3O87A

Crystal structure of ampc beta-lactamase in complex with a sulfonamide boronic acid inhibitor
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
358
structure length
351
Chain Sequence
APQQINDIVHRTITPLIEQQKIPGMAVAVIYQGKPYYFTWGYADIAKKQPVTQQTLFELGSVSKTFTGVLGGDAIARGEIKLSDPTTKYWPELTAKQWNGITLLHLATYTAGGLPLQVPDEVKSSSDLLRFYQNWQPAWAPGTQRLYANSSIGLFGALAVKPSGLSFEQAMQTRVFQPLKLNHTWINVPPAEEKNYAWGYREGKAVHVSPGALDAEAYGVKSTIEDMARWVQSNLKPLDINEKTLQQGIQLAQSRYWQTGDMYQGLGWEMLDWPVNPDSIIALAARPVKAITPPTPAVRASWVHKTGATGGFGSYVAFIPEKELGIVMLANKNYPNPARVDAAWQILNALQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Beta-lactamase
publication title Design, Synthesis, Crystal Structures, and Antimicrobial Activity of Sulfonamide Boronic Acids as beta-Lactamase Inhibitors
pubmed doi rcsb
source organism Escherichia coli
total genus 116
structure length 351
sequence length 358
chains with identical sequence B
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2010-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00144 Beta-lactamase Beta-lactamase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 3o87A00
4X6TA 3G4PA 5EVIA 5L2FA 1ONGA 3IXBA 1K56D 4JF5A 4N92A 4PM7A 4S2OA 1ONHA 5E2HA 3IT9A 2VGJA 4MEZA 4S2PA 3UPPA 3NI9A 4JXWA 3BFFA 5DTSA 4O7DA 2RCXA 2R9WA 4B4XA 4DXCA 1L0EA 4OKPA 2ZC5B 4ZJ3A 3MXRA 3ZVWA 2XFSA 4ZJ2A 2WKEA 1YMXA 2P9VB 1WE4A 5CHUA 2P74A 1BT5A 4K91A 4N9LA 5KZHA 1LHYA 4WEJA 1DY6A 1K56A 4KQRA 1PWGA 5FQIA 1U60A 2Y4AA 3SH9A 4DE0A 3VOYA 1FQGA 1KGGA 4NETA 4E3LA 4JBFA 1OMEA 4KZ4A 1HTZA 5HL1A 1GHMA 1MWRA 1PYYA 4IBXA 4BENA 4U0TA 2A49A 1SCWA 3NCKA 4PPRA 5GHYA 2WKHA 2Y2JA 2XF3A 5D3OA 4RX3A 3IF6C 3IH9A 4E3KA 1DJAA 3G34A 1K4FA 3O87A 4GN2A 3UNWA 3SS5A 3ZG8B 1GA9A 5J8XA 4JXGA 5E2GA 3N6IA 1VQQA 3UDIA 2G2UA 3PBRA 5GLCA 4Y0OA 2ZQDA 5TGFA 4DE1A 3M2JA 4GKUA 4ZJ1A 3PBOA 3V5MA 3UE0A 2ZM8A 3NIAA 2ZC3B 3E2LA 4A5RA 3HUNA 5DTTA 3IWIA 1NJ4A 1N9BA 4LCLA 4B4ZA 1L2SA 1NRFA 3C7UA 3AGDA 2Q9NA 1W7FA 3N7WA 1IKIA 5A92A 3VP4A 3HL9A 2X71A 3HLCA 1FOFA 1M6KA 5CGXA 5KSHA 3FYZA 3O3VA 1K57A 1GHIA 3PTEA 2Y59A 5FQKA 5JYPA 1K4EA 1CK3A 1YLYA 1FR6A 3HLFA 3N8RA 3MKEA 3DTMA 2ZM2A 2XD1A 3N8LA 4LV2A 1YLPA 4OPRA 1K55A 1L0GA 1CI9A 2E8IA 2V2FF 1EWZA 2ZC4B 1JTGA 1XGIA 1YLZA 5M18A 1JWVA 2P9VA 3A3EA 3HLDA 3OC2A 5FSRA 1PI4A 3SS4A 1HZOA 1I2WA 1IELA 5E43A 4BL3A 3ZG5A 5FATA 4BQMA 1ESUA 4OOMA 3HUOA 3LO7A 1FCMA 2EXAA 3P98A 1PZPA 5FAOA 3VSLA 4Z9QA 2OSUA 3B3XA 2V1ZA 4R3BA 2Y2KA 3IXHA 3ISGA 4X68A 3GVBA 2ZQ7A 1CEFA 3BM6A 4IBRA 4LV3A 3RXXA 2ZM0A 4FSFA 3WS4A 3FV7A 3JYIA 5CERA 4N1HA 4ZAMA 2WGIA 4IVKA 3IF5A 1YM1A 4QB8A 5HFOA 2Z2MB 2Y2OA 3IWQA 4ZBEA 4OLGA 1E3UD 3S22A 2VGKA 5HW3A 1S6RA 2QMIA 5EE8A 4KZ8A 2OV5A 5HAQA 4QJGA 1NXYA 3Q07A 4HEFA 4KZ7A 4OLDA 4JF4A 1E4DA 1K38A 1MWUA 3Q81A 5AQ7A 1XKZA 3A3IA 5FI7A 4S2MA 3V3SA 1ES5A 5EVID 1ZKJA 5IHVA 1TDGA 1IYSA 1L0DA 3QNBA 4Y0TA 5GL9A 5HARA 3VFHA 3BLSA 1MPLA 5HAIA 1YQSA 5CHMA 1JWPA 4OPQA 4KQQA 3LCEA 4L0LA 4LV0A 3CZDA 1XPBA 5E2EA 4EUZA 2Z2LB 4FD8A 4N1XA 4P6BA 4KZ5A 5HAPA 1XA7A 4UA6A 1IKGA 5CGWA 1BZAA 4GD8A 2XGNA 3Q1FA 2HDUA 2ZLYA 1WYBA 2JE5A 3BEBA 3ZNTA 3FKVA 1TDLA 1NZUA 4S2JA 3MZFA 4GZBA 4KENB 2ZQAA 3UY6A 4IVIA 1IYOA 1PZOA 2J8YA 4RA7A 2FFFB 3PBQA 4XUXA 1YLTA 1LI9A 1QMFA 3PBTA 4PM9A 3G30A 5F1GA 5EECA 5G18A 4NK3A 3VP0A 1G68A 3A3FA 1NZOA 3QNCA 2G2WA 1NYYA 5FI2A 2DRWA 1NY0A 2WZXA 5FQMA 4U3TA 4CJNA 4UAAA 2IWDA 3M6HA 4WZ4A 4X69A 5CEDA 3FWLA 1KDWA 5AQBA 3A3DA 2X02A 2ZC7A 1JTDA 1K6SA 3ZDJA 4BD1A 1JWZA 4OOYA 1SDNA 2XR0A 3IXGA 1RGZA 5GLBA 4QY5A 1KVLA 4U0XA 4WZ5A 4FH2A 2EFUA 4P0MA 1BTLA 1EI5A 1M40A 2EX6A 3LY3A 3QHYA 3IF6B 4OQHA 1BLPA 5FQQA 5KSCA 2JC7A 3OPLA 4S2KA 2ZJ9A 1KVMA 4OPZA 3C7VA 1LI0A 4BD0A 3SOIA 4FH4A 3FZCA 2V20A 2BG1A 4DE3A 3WS5A 4GNUA 4XUZA 2H10A 4LV1A 3ZVTA 4R4RA 3WS0A 3NDEA 3VP1A 4M3KA 5DTKA 1BULA 1GA0A 1LL9A 2JCHA 2Y91A 4K0XA 5GLDA 1VM1A 2QPNA 2BLSA 2ZMAA 2J9OA 2PU2A 4WMCA 3PAEA 4S2NC 1NYMA 1SKFA 2Y2LA 5FASA 4DDSA 4OONA 1YMSA 3MZEA 5A91A 1HD8A 1KGEA 1PW8A 4JPMA 3Q7VB 2XDMA 1PW1A 1W79A 3VOZA 4PMAA 3BFEA 3IQAA 2I72A 4OQGA 4Q8IA 4RYEA 1MKIA 3C4OA 3C4PA 3LY4A 4RVAA 3EQVA 4YINA 5CRFA 3IWOA 3W4PA 1IEMA 5TFQA 1ERQA 1GHPA 2XQZA 3OZHA 4R1GA 3NC8A 1YT4A 1XP4A 4DKIA 2H0YA 1KDSA 3GQZA 1XX2A 4GDNA 4R0QA 4XXRA 2Y2PA 1K6RA 5EOOA 1K54C 2HP9A 1Q2QA 2EX2A 5CTNA 5F1FA 4MLLA 2EX9A 3S4XA 3DW0A 5CECA 1RGYA 2ZQCA 5FQ9A 5FQJA 4E3OA 2XFTA 4HBTA 4EBNA 3IF6A 3HUMA 2J9PA 1C3BA 1G6AA 1FCNA 1W8YA 3DWKA 4GOGA 4KG2A 1H8ZA 5CXWA 3GRJA 3BRMA 2HP6A 3GV9A 4DF6A 3GMWA 5EVIC 3WRZA 3UPNA 4MBKA 3BFCA 4EBLA 3G35A 2Y2GA 5EVLA 1CEGA 3AGFA 1DJBA 4E6WA 3MKFA 1KGFA 3VP3A 2Y2NA 1N4OA 2B5RA 1K25A 4Y7PA 2RL3A 4E6XA 4RX2A 4OP5A 3UDXA 5AQ9A 3FKWA 3OCNA 1BSGA 3BLMA 1XA1A 3UN7A 4D2OA 4MBFA 3BYDA 4HBUA 1KE0A 5TR7A 3W8KA 4HESA 3TG9A 3PBNA 4JLFA 1SHVA 5CTMA 2WZZA 1ES4A 1LL5A 5U47A 3Q7VA 5DF9A 1GCEA 1CI8A 1L0FA 3GTCA 1AXBA 1RP5A 1PWDA 2JBFA 2XLNA 3CMZA 3NDGA 4UHUA 2ZQ9A 3SS3A 4OVDA 1ZC2A 3G2YA 1XXMA 2Y55A 4KZ6A 3ZFZA 5M19A 5A93A 2C5WB 2Y2QA 3ITAA 3E2KA 5EUAA 4S2IA 1H5XA 2Y2HA 4E3IA 1KE4A 4JXVA 3OPRA 4ZTKA 2ZD8A 3WWXA 3NY4A 1TEMA 3VSKA 3VMAA 2UWXA 3GSGA 3ZG7B 5GHZA 3CJMA 3G31A 4OOLA 4JF6A 4DRTA 2XD5A 4KZ3A 4JXSA 2X01A 3HLEA 3UPOA 4QHCA 2DCFA 3N8SA 3UE1A 1ESIA 4EQIA 3D4FA 3IXDA 3ZHHA 1BUEA 2ZC6B 3EQUA 4P85A 1EROA 1W5DA 2OLUA 5M1AA 2IWBA 3W4QA 1PIOA 4Y0UA 4E3MA 3MFDA 4MBHA 3WS1A 1ERMA 1K57C 1KE3A 5F82A 4BL2A 2J7VA 1H8YA 4QU3A 4WMCD 5GLAA 4PM5A 3UE3A 3ZGAB 3G32A 4QD4A 1FSYA 1LLBA 4N9KA 4GD6A 2GDNA 2Q9MA 1K55C 2FFYA 1ZG4A 4QY6A 2EXBA 2WGWB 2H5SA 3RJUA 3MXSA 3UO9A 4K0WA 5CEBA 2Y2MA 2PBYA 2HDQA 1PWCA 3ZG0A 5BOHA 2A3UA 1PI5A 4OQ0A 4EWFA 4LCMA 1Z6FA 2DNSA 4CPKA 3BFGA 1YLWA 4KQOA 3VP2A 1MY8A 3ITBA 3BFDA 3G2ZA 4S2LA 3I7JA 4X53A 4UA7A 5GHXA 4C6YA 4E3NA 5CGSA 3BECA 5DF7A 2OLVA 3IH8A 5EPHA 4WELA 4FCFA 5DF8A 5CHJA 3V3RA 4B88A 4JKTA 4ZDXA 2C6WB 4LENA 2R9XA 4H8RA 3DWZA 3SH7A 3P09A 1Q2PA 2WADA 2XK1A 2CC1A 4KG6A 4PM6A 2EFXA 3ZNYA 1I2SA 1FSWA 3HLWA 1MWTA 4P87A 3W4OA 5KMWA 3PBSA 4WBGA 5E2FA 4WEKA 5FA7A 3WS2A 1BLSA 1IYPA 1JVJA 3HLGA 2XEPA 3HBRA 3M2KA 4OH0A 4MNRA 2Y2IA 3SH8A 3IHBA 4UA9A 3UDFA 2IWCA 1I5QA 1O7EA 3MBZA 1FR1A 3RXWA 5FAQA 5EVIB 1SDEA 3Q82A 1ES2A 1ES3A 4DDYA 2QZ6A 1MWSA 3NBLA 4EV4A 1TVFA 4ID4A 2HDSA 1WYCA 2EX8A 4YFMA 3TOIA 3V39A 2H0TA 1FCOA 2XH9A 4KZBA 4F94A 2HP5A 3MZDA 2WGWA 1ALQA 2WUQA 5I94A 4OP8A 5AQAA 3VFFA 3OPHA 4C3QA 4GDBA 5EOEA 4S2NA 3S1YA 1BLCA 1HVBA 4C75A 3GR2A 3HLBA 5A90A 3HREA 2WYXA 4E3JA 4IEDA 1QMEA 4DE2A 1O07A 4KG5A 1MXOA 3HVFA 5F83A 5JYOA 3ZCZA 4BJPA 4R4SA 3IHAA 4GB7A 2WAEA 4EBPA 1Y54A 1W8QA 3OPPA 3Q7ZA 4KZ9A 3N4IA 4WM9A 2WK0A 3OCLA 4KZAA 3AGEA 4BLMA 1YLJA 4WZ5C 5FI6A 3A3JA 3M6BA 1DJCA 3C5AA 2WKIA 1J9MA 4R3JA 2WGVA 3CG5A 3O88A 5HX9A 2HPBA 4WYYA 5FDHA 2WAFA 3PAGA 4X56A 3WRTA 3O86A 2HDRA 1K54A 3V50A 1MBLA 5FAPA 1ZG6A 1XGJA 5DVAA 1BLHA 1RCJA 2PU4A 3LEZA 4X55A 3ZG9B 1E3UA 4DXBA 1E25A 4OPYA 4PM8A 1S0WA 2ZQ8A 4R23A 1IYQA 3TSGA 4OQIA
chains in the Genus database with same CATH superfamily
2YKHA 2EWVA 4D60A 3IXBA 3D9YA 2UV0E 5DKKA 3QP6A 3E4QA 4S2PA 2VV7A 3NI9A 4YOFA 2RCXA 2R9WA 3K3DA 3MXRA 3MQOA 3T1QB 3KYQA 4K91A 1A0KA 1LHYA 1K56A 5FQIA 2HZ5A 4YNRA 2V8CA 3JPUA 3DTIA 3UB9A 1IOUA 4GLQA 1MWRA 4LFUA 2J3TD 1S4RA 2P7JA 4PPRA 3S7NA 2V8FA 3IH9A 1UWNX 2JKFA 2M1CA 4F3LA 3UNWA 3ZG8B 4L9EA 5E2GA 3N6IA 4Z1WA 3UDIA 4DE1A 4GKUA 1G5UA 2ZC3B 3E2LA 3HUNA 4B4ZA 3C7UA 3N7WA 3HL9A 1FOFA 1S66L 3O3VA 1F5MA 1FR6A 1CF0A 3N8RA 2XRNA 2W3EA 4OPRA 1K55A 1OTBA 2V2FF 1EWZA 1XGIA 3A3EA 5C5KA 1PI4A 1HZOA 1IELA 5IU1A 3S7OA 5E43A 3NJAA 3ZG5A 4BQMA 4OOMA 5FAOA 1PZPA 2Y2KA 3ISGA 3GVBA 2ZQ7A 3BM6A 3WS4A 2PR5A 4FSFA 4IVKA 4QB8A 5HFOA 5L09A 3S22A 1S6RA 2OV5A 5HAQA 4HEFA 4JF4A 1MWUA 3Q81A 4NXGA 1XKZA 5FI7A 4CQHA 3V3SA 5EVID 1YSPA 4EERA 4Y0TA 1DP9A 4EUZA 1XPBA 5E2EA 4JGPA 3T4OA 1KOUA 4NXBA 1WA9A 3CUEC 5CGWA 4E04A 3NOTC 2GNXA 3BEBA 3ZNTA 1NZUA 4S2JA 4KENB 2ZQAA 3GECA 1YLTA 1QMFA 3PBTA 5F1GA 3G30A 1P97A 1UGUA 2G2WA 1NYYA 2PT7A 2WZXA 4U3TA 2K7SA 3LR4A 1KDWA 2B18A 1K6SA 1JWZA 4OOYA 2PD8A 1KVLA 4WZ5A 4P0MA 1BTLA 1EI5A 5FQQA 4S2KA 1KVMA 4OPZA 3FZCA 4GNUA 4LV1A 3C30A 4M3KA 5DTKA 3A0SA 2QPNA 4S2NC 1SKFA 4DDSA 4OONA 2K2NA 1JNUA 1HD8A 3K2NA 4JPMA 2XDMA 2FZ0A 3VOZA 4Q8IA 1MKIA 3C4OA 3VOLA 5TFQA 3NOPC 1YT4A 2J3WA 1XX2A 2G7UA 5EOOA 2HP9A 2JKTI 1UWPX 2EX9A 3FPVA 2ZQCA 5FQ9A 4E3OA 2XFTA 4HBTA 4I3AA 3HUMA 2J9PA 1G6AA 5CXWA 3GRJA 3GV9A 4MBKA 3G35A 2VLGA 4E6WA 4XT2B 3VP3A 2Z6DA 2VV8A 4LLOB 2B5RA 4OP5A 3A0VA 3UDXA 1G28A 1GSVA 1BSGA 3BLMA 2DMWA 3UN7A 4D2OA 3BJNA 4MBFA 1KE0A 4HESA 4JLFA 5CTMA 1LL5A 2OAQ1 2O9CA 5U47A 1GCEA 3GTCA 1RP5A 2XA7M 1ZC2A 3MMHA 5M19A 2C5WB 5EUAA 4R38A 4JXVA 1T1BA 2GZAA 3T4QA 5GHZA 3CJMA 2J80A 4JF6A 4KZ3A 4PHTA 3UPOA 4JGRA 2L4RA 3UE1A 4EQIA 2Y8HA 1BUEA 1G6OA 3EQUA 2OLUA 3W4QA 4E3MA 5L8MA 1ERMA 1KE3A 4XT2A 3EWKA 1H8YA 4QU3A 4GW9A 3G32A 4QD4A 4N9KA 4GD6A 2GDNA 2INWA 2FFYA 1ZG4A 2EXBA 2H5SA 1F98A 3MXSA 4K0WA 2PBDP 2Y2MA 4BWIA 3DTKA 1LT0A 4OQ0A 3C38A 2HJ9C 3TJZC 1YLWA 4UA7A 4E3NA 3BECA 4I38A 3V3RA 3T4LA 3LIAA 4ETZA 1VEUB 2R9XA 1S1YA 3P09A 4Q0HA 4KG6A 3ZNYA 3BY9A 4CLCC 1IYPA 2JKTM 5FEGA 2XEPA 3M2KA 2VKSA 3IBRA 1O7EA 5FAQA 1SDEA 3E4PA 1ES2A 1MWSA 2HDSA 2EX8A 4HH2A 4BBVA 2PAVP 4F94A 3CLOA 4S2NA 1HVBA 4C75A 5F5YA 3VE3A 3LIEA 2WAEA 1LSXA 3OPPA 3N4IA 4WM9A 3M6BA 1IFQA 2KLIA 1VEUA 3CG5A 3WRTA 4M4XA 1BYWA 3LR0A 3V50A 3K3CA 5FAPA 4Y13A 1DP6A 1ZG6A 5DVAA 1RCJA 2PU4A 5KIZA 3ZG9B 1E3UA 4OPYA 2PYRA 4JGQA 1S4SA 4EESA 3TSGA 1ONGA 1K56D 4JF5A 1ONHA 4JXWA 4O7DA 4DXCA 4B4XA 4O8GA 1WE4A 5CHUA 4N9LA 1U60A 2Y4AA 3T12B 2JHEA 1OMEA 5F69A 4KZ4A 1HTZA 5HL1A 1PYYA 3BQ8A 2XF3A 5D3OA 4RX3A 3IF6C 1K4FA 3NOUC 4EEUA 5J8XA 1P0ZA 3PBRA 2ZQDA 5EFWA 2OOLA 3PBOA 3V5MA 4CLCB 5DTTA 1NJ4A 4LCLA 1NRFA 4LGWA 2Q9NA 1P9RA 1W7FA 1IKIA 3T1RA 5CX7A 5KSHA 3UB7A 3KSFA 1GHIA 2VEAA 1K4EA 1YLYA 2YKFA 3MKEA 2XROA 2M7UA 1L0GA 2ZC4B 1JTGA 1JWVA 3HLDA 3SS4A 2VZWA 1ESUA 5HDSA 2EXAA 3P98A 2Y79A 3LUQA 3VSLA 2QHKA 4HJ3A 1YPRA 4EEPA 3ULFA 2Z6CA 4N1HA 3IF5A 1YM1A 2Z2MB 2Y2OA 3IWQA 4JGOA 4OLGA 5HW3A 5EE8A 3LEQA 4OLDA 3KYEA 1E4DA 5AQ7A 4R70A 4S2MA 1ES5A 5IHVA 1TDGA 1IYSA 2OWJA 4CLCA 5GL9A 1SKOB 4LRXC 4EW7A 3VFHA 1MPLA 5F68A 4OPQA 4KQQA 4L0LA 4G3KA 2Z2LB 4FD8A 2PRFA 5HAPA 1XA7A 2JKGA 4KUOA 4GD8A 3Q1FA 1P9WA 3FKVA 1AWIA 1T18A 4IVIA 1IYOA 4RA7A 3PBQA 3NULA 5G18A 1LI9A 3RXWA 3LI8A 3R4KA 3VP0A 1NZOA 5HL6A 1FILA 1TS0A 3FC7A 5FQMA 4CJNA 5IS1A 5G4YA 3CI6A 3U4LP 2X02A 1V9ZA 1GSWA 2FH5A 1RGZA 2QKPA 3QHYA 3IF6B 1Y4OA 4HHDA 1BLPA 3OPLA 4ESPA 2ZJ9A 3SOIA 2ZMFA 2BG1A 2H10A 1SKOA 4R4RA 3VP1A 1NRJA 4K0XA 1NYMA 4DJ2A 1KGEA 1PW8A 4ZRRA 3Q7VB 3BFEA 5LBRA 2I72A 2BTFP 4FUWA 3C4PA 5TJJA 3TE8A 3PYPA 1IEMA 3SW1A 4L9FA 4R1GA 3LR3A 2H0YA 4UEYA 4R0QA 4HP4A 1Q2QA 5HPFA 4MLLA 5CECA 1RGYA 5FQJA 3IF6A 4WN5A 3OBFA 4GOGA 2L1MA 4DF6A 5EVIC 3UPNA 2Y2GA 3AGFA 4AFIA 3MKFA 2Y2NA 2EWWA 2RL3A 4RX2A 1XJ3A 5AQ9A 1XA1A 5FL3A 5TR7A 3TG9A 4Y3IA 1TS8A 4HNBA 3Q7VA 5DF9A 1CI8A 3E0YA 4MN5A 2JBFA 2XLNA 2PYPA 4OVDA 1X0OA 3ITAA 5J7EA 1LSWA 3B33A 3LFVA 4S2IA 2ZD8A 3DBAA 3WWXA 3VSKA 2UWXA 3ZG7B 3OLOA 4OOLA 1W63M 2LB9A 3N8SA 3IXDA 5HD3A 1W5DA 4O0PA 1PIOA 3UE6A 4Y0UA 1OTIA 4IHQA 3WS1A 4BL2A 1K57C 4WMCD 2O99A 3UE3A 1H0MA 1OTAA 1FSYA 1LLBA 3KSGA 2WGWB 2V9AA 1TS7A 2B02A 1F9IA 4I5SA 4I3JA 3OOVA 5EV0A 3E98A 3ZG0A 4Y15A 4EWFA 4LRZE 1J3WA 1Z6FA 3BFGA 1MY8A 3ITBA 4IUKA 5HZHA 5GHXA 4C6YA 5EPHA 2VX8A 4FCFA 4B88A 4P6ZM 4ZDXA 1ACFA 4H8RA 2A24B 4PM6A 2XK1A 2CC1A 3LICA 1FSWA 3HLWA 1MWTA 4P87A 3UB8A 3W4OA 5E2FA 4WEKA 4B93A 5HWVA 3UMDA 1CJFA 4X1LA 4B9OA 4MNRA 3SH8A 3T4JA 3IHBA 4UA9A 2IWCA 3LR5A 4GS9B 5EVIB 4R6LA 3Q82A 1STZA 5DJUA 1N9LA 4DDYA 4EV4A 4QPRA 3H82B 3G6OA 4YFMA 1FCOA 3MZDA 2WGWA 5AQAA 5MC7A 4GDBA 3HLBA 4E3JA 2WYXA 3H9WA 3LIFA 3EOIA 5JYOA 3ZCZA 2VK3A 4R4SA 3IHAA 3MS6A 1Y54A 3Q7ZA 2WK0A 1YLJA 5HDCA 1DJCA 4NEED 3W2ZA 4Y17A 3TW8A 4WYYA 2WAFA 2A24A 4X56A 3O86A 5HD5A 5EVEA 1MBLA 1NLYA 1E25A 4QHCA 4GS9A 5EVIA 1HLUP 2JN7A 4N92A 4ARZB 5E2HA 2P08A 3H82A 1L0EA 2ZC5B 4ZJ3A 1MKMA 2XFSA 4ZJ2A 1YMXA 5KZHA 4WEJA 3ZQ5A 4KUKA 2MJ6A 3VOYA 2HGVA 3C8CA 2ZOHA 4BMWA 1GHMA 4IBXA 4BENA 4U0TA 2A49A 2P04A 3NCKA 2Y2JA 3KYZA 3SZTA 1DJAA 3O87A 1H3QA 1VQQA 2G2UA 4Y0OA 2GX5A 5TGFA 2E8JA 4MCWA 3UE0A 4FTXA 2ZM8A 4A5RA 1N9BA 1L2SA 2I9VA 2PHYA 1OT9A 3VP4A 2X71A 3HLCA 1K57A 4ARZA 2Y59A 5FQKA 5JYPA 1YKDA 1CK3A 3HLFA 3S7QA 3DTMA 4LV2A 4WL9A 1CI9A 3EEAA 1YLZA 3OC2A 5FSRA 1I2WA 3U2AA 3BW6A 5FATA 1T19A 3MSHA 4Z9QA 2OSUA 3B3XA 2Q0OA 3IXHA 2NUPC 1CEFA 4IBRA 4LV3A 3LI9A 5CERA 3F1NB 3ICYA 3LIBA 3GDIA 4Y2FA 4NG2A 2VGKA 2QMIA 4KZ8A 1TF1A 4QJGA 3Q07A 3IS2B 3RH8B 1K38A 3PR6A 1OT6A 1YQSA 1JWPA 2WKPA 3T1XA 4UA6A 2ZLYA 1WYBA 2JE5A 3MZFA 4KQDA 3UY6A 1LSVA 4PM9A 1G68A 1TS6A 3A3FA 2NUTC 3T50A 3QNCA 1OJGA 5FI2A 2DRWA 4EETB 2IWDA 3M6HA 4P6ZS 4X69A 5CEDA 2HV1A 4GCZA 1D7EA 2AVXA 2ZC7A 1JTDA 5EM1A 1SDNA 4ETXA 3IXGA 2XSSA 1CQAA 2VGLS 3F1NA 4QY5A 4U0XA 4FH2A 2EFUA 4Q0JA 4OQHA 1M40A 2EX6A 3CHWP 2JC7A 3KSIA 2H28A 3BQAA 1NWZA 3LGOA 3IS2A 1GSXA 3C7VA 3KSHA 4FH4A 3MR0A 4WUJA 4BBTA 3MFXA 3S7PA 4XUZA 4GJ4A 3ZVTA 3WS0A 2JCHA 2Y91A 1VM1A 2ZMAA 2J9OA 5FASA 3IBJA 3KO6A 1YMSA 3CITA 2W0NA 5A91A 2WKRA 1W79A 4PMAA 2PDRA 1W63Q 3HJKA 3T4KA 1FIKA 1YAXA 1SZVA 4RYEA 1S67L 4RVAA 3EQVA 3VE4A 5CRFA 3W4PA 4DN0A 1ERQA 1GHPA 3FG8A 1L3LA 3OZHA 3MQQA 3NC8A 3GQZA 4GDNA 2IA2A 1K6RA 2Y2PA 1DP8A 2EX2A 5CTNA 4BBUA 4MDZA 3S4XA 3DW0A 4PKYG 2VJWA 4EBNA 1C3BA 3L9KA 1FCNA 4KG2A 1H8ZA 4X25A 2HP6A 3GMWA 3BFCA 5EVLA 1DJBA 4PKYA 1ZHHB 4LRYC 1K25A 4Y7PA 1XJ6A 2W3HA 3FKWA 3CWFA 4HBUA 3W8KA 4WF0A 2GJ3A 2W27A 1L0FA 3NDGA 1OJ5A 4UHUA 2ZQ9A 3H7WB 2V0UA 1XXMA 2O9AA 1XFNA 3ZFZA 3ZYTA 5A93A 2Y2QA 3E2KA 1H5XA 1T1AA 4E3IA 2D02A 4ZTKA 3NY4A 1TEMA 3VMAA 2QWSA 3CPTB 2R78A 4JXSA 2X01A 3HLEA 2J3TC 1MC0A 2ZC6B 4P85A 1EROA 4PAUA 5M1AA 3MFDA 4MBHA 3HJIA 5F82A 2J7VA 5GLAA 1D1JA 3LIDA 3B42A 4NXEA 1OPXA 3QP5A 2JKRM 3UO9A 2PBYA 1PWCA 1XFQA 5J3WA 5BOHA 4LCMA 3NECA 3H7WA 4L9GA 5HSQA 4KQOA 4EXOA 3G2ZA 4X53A 3DTEA 2WKQA 5DF7A 2OLVA 5DF8A 5CHJA 4JKTA 2LB5A 3UMEA 3CPTA 3DWZA 3SH7A 1Q2PA 2WADA 2EFXA 5KMWA 3PBSA 4WBGA 3WS2A 1BLSA 4H6JB 1JVJA 3HBRA 2Y2IA 3UDFA 3LYXA 1I5QA 4RQ9A 4X1MA 1FR1A 1ES3A 3NBLA 4ID4A 4R3AA 1WYCA 4UQIS 3V39A 5DJTA 4IUHA 5I94A 3VFFA 4HJ4A 3OPHA 4C3QA 5EOEA 4EUVA 3S1YA 1BLCA 3GR2A 4ME4A 3HREA 4IEDA 5I5LA 2HJEA 3R7WB 4HY8A 1O07A 3HVFA 5F83A 4O01A 4EQ1A 1W8QA 4KZ9A 1OTDA 4KZAA 3AGEA 4BLMA 5FI6A 3A3JA 3MJQA 3C5AA 1T1CA 1J9MA 2WGVA 5HX9A 4NXFA 4G3WA 3PAGA 3DAVA 5G4ZA 1VETB 2KOIA 2M7VA 4H6JA 3LEZA 4X55A 1S0WA 2ZQ8A 1N9OA 4X6TA 3G4PA 5L2FA 5HWTA 4PM7A 4S2OA 3IT9A 2VGJA 4MEZA 3UPPA 3BFFA 5DTSA 4OKPA 3ZVWA 4DMZA 2WKEA 2HF6A 2P9VB 2P74A 1BT5A 4HI4A 5HWWA 1DY6A 3R7WA 2V1BA 1PWGA 4KQRA 3SH9A 4DE0A 1FQGA 5FDSA 1KGGA 4NETA 1PFLA 4E3LA 4JBFA 1V9YA 3D3OA 1SCWA 5GHYA 2QJ5A 2WKHA 1VB6A 5AJGA 4E3KA 3G34A 4GN2A 2W1RA 3SS5A 1GA9A 4JXGA 1VETA 1Y28A 3IX4A 5TBMB 5GLCA 3HCYA 3M2JA 4ZJ1A 3NIAA 2OWHA 3IWIA 3P7NA 2VGLM 3AGDA 5A92A 1M6KA 4HH3A 5CGXA 3FYZA 2ZOIA 5FEFA 3PTEA 5AVFA 3MF0A 3F1OB 2QYBA 1TD5A 2ZM2A 2XD1A 3N8LA 1YLPA 4WLAA 2E8IA 5M18A 2P9VA 1NLZA 1VHMA 4BL3A 2BASA 4EU0A 3HUOA 3LO7A 1FCMA 2B95A 3L7HA 2V1ZA 4R3BA 4X68A 3RXXA 2ZM0A 3FV7A 3JYIA 4ZAMA 2WGIA 3O5YA 2CMNA 1N9NA 4ZBEA 1E3UD 4I39A 1NXYA 4KZ7A 5TBMA 4K08A 3A3IA 2VV6A 5J4EA 1ZKJA 1L0DA 3QNBA 4QWOA 2V0WA 5HARA 3BLSA 5HAIA 2W3DA 5CHMA 3LCEA 4LV0A 3CZDA 4N1XA 4P6BA 4KZ5A 4IJGA 1IKGA 1BZAA 2XGNA 2HDUA 3F1OA 5A8BA 5DFXA 1TDLA 4GZBA 1PZOA 2J8YA 2PD7A 2FFFB 4XUXA 3T4SA 5EECA 4NK3A 2A2LA 4HP9A 3NHQA 4MN7A 2D01A 3EEHA 1NY0A 3F1PB 4UAAA 4WZ4A 3E4OA 3FWLA 5AQBA 3VV4A 3A3DA 3ZDJA 4BD1A 3A0RA 2XR0A 5GLBA 4YWZA 2KX6A 3CAXA 3LY3A 1H8MA 2EA9A 5K5BA 5KSCA 4HQAA 1LI0A 4BD0A 2V20A 4DE3A 3WS5A 1MZUA 3NDEA 1BULA 1GA0A 1LL9A 3CUEA 3PHYA 5L07A 3EGDC 5GLDA 3KX0X 2BLSA 4MMNA 2PU2A 4WMCA 3PAEA 1F2KA 2Y2LA 3MZEA 1PW1A 1K0KA 3IQAA 4OQGA 1XJ4A 3LY4A 5AVEA 4YINA 3IWOA 4NKPA 2XQZA 3F1PA 1OTEA 4II7A 1XP4A 4DKIA 1KDSA 4XXRA 1K54C 5F1FA 3TRCA 4CLCD 4HJ6A 1W8YA 3DWKA 3BRMA 3WRZA 2W3GA 4EBLA 1Z09A 1CEGA 1LL8A 1KGFA 1N4OA 4E6XA 4FOFA 3OCNA 5DFYA 3BYDA 3PBNA 3JVVA 1SHVA 2WZZA 1ES4A 1D06A 1AXBA 3RFBA 1PWDA 3CMZA 3SS3A 2W1TB 2ZBBA 2KDKA 4UQIM 3G2YA 2Y55A 4KZ6A 1EW0A 2K31A 2QJ7A 2Y2HA 1KE4A 3OPRA 2O9BA 5HPIA 3GSGA 2ZMVA 3G31A 4DRTA 2XD5A 3BWLA 2DCFA 1ESIA 3D4FA 3ZHHA 1ODVA 2IWBA 4HOIA 4GHIB 4PM5A 3ZGAB 3C2WA 4DJ3A 3QP2A 3IX8A 3IX3A 3QP1A 2Q9MA 3FPWA 1K55C 3EGXC 4QY6A 3RJUA 2ZL1B 3PXPA 5CEBA 2JKRI 2HDQA 2A3UA 1PI5A 1XJ2A 5F6AA 2DNSA 5L10A 2ACGA 2W1TA 4CPKA 1S1ZA 3T1SA 2PR6A 3VP2A 3BFDA 1DRMA 4S2LA 3I7JA 4Q0IA 4CLCE 5CGSA 1PNEA 3IH8A 4MN6A 4WELA 2L0WA 3QP8A 5DKLA 2C6WB 4LENA 2V1AA 3BY8A 1I2SA 5FA7A 3HLGA 4OH0A 3V67A 3T4TA 3RTYA 3MBZA 3D72A 4GHIA 2VA0A 3UB6A 2QZ6A 5IT5A 4G3VA 1TVFA 3MXQA 4I3IA 2XA7S 3TOIA 2H0TA 2XH9A 4KZBA 2HP5A 1ALQA 2WUQA 2ZL1A 4OP8A 4HIAA 1ZTUA 2O0YA 5A90A 2W3FA 1QMEA 4DE2A 1YSQA 4KG5A 1MXOA 5EM0A 3JVUA 4BJPA 4GB7A 4EBPA 3OCLA 4WZ5C 3UB5P 2WKIA 4R3JA 3O88A 2HPBA 5HDDA 5FDHA 3B47A 4F3LB 2HDRA 1K54A 3P01A 4Y5FA 4LPZA 3QP4A 1XGJA 1BLHA 4DXBA 4PM8A 4R23A 1IYQA 3MQ0A 2OAP1 1PRQA 4OQIA
chains in the Genus database with same CATH topology
4X6TA 3G4PA 5EVIA 5L2FA 1ONGA 3IXBA 1K56D 4JF5A 4N92A 4PM7A 4S2OA 1ONHA 5E2HA 3IT9A 2VGJA 4MEZA 4S2PA 3UPPA 3NI9A 4JXWA 3BFFA 5DTSA 4O7DA 2RCXA 2R9WA 4B4XA 4DXCA 1L0EA 4OKPA 2ZC5B 4ZJ3A 3MXRA 3ZVWA 2XFSA 4ZJ2A 2WKEA 1YMXA 2P9VB 1WE4A 5CHUA 2P74A 1BT5A 4K91A 4N9LA 5KZHA 1LHYA 4WEJA 1DY6A 1K56A 4KQRA 1PWGA 5FQIA 1U60A 2Y4AA 3SH9A 4DE0A 3VOYA 1FQGA 1KGGA 4NETA 4E3LA 4JBFA 1OMEA 4KZ4A 1HTZA 5HL1A 1GHMA 1MWRA 1PYYA 4IBXA 4BENA 4U0TA 2A49A 1SCWA 3NCKA 4PPRA 5GHYA 2WKHA 2Y2JA 2XF3A 5D3OA 4RX3A 3IF6C 3IH9A 4E3KA 1DJAA 3G34A 1K4FA 3O87A 4GN2A 3UNWA 3SS5A 3ZG8B 1GA9A 5J8XA 4JXGA 5E2GA 3N6IA 1VQQA 3UDIA 2G2UA 3PBRA 5GLCA 4Y0OA 2ZQDA 5TGFA 4DE1A 3M2JA 4GKUA 4ZJ1A 3PBOA 3V5MA 3UE0A 2ZM8A 3NIAA 2ZC3B 3E2LA 4A5RA 3HUNA 5DTTA 3IWIA 1NJ4A 1N9BA 4LCLA 4B4ZA 1L2SA 1NRFA 3C7UA 3AGDA 2Q9NA 1W7FA 3N7WA 1IKIA 5A92A 3VP4A 3HL9A 2X71A 3HLCA 1FOFA 1M6KA 5CGXA 5KSHA 3FYZA 3O3VA 1K57A 1GHIA 3PTEA 2Y59A 5FQKA 5JYPA 1K4EA 1CK3A 1YLYA 1FR6A 3HLFA 3N8RA 3MKEA 3DTMA 2ZM2A 2XD1A 3N8LA 4LV2A 1YLPA 4OPRA 1K55A 1L0GA 1CI9A 2E8IA 2V2FF 1EWZA 2ZC4B 1JTGA 1XGIA 1YLZA 5M18A 1JWVA 2P9VA 3A3EA 3HLDA 3OC2A 5FSRA 1PI4A 3SS4A 1HZOA 1I2WA 1IELA 5E43A 4BL3A 3ZG5A 5FATA 4BQMA 1ESUA 4OOMA 3HUOA 3LO7A 1FCMA 2EXAA 3P98A 1PZPA 5FAOA 3VSLA 4Z9QA 2OSUA 3B3XA 2V1ZA 4R3BA 2Y2KA 3IXHA 3ISGA 4X68A 3GVBA 2ZQ7A 1CEFA 3BM6A 4IBRA 4LV3A 3RXXA 2ZM0A 4FSFA 3WS4A 3FV7A 3JYIA 5CERA 4N1HA 4ZAMA 2WGIA 4IVKA 3IF5A 1YM1A 4QB8A 5HFOA 2Z2MB 2Y2OA 3IWQA 4ZBEA 4OLGA 1E3UD 3S22A 2VGKA 5HW3A 1S6RA 2QMIA 5EE8A 4KZ8A 2OV5A 5HAQA 4QJGA 1NXYA 3Q07A 4HEFA 4KZ7A 4OLDA 4JF4A 1E4DA 1K38A 1MWUA 3Q81A 5AQ7A 1XKZA 3A3IA 5FI7A 4S2MA 3V3SA 1ES5A 5EVID 1ZKJA 5IHVA 1TDGA 1IYSA 1L0DA 3QNBA 4Y0TA 5GL9A 5HARA 3VFHA 3BLSA 1MPLA 5HAIA 1YQSA 5CHMA 1JWPA 4OPQA 4KQQA 3LCEA 4L0LA 4LV0A 3CZDA 1XPBA 5E2EA 4EUZA 2Z2LB 4FD8A 4N1XA 4P6BA 4KZ5A 5HAPA 1XA7A 4UA6A 1IKGA 5CGWA 1BZAA 4GD8A 2XGNA 3Q1FA 2HDUA 2ZLYA 1WYBA 2JE5A 3BEBA 3ZNTA 3FKVA 1TDLA 1NZUA 4S2JA 3MZFA 4GZBA 4KENB 2ZQAA 3UY6A 4IVIA 1IYOA 1PZOA 2J8YA 4RA7A 2FFFB 3PBQA 4XUXA 1YLTA 1LI9A 1QMFA 3PBTA 4PM9A 3G30A 5F1GA 5EECA 5G18A 4NK3A 3VP0A 1G68A 3A3FA 1NZOA 3QNCA 2G2WA 1NYYA 5FI2A 2DRWA 1NY0A 2WZXA 5FQMA 4U3TA 4CJNA 4UAAA 2IWDA 3M6HA 4WZ4A 4X69A 5CEDA 3FWLA 1KDWA 5AQBA 3A3DA 2X02A 2ZC7A 1JTDA 1K6SA 3ZDJA 4BD1A 1JWZA 4OOYA 1SDNA 2XR0A 3IXGA 1RGZA 5GLBA 4QY5A 1KVLA 4U0XA 4WZ5A 4FH2A 2EFUA 4P0MA 1BTLA 1EI5A 1M40A 2EX6A 3LY3A 3QHYA 3IF6B 4OQHA 1BLPA 5FQQA 5KSCA 2JC7A 3OPLA 4S2KA 2ZJ9A 1KVMA 4OPZA 3C7VA 1LI0A 4BD0A 3SOIA 4FH4A 3FZCA 2V20A 2BG1A 4DE3A 3WS5A 4GNUA 4XUZA 2H10A 4LV1A 3ZVTA 4R4RA 3WS0A 3NDEA 3VP1A 4M3KA 5DTKA 1BULA 1GA0A 1LL9A 2JCHA 2Y91A 4K0XA 5GLDA 1VM1A 2QPNA 2BLSA 2ZMAA 2J9OA 2PU2A 4WMCA 3PAEA 4S2NC 1NYMA 1SKFA 2Y2LA 5FASA 4DDSA 4OONA 1YMSA 3MZEA 5A91A 1HD8A 1KGEA 1PW8A 4JPMA 3Q7VB 2XDMA 1PW1A 1W79A 3VOZA 4PMAA 3BFEA 3IQAA 2I72A 4OQGA 4Q8IA 4RYEA 1MKIA 3C4OA 3C4PA 3LY4A 4RVAA 3EQVA 4YINA 5CRFA 3IWOA 3W4PA 1IEMA 5TFQA 1ERQA 1GHPA 2XQZA 3OZHA 4R1GA 3NC8A 1YT4A 1XP4A 4DKIA 2H0YA 1KDSA 3GQZA 1XX2A 4GDNA 4R0QA 4XXRA 2Y2PA 1K6RA 5EOOA 1K54C 2HP9A 1Q2QA 2EX2A 5CTNA 5F1FA 4MLLA 2EX9A 3S4XA 3DW0A 5CECA 1RGYA 2ZQCA 5FQ9A 5FQJA 4E3OA 2XFTA 4HBTA 4EBNA 3IF6A 3HUMA 2J9PA 1C3BA 1G6AA 1FCNA 1W8YA 3DWKA 4GOGA 4KG2A 1H8ZA 5CXWA 3GRJA 3BRMA 2HP6A 3GV9A 4DF6A 3GMWA 5EVIC 3WRZA 3UPNA 4MBKA 3BFCA 4EBLA 3G35A 2Y2GA 5EVLA 1CEGA 3AGFA 1DJBA 4E6WA 3MKFA 1KGFA 3VP3A 2Y2NA 1N4OA 2B5RA 1K25A 4Y7PA 2RL3A 4E6XA 4RX2A 4OP5A 3UDXA 5AQ9A 3FKWA 3OCNA 1BSGA 3BLMA 1XA1A 3UN7A 4D2OA 4MBFA 3BYDA 4HBUA 1KE0A 5TR7A 3W8KA 4HESA 3TG9A 3PBNA 4JLFA 1SHVA 5CTMA 2WZZA 1ES4A 1LL5A 5U47A 3Q7VA 5DF9A 1GCEA 1CI8A 1L0FA 3GTCA 1AXBA 1RP5A 1PWDA 2JBFA 2XLNA 3CMZA 3NDGA 4UHUA 2ZQ9A 3SS3A 4OVDA 1ZC2A 3G2YA 1XXMA 2Y55A 4KZ6A 3ZFZA 5M19A 5A93A 2C5WB 2Y2QA 3ITAA 3E2KA 5EUAA 4S2IA 1H5XA 2Y2HA 4E3IA 1KE4A 4JXVA 3OPRA 4ZTKA 2ZD8A 3WWXA 3NY4A 1TEMA 3VSKA 3VMAA 2UWXA 3GSGA 3ZG7B 5GHZA 3CJMA 3G31A 4OOLA 4JF6A 4DRTA 2XD5A 4KZ3A 4JXSA 2X01A 3HLEA 3UPOA 4QHCA 2DCFA 3N8SA 3UE1A 1ESIA 4EQIA 3D4FA 3IXDA 3ZHHA 1BUEA 2ZC6B 3EQUA 4P85A 1EROA 1W5DA 2OLUA 5M1AA 2IWBA 3W4QA 1PIOA 4Y0UA 4E3MA 3MFDA 4MBHA 3WS1A 1ERMA 1K57C 1KE3A 5F82A 4BL2A 2J7VA 1H8YA 4QU3A 4WMCD 5GLAA 4PM5A 3UE3A 3ZGAB 3G32A 4QD4A 1FSYA 1LLBA 4N9KA 4GD6A 2GDNA 2Q9MA 1K55C 2FFYA 1ZG4A 4QY6A 2EXBA 2WGWB 2H5SA 3RJUA 3MXSA 3UO9A 4K0WA 5CEBA 2Y2MA 2PBYA 2HDQA 1PWCA 3ZG0A 5BOHA 2A3UA 1PI5A 4OQ0A 4EWFA 4LCMA 1Z6FA 2DNSA 4CPKA 3BFGA 1YLWA 4KQOA 3VP2A 1MY8A 3ITBA 3BFDA 3G2ZA 4S2LA 3I7JA 4X53A 4UA7A 5GHXA 4C6YA 4E3NA 5CGSA 3BECA 5DF7A 2OLVA 3IH8A 5EPHA 4WELA 4FCFA 5DF8A 5CHJA 3V3RA 4B88A 4JKTA 4ZDXA 2C6WB 4LENA 2R9XA 4H8RA 3DWZA 3SH7A 3P09A 1Q2PA 2WADA 2XK1A 2CC1A 4KG6A 4PM6A 2EFXA 3ZNYA 1I2SA 1FSWA 3HLWA 1MWTA 4P87A 3W4OA 5KMWA 3PBSA 4WBGA 5E2FA 4WEKA 5FA7A 3WS2A 1BLSA 1IYPA 1JVJA 3HLGA 2XEPA 3HBRA 3M2KA 4OH0A 4MNRA 2Y2IA 3SH8A 3IHBA 4UA9A 3UDFA 2IWCA 1I5QA 1O7EA 3MBZA 1FR1A 3RXWA 5FAQA 5EVIB 1SDEA 3Q82A 1ES2A 1ES3A 4DDYA 2QZ6A 1MWSA 3NBLA 4EV4A 1TVFA 4ID4A 2HDSA 1WYCA 2EX8A 4YFMA 3TOIA 3V39A 2H0TA 1FCOA 2XH9A 4KZBA 4F94A 2HP5A 3MZDA 2WGWA 1ALQA 2WUQA 5I94A 4OP8A 5AQAA 3VFFA 3OPHA 4C3QA 4GDBA 5EOEA 4S2NA 3S1YA 1BLCA 1HVBA 4C75A 3GR2A 3HLBA 5A90A 3HREA 2WYXA 4E3JA 4IEDA 1QMEA 4DE2A 1O07A 4KG5A 1MXOA 3HVFA 5F83A 5JYOA 3ZCZA 4BJPA 4R4SA 3IHAA 4GB7A 2WAEA 4EBPA 1Y54A 1W8QA 3OPPA 3Q7ZA 4KZ9A 3N4IA 4WM9A 2WK0A 3OCLA 4KZAA 3AGEA 4BLMA 1YLJA 4WZ5C 5FI6A 3A3JA 3M6BA 1DJCA 3C5AA 2WKIA 1J9MA 4R3JA 2WGVA 3CG5A 3O88A 5HX9A 2HPBA 4WYYA 5FDHA 2WAFA 3PAGA 4X56A 3WRTA 3O86A 2HDRA 1K54A 3V50A 1MBLA 5FAPA 1ZG6A 1XGJA 5DVAA 1BLHA 1RCJA 2PU4A 3LEZA 4X55A 3ZG9B 1E3UA 4DXBA 1E25A 4OPYA 4PM8A 1S0WA 2ZQ8A 4R23A 1IYQA 3TSGA 4OQIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4X6T A;  3G4P A;  5EVI A;  5L2F A;  1ONG A;  3IXB A;  1K56 D;  4JF5 A;  4N92 A;  4PM7 A;  4S2O A;  1ONH A;  5E2H A;  3IT9 A;  2VGJ A;  4MEZ A;  4S2P A;  3UPP A;  3NI9 A;  4JXW A;  3BFF A;  5DTS A;  4O7D A;  2RCX A;  2R9W A;  4B4X A;  4DXC A;  1L0E A;  4OKP A;  2ZC5 B;  4ZJ3 A;  3MXR A;  3ZVW A;  2XFS A;  4ZJ2 A;  2WKE A;  1YMX A;  2P9V B;  1WE4 A;  5CHU A;  2P74 A;  1BT5 A;  4K91 A;  4N9L A;  5KZH A;  1LHY A;  4WEJ A;  1DY6 A;  1K56 A;  4KQR A;  1PWG A;  5FQI A;  1U60 A;  2Y4A A;  3SH9 A;  4DE0 A;  3VOY A;  1FQG A;  1KGG A;  4NET A;  4E3L A;  4JBF A;  1OME A;  4KZ4 A;  1HTZ A;  5HL1 A;  1GHM A;  1MWR A;  1PYY A;  4IBX A;  4BEN A;  4U0T A;  2A49 A;  1SCW A;  3NCK A;  4PPR A;  5GHY A;  2WKH A;  2Y2J A;  2XF3 A;  5D3O A;  4RX3 A;  3IF6 C;  3IH9 A;  4E3K A;  1DJA A;  3G34 A;  1K4F A;  3O87 A;  4GN2 A;  3UNW A;  3SS5 A;  3ZG8 B;  1GA9 A;  5J8X A;  4JXG A;  5E2G A;  3N6I A;  1VQQ A;  3UDI A;  2G2U A;  3PBR A;  5GLC A;  4Y0O A;  2ZQD A;  5TGF A;  4DE1 A;  3M2J A;  4GKU A;  4ZJ1 A;  3PBO A;  3V5M A;  3UE0 A;  2ZM8 A;  3NIA A;  2ZC3 B;  3E2L A;  4A5R A;  3HUN A;  5DTT A;  3IWI A;  1NJ4 A;  1N9B A;  4LCL A;  4B4Z A;  1L2S A;  1NRF A;  3C7U A;  3AGD A;  2Q9N A;  1W7F A;  3N7W A;  1IKI A;  5A92 A;  3VP4 A;  3HL9 A;  2X71 A;  3HLC A;  1FOF A;  1M6K A;  5CGX A;  5KSH A;  3FYZ A;  3O3V A;  1K57 A;  1GHI A;  3PTE A;  2Y59 A;  5FQK A;  5JYP A;  1K4E A;  1CK3 A;  1YLY A;  1FR6 A;  3HLF A;  3N8R A;  3MKE A;  3DTM A;  2ZM2 A;  2XD1 A;  3N8L A;  4LV2 A;  1YLP A;  4OPR A;  1K55 A;  1L0G A;  1CI9 A;  2E8I A;  2V2F F;  1EWZ A;  2ZC4 B;  1JTG A;  1XGI A;  1YLZ A;  5M18 A;  1JWV A;  2P9V A;  3A3E A;  3HLD A;  3OC2 A;  5FSR A;  1PI4 A;  3SS4 A;  1HZO A;  1I2W A;  1IEL A;  5E43 A;  4BL3 A;  3ZG5 A;  5FAT A;  4BQM A;  1ESU A;  4OOM A;  3HUO A;  3LO7 A;  1FCM A;  2EXA A;  3P98 A;  1PZP A;  5FAO A;  3VSL A;  4Z9Q A;  2OSU A;  3B3X A;  2V1Z A;  4R3B A;  2Y2K A;  3IXH A;  3ISG A;  4X68 A;  3GVB A;  2ZQ7 A;  1CEF A;  3BM6 A;  4IBR A;  4LV3 A;  3RXX A;  2ZM0 A;  4FSF A;  3WS4 A;  3FV7 A;  3JYI A;  5CER A;  4N1H A;  4ZAM A;  2WGI A;  4IVK A;  3IF5 A;  1YM1 A;  4QB8 A;  5HFO A;  2Z2M B;  2Y2O A;  3IWQ A;  4ZBE A;  4OLG A;  1E3U D;  3S22 A;  2VGK A;  5HW3 A;  1S6R A;  2QMI A;  5EE8 A;  4KZ8 A;  2OV5 A;  5HAQ A;  4QJG A;  1NXY A;  3Q07 A;  4HEF A;  4KZ7 A;  4OLD A;  4JF4 A;  1E4D A;  1K38 A;  1MWU A;  3Q81 A;  5AQ7 A;  1XKZ A;  3A3I A;  5FI7 A;  4S2M A;  3V3S A;  1ES5 A;  5EVI D;  1ZKJ A;  5IHV A;  1TDG A;  1IYS A;  1L0D A;  3QNB A;  4Y0T A;  5GL9 A;  5HAR A;  3VFH A;  3BLS A;  1MPL A;  5HAI A;  1YQS A;  5CHM A;  1JWP A;  4OPQ A;  4KQQ A;  3LCE A;  4L0L A;  4LV0 A;  3CZD A;  1XPB A;  5E2E A;  4EUZ A;  2Z2L B;  4FD8 A;  4N1X A;  4P6B A;  4KZ5 A;  5HAP A;  1XA7 A;  4UA6 A;  1IKG A;  5CGW A;  1BZA A;  4GD8 A;  2XGN A;  3Q1F A;  2HDU A;  2ZLY A;  1WYB A;  2JE5 A;  3BEB A;  3ZNT A;  3FKV A;  1TDL A;  1NZU A;  4S2J A;  3MZF A;  4GZB A;  4KEN B;  2ZQA A;  3UY6 A;  4IVI A;  1IYO A;  1PZO A;  2J8Y A;  4RA7 A;  2FFF B;  3PBQ A;  4XUX A;  1YLT A;  1LI9 A;  1QMF A;  3PBT A;  4PM9 A;  3G30 A;  5F1G A;  5EEC A;  5G18 A;  4NK3 A;  3VP0 A;  1G68 A;  3A3F A;  1NZO A;  3QNC A;  2G2W A;  1NYY A;  5FI2 A;  2DRW A;  1NY0 A;  2WZX A;  5FQM A;  4U3T A;  4CJN A;  4UAA A;  2IWD A;  3M6H A;  4WZ4 A;  4X69 A;  5CED A;  3FWL A;  1KDW A;  5AQB A;  3A3D A;  2X02 A;  2ZC7 A;  1JTD A;  1K6S A;  3ZDJ A;  4BD1 A;  1JWZ A;  4OOY A;  1SDN A;  2XR0 A;  3IXG A;  1RGZ A;  5GLB A;  4QY5 A;  1KVL A;  4U0X A;  4WZ5 A;  4FH2 A;  2EFU A;  4P0M A;  1BTL A;  1EI5 A;  1M40 A;  2EX6 A;  3LY3 A;  3QHY A;  3IF6 B;  4OQH A;  1BLP A;  5FQQ A;  5KSC A;  2JC7 A;  3OPL A;  4S2K A;  2ZJ9 A;  1KVM A;  4OPZ A;  3C7V A;  1LI0 A;  4BD0 A;  3SOI A;  4FH4 A;  3FZC A;  2V20 A;  2BG1 A;  4DE3 A;  3WS5 A;  4GNU A;  4XUZ A;  2H10 A;  4LV1 A;  3ZVT A;  4R4R A;  3WS0 A;  3NDE A;  3VP1 A;  4M3K A;  5DTK A;  1BUL A;  1GA0 A;  1LL9 A;  2JCH A;  2Y91 A;  4K0X A;  5GLD A;  1VM1 A;  2QPN A;  2BLS A;  2ZMA A;  2J9O A;  2PU2 A;  4WMC A;  3PAE A;  4S2N C;  1NYM A;  1SKF A;  2Y2L A;  5FAS A;  4DDS A;  4OON A;  1YMS A;  3MZE A;  5A91 A;  1HD8 A;  1KGE A;  1PW8 A;  4JPM A;  3Q7V B;  2XDM A;  1PW1 A;  1W79 A;  3VOZ A;  4PMA A;  3BFE A;  3IQA A;  2I72 A;  4OQG A;  4Q8I A;  4RYE A;  1MKI A;  3C4O A;  3C4P A;  3LY4 A;  4RVA A;  3EQV A;  4YIN A;  5CRF A;  3IWO A;  3W4P A;  1IEM A;  5TFQ A;  1ERQ A;  1GHP A;  2XQZ A;  3OZH A;  4R1G A;  3NC8 A;  1YT4 A;  1XP4 A;  4DKI A;  2H0Y A;  1KDS A;  3GQZ A;  1XX2 A;  4GDN A;  4R0Q A;  4XXR A;  2Y2P A;  1K6R A;  5EOO A;  1K54 C;  2HP9 A;  1Q2Q A;  2EX2 A;  5CTN A;  5F1F A;  4MLL A;  2EX9 A;  3S4X A;  3DW0 A;  5CEC A;  1RGY A;  2ZQC A;  5FQ9 A;  5FQJ A;  4E3O A;  2XFT A;  4HBT A;  4EBN A;  3IF6 A;  3HUM A;  2J9P A;  1C3B A;  1G6A A;  1FCN A;  1W8Y A;  3DWK A;  4GOG A;  4KG2 A;  1H8Z A;  5CXW A;  3GRJ A;  3BRM A;  2HP6 A;  3GV9 A;  4DF6 A;  3GMW A;  5EVI C;  3WRZ A;  3UPN A;  4MBK A;  3BFC A;  4EBL A;  3G35 A;  2Y2G A;  5EVL A;  1CEG A;  3AGF A;  1DJB A;  4E6W A;  3MKF A;  1KGF A;  3VP3 A;  2Y2N A;  1N4O A;  2B5R A;  1K25 A;  4Y7P A;  2RL3 A;  4E6X A;  4RX2 A;  4OP5 A;  3UDX A;  5AQ9 A;  3FKW A;  3OCN A;  1BSG A;  3BLM A;  1XA1 A;  3UN7 A;  4D2O A;  4MBF A;  3BYD A;  4HBU A;  1KE0 A;  5TR7 A;  3W8K A;  4HES A;  3TG9 A;  3PBN A;  4JLF A;  1SHV A;  5CTM A;  2WZZ A;  1ES4 A;  1LL5 A;  5U47 A;  3Q7V A;  5DF9 A;  1GCE A;  1CI8 A;  1L0F A;  3GTC A;  1AXB A;  1RP5 A;  1PWD A;  2JBF A;  2XLN A;  3CMZ A;  3NDG A;  4UHU A;  2ZQ9 A;  3SS3 A;  4OVD A;  1ZC2 A;  3G2Y A;  1XXM A;  2Y55 A;  4KZ6 A;  3ZFZ A;  5M19 A;  5A93 A;  2C5W B;  2Y2Q A;  3ITA A;  3E2K A;  5EUA A;  4S2I A;  1H5X A;  2Y2H A;  4E3I A;  1KE4 A;  4JXV A;  3OPR A;  4ZTK A;  2ZD8 A;  3WWX A;  3NY4 A;  1TEM A;  3VSK A;  3VMA A;  2UWX A;  3GSG A;  3ZG7 B;  5GHZ A;  3CJM A;  3G31 A;  4OOL A;  4JF6 A;  4DRT A;  2XD5 A;  4KZ3 A;  4JXS A;  2X01 A;  3HLE A;  3UPO A;  4QHC A;  2DCF A;  3N8S A;  3UE1 A;  1ESI A;  4EQI A;  3D4F A;  3IXD A;  3ZHH A;  1BUE A;  2ZC6 B;  3EQU A;  4P85 A;  1ERO A;  1W5D A;  2OLU A;  5M1A A;  2IWB A;  3W4Q A;  1PIO A;  4Y0U A;  4E3M A;  3MFD A;  4MBH A;  3WS1 A;  1ERM A;  1K57 C;  1KE3 A;  5F82 A;  4BL2 A;  2J7V A;  1H8Y A;  4QU3 A;  4WMC D;  5GLA A;  4PM5 A;  3UE3 A;  3ZGA B;  3G32 A;  4QD4 A;  1FSY A;  1LLB A;  4N9K A;  4GD6 A;  2GDN A;  2Q9M A;  1K55 C;  2FFY A;  1ZG4 A;  4QY6 A;  2EXB A;  2WGW B;  2H5S A;  3RJU A;  3MXS A;  3UO9 A;  4K0W A;  5CEB A;  2Y2M A;  2PBY A;  2HDQ A;  1PWC A;  3ZG0 A;  5BOH A;  2A3U A;  1PI5 A;  4OQ0 A;  4EWF A;  4LCM A;  1Z6F A;  2DNS A;  4CPK A;  3BFG A;  1YLW A;  4KQO A;  3VP2 A;  1MY8 A;  3ITB A;  3BFD A;  3G2Z A;  4S2L A;  3I7J A;  4X53 A;  4UA7 A;  5GHX A;  4C6Y A;  4E3N A;  5CGS A;  3BEC A;  5DF7 A;  2OLV A;  3IH8 A;  5EPH A;  4WEL A;  4FCF A;  5DF8 A;  5CHJ A;  3V3R A;  4B88 A;  4JKT A;  4ZDX A;  2C6W B;  4LEN A;  2R9X A;  4H8R A;  3DWZ A;  3SH7 A;  3P09 A;  1Q2P A;  2WAD A;  2XK1 A;  2CC1 A;  4KG6 A;  4PM6 A;  2EFX A;  3ZNY A;  1I2S A;  1FSW A;  3HLW A;  1MWT A;  4P87 A;  3W4O A;  5KMW A;  3PBS A;  4WBG A;  5E2F A;  4WEK A;  5FA7 A;  3WS2 A;  1BLS A;  1IYP A;  1JVJ A;  3HLG A;  2XEP A;  3HBR A;  3M2K A;  4OH0 A;  4MNR A;  2Y2I A;  3SH8 A;  3IHB A;  4UA9 A;  3UDF A;  2IWC A;  1I5Q A;  1O7E A;  3MBZ A;  1FR1 A;  3RXW A;  5FAQ A;  5EVI B;  1SDE A;  3Q82 A;  1ES2 A;  1ES3 A;  4DDY A;  2QZ6 A;  1MWS A;  3NBL A;  4EV4 A;  1TVF A;  4ID4 A;  2HDS A;  1WYC A;  2EX8 A;  4YFM A;  3TOI A;  3V39 A;  2H0T A;  1FCO A;  2XH9 A;  4KZB A;  4F94 A;  2HP5 A;  3MZD A;  2WGW A;  1ALQ A;  2WUQ A;  5I94 A;  4OP8 A;  5AQA A;  3VFF A;  3OPH A;  4C3Q A;  4GDB A;  5EOE A;  4S2N A;  3S1Y A;  1BLC A;  1HVB A;  4C75 A;  3GR2 A;  3HLB A;  5A90 A;  3HRE A;  2WYX A;  4E3J A;  4IED A;  1QME A;  4DE2 A;  1O07 A;  4KG5 A;  1MXO A;  3HVF A;  5F83 A;  5JYO A;  3ZCZ A;  4BJP A;  4R4S A;  3IHA A;  4GB7 A;  2WAE A;  4EBP A;  1Y54 A;  1W8Q A;  3OPP A;  3Q7Z A;  4KZ9 A;  3N4I A;  4WM9 A;  2WK0 A;  3OCL A;  4KZA A;  3AGE A;  4BLM A;  1YLJ A;  4WZ5 C;  5FI6 A;  3A3J A;  3M6B A;  1DJC A;  3C5A A;  2WKI A;  1J9M A;  4R3J A;  2WGV A;  3CG5 A;  3O88 A;  5HX9 A;  2HPB A;  4WYY A;  5FDH A;  2WAF A;  3PAG A;  4X56 A;  3WRT A;  3O86 A;  2HDR A;  1K54 A;  3V50 A;  1MBL A;  5FAP A;  1ZG6 A;  1XGJ A;  5DVA A;  1BLH A;  1RCJ A;  2PU4 A;  3LEZ A;  4X55 A;  3ZG9 B;  1E3U A;  4DXB A;  1E25 A;  4OPY A;  4PM8 A;  1S0W A;  2ZQ8 A;  4R23 A;  1IYQ A;  3TSG A;  4OQI A; 
#chains in the Genus database with same CATH topology
 2YKH A;  2EWV A;  4D60 A;  3IXB A;  3D9Y A;  2UV0 E;  5DKK A;  3QP6 A;  3E4Q A;  4S2P A;  2VV7 A;  3NI9 A;  4YOF A;  2RCX A;  2R9W A;  3K3D A;  3MXR A;  3MQO A;  3T1Q B;  3KYQ A;  4K91 A;  1A0K A;  1LHY A;  1K56 A;  5FQI A;  2HZ5 A;  4YNR A;  2V8C A;  3JPU A;  3DTI A;  3UB9 A;  1IOU A;  4GLQ A;  1MWR A;  4LFU A;  2J3T D;  1S4R A;  2P7J A;  4PPR A;  3S7N A;  2V8F A;  3IH9 A;  1UWN X;  2JKF A;  2M1C A;  4F3L A;  3UNW A;  3ZG8 B;  4L9E A;  5E2G A;  3N6I A;  4Z1W A;  3UDI A;  4DE1 A;  4GKU A;  1G5U A;  2ZC3 B;  3E2L A;  3HUN A;  4B4Z A;  3C7U A;  3N7W A;  3HL9 A;  1FOF A;  1S66 L;  3O3V A;  1F5M A;  1FR6 A;  1CF0 A;  3N8R A;  2XRN A;  2W3E A;  4OPR A;  1K55 A;  1OTB A;  2V2F F;  1EWZ A;  1XGI A;  3A3E A;  5C5K A;  1PI4 A;  1HZO A;  1IEL A;  5IU1 A;  3S7O A;  5E43 A;  3NJA A;  3ZG5 A;  4BQM A;  4OOM A;  5FAO A;  1PZP A;  2Y2K A;  3ISG A;  3GVB A;  2ZQ7 A;  3BM6 A;  3WS4 A;  2PR5 A;  4FSF A;  4IVK A;  4QB8 A;  5HFO A;  5L09 A;  3S22 A;  1S6R A;  2OV5 A;  5HAQ A;  4HEF A;  4JF4 A;  1MWU A;  3Q81 A;  4NXG A;  1XKZ A;  5FI7 A;  4CQH A;  3V3S A;  5EVI D;  1YSP A;  4EER A;  4Y0T A;  1DP9 A;  4EUZ A;  1XPB A;  5E2E A;  4JGP A;  3T4O A;  1KOU A;  4NXB A;  1WA9 A;  3CUE C;  5CGW A;  4E04 A;  3NOT C;  2GNX A;  3BEB A;  3ZNT A;  1NZU A;  4S2J A;  4KEN B;  2ZQA A;  3GEC A;  1YLT A;  1QMF A;  3PBT A;  5F1G A;  3G30 A;  1P97 A;  1UGU A;  2G2W A;  1NYY A;  2PT7 A;  2WZX A;  4U3T A;  2K7S A;  3LR4 A;  1KDW A;  2B18 A;  1K6S A;  1JWZ A;  4OOY A;  2PD8 A;  1KVL A;  4WZ5 A;  4P0M A;  1BTL A;  1EI5 A;  5FQQ A;  4S2K A;  1KVM A;  4OPZ A;  3FZC A;  4GNU A;  4LV1 A;  3C30 A;  4M3K A;  5DTK A;  3A0S A;  2QPN A;  4S2N C;  1SKF A;  4DDS A;  4OON A;  2K2N A;  1JNU A;  1HD8 A;  3K2N A;  4JPM A;  2XDM A;  2FZ0 A;  3VOZ A;  4Q8I A;  1MKI A;  3C4O A;  3VOL A;  5TFQ A;  3NOP C;  1YT4 A;  2J3W A;  1XX2 A;  2G7U A;  5EOO A;  2HP9 A;  2JKT I;  1UWP X;  2EX9 A;  3FPV A;  2ZQC A;  5FQ9 A;  4E3O A;  2XFT A;  4HBT A;  4I3A A;  3HUM A;  2J9P A;  1G6A A;  5CXW A;  3GRJ A;  3GV9 A;  4MBK A;  3G35 A;  2VLG A;  4E6W A;  4XT2 B;  3VP3 A;  2Z6D A;  2VV8 A;  4LLO B;  2B5R A;  4OP5 A;  3A0V A;  3UDX A;  1G28 A;  1GSV A;  1BSG A;  3BLM A;  2DMW A;  3UN7 A;  4D2O A;  3BJN A;  4MBF A;  1KE0 A;  4HES A;  4JLF A;  5CTM A;  1LL5 A;  2OAQ 1;  2O9C A;  5U47 A;  1GCE A;  3GTC A;  1RP5 A;  2XA7 M;  1ZC2 A;  3MMH A;  5M19 A;  2C5W B;  5EUA A;  4R38 A;  4JXV A;  1T1B A;  2GZA A;  3T4Q A;  5GHZ A;  3CJM A;  2J80 A;  4JF6 A;  4KZ3 A;  4PHT A;  3UPO A;  4JGR A;  2L4R A;  3UE1 A;  4EQI A;  2Y8H A;  1BUE A;  1G6O A;  3EQU A;  2OLU A;  3W4Q A;  4E3M A;  5L8M A;  1ERM A;  1KE3 A;  4XT2 A;  3EWK A;  1H8Y A;  4QU3 A;  4GW9 A;  3G32 A;  4QD4 A;  4N9K A;  4GD6 A;  2GDN A;  2INW A;  2FFY A;  1ZG4 A;  2EXB A;  2H5S A;  1F98 A;  3MXS A;  4K0W A;  2PBD P;  2Y2M A;  4BWI A;  3DTK A;  1LT0 A;  4OQ0 A;  3C38 A;  2HJ9 C;  3TJZ C;  1YLW A;  4UA7 A;  4E3N A;  3BEC A;  4I38 A;  3V3R A;  3T4L A;  3LIA A;  4ETZ A;  1VEU B;  2R9X A;  1S1Y A;  3P09 A;  4Q0H A;  4KG6 A;  3ZNY A;  3BY9 A;  4CLC C;  1IYP A;  2JKT M;  5FEG A;  2XEP A;  3M2K A;  2VKS A;  3IBR A;  1O7E A;  5FAQ A;  1SDE A;  3E4P A;  1ES2 A;  1MWS A;  2HDS A;  2EX8 A;  4HH2 A;  4BBV A;  2PAV P;  4F94 A;  3CLO A;  4S2N A;  1HVB A;  4C75 A;  5F5Y A;  3VE3 A;  3LIE A;  2WAE A;  1LSX A;  3OPP A;  3N4I A;  4WM9 A;  3M6B A;  1IFQ A;  2KLI A;  1VEU A;  3CG5 A;  3WRT A;  4M4X A;  1BYW A;  3LR0 A;  3V50 A;  3K3C A;  5FAP A;  4Y13 A;  1DP6 A;  1ZG6 A;  5DVA A;  1RCJ A;  2PU4 A;  5KIZ A;  3ZG9 B;  1E3U A;  4OPY A;  2PYR A;  4JGQ A;  1S4S A;  4EES A;  3TSG A;  1ONG A;  1K56 D;  4JF5 A;  1ONH A;  4JXW A;  4O7D A;  4DXC A;  4B4X A;  4O8G A;  1WE4 A;  5CHU A;  4N9L A;  1U60 A;  2Y4A A;  3T12 B;  2JHE A;  1OME A;  5F69 A;  4KZ4 A;  1HTZ A;  5HL1 A;  1PYY A;  3BQ8 A;  2XF3 A;  5D3O A;  4RX3 A;  3IF6 C;  1K4F A;  3NOU C;  4EEU A;  5J8X A;  1P0Z A;  3PBR A;  2ZQD A;  5EFW A;  2OOL A;  3PBO A;  3V5M A;  4CLC B;  5DTT A;  1NJ4 A;  4LCL A;  1NRF A;  4LGW A;  2Q9N A;  1P9R A;  1W7F A;  1IKI A;  3T1R A;  5CX7 A;  5KSH A;  3UB7 A;  3KSF A;  1GHI A;  2VEA A;  1K4E A;  1YLY A;  2YKF A;  3MKE A;  2XRO A;  2M7U A;  1L0G A;  2ZC4 B;  1JTG A;  1JWV A;  3HLD A;  3SS4 A;  2VZW A;  1ESU A;  5HDS A;  2EXA A;  3P98 A;  2Y79 A;  3LUQ A;  3VSL A;  2QHK A;  4HJ3 A;  1YPR A;  4EEP A;  3ULF A;  2Z6C A;  4N1H A;  3IF5 A;  1YM1 A;  2Z2M B;  2Y2O A;  3IWQ A;  4JGO A;  4OLG A;  5HW3 A;  5EE8 A;  3LEQ A;  4OLD A;  3KYE A;  1E4D A;  5AQ7 A;  4R70 A;  4S2M A;  1ES5 A;  5IHV A;  1TDG A;  1IYS A;  2OWJ A;  4CLC A;  5GL9 A;  1SKO B;  4LRX C;  4EW7 A;  3VFH A;  1MPL A;  5F68 A;  4OPQ A;  4KQQ A;  4L0L A;  4G3K A;  2Z2L B;  4FD8 A;  2PRF A;  5HAP A;  1XA7 A;  2JKG A;  4KUO A;  4GD8 A;  3Q1F A;  1P9W A;  3FKV A;  1AWI A;  1T18 A;  4IVI A;  1IYO A;  4RA7 A;  3PBQ A;  3NUL A;  5G18 A;  1LI9 A;  3RXW A;  3LI8 A;  3R4K A;  3VP0 A;  1NZO A;  5HL6 A;  1FIL A;  1TS0 A;  3FC7 A;  5FQM A;  4CJN A;  5IS1 A;  5G4Y A;  3CI6 A;  3U4L P;  2X02 A;  1V9Z A;  1GSW A;  2FH5 A;  1RGZ A;  2QKP A;  3QHY A;  3IF6 B;  1Y4O A;  4HHD A;  1BLP A;  3OPL A;  4ESP A;  2ZJ9 A;  3SOI A;  2ZMF A;  2BG1 A;  2H10 A;  1SKO A;  4R4R A;  3VP1 A;  1NRJ A;  4K0X A;  1NYM A;  4DJ2 A;  1KGE A;  1PW8 A;  4ZRR A;  3Q7V B;  3BFE A;  5LBR A;  2I72 A;  2BTF P;  4FUW A;  3C4P A;  5TJJ A;  3TE8 A;  3PYP A;  1IEM A;  3SW1 A;  4L9F A;  4R1G A;  3LR3 A;  2H0Y A;  4UEY A;  4R0Q A;  4HP4 A;  1Q2Q A;  5HPF A;  4MLL A;  5CEC A;  1RGY A;  5FQJ A;  3IF6 A;  4WN5 A;  3OBF A;  4GOG A;  2L1M A;  4DF6 A;  5EVI C;  3UPN A;  2Y2G A;  3AGF A;  4AFI A;  3MKF A;  2Y2N A;  2EWW A;  2RL3 A;  4RX2 A;  1XJ3 A;  5AQ9 A;  1XA1 A;  5FL3 A;  5TR7 A;  3TG9 A;  4Y3I A;  1TS8 A;  4HNB A;  3Q7V A;  5DF9 A;  1CI8 A;  3E0Y A;  4MN5 A;  2JBF A;  2XLN A;  2PYP A;  4OVD A;  1X0O A;  3ITA A;  5J7E A;  1LSW A;  3B33 A;  3LFV A;  4S2I A;  2ZD8 A;  3DBA A;  3WWX A;  3VSK A;  2UWX A;  3ZG7 B;  3OLO A;  4OOL A;  1W63 M;  2LB9 A;  3N8S A;  3IXD A;  5HD3 A;  1W5D A;  4O0P A;  1PIO A;  3UE6 A;  4Y0U A;  1OTI A;  4IHQ A;  3WS1 A;  4BL2 A;  1K57 C;  4WMC D;  2O99 A;  3UE3 A;  1H0M A;  1OTA A;  1FSY A;  1LLB A;  3KSG A;  2WGW B;  2V9A A;  1TS7 A;  2B02 A;  1F9I A;  4I5S A;  4I3J A;  3OOV A;  5EV0 A;  3E98 A;  3ZG0 A;  4Y15 A;  4EWF A;  4LRZ E;  1J3W A;  1Z6F A;  3BFG A;  1MY8 A;  3ITB A;  4IUK A;  5HZH A;  5GHX A;  4C6Y A;  5EPH A;  2VX8 A;  4FCF A;  4B88 A;  4P6Z M;  4ZDX A;  1ACF A;  4H8R A;  2A24 B;  4PM6 A;  2XK1 A;  2CC1 A;  3LIC A;  1FSW A;  3HLW A;  1MWT A;  4P87 A;  3UB8 A;  3W4O A;  5E2F A;  4WEK A;  4B93 A;  5HWV A;  3UMD A;  1CJF A;  4X1L A;  4B9O A;  4MNR A;  3SH8 A;  3T4J A;  3IHB A;  4UA9 A;  2IWC A;  3LR5 A;  4GS9 B;  5EVI B;  4R6L A;  3Q82 A;  1STZ A;  5DJU A;  1N9L A;  4DDY A;  4EV4 A;  4QPR A;  3H82 B;  3G6O A;  4YFM A;  1FCO A;  3MZD A;  2WGW A;  5AQA A;  5MC7 A;  4GDB A;  3HLB A;  4E3J A;  2WYX A;  3H9W A;  3LIF A;  3EOI A;  5JYO A;  3ZCZ A;  2VK3 A;  4R4S A;  3IHA A;  3MS6 A;  1Y54 A;  3Q7Z A;  2WK0 A;  1YLJ A;  5HDC A;  1DJC A;  4NEE D;  3W2Z A;  4Y17 A;  3TW8 A;  4WYY A;  2WAF A;  2A24 A;  4X56 A;  3O86 A;  5HD5 A;  5EVE A;  1MBL A;  1NLY A;  1E25 A;  4QHC A;  4GS9 A;  5EVI A;  1HLU P;  2JN7 A;  4N92 A;  4ARZ B;  5E2H A;  2P08 A;  3H82 A;  1L0E A;  2ZC5 B;  4ZJ3 A;  1MKM A;  2XFS A;  4ZJ2 A;  1YMX A;  5KZH A;  4WEJ A;  3ZQ5 A;  4KUK A;  2MJ6 A;  3VOY A;  2HGV A;  3C8C A;  2ZOH A;  4BMW A;  1GHM A;  4IBX A;  4BEN A;  4U0T A;  2A49 A;  2P04 A;  3NCK A;  2Y2J A;  3KYZ A;  3SZT A;  1DJA A;  3O87 A;  1H3Q A;  1VQQ A;  2G2U A;  4Y0O A;  2GX5 A;  5TGF A;  2E8J A;  4MCW A;  3UE0 A;  4FTX A;  2ZM8 A;  4A5R A;  1N9B A;  1L2S A;  2I9V A;  2PHY A;  1OT9 A;  3VP4 A;  2X71 A;  3HLC A;  1K57 A;  4ARZ A;  2Y59 A;  5FQK A;  5JYP A;  1YKD A;  1CK3 A;  3HLF A;  3S7Q A;  3DTM A;  4LV2 A;  4WL9 A;  1CI9 A;  3EEA A;  1YLZ A;  3OC2 A;  5FSR A;  1I2W A;  3U2A A;  3BW6 A;  5FAT A;  1T19 A;  3MSH A;  4Z9Q A;  2OSU A;  3B3X A;  2Q0O A;  3IXH A;  2NUP C;  1CEF A;  4IBR A;  4LV3 A;  3LI9 A;  5CER A;  3F1N B;  3ICY A;  3LIB A;  3GDI A;  4Y2F A;  4NG2 A;  2VGK A;  2QMI A;  4KZ8 A;  1TF1 A;  4QJG A;  3Q07 A;  3IS2 B;  3RH8 B;  1K38 A;  3PR6 A;  1OT6 A;  1YQS A;  1JWP A;  2WKP A;  3T1X A;  4UA6 A;  2ZLY A;  1WYB A;  2JE5 A;  3MZF A;  4KQD A;  3UY6 A;  1LSV A;  4PM9 A;  1G68 A;  1TS6 A;  3A3F A;  2NUT C;  3T50 A;  3QNC A;  1OJG A;  5FI2 A;  2DRW A;  4EET B;  2IWD A;  3M6H A;  4P6Z S;  4X69 A;  5CED A;  2HV1 A;  4GCZ A;  1D7E A;  2AVX A;  2ZC7 A;  1JTD A;  5EM1 A;  1SDN A;  4ETX A;  3IXG A;  2XSS A;  1CQA A;  2VGL S;  3F1N A;  4QY5 A;  4U0X A;  4FH2 A;  2EFU A;  4Q0J A;  4OQH A;  1M40 A;  2EX6 A;  3CHW P;  2JC7 A;  3KSI A;  2H28 A;  3BQA A;  1NWZ A;  3LGO A;  3IS2 A;  1GSX A;  3C7V A;  3KSH A;  4FH4 A;  3MR0 A;  4WUJ A;  4BBT A;  3MFX A;  3S7P A;  4XUZ A;  4GJ4 A;  3ZVT A;  3WS0 A;  2JCH A;  2Y91 A;  1VM1 A;  2ZMA A;  2J9O A;  5FAS A;  3IBJ A;  3KO6 A;  1YMS A;  3CIT A;  2W0N A;  5A91 A;  2WKR A;  1W79 A;  4PMA A;  2PDR A;  1W63 Q;  3HJK A;  3T4K A;  1FIK A;  1YAX A;  1SZV A;  4RYE A;  1S67 L;  4RVA A;  3EQV A;  3VE4 A;  5CRF A;  3W4P A;  4DN0 A;  1ERQ A;  1GHP A;  3FG8 A;  1L3L A;  3OZH A;  3MQQ A;  3NC8 A;  3GQZ A;  4GDN A;  2IA2 A;  1K6R A;  2Y2P A;  1DP8 A;  2EX2 A;  5CTN A;  4BBU A;  4MDZ A;  3S4X A;  3DW0 A;  4PKY G;  2VJW A;  4EBN A;  1C3B A;  3L9K A;  1FCN A;  4KG2 A;  1H8Z A;  4X25 A;  2HP6 A;  3GMW A;  3BFC A;  5EVL A;  1DJB A;  4PKY A;  1ZHH B;  4LRY C;  1K25 A;  4Y7P A;  1XJ6 A;  2W3H A;  3FKW A;  3CWF A;  4HBU A;  3W8K A;  4WF0 A;  2GJ3 A;  2W27 A;  1L0F A;  3NDG A;  1OJ5 A;  4UHU A;  2ZQ9 A;  3H7W B;  2V0U A;  1XXM A;  2O9A A;  1XFN A;  3ZFZ A;  3ZYT A;  5A93 A;  2Y2Q A;  3E2K A;  1H5X A;  1T1A A;  4E3I A;  2D02 A;  4ZTK A;  3NY4 A;  1TEM A;  3VMA A;  2QWS A;  3CPT B;  2R78 A;  4JXS A;  2X01 A;  3HLE A;  2J3T C;  1MC0 A;  2ZC6 B;  4P85 A;  1ERO A;  4PAU A;  5M1A A;  3MFD A;  4MBH A;  3HJI A;  5F82 A;  2J7V A;  5GLA A;  1D1J A;  3LID A;  3B42 A;  4NXE A;  1OPX A;  3QP5 A;  2JKR M;  3UO9 A;  2PBY A;  1PWC A;  1XFQ A;  5J3W A;  5BOH A;  4LCM A;  3NEC A;  3H7W A;  4L9G A;  5HSQ A;  4KQO A;  4EXO A;  3G2Z A;  4X53 A;  3DTE A;  2WKQ A;  5DF7 A;  2OLV A;  5DF8 A;  5CHJ A;  4JKT A;  2LB5 A;  3UME A;  3CPT A;  3DWZ A;  3SH7 A;  1Q2P A;  2WAD A;  2EFX A;  5KMW A;  3PBS A;  4WBG A;  3WS2 A;  1BLS A;  4H6J B;  1JVJ A;  3HBR A;  2Y2I A;  3UDF A;  3LYX A;  1I5Q A;  4RQ9 A;  4X1M A;  1FR1 A;  1ES3 A;  3NBL A;  4ID4 A;  4R3A A;  1WYC A;  4UQI S;  3V39 A;  5DJT A;  4IUH A;  5I94 A;  3VFF A;  4HJ4 A;  3OPH A;  4C3Q A;  5EOE A;  4EUV A;  3S1Y A;  1BLC A;  3GR2 A;  4ME4 A;  3HRE A;  4IED A;  5I5L A;  2HJE A;  3R7W B;  4HY8 A;  1O07 A;  3HVF A;  5F83 A;  4O01 A;  4EQ1 A;  1W8Q A;  4KZ9 A;  1OTD A;  4KZA A;  3AGE A;  4BLM A;  5FI6 A;  3A3J A;  3MJQ A;  3C5A A;  1T1C A;  1J9M A;  2WGV A;  5HX9 A;  4NXF A;  4G3W A;  3PAG A;  3DAV A;  5G4Z A;  1VET B;  2KOI A;  2M7V A;  4H6J A;  3LEZ A;  4X55 A;  1S0W A;  2ZQ8 A;  1N9O A;  4X6T A;  3G4P A;  5L2F A;  5HWT A;  4PM7 A;  4S2O A;  3IT9 A;  2VGJ A;  4MEZ A;  3UPP A;  3BFF A;  5DTS A;  4OKP A;  3ZVW A;  4DMZ A;  2WKE A;  2HF6 A;  2P9V B;  2P74 A;  1BT5 A;  4HI4 A;  5HWW A;  1DY6 A;  3R7W A;  2V1B A;  1PWG A;  4KQR A;  3SH9 A;  4DE0 A;  1FQG A;  5FDS A;  1KGG A;  4NET A;  1PFL A;  4E3L A;  4JBF A;  1V9Y A;  3D3O A;  1SCW A;  5GHY A;  2QJ5 A;  2WKH A;  1VB6 A;  5AJG A;  4E3K A;  3G34 A;  4GN2 A;  2W1R A;  3SS5 A;  1GA9 A;  4JXG A;  1VET A;  1Y28 A;  3IX4 A;  5TBM B;  5GLC A;  3HCY A;  3M2J A;  4ZJ1 A;  3NIA A;  2OWH A;  3IWI A;  3P7N A;  2VGL M;  3AGD A;  5A92 A;  1M6K A;  4HH3 A;  5CGX A;  3FYZ A;  2ZOI A;  5FEF A;  3PTE A;  5AVF A;  3MF0 A;  3F1O B;  2QYB A;  1TD5 A;  2ZM2 A;  2XD1 A;  3N8L A;  1YLP A;  4WLA A;  2E8I A;  5M18 A;  2P9V A;  1NLZ A;  1VHM A;  4BL3 A;  2BAS A;  4EU0 A;  3HUO A;  3LO7 A;  1FCM A;  2B95 A;  3L7H A;  2V1Z A;  4R3B A;  4X68 A;  3RXX A;  2ZM0 A;  3FV7 A;  3JYI A;  4ZAM A;  2WGI A;  3O5Y A;  2CMN A;  1N9N A;  4ZBE A;  1E3U D;  4I39 A;  1NXY A;  4KZ7 A;  5TBM A;  4K08 A;  3A3I A;  2VV6 A;  5J4E A;  1ZKJ A;  1L0D A;  3QNB A;  4QWO A;  2V0W A;  5HAR A;  3BLS A;  5HAI A;  2W3D A;  5CHM A;  3LCE A;  4LV0 A;  3CZD A;  4N1X A;  4P6B A;  4KZ5 A;  4IJG A;  1IKG A;  1BZA A;  2XGN A;  2HDU A;  3F1O A;  5A8B A;  5DFX A;  1TDL A;  4GZB A;  1PZO A;  2J8Y A;  2PD7 A;  2FFF B;  4XUX A;  3T4S A;  5EEC A;  4NK3 A;  2A2L A;  4HP9 A;  3NHQ A;  4MN7 A;  2D01 A;  3EEH A;  1NY0 A;  3F1P B;  4UAA A;  4WZ4 A;  3E4O A;  3FWL A;  5AQB A;  3VV4 A;  3A3D A;  3ZDJ A;  4BD1 A;  3A0R A;  2XR0 A;  5GLB A;  4YWZ A;  2KX6 A;  3CAX A;  3LY3 A;  1H8M A;  2EA9 A;  5K5B A;  5KSC A;  4HQA A;  1LI0 A;  4BD0 A;  2V20 A;  4DE3 A;  3WS5 A;  1MZU A;  3NDE A;  1BUL A;  1GA0 A;  1LL9 A;  3CUE A;  3PHY A;  5L07 A;  3EGD C;  5GLD A;  3KX0 X;  2BLS A;  4MMN A;  2PU2 A;  4WMC A;  3PAE A;  1F2K A;  2Y2L A;  3MZE A;  1PW1 A;  1K0K A;  3IQA A;  4OQG A;  1XJ4 A;  3LY4 A;  5AVE A;  4YIN A;  3IWO A;  4NKP A;  2XQZ A;  3F1P A;  1OTE A;  4II7 A;  1XP4 A;  4DKI A;  1KDS A;  4XXR A;  1K54 C;  5F1F A;  3TRC A;  4CLC D;  4HJ6 A;  1W8Y A;  3DWK A;  3BRM A;  3WRZ A;  2W3G A;  4EBL A;  1Z09 A;  1CEG A;  1LL8 A;  1KGF A;  1N4O A;  4E6X A;  4FOF A;  3OCN A;  5DFY A;  3BYD A;  3PBN A;  3JVV A;  1SHV A;  2WZZ A;  1ES4 A;  1D06 A;  1AXB A;  3RFB A;  1PWD A;  3CMZ A;  3SS3 A;  2W1T B;  2ZBB A;  2KDK A;  4UQI M;  3G2Y A;  2Y55 A;  4KZ6 A;  1EW0 A;  2K31 A;  2QJ7 A;  2Y2H A;  1KE4 A;  3OPR A;  2O9B A;  5HPI A;  3GSG A;  2ZMV A;  3G31 A;  4DRT A;  2XD5 A;  3BWL A;  2DCF A;  1ESI A;  3D4F A;  3ZHH A;  1ODV A;  2IWB A;  4HOI A;  4GHI B;  4PM5 A;  3ZGA B;  3C2W A;  4DJ3 A;  3QP2 A;  3IX8 A;  3IX3 A;  3QP1 A;  2Q9M A;  3FPW A;  1K55 C;  3EGX C;  4QY6 A;  3RJU A;  2ZL1 B;  3PXP A;  5CEB A;  2JKR I;  2HDQ A;  2A3U A;  1PI5 A;  1XJ2 A;  5F6A A;  2DNS A;  5L10 A;  2ACG A;  2W1T A;  4CPK A;  1S1Z A;  3T1S A;  2PR6 A;  3VP2 A;  3BFD A;  1DRM A;  4S2L A;  3I7J A;  4Q0I A;  4CLC E;  5CGS A;  1PNE A;  3IH8 A;  4MN6 A;  4WEL A;  2L0W A;  3QP8 A;  5DKL A;  2C6W B;  4LEN A;  2V1A A;  3BY8 A;  1I2S A;  5FA7 A;  3HLG A;  4OH0 A;  3V67 A;  3T4T A;  3RTY A;  3MBZ A;  3D72 A;  4GHI A;  2VA0 A;  3UB6 A;  2QZ6 A;  5IT5 A;  4G3V A;  1TVF A;  3MXQ A;  4I3I A;  2XA7 S;  3TOI A;  2H0T A;  2XH9 A;  4KZB A;  2HP5 A;  1ALQ A;  2WUQ A;  2ZL1 A;  4OP8 A;  4HIA A;  1ZTU A;  2O0Y A;  5A90 A;  2W3F A;  1QME A;  4DE2 A;  1YSQ A;  4KG5 A;  1MXO A;  5EM0 A;  3JVU A;  4BJP A;  4GB7 A;  4EBP A;  3OCL A;  4WZ5 C;  3UB5 P;  2WKI A;  4R3J A;  3O88 A;  2HPB A;  5HDD A;  5FDH A;  3B47 A;  4F3L B;  2HDR A;  1K54 A;  3P01 A;  4Y5F A;  4LPZ A;  3QP4 A;  1XGJ A;  1BLH A;  4DXB A;  4PM8 A;  4R23 A;  1IYQ A;  3MQ0 A;  2OAP 1;  1PRQ A;  4OQI A; 
#chains in the Genus database with same CATH homology
 4X6T A;  3G4P A;  5EVI A;  5L2F A;  1ONG A;  3IXB A;  1K56 D;  4JF5 A;  4N92 A;  4PM7 A;  4S2O A;  1ONH A;  5E2H A;  3IT9 A;  2VGJ A;  4MEZ A;  4S2P A;  3UPP A;  3NI9 A;  4JXW A;  3BFF A;  5DTS A;  4O7D A;  2RCX A;  2R9W A;  4B4X A;  4DXC A;  1L0E A;  4OKP A;  2ZC5 B;  4ZJ3 A;  3MXR A;  3ZVW A;  2XFS A;  4ZJ2 A;  2WKE A;  1YMX A;  2P9V B;  1WE4 A;  5CHU A;  2P74 A;  1BT5 A;  4K91 A;  4N9L A;  5KZH A;  1LHY A;  4WEJ A;  1DY6 A;  1K56 A;  4KQR A;  1PWG A;  5FQI A;  1U60 A;  2Y4A A;  3SH9 A;  4DE0 A;  3VOY A;  1FQG A;  1KGG A;  4NET A;  4E3L A;  4JBF A;  1OME A;  4KZ4 A;  1HTZ A;  5HL1 A;  1GHM A;  1MWR A;  1PYY A;  4IBX A;  4BEN A;  4U0T A;  2A49 A;  1SCW A;  3NCK A;  4PPR A;  5GHY A;  2WKH A;  2Y2J A;  2XF3 A;  5D3O A;  4RX3 A;  3IF6 C;  3IH9 A;  4E3K A;  1DJA A;  3G34 A;  1K4F A;  3O87 A;  4GN2 A;  3UNW A;  3SS5 A;  3ZG8 B;  1GA9 A;  5J8X A;  4JXG A;  5E2G A;  3N6I A;  1VQQ A;  3UDI A;  2G2U A;  3PBR A;  5GLC A;  4Y0O A;  2ZQD A;  5TGF A;  4DE1 A;  3M2J A;  4GKU A;  4ZJ1 A;  3PBO A;  3V5M A;  3UE0 A;  2ZM8 A;  3NIA A;  2ZC3 B;  3E2L A;  4A5R A;  3HUN A;  5DTT A;  3IWI A;  1NJ4 A;  1N9B A;  4LCL A;  4B4Z A;  1L2S A;  1NRF A;  3C7U A;  3AGD A;  2Q9N A;  1W7F A;  3N7W A;  1IKI A;  5A92 A;  3VP4 A;  3HL9 A;  2X71 A;  3HLC A;  1FOF A;  1M6K A;  5CGX A;  5KSH A;  3FYZ A;  3O3V A;  1K57 A;  1GHI A;  3PTE A;  2Y59 A;  5FQK A;  5JYP A;  1K4E A;  1CK3 A;  1YLY A;  1FR6 A;  3HLF A;  3N8R A;  3MKE A;  3DTM A;  2ZM2 A;  2XD1 A;  3N8L A;  4LV2 A;  1YLP A;  4OPR A;  1K55 A;  1L0G A;  1CI9 A;  2E8I A;  2V2F F;  1EWZ A;  2ZC4 B;  1JTG A;  1XGI A;  1YLZ A;  5M18 A;  1JWV A;  2P9V A;  3A3E A;  3HLD A;  3OC2 A;  5FSR A;  1PI4 A;  3SS4 A;  1HZO A;  1I2W A;  1IEL A;  5E43 A;  4BL3 A;  3ZG5 A;  5FAT A;  4BQM A;  1ESU A;  4OOM A;  3HUO A;  3LO7 A;  1FCM A;  2EXA A;  3P98 A;  1PZP A;  5FAO A;  3VSL A;  4Z9Q A;  2OSU A;  3B3X A;  2V1Z A;  4R3B A;  2Y2K A;  3IXH A;  3ISG A;  4X68 A;  3GVB A;  2ZQ7 A;  1CEF A;  3BM6 A;  4IBR A;  4LV3 A;  3RXX A;  2ZM0 A;  4FSF A;  3WS4 A;  3FV7 A;  3JYI A;  5CER A;  4N1H A;  4ZAM A;  2WGI A;  4IVK A;  3IF5 A;  1YM1 A;  4QB8 A;  5HFO A;  2Z2M B;  2Y2O A;  3IWQ A;  4ZBE A;  4OLG A;  1E3U D;  3S22 A;  2VGK A;  5HW3 A;  1S6R A;  2QMI A;  5EE8 A;  4KZ8 A;  2OV5 A;  5HAQ A;  4QJG A;  1NXY A;  3Q07 A;  4HEF A;  4KZ7 A;  4OLD A;  4JF4 A;  1E4D A;  1K38 A;  1MWU A;  3Q81 A;  5AQ7 A;  1XKZ A;  3A3I A;  5FI7 A;  4S2M A;  3V3S A;  1ES5 A;  5EVI D;  1ZKJ A;  5IHV A;  1TDG A;  1IYS A;  1L0D A;  3QNB A;  4Y0T A;  5GL9 A;  5HAR A;  3VFH A;  3BLS A;  1MPL A;  5HAI A;  1YQS A;  5CHM A;  1JWP A;  4OPQ A;  4KQQ A;  3LCE A;  4L0L A;  4LV0 A;  3CZD A;  1XPB A;  5E2E A;  4EUZ A;  2Z2L B;  4FD8 A;  4N1X A;  4P6B A;  4KZ5 A;  5HAP A;  1XA7 A;  4UA6 A;  1IKG A;  5CGW A;  1BZA A;  4GD8 A;  2XGN A;  3Q1F A;  2HDU A;  2ZLY A;  1WYB A;  2JE5 A;  3BEB A;  3ZNT A;  3FKV A;  1TDL A;  1NZU A;  4S2J A;  3MZF A;  4GZB A;  4KEN B;  2ZQA A;  3UY6 A;  4IVI A;  1IYO A;  1PZO A;  2J8Y A;  4RA7 A;  2FFF B;  3PBQ A;  4XUX A;  1YLT A;  1LI9 A;  1QMF A;  3PBT A;  4PM9 A;  3G30 A;  5F1G A;  5EEC A;  5G18 A;  4NK3 A;  3VP0 A;  1G68 A;  3A3F A;  1NZO A;  3QNC A;  2G2W A;  1NYY A;  5FI2 A;  2DRW A;  1NY0 A;  2WZX A;  5FQM A;  4U3T A;  4CJN A;  4UAA A;  2IWD A;  3M6H A;  4WZ4 A;  4X69 A;  5CED A;  3FWL A;  1KDW A;  5AQB A;  3A3D A;  2X02 A;  2ZC7 A;  1JTD A;  1K6S A;  3ZDJ A;  4BD1 A;  1JWZ A;  4OOY A;  1SDN A;  2XR0 A;  3IXG A;  1RGZ A;  5GLB A;  4QY5 A;  1KVL A;  4U0X A;  4WZ5 A;  4FH2 A;  2EFU A;  4P0M A;  1BTL A;  1EI5 A;  1M40 A;  2EX6 A;  3LY3 A;  3QHY A;  3IF6 B;  4OQH A;  1BLP A;  5FQQ A;  5KSC A;  2JC7 A;  3OPL A;  4S2K A;  2ZJ9 A;  1KVM A;  4OPZ A;  3C7V A;  1LI0 A;  4BD0 A;  3SOI A;  4FH4 A;  3FZC A;  2V20 A;  2BG1 A;  4DE3 A;  3WS5 A;  4GNU A;  4XUZ A;  2H10 A;  4LV1 A;  3ZVT A;  4R4R A;  3WS0 A;  3NDE A;  3VP1 A;  4M3K A;  5DTK A;  1BUL A;  1GA0 A;  1LL9 A;  2JCH A;  2Y91 A;  4K0X A;  5GLD A;  1VM1 A;  2QPN A;  2BLS A;  2ZMA A;  2J9O A;  2PU2 A;  4WMC A;  3PAE A;  4S2N C;  1NYM A;  1SKF A;  2Y2L A;  5FAS A;  4DDS A;  4OON A;  1YMS A;  3MZE A;  5A91 A;  1HD8 A;  1KGE A;  1PW8 A;  4JPM A;  3Q7V B;  2XDM A;  1PW1 A;  1W79 A;  3VOZ A;  4PMA A;  3BFE A;  3IQA A;  2I72 A;  4OQG A;  4Q8I A;  4RYE A;  1MKI A;  3C4O A;  3C4P A;  3LY4 A;  4RVA A;  3EQV A;  4YIN A;  5CRF A;  3IWO A;  3W4P A;  1IEM A;  5TFQ A;  1ERQ A;  1GHP A;  2XQZ A;  3OZH A;  4R1G A;  3NC8 A;  1YT4 A;  1XP4 A;  4DKI A;  2H0Y A;  1KDS A;  3GQZ A;  1XX2 A;  4GDN A;  4R0Q A;  4XXR A;  2Y2P A;  1K6R A;  5EOO A;  1K54 C;  2HP9 A;  1Q2Q A;  2EX2 A;  5CTN A;  5F1F A;  4MLL A;  2EX9 A;  3S4X A;  3DW0 A;  5CEC A;  1RGY A;  2ZQC A;  5FQ9 A;  5FQJ A;  4E3O A;  2XFT A;  4HBT A;  4EBN A;  3IF6 A;  3HUM A;  2J9P A;  1C3B A;  1G6A A;  1FCN A;  1W8Y A;  3DWK A;  4GOG A;  4KG2 A;  1H8Z A;  5CXW A;  3GRJ A;  3BRM A;  2HP6 A;  3GV9 A;  4DF6 A;  3GMW A;  5EVI C;  3WRZ A;  3UPN A;  4MBK A;  3BFC A;  4EBL A;  3G35 A;  2Y2G A;  5EVL A;  1CEG A;  3AGF A;  1DJB A;  4E6W A;  3MKF A;  1KGF A;  3VP3 A;  2Y2N A;  1N4O A;  2B5R A;  1K25 A;  4Y7P A;  2RL3 A;  4E6X A;  4RX2 A;  4OP5 A;  3UDX A;  5AQ9 A;  3FKW A;  3OCN A;  1BSG A;  3BLM A;  1XA1 A;  3UN7 A;  4D2O A;  4MBF A;  3BYD A;  4HBU A;  1KE0 A;  5TR7 A;  3W8K A;  4HES A;  3TG9 A;  3PBN A;  4JLF A;  1SHV A;  5CTM A;  2WZZ A;  1ES4 A;  1LL5 A;  5U47 A;  3Q7V A;  5DF9 A;  1GCE A;  1CI8 A;  1L0F A;  3GTC A;  1AXB A;  1RP5 A;  1PWD A;  2JBF A;  2XLN A;  3CMZ A;  3NDG A;  4UHU A;  2ZQ9 A;  3SS3 A;  4OVD A;  1ZC2 A;  3G2Y A;  1XXM A;  2Y55 A;  4KZ6 A;  3ZFZ A;  5M19 A;  5A93 A;  2C5W B;  2Y2Q A;  3ITA A;  3E2K A;  5EUA A;  4S2I A;  1H5X A;  2Y2H A;  4E3I A;  1KE4 A;  4JXV A;  3OPR A;  4ZTK A;  2ZD8 A;  3WWX A;  3NY4 A;  1TEM A;  3VSK A;  3VMA A;  2UWX A;  3GSG A;  3ZG7 B;  5GHZ A;  3CJM A;  3G31 A;  4OOL A;  4JF6 A;  4DRT A;  2XD5 A;  4KZ3 A;  4JXS A;  2X01 A;  3HLE A;  3UPO A;  4QHC A;  2DCF A;  3N8S A;  3UE1 A;  1ESI A;  4EQI A;  3D4F A;  3IXD A;  3ZHH A;  1BUE A;  2ZC6 B;  3EQU A;  4P85 A;  1ERO A;  1W5D A;  2OLU A;  5M1A A;  2IWB A;  3W4Q A;  1PIO A;  4Y0U A;  4E3M A;  3MFD A;  4MBH A;  3WS1 A;  1ERM A;  1K57 C;  1KE3 A;  5F82 A;  4BL2 A;  2J7V A;  1H8Y A;  4QU3 A;  4WMC D;  5GLA A;  4PM5 A;  3UE3 A;  3ZGA B;  3G32 A;  4QD4 A;  1FSY A;  1LLB A;  4N9K A;  4GD6 A;  2GDN A;  2Q9M A;  1K55 C;  2FFY A;  1ZG4 A;  4QY6 A;  2EXB A;  2WGW B;  2H5S A;  3RJU A;  3MXS A;  3UO9 A;  4K0W A;  5CEB A;  2Y2M A;  2PBY A;  2HDQ A;  1PWC A;  3ZG0 A;  5BOH A;  2A3U A;  1PI5 A;  4OQ0 A;  4EWF A;  4LCM A;  1Z6F A;  2DNS A;  4CPK A;  3BFG A;  1YLW A;  4KQO A;  3VP2 A;  1MY8 A;  3ITB A;  3BFD A;  3G2Z A;  4S2L A;  3I7J A;  4X53 A;  4UA7 A;  5GHX A;  4C6Y A;  4E3N A;  5CGS A;  3BEC A;  5DF7 A;  2OLV A;  3IH8 A;  5EPH A;  4WEL A;  4FCF A;  5DF8 A;  5CHJ A;  3V3R A;  4B88 A;  4JKT A;  4ZDX A;  2C6W B;  4LEN A;  2R9X A;  4H8R A;  3DWZ A;  3SH7 A;  3P09 A;  1Q2P A;  2WAD A;  2XK1 A;  2CC1 A;  4KG6 A;  4PM6 A;  2EFX A;  3ZNY A;  1I2S A;  1FSW A;  3HLW A;  1MWT A;  4P87 A;  3W4O A;  5KMW A;  3PBS A;  4WBG A;  5E2F A;  4WEK A;  5FA7 A;  3WS2 A;  1BLS A;  1IYP A;  1JVJ A;  3HLG A;  2XEP A;  3HBR A;  3M2K A;  4OH0 A;  4MNR A;  2Y2I A;  3SH8 A;  3IHB A;  4UA9 A;  3UDF A;  2IWC A;  1I5Q A;  1O7E A;  3MBZ A;  1FR1 A;  3RXW A;  5FAQ A;  5EVI B;  1SDE A;  3Q82 A;  1ES2 A;  1ES3 A;  4DDY A;  2QZ6 A;  1MWS A;  3NBL A;  4EV4 A;  1TVF A;  4ID4 A;  2HDS A;  1WYC A;  2EX8 A;  4YFM A;  3TOI A;  3V39 A;  2H0T A;  1FCO A;  2XH9 A;  4KZB A;  4F94 A;  2HP5 A;  3MZD A;  2WGW A;  1ALQ A;  2WUQ A;  5I94 A;  4OP8 A;  5AQA A;  3VFF A;  3OPH A;  4C3Q A;  4GDB A;  5EOE A;  4S2N A;  3S1Y A;  1BLC A;  1HVB A;  4C75 A;  3GR2 A;  3HLB A;  5A90 A;  3HRE A;  2WYX A;  4E3J A;  4IED A;  1QME A;  4DE2 A;  1O07 A;  4KG5 A;  1MXO A;  3HVF A;  5F83 A;  5JYO A;  3ZCZ A;  4BJP A;  4R4S A;  3IHA A;  4GB7 A;  2WAE A;  4EBP A;  1Y54 A;  1W8Q A;  3OPP A;  3Q7Z A;  4KZ9 A;  3N4I A;  4WM9 A;  2WK0 A;  3OCL A;  4KZA A;  3AGE A;  4BLM A;  1YLJ A;  4WZ5 C;  5FI6 A;  3A3J A;  3M6B A;  1DJC A;  3C5A A;  2WKI A;  1J9M A;  4R3J A;  2WGV A;  3CG5 A;  3O88 A;  5HX9 A;  2HPB A;  4WYY A;  5FDH A;  2WAF A;  3PAG A;  4X56 A;  3WRT A;  3O86 A;  2HDR A;  1K54 A;  3V50 A;  1MBL A;  5FAP A;  1ZG6 A;  1XGJ A;  5DVA A;  1BLH A;  1RCJ A;  2PU4 A;  3LEZ A;  4X55 A;  3ZG9 B;  1E3U A;  4DXB A;  1E25 A;  4OPY A;  4PM8 A;  1S0W A;  2ZQ8 A;  4R23 A;  1IYQ A;  3TSG A;  4OQI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...