A;  1M6K A;  3L9K A;  1K56 D;  5DFX A;  4FH4 A;  4BL2 A;  1L0G A;  5HD5 A;  2ZOI A;  5HDS A;  3GDI A;  5J8X A;  3ICY A;  1I2W A;  1PIO A;  5EVI C;  4KZ7 A;  1X0O A;  1IEL A;  2A24 B;  5GHX A;  1NWZ A;  4OKP A;  1PNE A;  3OLO A;  4EQI A;  4IVK A;  2H0Y A;  2HDQ A;  3UE0 A;  2V8C A;  4PM9 A;  3UY6 A;  1TS6 A;  5HD3 A;  1Q2Q A;  4QY6 A;  3RH8 B;  5TBM B;  4O8G A;  4OP8 A;  4EET B;  2P9V A;  3OPR A;  2ZM8 A;  3IT9 A;  3NUL A;  2WGV A;  1LL8 A;  4L9F A;  4R1G A;  5EVI D;  4EU0 A;  1O07 A;  4E6W A;  3LID A;  4LV3 A;  1SDN A;  3Q81 A;  1SZV A;  4BEN A;  4DMZ A;  1KGE A;  3HJI A;  4QWO A;  4DN0 A;  2B95 A;  3I7J A;  5HAP A;  4OOY A;  4U3T A;  4HJ3 A;  1NYM A;  1NZO A;  4LLO B;  3E2L A;  2ZJ9 A;  3BEC A;  1P9W A;  2XQZ A;  1GSW A;  4F94 A;  1YLJ A;  4JGO A;  3P98 A;  1FSW A;  4LV1 A;  5DF8 A;  2Y2I A;  3R7W B;  4QY5 A;  4ZAM A;  3NDE A;  3RXX A;  3UPO A;  4A5R A;  5F1F A;  3UO9 A;  4S2O A;  1TVF A;  1ESI A;  3C7V A;  2QHK A;  1S4S A;  1SDE A;  4P6B A;  4ZTK A;  4X68 A;  1ES3 A;  2WYX A;  1VET A;  4KZ9 A;  3C4P A;  3ZFZ A;  2HJ9 C;  5HPI A;  2PHY A;  5FDH A;  4P0M A;  2Y59 A;  4XXR A;  5KSH A;  3BFD A;  4HNB A;  4GDN A;  1XJ4 A;  3HUM A;  3Q7V A;  3ZG7 B;  2WGW B;  1N4O A;  4PM5 A;  2ZD8 A;  1FQG A;  3T4J A;  2PD7 A;  4WLA A;  2VEA A;  1OJ5 A;  1HD8 A;  3S22 A;  3IBR A;  5G18 A;  2KDK A;  4MEZ A;  3CUE C;  5GLA A;  4LFU A;  1GHI A;  3T4O A;  3S1Y A;  3T1S A;  5FQQ A;  2V1B A;  4L9E A;  1N9B A;  5DKK A;  1FOF A;  4OLD A;  3A3I A;  4WZ5 A;  4WEL A;  2XRO A;  1BUE A;  3BEB A;  3KSI A;  2Y2M A;  4P6Z M;  2Y91 A;  4X1M A;  2PR5 A;  1S1Y A;  1U60 A;  2P9V B;  4BBT A;  3DTI A;  4R6L A;  4ZRR A;  3UDI A;  2PR6 A;  4HQA A;  1XJ2 A;  4EV4 A;  3U4L P;  3IH9 A;  3GR2 A;  4HH3 A;  1Z09 A;  2VGL S;  2H28 A;  2G2W A;  3HLW A;  3HUO A;  4Z1W A;  2K7S A;  4RVA A;  3WRT A;  3HUN A;  3Q1F A;  2WGI A;  5MC7 A;  3NOU C;  1YLT A;  5FA7 A;  2INW A;  5CHJ A;  1K6S A;  2WAD A;  3N8S A;  3UDF A;  3GV9 A;  1H8M A;  5DKL A;  5L07 A;  3C5A A;  5DJU A;  4B4Z A;  4BD0 A;  4EW7 A;  1BLP A;  4JF5 A;  1JWZ A;  4HOI A;  3D72 A;  5AVF A;  4LRZ E;  3BRM A;  1BTL A;  1G28 A;  2J7V A;  2GDN A;  3W2Z A;  3AGE A;  1GA9 A;  3VP4 A;  1VET B;  2PBD P;  3N6I A;  3PAG A;  1BUL A;  3PBR A;  5GHY A;  1GSV A;  2EXB A;  1TS0 A;  3NOP C;  3MFX A;  2DRW A;  3A0R A;  3QP2 A;  5LBR A;  4XUX A;  5HX9 A;  4EQ1 A;  4PMA A;  2VK3 A;  4NG2 A;  1K4F A;  3OPL A;  4Y0O A;  3BQ8 A;  4IBR A;  4KEN B;  3T4S A;  3TRC A;  1P9R A;  1XJ6 A;  4N9K A;  4LPZ A;  4MMN A;  1PWG A;  4GB7 A;  2G2U A;  1Y54 A;  3T1Q B;  1OJG A;  3UB6 A;  3OZH A;  1T1B A;  3E0Y A;  5FQI A;  3B3X A;  1XX2 A;  4KZA A;  3IF5 A;  3H7W B;  1TF1 A;  3EGX C;  1K55 C;  3BFC A;  1XKZ A;  4DXB A;  4GZB A;  2Y55 A;  5TR7 A;  3A3J A;  3ZGA B;  2VGK A;  1KE0 A;  4U0T A;  3B33 A;  4DDS A;  3EEH A;  5GLB A;  5G4Z A;  5AJG A;  3RTY A;  3TSG A;  2PD8 A;  1DJB A;  4DKI A;  3A0V A;  4JPM A;  1MWT A;  5L8M A;  3BM6 A;  3IHA A;  3VV4 A;  4E04 A;  2ZM2 A;  4GLQ A;  1BT5 A;  1GHM A;  5CRF A;  2LB9 A;  5G4Y A;  2Y79 A;  3DWK A;  2BTF P;  1ES2 A;  4M4X A;  3CWF A;  2DMW A;  2ZMA A;  3FPV A;  5J7E A;  5DTT A;  4HP9 A;  2RCX A;  4MBF A;  2HDU A;  2XDM A;  4WMC D;  4S2L A;  1A0K A;  1NZU A;  1N9O A;  4R0Q A;  4HEF A;  2OAQ 1;  5AQ9 A;  1ODV A;  1PW1 A;  2DNS A;  3OBF A;  1PFL A;  1T18 A;  5CXW A;  1UGU A;  1XGJ A;  3HLE A;  2JE5 A;  4MNR A;  1FIK A;  2Z2M B;  4K91 A;  1OPX A;  1EW0 A;  4XUZ A;  3S7O A;  2W0N A;  4G3K A;  2WAE A;  3E4Q A;  3GVB A;  2WAF A;  3UB7 A;  2BG1 A;  5HAI A;  3GRJ A;  2XFT A;  3NY4 A;  4S2P A;  4E3J A;  3PBT A;  5FI6 A;  1RP5 A;  1MPL A;  3VOY A;  4JGQ A;  2EX6 A;  2X02 A;  2W3H A;  3T1R A;  3UE1 A;  2P74 A;  3MZD A;  4ESP A;  4UA6 A;  3S7Q A;  2EX2 A;  1H8Y A;  4UA7 A;  3LR3 A;  3LI9 A;  4X25 A;  1FIL A;  4JXS A;  3LYX A;  2XD1 A;  5A93 A;  4Y17 A;  1DP6 A;  2J8Y A;  3VOZ A;  4KG2 A;  4CLC C;  1CQA A;  3P7N A;  4ZJ3 A;  1YLZ A;  5C5K A;  1S4R A;  4M3K A;  4R70 A;  3ZG0 A;  2V8F A;  4HH2 A;  1IKG A;  3G31 A;  5E2F A;  4E3L A;  4I3A A;  2JCH A;  1T1C A;  3RJU A;  4E3N A;  3BY8 A;  4HJ4 A;  3MKE A;  2FH5 A;  2XF3 A;  1ESU A;  1F2K A;  2WKE A;  2QWS A;  4CLC D;  4HY8 A;  5CGW A;  5CEB A;  2XEP A;  4HP4 A;  2JKG A;  5KIZ A;  1NYY A;  1RCJ A;  2V20 A;  3T4Q A;  5HPF A;  3R7W A;  3K2N A;  2YKH A;  1CI9 A;  1ERM A;  5TGF A;  1ZKJ A;  3B47 A;  3CPT A;  2KOI A;  4UAA A;  4BBV A;  4LGW A;  4OPR A;  1PWC A;  3MSH A;  3HLC A;  4UEY A;  4FSF A;  5E43 A;  4B93 A;  4JGR A;  3W4O A;  3IS2 A;  2JN7 A;  1M40 A;  3W4Q A;  3TW8 A;  4KQO A;  2OSU A;  4WM9 A;  3F1O A;  4DF6 A;  5F1G A;  2WUQ A;  4N1H A;  5AQB A;  2R9W A;  1F5M A;  4S2M A;  3UE6 A;  2EWW A;  4JF6 A;  1TS8 A;  2M1C A;  2PU2 A;  2J3W A;  1ALQ A;  5J3W A;  3C2W A;  4WBG A;  4LV2 A;  1D7E A;  5EFW A;  1W79 A;  4JLF A;  2KX6 A;  4N9L A;  5EV0 A;  3D9Y A;  4DDY A;  1FCN A;  3PXP A;  2QJ7 A;  1E3U A;  4IED A;  3T4L A;  3UPN A;  4GJ4 A;  2JKR M;  3SH7 A;  3BYD A;  2BLS A;  5CHM A;  1SCW A;  1KGF A;  2VGL M;  2ZC6 B;  3BFF A;  4S2I A;  4DE1 A;  3OCL A;  3LIE A;  2E8I A;  4IHQ A;  3SS4 A;  3LIF A;  5HWT A;  1BSG A;  4B4X A;  5DFY A;  1IFQ A;  1MBL A;  5HDD A;  4CPK A;  2LB5 A;  5IS1 A;  1XJ3 A;  3ITB A;  2HDS A;  2HGV A;  4QB8 A;  3AGD A;  2M7U A;  2JBF A;  4KZ4 A;  4ARZ B;  4I5S A;  5I5L A;  1JTG A;  5FQJ A;  1ERQ A;  1IEM A;  3R4K A;  1TD5 A;  2QMI A;  3ZVT A;  2GZA A;  3IWO A;  2JC7 A;  2JHE A;  4IJG A;  4OOM A;  4I39 A;  4LRX C;  1K57 A;  4Q8I A;  5FI7 A;  3LUQ A;  3M2J A;  3WRZ A;  1YLW A;  1YLP A;  5J4E A;  4EBP A;  4HHD A;  4WEJ A;  4KZ3 A;  3C7U A;  4X6T A;  2VLG A;  4H6J A;  4GDB A;  3CPT B;  2B18 A;  4EBN A;  1YT4 A;  4Y15 A;  1G5U A;  3NHQ A;  3PBO A;  5E2H A;  5AVE A;  3ZHH A;  3KSH A;  5F68 A;  4LCL A;  2OV5 A;  3MR0 A;  4GD8 A;  2ZQD A;  2A3U A;  1W5D A;  4MBK A;  3IS2 B;  1XFN A;  4NXE A;  1DP9 A;  1P0Z A;  2V1Z A;  1NRJ A;  2ZL1 A;  2WK0 A;  3F1O B;  4BJP A;  3H82 A;  4S2J A;  2O0Y A;  3RXW A;  2PU4 A;  3VFF A;  3V5M A;  3O88 A;  3IQA A;  3GSG A;  4JXG A;  3FPW A;  5EM0 A;  2M7V A;  1EI5 A;  4E3M A;  2H5S A;  2FFF B;  3ZYT A;  2Y2J A;  5GLC A;  1QME A;  5CTM A;  1YMS A;  1KDW A;  4E3I A;  4AFI A;  2PRF A;  2W1R A;  4MDZ A;  1J9M A;  2C5W B;  1Z6F A;  3BY9 A;  3IWI A;  4II7 A;  1XXM A;  3CAX A;  3O5Y A;  4Y0U A;  3FV7 A;  1EWZ A;  1FCO A;  1GSX A;  3PYP A;  5HWW A;  3ULF A;  3W8K A;  2L4R A;  3H7W A;  4Y13 A;  4PPR A;  3Q7Z A;  3QP4 A;  2H10 A;  4GN2 A;  4QHC A;  1IYS A;  2QZ6 A;  4GNU A;  2L1M A;  2WZZ A;  4N92 A;  4D2O A;  4K08 A;  5DF7 A;  2VV7 A;  5FAT A;  4Z9Q A;  1W7F A;  1CF0 A;  3G35 A;  1OTI A;  1FSY A;  1KE4 A;  3IXD A;  5CHU A;  5JYP A;  3MXS A;  1KGG A;  3IBJ A;  3C30 A;  4UA9 A;  3MMH A;  4IUH A;  4KUK A;  2HJE A;  4LRY C;  4OQH A;  5FQM A;  2Y4A A;  4MN7 A;  4ETX A;  3VSL A;  1ACF A;  3JPU A;  5FSR A;  3HL9 A;  4R3A A;  3CMZ A;  3QHY A;  4F3L A;  2OWJ A;  3V3R A;  4C3Q A;  4GKU A;  3KYZ A;  2VV8 A;  3C8C A;  4BLM A;  4WYY A;  2EX9 A;  4S2N A;  2OLV A;  4B9O A;  1P97 A;  4H6J B;  1K54 A;  3HLD A;  3IHB A;  4PKY G;  3IF6 A;  2J3T C;  4Y2F A;  3WS1 A;  4KZ5 A;  4HBU A;  4PM8 A;  1I2S A;  4C6Y A;  3W4P A;  3UPP A;  2ZL1 B;  4E6X A;  3H82 B;  2WKP A;  1PZP A;  4FD8 A;  1AWI A;  2IA2 A;  4OP5 A;  4QJG A;  5BOH A;  5EE8 A;  3U2A A;  1W8Q A;  2ZMV A;  2J3T D;  5EVE A;  2HZ5 A;  2Z6C A;  3WWX A;  4IUK A;  3F1P A;  3HLG A;  3KYQ A;  4FTX A;  2D02 A;  3IX4 A;  5FDS A;  3NOT C;  2XA7 S;  3SOI A;  1S1Z A;  3ITA A;  1W8Y A;  1MKI A;  3P09 A;  1SHV A;  3LCE A;  1K4E A;  3ZG5 A;  3MS6 A;  5EOO A;  4Y5F A;  4UQI S;  2HP5 A;  3FC7 A;  1PW8 A;  1CEF A;  1C3B A;  2OAP 1;  2OLU A;  4ID4 A;  1ZC2 A;  2EX8 A;  3RFB A;  4LV0 A;  4Q0J A;  5F82 A;  1BYW A;  3PTE A;  2Q0O A;  4D60 A;  1NJ4 A;  4WZ5 C;  3D3O A;  1TDG A;  3O3V A;  3EQU A;  2Q9N A;  1JVJ A;  3M6H A;  3N7W A;  1LSV A;  2VKS A;  2PDR A;  3UB5 P;  3PR6 A;  1VEU A;  3GEC A;  4CJN A;  4F3L B;  1E4D A;  5IT5 A;  4KQQ A;  4U0X A;  3UME A;  4EUZ A;  3SH9 A;  3TJZ C;  3T12 B;  1BLS A;  1K56 A;  1IOU A;  4PAU A;  3C38 A;  1MZU A;  2Z6D A;  4YFM A;  5DJT A;  3VP1 A;  4Y7P A;  2P08 A;  1T1A A;  2VX8 A;  4K0X A;  5FEG A;  3IF6 B;  4PM6 A;  1N9N A;  2L0W A;  2CMN A;  2EFX A;  1AXB A;  3WS5 A;  3E98 A;  2A2L A;  3NI9 A;  5TJJ A;  1H3Q A;  4JBF A;  4R3J A;  4DJ3 A;  3A3E A;  4MBH A;  2W3E A;  4DE2 A;  4FOF A;  4JXW A;  1L0D A;  2ZMF A;  1FR1 A;  4HBT A;  3M2K A;  3N8R A;  3NDG A;  5EVI A;  1XA7 A;  3ZVW A;  3BFG A;  3CZD A;  3LR4 A;  4RA7 A;  5A8B A;  2Y2Q A;  2IWB A;  3NIA A;  4Y3I A;  3VE3 A;  5CEC A;  3F1P B;  5KZH A;  4CQH A;  1BZA A;  3NCK A;  3NC8 A;  4WN5 A;  3DTE A;  4OON A;  5EOE A;  1VHM A;  3FKW A;  4GCZ A;  1IYQ A;  2EFU A;  5DVA A;  3BLM A;  3SS3 A;  2PT7 A;  4ZJ1 A;  4OPQ A;  1WE4 A;  1Q2P A;  3CG5 A;  1NXY A;  1XFQ A;  3LY4 A;  3OC2 A;  4KG6 A;  5KSC A;  5M19 A;  1RGZ A;  5HAR A;  2ZQ7 A;  1NRF A;  4NKP A;  3O87 A;  1LLB A;  3ZG8 B;  2WKR A;  3ZQ5 A;  4GHI A;  2O99 A;  5GL9 A;  5HZH A;  1L3L A;  4NXG A;  3H9W A;  4WZ4 A;  4L9G A;  4ZBE A;  1DP8 A;  3A0S A;  2P04 A;  3KYE A;  2XR0 A;  4OVD A;  1QMF A;  3MF0 A;  4EXO A;  5FAQ A;  1IYO A;  4IBX A;  3QNB A;  2JKT M;  3SZT A;  3CJM A;  4ARZ A;  3LEQ A;  5JYO A;  1N9L A;  2VJW A;  2OWH A;  1BLC A;  3S7N A;  4HES A;  2PBY A;  4EER A;  3IX8 A;  1H0M A;  1VEU B;  4YWZ A;  4NK3 A;  3CLO A;  1WYC A;  1TEM A;  1JTD A;  1HLU P;  4MLL A;  3HRE A;  5GLD A;  1PWD A;  2HPB A;  1Y28 A;  2QJ5 A;  1CEG A;  3LR0 A;  1YLY A;  3B42 A;  4LEN A;  5M1A A;  4LCM A;  3UNW A;  2R9X A;  2ZOH A;  4GOG A;  2XK1 A;  3BFE A;  1VQQ A;  4MN5 A;  1HVB A;  2Z2L B;  4DXC A;  5DTS A;  3UN7 A;  4WEK A;  3NJA A;  2ZM0 A;  4R3B A;  4NEE D;  5DF9 A;  3CUE A;  3K3D A;  4EEP A;  2Y2G A;  2W3D A;  2JKR I;  1JWV A;  3AGF A;  1STZ A;  5EVI B;  4PM7 A;  3LGO A;  4HI4 A;  3SH8 A;  5EUA A;  1YSQ A;  3UMD A;  1F9I A;  2FFY A;  2W3F A;  3UB9 A;  3PAE A;  3A3F A;  4BMW A;  5EEC A;  1W63 M;  2GJ3 A;  2UV0 E;  3UB8 A;  2JKF A;  4X69 A;  3SW1 A;  1YSP A;  2X71 A;  4BWI A;  1NY0 A;  3EQV A;  5F69 A;  3FG8 A;  4KUO A;  1ZG6 A;  5M18 A;  2HV1 A;  2IWD A;  5F6A A;  3LIC A;  4K0W A;  4YIN A;  4GHI B;  1XPB A;  5I94 A;  2QKP A;  3VOL A;  3V39 A;  1LSW A;  1DY6 A;  5HL1 A;  3D4F A;  2DCF A;  2B02 A;  4EES A;  2XLN A;  3CIT A;  1MKM A;  4YNR A;  2HP6 A;  3VP0 A;  1KOU A;  1S0W A;  2WKQ A;  1T19 A;  5FAP A;  5CX7 A;  2J9P A;  4DE3 A;  3QP8 A;  1PYY A;  2XRN A;  2O9A A;  4R4R A;  3G32 A;  2PAV P;  2P7J A;  1TDL A;  3M6B A;  5EPH A;  2RL3 A;  4GS9 A;  5HDC A;  1WA9 A;  5FAS A;  3V3S A;  4HIA A;  3FKV A;  1F98 A;  3TE8 A;  5A90 A;  1MXO A;  2HDR A;  5U47 A;  3IXH A;  4KQD A;  3G2Y A;  3MZE A;  1WYB A;  4NET A;  4P87 A;  1I5Q A;  1E25 A;  2XH9 A;  4MCW A;  3P01 A;  3SS5 A;  5CTN A;  4RYE A;  1ZTU A;  3KSG A;  2Q9M A;  2XFS A;  2KLI A;  3T1X A;  1ZG4 A;  1G6A A;  4BBU A;  1OT6 A;  3TG9 A;  3T4K A;  3QNC A;  4X1L A;  3VP3 A;  3NBL A;  1GHP A;  2B5R A;  3QP5 A;  2XA7 M;  3Q07 A;  2MJ6 A;  3IH8 A;  4N1X A;  5AQA A;  4ZDX A;  3G4P A;  5GHZ A;  2AVX A;  2O9C A;  4OPY A;  3OOV A;  1K25 A;  1OTE A;  1D06 A;  1LHY A;  2ACG A;  3V67 A;  4UQI M;  2VA0 A;  3VFH A;  4FCF A;  3IWQ A;  3IX3 A;  2W1T B;  1K55 A;  4OOL A;  2WKH A;  4OLG A;  4R4S A;  3VSK A;  1FR6 A;  4X55 A;  4PKY A;  4BD1 A;  2BAS A;  2Y2P A;  3JVU A;  3DBA A;  2WKI A;  3KX0 X;  4KQR A;  4OPZ A;  2I9V A;  4WMC A;  3FZC A;  2ZC5 B;  5KMW A;  4RQ9 A;  2K31 A;  5E2G A;  2YKF A;  3OPP A;  4HJ6 A;  2NUT C;  3IXB A;  1UWN X;  4B88 A;  4O0P A;  5F5Y A;  3MKF A;  4L0L A;  1MC0 A;  2G7U A;  3N8L A;  1LL5 A;  5DTK A;  3MXR A;  4Y0T A;  1ES4 A;  1RGY A;  4R23 A;  1V9Z A;  1CK3 A;  2GX5 A;  2Y2N A;  2HF6 A;  3IXG A;  5FEF A;  2ZBB A;  1S66 L;  3CHW P;  3GMW A;  2K2N A;  5HL6 A;  2WZX A;  5E2E A;  4BL3 A;  4GS9 B;  4EUV A;  2CC1 A;  1K0K A;  4ZJ2 A;  3T4T A;  2OOL A;  1E3U D;  3G30 A;  3CI6 A;  3KO6 A;  1LT0 A;  4WL9 A;  1L0F A;  3V50 A;  3O86 A;  2XD5 A;  3OCN A;  1CJF A;  4KZ8 A;  5A91 A;  2GNX A;  3BLS A;  1ES5 A;  4EWF A;  3S7P A;  2Y8H A;  4MN6 A;  1YKD A;  4OQG A;  3HVF A;  2ZQ8 A;  3G2Z A;  3BJN A;  1KDS A;  4I38 A;  1K57 C;  3PBQ A;  1LL9 A;  4I3I A;  3E4P A;  3PHY A;  4OQ0 A;  3HLB A;  3EGD C;  4PHT A;  1MY8 A;  3HJK A;  4GD6 A;  3Q7V B;  1V9Y A;  1G68 A;  1L2S A;  1MWR A;  4O01 A;  3MZF A;  1TS7 A;  2E8J A;  1MWS A;  4CLC A;  4XT2 A;  1DJC A;  1SKO A;  5HAQ A;  3TOI A;  4ME4 A;  2Y2L A;  1NLZ A;  2R78 A;  2XGN A;  4KZ6 A;  2H0T A;  1CI8 A;  3F1N A;  4OQI A;  1K38 A;  3LIB A;  4G3V A;  3DAV A;  2C6W B;  2ZC3 B;  4KZB A;  1GA0 A;  3DTM A;  1W63 Q;  3BWL A;  2ZLY A;  5HW3 A;  3KSF A;  1KVL A;  1XP4 A;  2ZC4 B;  2V2F F;  4OH0 A;  5EVL A;  3LIA A;  1OTB A;  4I3J A;  3BW6 A;  2ZC7 A;  2W27 A;  4EBL A;  3L7H A;  4DRT A;  3HBR A;  2PYP A;  4QD4 A;  1HZO A;  1LSX A;  4KG5 A;  2XSS A;  2O9B A;  1JNU A;  3WS0 A;  1D1J A;  3K3C A;  4DJ2 A;  3NEC A;  2Y2K A;  4P6Z S;  2HP9 A;  5IU1 A;  1PRQ A;  3LY3 A;  1S6R A;  3T50 A;  5FI2 A;  4P85 A;  4CLC E;  1DRM A;  5L10 A;  4QU3 A;  4JKT A;  3ZG9 B;  3G34 A;  2UWX A;  3VMA A;  2V0U A;  1FCM A;  4DE0 A;  1J3W A;  5F83 A;  2V1A A;  1KVM A;  3EEA A;  1PI4 A;  3UE3 A;  4WUJ A; 
#chains in the Genus database with same CATH homology
 3D72 A;  2VLG A;  2ZOH A;  4H6J A;  5AVF A;  4LRZ E;  2PYR A;  1G28 A;  2B18 A;  3W2Z A;  4QPR A;  3NHQ A;  3LFV A;  3PBO A;  4MN5 A;  5AVE A;  2FZ0 A;  3KSH A;  5F68 A;  3MR0 A;  3PBR A;  3NJA A;  4WEK A;  3IS2 B;  1XFN A;  4NEE D;  4NXE A;  3JVV A;  1DP9 A;  1P0Z A;  5DF9 A;  1GSV A;  3CUE A;  1TS0 A;  3K3D A;  1NRJ A;  1ZHH B;  3NOP C;  5K5B A;  3F1O B;  4BJP A;  2J80 A;  3H82 A;  2W3D A;  2NUP C;  4EEP A;  2JKR I;  3MFX A;  2O0Y A;  3A0R A;  1VB6 A;  5LBR A;  1STZ A;  1OT9 A;  4EQ1 A;  4HI4 A;  1YSQ A;  2M7V A;  3FPW A;  3UMD A;  1F9I A;  2W3F A;  3UB9 A;  3ZYT A;  3HCY A;  4BMW A;  3EOI A;  1W63 M;  3MQ0 A;  2GJ3 A;  5HWV A;  3BQ8 A;  4CLC B;  4XT2 B;  3UB8 A;  2D01 A;  1OTD A;  4AFI A;  3T4S A;  3SW1 A;  3TRC A;  2W1R A;  4MDZ A;  1YSP A;  1P9R A;  1NLY A;  3G6O A;  1UWP X;  2V9A A;  4BWI A;  3EQV A;  1XJ6 A;  5F69 A;  3F1N B;  3FG8 A;  3MQQ A;  4KUO A;  3BY9 A;  2EA9 A;  4II7 A;  4LPZ A;  4MMN A;  2HV1 A;  3CAX A;  2JKT I;  3O5Y A;  1OJG A;  3UB6 A;  4Q0I A;  1T1B A;  3BQA A;  1GSX A;  3PYP A;  3E0Y A;  5HWW A;  5F6A A;  2A24 A;  3LIC A;  3ULF A;  4NXB A;  3EWK A;  2L4R A;  4GHI B;  3H7W A;  1S67 L;  2QKP A;  4JGP A;  3VOL A;  1LSW A;  3H7W B;  1TF1 A;  2L1M A;  1YAX A;  2B02 A;  4K08 A;  2VZW A;  4EES A;  3EGX C;  2VV7 A;  5TBM A;  3CIT A;  1MKM A;  4YNR A;  1OTI A;  1KOU A;  3PBS A;  2WKQ A;  1T19 A;  5CX7 A;  3B33 A;  3EEH A;  5G4Z A;  5AJG A;  3IBJ A;  3RTY A;  3C30 A;  2XRN A;  2O9A A;  2PD8 A;  3A0V A;  3MMH A;  2P7J A;  4IUH A;  3MXQ A;  5L8M A;  3VV4 A;  3PBN A;  4E04 A;  4GLQ A;  4KUK A;  2HJE A;  4LRY C;  5HSQ A;  4GS9 A;  5HDC A;  1WA9 A;  1OTA A;  4HIA A;  2LB9 A;  4YOF A;  4MN7 A;  5G4Y A;  2Y79 A;  3MQO A;  4ETX A;  4G3W A;  4NXF A;  1F98 A;  3TE8 A;  4R3A A;  4F3L A;  2V0W A;  2OWJ A;  4KQD A;  4M4X A;  3CWF A;  2DMW A;  3FPV A;  5J7E A;  3KYZ A;  4HP9 A;  2VV8 A;  2W3G A;  3C8C A;  4MCW A;  4EEU A;  2EWV A;  1G6O A;  4B9O A;  1N9O A;  3P01 A;  2OAQ 1;  1P97 A;  4H6J B;  1ZTU A;  3KSG A;  2QYB A;  1ODV A;  3OBF A;  4ETZ A;  1T18 A;  4PKY G;  3VE4 A;  2KLI A;  4GW9 A;  2J3T C;  4Y2F A;  3MJQ A;  1UGU A;  4BBU A;  1OT6 A;  3T4K A;  4WF0 A;  3H82 B;  2WKP A;  2XA7 M;  3LR5 A;  2MJ6 A;  1OPX A;  2IA2 A;  2VV6 A;  1EW0 A;  3S7O A;  2W0N A;  4G3K A;  3E4Q A;  2O9C A;  3LI8 A;  3UB7 A;  3E4O A;  3U2A A;  5FL3 A;  3OOV A;  1OTE A;  1D06 A;  2ZMV A;  3V67 A;  2J3T D;  2Z6C A;  4UQI M;  3PBT A;  4IUK A;  2W1T A;  3F1P A;  2VA0 A;  4Q0H A;  3KYQ A;  4R38 A;  2D02 A;  2W1T B;  4JGQ A;  4OOL A;  3NOT C;  2XA7 S;  1S1Z A;  5DFX A;  5HD5 A;  2ZOI A;  5HDS A;  3GDI A;  4PKY A;  3ICY A;  2W3H A;  2BAS A;  3JVU A;  3DBA A;  1X0O A;  3KX0 X;  3S7Q A;  2A24 B;  2I9V A;  3LR3 A;  4Y5F A;  1NWZ A;  2K31 A;  2YKF A;  3LI9 A;  3OLO A;  4RQ9 A;  4UQI S;  3LYX A;  2NUT C;  4HJ6 A;  1UWN X;  1DP6 A;  3FC7 A;  4O0P A;  4L0L A;  5F5Y A;  4CLC C;  1TS6 A;  2OAP 1;  5HD3 A;  1MC0 A;  2G7U A;  3P7N A;  3RH8 B;  3RFB A;  5TBM B;  4O8G A;  5C5K A;  1S4R A;  4Q0J A;  4EET B;  4R70 A;  4HH2 A;  1BYW A;  1V9Z A;  1LL8 A;  4L9F A;  4I3A A;  2GX5 A;  4EU0 A;  2HF6 A;  3LID A;  1T1C A;  2ZBB A;  1S66 L;  3BY8 A;  3D3O A;  4HJ4 A;  3EQU A;  4DMZ A;  3HJI A;  4DN0 A;  2FH5 A;  2K2N A;  5HL6 A;  2QWS A;  4CLC D;  4GS9 B;  4EUV A;  4HJ3 A;  4HY8 A;  4HP4 A;  1LSV A;  2VKS A;  2PDR A;  5KIZ A;  3PR6 A;  3GEC A;  4LLO B;  3T4T A;  4F3L B;  2OOL A;  1P9W A;  1GSW A;  5IT5 A;  4JGO A;  3CI6 A;  3KO6 A;  1LT0 A;  3T4Q A;  5HPF A;  4WL9 A;  3R7W A;  3K2N A;  3UME A;  3TJZ C;  3OCN A;  3R7W B;  1IOU A;  4PAU A;  3C38 A;  2YKH A;  2GNX A;  1MZU A;  2Z6D A;  5DJT A;  3S7P A;  2Y8H A;  4MN6 A;  2P08 A;  1T1A A;  2VX8 A;  2QHK A;  3B47 A;  1YKD A;  2KOI A;  4BBV A;  1N9N A;  1S4S A;  2L0W A;  4UEY A;  2CMN A;  4FSF A;  4B93 A;  3E98 A;  2A2L A;  2HJ9 C;  5HPI A;  3BJN A;  4JGR A;  4I38 A;  2PHY A;  1H3Q A;  5TJJ A;  3PBQ A;  3IS2 A;  2JN7 A;  4DJ3 A;  4I3I A;  4KQO A;  3TW8 A;  3E4P A;  3PHY A;  2W3E A;  4FOF A;  3EGD C;  3F1O A;  5KSH A;  2ZMF A;  4HNB A;  1XJ4 A;  4PHT A;  3HJK A;  3LR4 A;  5A8B A;  1F5M A;  3UE6 A;  1V9Y A;  2EWW A;  1TS8 A;  2M1C A;  4O01 A;  4Y3I A;  1TS7 A;  3VE3 A;  3T4J A;  2J3W A;  2PD7 A;  3F1P B;  4WLA A;  5J3W A;  2VEA A;  1OJ5 A;  3C2W A;  4CLC A;  4CQH A;  4XT2 A;  3IBR A;  2KDK A;  1D7E A;  4WN5 A;  5EFW A;  1VHM A;  2KX6 A;  3CUE C;  4ME4 A;  1NLZ A;  2R78 A;  4GCZ A;  3T4O A;  3PXP A;  2QJ7 A;  2V1B A;  4L9E A;  3F1N A;  5DKK A;  3LIB A;  4G3V A;  3T4L A;  4GJ4 A;  2JKR M;  2PT7 A;  1XFQ A;  3OC2 A;  1W63 Q;  3BWL A;  3KSF A;  2VGL M;  4NKP A;  4WEL A;  2XRO A;  2WKR A;  3ZQ5 A;  3KSI A;  4GHI A;  2O99 A;  4P6Z M;  5HZH A;  3LIA A;  4NXG A;  1OTB A;  2PR5 A;  1S1Y A;  3H9W A;  3OCL A;  3LIE A;  4L9G A;  4I3J A;  4IHQ A;  3BW6 A;  3LIF A;  4BBT A;  1DP8 A;  5HWT A;  3A0S A;  4R6L A;  2W27 A;  5DFY A;  4ZRR A;  2PR6 A;  2P04 A;  4HQA A;  1IFQ A;  2PYP A;  1XJ2 A;  5HDD A;  1LSX A;  3MF0 A;  2LB5 A;  5IS1 A;  4HH3 A;  1XJ3 A;  4EXO A;  2XSS A;  2O9B A;  1JNU A;  2JKT M;  2HGV A;  2VGL S;  2H28 A;  3K3C A;  4ARZ A;  4Z1W A;  4DJ2 A;  2M7U A;  2K7S A;  1N9L A;  4ARZ B;  4P6Z S;  5IU1 A;  4I5S A;  2VJW A;  2OWH A;  5I5L A;  3S7N A;  3T50 A;  4EER A;  3R4K A;  4YWZ A;  1TD5 A;  4CLC E;  2GZA A;  1DRM A;  3CLO A;  5MC7 A;  3NOU C;  2JHE A;  4IJG A;  4OOM A;  4I39 A;  2INW A;  4LRX C;  1H8M A;  5DKL A;  2V0U A;  3LUQ A;  2V1A A;  1Y28 A;  2QJ5 A;  5DJU A;  4EW7 A;  5J4E A;  3LR0 A;  3B42 A;  4HHD A;  3EEA A;  4WEJ A;  3UE3 A;  4WUJ A;  4HOI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...