4NXEA

Crystal structure of ilov-i486(2lt) at ph 6.5
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
104
structure length
103
Chain Sequence
KNFVITDPRLPDNPIIFASDGFLELTEYSREEILGRNARFLQGPETDQATVQKIRDAIRDQRETTVQLINYTKSGKKFWNLLHLQPVRDQKGELQYFGVQLDG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Flavoprotein, fluorescent protein
molecule keywords Phototropin-2
publication title Significant Expansion of Fluorescent Protein Sensing Ability through the Genetic Incorporation of Superior Photo-Induced Electron-Transfer Quenchers
pubmed doi rcsb
source organism Arabidopsis thaliana
total genus 31
structure length 103
sequence length 104
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2013-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13426 PAS_9 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4nxeA00
4NXEA 4GHIA 4HP9A 4WL9A 3IBRA 1UWPX 3CLOA 3MXQA 1TS6A 2OWHA 1S66L 2QWSA 2D02A 2YKHA 2ZBBA 4GS9A 2D01A 5HZHA 3UB6A 2Z6CA 4WN5A 1Y28A 1JNUA 5F69A 4K08A 4EESA 3ULFA 3UB9A 4BBVA 3B33A 2HV1A 2V0UA 4LRZE 2L1MA 5G4YA 5HD3A 4YWZA 3VE3A 1T1AA 3UB7A 1S1ZA 1GSXA 5HSQA 3GDIA 1OTIA 4HJ3A 3MFXA 1BYWA 3H7WA 4I38A 3H9WA 3K3DA 2INWA 2VV7A 4PKYA 3T50A 5F68A 4I3IA 3HJIA 1GSVA 5AVFA 3BY8A 2OOLA 3F1PA 1LSVA 3A0SA 1S67L 3SW1A 4HHDA 1P0ZA 3RTYA 1X0OA 4HNBA 1T19A 4JGPA 1VB6A 1GSWA 4L9EA 1V9YA 4H6JA 2QJ5A 1DP6A 3EEHA 1F98A 2R78A 4GW9A 2WKPA 5IS1A 1S1YA 4NXFA 2I9VA 2ZOHA 2L4RA 3F1OA 1N9LA 1OJGA 2V9AA 4HI4A 4I5SA 2PYPA 1LSWA 2V1BA 3MQQA 3BY9A 2VV6A 4EXOA 3VE4A 5TBMB 3UB8A 4L9FA 4XT2B 3LIDA 1G28A 4R3AA 2WKQA 5KIZA 3NOTC 1T1BA 1LL8A 5HWTA 2V1AA 3C8CA 1OTDA 4R38A 1OTEA 2YKFA 4LLOB 4HJ6A 4WF0A 3FC7A 3E4QA 5AVEA 1P97A 2V0WA 1UWNX 3PHYA 4I39A 4WLAA 2PDRA 3UE6A 3F1NB 3P7NA 3ICYA 1S4RA 3UMEA 4MN5A 3H82A 2A24B 3E4PA 2J80A 1DRMA 2GJ3A 4I3AA 3GECA 5IU1A 3A0VA 3IS2A 3LIBA 1XJ3A 4EQ1A 1D7EA 5EFWA 4GHIB 1XFNA 2PYRA 2QKPA 4BBUA 2BASA 4DJ3A 1T1CA 4F3LA 2KDKA 4WUJA 1XJ6A 2Z6DA 5DJUA 3MQOA 2PD7A 4GS9B 1KOUA 5HDSA 3KX0X 5HWWA 1TS0A 1OTBA 3MR0A 4EERA 4NXBA 5HDCA 4I3JA 3D72A 5F6AA 3H7WB 3E4OA 3LI9A 4DJ2A 2H28A 3F1PB 2VV8A 5J7EA 1XJ4A 5I5LA 4BBTA 5F5YA 2VLGA 2K7SA 2OWJA 2B02A 2PR5A 4JGOA 3NHQA 3NOPC 3LYXA 4H6JB 1OTAA 1DP9A 3CWFA 4KUOA 5HD5A 4HIAA 2KX6A 1OT6A 1XJ2A 3F1OB 3G6OA 4LRYC 4HP4A 3FG8A 2W27A 3UMDA 1UGUA 2PD8A 3MJQA 5DKLA 3LUQA 3LIEA 1TS8A 5HWVA 3NOUC 3A0RA 1S4SA 2P7JA 3HJKA 2ZOIA 4EEUA 5DJTA 4NXGA 5G4ZA 1LT0A 2VEAA 1WA9A 2CMNA 1OJ5A 4B9OA 4R6LA 2QHKA 1ODVA 3C2WA 5DKKA 1TS7A 2PHYA 2JHEA 4KUKA 3RH8B 4KQDA 5J4EA 1EW0A 2PR6A 1N9OA 4HQAA 3OLOA 4LRXC 5TBMA 3VOLA 5A8BA 2M1CA 4XT2A 3ZQ5A 1NWZA 2L0WA 3NJAA 3LI8A 1F9IA 3H82B 1DP8A 4HH3A 3EWKA 3K3CA 5HDDA 4HY8A 3CAXA 2QJ7A 4HOIA 3IS2B 4R70A 2JN7A 2WKRA 1OT9A 4LPZA 3LIAA 4HJ4A 1MZUA 4E04A 4HH2A 4PKYG 3F1NA 4RQ9A 4MN6A 3LIFA 2EA9A 3LICA 4EETB 2A24A 4F3LB 1XFQA 4JGQA 5J3WA 4GCZA 1D06A 2W0NA 4M4XA 4JGRA 1N9NA 1T18A 1LSXA 1V9ZA 4EW7A 3PYPA 3BWLA 4EEPA 4L9GA
chains in the Genus database with same CATH superfamily
3L9KA 2WZZA 3IF6C 4DE2A 4GJ4A 4WL9A 2VGLS 3G4PA 3IBRA 1K4FA 3BLMA 5DTKA 4N9LA 5EVIB 1WE4A 4EUZA 2K2NA 4XUXA 2V1ZA 3FPVA 2D02A 4LENA 2ZC6B 4WN5A 1BUEA 3QNCA 4AFIA 4EESA 2B18A 2WAFA 3B33A 2EWVA 5HD3A 1NYYA 1TD5A 1T1AA 4HBUA 2HPBA 5BOHA 2P9VA 1VETB 1FOFA 5E2EA 1S1ZA 4OPQA 5HSQA 1W63Q 3BFDA 2NUTC 4I38A 3H9WA 2C5WB 5GHYA 3SH7A 4JLFA 4DKIA 2JKRM 4I3IA 2PBDP 1GSVA 1DJAA 4JXVA 3JYIA 2Y8HA 3C4PA 1T19A 5KSHA 1V9YA 1CJFA 4C75A 1SKOB 3DW0A 5FQQA 4KG5A 1MY8A 1EWZA 1XPBA 3F1OA 3V3SA 4KZ5A 1WYBA 1H8YA 2V9AA 1FQGA 4HI4A 4I5SA 3TJZC 4JPMA 1O7EA 2W1TA 5M1AA 1BLPA 2Q0OA 2OLVA 5DFXA 3VFFA 4PPRA 1J3WA 1G28A 4R3AA 2WKQA 5KIZA 3BM6A 3NOTC 1K57A 2R9XA 5CHJA 3E0YA 4ZBEA 1FCMA 3PBSA 3C8CA 4PMAA 2XA7S 5FAPA 3RXXA 2Y59A 1CQAA 2GDNA 4R38A 4IHQA 3NIAA 4LLOB 5AVEA 1P97A 2V0WA 3VP1A 1OPXA 1JTGA 2EX9A 1GCEA 1IELA 2XDMA 3P7NA 2JCHA 1S4RA 5KSCA 4WYYA 3T4LA 3AGDA 4LCMA 4MBFA 2A24B 2ZD8A 1W8QA 3E4PA 3KYEA 3BFEA 2ZC5B 3S7OA 2J9PA 3ITBA 2A2LA 2ZL1B 3A0VA 2WKHA 3IS2A 4WMCA 3ZCZA 4EQ1A 3SS4A 4BL2A 4C6YA 3BYDA 1NLYA 4GHIB 1L0EA 3IF6A 5DF9A 3S1YA 4OLDA 2P74A 4GZBA 4EEPA 5HAPA 1H5XA 4E3OA 2KDKA 4ZTKA 5DJUA 2PD7A 3S7QA 2Y2NA 1KOUA 3UB5P 1H0MA 3LGOA 3CI6A 3B42A 1MWTA 3UDIA 5MC7A 2XD5A 4EERA 4NXBA 3D4FA 1ZKJA 3D72A 4B4XA 1QMEA 2JKTI 4WMCD 4KZ4A 4WELA 3BEBA 4NKPA 4X1LA 3HLWA 3T4OA 4S2PA 4R4SA 4KQQA 5DTSA 4OPZA 1RCJA 2HF6A 3G32A 4BBTA 3VOZA 1KE4A 1GA9A 3BQAA 2OWJA 5FEFA 3LCEA 3IBJA 4S2OA 3OCNA 4X1MA 3UPPA 4QJGA 1LL5A 4Q0HA 2DMWA 1L0FA 1DP9A 1AWIA 4KUOA 5HD5A 4E3LA 2Y2PA 2OAP1 2PBYA 4KG2A 3G6OA 1RGZA 4KG6A 3ZYTA 3BRMA 3UO9A 2G2UA 3MJQA 4Y0UA 4Y3IA 3P98A 3LIEA 1W8YA 3ZG0A 5JYPA 3LR4A 2ZMVA 3IQAA 3AGEA 3FYZA 2P7JA 2P04A 4KZ6A 3ZNTA 2WGWB 4Y2FA 4NXGA 3G30A 3EOIA 3IX4A 3R7WB 2KOIA 1DJBA 1OJ5A 2ZM8A 4B9OA 2J9OA 4R6LA 4YINA 2QHKA 3IH9A 3GR2A 1TS7A 4Y5FA 5EECA 3UN7A 1ERMA 3DAVA 3IT9A 4KUKA 4KQDA 1TDGA 1N9OA 4RYEA 4HQAA 4DN0A 1W5DA 3PBNA 5TBMA 4Z1WA 3VOLA 5G18A 5FEGA 2VJWA 4XT2A 3ZQ5A 3MZFA 3IX8A 2ZC7A 1F9IA 3N8LA 3EEAA 4UQIM 1E4DA 5EOOA 1IYPA 3NI9A 1SHVA 4HH3A 4Y0OA 4DXCA 3K3CA 4HY8A 3CAXA 2M7VA 2E8JA 2PRFA 5LBRA 4R70A 4KZ9A 4OVDA 2WKRA 1K0KA 2EX2A 4K0WA 4LPZA 4FUWA 1PWCA 4HH2A 4E3KA 4G3KA 4RQ9A 3GV9A 3EGDC 5D3OA 4KZ3A 3E2KA 3LIFA 3LICA 4EETB 3O87A 3DBAA 2GNXA 3QP4A 4QB8A 3OBFA 3B47A 4N1HA 1L3LA 3CMZA 5J3WA 4GCZA 1D06A 1ESUA 4JGRA 1N9NA 1Y54A 1VEUB 1M6KA 3EGXC 2Y2KA 4NXEA 2HJ9C 4ARZA 2VX8A 5FI7A 3A3FA 1UWPX 2C6WB 2WZXA 1PI4A 1NJ4A 4ID4A 5CTNA 2Y2MA 2H5SA 3IH8A 3IWOA 4GS9A 4UAAA 3UB6A 1GHMA 2Z6CA 1NY0A 4LV0A 4IBXA 1L2SA 4FH2A 1JNUA 4BD0A 3MKFA 4PM6A 3M6HA 4OPYA 2V0UA 4LRZE 2L1MA 3KYQA 5G4YA 4R3BA 3G2YA 5CX7A 5EVIC 1E3UD 1GSXA 4KENB 1YKDA 1OTIA 3MFXA 1BYWA 3H7WA 3PBTA 4OP5A 4CLCA 2J3TC 2INWA 4WEJA 4PKYA 2ZLYA 3RFBA 3HLEA 2Y2JA 5FQ9A 3GRJA 4N1XA 2JKTM 3HJIA 1DJCA 3T1QB 3FZCA 3F1PA 3CUEA 3A0SA 3IHBA 4HHDA 1X0OA 5EPHA 4CQHA 1FILA 2K31A 5CGXA 4JGPA 1GSWA 2G7UA 5L10A 2QJ5A 5HARA 1STZA 3S7PA 2V20A 2E8IA 2XD1A 5GHZA 3GVBA 2Y2LA 3UPOA 2ZOHA 3HUMA 3BQ8A 3C30A 1K6SA 3N8RA 4EBPA 1OJGA 1K55C 3WRZA 2ZM2A 3Q7VB 4WZ5C 4DDSA 3BY9A 2VV6A 4EXOA 2UWXA 3O88A 3VE4A 1IKIA 2ZMFA 2Y2IA 3UB8A 4L9FA 2V8CA 3LFVA 1MXOA 3DTKA 4FH4A 2Y4AA 1T1BA 1PRQA 5HWTA 5FI2A 2V1AA 3NC8A 2O99A 4Y17A 2ZJ9A 4N9KA 4WF0A 2X71A 2NUPC 5A92A 3MQ0A 2ZQ7A 5F1FA 4DE1A 4KZAA 2PDRA 2QYBA 3E2LA 4EQIA 3ICYA 2Y2HA 4K0XA 4CPKA 4MN5A 3H82A 2HDSA 2EXAA 1BSGA 4UA9A 1PWDA 1BULA 4B4ZA 1LL9A 4O01A 2GJ3A 3D3OA 1BTLA 1XA7A 1G6OA 3MBZA 5EVEA 2XQZA 3S22A 1P9WA 3LIBA 3Q81A 1Z09A 3W8KA 1D7EA 4WEKA 4G3WA 2PYRA 1XP4A 2QKPA 1LHYA 4BBUA 3SOIA 4BENA 4EV4A 2WYXA 4F3LA 3DTEA 3B3XA 1NZUA 3DWKA 3MQOA 4E3MA 2XFTA 3T4TA 4OOLA 1D1JA 3SH9A 2LB9A 1YMSA 3IF5A 2UV0E 2Q9MA 2HP9A 3V67A 5EVIA 3IWQA 4ZDXA 4FTXA 1HLUP 1VM1A 1YQSA 1ZC2A 5EM1A 3E4OA 1XA1A 3LI9A 3PBOA 4UQIS 4KZBA 4LCLA 3CG5A 3K2NA 2H28A 2XROA 2VV8A 5F1GA 1XJ4A 5F5YA 3T4KA 2K7SA 3QP2A 4ETXA 1VETA 1N9BA 2EFUA 5F83A 3NOPC 4IVIA 3OOVA 4H6JB 5HFOA 4OONA 3CWFA 4MDZA 4GKUA 4BQMA 1ALQA 1OT6A 1MWUA 2QPNA 1XJ2A 1I5QA 2GZAA 4LRYC 2V8FA 4MEZA 1A0KA 2W27A 3V5MA 3UMDA 3IXHA 3NCKA 1K55A 2PD8A 4GDBA 4P0MA 4YOFA 1C3BA 1TS8A 3NOUC 3A0RA 1S4SA 1ACFA 4WZ5A 3PTEA 3MKEA 3WS0A 1LT0A 1SKOA 4GD8A 4KZ8A 3UE3A 1ODVA 3UPNA 2A49A 1GA0A 5AQ7A 4ME4A 4CJNA 4C3QA 1MC0A 4OOMA 4Z9QA 4R4RA 5J4EA 3N4IA 1FCNA 2A3UA 5FAQA 1YLPA 3OLOA 4LRXC 1NXYA 5E2FA 4S2JA 1NWZA 2CC1A 3HLCA 4RVAA 3LR3A 1KVMA 4IBRA 1IKGA 2X01A 1DP8A 2IWBA 2HJEA 2QMIA 4GB7A 2H10A 1YSPA 2HDUA 4Y7PA 3VP3A 1XX2A 1S0WA 2VA0A 3GTCA 3TE8A 2JN7A 4E6XA 3C38A 4HJ4A 4E04A 3TOIA 3S7NA 3KYZA 2ZQAA 2WGIA 1PYYA 3Q07A 5FQJA 3V50A 2A24A 5KZHA 3P09A 3T4SA 3T1RA 2VGLM 3UE0A 1XFQA 1H3QA 1HZOA 1EROA 4EBNA 2ZL1A 3FV7A 2IWCA 5FQMA 1PZOA 4NG2A 1V9ZA 1BLSA 3PYPA 3BWLA 3UNWA 3SZTA 3OPPA 1XGIA 4GHIA 4HP9A 3ZHHA 2XEPA 3IXDA 3D9YA 3V3RA 3SH8A 1NRJA 3SS3A 1FIKA 4WZ4A 3MXQA 2OWHA 1S66L 5HX9A 3LY3A 5FQIA 1AXBA 2YKHA 2ZBBA 2I72A 5HZHA 5FAOA 4Q8IA 5EV0A 4U0TA 1TVFA 3UY6A 4WBGA 1K38A 4IEDA 4OH0A 1YSQA 3ULFA 2H0YA 3UB9A 3O86A 3CPTB 3FKVA 2HV1A 4YWZA 4M3KA 2EXBA 1K6RA 4OQGA 3GDIA 1YT4A 2EWWA 5CEDA 2VK3A 2JKFA 3M2KA 4OOYA 4OPRA 3LEZA 2VV7A 2Z2MB 3N7WA 3T50A 1Q2PA 3DTMA 2XRNA 4RX2A 1SZVA 1LSVA 4S2NC 1Q2QA 1G68A 2XSSA 4HNBA 4X53A 3KSFA 5A90A 4QY5A 5C5KA 1VB6A 1NYMA 1K56A 4L9EA 1S6RA 4P87A 1P9RA 5IHVA 2Y2GA 4BWIA 2WKPA 2W3GA 4UA6A 1ESIA 3ITAA 1S1YA 2I9VA 2L4RA 1RGYA 4EUVA 4IVKA 1ES3A 3C7UA 3OC2A 1KDSA 2BTFP 2PYPA 3MQQA 1FR6A 3KSHA 1G6AA 2XA7M 3SS5A 5TFQA 1JVJA 2WGWA 3QP1A 4RX3A 5CRFA 5EUAA 2O9CA 4OQIA 3MSHA 5GLAA 3R7WA 2PT7A 5GLDA 3WS1A 4BD1A 3MFDA 3G2ZA 2FZ0A 4JF4A 1FCOA 4R3JA 4B88A 3IWIA 3A3DA 4QY6A 3A3JA 1OTDA 1YMXA 1J9MA 1XKZA 1ZG6A 3FC7A 4R1GA 2QZ6A 5U47A 4JXSA 3RXWA 4PM7A 5FDHA 1CF0A 3WWXA 2DNSA 4WLAA 4QWOA 4FD8A 3UE6A 1PW8A 1EI5A 2WKIA 3F1NB 3QP5A 3MZEA 1IOUA 5CHUA 3KSIA 5FI6A 3VFHA 5AQAA 1F5MA 3MMHA 4OQ0A 4BMWA 3IX3A 3RJUA 3KSGA 5IU1A 4P6ZM 4PAUA 2JKGA 3NDEA 1XJ3A 3ISGA 2XFSA 4E3NA 3QNBA 4FCFA 4QHCA 4F94A 3A3EA 1ZTUA 3ZVTA 4FSFA 2ZQCA 5I94A 1JTDA 4JXWA 3KO6A 4UA7A 4IUKA 5CEBA 1NZOA 3BW6A 3LO7A 3ZG7B 1LI0A 5HDSA 5FASA 2XLNA 3VP2A 3KX0X 1CI8A 5FQKA 5HWWA 1TS0A 1VEUA 1OTBA 4L0LA 5L2FA 1CEFA 1E25A 1FSWA 1IFQA 1CI9A 1DY6A 3W4PA 3CJMA 4OQHA 3Q7ZA 2P9VB 4R23A 4ZJ1A 4I3JA 3G31A 4CLCD 3HLGA 4WM9A 3IHAA 2RL3A 4BL3A 5M19A 4ZRRA 2EX6A 2ACGA 4P85A 5L09A 1LI9A 5GL9A 4DJ2A 1N4OA 3WRTA 1FSYA 1QMFA 3UDXA 3ZVWA 3PR6A 5A91A 2VLGA 2PU4A 1O07A 2HZ5A 2B02A 3LEQA 3HLFA 4JGOA 3NHQA 3OPRA 1ERQA 5L8MA 3LYXA 5CTMA 1SDNA 1OTAA 1KGFA 4HBTA 2FH5A 2Y91A 5FL3A 3IXBA 5J8XA 2BLSA 3TSGA 4QU3A 3HVFA 4O7DA 4X55A 1TEMA 3A3IA 1YM1A 3F1OB 2ZQ9A 2XGNA 3GQZA 3LR5A 3JPUA 3FG8A 1TDLA 1ONHA 3MS6A 1PWGA 3LUQA 1VHMA 2MJ6A 2W1TB 3AGFA 1GHIA 1XGJA 5HWVA 3VOYA 3V39A 4PM5A 4R0QA 3HJKA 2ZOIA 1ES2A 5DJTA 2VEAA 1WA9A 3NBLA 4P6BA 2CMNA 4H8RA 5GLCA 4QPRA 2Q9NA 2WKEA 2G2WA 3C2WA 1PI5A 4Y0TA 4PM9A 3Q1FA 4DE3A 2J7VA 4QD4A 5CERA 2ZQ8A 4DRTA 2VGJA 1PIOA 5TR7A 1IYOA 2JHEA 3RH8B 3Q7VA 1ONGA 1BZAA 4A5RA 1BT5A 3C4OA 2R9WA 3N8SA 3MXSA 5M18A 5A8BA 3S4XA 2L0WA 3VP4A 3M6BA 1ES4A 3NJAA 3LI8A 2IWDA 2DCFA 2OAQ1 2WAEA 3CZDA 1SKFA 3VMAA 2ZMAA 4S2LA 5EE8A 5HDDA 5FA7A 4EWFA 1KE3A 2QJ7A 2Z2LB 3IS2B 1RP5A 1OT9A 4DMZA 3ZNYA 1YAXA 1GHPA 3LIAA 1MZUA 4BLMA 3FKWA 3VP0A 1SCWA 2Y79A 4GN2A 4E3JA 2XH9A 3IF6B 3P01A 4K91A 1KGEA 3R4KA 4YFMA 5JYOA 1YLJA 2EA9A 2W3FA 4X69A 5CECA 1Z6FA 5CGSA 3G35A 1NLZA 2ZM0A 5HW3A 3WS2A 1W79A 5KMWA 3EQUA 1LSXA 1PW1A 3TG9A 2WUQA 3EQVA 4JF5A 5FSRA 4X6TA 3Q82A 5EVID 3NECA 3CLOA 4S2KA 4UHUA 1TS6A 5F82A 1PZPA 3HUOA 2BG1A 4XXRA 4IJGA 2QWSA 1VQQA 5CGWA 3HREA 5HAQA 2FFFB 2J3TD 2D01A 3PBRA 4RA7A 2Y2OA 1L0GA 4OLGA 2HGVA 3BLSA 3L7HA 1Y28A 5HAIA 2VGKA 3WS4A 4BJPA 5F69A 3FWLA 2B95A 4K08A 3OPLA 4E3IA 4BBVA 5DF8A 3T1XA 3VE3A 1YPRA 3M2JA 4Q0JA 1ZHHB 3UB7A 5HPIA 4Y13A 5A93A 4S2MA 1KDWA 2ZC4B 4HJ3A 4EU0A 3K3DA 3GSGA 5TGFA 1BLCA 2H0TA 4GNUA 3UDFA 4XUZA 3O5YA 4DE0A 5F68A 5AVFA 3BY8A 2OOLA 1S67L 3SW1A 3U4LP 1P0ZA 4P6ZS 3RTYA 2O9AA 2JBFA 5GHXA 2XF3A 2RCXA 5DFYA 4H6JA 1MWRA 1KGGA 4X25A 1DP6A 5DVAA 3EEHA 1BLHA 1F98A 3G34A 4NK3A 2R78A 4GW9A 3WS5A 3O3VA 5IS1A 3OPHA 3LR0A 4NXFA 4X56A 1M40A 1N9LA 5DTTA 5EOEA 5HPFA 1CEGA 3PAGA 4IUHA 3BFCA 5EM0A 3QHYA 4MBKA 3U2AA 1MBLA 3TW8A 1LSWA 2V1BA 2W3EA 2KLIA 1SDEA 4N92A 2P08A 5TBMB 4XT2B 4DXBA 3LIDA 1PFLA 2LB5A 3HCYA 2VKSA 5AQBA 1JWZA 1K25A 4HEFA 4OKPA 1LL8A 3VV4A 1HTZA 3ZFZA 3E98A 4YNRA 4Y15A 1W63M 4CLCC 1OTEA 3OCLA 2YKFA 3OZHA 4HJ6A 1W7FA 2ZQDA 3E4QA 3JVVA 1CK3A 4KZ7A 2W3DA 1UWNX 3PHYA 1XXMA 2JE5A 1H8ZA 2W1RA 2OV5A 3CUEC 4I39A 1G5UA 3UMEA 4DDYA 2PU2A 2J80A 1DRMA 3QP8A 4I3AA 4S2IA 5IT5A 4HESA 3MXRA 2J3WA 4LGWA 3GECA 1Y4OA 1K54C 4JBFA 2M7UA 5GLBA 2EX8A 5EFWA 2J8YA 4NEED 4ARZB 2O0YA 1XFNA 3T4QA 2EFXA 1ZG4A 2HP6A 4PM8A 3VSKA 4D60A 2BASA 4DJ3A 1H8MA 1T1CA 5EVLA 4WUJA 5E2GA 1XJ6A 4UEYA 3N6IA 1U60A 2Z6DA 2GX5A 4GS9B 2WK0A 1K4EA 1F2KA 3HL9A 4NETA 2IA2A 1HVBA 5E43A 3W4OA 2HDQA 2JC7A 3DWZA 3MR0A 4LV3A 4ESPA 3HLBA 1NRFA 4CLCE 3BFFA 3NY4A 4LFUA 3VSLA 5HDCA 3T12B 3C5AA 5FDSA 2JKRI 4B93A 2HDRA 3HLDA 5DF7A 5L07A 3BFGA 1IEMA 5F6AA 3H7WB 4CLCB 4PHTA 5FATA 2Y2QA 1IYSA 5TJJA 4U0XA 3W4QA 5AJGA 3F1PB 4GDNA 2AVXA 2VZWA 4KQOA 2WGVA 3T1SA 5J7EA 5I5LA 1JWVA 3CPTA 3ZDJA 1WYCA 4JKTA 4ETZA 2OSUA 4U3TA 2PR5A 3T4JA 1K56D 4LV1A 4MLLA 3GMWA 4MNRA 1E3UA 1PNEA 2OLUA 3BJNA 3ZG5A 1FR1A 4HIAA 3MF0A 1ES5A 2KX6A 5E2HA 1MKIA 4ZAMA 5HL1A 4E6WA 5AQ9A 3MZDA 2Y55A 4HP4A 4O0PA 1UGUA 4MBHA 5DKLA 4GLQA 3NULA 4Q0IA 2DRWA 1KVLA 2WADA 1YLYA 5CXWA 4OP8A 4FOFA 4EEUA 3IXGA 4X68A 4ZJ2A 5G4ZA 5CHMA 4JXGA 3I7JA 1TF1A 3ZG9B 4DF6A 2PAVP 3NDGA 5DKKA 3BECA 4MCWA 1IYQA 3PXPA 2PHYA 2ZC3B 3FPWA 3CITA 1JWPA 4MN7A 2O9BA 2XR0A 1EW0A 2PR6A 4EBLA 5K5BA 2M1CA 1K57C 3QP6A 1YLTA 1I2WA 2X02A 3PAEA 4KQRA 3H82B 1MWSA 1I2SA 4O8GA 1OMEA 2V2FF 4GD6A 1MPLA 5HL6A 3PBQA 1LLBA 3EWKA 4LV2A 2B5RA 3JVUA 1HD8A 1L0DA 3ZG8B 2XK1A 4HOIA 4D2OA 3HUNA 4JF6A 3UE1A 1K54A 1YLWA 3TRCA 4ZJ3A 4MMNA 4PKYG 3F1NA 1MKMA 3CHWP 4MN6A 4S2NA 3DTIA 3C7VA 4GOGA 4F3LB 4G3VA 1KE0A 4JGQA 4II7A 1YLZA 3LY4A 2W0NA 4M4XA 2W3HA 2HP5A 4EW7A 1T18A 3HBRA 2FFYA 3ZGAB 3W2ZA 4L9GA
chains in the Genus database with same CATH topology
4NXEA 2HJ9C 4ARZA 2VX8A 4GHIA 4GJ4A 4HP9A 4WL9A 2VGLS 3IBRA 1UWPX 1NRJA 3CLOA 3MXQA 1TS6A 2OWHA 4IJGA 2K2NA 1S66L 2QWSA 3FPVA 2D02A 2YKHA 2J3TD 2ZBBA 4GS9A 2D01A 5HZHA 3UB6A 3PBRA 2Z6CA 4WN5A 2HGVA 4AFIA 1Y28A 4BJPA 1JNUA 5F69A 4K08A 1YSQA 3ULFA 4EESA 3UB9A 2B18A 4BBVA 3B33A 2EWVA 2HV1A 2V0UA 4LRZE 2L1MA 3KYQA 5G4YA 5HD3A 1TD5A 4YWZA 3VE3A 1T1AA 5CX7A 4Q0JA 1ZHHB 3UB7A 5HPIA 1S1ZA 1GSXA 1YKDA 5HSQA 1W63Q 3GDIA 2EWWA 1OTIA 4HJ3A 4EU0A 3MFXA 1BYWA 3H7WA 3PBTA 2NUTC 4CLCA 4I38A 3H9WA 2J3TC 3K3DA 2INWA 4WEJA 2VV7A 4PKYA 3RFBA 3T50A 3O5YA 2XRNA 5F68A 2JKRM 2JKTM 3HJIA 4I3IA 1GSVA 5AVFA 3BY8A 2OOLA 3F1PA 1LSVA 3CUEA 3A0SA 1S67L 3SW1A 4HHDA 1P0ZA 4P6ZS 1X0OA 3RTYA 4CQHA 2O9AA 2XSSA 2K31A 2Y8HA 4HNBA 1T19A 3KSFA 4JGPA 5C5KA 5KSHA 1VB6A 1GSWA 2G7UA 4L9EA 5DFYA 1V9YA 4H6JA 1P9RA 2QJ5A 1STZA 1DP6A 3S7PA 3EEHA 4BWIA 1F98A 2R78A 4GW9A 2WKPA 5IS1A 2W3GA 3LR0A 1S1YA 4NXFA 2I9VA 2ZOHA 3BQ8A 3F1OA 2L4RA 3C30A 1N9LA 5HPFA 4EUVA 1OJGA 4IUHA 3OC2A 2V9AA 3U2AA 4HI4A 4I5SA 3TW8A 2PYPA 3TJZC 1LSWA 2V1BA 3MQQA 2W1TA 2W3EA 2KLIA 3KSHA 3BY9A 2VV6A 4EXOA 2XA7M 3VE4A 5DFXA 2ZMFA 2P08A 5TBMB 2O9CA 3UB8A 4L9FA 4XT2B 3LIDA 3R7WA 1G28A 3LFVA 4R3AA 2WKQA 5KIZA 2PT7A 2LB5A 3HCYA 2VKSA 3NOTC 1T1BA 2FZ0A 3E0YA 3VV4A 1LL8A 5HWTA 2V1AA 3C8CA 3E98A 3PBSA 2XA7S 4YNRA 1W63M 1OTDA 4CLCC 2O99A 4R38A 1OTEA 3OCLA 2YKFA 4IHQA 4LLOB 4HJ6A 4WF0A 3FC7A 3E4QA 3JVVA 5AVEA 1P97A 2V0WA 2W3DA 1UWNX 3PHYA 2NUPC 1OPXA 3MQ0A 2W1RA 3CUEC 4I39A 4WLAA 2PDRA 2QYBA 3UE6A 3F1NB 3P7NA 3ICYA 1S4RA 1IOUA 3UMEA 3T4LA 3KSIA 4MN5A 3H82A 2A24B 1F5MA 3MMHA 3E4PA 2J80A 4BMWA 3S7OA 1DRMA 4O01A 2GJ3A 4I3AA 5IT5A 3D3OA 2J3WA 3KSGA 2A2LA 1G6OA 3GECA 4P6ZM 4PAUA 5IU1A 3A0VA 3IS2A 1P9WA 3LIBA 1XJ3A 2M7UA 4EQ1A 1D7EA 5EFWA 1ZTUA 4NEED 4WEKA 4ARZB 1NLYA 4G3WA 2O0YA 4GHIB 4FSFA 1XFNA 3T4QA 2PYRA 5DF9A 2QKPA 4BBUA 4EEPA 3KO6A 4IUKA 2BASA 4DJ3A 1H8MA 1T1CA 4F3LA 2KDKA 3BW6A 4WUJA 1XJ6A 4UEYA 2Z6DA 5DJUA 3MQOA 2GX5A 2PD7A 4GS9B 3S7QA 1KOUA 3T4TA 5HDSA 4OOLA 2IA2A 3KX0X 3CI6A 3B42A 5HWWA 1TS0A 2LB9A 1OTBA 4L0LA 5MC7A 3MR0A 4EERA 1IFQA 4NXBA 4CLCE 5HDCA 3V67A 4I3JA 3D72A 2JKRI 4B93A 2JKTI 4WELA 4CLCD 5F6AA 3H7WB 4CLCB 4NKPA 3E4OA 4ZRRA 3T4OA 3LI9A 3PBOA 4PHTA 4UQIS 4DJ2A 5TJJA 3K2NA 2H28A 2XROA 5AJGA 3F1PB 2HF6A 2VZWA 2VV8A 4KQOA 3PR6A 5J7EA 1XJ4A 5I5LA 4BBTA 5F5YA 2VLGA 3T4KA 2K7SA 3BQAA 2OWJA 4ETXA 4ETZA 2B02A 2PR5A 3T4JA 4JGOA 3NHQA 3IBJA 3NOPC 3OOVA 3OCNA 5L8MA 3LYXA 4H6JB 3BJNA 1OTAA 4Q0HA 2DMWA 1DP9A 3CWFA 4KUOA 5HD5A 2FH5A 5FL3A 4MDZA 4HIAA 3MF0A 2OAP1 2KX6A 1OT6A 1XJ2A 3F1OB 3LR5A 2GZAA 3G6OA 4LRYC 4HP4A 3FG8A 2W27A 4O0PA 3UMDA 3ZYTA 1UGUA 2PD8A 3MJQA 4YOFA 5DKLA 4GLQA 4Y3IA 1VHMA 2MJ6A 3LIEA 2W1TB 3LUQA 4Q0IA 3LR4A 2ZMVA 1TS8A 5HWVA 3NOUC 3A0RA 1S4SA 2P7JA 2P04A 3HJKA 2ZOIA 4FOFA 4EEUA 4Y2FA 5DJTA 4NXGA 5G4ZA 3EOIA 1LT0A 2VEAA 1WA9A 2CMNA 3R7WB 2KOIA 1OJ5A 4B9OA 1TF1A 4QPRA 4R6LA 2QHKA 3UE3A 1ODVA 3C2WA 5DKKA 1TS7A 4Y5FA 4MCWA 3PXPA 2PHYA 4ME4A 2JHEA 3FPWA 1MC0A 4KUKA 3RH8B 3CITA 4OOMA 4KQDA 4MN7A 2O9BA 5J4EA 1EW0A 2PR6A 1N9OA 4HQAA 4DN0A 5K5BA 3OLOA 4LRXC 3PBNA 5TBMA 4Z1WA 3VOLA 5A8BA 2M1CA 2VJWA 4XT2A 3ZQ5A 1NWZA 3LR3A 2L0WA 3NJAA 3LI8A 1F9IA 2OAQ1 3EEAA 3H82B 4UQIM 1DP8A 4O8GA 2HJEA 4HH3A 5HL6A 3PBQA 3EWKA 3K3CA 5HDDA 1YSPA 3CAXA 3JVUA 4HY8A 2M7VA 2QJ7A 5LBRA 4HOIA 3IS2B 4R70A 2VA0A 3TE8A 2JN7A 2WKRA 3C38A 1OT9A 4DMZA 1YAXA 4LPZA 3LIAA 4HJ4A 1MZUA 3TRCA 4E04A 4MMNA 3S7NA 4HH2A 4PKYG 2Y79A 3KYZA 3F1NA 4G3KA 1MKMA 4RQ9A 3P01A 3EGDC 4MN6A 3R4KA 3LIFA 2EA9A 3LICA 4EETB 2A24A 2W3FA 3DBAA 3T4SA 2GNXA 4F3LB 4G3VA 2VGLM 3OBFA 3B47A 1XFQA 1H3QA 4JGQA 4II7A 5J3WA 4GCZA 1NLZA 1D06A 2W0NA 4M4XA 2W3HA 4JGRA 3EQUA 1N9NA 1T18A 1LSXA 1V9ZA 4EW7A 3PYPA 3BWLA 3EGXC 3EQVA 3W2ZA 4L9GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NXE A;  4GHI A;  4HP9 A;  4WL9 A;  3IBR A;  1UWP X;  3CLO A;  3MXQ A;  1TS6 A;  2OWH A;  1S66 L;  2QWS A;  2D02 A;  2YKH A;  2ZBB A;  4GS9 A;  2D01 A;  5HZH A;  3UB6 A;  2Z6C A;  4WN5 A;  1Y28 A;  1JNU A;  5F69 A;  4K08 A;  4EES A;  3ULF A;  3UB9 A;  4BBV A;  3B33 A;  2HV1 A;  2V0U A;  4LRZ E;  2L1M A;  5G4Y A;  5HD3 A;  4YWZ A;  3VE3 A;  1T1A A;  3UB7 A;  1S1Z A;  1GSX A;  5HSQ A;  3GDI A;  1OTI A;  4HJ3 A;  3MFX A;  1BYW A;  3H7W A;  4I38 A;  3H9W A;  3K3D A;  2INW A;  2VV7 A;  4PKY A;  3T50 A;  5F68 A;  4I3I A;  3HJI A;  1GSV A;  5AVF A;  3BY8 A;  2OOL A;  3F1P A;  1LSV A;  3A0S A;  1S67 L;  3SW1 A;  4HHD A;  1P0Z A;  3RTY A;  1X0O A;  4HNB A;  1T19 A;  4JGP A;  1VB6 A;  1GSW A;  4L9E A;  1V9Y A;  4H6J A;  2QJ5 A;  1DP6 A;  3EEH A;  1F98 A;  2R78 A;  4GW9 A;  2WKP A;  5IS1 A;  1S1Y A;  4NXF A;  2I9V A;  2ZOH A;  2L4R A;  3F1O A;  1N9L A;  1OJG A;  2V9A A;  4HI4 A;  4I5S A;  2PYP A;  1LSW A;  2V1B A;  3MQQ A;  3BY9 A;  2VV6 A;  4EXO A;  3VE4 A;  5TBM B;  3UB8 A;  4L9F A;  4XT2 B;  3LID A;  1G28 A;  4R3A A;  2WKQ A;  5KIZ A;  3NOT C;  1T1B A;  1LL8 A;  5HWT A;  2V1A A;  3C8C A;  1OTD A;  4R38 A;  1OTE A;  2YKF A;  4LLO B;  4HJ6 A;  4WF0 A;  3FC7 A;  3E4Q A;  5AVE A;  1P97 A;  2V0W A;  1UWN X;  3PHY A;  4I39 A;  4WLA A;  2PDR A;  3UE6 A;  3F1N B;  3P7N A;  3ICY A;  1S4R A;  3UME A;  4MN5 A;  3H82 A;  2A24 B;  3E4P A;  2J80 A;  1DRM A;  2GJ3 A;  4I3A A;  3GEC A;  5IU1 A;  3A0V A;  3IS2 A;  3LIB A;  1XJ3 A;  4EQ1 A;  1D7E A;  5EFW A;  4GHI B;  1XFN A;  2PYR A;  2QKP A;  4BBU A;  2BAS A;  4DJ3 A;  1T1C A;  4F3L A;  2KDK A;  4WUJ A;  1XJ6 A;  2Z6D A;  5DJU A;  3MQO A;  2PD7 A;  4GS9 B;  1KOU A;  5HDS A;  3KX0 X;  5HWW A;  1TS0 A;  1OTB A;  3MR0 A;  4EER A;  4NXB A;  5HDC A;  4I3J A;  3D72 A;  5F6A A;  3H7W B;  3E4O A;  3LI9 A;  4DJ2 A;  2H28 A;  3F1P B;  2VV8 A;  5J7E A;  1XJ4 A;  5I5L A;  4BBT A;  5F5Y A;  2VLG A;  2K7S A;  2OWJ A;  2B02 A;  2PR5 A;  4JGO A;  3NHQ A;  3NOP C;  3LYX A;  4H6J B;  1OTA A;  1DP9 A;  3CWF A;  4KUO A;  5HD5 A;  4HIA A;  2KX6 A;  1OT6 A;  1XJ2 A;  3F1O B;  3G6O A;  4LRY C;  4HP4 A;  3FG8 A;  2W27 A;  3UMD A;  1UGU A;  2PD8 A;  3MJQ A;  5DKL A;  3LUQ A;  3LIE A;  1TS8 A;  5HWV A;  3NOU C;  3A0R A;  1S4S A;  2P7J A;  3HJK A;  2ZOI A;  4EEU A;  5DJT A;  4NXG A;  5G4Z A;  1LT0 A;  2VEA A;  1WA9 A;  2CMN A;  1OJ5 A;  4B9O A;  4R6L A;  2QHK A;  1ODV A;  3C2W A;  5DKK A;  1TS7 A;  2PHY A;  2JHE A;  4KUK A;  3RH8 B;  4KQD A;  5J4E A;  1EW0 A;  2PR6 A;  1N9O A;  4HQA A;  3OLO A;  4LRX C;  5TBM A;  3VOL A;  5A8B A;  2M1C A;  4XT2 A;  3ZQ5 A;  1NWZ A;  2L0W A;  3NJA A;  3LI8 A;  1F9I A;  3H82 B;  1DP8 A;  4HH3 A;  3EWK A;  3K3C A;  5HDD A;  4HY8 A;  3CAX A;  2QJ7 A;  4HOI A;  3IS2 B;  4R70 A;  2JN7 A;  2WKR A;  1OT9 A;  4LPZ A;  3LIA A;  4HJ4 A;  1MZU A;  4E04 A;  4HH2 A;  4PKY G;  3F1N A;  4RQ9 A;  4MN6 A;  3LIF A;  2EA9 A;  3LIC A;  4EET B;  2A24 A;  4F3L B;  1XFQ A;  4JGQ A;  5J3W A;  4GCZ A;  1D06 A;  2W0N A;  4M4X A;  4JGR A;  1N9N A;  1T18 A;  1LSX A;  1V9Z A;  4EW7 A;  3PYP A;  3BWL A;  4EEP A;  4L9G A; 
#chains in the Genus database with same CATH topology
 3L9K A;  2WZZ A;  3IF6 C;  4DE2 A;  4GJ4 A;  4WL9 A;  2VGL S;  3G4P A;  3IBR A;  1K4F A;  3BLM A;  5DTK A;  4N9L A;  5EVI B;  1WE4 A;  4EUZ A;  2K2N A;  4XUX A;  2V1Z A;  3FPV A;  2D02 A;  4LEN A;  2ZC6 B;  4WN5 A;  1BUE A;  3QNC A;  4AFI A;  4EES A;  2B18 A;  2WAF A;  3B33 A;  2EWV A;  5HD3 A;  1NYY A;  1TD5 A;  1T1A A;  4HBU A;  2HPB A;  5BOH A;  2P9V A;  1VET B;  1FOF A;  5E2E A;  1S1Z A;  4OPQ A;  5HSQ A;  1W63 Q;  3BFD A;  2NUT C;  4I38 A;  3H9W A;  2C5W B;  5GHY A;  3SH7 A;  4JLF A;  4DKI A;  2JKR M;  4I3I A;  2PBD P;  1GSV A;  1DJA A;  4JXV A;  3JYI A;  2Y8H A;  3C4P A;  1T19 A;  5KSH A;  1V9Y A;  1CJF A;  4C75 A;  1SKO B;  3DW0 A;  5FQQ A;  4KG5 A;  1MY8 A;  1EWZ A;  1XPB A;  3F1O A;  3V3S A;  4KZ5 A;  1WYB A;  1H8Y A;  2V9A A;  1FQG A;  4HI4 A;  4I5S A;  3TJZ C;  4JPM A;  1O7E A;  2W1T A;  5M1A A;  1BLP A;  2Q0O A;  2OLV A;  5DFX A;  3VFF A;  4PPR A;  1J3W A;  1G28 A;  4R3A A;  2WKQ A;  5KIZ A;  3BM6 A;  3NOT C;  1K57 A;  2R9X A;  5CHJ A;  3E0Y A;  4ZBE A;  1FCM A;  3PBS A;  3C8C A;  4PMA A;  2XA7 S;  5FAP A;  3RXX A;  2Y59 A;  1CQA A;  2GDN A;  4R38 A;  4IHQ A;  3NIA A;  4LLO B;  5AVE A;  1P97 A;  2V0W A;  3VP1 A;  1OPX A;  1JTG A;  2EX9 A;  1GCE A;  1IEL A;  2XDM A;  3P7N A;  2JCH A;  1S4R A;  5KSC A;  4WYY A;  3T4L A;  3AGD A;  4LCM A;  4MBF A;  2A24 B;  2ZD8 A;  1W8Q A;  3E4P A;  3KYE A;  3BFE A;  2ZC5 B;  3S7O A;  2J9P A;  3ITB A;  2A2L A;  2ZL1 B;  3A0V A;  2WKH A;  3IS2 A;  4WMC A;  3ZCZ A;  4EQ1 A;  3SS4 A;  4BL2 A;  4C6Y A;  3BYD A;  1NLY A;  4GHI B;  1L0E A;  3IF6 A;  5DF9 A;  3S1Y A;  4OLD A;  2P74 A;  4GZB A;  4EEP A;  5HAP A;  1H5X A;  4E3O A;  2KDK A;  4ZTK A;  5DJU A;  2PD7 A;  3S7Q A;  2Y2N A;  1KOU A;  3UB5 P;  1H0M A;  3LGO A;  3CI6 A;  3B42 A;  1MWT A;  3UDI A;  5MC7 A;  2XD5 A;  4EER A;  4NXB A;  3D4F A;  1ZKJ A;  3D72 A;  4B4X A;  1QME A;  2JKT I;  4WMC D;  4KZ4 A;  4WEL A;  3BEB A;  4NKP A;  4X1L A;  3HLW A;  3T4O A;  4S2P A;  4R4S A;  4KQQ A;  5DTS A;  4OPZ A;  1RCJ A;  2HF6 A;  3G32 A;  4BBT A;  3VOZ A;  1KE4 A;  1GA9 A;  3BQA A;  2OWJ A;  5FEF A;  3LCE A;  3IBJ A;  4S2O A;  3OCN A;  4X1M A;  3UPP A;  4QJG A;  1LL5 A;  4Q0H A;  2DMW A;  1L0F A;  1DP9 A;  1AWI A;  4KUO A;  5HD5 A;  4E3L A;  2Y2P A;  2OAP 1;  2PBY A;  4KG2 A;  3G6O A;  1RGZ A;  4KG6 A;  3ZYT A;  3BRM A;  3UO9 A;  2G2U A;  3MJQ A;  4Y0U A;  4Y3I A;  3P98 A;  3LIE A;  1W8Y A;  3ZG0 A;  5JYP A;  3LR4 A;  2ZMV A;  3IQA A;  3AGE A;  3FYZ A;  2P7J A;  2P04 A;  4KZ6 A;  3ZNT A;  2WGW B;  4Y2F A;  4NXG A;  3G30 A;  3EOI A;  3IX4 A;  3R7W B;  2KOI A;  1DJB A;  1OJ5 A;  2ZM8 A;  4B9O A;  2J9O A;  4R6L A;  4YIN A;  2QHK A;  3IH9 A;  3GR2 A;  1TS7 A;  4Y5F A;  5EEC A;  3UN7 A;  1ERM A;  3DAV A;  3IT9 A;  4KUK A;  4KQD A;  1TDG A;  1N9O A;  4RYE A;  4HQA A;  4DN0 A;  1W5D A;  3PBN A;  5TBM A;  4Z1W A;  3VOL A;  5G18 A;  5FEG A;  2VJW A;  4XT2 A;  3ZQ5 A;  3MZF A;  3IX8 A;  2ZC7 A;  1F9I A;  3N8L A;  3EEA A;  4UQI M;  1E4D A;  5EOO A;  1IYP A;  3NI9 A;  1SHV A;  4HH3 A;  4Y0O A;  4DXC A;  3K3C A;  4HY8 A;  3CAX A;  2M7V A;  2E8J A;  2PRF A;  5LBR A;  4R70 A;  4KZ9 A;  4OVD A;  2WKR A;  1K0K A;  2EX2 A;  4K0W A;  4LPZ A;  4FUW A;  1PWC A;  4HH2 A;  4E3K A;  4G3K A;  4RQ9 A;  3GV9 A;  3EGD C;  5D3O A;  4KZ3 A;  3E2K A;  3LIF A;  3LIC A;  4EET B;  3O87 A;  3DBA A;  2GNX A;  3QP4 A;  4QB8 A;  3OBF A;  3B47 A;  4N1H A;  1L3L A;  3CMZ A;  5J3W A;  4GCZ A;  1D06 A;  1ESU A;  4JGR A;  1N9N A;  1Y54 A;  1VEU B;  1M6K A;  3EGX C;  2Y2K A;  4NXE A;  2HJ9 C;  4ARZ A;  2VX8 A;  5FI7 A;  3A3F A;  1UWP X;  2C6W B;  2WZX A;  1PI4 A;  1NJ4 A;  4ID4 A;  5CTN A;  2Y2M A;  2H5S A;  3IH8 A;  3IWO A;  4GS9 A;  4UAA A;  3UB6 A;  1GHM A;  2Z6C A;  1NY0 A;  4LV0 A;  4IBX A;  1L2S A;  4FH2 A;  1JNU A;  4BD0 A;  3MKF A;  4PM6 A;  3M6H A;  4OPY A;  2V0U A;  4LRZ E;  2L1M A;  3KYQ A;  5G4Y A;  4R3B A;  3G2Y A;  5CX7 A;  5EVI C;  1E3U D;  1GSX A;  4KEN B;  1YKD A;  1OTI A;  3MFX A;  1BYW A;  3H7W A;  3PBT A;  4OP5 A;  4CLC A;  2J3T C;  2INW A;  4WEJ A;  4PKY A;  2ZLY A;  3RFB A;  3HLE A;  2Y2J A;  5FQ9 A;  3GRJ A;  4N1X A;  2JKT M;  3HJI A;  1DJC A;  3T1Q B;  3FZC A;  3F1P A;  3CUE A;  3A0S A;  3IHB A;  4HHD A;  1X0O A;  5EPH A;  4CQH A;  1FIL A;  2K31 A;  5CGX A;  4JGP A;  1GSW A;  2G7U A;  5L10 A;  2QJ5 A;  5HAR A;  1STZ A;  3S7P A;  2V20 A;  2E8I A;  2XD1 A;  5GHZ A;  3GVB A;  2Y2L A;  3UPO A;  2ZOH A;  3HUM A;  3BQ8 A;  3C30 A;  1K6S A;  3N8R A;  4EBP A;  1OJG A;  1K55 C;  3WRZ A;  2ZM2 A;  3Q7V B;  4WZ5 C;  4DDS A;  3BY9 A;  2VV6 A;  4EXO A;  2UWX A;  3O88 A;  3VE4 A;  1IKI A;  2ZMF A;  2Y2I A;  3UB8 A;  4L9F A;  2V8C A;  3LFV A;  1MXO A;  3DTK A;  4FH4 A;  2Y4A A;  1T1B A;  1PRQ A;  5HWT A;  5FI2 A;  2V1A A;  3NC8 A;  2O99 A;  4Y17 A;  2ZJ9 A;  4N9K A;  4WF0 A;  2X71 A;  2NUP C;  5A92 A;  3MQ0 A;  2ZQ7 A;  5F1F A;  4DE1 A;  4KZA A;  2PDR A;  2QYB A;  3E2L A;  4EQI A;  3ICY A;  2Y2H A;  4K0X A;  4CPK A;  4MN5 A;  3H82 A;  2HDS A;  2EXA A;  1BSG A;  4UA9 A;  1PWD A;  1BUL A;  4B4Z A;  1LL9 A;  4O01 A;  2GJ3 A;  3D3O A;  1BTL A;  1XA7 A;  1G6O A;  3MBZ A;  5EVE A;  2XQZ A;  3S22 A;  1P9W A;  3LIB A;  3Q81 A;  1Z09 A;  3W8K A;  1D7E A;  4WEK A;  4G3W A;  2PYR A;  1XP4 A;  2QKP A;  1LHY A;  4BBU A;  3SOI A;  4BEN A;  4EV4 A;  2WYX A;  4F3L A;  3DTE A;  3B3X A;  1NZU A;  3DWK A;  3MQO A;  4E3M A;  2XFT A;  3T4T A;  4OOL A;  1D1J A;  3SH9 A;  2LB9 A;  1YMS A;  3IF5 A;  2UV0 E;  2Q9M A;  2HP9 A;  3V67 A;  5EVI A;  3IWQ A;  4ZDX A;  4FTX A;  1HLU P;  1VM1 A;  1YQS A;  1ZC2 A;  5EM1 A;  3E4O A;  1XA1 A;  3LI9 A;  3PBO A;  4UQI S;  4KZB A;  4LCL A;  3CG5 A;  3K2N A;  2H28 A;  2XRO A;  2VV8 A;  5F1G A;  1XJ4 A;  5F5Y A;  3T4K A;  2K7S A;  3QP2 A;  4ETX A;  1VET A;  1N9B A;  2EFU A;  5F83 A;  3NOP C;  4IVI A;  3OOV A;  4H6J B;  5HFO A;  4OON A;  3CWF A;  4MDZ A;  4GKU A;  4BQM A;  1ALQ A;  1OT6 A;  1MWU A;  2QPN A;  1XJ2 A;  1I5Q A;  2GZA A;  4LRY C;  2V8F A;  4MEZ A;  1A0K A;  2W27 A;  3V5M A;  3UMD A;  3IXH A;  3NCK A;  1K55 A;  2PD8 A;  4GDB A;  4P0M A;  4YOF A;  1C3B A;  1TS8 A;  3NOU C;  3A0R A;  1S4S A;  1ACF A;  4WZ5 A;  3PTE A;  3MKE A;  3WS0 A;  1LT0 A;  1SKO A;  4GD8 A;  4KZ8 A;  3UE3 A;  1ODV A;  3UPN A;  2A49 A;  1GA0 A;  5AQ7 A;  4ME4 A;  4CJN A;  4C3Q A;  1MC0 A;  4OOM A;  4Z9Q A;  4R4R A;  5J4E A;  3N4I A;  1FCN A;  2A3U A;  5FAQ A;  1YLP A;  3OLO A;  4LRX C;  1NXY A;  5E2F A;  4S2J A;  1NWZ A;  2CC1 A;  3HLC A;  4RVA A;  3LR3 A;  1KVM A;  4IBR A;  1IKG A;  2X01 A;  1DP8 A;  2IWB A;  2HJE A;  2QMI A;  4GB7 A;  2H10 A;  1YSP A;  2HDU A;  4Y7P A;  3VP3 A;  1XX2 A;  1S0W A;  2VA0 A;  3GTC A;  3TE8 A;  2JN7 A;  4E6X A;  3C38 A;  4HJ4 A;  4E04 A;  3TOI A;  3S7N A;  3KYZ A;  2ZQA A;  2WGI A;  1PYY A;  3Q07 A;  5FQJ A;  3V50 A;  2A24 A;  5KZH A;  3P09 A;  3T4S A;  3T1R A;  2VGL M;  3UE0 A;  1XFQ A;  1H3Q A;  1HZO A;  1ERO A;  4EBN A;  2ZL1 A;  3FV7 A;  2IWC A;  5FQM A;  1PZO A;  4NG2 A;  1V9Z A;  1BLS A;  3PYP A;  3BWL A;  3UNW A;  3SZT A;  3OPP A;  1XGI A;  4GHI A;  4HP9 A;  3ZHH A;  2XEP A;  3IXD A;  3D9Y A;  3V3R A;  3SH8 A;  1NRJ A;  3SS3 A;  1FIK A;  4WZ4 A;  3MXQ A;  2OWH A;  1S66 L;  5HX9 A;  3LY3 A;  5FQI A;  1AXB A;  2YKH A;  2ZBB A;  2I72 A;  5HZH A;  5FAO A;  4Q8I A;  5EV0 A;  4U0T A;  1TVF A;  3UY6 A;  4WBG A;  1K38 A;  4IED A;  4OH0 A;  1YSQ A;  3ULF A;  2H0Y A;  3UB9 A;  3O86 A;  3CPT B;  3FKV A;  2HV1 A;  4YWZ A;  4M3K A;  2EXB A;  1K6R A;  4OQG A;  3GDI A;  1YT4 A;  2EWW A;  5CED A;  2VK3 A;  2JKF A;  3M2K A;  4OOY A;  4OPR A;  3LEZ A;  2VV7 A;  2Z2M B;  3N7W A;  3T50 A;  1Q2P A;  3DTM A;  2XRN A;  4RX2 A;  1SZV A;  1LSV A;  4S2N C;  1Q2Q A;  1G68 A;  2XSS A;  4HNB A;  4X53 A;  3KSF A;  5A90 A;  4QY5 A;  5C5K A;  1VB6 A;  1NYM A;  1K56 A;  4L9E A;  1S6R A;  4P87 A;  1P9R A;  5IHV A;  2Y2G A;  4BWI A;  2WKP A;  2W3G A;  4UA6 A;  1ESI A;  3ITA A;  1S1Y A;  2I9V A;  2L4R A;  1RGY A;  4EUV A;  4IVK A;  1ES3 A;  3C7U A;  3OC2 A;  1KDS A;  2BTF P;  2PYP A;  3MQQ A;  1FR6 A;  3KSH A;  1G6A A;  2XA7 M;  3SS5 A;  5TFQ A;  1JVJ A;  2WGW A;  3QP1 A;  4RX3 A;  5CRF A;  5EUA A;  2O9C A;  4OQI A;  3MSH A;  5GLA A;  3R7W A;  2PT7 A;  5GLD A;  3WS1 A;  4BD1 A;  3MFD A;  3G2Z A;  2FZ0 A;  4JF4 A;  1FCO A;  4R3J A;  4B88 A;  3IWI A;  3A3D A;  4QY6 A;  3A3J A;  1OTD A;  1YMX A;  1J9M A;  1XKZ A;  1ZG6 A;  3FC7 A;  4R1G A;  2QZ6 A;  5U47 A;  4JXS A;  3RXW A;  4PM7 A;  5FDH A;  1CF0 A;  3WWX A;  2DNS A;  4WLA A;  4QWO A;  4FD8 A;  3UE6 A;  1PW8 A;  1EI5 A;  2WKI A;  3F1N B;  3QP5 A;  3MZE A;  1IOU A;  5CHU A;  3KSI A;  5FI6 A;  3VFH A;  5AQA A;  1F5M A;  3MMH A;  4OQ0 A;  4BMW A;  3IX3 A;  3RJU A;  3KSG A;  5IU1 A;  4P6Z M;  4PAU A;  2JKG A;  3NDE A;  1XJ3 A;  3ISG A;  2XFS A;  4E3N A;  3QNB A;  4FCF A;  4QHC A;  4F94 A;  3A3E A;  1ZTU A;  3ZVT A;  4FSF A;  2ZQC A;  5I94 A;  1JTD A;  4JXW A;  3KO6 A;  4UA7 A;  4IUK A;  5CEB A;  1NZO A;  3BW6 A;  3LO7 A;  3ZG7 B;  1LI0 A;  5HDS A;  5FAS A;  2XLN A;  3VP2 A;  3KX0 X;  1CI8 A;  5FQK A;  5HWW A;  1TS0 A;  1VEU A;  1OTB A;  4L0L A;  5L2F A;  1CEF A;  1E25 A;  1FSW A;  1IFQ A;  1CI9 A;  1DY6 A;  3W4P A;  3CJM A;  4OQH A;  3Q7Z A;  2P9V B;  4R23 A;  4ZJ1 A;  4I3J A;  3G31 A;  4CLC D;  3HLG A;  4WM9 A;  3IHA A;  2RL3 A;  4BL3 A;  5M19 A;  4ZRR A;  2EX6 A;  2ACG A;  4P85 A;  5L09 A;  1LI9 A;  5GL9 A;  4DJ2 A;  1N4O A;  3WRT A;  1FSY A;  1QMF A;  3UDX A;  3ZVW A;  3PR6 A;  5A91 A;  2VLG A;  2PU4 A;  1O07 A;  2HZ5 A;  2B02 A;  3LEQ A;  3HLF A;  4JGO A;  3NHQ A;  3OPR A;  1ERQ A;  5L8M A;  3LYX A;  5CTM A;  1SDN A;  1OTA A;  1KGF A;  4HBT A;  2FH5 A;  2Y91 A;  5FL3 A;  3IXB A;  5J8X A;  2BLS A;  3TSG A;  4QU3 A;  3HVF A;  4O7D A;  4X55 A;  1TEM A;  3A3I A;  1YM1 A;  3F1O B;  2ZQ9 A;  2XGN A;  3GQZ A;  3LR5 A;  3JPU A;  3FG8 A;  1TDL A;  1ONH A;  3MS6 A;  1PWG A;  3LUQ A;  1VHM A;  2MJ6 A;  2W1T B;  3AGF A;  1GHI A;  1XGJ A;  5HWV A;  3VOY A;  3V39 A;  4PM5 A;  4R0Q A;  3HJK A;  2ZOI A;  1ES2 A;  5DJT A;  2VEA A;  1WA9 A;  3NBL A;  4P6B A;  2CMN A;  4H8R A;  5GLC A;  4QPR A;  2Q9N A;  2WKE A;  2G2W A;  3C2W A;  1PI5 A;  4Y0T A;  4PM9 A;  3Q1F A;  4DE3 A;  2J7V A;  4QD4 A;  5CER A;  2ZQ8 A;  4DRT A;  2VGJ A;  1PIO A;  5TR7 A;  1IYO A;  2JHE A;  3RH8 B;  3Q7V A;  1ONG A;  1BZA A;  4A5R A;  1BT5 A;  3C4O A;  2R9W A;  3N8S A;  3MXS A;  5M18 A;  5A8B A;  3S4X A;  2L0W A;  3VP4 A;  3M6B A;  1ES4 A;  3NJA A;  3LI8 A;  2IWD A;  2DCF A;  2OAQ 1;  2WAE A;  3CZD A;  1SKF A;  3VMA A;  2ZMA A;  4S2L A;  5EE8 A;  5HDD A;  5FA7 A;  4EWF A;  1KE3 A;  2QJ7 A;  2Z2L B;  3IS2 B;  1RP5 A;  1OT9 A;  4DMZ A;  3ZNY A;  1YAX A;  1GHP A;  3LIA A;  1MZU A;  4BLM A;  3FKW A;  3VP0 A;  1SCW A;  2Y79 A;  4GN2 A;  4E3J A;  2XH9 A;  3IF6 B;  3P01 A;  4K91 A;  1KGE A;  3R4K A;  4YFM A;  5JYO A;  1YLJ A;  2EA9 A;  2W3F A;  4X69 A;  5CEC A;  1Z6F A;  5CGS A;  3G35 A;  1NLZ A;  2ZM0 A;  5HW3 A;  3WS2 A;  1W79 A;  5KMW A;  3EQU A;  1LSX A;  1PW1 A;  3TG9 A;  2WUQ A;  3EQV A;  4JF5 A;  5FSR A;  4X6T A;  3Q82 A;  5EVI D;  3NEC A;  3CLO A;  4S2K A;  4UHU A;  1TS6 A;  5F82 A;  1PZP A;  3HUO A;  2BG1 A;  4XXR A;  4IJG A;  2QWS A;  1VQQ A;  5CGW A;  3HRE A;  5HAQ A;  2FFF B;  2J3T D;  2D01 A;  3PBR A;  4RA7 A;  2Y2O A;  1L0G A;  4OLG A;  2HGV A;  3BLS A;  3L7H A;  1Y28 A;  5HAI A;  2VGK A;  3WS4 A;  4BJP A;  5F69 A;  3FWL A;  2B95 A;  4K08 A;  3OPL A;  4E3I A;  4BBV A;  5DF8 A;  3T1X A;  3VE3 A;  1YPR A;  3M2J A;  4Q0J A;  1ZHH B;  3UB7 A;  5HPI A;  4Y13 A;  5A93 A;  4S2M A;  1KDW A;  2ZC4 B;  4HJ3 A;  4EU0 A;  3K3D A;  3GSG A;  5TGF A;  1BLC A;  2H0T A;  4GNU A;  3UDF A;  4XUZ A;  3O5Y A;  4DE0 A;  5F68 A;  5AVF A;  3BY8 A;  2OOL A;  1S67 L;  3SW1 A;  3U4L P;  1P0Z A;  4P6Z S;  3RTY A;  2O9A A;  2JBF A;  5GHX A;  2XF3 A;  2RCX A;  5DFY A;  4H6J A;  1MWR A;  1KGG A;  4X25 A;  1DP6 A;  5DVA A;  3EEH A;  1BLH A;  1F98 A;  3G34 A;  4NK3 A;  2R78 A;  4GW9 A;  3WS5 A;  3O3V A;  5IS1 A;  3OPH A;  3LR0 A;  4NXF A;  4X56 A;  1M40 A;  1N9L A;  5DTT A;  5EOE A;  5HPF A;  1CEG A;  3PAG A;  4IUH A;  3BFC A;  5EM0 A;  3QHY A;  4MBK A;  3U2A A;  1MBL A;  3TW8 A;  1LSW A;  2V1B A;  2W3E A;  2KLI A;  1SDE A;  4N92 A;  2P08 A;  5TBM B;  4XT2 B;  4DXB A;  3LID A;  1PFL A;  2LB5 A;  3HCY A;  2VKS A;  5AQB A;  1JWZ A;  1K25 A;  4HEF A;  4OKP A;  1LL8 A;  3VV4 A;  1HTZ A;  3ZFZ A;  3E98 A;  4YNR A;  4Y15 A;  1W63 M;  4CLC C;  1OTE A;  3OCL A;  2YKF A;  3OZH A;  4HJ6 A;  1W7F A;  2ZQD A;  3E4Q A;  3JVV A;  1CK3 A;  4KZ7 A;  2W3D A;  1UWN X;  3PHY A;  1XXM A;  2JE5 A;  1H8Z A;  2W1R A;  2OV5 A;  3CUE C;  4I39 A;  1G5U A;  3UME A;  4DDY A;  2PU2 A;  2J80 A;  1DRM A;  3QP8 A;  4I3A A;  4S2I A;  5IT5 A;  4HES A;  3MXR A;  2J3W A;  4LGW A;  3GEC A;  1Y4O A;  1K54 C;  4JBF A;  2M7U A;  5GLB A;  2EX8 A;  5EFW A;  2J8Y A;  4NEE D;  4ARZ B;  2O0Y A;  1XFN A;  3T4Q A;  2EFX A;  1ZG4 A;  2HP6 A;  4PM8 A;  3VSK A;  4D60 A;  2BAS A;  4DJ3 A;  1H8M A;  1T1C A;  5EVL A;  4WUJ A;  5E2G A;  1XJ6 A;  4UEY A;  3N6I A;  1U60 A;  2Z6D A;  2GX5 A;  4GS9 B;  2WK0 A;  1K4E A;  1F2K A;  3HL9 A;  4NET A;  2IA2 A;  1HVB A;  5E43 A;  3W4O A;  2HDQ A;  2JC7 A;  3DWZ A;  3MR0 A;  4LV3 A;  4ESP A;  3HLB A;  1NRF A;  4CLC E;  3BFF A;  3NY4 A;  4LFU A;  3VSL A;  5HDC A;  3T12 B;  3C5A A;  5FDS A;  2JKR I;  4B93 A;  2HDR A;  3HLD A;  5DF7 A;  5L07 A;  3BFG A;  1IEM A;  5F6A A;  3H7W B;  4CLC B;  4PHT A;  5FAT A;  2Y2Q A;  1IYS A;  5TJJ A;  4U0X A;  3W4Q A;  5AJG A;  3F1P B;  4GDN A;  2AVX A;  2VZW A;  4KQO A;  2WGV A;  3T1S A;  5J7E A;  5I5L A;  1JWV A;  3CPT A;  3ZDJ A;  1WYC A;  4JKT A;  4ETZ A;  2OSU A;  4U3T A;  2PR5 A;  3T4J A;  1K56 D;  4LV1 A;  4MLL A;  3GMW A;  4MNR A;  1E3U A;  1PNE A;  2OLU A;  3BJN A;  3ZG5 A;  1FR1 A;  4HIA A;  3MF0 A;  1ES5 A;  2KX6 A;  5E2H A;  1MKI A;  4ZAM A;  5HL1 A;  4E6W A;  5AQ9 A;  3MZD A;  2Y55 A;  4HP4 A;  4O0P A;  1UGU A;  4MBH A;  5DKL A;  4GLQ A;  3NUL A;  4Q0I A;  2DRW A;  1KVL A;  2WAD A;  1YLY A;  5CXW A;  4OP8 A;  4FOF A;  4EEU A;  3IXG A;  4X68 A;  4ZJ2 A;  5G4Z A;  5CHM A;  4JXG A;  3I7J A;  1TF1 A;  3ZG9 B;  4DF6 A;  2PAV P;  3NDG A;  5DKK A;  3BEC A;  4MCW A;  1IYQ A;  3PXP A;  2PHY A;  2ZC3 B;  3FPW A;  3CIT A;  1JWP A;  4MN7 A;  2O9B A;  2XR0 A;  1EW0 A;  2PR6 A;  4EBL A;  5K5B A;  2M1C A;  1K57 C;  3QP6 A;  1YLT A;  1I2W A;  2X02 A;  3PAE A;  4KQR A;  3H82 B;  1MWS A;  1I2S A;  4O8G A;  1OME A;  2V2F F;  4GD6 A;  1MPL A;  5HL6 A;  3PBQ A;  1LLB A;  3EWK A;  4LV2 A;  2B5R A;  3JVU A;  1HD8 A;  1L0D A;  3ZG8 B;  2XK1 A;  4HOI A;  4D2O A;  3HUN A;  4JF6 A;  3UE1 A;  1K54 A;  1YLW A;  3TRC A;  4ZJ3 A;  4MMN A;  4PKY G;  3F1N A;  1MKM A;  3CHW P;  4MN6 A;  4S2N A;  3DTI A;  3C7V A;  4GOG A;  4F3L B;  4G3V A;  1KE0 A;  4JGQ A;  4II7 A;  1YLZ A;  3LY4 A;  2W0N A;  4M4X A;  2W3H A;  2HP5 A;  4EW7 A;  1T18 A;  3HBR A;  2FFY A;  3ZGA B;  3W2Z A;  4L9G A; 
#chains in the Genus database with same CATH homology
 4NXE A;  2HJ9 C;  4ARZ A;  2VX8 A;  4GHI A;  4GJ4 A;  4HP9 A;  4WL9 A;  2VGL S;  3IBR A;  1UWP X;  1NRJ A;  3CLO A;  3MXQ A;  1TS6 A;  2OWH A;  4IJG A;  2K2N A;  1S66 L;  2QWS A;  3FPV A;  2D02 A;  2YKH A;  2J3T D;  2ZBB A;  4GS9 A;  2D01 A;  5HZH A;  3UB6 A;  3PBR A;  2Z6C A;  4WN5 A;  2HGV A;  4AFI A;  1Y28 A;  4BJP A;  1JNU A;  5F69 A;  4K08 A;  1YSQ A;  3ULF A;  4EES A;  3UB9 A;  2B18 A;  4BBV A;  3B33 A;  2EWV A;  2HV1 A;  2V0U A;  4LRZ E;  2L1M A;  3KYQ A;  5G4Y A;  5HD3 A;  1TD5 A;  4YWZ A;  3VE3 A;  1T1A A;  5CX7 A;  4Q0J A;  1ZHH B;  3UB7 A;  5HPI A;  1S1Z A;  1GSX A;  1YKD A;  5HSQ A;  1W63 Q;  3GDI A;  2EWW A;  1OTI A;  4HJ3 A;  4EU0 A;  3MFX A;  1BYW A;  3H7W A;  3PBT A;  2NUT C;  4CLC A;  4I38 A;  3H9W A;  2J3T C;  3K3D A;  2INW A;  4WEJ A;  2VV7 A;  4PKY A;  3RFB A;  3T50 A;  3O5Y A;  2XRN A;  5F68 A;  2JKR M;  2JKT M;  3HJI A;  4I3I A;  1GSV A;  5AVF A;  3BY8 A;  2OOL A;  3F1P A;  1LSV A;  3CUE A;  3A0S A;  1S67 L;  3SW1 A;  4HHD A;  1P0Z A;  4P6Z S;  1X0O A;  3RTY A;  4CQH A;  2O9A A;  2XSS A;  2K31 A;  2Y8H A;  4HNB A;  1T19 A;  3KSF A;  4JGP A;  5C5K A;  5KSH A;  1VB6 A;  1GSW A;  2G7U A;  4L9E A;  5DFY A;  1V9Y A;  4H6J A;  1P9R A;  2QJ5 A;  1STZ A;  1DP6 A;  3S7P A;  3EEH A;  4BWI A;  1F98 A;  2R78 A;  4GW9 A;  2WKP A;  5IS1 A;  2W3G A;  3LR0 A;  1S1Y A;  4NXF A;  2I9V A;  2ZOH A;  3BQ8 A;  3F1O A;  2L4R A;  3C30 A;  1N9L A;  5HPF A;  4EUV A;  1OJG A;  4IUH A;  3OC2 A;  2V9A A;  3U2A A;  4HI4 A;  4I5S A;  3TW8 A;  2PYP A;  3TJZ C;  1LSW A;  2V1B A;  3MQQ A;  2W1T A;  2W3E A;  2KLI A;  3KSH A;  3BY9 A;  2VV6 A;  4EXO A;  2XA7 M;  3VE4 A;  5DFX A;  2ZMF A;  2P08 A;  5TBM B;  2O9C A;  3UB8 A;  4L9F A;  4XT2 B;  3LID A;  3R7W A;  1G28 A;  3LFV A;  4R3A A;  2WKQ A;  5KIZ A;  2PT7 A;  2LB5 A;  3HCY A;  2VKS A;  3NOT C;  1T1B A;  2FZ0 A;  3E0Y A;  3VV4 A;  1LL8 A;  5HWT A;  2V1A A;  3C8C A;  3E98 A;  3PBS A;  2XA7 S;  4YNR A;  1W63 M;  1OTD A;  4CLC C;  2O99 A;  4R38 A;  1OTE A;  3OCL A;  2YKF A;  4IHQ A;  4LLO B;  4HJ6 A;  4WF0 A;  3FC7 A;  3E4Q A;  3JVV A;  5AVE A;  1P97 A;  2V0W A;  2W3D A;  1UWN X;  3PHY A;  2NUP C;  1OPX A;  3MQ0 A;  2W1R A;  3CUE C;  4I39 A;  4WLA A;  2PDR A;  2QYB A;  3UE6 A;  3F1N B;  3P7N A;  3ICY A;  1S4R A;  1IOU A;  3UME A;  3T4L A;  3KSI A;  4MN5 A;  3H82 A;  2A24 B;  1F5M A;  3MMH A;  3E4P A;  2J80 A;  4BMW A;  3S7O A;  1DRM A;  4O01 A;  2GJ3 A;  4I3A A;  5IT5 A;  3D3O A;  2J3W A;  3KSG A;  2A2L A;  1G6O A;  3GEC A;  4P6Z M;  4PAU A;  5IU1 A;  3A0V A;  3IS2 A;  1P9W A;  3LIB A;  1XJ3 A;  2M7U A;  4EQ1 A;  1D7E A;  5EFW A;  1ZTU A;  4NEE D;  4WEK A;  4ARZ B;  1NLY A;  4G3W A;  2O0Y A;  4GHI B;  4FSF A;  1XFN A;  3T4Q A;  2PYR A;  5DF9 A;  2QKP A;  4BBU A;  4EEP A;  3KO6 A;  4IUK A;  2BAS A;  4DJ3 A;  1H8M A;  1T1C A;  4F3L A;  2KDK A;  3BW6 A;  4WUJ A;  1XJ6 A;  4UEY A;  2Z6D A;  5DJU A;  3MQO A;  2GX5 A;  2PD7 A;  4GS9 B;  3S7Q A;  1KOU A;  3T4T A;  5HDS A;  4OOL A;  2IA2 A;  3KX0 X;  3CI6 A;  3B42 A;  5HWW A;  1TS0 A;  2LB9 A;  1OTB A;  4L0L A;  5MC7 A;  3MR0 A;  4EER A;  1IFQ A;  4NXB A;  4CLC E;  5HDC A;  3V67 A;  4I3J A;  3D72 A;  2JKR I;  4B93 A;  2JKT I;  4WEL A;  4CLC D;  5F6A A;  3H7W B;  4CLC B;  4NKP A;  3E4O A;  4ZRR A;  3T4O A;  3LI9 A;  3PBO A;  4PHT A;  4UQI S;  4DJ2 A;  5TJJ A;  3K2N A;  2H28 A;  2XRO A;  5AJG A;  3F1P B;  2HF6 A;  2VZW A;  2VV8 A;  4KQO A;  3PR6 A;  5J7E A;  1XJ4 A;  5I5L A;  4BBT A;  5F5Y A;  2VLG A;  3T4K A;  2K7S A;  3BQA A;  2OWJ A;  4ETX A;  4ETZ A;  2B02 A;  2PR5 A;  3T4J A;  4JGO A;  3NHQ A;  3IBJ A;  3NOP C;  3OOV A;  3OCN A;  5L8M A;  3LYX A;  4H6J B;  3BJN A;  1OTA A;  4Q0H A;  2DMW A;  1DP9 A;  3CWF A;  4KUO A;  5HD5 A;  2FH5 A;  5FL3 A;  4MDZ A;  4HIA A;  3MF0 A;  2OAP 1;  2KX6 A;  1OT6 A;  1XJ2 A;  3F1O B;  3LR5 A;  2GZA A;  3G6O A;  4LRY C;  4HP4 A;  3FG8 A;  2W27 A;  4O0P A;  3UMD A;  3ZYT A;  1UGU A;  2PD8 A;  3MJQ A;  4YOF A;  5DKL A;  4GLQ A;  4Y3I A;  1VHM A;  2MJ6 A;  3LIE A;  2W1T B;  3LUQ A;  4Q0I A;  3LR4 A;  2ZMV A;  1TS8 A;  5HWV A;  3NOU C;  3A0R A;  1S4S A;  2P7J A;  2P04 A;  3HJK A;  2ZOI A;  4FOF A;  4EEU A;  4Y2F A;  5DJT A;  4NXG A;  5G4Z A;  3EOI A;  1LT0 A;  2VEA A;  1WA9 A;  2CMN A;  3R7W B;  2KOI A;  1OJ5 A;  4B9O A;  1TF1 A;  4QPR A;  4R6L A;  2QHK A;  3UE3 A;  1ODV A;  3C2W A;  5DKK A;  1TS7 A;  4Y5F A;  4MCW A;  3PXP A;  2PHY A;  4ME4 A;  2JHE A;  3FPW A;  1MC0 A;  4KUK A;  3RH8 B;  3CIT A;  4OOM A;  4KQD A;  4MN7 A;  2O9B A;  5J4E A;  1EW0 A;  2PR6 A;  1N9O A;  4HQA A;  4DN0 A;  5K5B A;  3OLO A;  4LRX C;  3PBN A;  5TBM A;  4Z1W A;  3VOL A;  5A8B A;  2M1C A;  2VJW A;  4XT2 A;  3ZQ5 A;  1NWZ A;  3LR3 A;  2L0W A;  3NJA A;  3LI8 A;  1F9I A;  2OAQ 1;  3EEA A;  3H82 B;  4UQI M;  1DP8 A;  4O8G A;  2HJE A;  4HH3 A;  5HL6 A;  3PBQ A;  3EWK A;  3K3C A;  5HDD A;  1YSP A;  3CAX A;  3JVU A;  4HY8 A;  2M7V A;  2QJ7 A;  5LBR A;  4HOI A;  3IS2 B;  4R70 A;  2VA0 A;  3TE8 A;  2JN7 A;  2WKR A;  3C38 A;  1OT9 A;  4DMZ A;  1YAX A;  4LPZ A;  3LIA A;  4HJ4 A;  1MZU A;  3TRC A;  4E04 A;  4MMN A;  3S7N A;  4HH2 A;  4PKY G;  2Y79 A;  3KYZ A;  3F1N A;  4G3K A;  1MKM A;  4RQ9 A;  3P01 A;  3EGD C;  4MN6 A;  3R4K A;  3LIF A;  2EA9 A;  3LIC A;  4EET B;  2A24 A;  2W3F A;  3DBA A;  3T4S A;  2GNX A;  4F3L B;  4G3V A;  2VGL M;  3OBF A;  3B47 A;  1XFQ A;  1H3Q A;  4JGQ A;  4II7 A;  5J3W A;  4GCZ A;  1NLZ A;  1D06 A;  2W0N A;  4M4X A;  2W3H A;  4JGR A;  3EQU A;  1N9N A;  1T18 A;  1LSX A;  1V9Z A;  4EW7 A;  3PYP A;  3BWL A;  3EGX C;  3EQV A;  3W2Z A;  4L9G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...