3O87A

Crystal structure of ampc beta-lactamase in complex with a sulfonamide boronic acid inhibitor
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
358
structure length
351
Chain Sequence
APQQINDIVHRTITPLIEQQKIPGMAVAVIYQGKPYYFTWGYADIAKKQPVTQQTLFELGSVSKTFTGVLGGDAIARGEIKLSDPTTKYWPELTAKQWNGITLLHLATYTAGGLPLQVPDEVKSSSDLLRFYQNWQPAWAPGTQRLYANSSIGLFGALAVKPSGLSFEQAMQTRVFQPLKLNHTWINVPPAEEKNYAWGYREGKAVHVSPGALDAEAYGVKSTIEDMARWVQSNLKPLDINEKTLQQGIQLAQSRYWQTGDMYQGLGWEMLDWPVNPDSIIALAARPVKAITPPTPAVRASWVHKTGATGGFGSYVAFIPEKELGIVMLANKNYPNPARVDAAWQILNALQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Design, Synthesis, Crystal Structures, and Antimicrobial Activity of Sulfonamide Boronic Acids as beta-Lactamase Inhibitors
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
molecule keywords Beta-lactamase
total genus 116
structure length 351
sequence length 358
chains with identical sequence B
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2010-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00144 Beta-lactamase Beta-lactamase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 3o87A00
4GD8A 3E2LA 2XGNA 4KZ7A 3A3JA 3CG5A 2EX8A 4MBFA 2GDNA 4GOGA 2EX6A 1BT5A 3C7VA 5JYPA 2WZXA 5FQMA 3G35A 2CC1A 3ZG0A 2BG1A 4U0XA 5D3OA 3IWOA 4D2OA 3B3XA 4P6BA 2E8IA 3LCEA 4WBGA 4E3OA 1MWTA 3CJMA 4R3JA 4S2LA 1DJCA 2ZMAA 3N4IA 4LV3A 3S22A 1DJBA 2ZC5B 4ZBEA 4QD4A 4YFMA 5FA7A 3I7JA 1XA1A 4K91A 4WZ4A 4KZBA 4ZJ3A 1L0EA 1BUEA 1FR6A 3A3FA 3VFHA 4CPKA 2IWCA 1JVJA 4HBUA 3FZCA 4Y0TA 5A90A 5DVAA 3QHYA 2EX2A 2WAFA 3PBQA 1MWSA 2Y2NA 1NYYA 3ZCZA 3JYIA 3M6BA 4ZTKA 4BD0A 2Y2HA 3ZHHA 5FQIA 3NC8A 3M6HA 2HP5A 3VP4A 1IKIA 3GTCA 1EWZA 3G2YA 2OV5A 1Z6FA 2XH9A 1TDLA 1EI5A 3HLCA 1LL5A 3HLEA 5EVIC 4ZDXA 3IF6B 1LI9A 3ZVWA 3MXSA 2RL3A 3BLMA 1ES5A 4BENA 3BFEA 1WE4A 2JE5A 4K0XA 2PU4A 3UO9A 5FAOA 3VP0A 5AQBA 5KMWA 5GHYA 2Y2MA 1ZG6A 3N6IA 3AGEA 1W7FA 5EPHA 1YLYA 5CERA 3BECA 4P87A 1K25A 3SS3A 3NDEA 2Q9NA 4QJGA 4N1HA 1ZG4A 3SH8A 1K57A 3VP2A 1LL9A 1CEGA 3O88A 3MXRA 1PWDA 1YT4A 3RXXA 3BM6A 1K38A 1YLZA 4RVAA 1YM1A 5F1GA 1QMEA 5KSCA 1XGJA 3MZDA 5DTSA 3UNWA 1IYOA 1HTZA 3HUNA 1K57C 2Q9MA 1KGGA 3W4OA 5FASA 3N8SA 5CGSA 2WYXA 1CI9A 1NY0A 3HLWA 3P98A 4GDNA 4DF6A 4R4SA 4S2IA 3DW0A 3HL9A 4GDBA 4IBRA 2JBFA 3IT9A 4K0WA 1MXOA 1E3UA 4BJPA 4X53A 1FCMA 1IEMA 1K6RA 1SKFA 2HP9A 4JF4A 3BYDA 2R9XA 4L0LA 3Q81A 2H0TA 1K4FA 3QNBA 5GLCA 2V20A 3IXGA 5J8XA 1CEFA 2ZQCA 4N1XA 4OLGA 4X68A 4DDYA 3GVBA 5CXWA 1E25A 1Q2QA 4GB7A 4LCMA 1U60A 1W5DA 4JKTA 1MWRA 3WWXA 2Z2MB 2BLSA 3UPOA 4WEJA 4KG6A 3ZGAB 5A91A 4EV4A 5CEBA 3UY6A 5EE8A 5EECA 1ONGA 1H8ZA 2ZQ9A 4JPMA 4WMCA 4GD6A 4EUZA 2EFUA 5GLBA 5EVID 1K54A 1TVFA 4UAAA 1FQGA 4Z9QA 4OPZA 2XQZA 5KZHA 2VGKA 4OH0A 4OOMA 1K6SA 3MKFA 4IVKA 4Y0OA 5EVIA 5GL9A 4LV2A 1MKIA 1MWUA 2Y4AA 3G31A 5G18A 3A3IA 1I5QA 2WGWB 2HDUA 2Y2IA 1FCOA 4GN2A 5HARA 1BTLA 3SS5A 4X55A 3BFGA 5A93A 5EOOA 4KG2A 2H5SA 4UA6A 1GA9A 2J7VA 5GLDA 2IWDA 4IVIA 5EVIB 1KE3A 3V3SA 3W4QA 4OOYA 2EXAA 3BEBA 1O07A 3WS0A 4WEKA 3GRJA 3BFFA 4FD8A 3HLFA 1JWZA 2Y2PA 4X69A 3UDIA 1FCNA 1RGZA 3G4PA 1G6AA 3IF6A 1FSYA 1K56D 2Y2OA 3HBRA 3OCNA 1PZOA 1C3BA 4OQ0A 5DF7A 4ZAMA 1GA0A 1CI8A 4KZAA 4OPYA 3UN7A 4CJNA 1M40A 1BLCA 4RYEA 2V2FF 1PWCA 2XEPA 3MBZA 4PM8A 1XPBA 4OONA 4EBNA 2XD1A 2ZM0A 1NRFA 2ZC3B 1BLPA 3HLGA 5E43A 2C5WB 1PI4A 2XLNA 1BSGA 2DNSA 4BLMA 1N4OA 5GHZA 5EVLA 1KDWA 4UA7A 1KDSA 3DTMA 3VOZA 1HVBA 1RCJA 5FQQA 4EWFA 4JF6A 2WKHA 4Q8IA 1PYYA 2ZJ9A 5FQJA 2PBYA 4RX2A 4X56A 2ZLYA 3AGDA 4RA7A 4YINA 4NK3A 1YLTA 1PZPA 3G30A 5CTMA 1XGIA 3WS4A 2Y2JA 4JBFA 2WAEA 4JXGA 1IYSA 2WGWA 3BRMA 5HAQA 5CGXA 3IH8A 2HDSA 4KQRA 4MLLA 3UPPA 4PM5A 4XUZA 3CMZA 3LY4A 5DF8A 1BLSA 1FR1A 2HPBA 3PBTA 4WYYA 1DY6A 1K55A 4R1GA 4S2JA 4KZ9A 5CEDA 2DRWA 2X02A 2J9PA 1YLWA 2WGVA 2EFXA 2X71A 3CZDA 4OOLA 5TR7A 4PMAA 3FKWA 3IQAA 2RCXA 4BQMA 4GKUA 4WM9A 2HDQA 3MFDA 2WUQA 1ES4A 3P09A 4U3TA 1VM1A 4UHUA 4JXSA 4MBHA 1E3UD 2V1ZA 2XFSA 2Y59A 4RX3A 5KSHA 3ZG5A 2OLVA 4JF5A 4B4ZA 3IF5A 3O87A 4S2NA 1H8YA 4OQHA 2HP6A 4EQIA 3WS2A 4B88A 1KE4A 2ZC6B 2OSUA 4JLFA 2QZ6A 4ZJ1A 3RJUA 4DE1A 5E2FA 1RP5A 3VP3A 3ISGA 4N9KA 2ZQAA 5DTTA 2ZD8A 5DF9A 4LV1A 5DTKA 3OCLA 4KZ3A 1YQSA 1ERMA 5HAPA 4E3IA 3C4PA 3NBLA 4P0MA 2X01A 3HVFA 1OMEA 1KE0A 2XR0A 4S2KA 2ZQ7A 1KVMA 4UA9A 3PTEA 3FYZA 1JTGA 4E3LA 3OZHA 3HREA 3OPHA 2WKIA 5FATA 5FQ9A 4C6YA 1K4EA 5HAIA 3IWIA 3UDXA 2XF3A 1ESIA 2XK1A 3UPNA 2B5RA 3PBRA 4OLDA 1H5XA 4KQQA 5TFQA 1ESUA 5TGFA 5EOEA 1NZOA 4PM6A 3Q1FA 2EXBA 4DE0A 4OVDA 1LLBA 4U0TA 4OQGA 1GHMA 1JWPA 3QNCA 5CHUA 3SOIA 3IXHA 5FI6A 4LENA 3SH9A 2P9VA 5FQKA 4KZ5A 3A3DA 5FDHA 1TDGA 4DE2A 1I2WA 3OC2A 1K56A 3C5AA 3TG9A 1XA7A 5CGWA 3W4PA 3GQZA 1GHIA 1XKZA 3SH7A 5L2FA 1RGYA 1FSWA 3O3VA 3ZVTA 3ITAA 1BZAA 1JWVA 2OLUA 2Y2GA 3GMWA 4N9LA 1ZC2A 4IEDA 4KZ6A 4E6WA 3Q07A 1WYCA 3NY4A 3PBSA 3NDGA 1NXYA 2A49A 5GHXA 1FOFA 5BOHA 4OKPA 1HD8A 1N9BA 4X6TA 1ONHA 1KGEA 1IELA 1IKGA 3PBNA 4WELA 4DXCA 2H0YA 4FSFA 2P9VB 3GSGA 5CRFA 5E2HA 1ALQA 2Y91A 3N8LA 1KGFA 3ZG8B 5A92A 1LHYA 3O86A 1YLPA 4P85A 1K54C 4KENB 3FV7A 4QU3A 1G68A 1IYQA 1PI5A 4WZ5A 1W79A 3DWZA 3GV9A 3ZG9B 4S2NC 5CTNA 2WZZA 2R9WA 2ZC7A 3E2KA 3FWLA 3PAGA 3SS4A 4HESA 1TEMA 5FI7A 4DRTA 4HEFA 1GCEA 2Z2LB 1PIOA 3BFCA 1L0DA 3HUMA 2WKEA 4GNUA 4HBTA 2G2UA 4R0QA 1MY8A 1XXMA 1KVLA 4QY5A 4OQIA 1M6KA 2I72A 1BLHA 3G34A 3A3EA 4XUXA 2H10A 1HZOA 3M2KA 4QY6A 4FH4A 2Y2QA 4OPQA 5F83A 5M19A 3PAEA 1L0FA 4GZBA 1I2SA 4N92A 5AQ7A 4C75A 3FKVA 1SCWA 4LCLA 2FFFB 3ZDJA 3ZNYA 4JXWA 5HFOA 4DXBA 1L2SA 4PM7A 5U47A 3VOYA 4LV0A 4R23A 5CHJA 4JXVA 3G2ZA 2WK0A 3OPPA 3RXWA 2J8YA 1GHPA 3WS5A 4C3QA 3VMAA 5HX9A 4BD1A 3W8KA 4B4XA 4S2MA 5IHVA 3GR2A 3UE0A 1W8YA 1QMFA 1XP4A 5FI2A 5FSRA 1YMSA 3LO7A 4E3NA 3C4OA 4S2PA 3MZFA 3UE3A 3UDFA 1EROA 3G32A 3VFFA 4KZ8A 3NIAA 3V39A 5GLAA 3AGFA 1S6RA 2Y2KA 3IWQA 2ZM2A 4O7DA 3ITBA 4KG5A 3BLSA 4Y7PA 3VSLA 1JTDA 2PU2A 3HLDA 3C7UA 4ID4A 5HW3A 4NETA 3TOIA 1DJAA 3VP1A 3WRTA 3OPLA 5E2GA 5I94A 4QB8A 4F94A 1YMXA 1VQQA 3NCKA 5AQ9A 2FFYA 1Y54A 1SHVA 3DWKA 2XDMA 1CK3A 1K55C 3N7WA 1O7EA 3VSKA 1MPLA 4E6XA 1XX2A 2A3UA 4PM9A 4H8RA 2WADA 5E2EA 4E3JA 4BL3A 1PWGA 2HDRA 3LY3A 5EUAA 4DE3A 4WZ5C 1MBLA 3ZFZA 5AQAA 1LI0A 2XD5A 3UE1A 1E4DA 4DDSA 2P74A 1YLJA 4XXRA 3EQVA 4QHCA 2ZC4B 4BL2A 2EX9A 3ZG7B 3ZNTA 3HLBA 3MKEA 5F82A 2DCFA 1SDEA 2ZQDA 4M3KA 5CHMA 2IWBA 4KZ4A 2QPNA 3NI9A 1PW8A 3V3RA 4WMCD 1ES2A 3IHAA 2ZM8A 3TSGA 1ERQA 3Q7VA 3V5MA 1PW1A 1Q2PA 2QMIA 5HL1A 3WS1A 1S0WA 2Y55A 3IXBA 5FAPA 3Q7ZA 3WRZA 4IBXA 3HUOA 3V50A 1WYBA 4KQOA 4E3MA 2WGIA 4R3BA 1IYPA 3S1YA 3IF6C 3BFDA 3Q7VB 1L0GA 4EBLA 2G2WA 2Y2LA 1NJ4A 1J9MA 1AXBA 2XFTA 4Y0UA 4ZJ2A 4OP8A 2C6WB 2UWXA 2VGJA 4FH2A 4DKIA 4E3KA 3IXDA 1NZUA 4MEZA 3IH9A 4A5RA 3EQUA 1SDNA 4S2OA 5M18A 5M1AA 3PBOA 5F1FA 2JCHA 4MNRA 4OP5A 4MBKA 5JYOA 2JC7A 1BULA 3N8RA 4R4RA 1NYMA 1ES3A 3OPRA 4PPRA 3S4XA 3IHBA 3LEZA 1W8QA 5FAQA 5CECA 3D4FA 2J9OA 1ZKJA 3Q82A 3M2JA 4OPRA 3MZEA 4FCFA 4EBPA 2ZQ8A
chains in the Genus database with same CATH superfamily
4GD8A 4P6ZM 2XGNA 2Z6CA 2W3HA 3A3JA 2EX8A 2GDNA 2EX6A 1BT5A 4U0XA 3B3XA 2E8IA 2ZOHA 3JVVA 4E3OA 4R3JA 1DJCA 3T4LA 4LV3A 1YSPA 4H6JB 4ZBEA 1OJ5A 2VGLS 5HDDA 4WZ4A 4NXEA 1Y4OA 4KZBA 4ZJ3A 3VFHA 4CPKA 2IWCA 3FZCA 2EX2A 4ZTKA 3T1RA 4BBUA 3NC8A 2HP5A 3KYQA 3VP4A 3T1SA 3GTCA 1N9OA 4XT2A 3RFBA 1PRQA 1DP9A 3BLMA 4K0XA 3NOTC 3MR0A 3UO9A 5FAOA 3VP0A 5AQBA 5A8BA 4WN5A 2Y2MA 1FILA 1W7FA 1LSXA 5DJUA 5CERA 3SS3A 2W1RA 3SH8A 1LL8A 2PR5A 2B02A 1TS0A 1YM1A 3F1PA 3HUNA 2DMWA 2Q9MA 3W4OA 5IT5A 5FASA 3IX4A 1CI9A 1NY0A 2VZWA 3P98A 4DF6A 5K5BA 1IFQA 1XJ6A 2PYPA 1FCMA 2HP9A 1D7EA 3BYDA 4L0LA 2KLIA 3Q81A 3QNBA 5GLCA 1CEFA 3CLOA 4X68A 4DDYA 5CXWA 5DKLA 4GB7A 4L9FA 1MWRA 3T4KA 3FPVA 4WEJA 5A91A 5CEBA 3UY6A 3MMHA 1ONGA 1XJ4A 4WMCA 3NULA 5HWVA 4EUZA 2EFUA 2GX5A 5EVID 2XQZA 5EM1A 3UB8A 1VB6A 4OOMA 1MWUA 2Y4AA 5G18A 3A3IA 2HDUA 1FCOA 5HARA 4X55A 3BFGA 5EOOA 5GLDA 4OOYA 1TS7A 3MXQA 3HLFA 2Y2PA 5J7EA 4X69A 1RGZA 3G4PA 3ICYA 3OCNA 1PZOA 1C3BA 4OQ0A 5EVEA 1M40A 3DTKA 3MBZA 2ZMVA 1NRFA 4ZRRA 1S4SA 2W3EA 3T4OA 1BSGA 2H28A 1KDSA 3DTMA 1HVBA 4BBTA 1KOUA 2WKHA 3FC7A 5FQJA 4RA7A 1NRJA 4NK3A 1PZPA 1XGIA 4JXGA 1IYSA 3CUEC 3LIDA 5TBMB 2QYBA 3LY4A 1DY6A 1OTIA 4Y17A 2MJ6A 2J9PA 2X71A 4FOFA 3IQAA 4WM9A 2WUQA 5G4YA 4U3TA 4MBHA 1ACFA 2V9AA 2XFSA 3ZG5A 3O87A 3KX0X 3S7QA 4ESPA 1KE4A 3E4OA 2ZC6B 4ZJ1A 3RJUA 4DE1A 1CJFA 2ZQAA 5F69A 4WLAA 5DTKA 4E3IA 2X01A 1OTEA 4S2KA 2ZQ7A 3KSGA 5DKKA 2VJWA 4O01A 2VA0A 1JTGA 5HDCA 3F1PB 3HREA 3OPHA 5FQ9A 4BMWA 1GSVA 1K4EA 3GDIA 3B42A 3UPNA 2B5RA 1H5XA 4II7A 4QPRA 1MKMA 4DE0A 4PKYG 1GHMA 5FDHA 3VE3A 3OC2A 1K56A 3W4PA 3BJNA 1XKZA 1RGYA 3O3VA 5HWWA 3K2NA 2OLUA 4EXOA 2Y2GA 3GMWA 1ZC2A 4NXGA 4E6WA 3Q07A 4WL9A 1F98A 1NXYA 2A49A 3LIFA 1SZVA 3D3OA 1ONHA 4DXCA 1XFQA 5CRFA 2Y91A 3ZG8B 5A92A 1LHYA 3O86A 4P85A 4KENB 3DWZA 2L0WA 2WZZA 2ZC7A 3E2KA 3PAGA 4HESA 1IOUA 1TEMA 2D01A 1PIOA 3HUMA 3E0YA 1MY8A 2P04A 4M4XA 1BLHA 2H10A 1TS6A 3M2KA 1L0FA 5HL6A 1I2SA 4N92A 5AQ7A 3ZNYA 4RQ9A 4PM7A 5U47A 4R23A 3RH8B 3FG8A 5G4ZA 3KYEA 2I9VA 5IHVA 1YMSA 3UE3A 3VFFA 1J3WA 2K31A 2ZM2A 4Y7PA 4ID4A 5HW3A 4NETA 3TOIA 3OPLA 1DP8A 4CLCA 1Y54A 3H7WA 3N7WA 3KSFA 2V0WA 2HDRA 3LY3A 1MBLA 3A0RA 1LI0A 3DAVA 2ZC4B 2EX9A 3CWFA 5F82A 3R4KA 1V9YA 3TJZC 3V5MA 3ULFA 3EEAA 3WS1A 1S0WA 5FAPA 4IBXA 5KIZA 3NJAA 2G2WA 1NJ4A 3B33A 1MZUA 4ME4A 4OP8A 2C6WB 2UWXA 4UQIM 4MEZA 3IH9A 4S2OA 2VK3A 5HPIA 3PBOA 4MNRA 5JYOA 3N8RA 4HNBA 1ES3A 3OPRA 3S4XA 3U4LP 3LEZA 2ZMFA 5CECA 2J9OA 5AJGA 3MZEA 3W2ZA 5J4EA 3E2LA 4KZ7A 4Y2FA 4MBFA 4GOGA 4YNRA 3JVUA 5JYPA 3C7VA 2BG1A 3IWOA 3LCEA 5AVFA 4WBGA 5HZHA 3U2AA 4HI4A 2ZMAA 3N4IA 2ZC5B 1H3QA 3T4QA 2NUPC 2LB5A 2M1CA 3QP4A 3V67A 2B18A 2FH5A 3C8CA 4HJ6A 1JVJA 4Y0TA 3OLOA 3QHYA 1NYYA 3JYIA 3M6BA 3CUEA 4ETXA 1AWIA 2VV6A 3G2YA 1TDLA 1EI5A 3HLEA 4ZDXA 3IF6B 1PNEA 4MN6A 3LUQA 4BENA 3BFEA 1WE4A 2XA7M 2PU4A 2KDKA 4BWIA 5EM0A 3BECA 4P87A 1K25A 2Q9NA 1NLYA 3VP2A 1LL9A 2PHYA 1YT4A 1YLZA 1GSWA 2KX6A 5F1GA 1QMEA 5KSCA 1XGJA 3UNWA 1IYOA 3LIBA 3IBRA 1K57C 2CMNA 3LR0A 3LI9A 3P01A 3HLWA 4R4SA 4S2IA 2WKPA 4BJPA 1E3UA 1K6RA 3CITA 1K0KA 2R9XA 1V9ZA 3IXGA 1F2KA 5J8XA 2A24B 3GVBA 1E25A 3DTIA 1Q2QA 4E04A 4JKTA 3WWXA 3QP8A 4KG6A 3T4TA 1P9RA 2D02A 1H8ZA 1W63Q 4JPMA 4GD6A 1VHMA 5GLBA 1K54A 1TVFA 1K6SA 3MKFA 4IVKA 4Y0OA 1VETB 1T1BA 1I5QA 5DFYA 2WGWB 2Y2IA 4GN2A 2A24A 4KG2A 5HD3A 2H5SA 2O9CA 1GA9A 2IWDA 3V3SA 3SW1A 4HOIA 4WEKA 3BFFA 2PD7A 1JWZA 1FCNA 3IF6A 4KZAA 1CI8A 4RYEA 2V2FF 2XEPA 4PM8A 1XPBA 4YOFA 2XD1A 2ZM0A 2ZC3B 5E43A 3LIAA 4I5SA 5C5KA 4CLCB 2XLNA 1N4OA 5GHZA 4UA7A 3VOZA 1RCJA 4FUWA 2W27A 4JF6A 4LRYC 4Q8IA 2ZJ9A 2PBYA 1N9NA 3AGDA 2OWJA 1YLTA 3G30A 3LR5A 2Y2JA 4JBFA 2WAEA 5L09A 2IA2A 4NXFA 1BLSA 1FR1A 3PBTA 5AVEA 2NUTC 4KZ9A 1YLWA 4HH2A 2RCXA 4BQMA 2EWVA 3C38A 1ES4A 3P09A 4UHUA 2QHKA 2V1ZA 2Y59A 4RX3A 4DJ2A 3LR4A 3IF5A 4S2NA 3PHYA 2VLGA 4EQIA 2K7SA 1LSVA 3P7NA 2LB9A 4N9KA 2OAQ1 5DF9A 2ZL1B 1S4RA 3O5YA 3F1NB 4KZ3A 5HDSA 4P0MA 1KE0A 3HJKA 4E3LA 3OZHA 4GW9A 3T1XA 4C6YA 3UDXA 2Q0OA 1ESIA 2XK1A 1H0MA 3PBRA 4KQQA 4PM6A 2EXBA 1LLBA 1XJ2A 5CHUA 3QNCA 3SH9A 2P9VA 5FQKA 4P6ZS 1TDGA 1I2WA 3TG9A 3GQZA 4GLQA 2E8JA 5L2FA 1FSWA 3EGDC 3ZVTA 4HJ3A 4N9LA 1D1JA 1NLZA 4IEDA 4KZ6A 3NY4A 3NDGA 5BOHA 1HD8A 1N9BA 4MCWA 1KGEA 1IKGA 4FSFA 3ZYTA 5E2HA 1ALQA 5FL3A 3N8LA 1KGFA 2Z6DA 4F3LA 4EETB 4WZ5A 4HP4A 5CTNA 3LFVA 2R9WA 3SS4A 4GHIA 4HEFA 1L0DA 2HV1A 2WKEA 4LFUA 1KVLA 1DP6A 1M6KA 3G34A 3A3EA 4XUXA 4FTXA 4QY6A 4OPQA 3PAEA 1OPXA 4C75A 4UEYA 3ZDJA 2FFFB 5HFOA 1L2SA 4Q0IA 1GSXA 1Y28A 4PKYA 3OPPA 3WS5A 2J8YA 4G3KA 4C3QA 4R6LA 3VMAA 4BD1A 3W8KA 4S2MA 1F9IA 3GR2A 4EEPA 1W8YA 1XP4A 3CAXA 5FSRA 2PBDP 3A0VA 5DFXA 3G32A 1EW0A 4KZ8A 3NIAA 2W3GA 2W1TA 4KG5A 3C7UA 3MQQA 5I94A 4F94A 1S67L 4Y13A 2V1AA 3DWKA 3UB6A 1K55C 2HZ5A 1O7EA 4E6XA 5E2EA 4R3AA 4DE3A 3BY8A 1G6OA 3PXPA 3ZFZA 3MSHA 3K3DA 4DDSA 4XXRA 3ZG7B 3ZNTA 3IS2A 1OTAA 2KOIA 2V8FA 2QJ5A 4KZ4A 2QPNA 1PW8A 3V3RA 2ZM8A 3TSGA 1ERQA 2QMIA 3IXBA 4E3MA 1IYPA 3BFDA 4LRXC 2VGJA 4FH2A 4EESA 2O9BA 1ZTUA 1SDNA 3H82A 4NXBA 5F1FA 4OP5A 2JC7A 1BULA 2JKTI 1NYMA 3L9KA 4HY8A 3IHBA 3D4FA 4OPRA 4FCFA 2ZQ8A 1MC0A 1WA9A 3CG5A 2WZXA 5FQMA 2CC1A 3ZG0A 4CQHA 4D2OA 4IJGA 5HSQA 4I38A 3S22A 1DJBA 4YFMA 2JKFA 4K91A 1L0EA 3A3FA 3S7NA 5L07A 4ETZA 1PFLA 2QJ7A 3S7PA 2WAFA 2Y2NA 4BD0A 2Y2HA 2OV5A 1Z6FA 2XH9A 5EVIC 4O0PA 1ES5A 2JE5A 3HJIA 1H8MA 3N6IA 3NDEA 1YKDA 4N1HA 4GJ4A 3MXRA 3R7WB 1K38A 3T12B 3MZDA 5DTSA 1HTZA 1T18A 4GDNA 3DW0A 3HL9A 3MJQA 4GDBA 4IBRA 3IT9A 1MXOA 5J3WA 1IEMA 1SKFA 5DJTA 4JF4A 1K4FA 2V20A 4I3AA 2ZQCA 4N1XA 2FZ0A 2JKRI 3NHQA 2GJ3A 2PYRA 4JGPA 1CF0A 4LCMA 5MC7A 2BLSA 3ZGAB 1FIKA 1A0KA 4EV4A 3LR3A 5EECA 1ODVA 4Z9QA 4UAAA 2V8CA 1LT0A 5GL9A 5CX7A 3A0SA 4B93A 2HJEA 3F1OA 1BTLA 2J7VA 4IVIA 5EVIB 3W4QA 2EXAA 3WS0A 2Y8HA 3GRJA 3UDIA 2P7JA 3G6OA 1FSYA 1K56D 5DF7A 1GA0A 4CJNA 2HGVA 1L3LA 1BLCA 4EBNA 1TF1A 1BLPA 2L4RA 2PT7A 1PI4A 2DNSA 4BLMA 3UB9A 2PRFA 5EVLA 5F68A 4DMZA 5FQQA 4EWFA 3LICA 3NOUC 1PYYA 2XA7S 4X56A 4NG2A 4YINA 5CTMA 3MF0A 2WGWA 5HAQA 5CGXA 2HDSA 4KQRA 4PM5A 3UPPA 3BQ8A 3CMZA 2ZOIA 5DF8A 4WYYA 2EWWA 4R1GA 2YKHA 4HJ4A 2DRWA 3CZDA 4OOLA 2EFXA 5TR7A 5F6AA 1VETA 2P08A 3TE8A 4GKUA 2HDQA 1F5MA 2VV7A 2BTFP 3OOVA 2OLVA 4JF5A 3BY9A 3IX8A 3WS2A 4B88A 2OSUA 4JLFA 4KUOA 2QZ6A 4CLCC 5E2FA 3ISGA 1XJ3A 1YQSA 1ERMA 2JN7A 3LGOA 1OMEA 4HH3A 4UA9A 3PTEA 1LSWA 5FATA 2XF3A 5TGFA 4OLDA 1ESUA 5EOEA 3Q1FA 4U0TA 3SOIA 3IXHA 4JGRA 4EEUA 2AVXA 4KZ5A 4DE2A 3C5AA 4K08A 1GHIA 2K2NA 4B9OA 1BZAA 3MS6A 1JWVA 3OBFA 4OKPA 4X6TA 2JKGA 1W63M 3PBNA 3TW8A 3T1QB 2ZBBA 4BBVA 2V1BA 5FEGA 1K54C 3FV7A 3ZG9B 1S66L 2O99A 3B47A 3LIEA 3VE4A 2JKTM 5FI7A 4HBTA 4I3IA 3BFCA 2OOLA 2G2UA 1BYWA 4XT2B 2XROA 4FH4A 5F83A 4CLCD 4CLCE 5M19A 1UGUA 1X0OA 1SCWA 3KSIA 1HLUP 4JXWA 3VOYA 1T1AA 5HPFA 5CHJA 3G2ZA 3FPWA 3E98A 4LPZA 5HX9A 4EQ1A 3RTYA 3UE0A 5FI2A 1CQAA 3PR6A 3V39A 1OT6A 4EW7A 5GLAA 3AGFA 3IWQA 2Y2KA 3ITBA 3VSLA 2PU2A 1DJAA 3WRTA 5LBRA 2J80A 4Y5FA 5L10A 1YMXA 3NCKA 4KUKA 5AQ9A 4DN0A 3QP2A 3MQ0A 1MPLA 2Y79A 4PM9A 2WADA 4BL3A 4Y15A 4WZ5C 2VEAA 3T4SA 3H9WA 1E4DA 1YLJA 2BASA 3EQVA 4QHCA 4LRZE 3MKEA 3C2WA 4M3KA 2ZQDA 2IWBA 2W1TB 3NI9A 4WMCD 3IHAA 3Q7VA 1Q2PA 2Y55A 2W0NA 1TS8A 2WGIA 3F1OB 4R3BA 5L8MA 3S1YA 3Q7VB 4EBLA 2Y2LA 3H7WB 1YSQA 1AXBA 4Y3IA 4UQIS 4DKIA 3IXDA 4EUVA 3GECA 5M1AA 2JCHA 3EWKA 1T1CA 4R4RA 4X25A 1W8QA 3K3CA 3Q82A 4IUHA 3M2JA 4EBPA 2HJ9C 4X1LA 5IU1A 3VV4A 3G35A 1D06A 5D3OA 2J3WA 4NKPA 2OWHA 4P6BA 3E4PA 3UB5P 3LEQA 2UV0E 1MWTA 3CJMA 4S2LA 3NECA 4R38A 3T4JA 4QD4A 3D9YA 5FA7A 4QWOA 2INWA 3I7JA 1XA1A 1BUEA 1FR6A 3IS2B 3IX3A 4HBUA 5A90A 5DVAA 3PBQA 4AFIA 1MWSA 5EV0A 4L9EA 3ZCZA 4D60A 3ZHHA 5FQIA 3M6HA 3IBJA 1IKIA 1EWZA 3MFXA 3HLCA 1LL5A 4ARZB 1LI9A 1YPRA 3ZVWA 3MXSA 2RL3A 4GS9B 2G7UA 5KMWA 1UWPX 5GHYA 1P9WA 1ZG6A 3AGEA 5EPHA 1YLYA 4HQAA 4G3WA 2YKFA 3BQAA 4QJGA 1ZG4A 2PDRA 5HWTA 1K57A 1CEGA 3O88A 1PWDA 3RXXA 3BM6A 4RVAA 3JPUA 4ARZA 1KGGA 3N8SA 5CGSA 2WYXA 2JBFA 4K0WA 2HF6A 3KYZA 4MN5A 4X53A 2PD8A 2H0TA 2ACGA 5HD5A 3EEHA 1VEUB 4OLGA 2L1MA 4EERA 1U60A 1W5DA 2Z2MB 3UPOA 4PAUA 2M7UA 4IHQA 5EE8A 1P0ZA 1S1ZA 2ZQ9A 1DRMA 2XSSA 4MMNA 1FQGA 4R70A 4OPZA 5KZHA 2VGKA 4OH0A 2W3FA 5EVIA 4LV2A 1MKIA 3G31A 3MQOA 4PHTA 3SS5A 3S7OA 5A93A 4UA6A 1KE3A 1XFNA 3BEBA 1O07A 4FD8A 3UMEA 3NOPC 1G6AA 2Y2OA 3HBRA 4ZAMA 3UN7A 4HIAA 1OTDA 4OPYA 1PWCA 3DBAA 4OONA 3HLGA 2C5WB 5IS1A 3CI6A 4LGWA 4Z1WA 1KDWA 1T19A 3ZQ5A 2XRNA 1NWZA 2OAP1 3CPTB 4GS9A 4RX2A 2ZLYA 4MDZA 3WS4A 2EA9A 3CPTA 3BRMA 5I5LA 3IH8A 4MLLA 3F1NA 5EFWA 4XUZA 2HPBA 1K55A 4S2JA 5CEDA 2R78A 2X02A 2WGVA 4PMAA 3FKWA 3MFDA 2VKSA 5F5YA 3SZTA 1VM1A 4JXSA 1E3UD 2VGLM 5KSHA 1N9LA 3KSHA 4B4ZA 3QP1A 1H8YA 4OQHA 2HP6A 3PYPA 3DTEA 1RP5A 3VP3A 3BW6A 1G28A 4L9GA 5DTTA 2ZD8A 4LV1A 2JKRM 2GZAA 3OCLA 5HAPA 3C4PA 3NBLA 3D72A 3HVFA 2JHEA 2XR0A 1KVMA 1SKOB 4HP9A 3FYZA 4YWZA 4F3LB 2WKIA 5HAIA 3IWIA 4Q0HA 5TFQA 1NZOA 3VOLA 4OVDA 4X1MA 4OQGA 4WUJA 1JWPA 5FI6A 4LENA 3A3DA 4HHDA 4LLOB 1ZHHB 2V0UA 1XA7A 4JGQA 1YAXA 5CGWA 1UWNX 3SH7A 2VV8A 2PAVP 3ITAA 5FDSA 2J3TD 2WKRA 1WYCA 1STZA 3PBSA 3KO6A 4EU0A 4IUKA 5GHXA 1FOFA 2O9AA 1IELA 4WELA 2H0YA 2P9VB 3GSGA 3QP5A 4O8GA 4NEED 1YLPA 1OT9A 4QU3A 1G68A 1IYQA 1PI5A 2W3DA 1W79A 3GV9A 3BWLA 4S2NC 3FWLA 4DRTA 1GCEA 2Z2LB 4R0QA 4GNUA 2QWSA 1XXMA 3HCYA 4QY5A 3CHWP 4OQIA 2I72A 1HZOA 2Y2QA 2WKQA 4GZBA 2ZL1A 3FKVA 4LCLA 4DXBA 3UB7A 1JNUA 4LV0A 3UE6A 4JXVA 1P97A 2WK0A 3RXWA 2O0YA 1GHPA 4DJ3A 1OJGA 1S1YA 3R7WA 4B4XA 4Q0JA 1QMFA 3LO7A 4E3NA 3C4OA 1OTBA 4S2PA 3MZFA 3UDFA 1EROA 4WF0A 1TD5A 1G5UA 4O7DA 1S6RA 5TJJA 3BLSA 1JTDA 3HLDA 3VP1A 5E2GA 4QB8A 1VQQA 1VEUA 2FFYA 1SHVA 3LI8A 2XDMA 1CK3A 3VSKA 1XX2A 2A3UA 4H8RA 4E3JA 2M7VA 2QKPA 1PWGA 5EUAA 5AQAA 2XD5A 3T50A 3UE1A 2P74A 5FEFA 2GNXA 4I3JA 3HLBA 2DCFA 1SDEA 5CHMA 3EOIA 2A2LA 1SKOA 1ES2A 5TBMA 4BL2A 1PW1A 2J3TC 5HL1A 3Q7ZA 3WRZA 2PR6A 1Z09A 3HUOA 3V50A 1WYBA 4KQOA 4G3VA 4GHIB 3IF6C 1L0GA 3E4QA 2B95A 4I39A 1J9MA 3UMDA 2XFTA 3H82B 4MN7A 4Y0UA 4ZJ2A 4E3KA 3C30A 4JGOA 3EGXC 1NZUA 3L7HA 4KQDA 4A5RA 3EQUA 5M18A 4GCZA 3LYXA 4MBKA 4H6JA 2VX8A 3TRCA 4PPRA 5FAQA 1ZKJA 3QP6A
chains in the Genus database with same CATH topology
4GD8A 3E2LA 2XGNA 4KZ7A 3A3JA 3CG5A 2EX8A 4MBFA 2GDNA 4GOGA 2EX6A 1BT5A 3C7VA 5JYPA 2WZXA 5FQMA 3G35A 2CC1A 3ZG0A 2BG1A 4U0XA 5D3OA 3IWOA 4D2OA 3B3XA 4P6BA 2E8IA 3LCEA 4WBGA 4E3OA 1MWTA 3CJMA 4R3JA 4S2LA 1DJCA 2ZMAA 3N4IA 4LV3A 3S22A 1DJBA 2ZC5B 4ZBEA 4QD4A 4YFMA 5FA7A 3I7JA 1XA1A 4K91A 4WZ4A 4KZBA 4ZJ3A 1L0EA 1BUEA 1FR6A 3A3FA 3VFHA 4CPKA 2IWCA 1JVJA 4HBUA 3FZCA 4Y0TA 5A90A 5DVAA 3QHYA 2EX2A 2WAFA 3PBQA 1MWSA 2Y2NA 1NYYA 3ZCZA 3JYIA 3M6BA 4ZTKA 4BD0A 2Y2HA 3ZHHA 5FQIA 3NC8A 3M6HA 2HP5A 3VP4A 1IKIA 3GTCA 1EWZA 3G2YA 2OV5A 1Z6FA 2XH9A 1TDLA 1EI5A 3HLCA 1LL5A 3HLEA 5EVIC 4ZDXA 3IF6B 1LI9A 3ZVWA 3MXSA 2RL3A 3BLMA 1ES5A 4BENA 3BFEA 1WE4A 2JE5A 4K0XA 2PU4A 3UO9A 5FAOA 3VP0A 5AQBA 5KMWA 5GHYA 2Y2MA 1ZG6A 3N6IA 3AGEA 1W7FA 5EPHA 1YLYA 5CERA 3BECA 4P87A 1K25A 3SS3A 3NDEA 2Q9NA 4QJGA 4N1HA 1ZG4A 3SH8A 1K57A 3VP2A 1LL9A 1CEGA 3O88A 3MXRA 1PWDA 1YT4A 3RXXA 3BM6A 1K38A 1YLZA 4RVAA 1YM1A 5F1GA 1QMEA 5KSCA 1XGJA 3MZDA 5DTSA 3UNWA 1IYOA 1HTZA 3HUNA 1K57C 2Q9MA 1KGGA 3W4OA 5FASA 3N8SA 5CGSA 2WYXA 1CI9A 1NY0A 3HLWA 3P98A 4GDNA 4DF6A 4R4SA 4S2IA 3DW0A 3HL9A 4GDBA 4IBRA 2JBFA 3IT9A 4K0WA 1MXOA 1E3UA 4BJPA 4X53A 1FCMA 1IEMA 1K6RA 1SKFA 2HP9A 4JF4A 3BYDA 2R9XA 4L0LA 3Q81A 2H0TA 1K4FA 3QNBA 5GLCA 2V20A 3IXGA 5J8XA 1CEFA 2ZQCA 4N1XA 4OLGA 4X68A 4DDYA 3GVBA 5CXWA 1E25A 1Q2QA 4GB7A 4LCMA 1U60A 1W5DA 4JKTA 1MWRA 3WWXA 2Z2MB 2BLSA 3UPOA 4WEJA 4KG6A 3ZGAB 5A91A 4EV4A 5CEBA 3UY6A 5EE8A 5EECA 1ONGA 1H8ZA 2ZQ9A 4JPMA 4WMCA 4GD6A 4EUZA 2EFUA 5GLBA 5EVID 1K54A 1TVFA 4UAAA 1FQGA 4Z9QA 4OPZA 2XQZA 5KZHA 2VGKA 4OH0A 4OOMA 1K6SA 3MKFA 4IVKA 4Y0OA 5EVIA 5GL9A 4LV2A 1MKIA 1MWUA 2Y4AA 3G31A 5G18A 3A3IA 1I5QA 2WGWB 2HDUA 2Y2IA 1FCOA 4GN2A 5HARA 1BTLA 3SS5A 4X55A 3BFGA 5A93A 5EOOA 4KG2A 2H5SA 4UA6A 1GA9A 2J7VA 5GLDA 2IWDA 4IVIA 5EVIB 1KE3A 3V3SA 3W4QA 4OOYA 2EXAA 3BEBA 1O07A 3WS0A 4WEKA 3GRJA 3BFFA 4FD8A 3HLFA 1JWZA 2Y2PA 4X69A 3UDIA 1FCNA 1RGZA 3G4PA 1G6AA 3IF6A 1FSYA 1K56D 2Y2OA 3HBRA 3OCNA 1PZOA 1C3BA 4OQ0A 5DF7A 4ZAMA 1GA0A 1CI8A 4KZAA 4OPYA 3UN7A 4CJNA 1M40A 1BLCA 4RYEA 2V2FF 1PWCA 2XEPA 3MBZA 4PM8A 1XPBA 4OONA 4EBNA 2XD1A 2ZM0A 1NRFA 2ZC3B 1BLPA 3HLGA 5E43A 2C5WB 1PI4A 2XLNA 1BSGA 2DNSA 4BLMA 1N4OA 5GHZA 5EVLA 1KDWA 4UA7A 1KDSA 3DTMA 3VOZA 1HVBA 1RCJA 5FQQA 4EWFA 4JF6A 2WKHA 4Q8IA 1PYYA 2ZJ9A 5FQJA 2PBYA 4RX2A 4X56A 2ZLYA 3AGDA 4RA7A 4YINA 4NK3A 1YLTA 1PZPA 3G30A 5CTMA 1XGIA 3WS4A 2Y2JA 4JBFA 2WAEA 4JXGA 1IYSA 2WGWA 3BRMA 5HAQA 5CGXA 3IH8A 2HDSA 4KQRA 4MLLA 3UPPA 4PM5A 4XUZA 3CMZA 3LY4A 5DF8A 1BLSA 1FR1A 2HPBA 3PBTA 4WYYA 1DY6A 1K55A 4R1GA 4S2JA 4KZ9A 5CEDA 2DRWA 2X02A 2J9PA 1YLWA 2WGVA 2EFXA 2X71A 3CZDA 4OOLA 5TR7A 4PMAA 3FKWA 3IQAA 2RCXA 4BQMA 4GKUA 4WM9A 2HDQA 3MFDA 2WUQA 1ES4A 3P09A 4U3TA 1VM1A 4UHUA 4JXSA 4MBHA 1E3UD 2V1ZA 2XFSA 2Y59A 4RX3A 5KSHA 3ZG5A 2OLVA 4JF5A 4B4ZA 3IF5A 3O87A 4S2NA 1H8YA 4OQHA 2HP6A 4EQIA 3WS2A 4B88A 1KE4A 2ZC6B 2OSUA 4JLFA 2QZ6A 4ZJ1A 3RJUA 4DE1A 5E2FA 1RP5A 3VP3A 3ISGA 4N9KA 2ZQAA 5DTTA 2ZD8A 5DF9A 4LV1A 5DTKA 3OCLA 4KZ3A 1YQSA 1ERMA 5HAPA 4E3IA 3C4PA 3NBLA 4P0MA 2X01A 3HVFA 1OMEA 1KE0A 2XR0A 4S2KA 2ZQ7A 1KVMA 4UA9A 3PTEA 3FYZA 1JTGA 4E3LA 3OZHA 3HREA 3OPHA 2WKIA 5FATA 5FQ9A 4C6YA 1K4EA 5HAIA 3IWIA 3UDXA 2XF3A 1ESIA 2XK1A 3UPNA 2B5RA 3PBRA 4OLDA 1H5XA 4KQQA 5TFQA 1ESUA 5TGFA 5EOEA 1NZOA 4PM6A 3Q1FA 2EXBA 4DE0A 4OVDA 1LLBA 4U0TA 4OQGA 1GHMA 1JWPA 3QNCA 5CHUA 3SOIA 3IXHA 5FI6A 4LENA 3SH9A 2P9VA 5FQKA 4KZ5A 3A3DA 5FDHA 1TDGA 4DE2A 1I2WA 3OC2A 1K56A 3C5AA 3TG9A 1XA7A 5CGWA 3W4PA 3GQZA 1GHIA 1XKZA 3SH7A 5L2FA 1RGYA 1FSWA 3O3VA 3ZVTA 3ITAA 1BZAA 1JWVA 2OLUA 2Y2GA 3GMWA 4N9LA 1ZC2A 4IEDA 4KZ6A 4E6WA 3Q07A 1WYCA 3NY4A 3PBSA 3NDGA 1NXYA 2A49A 5GHXA 1FOFA 5BOHA 4OKPA 1HD8A 1N9BA 4X6TA 1ONHA 1KGEA 1IELA 1IKGA 3PBNA 4WELA 4DXCA 2H0YA 4FSFA 2P9VB 3GSGA 5CRFA 5E2HA 1ALQA 2Y91A 3N8LA 1KGFA 3ZG8B 5A92A 1LHYA 3O86A 1YLPA 4P85A 1K54C 4KENB 3FV7A 4QU3A 1G68A 1IYQA 1PI5A 4WZ5A 1W79A 3DWZA 3GV9A 3ZG9B 4S2NC 5CTNA 2WZZA 2R9WA 2ZC7A 3E2KA 3FWLA 3PAGA 3SS4A 4HESA 1TEMA 5FI7A 4DRTA 4HEFA 1GCEA 2Z2LB 1PIOA 3BFCA 1L0DA 3HUMA 2WKEA 4GNUA 4HBTA 2G2UA 4R0QA 1MY8A 1XXMA 1KVLA 4QY5A 4OQIA 1M6KA 2I72A 1BLHA 3G34A 3A3EA 4XUXA 2H10A 1HZOA 3M2KA 4QY6A 4FH4A 2Y2QA 4OPQA 5F83A 5M19A 3PAEA 1L0FA 4GZBA 1I2SA 4N92A 5AQ7A 4C75A 3FKVA 1SCWA 4LCLA 2FFFB 3ZDJA 3ZNYA 4JXWA 5HFOA 4DXBA 1L2SA 4PM7A 5U47A 3VOYA 4LV0A 4R23A 5CHJA 4JXVA 3G2ZA 2WK0A 3OPPA 3RXWA 2J8YA 1GHPA 3WS5A 4C3QA 3VMAA 5HX9A 4BD1A 3W8KA 4B4XA 4S2MA 5IHVA 3GR2A 3UE0A 1W8YA 1QMFA 1XP4A 5FI2A 5FSRA 1YMSA 3LO7A 4E3NA 3C4OA 4S2PA 3MZFA 3UE3A 3UDFA 1EROA 3G32A 3VFFA 4KZ8A 3NIAA 3V39A 5GLAA 3AGFA 1S6RA 2Y2KA 3IWQA 2ZM2A 4O7DA 3ITBA 4KG5A 3BLSA 4Y7PA 3VSLA 1JTDA 2PU2A 3HLDA 3C7UA 4ID4A 5HW3A 4NETA 3TOIA 1DJAA 3VP1A 3WRTA 3OPLA 5E2GA 5I94A 4QB8A 4F94A 1YMXA 1VQQA 3NCKA 5AQ9A 2FFYA 1Y54A 1SHVA 3DWKA 2XDMA 1CK3A 1K55C 3N7WA 1O7EA 3VSKA 1MPLA 4E6XA 1XX2A 2A3UA 4PM9A 4H8RA 2WADA 5E2EA 4E3JA 4BL3A 1PWGA 2HDRA 3LY3A 5EUAA 4DE3A 4WZ5C 1MBLA 3ZFZA 5AQAA 1LI0A 2XD5A 3UE1A 1E4DA 4DDSA 2P74A 1YLJA 4XXRA 3EQVA 4QHCA 2ZC4B 4BL2A 2EX9A 3ZG7B 3ZNTA 3HLBA 3MKEA 5F82A 2DCFA 1SDEA 2ZQDA 4M3KA 5CHMA 2IWBA 4KZ4A 2QPNA 3NI9A 1PW8A 3V3RA 4WMCD 1ES2A 3IHAA 2ZM8A 3TSGA 1ERQA 3Q7VA 3V5MA 1PW1A 1Q2PA 2QMIA 5HL1A 3WS1A 1S0WA 2Y55A 3IXBA 5FAPA 3Q7ZA 3WRZA 4IBXA 3HUOA 3V50A 1WYBA 4KQOA 4E3MA 2WGIA 4R3BA 1IYPA 3S1YA 3IF6C 3BFDA 3Q7VB 1L0GA 4EBLA 2G2WA 2Y2LA 1NJ4A 1J9MA 1AXBA 2XFTA 4Y0UA 4ZJ2A 4OP8A 2C6WB 2UWXA 2VGJA 4FH2A 4DKIA 4E3KA 3IXDA 1NZUA 4MEZA 3IH9A 4A5RA 3EQUA 1SDNA 4S2OA 5M18A 5M1AA 3PBOA 5F1FA 2JCHA 4MNRA 4OP5A 4MBKA 5JYOA 2JC7A 1BULA 3N8RA 4R4RA 1NYMA 1ES3A 3OPRA 4PPRA 3S4XA 3IHBA 3LEZA 1W8QA 5FAQA 5CECA 3D4FA 2J9OA 1ZKJA 3Q82A 3M2JA 4OPRA 3MZEA 4FCFA 4EBPA 2ZQ8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GD8 A;  3E2L A;  2XGN A;  4KZ7 A;  3A3J A;  3CG5 A;  2EX8 A;  4MBF A;  2GDN A;  4GOG A;  2EX6 A;  1BT5 A;  3C7V A;  5JYP A;  2WZX A;  5FQM A;  3G35 A;  2CC1 A;  3ZG0 A;  2BG1 A;  4U0X A;  5D3O A;  3IWO A;  4D2O A;  3B3X A;  4P6B A;  2E8I A;  3LCE A;  4WBG A;  4E3O A;  1MWT A;  3CJM A;  4R3J A;  4S2L A;  1DJC A;  2ZMA A;  3N4I A;  4LV3 A;  3S22 A;  1DJB A;  2ZC5 B;  4ZBE A;  4QD4 A;  4YFM A;  5FA7 A;  3I7J A;  1XA1 A;  4K91 A;  4WZ4 A;  4KZB A;  4ZJ3 A;  1L0E A;  1BUE A;  1FR6 A;  3A3F A;  3VFH A;  4CPK A;  2IWC A;  1JVJ A;  4HBU A;  3FZC A;  4Y0T A;  5A90 A;  5DVA A;  3QHY A;  2EX2 A;  2WAF A;  3PBQ A;  1MWS A;  2Y2N A;  1NYY A;  3ZCZ A;  3JYI A;  3M6B A;  4ZTK A;  4BD0 A;  2Y2H A;  3ZHH A;  5FQI A;  3NC8 A;  3M6H A;  2HP5 A;  3VP4 A;  1IKI A;  3GTC A;  1EWZ A;  3G2Y A;  2OV5 A;  1Z6F A;  2XH9 A;  1TDL A;  1EI5 A;  3HLC A;  1LL5 A;  3HLE A;  5EVI C;  4ZDX A;  3IF6 B;  1LI9 A;  3ZVW A;  3MXS A;  2RL3 A;  3BLM A;  1ES5 A;  4BEN A;  3BFE A;  1WE4 A;  2JE5 A;  4K0X A;  2PU4 A;  3UO9 A;  5FAO A;  3VP0 A;  5AQB A;  5KMW A;  5GHY A;  2Y2M A;  1ZG6 A;  3N6I A;  3AGE A;  1W7F A;  5EPH A;  1YLY A;  5CER A;  3BEC A;  4P87 A;  1K25 A;  3SS3 A;  3NDE A;  2Q9N A;  4QJG A;  4N1H A;  1ZG4 A;  3SH8 A;  1K57 A;  3VP2 A;  1LL9 A;  1CEG A;  3O88 A;  3MXR A;  1PWD A;  1YT4 A;  3RXX A;  3BM6 A;  1K38 A;  1YLZ A;  4RVA A;  1YM1 A;  5F1G A;  1QME A;  5KSC A;  1XGJ A;  3MZD A;  5DTS A;  3UNW A;  1IYO A;  1HTZ A;  3HUN A;  1K57 C;  2Q9M A;  1KGG A;  3W4O A;  5FAS A;  3N8S A;  5CGS A;  2WYX A;  1CI9 A;  1NY0 A;  3HLW A;  3P98 A;  4GDN A;  4DF6 A;  4R4S A;  4S2I A;  3DW0 A;  3HL9 A;  4GDB A;  4IBR A;  2JBF A;  3IT9 A;  4K0W A;  1MXO A;  1E3U A;  4BJP A;  4X53 A;  1FCM A;  1IEM A;  1K6R A;  1SKF A;  2HP9 A;  4JF4 A;  3BYD A;  2R9X A;  4L0L A;  3Q81 A;  2H0T A;  1K4F A;  3QNB A;  5GLC A;  2V20 A;  3IXG A;  5J8X A;  1CEF A;  2ZQC A;  4N1X A;  4OLG A;  4X68 A;  4DDY A;  3GVB A;  5CXW A;  1E25 A;  1Q2Q A;  4GB7 A;  4LCM A;  1U60 A;  1W5D A;  4JKT A;  1MWR A;  3WWX A;  2Z2M B;  2BLS A;  3UPO A;  4WEJ A;  4KG6 A;  3ZGA B;  5A91 A;  4EV4 A;  5CEB A;  3UY6 A;  5EE8 A;  5EEC A;  1ONG A;  1H8Z A;  2ZQ9 A;  4JPM A;  4WMC A;  4GD6 A;  4EUZ A;  2EFU A;  5GLB A;  5EVI D;  1K54 A;  1TVF A;  4UAA A;  1FQG A;  4Z9Q A;  4OPZ A;  2XQZ A;  5KZH A;  2VGK A;  4OH0 A;  4OOM A;  1K6S A;  3MKF A;  4IVK A;  4Y0O A;  5EVI A;  5GL9 A;  4LV2 A;  1MKI A;  1MWU A;  2Y4A A;  3G31 A;  5G18 A;  3A3I A;  1I5Q A;  2WGW B;  2HDU A;  2Y2I A;  1FCO A;  4GN2 A;  5HAR A;  1BTL A;  3SS5 A;  4X55 A;  3BFG A;  5A93 A;  5EOO A;  4KG2 A;  2H5S A;  4UA6 A;  1GA9 A;  2J7V A;  5GLD A;  2IWD A;  4IVI A;  5EVI B;  1KE3 A;  3V3S A;  3W4Q A;  4OOY A;  2EXA A;  3BEB A;  1O07 A;  3WS0 A;  4WEK A;  3GRJ A;  3BFF A;  4FD8 A;  3HLF A;  1JWZ A;  2Y2P A;  4X69 A;  3UDI A;  1FCN A;  1RGZ A;  3G4P A;  1G6A A;  3IF6 A;  1FSY A;  1K56 D;  2Y2O A;  3HBR A;  3OCN A;  1PZO A;  1C3B A;  4OQ0 A;  5DF7 A;  4ZAM A;  1GA0 A;  1CI8 A;  4KZA A;  4OPY A;  3UN7 A;  4CJN A;  1M40 A;  1BLC A;  4RYE A;  2V2F F;  1PWC A;  2XEP A;  3MBZ A;  4PM8 A;  1XPB A;  4OON A;  4EBN A;  2XD1 A;  2ZM0 A;  1NRF A;  2ZC3 B;  1BLP A;  3HLG A;  5E43 A;  2C5W B;  1PI4 A;  2XLN A;  1BSG A;  2DNS A;  4BLM A;  1N4O A;  5GHZ A;  5EVL A;  1KDW A;  4UA7 A;  1KDS A;  3DTM A;  3VOZ A;  1HVB A;  1RCJ A;  5FQQ A;  4EWF A;  4JF6 A;  2WKH A;  4Q8I A;  1PYY A;  2ZJ9 A;  5FQJ A;  2PBY A;  4RX2 A;  4X56 A;  2ZLY A;  3AGD A;  4RA7 A;  4YIN A;  4NK3 A;  1YLT A;  1PZP A;  3G30 A;  5CTM A;  1XGI A;  3WS4 A;  2Y2J A;  4JBF A;  2WAE A;  4JXG A;  1IYS A;  2WGW A;  3BRM A;  5HAQ A;  5CGX A;  3IH8 A;  2HDS A;  4KQR A;  4MLL A;  3UPP A;  4PM5 A;  4XUZ A;  3CMZ A;  3LY4 A;  5DF8 A;  1BLS A;  1FR1 A;  2HPB A;  3PBT A;  4WYY A;  1DY6 A;  1K55 A;  4R1G A;  4S2J A;  4KZ9 A;  5CED A;  2DRW A;  2X02 A;  2J9P A;  1YLW A;  2WGV A;  2EFX A;  2X71 A;  3CZD A;  4OOL A;  5TR7 A;  4PMA A;  3FKW A;  3IQA A;  2RCX A;  4BQM A;  4GKU A;  4WM9 A;  2HDQ A;  3MFD A;  2WUQ A;  1ES4 A;  3P09 A;  4U3T A;  1VM1 A;  4UHU A;  4JXS A;  4MBH A;  1E3U D;  2V1Z A;  2XFS A;  2Y59 A;  4RX3 A;  5KSH A;  3ZG5 A;  2OLV A;  4JF5 A;  4B4Z A;  3IF5 A;  3O87 A;  4S2N A;  1H8Y A;  4OQH A;  2HP6 A;  4EQI A;  3WS2 A;  4B88 A;  1KE4 A;  2ZC6 B;  2OSU A;  4JLF A;  2QZ6 A;  4ZJ1 A;  3RJU A;  4DE1 A;  5E2F A;  1RP5 A;  3VP3 A;  3ISG A;  4N9K A;  2ZQA A;  5DTT A;  2ZD8 A;  5DF9 A;  4LV1 A;  5DTK A;  3OCL A;  4KZ3 A;  1YQS A;  1ERM A;  5HAP A;  4E3I A;  3C4P A;  3NBL A;  4P0M A;  2X01 A;  3HVF A;  1OME A;  1KE0 A;  2XR0 A;  4S2K A;  2ZQ7 A;  1KVM A;  4UA9 A;  3PTE A;  3FYZ A;  1JTG A;  4E3L A;  3OZH A;  3HRE A;  3OPH A;  2WKI A;  5FAT A;  5FQ9 A;  4C6Y A;  1K4E A;  5HAI A;  3IWI A;  3UDX A;  2XF3 A;  1ESI A;  2XK1 A;  3UPN A;  2B5R A;  3PBR A;  4OLD A;  1H5X A;  4KQQ A;  5TFQ A;  1ESU A;  5TGF A;  5EOE A;  1NZO A;  4PM6 A;  3Q1F A;  2EXB A;  4DE0 A;  4OVD A;  1LLB A;  4U0T A;  4OQG A;  1GHM A;  1JWP A;  3QNC A;  5CHU A;  3SOI A;  3IXH A;  5FI6 A;  4LEN A;  3SH9 A;  2P9V A;  5FQK A;  4KZ5 A;  3A3D A;  5FDH A;  1TDG A;  4DE2 A;  1I2W A;  3OC2 A;  1K56 A;  3C5A A;  3TG9 A;  1XA7 A;  5CGW A;  3W4P A;  3GQZ A;  1GHI A;  1XKZ A;  3SH7 A;  5L2F A;  1RGY A;  1FSW A;  3O3V A;  3ZVT A;  3ITA A;  1BZA A;  1JWV A;  2OLU A;  2Y2G A;  3GMW A;  4N9L A;  1ZC2 A;  4IED A;  4KZ6 A;  4E6W A;  3Q07 A;  1WYC A;  3NY4 A;  3PBS A;  3NDG A;  1NXY A;  2A49 A;  5GHX A;  1FOF A;  5BOH A;  4OKP A;  1HD8 A;  1N9B A;  4X6T A;  1ONH A;  1KGE A;  1IEL A;  1IKG A;  3PBN A;  4WEL A;  4DXC A;  2H0Y A;  4FSF A;  2P9V B;  3GSG A;  5CRF A;  5E2H A;  1ALQ A;  2Y91 A;  3N8L A;  1KGF A;  3ZG8 B;  5A92 A;  1LHY A;  3O86 A;  1YLP A;  4P85 A;  1K54 C;  4KEN B;  3FV7 A;  4QU3 A;  1G68 A;  1IYQ A;  1PI5 A;  4WZ5 A;  1W79 A;  3DWZ A;  3GV9 A;  3ZG9 B;  4S2N C;  5CTN A;  2WZZ A;  2R9W A;  2ZC7 A;  3E2K A;  3FWL A;  3PAG A;  3SS4 A;  4HES A;  1TEM A;  5FI7 A;  4DRT A;  4HEF A;  1GCE A;  2Z2L B;  1PIO A;  3BFC A;  1L0D A;  3HUM A;  2WKE A;  4GNU A;  4HBT A;  2G2U A;  4R0Q A;  1MY8 A;  1XXM A;  1KVL A;  4QY5 A;  4OQI A;  1M6K A;  2I72 A;  1BLH A;  3G34 A;  3A3E A;  4XUX A;  2H10 A;  1HZO A;  3M2K A;  4QY6 A;  4FH4 A;  2Y2Q A;  4OPQ A;  5F83 A;  5M19 A;  3PAE A;  1L0F A;  4GZB A;  1I2S A;  4N92 A;  5AQ7 A;  4C75 A;  3FKV A;  1SCW A;  4LCL A;  2FFF B;  3ZDJ A;  3ZNY A;  4JXW A;  5HFO A;  4DXB A;  1L2S A;  4PM7 A;  5U47 A;  3VOY A;  4LV0 A;  4R23 A;  5CHJ A;  4JXV A;  3G2Z A;  2WK0 A;  3OPP A;  3RXW A;  2J8Y A;  1GHP A;  3WS5 A;  4C3Q A;  3VMA A;  5HX9 A;  4BD1 A;  3W8K A;  4B4X A;  4S2M A;  5IHV A;  3GR2 A;  3UE0 A;  1W8Y A;  1QMF A;  1XP4 A;  5FI2 A;  5FSR A;  1YMS A;  3LO7 A;  4E3N A;  3C4O A;  4S2P A;  3MZF A;  3UE3 A;  3UDF A;  1ERO A;  3G32 A;  3VFF A;  4KZ8 A;  3NIA A;  3V39 A;  5GLA A;  3AGF A;  1S6R A;  2Y2K A;  3IWQ A;  2ZM2 A;  4O7D A;  3ITB A;  4KG5 A;  3BLS A;  4Y7P A;  3VSL A;  1JTD A;  2PU2 A;  3HLD A;  3C7U A;  4ID4 A;  5HW3 A;  4NET A;  3TOI A;  1DJA A;  3VP1 A;  3WRT A;  3OPL A;  5E2G A;  5I94 A;  4QB8 A;  4F94 A;  1YMX A;  1VQQ A;  3NCK A;  5AQ9 A;  2FFY A;  1Y54 A;  1SHV A;  3DWK A;  2XDM A;  1CK3 A;  1K55 C;  3N7W A;  1O7E A;  3VSK A;  1MPL A;  4E6X A;  1XX2 A;  2A3U A;  4PM9 A;  4H8R A;  2WAD A;  5E2E A;  4E3J A;  4BL3 A;  1PWG A;  2HDR A;  3LY3 A;  5EUA A;  4DE3 A;  4WZ5 C;  1MBL A;  3ZFZ A;  5AQA A;  1LI0 A;  2XD5 A;  3UE1 A;  1E4D A;  4DDS A;  2P74 A;  1YLJ A;  4XXR A;  3EQV A;  4QHC A;  2ZC4 B;  4BL2 A;  2EX9 A;  3ZG7 B;  3ZNT A;  3HLB A;  3MKE A;  5F82 A;  2DCF A;  1SDE A;  2ZQD A;  4M3K A;  5CHM A;  2IWB A;  4KZ4 A;  2QPN A;  3NI9 A;  1PW8 A;  3V3R A;  4WMC D;  1ES2 A;  3IHA A;  2ZM8 A;  3TSG A;  1ERQ A;  3Q7V A;  3V5M A;  1PW1 A;  1Q2P A;  2QMI A;  5HL1 A;  3WS1 A;  1S0W A;  2Y55 A;  3IXB A;  5FAP A;  3Q7Z A;  3WRZ A;  4IBX A;  3HUO A;  3V50 A;  1WYB A;  4KQO A;  4E3M A;  2WGI A;  4R3B A;  1IYP A;  3S1Y A;  3IF6 C;  3BFD A;  3Q7V B;  1L0G A;  4EBL A;  2G2W A;  2Y2L A;  1NJ4 A;  1J9M A;  1AXB A;  2XFT A;  4Y0U A;  4ZJ2 A;  4OP8 A;  2C6W B;  2UWX A;  2VGJ A;  4FH2 A;  4DKI A;  4E3K A;  3IXD A;  1NZU A;  4MEZ A;  3IH9 A;  4A5R A;  3EQU A;  1SDN A;  4S2O A;  5M18 A;  5M1A A;  3PBO A;  5F1F A;  2JCH A;  4MNR A;  4OP5 A;  4MBK A;  5JYO A;  2JC7 A;  1BUL A;  3N8R A;  4R4R A;  1NYM A;  1ES3 A;  3OPR A;  4PPR A;  3S4X A;  3IHB A;  3LEZ A;  1W8Q A;  5FAQ A;  5CEC A;  3D4F A;  2J9O A;  1ZKJ A;  3Q82 A;  3M2J A;  4OPR A;  3MZE A;  4FCF A;  4EBP A;  2ZQ8 A; 
#chains in the Genus database with same CATH topology
 4GD8 A;  4P6Z M;  2XGN A;  2Z6C A;  2W3H A;  3A3J A;  2EX8 A;  2GDN A;  2EX6 A;  1BT5 A;  4U0X A;  3B3X A;  2E8I A;  2ZOH A;  3JVV A;  4E3O A;  4R3J A;  1DJC A;  3T4L A;  4LV3 A;  1YSP A;  4H6J B;  4ZBE A;  1OJ5 A;  2VGL S;  5HDD A;  4WZ4 A;  4NXE A;  1Y4O A;  4KZB A;  4ZJ3 A;  3VFH A;  4CPK A;  2IWC A;  3FZC A;  2EX2 A;  4ZTK A;  3T1R A;  4BBU A;  3NC8 A;  2HP5 A;  3KYQ A;  3VP4 A;  3T1S A;  3GTC A;  1N9O A;  4XT2 A;  3RFB A;  1PRQ A;  1DP9 A;  3BLM A;  4K0X A;  3NOT C;  3MR0 A;  3UO9 A;  5FAO A;  3VP0 A;  5AQB A;  5A8B A;  4WN5 A;  2Y2M A;  1FIL A;  1W7F A;  1LSX A;  5DJU A;  5CER A;  3SS3 A;  2W1R A;  3SH8 A;  1LL8 A;  2PR5 A;  2B02 A;  1TS0 A;  1YM1 A;  3F1P A;  3HUN A;  2DMW A;  2Q9M A;  3W4O A;  5IT5 A;  5FAS A;  3IX4 A;  1CI9 A;  1NY0 A;  2VZW A;  3P98 A;  4DF6 A;  5K5B A;  1IFQ A;  1XJ6 A;  2PYP A;  1FCM A;  2HP9 A;  1D7E A;  3BYD A;  4L0L A;  2KLI A;  3Q81 A;  3QNB A;  5GLC A;  1CEF A;  3CLO A;  4X68 A;  4DDY A;  5CXW A;  5DKL A;  4GB7 A;  4L9F A;  1MWR A;  3T4K A;  3FPV A;  4WEJ A;  5A91 A;  5CEB A;  3UY6 A;  3MMH A;  1ONG A;  1XJ4 A;  4WMC A;  3NUL A;  5HWV A;  4EUZ A;  2EFU A;  2GX5 A;  5EVI D;  2XQZ A;  5EM1 A;  3UB8 A;  1VB6 A;  4OOM A;  1MWU A;  2Y4A A;  5G18 A;  3A3I A;  2HDU A;  1FCO A;  5HAR A;  4X55 A;  3BFG A;  5EOO A;  5GLD A;  4OOY A;  1TS7 A;  3MXQ A;  3HLF A;  2Y2P A;  5J7E A;  4X69 A;  1RGZ A;  3G4P A;  3ICY A;  3OCN A;  1PZO A;  1C3B A;  4OQ0 A;  5EVE A;  1M40 A;  3DTK A;  3MBZ A;  2ZMV A;  1NRF A;  4ZRR A;  1S4S A;  2W3E A;  3T4O A;  1BSG A;  2H28 A;  1KDS A;  3DTM A;  1HVB A;  4BBT A;  1KOU A;  2WKH A;  3FC7 A;  5FQJ A;  4RA7 A;  1NRJ A;  4NK3 A;  1PZP A;  1XGI A;  4JXG A;  1IYS A;  3CUE C;  3LID A;  5TBM B;  2QYB A;  3LY4 A;  1DY6 A;  1OTI A;  4Y17 A;  2MJ6 A;  2J9P A;  2X71 A;  4FOF A;  3IQA A;  4WM9 A;  2WUQ A;  5G4Y A;  4U3T A;  4MBH A;  1ACF A;  2V9A A;  2XFS A;  3ZG5 A;  3O87 A;  3KX0 X;  3S7Q A;  4ESP A;  1KE4 A;  3E4O A;  2ZC6 B;  4ZJ1 A;  3RJU A;  4DE1 A;  1CJF A;  2ZQA A;  5F69 A;  4WLA A;  5DTK A;  4E3I A;  2X01 A;  1OTE A;  4S2K A;  2ZQ7 A;  3KSG A;  5DKK A;  2VJW A;  4O01 A;  2VA0 A;  1JTG A;  5HDC A;  3F1P B;  3HRE A;  3OPH A;  5FQ9 A;  4BMW A;  1GSV A;  1K4E A;  3GDI A;  3B42 A;  3UPN A;  2B5R A;  1H5X A;  4II7 A;  4QPR A;  1MKM A;  4DE0 A;  4PKY G;  1GHM A;  5FDH A;  3VE3 A;  3OC2 A;  1K56 A;  3W4P A;  3BJN A;  1XKZ A;  1RGY A;  3O3V A;  5HWW A;  3K2N A;  2OLU A;  4EXO A;  2Y2G A;  3GMW A;  1ZC2 A;  4NXG A;  4E6W A;  3Q07 A;  4WL9 A;  1F98 A;  1NXY A;  2A49 A;  3LIF A;  1SZV A;  3D3O A;  1ONH A;  4DXC A;  1XFQ A;  5CRF A;  2Y91 A;  3ZG8 B;  5A92 A;  1LHY A;  3O86 A;  4P85 A;  4KEN B;  3DWZ A;  2L0W A;  2WZZ A;  2ZC7 A;  3E2K A;  3PAG A;  4HES A;  1IOU A;  1TEM A;  2D01 A;  1PIO A;  3HUM A;  3E0Y A;  1MY8 A;  2P04 A;  4M4X A;  1BLH A;  2H10 A;  1TS6 A;  3M2K A;  1L0F A;  5HL6 A;  1I2S A;  4N92 A;  5AQ7 A;  3ZNY A;  4RQ9 A;  4PM7 A;  5U47 A;  4R23 A;  3RH8 B;  3FG8 A;  5G4Z A;  3KYE A;  2I9V A;  5IHV A;  1YMS A;  3UE3 A;  3VFF A;  1J3W A;  2K31 A;  2ZM2 A;  4Y7P A;  4ID4 A;  5HW3 A;  4NET A;  3TOI A;  3OPL A;  1DP8 A;  4CLC A;  1Y54 A;  3H7W A;  3N7W A;  3KSF A;  2V0W A;  2HDR A;  3LY3 A;  1MBL A;  3A0R A;  1LI0 A;  3DAV A;  2ZC4 B;  2EX9 A;  3CWF A;  5F82 A;  3R4K A;  1V9Y A;  3TJZ C;  3V5M A;  3ULF A;  3EEA A;  3WS1 A;  1S0W A;  5FAP A;  4IBX A;  5KIZ A;  3NJA A;  2G2W A;  1NJ4 A;  3B33 A;  1MZU A;  4ME4 A;  4OP8 A;  2C6W B;  2UWX A;  4UQI M;  4MEZ A;  3IH9 A;  4S2O A;  2VK3 A;  5HPI A;  3PBO A;  4MNR A;  5JYO A;  3N8R A;  4HNB A;  1ES3 A;  3OPR A;  3S4X A;  3U4L P;  3LEZ A;  2ZMF A;  5CEC A;  2J9O A;  5AJG A;  3MZE A;  3W2Z A;  5J4E A;  3E2L A;  4KZ7 A;  4Y2F A;  4MBF A;  4GOG A;  4YNR A;  3JVU A;  5JYP A;  3C7V A;  2BG1 A;  3IWO A;  3LCE A;  5AVF A;  4WBG A;  5HZH A;  3U2A A;  4HI4 A;  2ZMA A;  3N4I A;  2ZC5 B;  1H3Q A;  3T4Q A;  2NUP C;  2LB5 A;  2M1C A;  3QP4 A;  3V67 A;  2B18 A;  2FH5 A;  3C8C A;  4HJ6 A;  1JVJ A;  4Y0T A;  3OLO A;  3QHY A;  1NYY A;  3JYI A;  3M6B A;  3CUE A;  4ETX A;  1AWI A;  2VV6 A;  3G2Y A;  1TDL A;  1EI5 A;  3HLE A;  4ZDX A;  3IF6 B;  1PNE A;  4MN6 A;  3LUQ A;  4BEN A;  3BFE A;  1WE4 A;  2XA7 M;  2PU4 A;  2KDK A;  4BWI A;  5EM0 A;  3BEC A;  4P87 A;  1K25 A;  2Q9N A;  1NLY A;  3VP2 A;  1LL9 A;  2PHY A;  1YT4 A;  1YLZ A;  1GSW A;  2KX6 A;  5F1G A;  1QME A;  5KSC A;  1XGJ A;  3UNW A;  1IYO A;  3LIB A;  3IBR A;  1K57 C;  2CMN A;  3LR0 A;  3LI9 A;  3P01 A;  3HLW A;  4R4S A;  4S2I A;  2WKP A;  4BJP A;  1E3U A;  1K6R A;  3CIT A;  1K0K A;  2R9X A;  1V9Z A;  3IXG A;  1F2K A;  5J8X A;  2A24 B;  3GVB A;  1E25 A;  3DTI A;  1Q2Q A;  4E04 A;  4JKT A;  3WWX A;  3QP8 A;  4KG6 A;  3T4T A;  1P9R A;  2D02 A;  1H8Z A;  1W63 Q;  4JPM A;  4GD6 A;  1VHM A;  5GLB A;  1K54 A;  1TVF A;  1K6S A;  3MKF A;  4IVK A;  4Y0O A;  1VET B;  1T1B A;  1I5Q A;  5DFY A;  2WGW B;  2Y2I A;  4GN2 A;  2A24 A;  4KG2 A;  5HD3 A;  2H5S A;  2O9C A;  1GA9 A;  2IWD A;  3V3S A;  3SW1 A;  4HOI A;  4WEK A;  3BFF A;  2PD7 A;  1JWZ A;  1FCN A;  3IF6 A;  4KZA A;  1CI8 A;  4RYE A;  2V2F F;  2XEP A;  4PM8 A;  1XPB A;  4YOF A;  2XD1 A;  2ZM0 A;  2ZC3 B;  5E43 A;  3LIA A;  4I5S A;  5C5K A;  4CLC B;  2XLN A;  1N4O A;  5GHZ A;  4UA7 A;  3VOZ A;  1RCJ A;  4FUW A;  2W27 A;  4JF6 A;  4LRY C;  4Q8I A;  2ZJ9 A;  2PBY A;  1N9N A;  3AGD A;  2OWJ A;  1YLT A;  3G30 A;  3LR5 A;  2Y2J A;  4JBF A;  2WAE A;  5L09 A;  2IA2 A;  4NXF A;  1BLS A;  1FR1 A;  3PBT A;  5AVE A;  2NUT C;  4KZ9 A;  1YLW A;  4HH2 A;  2RCX A;  4BQM A;  2EWV A;  3C38 A;  1ES4 A;  3P09 A;  4UHU A;  2QHK A;  2V1Z A;  2Y59 A;  4RX3 A;  4DJ2 A;  3LR4 A;  3IF5 A;  4S2N A;  3PHY A;  2VLG A;  4EQI A;  2K7S A;  1LSV A;  3P7N A;  2LB9 A;  4N9K A;  2OAQ 1;  5DF9 A;  2ZL1 B;  1S4R A;  3O5Y A;  3F1N B;  4KZ3 A;  5HDS A;  4P0M A;  1KE0 A;  3HJK A;  4E3L A;  3OZH A;  4GW9 A;  3T1X A;  4C6Y A;  3UDX A;  2Q0O A;  1ESI A;  2XK1 A;  1H0M A;  3PBR A;  4KQQ A;  4PM6 A;  2EXB A;  1LLB A;  1XJ2 A;  5CHU A;  3QNC A;  3SH9 A;  2P9V A;  5FQK A;  4P6Z S;  1TDG A;  1I2W A;  3TG9 A;  3GQZ A;  4GLQ A;  2E8J A;  5L2F A;  1FSW A;  3EGD C;  3ZVT A;  4HJ3 A;  4N9L A;  1D1J A;  1NLZ A;  4IED A;  4KZ6 A;  3NY4 A;  3NDG A;  5BOH A;  1HD8 A;  1N9B A;  4MCW A;  1KGE A;  1IKG A;  4FSF A;  3ZYT A;  5E2H A;  1ALQ A;  5FL3 A;  3N8L A;  1KGF A;  2Z6D A;  4F3L A;  4EET B;  4WZ5 A;  4HP4 A;  5CTN A;  3LFV A;  2R9W A;  3SS4 A;  4GHI A;  4HEF A;  1L0D A;  2HV1 A;  2WKE A;  4LFU A;  1KVL A;  1DP6 A;  1M6K A;  3G34 A;  3A3E A;  4XUX A;  4FTX A;  4QY6 A;  4OPQ A;  3PAE A;  1OPX A;  4C75 A;  4UEY A;  3ZDJ A;  2FFF B;  5HFO A;  1L2S A;  4Q0I A;  1GSX A;  1Y28 A;  4PKY A;  3OPP A;  3WS5 A;  2J8Y A;  4G3K A;  4C3Q A;  4R6L A;  3VMA A;  4BD1 A;  3W8K A;  4S2M A;  1F9I A;  3GR2 A;  4EEP A;  1W8Y A;  1XP4 A;  3CAX A;  5FSR A;  2PBD P;  3A0V A;  5DFX A;  3G32 A;  1EW0 A;  4KZ8 A;  3NIA A;  2W3G A;  2W1T A;  4KG5 A;  3C7U A;  3MQQ A;  5I94 A;  4F94 A;  1S67 L;  4Y13 A;  2V1A A;  3DWK A;  3UB6 A;  1K55 C;  2HZ5 A;  1O7E A;  4E6X A;  5E2E A;  4R3A A;  4DE3 A;  3BY8 A;  1G6O A;  3PXP A;  3ZFZ A;  3MSH A;  3K3D A;  4DDS A;  4XXR A;  3ZG7 B;  3ZNT A;  3IS2 A;  1OTA A;  2KOI A;  2V8F A;  2QJ5 A;  4KZ4 A;  2QPN A;  1PW8 A;  3V3R A;  2ZM8 A;  3TSG A;  1ERQ A;  2QMI A;  3IXB A;  4E3M A;  1IYP A;  3BFD A;  4LRX C;  2VGJ A;  4FH2 A;  4EES A;  2O9B A;  1ZTU A;  1SDN A;  3H82 A;  4NXB A;  5F1F A;  4OP5 A;  2JC7 A;  1BUL A;  2JKT I;  1NYM A;  3L9K A;  4HY8 A;  3IHB A;  3D4F A;  4OPR A;  4FCF A;  2ZQ8 A;  1MC0 A;  1WA9 A;  3CG5 A;  2WZX A;  5FQM A;  2CC1 A;  3ZG0 A;  4CQH A;  4D2O A;  4IJG A;  5HSQ A;  4I38 A;  3S22 A;  1DJB A;  4YFM A;  2JKF A;  4K91 A;  1L0E A;  3A3F A;  3S7N A;  5L07 A;  4ETZ A;  1PFL A;  2QJ7 A;  3S7P A;  2WAF A;  2Y2N A;  4BD0 A;  2Y2H A;  2OV5 A;  1Z6F A;  2XH9 A;  5EVI C;  4O0P A;  1ES5 A;  2JE5 A;  3HJI A;  1H8M A;  3N6I A;  3NDE A;  1YKD A;  4N1H A;  4GJ4 A;  3MXR A;  3R7W B;  1K38 A;  3T12 B;  3MZD A;  5DTS A;  1HTZ A;  1T18 A;  4GDN A;  3DW0 A;  3HL9 A;  3MJQ A;  4GDB A;  4IBR A;  3IT9 A;  1MXO A;  5J3W A;  1IEM A;  1SKF A;  5DJT A;  4JF4 A;  1K4F A;  2V20 A;  4I3A A;  2ZQC A;  4N1X A;  2FZ0 A;  2JKR I;  3NHQ A;  2GJ3 A;  2PYR A;  4JGP A;  1CF0 A;  4LCM A;  5MC7 A;  2BLS A;  3ZGA B;  1FIK A;  1A0K A;  4EV4 A;  3LR3 A;  5EEC A;  1ODV A;  4Z9Q A;  4UAA A;  2V8C A;  1LT0 A;  5GL9 A;  5CX7 A;  3A0S A;  4B93 A;  2HJE A;  3F1O A;  1BTL A;  2J7V A;  4IVI A;  5EVI B;  3W4Q A;  2EXA A;  3WS0 A;  2Y8H A;  3GRJ A;  3UDI A;  2P7J A;  3G6O A;  1FSY A;  1K56 D;  5DF7 A;  1GA0 A;  4CJN A;  2HGV A;  1L3L A;  1BLC A;  4EBN A;  1TF1 A;  1BLP A;  2L4R A;  2PT7 A;  1PI4 A;  2DNS A;  4BLM A;  3UB9 A;  2PRF A;  5EVL A;  5F68 A;  4DMZ A;  5FQQ A;  4EWF A;  3LIC A;  3NOU C;  1PYY A;  2XA7 S;  4X56 A;  4NG2 A;  4YIN A;  5CTM A;  3MF0 A;  2WGW A;  5HAQ A;  5CGX A;  2HDS A;  4KQR A;  4PM5 A;  3UPP A;  3BQ8 A;  3CMZ A;  2ZOI A;  5DF8 A;  4WYY A;  2EWW A;  4R1G A;  2YKH A;  4HJ4 A;  2DRW A;  3CZD A;  4OOL A;  2EFX A;  5TR7 A;  5F6A A;  1VET A;  2P08 A;  3TE8 A;  4GKU A;  2HDQ A;  1F5M A;  2VV7 A;  2BTF P;  3OOV A;  2OLV A;  4JF5 A;  3BY9 A;  3IX8 A;  3WS2 A;  4B88 A;  2OSU A;  4JLF A;  4KUO A;  2QZ6 A;  4CLC C;  5E2F A;  3ISG A;  1XJ3 A;  1YQS A;  1ERM A;  2JN7 A;  3LGO A;  1OME A;  4HH3 A;  4UA9 A;  3PTE A;  1LSW A;  5FAT A;  2XF3 A;  5TGF A;  4OLD A;  1ESU A;  5EOE A;  3Q1F A;  4U0T A;  3SOI A;  3IXH A;  4JGR A;  4EEU A;  2AVX A;  4KZ5 A;  4DE2 A;  3C5A A;  4K08 A;  1GHI A;  2K2N A;  4B9O A;  1BZA A;  3MS6 A;  1JWV A;  3OBF A;  4OKP A;  4X6T A;  2JKG A;  1W63 M;  3PBN A;  3TW8 A;  3T1Q B;  2ZBB A;  4BBV A;  2V1B A;  5FEG A;  1K54 C;  3FV7 A;  3ZG9 B;  1S66 L;  2O99 A;  3B47 A;  3LIE A;  3VE4 A;  2JKT M;  5FI7 A;  4HBT A;  4I3I A;  3BFC A;  2OOL A;  2G2U A;  1BYW A;  4XT2 B;  2XRO A;  4FH4 A;  5F83 A;  4CLC D;  4CLC E;  5M19 A;  1UGU A;  1X0O A;  1SCW A;  3KSI A;  1HLU P;  4JXW A;  3VOY A;  1T1A A;  5HPF A;  5CHJ A;  3G2Z A;  3FPW A;  3E98 A;  4LPZ A;  5HX9 A;  4EQ1 A;  3RTY A;  3UE0 A;  5FI2 A;  1CQA A;  3PR6 A;  3V39 A;  1OT6 A;  4EW7 A;  5GLA A;  3AGF A;  3IWQ A;  2Y2K A;  3ITB A;  3VSL A;  2PU2 A;  1DJA A;  3WRT A;  5LBR A;  2J80 A;  4Y5F A;  5L10 A;  1YMX A;  3NCK A;  4KUK A;  5AQ9 A;  4DN0 A;  3QP2 A;  3MQ0 A;  1MPL A;  2Y79 A;  4PM9 A;  2WAD A;  4BL3 A;  4Y15 A;  4WZ5 C;  2VEA A;  3T4S A;  3H9W A;  1E4D A;  1YLJ A;  2BAS A;  3EQV A;  4QHC A;  4LRZ E;  3MKE A;  3C2W A;  4M3K A;  2ZQD A;  2IWB A;  2W1T B;  3NI9 A;  4WMC D;  3IHA A;  3Q7V A;  1Q2P A;  2Y55 A;  2W0N A;  1TS8 A;  2WGI A;  3F1O B;  4R3B A;  5L8M A;  3S1Y A;  3Q7V B;  4EBL A;  2Y2L A;  3H7W B;  1YSQ A;  1AXB A;  4Y3I A;  4UQI S;  4DKI A;  3IXD A;  4EUV A;  3GEC A;  5M1A A;  2JCH A;  3EWK A;  1T1C A;  4R4R A;  4X25 A;  1W8Q A;  3K3C A;  3Q82 A;  4IUH A;  3M2J A;  4EBP A;  2HJ9 C;  4X1L A;  5IU1 A;  3VV4 A;  3G35 A;  1D06 A;  5D3O A;  2J3W A;  4NKP A;  2OWH A;  4P6B A;  3E4P A;  3UB5 P;  3LEQ A;  2UV0 E;  1MWT A;  3CJM A;  4S2L A;  3NEC A;  4R38 A;  3T4J A;  4QD4 A;  3D9Y A;  5FA7 A;  4QWO A;  2INW A;  3I7J A;  1XA1 A;  1BUE A;  1FR6 A;  3IS2 B;  3IX3 A;  4HBU A;  5A90 A;  5DVA A;  3PBQ A;  4AFI A;  1MWS A;  5EV0 A;  4L9E A;  3ZCZ A;  4D60 A;  3ZHH A;  5FQI A;  3M6H A;  3IBJ A;  1IKI A;  1EWZ A;  3MFX A;  3HLC A;  1LL5 A;  4ARZ B;  1LI9 A;  1YPR A;  3ZVW A;  3MXS A;  2RL3 A;  4GS9 B;  2G7U A;  5KMW A;  1UWP X;  5GHY A;  1P9W A;  1ZG6 A;  3AGE A;  5EPH A;  1YLY A;  4HQA A;  4G3W A;  2YKF A;  3BQA A;  4QJG A;  1ZG4 A;  2PDR A;  5HWT A;  1K57 A;  1CEG A;  3O88 A;  1PWD A;  3RXX A;  3BM6 A;  4RVA A;  3JPU A;  4ARZ A;  1KGG A;  3N8S A;  5CGS A;  2WYX A;  2JBF A;  4K0W A;  2HF6 A;  3KYZ A;  4MN5 A;  4X53 A;  2PD8 A;  2H0T A;  2ACG A;  5HD5 A;  3EEH A;  1VEU B;  4OLG A;  2L1M A;  4EER A;  1U60 A;  1W5D A;  2Z2M B;  3UPO A;  4PAU A;  2M7U A;  4IHQ A;  5EE8 A;  1P0Z A;  1S1Z A;  2ZQ9 A;  1DRM A;  2XSS A;  4MMN A;  1FQG A;  4R70 A;  4OPZ A;  5KZH A;  2VGK A;  4OH0 A;  2W3F A;  5EVI A;  4LV2 A;  1MKI A;  3G31 A;  3MQO A;  4PHT A;  3SS5 A;  3S7O A;  5A93 A;  4UA6 A;  1KE3 A;  1XFN A;  3BEB A;  1O07 A;  4FD8 A;  3UME A;  3NOP C;  1G6A A;  2Y2O A;  3HBR A;  4ZAM A;  3UN7 A;  4HIA A;  1OTD A;  4OPY A;  1PWC A;  3DBA A;  4OON A;  3HLG A;  2C5W B;  5IS1 A;  3CI6 A;  4LGW A;  4Z1W A;  1KDW A;  1T19 A;  3ZQ5 A;  2XRN A;  1NWZ A;  2OAP 1;  3CPT B;  4GS9 A;  4RX2 A;  2ZLY A;  4MDZ A;  3WS4 A;  2EA9 A;  3CPT A;  3BRM A;  5I5L A;  3IH8 A;  4MLL A;  3F1N A;  5EFW A;  4XUZ A;  2HPB A;  1K55 A;  4S2J A;  5CED A;  2R78 A;  2X02 A;  2WGV A;  4PMA A;  3FKW A;  3MFD A;  2VKS A;  5F5Y A;  3SZT A;  1VM1 A;  4JXS A;  1E3U D;  2VGL M;  5KSH A;  1N9L A;  3KSH A;  4B4Z A;  3QP1 A;  1H8Y A;  4OQH A;  2HP6 A;  3PYP A;  3DTE A;  1RP5 A;  3VP3 A;  3BW6 A;  1G28 A;  4L9G A;  5DTT A;  2ZD8 A;  4LV1 A;  2JKR M;  2GZA A;  3OCL A;  5HAP A;  3C4P A;  3NBL A;  3D72 A;  3HVF A;  2JHE A;  2XR0 A;  1KVM A;  1SKO B;  4HP9 A;  3FYZ A;  4YWZ A;  4F3L B;  2WKI A;  5HAI A;  3IWI A;  4Q0H A;  5TFQ A;  1NZO A;  3VOL A;  4OVD A;  4X1M A;  4OQG A;  4WUJ A;  1JWP A;  5FI6 A;  4LEN A;  3A3D A;  4HHD A;  4LLO B;  1ZHH B;  2V0U A;  1XA7 A;  4JGQ A;  1YAX A;  5CGW A;  1UWN X;  3SH7 A;  2VV8 A;  2PAV P;  3ITA A;  5FDS A;  2J3T D;  2WKR A;  1WYC A;  1STZ A;  3PBS A;  3KO6 A;  4EU0 A;  4IUK A;  5GHX A;  1FOF A;  2O9A A;  1IEL A;  4WEL A;  2H0Y A;  2P9V B;  3GSG A;  3QP5 A;  4O8G A;  4NEE D;  1YLP A;  1OT9 A;  4QU3 A;  1G68 A;  1IYQ A;  1PI5 A;  2W3D A;  1W79 A;  3GV9 A;  3BWL A;  4S2N C;  3FWL A;  4DRT A;  1GCE A;  2Z2L B;  4R0Q A;  4GNU A;  2QWS A;  1XXM A;  3HCY A;  4QY5 A;  3CHW P;  4OQI A;  2I72 A;  1HZO A;  2Y2Q A;  2WKQ A;  4GZB A;  2ZL1 A;  3FKV A;  4LCL A;  4DXB A;  3UB7 A;  1JNU A;  4LV0 A;  3UE6 A;  4JXV A;  1P97 A;  2WK0 A;  3RXW A;  2O0Y A;  1GHP A;  4DJ3 A;  1OJG A;  1S1Y A;  3R7W A;  4B4X A;  4Q0J A;  1QMF A;  3LO7 A;  4E3N A;  3C4O A;  1OTB A;  4S2P A;  3MZF A;  3UDF A;  1ERO A;  4WF0 A;  1TD5 A;  1G5U A;  4O7D A;  1S6R A;  5TJJ A;  3BLS A;  1JTD A;  3HLD A;  3VP1 A;  5E2G A;  4QB8 A;  1VQQ A;  1VEU A;  2FFY A;  1SHV A;  3LI8 A;  2XDM A;  1CK3 A;  3VSK A;  1XX2 A;  2A3U A;  4H8R A;  4E3J A;  2M7V A;  2QKP A;  1PWG A;  5EUA A;  5AQA A;  2XD5 A;  3T50 A;  3UE1 A;  2P74 A;  5FEF A;  2GNX A;  4I3J A;  3HLB A;  2DCF A;  1SDE A;  5CHM A;  3EOI A;  2A2L A;  1SKO A;  1ES2 A;  5TBM A;  4BL2 A;  1PW1 A;  2J3T C;  5HL1 A;  3Q7Z A;  3WRZ A;  2PR6 A;  1Z09 A;  3HUO A;  3V50 A;  1WYB A;  4KQO A;  4G3V A;  4GHI B;  3IF6 C;  1L0G A;  3E4Q A;  2B95 A;  4I39 A;  1J9M A;  3UMD A;  2XFT A;  3H82 B;  4MN7 A;  4Y0U A;  4ZJ2 A;  4E3K A;  3C30 A;  4JGO A;  3EGX C;  1NZU A;  3L7H A;  4KQD A;  4A5R A;  3EQU A;  5M18 A;  4GCZ A;  3LYX A;  4MBK A;  4H6J A;  2VX8 A;  3TRC A;  4PPR A;  5FAQ A;  1ZKJ A;  3QP6 A; 
#chains in the Genus database with same CATH homology
 4GD8 A;  3E2L A;  2XGN A;  4KZ7 A;  3A3J A;  3CG5 A;  2EX8 A;  4MBF A;  2GDN A;  4GOG A;  2EX6 A;  1BT5 A;  3C7V A;  5JYP A;  2WZX A;  5FQM A;  3G35 A;  2CC1 A;  3ZG0 A;  2BG1 A;  4U0X A;  5D3O A;  3IWO A;  4D2O A;  3B3X A;  4P6B A;  2E8I A;  3LCE A;  4WBG A;  4E3O A;  1MWT A;  3CJM A;  4R3J A;  4S2L A;  1DJC A;  2ZMA A;  3N4I A;  4LV3 A;  3S22 A;  1DJB A;  2ZC5 B;  4ZBE A;  4QD4 A;  4YFM A;  5FA7 A;  3I7J A;  1XA1 A;  4K91 A;  4WZ4 A;  4KZB A;  4ZJ3 A;  1L0E A;  1BUE A;  1FR6 A;  3A3F A;  3VFH A;  4CPK A;  2IWC A;  1JVJ A;  4HBU A;  3FZC A;  4Y0T A;  5A90 A;  5DVA A;  3QHY A;  2EX2 A;  2WAF A;  3PBQ A;  1MWS A;  2Y2N A;  1NYY A;  3ZCZ A;  3JYI A;  3M6B A;  4ZTK A;  4BD0 A;  2Y2H A;  3ZHH A;  5FQI A;  3NC8 A;  3M6H A;  2HP5 A;  3VP4 A;  1IKI A;  3GTC A;  1EWZ A;  3G2Y A;  2OV5 A;  1Z6F A;  2XH9 A;  1TDL A;  1EI5 A;  3HLC A;  1LL5 A;  3HLE A;  5EVI C;  4ZDX A;  3IF6 B;  1LI9 A;  3ZVW A;  3MXS A;  2RL3 A;  3BLM A;  1ES5 A;  4BEN A;  3BFE A;  1WE4 A;  2JE5 A;  4K0X A;  2PU4 A;  3UO9 A;  5FAO A;  3VP0 A;  5AQB A;  5KMW A;  5GHY A;  2Y2M A;  1ZG6 A;  3N6I A;  3AGE A;  1W7F A;  5EPH A;  1YLY A;  5CER A;  3BEC A;  4P87 A;  1K25 A;  3SS3 A;  3NDE A;  2Q9N A;  4QJG A;  4N1H A;  1ZG4 A;  3SH8 A;  1K57 A;  3VP2 A;  1LL9 A;  1CEG A;  3O88 A;  3MXR A;  1PWD A;  1YT4 A;  3RXX A;  3BM6 A;  1K38 A;  1YLZ A;  4RVA A;  1YM1 A;  5F1G A;  1QME A;  5KSC A;  1XGJ A;  3MZD A;  5DTS A;  3UNW A;  1IYO A;  1HTZ A;  3HUN A;  1K57 C;  2Q9M A;  1KGG A;  3W4O A;  5FAS A;  3N8S A;  5CGS A;  2WYX A;  1CI9 A;  1NY0 A;  3HLW A;  3P98 A;  4GDN A;  4DF6 A;  4R4S A;  4S2I A;  3DW0 A;  3HL9 A;  4GDB A;  4IBR A;  2JBF A;  3IT9 A;  4K0W A;  1MXO A;  1E3U A;  4BJP A;  4X53 A;  1FCM A;  1IEM A;  1K6R A;  1SKF A;  2HP9 A;  4JF4 A;  3BYD A;  2R9X A;  4L0L A;  3Q81 A;  2H0T A;  1K4F A;  3QNB A;  5GLC A;  2V20 A;  3IXG A;  5J8X A;  1CEF A;  2ZQC A;  4N1X A;  4OLG A;  4X68 A;  4DDY A;  3GVB A;  5CXW A;  1E25 A;  1Q2Q A;  4GB7 A;  4LCM A;  1U60 A;  1W5D A;  4JKT A;  1MWR A;  3WWX A;  2Z2M B;  2BLS A;  3UPO A;  4WEJ A;  4KG6 A;  3ZGA B;  5A91 A;  4EV4 A;  5CEB A;  3UY6 A;  5EE8 A;  5EEC A;  1ONG A;  1H8Z A;  2ZQ9 A;  4JPM A;  4WMC A;  4GD6 A;  4EUZ A;  2EFU A;  5GLB A;  5EVI D;  1K54 A;  1TVF A;  4UAA A;  1FQG A;  4Z9Q A;  4OPZ A;  2XQZ A;  5KZH A;  2VGK A;  4OH0 A;  4OOM A;  1K6S A;  3MKF A;  4IVK A;  4Y0O A;  5EVI A;  5GL9 A;  4LV2 A;  1MKI A;  1MWU A;  2Y4A A;  3G31 A;  5G18 A;  3A3I A;  1I5Q A;  2WGW B;  2HDU A;  2Y2I A;  1FCO A;  4GN2 A;  5HAR A;  1BTL A;  3SS5 A;  4X55 A;  3BFG A;  5A93 A;  5EOO A;  4KG2 A;  2H5S A;  4UA6 A;  1GA9 A;  2J7V A;  5GLD A;  2IWD A;  4IVI A;  5EVI B;  1KE3 A;  3V3S A;  3W4Q A;  4OOY A;  2EXA A;  3BEB A;  1O07 A;  3WS0 A;  4WEK A;  3GRJ A;  3BFF A;  4FD8 A;  3HLF A;  1JWZ A;  2Y2P A;  4X69 A;  3UDI A;  1FCN A;  1RGZ A;  3G4P A;  1G6A A;  3IF6 A;  1FSY A;  1K56 D;  2Y2O A;  3HBR A;  3OCN A;  1PZO A;  1C3B A;  4OQ0 A;  5DF7 A;  4ZAM A;  1GA0 A;  1CI8 A;  4KZA A;  4OPY A;  3UN7 A;  4CJN A;  1M40 A;  1BLC A;  4RYE A;  2V2F F;  1PWC A;  2XEP A;  3MBZ A;  4PM8 A;  1XPB A;  4OON A;  4EBN A;  2XD1 A;  2ZM0 A;  1NRF A;  2ZC3 B;  1BLP A;  3HLG A;  5E43 A;  2C5W B;  1PI4 A;  2XLN A;  1BSG A;  2DNS A;  4BLM A;  1N4O A;  5GHZ A;  5EVL A;  1KDW A;  4UA7 A;  1KDS A;  3DTM A;  3VOZ A;  1HVB A;  1RCJ A;  5FQQ A;  4EWF A;  4JF6 A;  2WKH A;  4Q8I A;  1PYY A;  2ZJ9 A;  5FQJ A;  2PBY A;  4RX2 A;  4X56 A;  2ZLY A;  3AGD A;  4RA7 A;  4YIN A;  4NK3 A;  1YLT A;  1PZP A;  3G30 A;  5CTM A;  1XGI A;  3WS4 A;  2Y2J A;  4JBF A;  2WAE A;  4JXG A;  1IYS A;  2WGW A;  3BRM A;  5HAQ A;  5CGX A;  3IH8 A;  2HDS A;  4KQR A;  4MLL A;  3UPP A;  4PM5 A;  4XUZ A;  3CMZ A;  3LY4 A;  5DF8 A;  1BLS A;  1FR1 A;  2HPB A;  3PBT A;  4WYY A;  1DY6 A;  1K55 A;  4R1G A;  4S2J A;  4KZ9 A;  5CED A;  2DRW A;  2X02 A;  2J9P A;  1YLW A;  2WGV A;  2EFX A;  2X71 A;  3CZD A;  4OOL A;  5TR7 A;  4PMA A;  3FKW A;  3IQA A;  2RCX A;  4BQM A;  4GKU A;  4WM9 A;  2HDQ A;  3MFD A;  2WUQ A;  1ES4 A;  3P09 A;  4U3T A;  1VM1 A;  4UHU A;  4JXS A;  4MBH A;  1E3U D;  2V1Z A;  2XFS A;  2Y59 A;  4RX3 A;  5KSH A;  3ZG5 A;  2OLV A;  4JF5 A;  4B4Z A;  3IF5 A;  3O87 A;  4S2N A;  1H8Y A;  4OQH A;  2HP6 A;  4EQI A;  3WS2 A;  4B88 A;  1KE4 A;  2ZC6 B;  2OSU A;  4JLF A;  2QZ6 A;  4ZJ1 A;  3RJU A;  4DE1 A;  5E2F A;  1RP5 A;  3VP3 A;  3ISG A;  4N9K A;  2ZQA A;  5DTT A;  2ZD8 A;  5DF9 A;  4LV1 A;  5DTK A;  3OCL A;  4KZ3 A;  1YQS A;  1ERM A;  5HAP A;  4E3I A;  3C4P A;  3NBL A;  4P0M A;  2X01 A;  3HVF A;  1OME A;  1KE0 A;  2XR0 A;  4S2K A;  2ZQ7 A;  1KVM A;  4UA9 A;  3PTE A;  3FYZ A;  1JTG A;  4E3L A;  3OZH A;  3HRE A;  3OPH A;  2WKI A;  5FAT A;  5FQ9 A;  4C6Y A;  1K4E A;  5HAI A;  3IWI A;  3UDX A;  2XF3 A;  1ESI A;  2XK1 A;  3UPN A;  2B5R A;  3PBR A;  4OLD A;  1H5X A;  4KQQ A;  5TFQ A;  1ESU A;  5TGF A;  5EOE A;  1NZO A;  4PM6 A;  3Q1F A;  2EXB A;  4DE0 A;  4OVD A;  1LLB A;  4U0T A;  4OQG A;  1GHM A;  1JWP A;  3QNC A;  5CHU A;  3SOI A;  3IXH A;  5FI6 A;  4LEN A;  3SH9 A;  2P9V A;  5FQK A;  4KZ5 A;  3A3D A;  5FDH A;  1TDG A;  4DE2 A;  1I2W A;  3OC2 A;  1K56 A;  3C5A A;  3TG9 A;  1XA7 A;  5CGW A;  3W4P A;  3GQZ A;  1GHI A;  1XKZ A;  3SH7 A;  5L2F A;  1RGY A;  1FSW A;  3O3V A;  3ZVT A;  3ITA A;  1BZA A;  1JWV A;  2OLU A;  2Y2G A;  3GMW A;  4N9L A;  1ZC2 A;  4IED A;  4KZ6 A;  4E6W A;  3Q07 A;  1WYC A;  3NY4 A;  3PBS A;  3NDG A;  1NXY A;  2A49 A;  5GHX A;  1FOF A;  5BOH A;  4OKP A;  1HD8 A;  1N9B A;  4X6T A;  1ONH A;  1KGE A;  1IEL A;  1IKG A;  3PBN A;  4WEL A;  4DXC A;  2H0Y A;  4FSF A;  2P9V B;  3GSG A;  5CRF A;  5E2H A;  1ALQ A;  2Y91 A;  3N8L A;  1KGF A;  3ZG8 B;  5A92 A;  1LHY A;  3O86 A;  1YLP A;  4P85 A;  1K54 C;  4KEN B;  3FV7 A;  4QU3 A;  1G68 A;  1IYQ A;  1PI5 A;  4WZ5 A;  1W79 A;  3DWZ A;  3GV9 A;  3ZG9 B;  4S2N C;  5CTN A;  2WZZ A;  2R9W A;  2ZC7 A;  3E2K A;  3FWL A;  3PAG A;  3SS4 A;  4HES A;  1TEM A;  5FI7 A;  4DRT A;  4HEF A;  1GCE A;  2Z2L B;  1PIO A;  3BFC A;  1L0D A;  3HUM A;  2WKE A;  4GNU A;  4HBT A;  2G2U A;  4R0Q A;  1MY8 A;  1XXM A;  1KVL A;  4QY5 A;  4OQI A;  1M6K A;  2I72 A;  1BLH A;  3G34 A;  3A3E A;  4XUX A;  2H10 A;  1HZO A;  3M2K A;  4QY6 A;  4FH4 A;  2Y2Q A;  4OPQ A;  5F83 A;  5M19 A;  3PAE A;  1L0F A;  4GZB A;  1I2S A;  4N92 A;  5AQ7 A;  4C75 A;  3FKV A;  1SCW A;  4LCL A;  2FFF B;  3ZDJ A;  3ZNY A;  4JXW A;  5HFO A;  4DXB A;  1L2S A;  4PM7 A;  5U47 A;  3VOY A;  4LV0 A;  4R23 A;  5CHJ A;  4JXV A;  3G2Z A;  2WK0 A;  3OPP A;  3RXW A;  2J8Y A;  1GHP A;  3WS5 A;  4C3Q A;  3VMA A;  5HX9 A;  4BD1 A;  3W8K A;  4B4X A;  4S2M A;  5IHV A;  3GR2 A;  3UE0 A;  1W8Y A;  1QMF A;  1XP4 A;  5FI2 A;  5FSR A;  1YMS A;  3LO7 A;  4E3N A;  3C4O A;  4S2P A;  3MZF A;  3UE3 A;  3UDF A;  1ERO A;  3G32 A;  3VFF A;  4KZ8 A;  3NIA A;  3V39 A;  5GLA A;  3AGF A;  1S6R A;  2Y2K A;  3IWQ A;  2ZM2 A;  4O7D A;  3ITB A;  4KG5 A;  3BLS A;  4Y7P A;  3VSL A;  1JTD A;  2PU2 A;  3HLD A;  3C7U A;  4ID4 A;  5HW3 A;  4NET A;  3TOI A;  1DJA A;  3VP1 A;  3WRT A;  3OPL A;  5E2G A;  5I94 A;  4QB8 A;  4F94 A;  1YMX A;  1VQQ A;  3NCK A;  5AQ9 A;  2FFY A;  1Y54 A;  1SHV A;  3DWK A;  2XDM A;  1CK3 A;  1K55 C;  3N7W A;  1O7E A;  3VSK A;  1MPL A;  4E6X A;  1XX2 A;  2A3U A;  4PM9 A;  4H8R A;  2WAD A;  5E2E A;  4E3J A;  4BL3 A;  1PWG A;  2HDR A;  3LY3 A;  5EUA A;  4DE3 A;  4WZ5 C;  1MBL A;  3ZFZ A;  5AQA A;  1LI0 A;  2XD5 A;  3UE1 A;  1E4D A;  4DDS A;  2P74 A;  1YLJ A;  4XXR A;  3EQV A;  4QHC A;  2ZC4 B;  4BL2 A;  2EX9 A;  3ZG7 B;  3ZNT A;  3HLB A;  3MKE A;  5F82 A;  2DCF A;  1SDE A;  2ZQD A;  4M3K A;  5CHM A;  2IWB A;  4KZ4 A;  2QPN A;  3NI9 A;  1PW8 A;  3V3R A;  4WMC D;  1ES2 A;  3IHA A;  2ZM8 A;  3TSG A;  1ERQ A;  3Q7V A;  3V5M A;  1PW1 A;  1Q2P A;  2QMI A;  5HL1 A;  3WS1 A;  1S0W A;  2Y55 A;  3IXB A;  5FAP A;  3Q7Z A;  3WRZ A;  4IBX A;  3HUO A;  3V50 A;  1WYB A;  4KQO A;  4E3M A;  2WGI A;  4R3B A;  1IYP A;  3S1Y A;  3IF6 C;  3BFD A;  3Q7V B;  1L0G A;  4EBL A;  2G2W A;  2Y2L A;  1NJ4 A;  1J9M A;  1AXB A;  2XFT A;  4Y0U A;  4ZJ2 A;  4OP8 A;  2C6W B;  2UWX A;  2VGJ A;  4FH2 A;  4DKI A;  4E3K A;  3IXD A;  1NZU A;  4MEZ A;  3IH9 A;  4A5R A;  3EQU A;  1SDN A;  4S2O A;  5M18 A;  5M1A A;  3PBO A;  5F1F A;  2JCH A;  4MNR A;  4OP5 A;  4MBK A;  5JYO A;  2JC7 A;  1BUL A;  3N8R A;  4R4R A;  1NYM A;  1ES3 A;  3OPR A;  4PPR A;  3S4X A;  3IHB A;  3LEZ A;  1W8Q A;  5FAQ A;  5CEC A;  3D4F A;  2J9O A;  1ZKJ A;  3Q82 A;  3M2J A;  4OPR A;  3MZE A;  4FCF A;  4EBP A;  2ZQ8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...