3O87A

Crystal structure of ampc beta-lactamase in complex with a sulfonamide boronic acid inhibitor
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
358
structure length
351
Chain Sequence
APQQINDIVHRTITPLIEQQKIPGMAVAVIYQGKPYYFTWGYADIAKKQPVTQQTLFELGSVSKTFTGVLGGDAIARGEIKLSDPTTKYWPELTAKQWNGITLLHLATYTAGGLPLQVPDEVKSSSDLLRFYQNWQPAWAPGTQRLYANSSIGLFGALAVKPSGLSFEQAMQTRVFQPLKLNHTWINVPPAEEKNYAWGYREGKAVHVSPGALDAEAYGVKSTIEDMARWVQSNLKPLDINEKTLQQGIQLAQSRYWQTGDMYQGLGWEMLDWPVNPDSIIALAARPVKAITPPTPAVRASWVHKTGATGGFGSYVAFIPEKELGIVMLANKNYPNPARVDAAWQILNALQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactamase
publication title Design, Synthesis, Crystal Structures, and Antimicrobial Activity of Sulfonamide Boronic Acids as beta-Lactamase Inhibitors
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 116
structure length 351
sequence length 358
chains with identical sequence B
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2010-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00144 Beta-lactamase Beta-lactamase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 3o87A00
2Y2HA 3VOYA 1KE4A 1O7EA 4K91A 4R0QA 4A5RA 3WRZA 4JBFA 3ZG5A 1LI9A 4WEJA 4WMCD 4LV1A 4OKPA 4KQOA 2P9VA 5CEBA 5DTTA 3BLMA 1S0WA 1RCJA 2ZJ9A 4IVKA 3IH8A 2WGWA 3PTEA 4EQIA 5HFOA 1GA0A 4C6YA 2DCFA 1CI8A 3ISGA 3NI9A 3HLDA 4OQ0A 4KG6A 2Y2NA 5EECA 2ZQDA 4B88A 4QHCA 1NJ4A 5FQIA 1N9BA 1J9MA 3Q1FA 3IT9A 3SH9A 2V1ZA 3MZEA 4LV0A 5EE8A 3BFGA 3CZDA 2Y2IA 3GQZA 4K0XA 2HP9A 1XP4A 3UY6A 1HZOA 3ZG7B 4S2LA 1K55A 1E3UD 3N6IA 1E25A 2G2UA 2WK0A 3Q82A 2B5RA 4CJNA 1GHMA 3Q81A 4ZJ1A 3LY4A 3Q7VA 1ALQA 2VGKA 3HREA 3W4PA 1I2WA 3FWLA 1EI5A 4R1GA 3BFDA 1FCNA 1NY0A 3G2YA 3PBQA 5DF8A 4OQIA 2HDRA 3G31A 4KZ9A 3N8SA 1JVJA 5FATA 4B4XA 4BD0A 4DXCA 5FQMA 2WKIA 2XR0A 3WS2A 3DWKA 5DVAA 4ZDXA 2QMIA 4BLMA 1QMFA 1ZG6A 4FH2A 3BECA 4M3KA 3W4QA 3IXBA 3MKFA 2Y55A 2QZ6A 3VP4A 3UPOA 1PWGA 5G18A 4OOMA 1Z6FA 5HX9A 3VSKA 3IXDA 1LL5A 3MZFA 4BJPA 3C5AA 3ZNYA 4U0XA 2PU4A 1IKGA 4OP5A 4EBPA 2DRWA 2EFUA 4LCLA 2R9WA 4WZ4A 1IYQA 1XXMA 4BD1A 5EVIB 1ES3A 4KQQA 1W7FA 2XD5A 2WGVA 5FAOA 1M40A 4LCMA 5FQJA 4E3OA 4JXWA 3MKEA 1CEFA 5M19A 2WADA 2WAEA 3LO7A 1MY8A 3HLBA 4PMAA 3AGFA 1TEMA 3G30A 3ZGAB 1RGZA 1W79A 3FKVA 1IEMA 1SDEA 4JXVA 4Y0TA 5DTSA 4MLLA 3O88A 3SH7A 1WYBA 4RVAA 3IF6C 4R4SA 1XA7A 2P9VB 2XFTA 5TGFA 1SCWA 4GOGA 4UAAA 3N8RA 1XX2A 1JTDA 5E43A 2Y2MA 5FA7A 4ID4A 3NCKA 4KZ8A 1BT5A 3SOIA 3JYIA 3QNCA 2EXAA 4YFMA 2A49A 3HLWA 3HBRA 3V50A 2PU2A 1L2SA 4L0LA 1HTZA 1FQGA 4OPZA 4EUZA 1FSYA 2J8YA 3UDFA 3A3EA 1LL9A 1W8QA 3RXWA 3PBNA 2ZD8A 3DWZA 3HUMA 1L0DA 4QD4A 3VFFA 5EVID 2DNSA 2Y59A 5EPHA 2ZC7A 1IYPA 3HVFA 4ZBEA 2WGIA 2HDSA 1BSGA 1K25A 1TVFA 2WKHA 2Y2PA 4RA7A 4X6TA 2XGNA 5J8XA 2OLVA 4BL2A 4U0TA 3PBRA 3HL9A 3IF5A 3V5MA 3ZHHA 3N4IA 3B3XA 1KE0A 5CRFA 4Y0OA 1EROA 3IF6A 1ZG4A 5FQKA 2XK1A 2IWDA 2Y2QA 5M18A 4RYEA 5E2FA 2RCXA 2C5WB 3Q7ZA 4R23A 4LV3A 1KDWA 4GZBA 3P98A 4XXRA 3V39A 3VP3A 3HUOA 3OPRA 1BUEA 2XQZA 5E2GA 1I5QA 5GLCA 1ERMA 2JC7A 4S2PA 2HDQA 3LEZA 4GNUA 4FCFA 2A3UA 3GV9A 3EQVA 3N7WA 2XH9A 3GMWA 4ZJ3A 1U60A 1K54C 5U47A 5GLDA 3ZG9B 4EBNA 1E4DA 1FCOA 4IVIA 5EVLA 1MWRA 1GA9A 3HLEA 4OOYA 4DRTA 2H0YA 1ONHA 1PW1A 4KG2A 3CJMA 3C4PA 1HVBA 3CG5A 2X01A 4PM6A 1BLCA 3NDEA 1LHYA 3SS5A 4OQGA 3C7UA 3WWXA 3ZNTA 2H10A 1MWUA 2ZMAA 4MBFA 5CERA 2WKEA 5L2FA 1L0FA 4GD6A 4KZ6A 5HL1A 4JF4A 1GHIA 1YMXA 4OLGA 3PBSA 3UDIA 5A93A 5KSCA 2WUQA 3VMAA 3SS4A 4UA6A 2R9XA 5GLAA 1OMEA 3UE0A 1MXOA 1FR1A 3NIAA 1MWTA 4OVDA 3ZG0A 4ZAMA 5HAPA 4PM8A 4DE2A 3MXRA 4R3BA 2X71A 2XDMA 3ZCZA 4P0MA 1ESUA 3V3SA 3M2JA 3TG9A 4K0WA 1KGEA 1ESIA 5HW3A 5E2EA 3N8LA 4X55A 1NYMA 4C3QA 1IELA 3RXXA 5A92A 4FD8A 1IKIA 2ZQAA 1L0EA 2Q9MA 3BLSA 3OC2A 5I94A 4DF6A 3MXSA 3G35A 4N1XA 5EOEA 4C75A 5FI7A 4CPKA 4RX2A 4F94A 1ZKJA 4X53A 4OPRA 2RL3A 3SH8A 3DTMA 1TDGA 2OSUA 1K56A 2Y2LA 4EV4A 1BLPA 4N1HA 3IF6B 3BRMA 1BLHA 5EOOA 1EWZA 3PAGA 4JF5A 4OONA 3IHAA 4DDYA 4E3IA 3OCLA 3I7JA 3TSGA 1RP5A 4P85A 1YMSA 1XKZA 2Y4AA 2ZQCA 4HEFA 4KZAA 4OP8A 5AQ9A 1E3UA 1H5XA 1G6AA 2G2WA 2PBYA 2WYXA 4OPQA 4E6WA 4KENB 1I2SA 3UE1A 4S2OA 2HP5A 1S6RA 2EFXA 5A91A 5F83A 3UPPA 4DE3A 1Q2PA 4O7DA 1FCMA 4ZTKA 3RJUA 4GKUA 5FASA 3G4PA 3UN7A 4KZ4A 4H8RA 4JF6A 2GDNA 1SHVA 1NXYA 4BQMA 2E8IA 2WGWB 3WS5A 3HLFA 3V3RA 5CHUA 2XD1A 4E3KA 3UO9A 4OQHA 4HBTA 5AQBA 1GCEA 5HAIA 4GD8A 1KVLA 5KSHA 3IWQA 1XGJA 1K57C 3ITBA 5BOHA 4WYYA 1JWPA 4MNRA 3HLGA 3NC8A 3WS0A 3VFHA 1NZUA 4XUZA 5CHMA 5EVIC 5FAPA 2Y2KA 4JPMA 2OLUA 1NYYA 3VP0A 5GL9A 1IYOA 3M2KA 3W8KA 3Q7VB 4JXSA 2P74A 2ZC4B 3HUNA 4DDSA 3PBTA 4QY5A 4HBUA 1SDNA 4P6BA 2QPNA 1ES5A 2H5SA 5KZHA 4UA9A 1DJAA 1PI5A 5FI6A 3QHYA 4WEKA 3ZVWA 3LY3A 4OLDA 4U3TA 2J9OA 1YLJA 2V2FF 4WZ5C 1L0GA 1YLWA 4E6XA 3LCEA 1KVMA 4OPYA 4OOLA 2J9PA 2JE5A 2WAFA 4YINA 3VSLA 2C6WB 1FSWA 1YLPA 3VP2A 4P87A 1KDSA 3UDXA 3PAEA 5FI2A 3UPNA 4RX3A 2WZXA 3G32A 1LI0A 1PWCA 4Y0UA 2EX9A 3O86A 1K57A 2BLSA 2Y2GA 2ZC5B 5FAQA 5HAQA 4B4ZA 5KMWA 4PPRA 4JXGA 4GDBA 4KZBA 3UNWA 5EVIA 2FFFB 4Y7PA 1SKFA 2HP6A 3BFCA 3BFEA 3C4OA 5GHXA 4Z9QA 1GHPA 3IWIA 1FR6A 4XUXA 5CTNA 3WRTA 2ZM8A 4D2OA 5JYPA 3C7VA 4FSFA 4E3NA 4QY6A 2ZC3B 1WE4A 5TFQA 3S22A 3BM6A 3A3FA 2CC1A 5FSRA 3FV7A 5DF7A 5AQ7A 3IWOA 3ZG8B 1KGGA 5F82A 4WZ5A 1G68A 4R4RA 2EX6A 4MBHA 1YLTA 4PM7A 5EUAA 1JWVA 3GVBA 4S2NC 3UE3A 4QJGA 1PIOA 1HD8A 1PYYA 2ZC6B 4LV2A 1IYSA 2XLNA 4DE1A 1WYCA 3GSGA 3HLCA 4N92A 3Q07A 3E2KA 3IXHA 4LENA 5FDHA 1O07A 3A3JA 1XPBA 1PZOA 2JBFA 3OCNA 1K56D 3AGDA 4S2IA 4X68A 3G2ZA 3IQAA 1FOFA 4WMCA 3MZDA 3O87A 5AQAA 1MPLA 3O3VA 4MBKA 1K54A 2Q9NA 1YLYA 1K38A 1JWZA 2ZQ9A 1PWDA 3NBLA 4QU3A 1MBLA 1C3BA 3ITAA 2JCHA 3DW0A 3P09A 4PM9A 5IHVA 4DXBA 4S2JA 4Q8IA 1ES4A 3ZVTA 3S1YA 1RGYA 5JYOA 1M6KA 2Y91A 4FH4A 1NZOA 3QNBA 3W4OA 4S2MA 3NDGA 4S2KA 1DY6A 2XEPA 3GR2A 3S4XA 1QMEA 4HESA 5F1GA 4JLFA 3GRJA 1K6RA 2XF3A 5E2HA 1BLSA 3FKWA 5GHYA 1ERQA 4E3MA 3BFFA 4X69A 4S2NA 1YM1A 1Q2QA 4WM9A 4NETA 5CGWA 2ZQ8A 4KG5A 3ZFZA 3MBZA 3PBOA 1W8YA 4NK3A 4UHUA 4IBRA 5CXWA 4GB7A 1YLZA 1ONGA 4R3JA 3CMZA 4PM5A 3IH9A 1NRFA 2WZZA 1KGFA 2Z2LB 3OPLA 2FFYA 1BTLA 2VGJA 5FQ9A 3A3IA 2UWXA 4KZ3A 5DF9A 4IBXA 4EBLA 5CEDA 1KE3A 5HARA 2ZQ7A 1YQSA 2IWCA 3OZHA 2BG1A 3AGEA 1PZPA 4DKIA 1VM1A 2V20A 4WBGA 1DJCA 5CGXA 4EWFA 2Y2JA 2HDUA 4GN2A 1K4EA 1CK3A 3EQUA 4KZ7A 1Y54A 4IEDA 1K6SA 5M1AA 1PW8A 5CECA 1AXBA 1CI9A 4N9LA 4JKTA 4WELA 3WS1A 3D4FA 5CTMA 1TDLA 4UA7A 3OPHA 3M6HA 4BENA 2EX2A 1ZC2A 1YT4A 3ZDJA 2OV5A 3VOZA 4ZJ2A 4X56A 4E3JA 3BYDA 4N9KA 1CEGA 1LLBA 2Y2OA 3G34A 3M6BA 5CHJA 1H8ZA 5GHZA 4KQRA 1XGIA 5DTKA 1W5DA 3IHBA 2XFSA 1BZAA 1XA1A 3E2LA 3NY4A 3FYZA 3OPPA 5CGSA 4BL3A 1BULA 4DE0A 1ES2A 1K4FA 2EXBA 3SS3A 3MFDA 3FZCA 1H8YA 5F1FA 2EX8A 1PI4A 1N4OA 5GLBA 1MWSA 3IXGA 3VP1A 2ZM0A 3WS4A 2ZLYA 3BEBA 5A90A 3TOIA 1MKIA 5TR7A 4MEZA 4OH0A 2HPBA 1JTGA 4GDNA 2IWBA 2Z2MB 2ZM2A 3GTCA 4E3LA 2J7VA 1K55C 4QB8A 1VQQA 3A3DA 2H0TA 2I72A 1DJBA 5D3OA 4KZ5A 5FQQA 2X02A
chains in the Genus database with same CATH superfamily
2Y2HA 3VOYA 1KE4A 4K91A 4YOFA 4JBFA 4HJ3A 4GW9A 4G3WA 4LV1A 5DTTA 1RCJA 2ZJ9A 2VZWA 4BWIA 3LR3A 2Y2NA 1VETA 5FQIA 3GECA 4LV0A 2HP9A 3ZG7B 2JN7A 4XT2B 4S2LA 3KSFA 3N6IA 3Q82A 3W4PA 3IBJA 2QWSA 1FCNA 1NY0A 5DF8A 3PBQA 1MZUA 2HDRA 3G31A 4KZ9A 3CITA 2XRNA 2WKIA 3GDIA 3C30A 4I3AA 4M3KA 4GS9B 1S67L 1OT6A 3E0YA 4EESA 4EEPA 3F1PB 3T4TA 3MZFA 3MFXA 2ACGA 4LCLA 4Q0IA 4KQQA 1YSQA 1W7FA 5FAOA 2WGVA 1M40A 2K2NA 3T1SA 1MY8A 3HLBA 4PMAA 1W79A 4Y0TA 3O88A 1XA7A 1F9IA 2P9VB 5TGFA 3N8RA 2QYBA 5FA7A 1N9LA 3NCKA 1OTAA 3JYIA 2EXAA 3HCYA 2A49A 1XFQA 1FQGA 2J8YA 3A3EA 3DWZA 3HUMA 4QD4A 5EVID 4MCWA 1K25A 4H6JA 4RA7A 4I38A 2OLVA 4HY8A 4U0TA 3V5MA 3ZHHA 3T4OA 2GNXA 5CRFA 3UB6A 1ZHHB 3H9WA 3PHYA 4XXRA 3V39A 3VP3A 3HUOA 5GLCA 2XQZA 3T4QA 4ARZA 3DAVA 4LRYC 4LPZA 2HJ9C 3GMWA 1U60A 4F3LB 5U47A 2KDKA 1NLZA 1FCOA 3SZTA 4KG2A 3OOVA 1HVBA 2X01A 5AJGA 2V8CA 4OQGA 3WWXA 1MWUA 1TS7A 5L2FA 5HL1A 2PHYA 5A93A 2WUQA 1EW0A 1OMEA 2M7VA 1FR1A 2L0WA 3ZG0A 1UGUA 4PM8A 2K7SA 4LRXC 2O9AA 4R3BA 2X71A 3MJQA 4IUKA 4P0MA 4ETXA 3N8LA 4X55A 1LT0A 1NYMA 5A92A 3BLSA 1L0EA 2Q9MA 1P9RA 4X25A 5I94A 4DF6A 3G35A 4CPKA 1ZKJA 4OPRA 3S7NA 3SH8A 3DTMA 3R7WA 1K56A 4E04A 3QP8A 4N1HA 3BRMA 5EOOA 1EWZA 3PAGA 4OONA 3IHAA 4HIAA 2V1BA 5DKKA 4PKYA 4II7A 1G6AA 2PBYA 4GLQA 4OPQA 4MN5A 2HP5A 4ZTKA 3RJUA 2VEAA 4GHIB 3TJZC 4KZ4A 3UN7A 1NXYA 3BWLA 4NXFA 5I5LA 3V3RA 5CHUA 5EVEA 1VHMA 3LR5A 3T12B 4UQIM 2WKQA 5DJUA 3IWQA 3F1NB 1W63M 3BQAA 4BBTA 5BOHA 2Y2KA 4JPMA 4X1MA 4UQIS 1IYOA 3M2KA 3W8KA 5J4EA 4JXSA 3HUNA 3PBTA 3BJNA 2B02A 1SDNA 1DJAA 1PI5A 3LY3A 1LSXA 3CLOA 5FEFA 1YLWA 2L1MA 2O0YA 3EWKA 3VSLA 5EV0A 2C6WB 2I9VA 4FTXA 4P87A 1LI0A 2WKRA 4Y0UA 2ZL1B 3B33A 2Y2GA 5FAQA 3VE4A 4PAUA 3CPTB 2FFFB 3C4OA 5GHXA 3IWIA 4EERA 1TF1A 2ZC3B 2VV6A 2L4RA 5FSRA 3IWOA 4I5SA 3ZG8B 1P97A 4R4RA 5IS1A 1JWVA 3UE3A 3LIFA 1IYSA 1WYCA 2PRFA 3GSGA 3LUQA 4S2IA 1PZOA 1K56D 3IQAA 3O87A 3O3VA 1YLYA 1PWDA 1MBLA 4DXBA 4PM9A 3IS2A 1RGYA 1NZOA 3KO6A 3QNBA 3W4OA 2E8JA 1WA9A 2AVXA 3KSGA 2A24A 3GRJA 5E2HA 3FKWA 1OT9A 3QP4A 3CHWP 4WM9A 4NETA 5CGWA 4HNBA 2J80A 3MBZA 3PBOA 3G6OA 4GB7A 2BTFP 5DFYA 2H28A 3IH9A 4G3VA 2VGJA 4KZ3A 5DF9A 1S1YA 5HARA 4DJ3A 4DKIA 2V20A 4WBGA 1YPRA 2Y2JA 2HDUA 4BBUA 4XT2A 4JKTA 3D4FA 1TDLA 2EX2A 3VOZA 3KYQA 4E3JA 1IOUA 4N9KA 3KX0X 1T1CA 4KQRA 2W3EA 5DTKA 2XFSA 3E2LA 1MC0A 4DE0A 3SS3A 5HDDA 1N4OA 4CLCB 1LSVA 3F1PA 2ZM0A 2ZLYA 2Q0OA 3E98A 2HJEA 4GDNA 3GTCA 2J7VA 1K55C 3A3DA 2I72A 3UB5P 4KZ5A 1Z09A 5FQQA 4P6ZS 1O7EA 3H7WB 3EGDC 4R0QA 1OPXA 4A5RA 2V9AA 3ZG5A 1LSWA 3UMDA 5CEBA 2P9VA 1S0WA 4EQIA 1CI8A 3ISGA 5EECA 1W63Q 5EE8A 3BFGA 3GQZA 2Y2IA 1SKOB 1HZOA 2QHKA 3MF0A 1K55A 1E3UD 4CJNA 1GHMA 1VEUA 3LY4A 4ZJ1A 4L9EA 4R1GA 4BBVA 3G2YA 4HJ6A 1JVJA 4DXCA 3D3OA 3LR4A 5HL6A 5DVAA 2QMIA 4BLMA 3K3DA 3W4QA 3IXBA 3MKFA 2Y55A 1Z6FA 1LL5A 2PD8A 3C5AA 2PU4A 5F5YA 5G4YA 1IKGA 4OP5A 4F3LA 2ZBBA 4ZRRA 5M19A 2VGLM 3LO7A 3SH7A 4MLLA 1WYBA 4DJ2A 5J3WA 4RVAA 4R4SA 2W1TA 1TS8A 1XX2A 2Y2MA 1Y28A 3B42A 4KZ8A 1BT5A 1K0KA 3SOIA 4PHTA 3LI8A 1F5MA 4OPZA 1FSYA 1W8QA 3RXWA 1L0DA 4I3IA 4NXEA 2Y59A 5EPHA 4O8GA 1IYPA 4ZBEA 3IS2B 2WGIA 1UWPX 1BSGA 1TVFA 3DTEA 2XGNA 1J3WA 3N4IA 2JKTM 3P01A 3H82B 1EROA 1ZG4A 5FQKA 1DRMA 2RCXA 1ZTUA 3NJAA 4WL9A 5E2GA 2EA9A 1T1AA 4GHIA 4S2PA 2HDQA 3LEZA 4GNUA 3T4SA 3EQVA 4Y13A 2Y79A 4ZJ3A 3CAXA 1K54C 4IVIA 3FC7A 1GA9A 4NKPA 4I39A 5KIZA 4CLCE 3C4PA 1P0ZA 3F1NA 2H10A 4NG2A 4GD6A 4JF4A 1OTIA 3UDIA 3PBSA 3UE0A 5A8BA 1MWTA 3MXRA 1T18A 2XDMA 3TE8A 3M2JA 1ESIA 5E2EA 3LICA 4C3QA 4FD8A 3OC2A 3K2NA 5EOEA 3LIAA 4RX2A 5LBRA 4X53A 2RL3A 1TDGA 2ZL1A 1CF0A 3QP5A 3IF6B 3CPTA 4EQ1A 4JF5A 4L9GA 1OJGA 3I7JA 3TSGA 4P85A 2Y4AA 5AQ9A 4E6WA 4KENB 3UE1A 1S6RA 3UPPA 5F83A 4DE3A 3MS6A 5IT5A 2NUTC 5FASA 3G4PA 4JF6A 3T4KA 1SHVA 3PR6A 2E8IA 2HZ5A 2XD1A 4OQHA 5AQBA 4YNRA 4GD8A 5HSQA 2VJWA 1SZVA 4JGPA 1K57C 4Q0JA 1OTBA 3QP2A 3WS0A 2JKFA 4XUZA 3JPUA 5CHMA 3VP0A 3D9YA 1VEUB 2FZ0A 3MQQA 4DDSA 4QY5A 1S1ZA 4P6BA 4UA9A 5FI6A 4WEKA 2J3TC 2J9OA 4WZ5C 1L0GA 1T1BA 3UPNA 5FI2A 1K57A 2BLSA 1T19A 5HPFA 5KMWA 4GDBA 2XA7M 5HWTA 3UNWA 3VOLA 4Y5FA 3MMHA 1G5UA 3LIBA 3WRTA 4CLCC 4B9OA 5JYPA 5MC7A 3C7VA 3P7NA 4E3NA 4QY6A 3U4LP 2VKSA 2XA7S 3S22A 3BM6A 3A3FA 5K5BA 5AQ7A 2W1TB 1OTEA 4WZ5A 1YLTA 3IX8A 4PM7A 3GVBA 1PNEA 1H8MA 4S2NC 1PYYA 2ZC6B 2XLNA 4LENA 4X68A 3OCNA 3AGDA 4WMCA 1FOFA 3MZDA 4DN0A 4MBKA 2Q9NA 1K38A 2BASA 3NBLA 3HJKA 1C3BA 3DTKA 4FUWA 2JCHA 3P09A 3ZVTA 4CLCA 3S1YA 5JYOA 1M6KA 4FH4A 1G28A 2OWHA 4S2MA 2XEPA 3GR2A 4BMWA 4IJGA 4CQHA 4MN7A 4JLFA 2XF3A 2INWA 3LGOA 3BFFA 4S2NA 1YM1A 2K31A 3C8CA 2MJ6A 3E4QA 4KG5A 1N9OA 3EEAA 3H7WA 1W8YA 4NXBA 4IBRA 4NEED 4R3JA 1HLUP 5HWWA 1KGFA 2Z2LB 1FIKA 2FFYA 5FQ9A 3A3IA 3VV4A 4EBLA 1KE3A 1X0OA 1YQSA 2UV0E 2BG1A 2ZMVA 5CGXA 1CK3A 4KZ7A 1SKOA 1K6SA 4WELA 3WS1A 2QJ7A 4UA7A 3M6HA 4BENA 4ZJ2A 3T4JA 3KYZA 1LLBA 1XGIA 1W5DA 1BZAA 4BL3A 1F2KA 1BULA 1MKMA 3CWFA 1K4FA 1H8YA 1CQAA 2EX8A 5GLBA 3VP1A 1F98A 3BEBA 3TW8A 3TOIA 3MSHA 5TR7A 4OH0A 2HPBA 4UEYA 4B93A 1XJ3A 4E3LA 1VQQA 2CMNA 1DJBA 3WRZA 1LI9A 4WMCD 4OKPA 4EU0A 3BLMA 4IVKA 2KX6A 3PTEA 1VB6A 5HFOA 1GA0A 2O99A 4C6YA 2PBDP 4EW7A 3A0RA 4CLCD 4KG6A 5EM0A 2ZQDA 4QHCA 1J9MA 2JKTI 3IT9A 4WUJA 5CX7A 2V1ZA 2XROA 1XP4A 3UY6A 2LB9A 2GJ3A 1E25A 2G2UA 4MDZA 2B5RA 3Q81A 2VGKA 1I2WA 1EI5A 4OQIA 3H82A 5L10A 5FQMA 2XR0A 3WS2A 3LEQA 3L9KA 4ZDXA 4FH2A 3BECA 3VP4A 3UPOA 1PWGA 4HQAA 3PXPA 5HX9A 4Z1WA 3ZNYA 4I3JA 2DRWA 2EFUA 4WZ4A 1IYQA 1XXMA 1ES3A 2PT7A 4LCMA 5FQJA 4Y2FA 3MKEA 2KLIA 1CJFA 2WADA 2PAVP 1TEMA 3T1QB 3G30A 1RGZA 3FKVA 4JXVA 1IEMA 1SDEA 5DTSA 2V1AA 4R3AA 3VE3A 3IF6C 4Y15A 3T4LA 2XFTA 1SCWA 2G7UA 5E43A 4ID4A 1OTDA 2W1RA 2Z6CA 1XJ6A 3QNCA 5HPIA 4YFMA 3FPVA 3HLWA 3E4OA 3HBRA 1NLYA 3V50A 2PU2A 1G6OA 2VK3A 4L0LA 4R70A 3DTIA 5EFWA 4X1LA 3UDFA 2YKFA 1STZA 3PBNA 1L3LA 4EETB 4JGRA 3HVFA 3FG8A 4Y17A 2WKHA 4P6ZM 1H3QA 3HL9A 3IF5A 3B3XA 4QWOA 4Y0OA 3IF6A 1S66L 2P08A 2XK1A 5M18A 1YKDA 3Q7ZA 4WLAA 1KDWA 3LR0A 1BUEA 4HH3A 3S7PA 5EM1A 1ERMA 2JC7A 4FCFA 2A3UA 2XH9A 2YKHA 3ZG9B 1E4DA 1MWRA 4EUVA 1PW1A 1D06A 3CJMA 2JKGA 4PM6A 1BLCA 1LHYA 5F68A 5L8MA 4MBFA 2WKEA 1L0FA 2KOIA 1GHIA 4OLGA 5KSCA 3VMAA 3SS4A 4NXGA 2R9XA 4UA6A 4RQ9A 5GLAA 3UB9A 3T1XA 3HJIA 4DE2A 3ZCZA 2D02A 1ESUA 3V3SA 5HW3A 1IELA 3RXXA 2ZQAA 3L7HA 3MXSA 1NWZA 2VA0A 2QJ5A 4N1XA 4C75A 5FI7A 4F94A 4KUOA 4HHDA 4EV4A 3LIDA 4WF0A 4DDYA 4IUHA 3OCLA 3ULFA 3RH8B 3OBFA 2ZQCA 4HEFA 1AWIA 1H5XA 3UB7A 1TS6A 2WYXA 1KOUA 1I2SA 4S2OA 4O7DA 3RTYA 4H8RA 2ZMFA 2GDNA 3WS5A 3HLFA 3IX3A 3UO9A 4HBTA 1GCEA 3MXQA 5HAIA 1KVLA 5KSHA 5L07A 3NULA 3MQOA 1XGJA 2V8FA 3ZYTA 5EVIC 1NRJA 5FAPA 4EEUA 3BY8A 5GL9A 3MR0A 2P74A 5TBMB 4HBUA 4LFUA 1ES5A 2H5SA 2VV7A 5KZHA 3A0VA 4U3TA 1YLJA 2V2FF 4E6XA 1S4RA 3LCEA 2WAFA 3OLOA 3K3CA 1KDSA 3UDXA 3PAEA 5DFXA 4RX3A 3NOPC 1ODVA 2EX9A 3RFBA 3UE6A 2ZC5B 5HAQA 1DP9A 3PYPA 4HI4A 5EVIA 4Y7PA 3T50A 5F6AA 4Z9QA 3QP1A 5CTNA 2ZM8A 4D2OA 4LLOB 4QPRA 4LGWA 4FSFA 3QP6A 1WE4A 2PDRA 5TFQA 5TJJA 1KGGA 2OOLA 1G68A 2EX6A 5EUAA 1GSVA 2PYPA 3UB8A 1HD8A 3IX4A 4LV2A 3HLCA 3IXHA 3SW1A 1O07A 1XPBA 3G2ZA 4L9FA 3C38A 1K54A 1JWZA 4QU3A 4KQDA 3ITAA 3LFVA 3DW0A 4S2JA 4Q8IA 4LRZE 3NDGA 4S2KA 3S4XA 1QMEA 5F1GA 2ZOHA 1K6RA 1BLSA 1ERQA 4E3MA 1Q2QA 5HD5A 5AVFA 2ZQ8A 3ZFZA 2J3WA 4NK3A 3JVUA 5CXWA 3BW6A 3OPLA 1OJ5A 3NECA 3A0SA 1BTLA 2B95A 2UWXA 2W3GA 4IBXA 2ZQ7A 2IWCA 3ZQ5A 1PZPA 1D1JA 1DJCA 4GN2A 3EQUA 5M1AA 1PW8A 3W2ZA 1AXBA 4N9LA 2R78A 1ZC2A 3ZDJA 2OV5A 4X56A 4GJ4A 3BYDA 1GSXA 1CEGA 3G34A 3M6BA 1PRQA 3BQ8A 2P04A 1P9WA 3NY4A 5CGSA 2EXBA 3MFDA 5F1FA 1PI4A 1MWSA 3MQ0A 1MKIA 1BYWA 4MEZA 4HP4A 2IWBA 3E4PA 4QB8A 5D3OA 2X02A 4WEJA 1GSWA 4KQOA 1Y4OA 2M1CA 3IH8A 2WGWA 4ESPA 2DCFA 3NI9A 3HLDA 4OQ0A 2EWVA 4B88A 1NJ4A 3NOTC 1N9BA 3Q1FA 3SH9A 3MZEA 3CZDA 4K0XA 4MN6A 2W3FA 5DKLA 2WK0A 1S4SA 1ALQA 3HREA 3Q7VA 3FWLA 2GX5A 3BFDA 2OAQ1 3FPWA 4B4XA 2PR6A 3N8SA 5FATA 4BD0A 1YSPA 3DWKA 1A0KA 3LIEA 1QMFA 1ZG6A 2Z6DA 2O9BA 2OWJA 2QZ6A 3S7QA 4ETZA 5G18A 4OOMA 1UWNX 3S7OA 3VSKA 3IXDA 4BJPA 4U0XA 4EBPA 2R9WA 2VX8A 4BD1A 5EVIB 2XD5A 4E3OA 4JXWA 2HGVA 1CEFA 2WAEA 2W27A 2IA2A 1XJ2A 3AGFA 3ZGAB 3BY9A 4GOGA 2JKRM 2WKPA 4UAAA 3JVVA 1JTDA 2W0NA 1L2SA 1VETB 1HTZA 4EUZA 1LL9A 5HZHA 1YAXA 2ZD8A 3VFFA 4EXOA 2DNSA 2ZC7A 3V67A 2D01A 5C5KA 2HDSA 2Y2PA 4X6TA 5J8XA 4BL2A 3PBRA 1KE0A 3DBAA 3F1OA 2IWDA 2J3TD 2Y2QA 3KSHA 4RYEA 2M7UA 5E2FA 2C5WB 4R23A 4LV3A 4GZBA 3P98A 3OPRA 1I5QA 2EWWA 2GZAA 3O5YA 4D60A 2P7JA 3GV9A 3N7WA 1N9NA 5GLDA 4EBNA 1LL8A 5F69A 5EVLA 1FILA 4OOYA 3HLEA 4DRTA 2H0YA 1ONHA 5L09A 4O0PA 2W3HA 3CG5A 3NDEA 3SS5A 3ZNTA 3C7UA 2V0WA 2ZMAA 5CERA 1TS0A 4KZ6A 1YMXA 1MXOA 3KYEA 3NIAA 4OVDA 5TBMA 4ZAMA 5HAPA 3TG9A 4K0WA 1KGEA 1DP6A 1IKIA 2HV1A 3NOUC 4H6JB 4R38A 3CI6A 4YWZA 2OSUA 2Y2LA 5HD3A 1BLPA 2NUPC 1BLHA 4E3IA 3TRCA 1RP5A 1YMSA 1XKZA 4OP8A 4KZAA 1E3UA 2G2WA 2EFXA 5A91A 1Q2PA 1FCMA 4GKUA 4ARZB 4BQMA 2WGWB 4E3KA 2OAP1 5HWVA 2A2LA 3EEHA 3EGXC 1PFLA 3ITBA 4WYYA 1JWPA 4MNRA 3HLGA 3NC8A 3VFHA 1NZUA 2LB5A 2OLUA 1NYYA 4JGOA 2B18A 3Q7VB 2ZC4B 1JNUA 2XSSA 2QPNA 3C2WA 3QHYA 3ZVWA 4PKYG 4OLDA 3T1RA 2FH5A 1V9ZA 1KVMA 4OPYA 4MMNA 4OOLA 2J9PA 2JE5A 4GS9A 4YINA 1H0MA 1FSWA 1YLPA 3VP2A 2W3DA 2WZXA 3G32A 1DP8A 1PWCA 2Y8HA 3R7WB 3O86A 4B4ZA 4PPRA 4JXGA 4KZBA 4K08A 1SKFA 2HP6A 3BFCA 1D7EA 3BFEA 1GHPA 1FR6A 4XUXA 4Q0HA 4IHQA 2CC1A 3FV7A 5DF7A 5F82A 3EOIA 4MBHA 2PD7A 5HDCA 4KUKA 4QJGA 1PIOA 4DE1A 4N92A 3Q07A 3E2KA 5FDHA 1TD5A 1V9YA 3A3JA 2JBFA 2HF6A 2VLGA 2JHEA 5AQAA 3KSIA 1MPLA 3LYXA 4AFIA 2ZQ9A 3UMEA 5IHVA 1ES4A 1IFQA 4ME4A 2V0UA 2Y91A 1ACFA 1DY6A 3F1OB 4HESA 5AVEA 3LI9A 5GHYA 3CUEC 4X69A 3U2AA 4JGQA 5FEGA 5FL3A 3R4KA 4UHUA 4HH2A 1YLZA 2DMWA 1ONGA 4R6LA 3CMZA 4PM5A 2ZOIA 1NRFA 4FOFA 2WZZA 3IBRA 5DJTA 5CEDA 2QKPA 2O9CA 3OZHA 3AGEA 1VM1A 4EWFA 1K4EA 4HJ4A 4O01A 1Y54A 4IEDA 5CECA 4M4XA 1CI9A 3CUEA 5CTMA 4G3KA 3OPHA 5J7EA 1YT4A 5FDSA 2VGLS 2Y2OA 5CHJA 1H8ZA 5GHZA 3IHBA 4Y3IA 3ICYA 1XA1A 3FYZA 3OPPA 4HP9A 3B47A 4WN5A 1ES2A 5G4ZA 3FZCA 3IXGA 2PYRA 3WS4A 5A90A 4GCZA 2PR5A 1XFNA 2VV8A 1XJ4A 5HDSA 4DMZA 1JTGA 2A24B 3NHQA 2JKRI 2Z2MB 2ZM2A 5IU1A 4HOIA 3D72A 2H0TA
chains in the Genus database with same CATH topology
2Y2HA 3VOYA 1KE4A 1O7EA 4K91A 4R0QA 4A5RA 3WRZA 4JBFA 3ZG5A 1LI9A 4WEJA 4WMCD 4LV1A 4OKPA 4KQOA 2P9VA 5CEBA 5DTTA 3BLMA 1S0WA 1RCJA 2ZJ9A 4IVKA 3IH8A 2WGWA 3PTEA 4EQIA 5HFOA 1GA0A 4C6YA 2DCFA 1CI8A 3ISGA 3NI9A 3HLDA 4OQ0A 4KG6A 2Y2NA 5EECA 2ZQDA 4B88A 4QHCA 1NJ4A 5FQIA 1N9BA 1J9MA 3Q1FA 3IT9A 3SH9A 2V1ZA 3MZEA 4LV0A 5EE8A 3BFGA 3CZDA 2Y2IA 3GQZA 4K0XA 2HP9A 1XP4A 3UY6A 1HZOA 3ZG7B 4S2LA 1K55A 1E3UD 3N6IA 1E25A 2G2UA 2WK0A 3Q82A 2B5RA 4CJNA 1GHMA 3Q81A 4ZJ1A 3LY4A 3Q7VA 1ALQA 2VGKA 3HREA 3W4PA 1I2WA 3FWLA 1EI5A 4R1GA 3BFDA 1FCNA 1NY0A 3G2YA 3PBQA 5DF8A 4OQIA 2HDRA 3G31A 4KZ9A 3N8SA 1JVJA 5FATA 4B4XA 4BD0A 4DXCA 5FQMA 2WKIA 2XR0A 3WS2A 3DWKA 5DVAA 4ZDXA 2QMIA 4BLMA 1QMFA 1ZG6A 4FH2A 3BECA 4M3KA 3W4QA 3IXBA 3MKFA 2Y55A 2QZ6A 3VP4A 3UPOA 1PWGA 5G18A 4OOMA 1Z6FA 5HX9A 3VSKA 3IXDA 1LL5A 3MZFA 4BJPA 3C5AA 3ZNYA 4U0XA 2PU4A 1IKGA 4OP5A 4EBPA 2DRWA 2EFUA 4LCLA 2R9WA 4WZ4A 1IYQA 1XXMA 4BD1A 5EVIB 1ES3A 4KQQA 1W7FA 2XD5A 2WGVA 5FAOA 1M40A 4LCMA 5FQJA 4E3OA 4JXWA 3MKEA 1CEFA 5M19A 2WADA 2WAEA 3LO7A 1MY8A 3HLBA 4PMAA 3AGFA 1TEMA 3G30A 3ZGAB 1RGZA 1W79A 3FKVA 1IEMA 1SDEA 4JXVA 4Y0TA 5DTSA 4MLLA 3O88A 3SH7A 1WYBA 4RVAA 3IF6C 4R4SA 1XA7A 2P9VB 2XFTA 5TGFA 1SCWA 4GOGA 4UAAA 3N8RA 1XX2A 1JTDA 5E43A 2Y2MA 5FA7A 4ID4A 3NCKA 4KZ8A 1BT5A 3SOIA 3JYIA 3QNCA 2EXAA 4YFMA 2A49A 3HLWA 3HBRA 3V50A 2PU2A 1L2SA 4L0LA 1HTZA 1FQGA 4OPZA 4EUZA 1FSYA 2J8YA 3UDFA 3A3EA 1LL9A 1W8QA 3RXWA 3PBNA 2ZD8A 3DWZA 3HUMA 1L0DA 4QD4A 3VFFA 5EVID 2DNSA 2Y59A 5EPHA 2ZC7A 1IYPA 3HVFA 4ZBEA 2WGIA 2HDSA 1BSGA 1K25A 1TVFA 2WKHA 2Y2PA 4RA7A 4X6TA 2XGNA 5J8XA 2OLVA 4BL2A 4U0TA 3PBRA 3HL9A 3IF5A 3V5MA 3ZHHA 3N4IA 3B3XA 1KE0A 5CRFA 4Y0OA 1EROA 3IF6A 1ZG4A 5FQKA 2XK1A 2IWDA 2Y2QA 5M18A 4RYEA 5E2FA 2RCXA 2C5WB 3Q7ZA 4R23A 4LV3A 1KDWA 4GZBA 3P98A 4XXRA 3V39A 3VP3A 3HUOA 3OPRA 1BUEA 2XQZA 5E2GA 1I5QA 5GLCA 1ERMA 2JC7A 4S2PA 2HDQA 3LEZA 4GNUA 4FCFA 2A3UA 3GV9A 3EQVA 3N7WA 2XH9A 3GMWA 4ZJ3A 1U60A 1K54C 5U47A 5GLDA 3ZG9B 4EBNA 1E4DA 1FCOA 4IVIA 5EVLA 1MWRA 1GA9A 3HLEA 4OOYA 4DRTA 2H0YA 1ONHA 1PW1A 4KG2A 3CJMA 3C4PA 1HVBA 3CG5A 2X01A 4PM6A 1BLCA 3NDEA 1LHYA 3SS5A 4OQGA 3C7UA 3WWXA 3ZNTA 2H10A 1MWUA 2ZMAA 4MBFA 5CERA 2WKEA 5L2FA 1L0FA 4GD6A 4KZ6A 5HL1A 4JF4A 1GHIA 1YMXA 4OLGA 3PBSA 3UDIA 5A93A 5KSCA 2WUQA 3VMAA 3SS4A 4UA6A 2R9XA 5GLAA 1OMEA 3UE0A 1MXOA 1FR1A 3NIAA 1MWTA 4OVDA 3ZG0A 4ZAMA 5HAPA 4PM8A 4DE2A 3MXRA 4R3BA 2X71A 2XDMA 3ZCZA 4P0MA 1ESUA 3V3SA 3M2JA 3TG9A 4K0WA 1KGEA 1ESIA 5HW3A 5E2EA 3N8LA 4X55A 1NYMA 4C3QA 1IELA 3RXXA 5A92A 4FD8A 1IKIA 2ZQAA 1L0EA 2Q9MA 3BLSA 3OC2A 5I94A 4DF6A 3MXSA 3G35A 4N1XA 5EOEA 4C75A 5FI7A 4CPKA 4RX2A 4F94A 1ZKJA 4X53A 4OPRA 2RL3A 3SH8A 3DTMA 1TDGA 2OSUA 1K56A 2Y2LA 4EV4A 1BLPA 4N1HA 3IF6B 3BRMA 1BLHA 5EOOA 1EWZA 3PAGA 4JF5A 4OONA 3IHAA 4DDYA 4E3IA 3OCLA 3I7JA 3TSGA 1RP5A 4P85A 1YMSA 1XKZA 2Y4AA 2ZQCA 4HEFA 4KZAA 4OP8A 5AQ9A 1E3UA 1H5XA 1G6AA 2G2WA 2PBYA 2WYXA 4OPQA 4E6WA 4KENB 1I2SA 3UE1A 4S2OA 2HP5A 1S6RA 2EFXA 5A91A 5F83A 3UPPA 4DE3A 1Q2PA 4O7DA 1FCMA 4ZTKA 3RJUA 4GKUA 5FASA 3G4PA 3UN7A 4KZ4A 4H8RA 4JF6A 2GDNA 1SHVA 1NXYA 4BQMA 2E8IA 2WGWB 3WS5A 3HLFA 3V3RA 5CHUA 2XD1A 4E3KA 3UO9A 4OQHA 4HBTA 5AQBA 1GCEA 5HAIA 4GD8A 1KVLA 5KSHA 3IWQA 1XGJA 1K57C 3ITBA 5BOHA 4WYYA 1JWPA 4MNRA 3HLGA 3NC8A 3WS0A 3VFHA 1NZUA 4XUZA 5CHMA 5EVIC 5FAPA 2Y2KA 4JPMA 2OLUA 1NYYA 3VP0A 5GL9A 1IYOA 3M2KA 3W8KA 3Q7VB 4JXSA 2P74A 2ZC4B 3HUNA 4DDSA 3PBTA 4QY5A 4HBUA 1SDNA 4P6BA 2QPNA 1ES5A 2H5SA 5KZHA 4UA9A 1DJAA 1PI5A 5FI6A 3QHYA 4WEKA 3ZVWA 3LY3A 4OLDA 4U3TA 2J9OA 1YLJA 2V2FF 4WZ5C 1L0GA 1YLWA 4E6XA 3LCEA 1KVMA 4OPYA 4OOLA 2J9PA 2JE5A 2WAFA 4YINA 3VSLA 2C6WB 1FSWA 1YLPA 3VP2A 4P87A 1KDSA 3UDXA 3PAEA 5FI2A 3UPNA 4RX3A 2WZXA 3G32A 1LI0A 1PWCA 4Y0UA 2EX9A 3O86A 1K57A 2BLSA 2Y2GA 2ZC5B 5FAQA 5HAQA 4B4ZA 5KMWA 4PPRA 4JXGA 4GDBA 4KZBA 3UNWA 5EVIA 2FFFB 4Y7PA 1SKFA 2HP6A 3BFCA 3BFEA 3C4OA 5GHXA 4Z9QA 1GHPA 3IWIA 1FR6A 4XUXA 5CTNA 3WRTA 2ZM8A 4D2OA 5JYPA 3C7VA 4FSFA 4E3NA 4QY6A 2ZC3B 1WE4A 5TFQA 3S22A 3BM6A 3A3FA 2CC1A 5FSRA 3FV7A 5DF7A 5AQ7A 3IWOA 3ZG8B 1KGGA 5F82A 4WZ5A 1G68A 4R4RA 2EX6A 4MBHA 1YLTA 4PM7A 5EUAA 1JWVA 3GVBA 4S2NC 3UE3A 4QJGA 1PIOA 1HD8A 1PYYA 2ZC6B 4LV2A 1IYSA 2XLNA 4DE1A 1WYCA 3GSGA 3HLCA 4N92A 3Q07A 3E2KA 3IXHA 4LENA 5FDHA 1O07A 3A3JA 1XPBA 1PZOA 2JBFA 3OCNA 1K56D 3AGDA 4S2IA 4X68A 3G2ZA 3IQAA 1FOFA 4WMCA 3MZDA 3O87A 5AQAA 1MPLA 3O3VA 4MBKA 1K54A 2Q9NA 1YLYA 1K38A 1JWZA 2ZQ9A 1PWDA 3NBLA 4QU3A 1MBLA 1C3BA 3ITAA 2JCHA 3DW0A 3P09A 4PM9A 5IHVA 4DXBA 4S2JA 4Q8IA 1ES4A 3ZVTA 3S1YA 1RGYA 5JYOA 1M6KA 2Y91A 4FH4A 1NZOA 3QNBA 3W4OA 4S2MA 3NDGA 4S2KA 1DY6A 2XEPA 3GR2A 3S4XA 1QMEA 4HESA 5F1GA 4JLFA 3GRJA 1K6RA 2XF3A 5E2HA 1BLSA 3FKWA 5GHYA 1ERQA 4E3MA 3BFFA 4X69A 4S2NA 1YM1A 1Q2QA 4WM9A 4NETA 5CGWA 2ZQ8A 4KG5A 3ZFZA 3MBZA 3PBOA 1W8YA 4NK3A 4UHUA 4IBRA 5CXWA 4GB7A 1YLZA 1ONGA 4R3JA 3CMZA 4PM5A 3IH9A 1NRFA 2WZZA 1KGFA 2Z2LB 3OPLA 2FFYA 1BTLA 2VGJA 5FQ9A 3A3IA 2UWXA 4KZ3A 5DF9A 4IBXA 4EBLA 5CEDA 1KE3A 5HARA 2ZQ7A 1YQSA 2IWCA 3OZHA 2BG1A 3AGEA 1PZPA 4DKIA 1VM1A 2V20A 4WBGA 1DJCA 5CGXA 4EWFA 2Y2JA 2HDUA 4GN2A 1K4EA 1CK3A 3EQUA 4KZ7A 1Y54A 4IEDA 1K6SA 5M1AA 1PW8A 5CECA 1AXBA 1CI9A 4N9LA 4JKTA 4WELA 3WS1A 3D4FA 5CTMA 1TDLA 4UA7A 3OPHA 3M6HA 4BENA 2EX2A 1ZC2A 1YT4A 3ZDJA 2OV5A 3VOZA 4ZJ2A 4X56A 4E3JA 3BYDA 4N9KA 1CEGA 1LLBA 2Y2OA 3G34A 3M6BA 5CHJA 1H8ZA 5GHZA 4KQRA 1XGIA 5DTKA 1W5DA 3IHBA 2XFSA 1BZAA 1XA1A 3E2LA 3NY4A 3FYZA 3OPPA 5CGSA 4BL3A 1BULA 4DE0A 1ES2A 1K4FA 2EXBA 3SS3A 3MFDA 3FZCA 1H8YA 5F1FA 2EX8A 1PI4A 1N4OA 5GLBA 1MWSA 3IXGA 3VP1A 2ZM0A 3WS4A 2ZLYA 3BEBA 5A90A 3TOIA 1MKIA 5TR7A 4MEZA 4OH0A 2HPBA 1JTGA 4GDNA 2IWBA 2Z2MB 2ZM2A 3GTCA 4E3LA 2J7VA 1K55C 4QB8A 1VQQA 3A3DA 2H0TA 2I72A 1DJBA 5D3OA 4KZ5A 5FQQA 2X02A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Y2H A;  3VOY A;  1KE4 A;  1O7E A;  4K91 A;  4R0Q A;  4A5R A;  3WRZ A;  4JBF A;  3ZG5 A;  1LI9 A;  4WEJ A;  4WMC D;  4LV1 A;  4OKP A;  4KQO A;  2P9V A;  5CEB A;  5DTT A;  3BLM A;  1S0W A;  1RCJ A;  2ZJ9 A;  4IVK A;  3IH8 A;  2WGW A;  3PTE A;  4EQI A;  5HFO A;  1GA0 A;  4C6Y A;  2DCF A;  1CI8 A;  3ISG A;  3NI9 A;  3HLD A;  4OQ0 A;  4KG6 A;  2Y2N A;  5EEC A;  2ZQD A;  4B88 A;  4QHC A;  1NJ4 A;  5FQI A;  1N9B A;  1J9M A;  3Q1F A;  3IT9 A;  3SH9 A;  2V1Z A;  3MZE A;  4LV0 A;  5EE8 A;  3BFG A;  3CZD A;  2Y2I A;  3GQZ A;  4K0X A;  2HP9 A;  1XP4 A;  3UY6 A;  1HZO A;  3ZG7 B;  4S2L A;  1K55 A;  1E3U D;  3N6I A;  1E25 A;  2G2U A;  2WK0 A;  3Q82 A;  2B5R A;  4CJN A;  1GHM A;  3Q81 A;  4ZJ1 A;  3LY4 A;  3Q7V A;  1ALQ A;  2VGK A;  3HRE A;  3W4P A;  1I2W A;  3FWL A;  1EI5 A;  4R1G A;  3BFD A;  1FCN A;  1NY0 A;  3G2Y A;  3PBQ A;  5DF8 A;  4OQI A;  2HDR A;  3G31 A;  4KZ9 A;  3N8S A;  1JVJ A;  5FAT A;  4B4X A;  4BD0 A;  4DXC A;  5FQM A;  2WKI A;  2XR0 A;  3WS2 A;  3DWK A;  5DVA A;  4ZDX A;  2QMI A;  4BLM A;  1QMF A;  1ZG6 A;  4FH2 A;  3BEC A;  4M3K A;  3W4Q A;  3IXB A;  3MKF A;  2Y55 A;  2QZ6 A;  3VP4 A;  3UPO A;  1PWG A;  5G18 A;  4OOM A;  1Z6F A;  5HX9 A;  3VSK A;  3IXD A;  1LL5 A;  3MZF A;  4BJP A;  3C5A A;  3ZNY A;  4U0X A;  2PU4 A;  1IKG A;  4OP5 A;  4EBP A;  2DRW A;  2EFU A;  4LCL A;  2R9W A;  4WZ4 A;  1IYQ A;  1XXM A;  4BD1 A;  5EVI B;  1ES3 A;  4KQQ A;  1W7F A;  2XD5 A;  2WGV A;  5FAO A;  1M40 A;  4LCM A;  5FQJ A;  4E3O A;  4JXW A;  3MKE A;  1CEF A;  5M19 A;  2WAD A;  2WAE A;  3LO7 A;  1MY8 A;  3HLB A;  4PMA A;  3AGF A;  1TEM A;  3G30 A;  3ZGA B;  1RGZ A;  1W79 A;  3FKV A;  1IEM A;  1SDE A;  4JXV A;  4Y0T A;  5DTS A;  4MLL A;  3O88 A;  3SH7 A;  1WYB A;  4RVA A;  3IF6 C;  4R4S A;  1XA7 A;  2P9V B;  2XFT A;  5TGF A;  1SCW A;  4GOG A;  4UAA A;  3N8R A;  1XX2 A;  1JTD A;  5E43 A;  2Y2M A;  5FA7 A;  4ID4 A;  3NCK A;  4KZ8 A;  1BT5 A;  3SOI A;  3JYI A;  3QNC A;  2EXA A;  4YFM A;  2A49 A;  3HLW A;  3HBR A;  3V50 A;  2PU2 A;  1L2S A;  4L0L A;  1HTZ A;  1FQG A;  4OPZ A;  4EUZ A;  1FSY A;  2J8Y A;  3UDF A;  3A3E A;  1LL9 A;  1W8Q A;  3RXW A;  3PBN A;  2ZD8 A;  3DWZ A;  3HUM A;  1L0D A;  4QD4 A;  3VFF A;  5EVI D;  2DNS A;  2Y59 A;  5EPH A;  2ZC7 A;  1IYP A;  3HVF A;  4ZBE A;  2WGI A;  2HDS A;  1BSG A;  1K25 A;  1TVF A;  2WKH A;  2Y2P A;  4RA7 A;  4X6T A;  2XGN A;  5J8X A;  2OLV A;  4BL2 A;  4U0T A;  3PBR A;  3HL9 A;  3IF5 A;  3V5M A;  3ZHH A;  3N4I A;  3B3X A;  1KE0 A;  5CRF A;  4Y0O A;  1ERO A;  3IF6 A;  1ZG4 A;  5FQK A;  2XK1 A;  2IWD A;  2Y2Q A;  5M18 A;  4RYE A;  5E2F A;  2RCX A;  2C5W B;  3Q7Z A;  4R23 A;  4LV3 A;  1KDW A;  4GZB A;  3P98 A;  4XXR A;  3V39 A;  3VP3 A;  3HUO A;  3OPR A;  1BUE A;  2XQZ A;  5E2G A;  1I5Q A;  5GLC A;  1ERM A;  2JC7 A;  4S2P A;  2HDQ A;  3LEZ A;  4GNU A;  4FCF A;  2A3U A;  3GV9 A;  3EQV A;  3N7W A;  2XH9 A;  3GMW A;  4ZJ3 A;  1U60 A;  1K54 C;  5U47 A;  5GLD A;  3ZG9 B;  4EBN A;  1E4D A;  1FCO A;  4IVI A;  5EVL A;  1MWR A;  1GA9 A;  3HLE A;  4OOY A;  4DRT A;  2H0Y A;  1ONH A;  1PW1 A;  4KG2 A;  3CJM A;  3C4P A;  1HVB A;  3CG5 A;  2X01 A;  4PM6 A;  1BLC A;  3NDE A;  1LHY A;  3SS5 A;  4OQG A;  3C7U A;  3WWX A;  3ZNT A;  2H10 A;  1MWU A;  2ZMA A;  4MBF A;  5CER A;  2WKE A;  5L2F A;  1L0F A;  4GD6 A;  4KZ6 A;  5HL1 A;  4JF4 A;  1GHI A;  1YMX A;  4OLG A;  3PBS A;  3UDI A;  5A93 A;  5KSC A;  2WUQ A;  3VMA A;  3SS4 A;  4UA6 A;  2R9X A;  5GLA A;  1OME A;  3UE0 A;  1MXO A;  1FR1 A;  3NIA A;  1MWT A;  4OVD A;  3ZG0 A;  4ZAM A;  5HAP A;  4PM8 A;  4DE2 A;  3MXR A;  4R3B A;  2X71 A;  2XDM A;  3ZCZ A;  4P0M A;  1ESU A;  3V3S A;  3M2J A;  3TG9 A;  4K0W A;  1KGE A;  1ESI A;  5HW3 A;  5E2E A;  3N8L A;  4X55 A;  1NYM A;  4C3Q A;  1IEL A;  3RXX A;  5A92 A;  4FD8 A;  1IKI A;  2ZQA A;  1L0E A;  2Q9M A;  3BLS A;  3OC2 A;  5I94 A;  4DF6 A;  3MXS A;  3G35 A;  4N1X A;  5EOE A;  4C75 A;  5FI7 A;  4CPK A;  4RX2 A;  4F94 A;  1ZKJ A;  4X53 A;  4OPR A;  2RL3 A;  3SH8 A;  3DTM A;  1TDG A;  2OSU A;  1K56 A;  2Y2L A;  4EV4 A;  1BLP A;  4N1H A;  3IF6 B;  3BRM A;  1BLH A;  5EOO A;  1EWZ A;  3PAG A;  4JF5 A;  4OON A;  3IHA A;  4DDY A;  4E3I A;  3OCL A;  3I7J A;  3TSG A;  1RP5 A;  4P85 A;  1YMS A;  1XKZ A;  2Y4A A;  2ZQC A;  4HEF A;  4KZA A;  4OP8 A;  5AQ9 A;  1E3U A;  1H5X A;  1G6A A;  2G2W A;  2PBY A;  2WYX A;  4OPQ A;  4E6W A;  4KEN B;  1I2S A;  3UE1 A;  4S2O A;  2HP5 A;  1S6R A;  2EFX A;  5A91 A;  5F83 A;  3UPP A;  4DE3 A;  1Q2P A;  4O7D A;  1FCM A;  4ZTK A;  3RJU A;  4GKU A;  5FAS A;  3G4P A;  3UN7 A;  4KZ4 A;  4H8R A;  4JF6 A;  2GDN A;  1SHV A;  1NXY A;  4BQM A;  2E8I A;  2WGW B;  3WS5 A;  3HLF A;  3V3R A;  5CHU A;  2XD1 A;  4E3K A;  3UO9 A;  4OQH A;  4HBT A;  5AQB A;  1GCE A;  5HAI A;  4GD8 A;  1KVL A;  5KSH A;  3IWQ A;  1XGJ A;  1K57 C;  3ITB A;  5BOH A;  4WYY A;  1JWP A;  4MNR A;  3HLG A;  3NC8 A;  3WS0 A;  3VFH A;  1NZU A;  4XUZ A;  5CHM A;  5EVI C;  5FAP A;  2Y2K A;  4JPM A;  2OLU A;  1NYY A;  3VP0 A;  5GL9 A;  1IYO A;  3M2K A;  3W8K A;  3Q7V B;  4JXS A;  2P74 A;  2ZC4 B;  3HUN A;  4DDS A;  3PBT A;  4QY5 A;  4HBU A;  1SDN A;  4P6B A;  2QPN A;  1ES5 A;  2H5S A;  5KZH A;  4UA9 A;  1DJA A;  1PI5 A;  5FI6 A;  3QHY A;  4WEK A;  3ZVW A;  3LY3 A;  4OLD A;  4U3T A;  2J9O A;  1YLJ A;  2V2F F;  4WZ5 C;  1L0G A;  1YLW A;  4E6X A;  3LCE A;  1KVM A;  4OPY A;  4OOL A;  2J9P A;  2JE5 A;  2WAF A;  4YIN A;  3VSL A;  2C6W B;  1FSW A;  1YLP A;  3VP2 A;  4P87 A;  1KDS A;  3UDX A;  3PAE A;  5FI2 A;  3UPN A;  4RX3 A;  2WZX A;  3G32 A;  1LI0 A;  1PWC A;  4Y0U A;  2EX9 A;  3O86 A;  1K57 A;  2BLS A;  2Y2G A;  2ZC5 B;  5FAQ A;  5HAQ A;  4B4Z A;  5KMW A;  4PPR A;  4JXG A;  4GDB A;  4KZB A;  3UNW A;  5EVI A;  2FFF B;  4Y7P A;  1SKF A;  2HP6 A;  3BFC A;  3BFE A;  3C4O A;  5GHX A;  4Z9Q A;  1GHP A;  3IWI A;  1FR6 A;  4XUX A;  5CTN A;  3WRT A;  2ZM8 A;  4D2O A;  5JYP A;  3C7V A;  4FSF A;  4E3N A;  4QY6 A;  2ZC3 B;  1WE4 A;  5TFQ A;  3S22 A;  3BM6 A;  3A3F A;  2CC1 A;  5FSR A;  3FV7 A;  5DF7 A;  5AQ7 A;  3IWO A;  3ZG8 B;  1KGG A;  5F82 A;  4WZ5 A;  1G68 A;  4R4R A;  2EX6 A;  4MBH A;  1YLT A;  4PM7 A;  5EUA A;  1JWV A;  3GVB A;  4S2N C;  3UE3 A;  4QJG A;  1PIO A;  1HD8 A;  1PYY A;  2ZC6 B;  4LV2 A;  1IYS A;  2XLN A;  4DE1 A;  1WYC A;  3GSG A;  3HLC A;  4N92 A;  3Q07 A;  3E2K A;  3IXH A;  4LEN A;  5FDH A;  1O07 A;  3A3J A;  1XPB A;  1PZO A;  2JBF A;  3OCN A;  1K56 D;  3AGD A;  4S2I A;  4X68 A;  3G2Z A;  3IQA A;  1FOF A;  4WMC A;  3MZD A;  3O87 A;  5AQA A;  1MPL A;  3O3V A;  4MBK A;  1K54 A;  2Q9N A;  1YLY A;  1K38 A;  1JWZ A;  2ZQ9 A;  1PWD A;  3NBL A;  4QU3 A;  1MBL A;  1C3B A;  3ITA A;  2JCH A;  3DW0 A;  3P09 A;  4PM9 A;  5IHV A;  4DXB A;  4S2J A;  4Q8I A;  1ES4 A;  3ZVT A;  3S1Y A;  1RGY A;  5JYO A;  1M6K A;  2Y91 A;  4FH4 A;  1NZO A;  3QNB A;  3W4O A;  4S2M A;  3NDG A;  4S2K A;  1DY6 A;  2XEP A;  3GR2 A;  3S4X A;  1QME A;  4HES A;  5F1G A;  4JLF A;  3GRJ A;  1K6R A;  2XF3 A;  5E2H A;  1BLS A;  3FKW A;  5GHY A;  1ERQ A;  4E3M A;  3BFF A;  4X69 A;  4S2N A;  1YM1 A;  1Q2Q A;  4WM9 A;  4NET A;  5CGW A;  2ZQ8 A;  4KG5 A;  3ZFZ A;  3MBZ A;  3PBO A;  1W8Y A;  4NK3 A;  4UHU A;  4IBR A;  5CXW A;  4GB7 A;  1YLZ A;  1ONG A;  4R3J A;  3CMZ A;  4PM5 A;  3IH9 A;  1NRF A;  2WZZ A;  1KGF A;  2Z2L B;  3OPL A;  2FFY A;  1BTL A;  2VGJ A;  5FQ9 A;  3A3I A;  2UWX A;  4KZ3 A;  5DF9 A;  4IBX A;  4EBL A;  5CED A;  1KE3 A;  5HAR A;  2ZQ7 A;  1YQS A;  2IWC A;  3OZH A;  2BG1 A;  3AGE A;  1PZP A;  4DKI A;  1VM1 A;  2V20 A;  4WBG A;  1DJC A;  5CGX A;  4EWF A;  2Y2J A;  2HDU A;  4GN2 A;  1K4E A;  1CK3 A;  3EQU A;  4KZ7 A;  1Y54 A;  4IED A;  1K6S A;  5M1A A;  1PW8 A;  5CEC A;  1AXB A;  1CI9 A;  4N9L A;  4JKT A;  4WEL A;  3WS1 A;  3D4F A;  5CTM A;  1TDL A;  4UA7 A;  3OPH A;  3M6H A;  4BEN A;  2EX2 A;  1ZC2 A;  1YT4 A;  3ZDJ A;  2OV5 A;  3VOZ A;  4ZJ2 A;  4X56 A;  4E3J A;  3BYD A;  4N9K A;  1CEG A;  1LLB A;  2Y2O A;  3G34 A;  3M6B A;  5CHJ A;  1H8Z A;  5GHZ A;  4KQR A;  1XGI A;  5DTK A;  1W5D A;  3IHB A;  2XFS A;  1BZA A;  1XA1 A;  3E2L A;  3NY4 A;  3FYZ A;  3OPP A;  5CGS A;  4BL3 A;  1BUL A;  4DE0 A;  1ES2 A;  1K4F A;  2EXB A;  3SS3 A;  3MFD A;  3FZC A;  1H8Y A;  5F1F A;  2EX8 A;  1PI4 A;  1N4O A;  5GLB A;  1MWS A;  3IXG A;  3VP1 A;  2ZM0 A;  3WS4 A;  2ZLY A;  3BEB A;  5A90 A;  3TOI A;  1MKI A;  5TR7 A;  4MEZ A;  4OH0 A;  2HPB A;  1JTG A;  4GDN A;  2IWB A;  2Z2M B;  2ZM2 A;  3GTC A;  4E3L A;  2J7V A;  1K55 C;  4QB8 A;  1VQQ A;  3A3D A;  2H0T A;  2I72 A;  1DJB A;  5D3O A;  4KZ5 A;  5FQQ A;  2X02 A; 
#chains in the Genus database with same CATH topology
 2Y2H A;  3VOY A;  1KE4 A;  4K91 A;  4YOF A;  4JBF A;  4HJ3 A;  4GW9 A;  4G3W A;  4LV1 A;  5DTT A;  1RCJ A;  2ZJ9 A;  2VZW A;  4BWI A;  3LR3 A;  2Y2N A;  1VET A;  5FQI A;  3GEC A;  4LV0 A;  2HP9 A;  3ZG7 B;  2JN7 A;  4XT2 B;  4S2L A;  3KSF A;  3N6I A;  3Q82 A;  3W4P A;  3IBJ A;  2QWS A;  1FCN A;  1NY0 A;  5DF8 A;  3PBQ A;  1MZU A;  2HDR A;  3G31 A;  4KZ9 A;  3CIT A;  2XRN A;  2WKI A;  3GDI A;  3C30 A;  4I3A A;  4M3K A;  4GS9 B;  1S67 L;  1OT6 A;  3E0Y A;  4EES A;  4EEP A;  3F1P B;  3T4T A;  3MZF A;  3MFX A;  2ACG A;  4LCL A;  4Q0I A;  4KQQ A;  1YSQ A;  1W7F A;  5FAO A;  2WGV A;  1M40 A;  2K2N A;  3T1S A;  1MY8 A;  3HLB A;  4PMA A;  1W79 A;  4Y0T A;  3O88 A;  1XA7 A;  1F9I A;  2P9V B;  5TGF A;  3N8R A;  2QYB A;  5FA7 A;  1N9L A;  3NCK A;  1OTA A;  3JYI A;  2EXA A;  3HCY A;  2A49 A;  1XFQ A;  1FQG A;  2J8Y A;  3A3E A;  3DWZ A;  3HUM A;  4QD4 A;  5EVI D;  4MCW A;  1K25 A;  4H6J A;  4RA7 A;  4I38 A;  2OLV A;  4HY8 A;  4U0T A;  3V5M A;  3ZHH A;  3T4O A;  2GNX A;  5CRF A;  3UB6 A;  1ZHH B;  3H9W A;  3PHY A;  4XXR A;  3V39 A;  3VP3 A;  3HUO A;  5GLC A;  2XQZ A;  3T4Q A;  4ARZ A;  3DAV A;  4LRY C;  4LPZ A;  2HJ9 C;  3GMW A;  1U60 A;  4F3L B;  5U47 A;  2KDK A;  1NLZ A;  1FCO A;  3SZT A;  4KG2 A;  3OOV A;  1HVB A;  2X01 A;  5AJG A;  2V8C A;  4OQG A;  3WWX A;  1MWU A;  1TS7 A;  5L2F A;  5HL1 A;  2PHY A;  5A93 A;  2WUQ A;  1EW0 A;  1OME A;  2M7V A;  1FR1 A;  2L0W A;  3ZG0 A;  1UGU A;  4PM8 A;  2K7S A;  4LRX C;  2O9A A;  4R3B A;  2X71 A;  3MJQ A;  4IUK A;  4P0M A;  4ETX A;  3N8L A;  4X55 A;  1LT0 A;  1NYM A;  5A92 A;  3BLS A;  1L0E A;  2Q9M A;  1P9R A;  4X25 A;  5I94 A;  4DF6 A;  3G35 A;  4CPK A;  1ZKJ A;  4OPR A;  3S7N A;  3SH8 A;  3DTM A;  3R7W A;  1K56 A;  4E04 A;  3QP8 A;  4N1H A;  3BRM A;  5EOO A;  1EWZ A;  3PAG A;  4OON A;  3IHA A;  4HIA A;  2V1B A;  5DKK A;  4PKY A;  4II7 A;  1G6A A;  2PBY A;  4GLQ A;  4OPQ A;  4MN5 A;  2HP5 A;  4ZTK A;  3RJU A;  2VEA A;  4GHI B;  3TJZ C;  4KZ4 A;  3UN7 A;  1NXY A;  3BWL A;  4NXF A;  5I5L A;  3V3R A;  5CHU A;  5EVE A;  1VHM A;  3LR5 A;  3T12 B;  4UQI M;  2WKQ A;  5DJU A;  3IWQ A;  3F1N B;  1W63 M;  3BQA A;  4BBT A;  5BOH A;  2Y2K A;  4JPM A;  4X1M A;  4UQI S;  1IYO A;  3M2K A;  3W8K A;  5J4E A;  4JXS A;  3HUN A;  3PBT A;  3BJN A;  2B02 A;  1SDN A;  1DJA A;  1PI5 A;  3LY3 A;  1LSX A;  3CLO A;  5FEF A;  1YLW A;  2L1M A;  2O0Y A;  3EWK A;  3VSL A;  5EV0 A;  2C6W B;  2I9V A;  4FTX A;  4P87 A;  1LI0 A;  2WKR A;  4Y0U A;  2ZL1 B;  3B33 A;  2Y2G A;  5FAQ A;  3VE4 A;  4PAU A;  3CPT B;  2FFF B;  3C4O A;  5GHX A;  3IWI A;  4EER A;  1TF1 A;  2ZC3 B;  2VV6 A;  2L4R A;  5FSR A;  3IWO A;  4I5S A;  3ZG8 B;  1P97 A;  4R4R A;  5IS1 A;  1JWV A;  3UE3 A;  3LIF A;  1IYS A;  1WYC A;  2PRF A;  3GSG A;  3LUQ A;  4S2I A;  1PZO A;  1K56 D;  3IQA A;  3O87 A;  3O3V A;  1YLY A;  1PWD A;  1MBL A;  4DXB A;  4PM9 A;  3IS2 A;  1RGY A;  1NZO A;  3KO6 A;  3QNB A;  3W4O A;  2E8J A;  1WA9 A;  2AVX A;  3KSG A;  2A24 A;  3GRJ A;  5E2H A;  3FKW A;  1OT9 A;  3QP4 A;  3CHW P;  4WM9 A;  4NET A;  5CGW A;  4HNB A;  2J80 A;  3MBZ A;  3PBO A;  3G6O A;  4GB7 A;  2BTF P;  5DFY A;  2H28 A;  3IH9 A;  4G3V A;  2VGJ A;  4KZ3 A;  5DF9 A;  1S1Y A;  5HAR A;  4DJ3 A;  4DKI A;  2V20 A;  4WBG A;  1YPR A;  2Y2J A;  2HDU A;  4BBU A;  4XT2 A;  4JKT A;  3D4F A;  1TDL A;  2EX2 A;  3VOZ A;  3KYQ A;  4E3J A;  1IOU A;  4N9K A;  3KX0 X;  1T1C A;  4KQR A;  2W3E A;  5DTK A;  2XFS A;  3E2L A;  1MC0 A;  4DE0 A;  3SS3 A;  5HDD A;  1N4O A;  4CLC B;  1LSV A;  3F1P A;  2ZM0 A;  2ZLY A;  2Q0O A;  3E98 A;  2HJE A;  4GDN A;  3GTC A;  2J7V A;  1K55 C;  3A3D A;  2I72 A;  3UB5 P;  4KZ5 A;  1Z09 A;  5FQQ A;  4P6Z S;  1O7E A;  3H7W B;  3EGD C;  4R0Q A;  1OPX A;  4A5R A;  2V9A A;  3ZG5 A;  1LSW A;  3UMD A;  5CEB A;  2P9V A;  1S0W A;  4EQI A;  1CI8 A;  3ISG A;  5EEC A;  1W63 Q;  5EE8 A;  3BFG A;  3GQZ A;  2Y2I A;  1SKO B;  1HZO A;  2QHK A;  3MF0 A;  1K55 A;  1E3U D;  4CJN A;  1GHM A;  1VEU A;  3LY4 A;  4ZJ1 A;  4L9E A;  4R1G A;  4BBV A;  3G2Y A;  4HJ6 A;  1JVJ A;  4DXC A;  3D3O A;  3LR4 A;  5HL6 A;  5DVA A;  2QMI A;  4BLM A;  3K3D A;  3W4Q A;  3IXB A;  3MKF A;  2Y55 A;  1Z6F A;  1LL5 A;  2PD8 A;  3C5A A;  2PU4 A;  5F5Y A;  5G4Y A;  1IKG A;  4OP5 A;  4F3L A;  2ZBB A;  4ZRR A;  5M19 A;  2VGL M;  3LO7 A;  3SH7 A;  4MLL A;  1WYB A;  4DJ2 A;  5J3W A;  4RVA A;  4R4S A;  2W1T A;  1TS8 A;  1XX2 A;  2Y2M A;  1Y28 A;  3B42 A;  4KZ8 A;  1BT5 A;  1K0K A;  3SOI A;  4PHT A;  3LI8 A;  1F5M A;  4OPZ A;  1FSY A;  1W8Q A;  3RXW A;  1L0D A;  4I3I A;  4NXE A;  2Y59 A;  5EPH A;  4O8G A;  1IYP A;  4ZBE A;  3IS2 B;  2WGI A;  1UWP X;  1BSG A;  1TVF A;  3DTE A;  2XGN A;  1J3W A;  3N4I A;  2JKT M;  3P01 A;  3H82 B;  1ERO A;  1ZG4 A;  5FQK A;  1DRM A;  2RCX A;  1ZTU A;  3NJA A;  4WL9 A;  5E2G A;  2EA9 A;  1T1A A;  4GHI A;  4S2P A;  2HDQ A;  3LEZ A;  4GNU A;  3T4S A;  3EQV A;  4Y13 A;  2Y79 A;  4ZJ3 A;  3CAX A;  1K54 C;  4IVI A;  3FC7 A;  1GA9 A;  4NKP A;  4I39 A;  5KIZ A;  4CLC E;  3C4P A;  1P0Z A;  3F1N A;  2H10 A;  4NG2 A;  4GD6 A;  4JF4 A;  1OTI A;  3UDI A;  3PBS A;  3UE0 A;  5A8B A;  1MWT A;  3MXR A;  1T18 A;  2XDM A;  3TE8 A;  3M2J A;  1ESI A;  5E2E A;  3LIC A;  4C3Q A;  4FD8 A;  3OC2 A;  3K2N A;  5EOE A;  3LIA A;  4RX2 A;  5LBR A;  4X53 A;  2RL3 A;  1TDG A;  2ZL1 A;  1CF0 A;  3QP5 A;  3IF6 B;  3CPT A;  4EQ1 A;  4JF5 A;  4L9G A;  1OJG A;  3I7J A;  3TSG A;  4P85 A;  2Y4A A;  5AQ9 A;  4E6W A;  4KEN B;  3UE1 A;  1S6R A;  3UPP A;  5F83 A;  4DE3 A;  3MS6 A;  5IT5 A;  2NUT C;  5FAS A;  3G4P A;  4JF6 A;  3T4K A;  1SHV A;  3PR6 A;  2E8I A;  2HZ5 A;  2XD1 A;  4OQH A;  5AQB A;  4YNR A;  4GD8 A;  5HSQ A;  2VJW A;  1SZV A;  4JGP A;  1K57 C;  4Q0J A;  1OTB A;  3QP2 A;  3WS0 A;  2JKF A;  4XUZ A;  3JPU A;  5CHM A;  3VP0 A;  3D9Y A;  1VEU B;  2FZ0 A;  3MQQ A;  4DDS A;  4QY5 A;  1S1Z A;  4P6B A;  4UA9 A;  5FI6 A;  4WEK A;  2J3T C;  2J9O A;  4WZ5 C;  1L0G A;  1T1B A;  3UPN A;  5FI2 A;  1K57 A;  2BLS A;  1T19 A;  5HPF A;  5KMW A;  4GDB A;  2XA7 M;  5HWT A;  3UNW A;  3VOL A;  4Y5F A;  3MMH A;  1G5U A;  3LIB A;  3WRT A;  4CLC C;  4B9O A;  5JYP A;  5MC7 A;  3C7V A;  3P7N A;  4E3N A;  4QY6 A;  3U4L P;  2VKS A;  2XA7 S;  3S22 A;  3BM6 A;  3A3F A;  5K5B A;  5AQ7 A;  2W1T B;  1OTE A;  4WZ5 A;  1YLT A;  3IX8 A;  4PM7 A;  3GVB A;  1PNE A;  1H8M A;  4S2N C;  1PYY A;  2ZC6 B;  2XLN A;  4LEN A;  4X68 A;  3OCN A;  3AGD A;  4WMC A;  1FOF A;  3MZD A;  4DN0 A;  4MBK A;  2Q9N A;  1K38 A;  2BAS A;  3NBL A;  3HJK A;  1C3B A;  3DTK A;  4FUW A;  2JCH A;  3P09 A;  3ZVT A;  4CLC A;  3S1Y A;  5JYO A;  1M6K A;  4FH4 A;  1G28 A;  2OWH A;  4S2M A;  2XEP A;  3GR2 A;  4BMW A;  4IJG A;  4CQH A;  4MN7 A;  4JLF A;  2XF3 A;  2INW A;  3LGO A;  3BFF A;  4S2N A;  1YM1 A;  2K31 A;  3C8C A;  2MJ6 A;  3E4Q A;  4KG5 A;  1N9O A;  3EEA A;  3H7W A;  1W8Y A;  4NXB A;  4IBR A;  4NEE D;  4R3J A;  1HLU P;  5HWW A;  1KGF A;  2Z2L B;  1FIK A;  2FFY A;  5FQ9 A;  3A3I A;  3VV4 A;  4EBL A;  1KE3 A;  1X0O A;  1YQS A;  2UV0 E;  2BG1 A;  2ZMV A;  5CGX A;  1CK3 A;  4KZ7 A;  1SKO A;  1K6S A;  4WEL A;  3WS1 A;  2QJ7 A;  4UA7 A;  3M6H A;  4BEN A;  4ZJ2 A;  3T4J A;  3KYZ A;  1LLB A;  1XGI A;  1W5D A;  1BZA A;  4BL3 A;  1F2K A;  1BUL A;  1MKM A;  3CWF A;  1K4F A;  1H8Y A;  1CQA A;  2EX8 A;  5GLB A;  3VP1 A;  1F98 A;  3BEB A;  3TW8 A;  3TOI A;  3MSH A;  5TR7 A;  4OH0 A;  2HPB A;  4UEY A;  4B93 A;  1XJ3 A;  4E3L A;  1VQQ A;  2CMN A;  1DJB A;  3WRZ A;  1LI9 A;  4WMC D;  4OKP A;  4EU0 A;  3BLM A;  4IVK A;  2KX6 A;  3PTE A;  1VB6 A;  5HFO A;  1GA0 A;  2O99 A;  4C6Y A;  2PBD P;  4EW7 A;  3A0R A;  4CLC D;  4KG6 A;  5EM0 A;  2ZQD A;  4QHC A;  1J9M A;  2JKT I;  3IT9 A;  4WUJ A;  5CX7 A;  2V1Z A;  2XRO A;  1XP4 A;  3UY6 A;  2LB9 A;  2GJ3 A;  1E25 A;  2G2U A;  4MDZ A;  2B5R A;  3Q81 A;  2VGK A;  1I2W A;  1EI5 A;  4OQI A;  3H82 A;  5L10 A;  5FQM A;  2XR0 A;  3WS2 A;  3LEQ A;  3L9K A;  4ZDX A;  4FH2 A;  3BEC A;  3VP4 A;  3UPO A;  1PWG A;  4HQA A;  3PXP A;  5HX9 A;  4Z1W A;  3ZNY A;  4I3J A;  2DRW A;  2EFU A;  4WZ4 A;  1IYQ A;  1XXM A;  1ES3 A;  2PT7 A;  4LCM A;  5FQJ A;  4Y2F A;  3MKE A;  2KLI A;  1CJF A;  2WAD A;  2PAV P;  1TEM A;  3T1Q B;  3G30 A;  1RGZ A;  3FKV A;  4JXV A;  1IEM A;  1SDE A;  5DTS A;  2V1A A;  4R3A A;  3VE3 A;  3IF6 C;  4Y15 A;  3T4L A;  2XFT A;  1SCW A;  2G7U A;  5E43 A;  4ID4 A;  1OTD A;  2W1R A;  2Z6C A;  1XJ6 A;  3QNC A;  5HPI A;  4YFM A;  3FPV A;  3HLW A;  3E4O A;  3HBR A;  1NLY A;  3V50 A;  2PU2 A;  1G6O A;  2VK3 A;  4L0L A;  4R70 A;  3DTI A;  5EFW A;  4X1L A;  3UDF A;  2YKF A;  1STZ A;  3PBN A;  1L3L A;  4EET B;  4JGR A;  3HVF A;  3FG8 A;  4Y17 A;  2WKH A;  4P6Z M;  1H3Q A;  3HL9 A;  3IF5 A;  3B3X A;  4QWO A;  4Y0O A;  3IF6 A;  1S66 L;  2P08 A;  2XK1 A;  5M18 A;  1YKD A;  3Q7Z A;  4WLA A;  1KDW A;  3LR0 A;  1BUE A;  4HH3 A;  3S7P A;  5EM1 A;  1ERM A;  2JC7 A;  4FCF A;  2A3U A;  2XH9 A;  2YKH A;  3ZG9 B;  1E4D A;  1MWR A;  4EUV A;  1PW1 A;  1D06 A;  3CJM A;  2JKG A;  4PM6 A;  1BLC A;  1LHY A;  5F68 A;  5L8M A;  4MBF A;  2WKE A;  1L0F A;  2KOI A;  1GHI A;  4OLG A;  5KSC A;  3VMA A;  3SS4 A;  4NXG A;  2R9X A;  4UA6 A;  4RQ9 A;  5GLA A;  3UB9 A;  3T1X A;  3HJI A;  4DE2 A;  3ZCZ A;  2D02 A;  1ESU A;  3V3S A;  5HW3 A;  1IEL A;  3RXX A;  2ZQA A;  3L7H A;  3MXS A;  1NWZ A;  2VA0 A;  2QJ5 A;  4N1X A;  4C75 A;  5FI7 A;  4F94 A;  4KUO A;  4HHD A;  4EV4 A;  3LID A;  4WF0 A;  4DDY A;  4IUH A;  3OCL A;  3ULF A;  3RH8 B;  3OBF A;  2ZQC A;  4HEF A;  1AWI A;  1H5X A;  3UB7 A;  1TS6 A;  2WYX A;  1KOU A;  1I2S A;  4S2O A;  4O7D A;  3RTY A;  4H8R A;  2ZMF A;  2GDN A;  3WS5 A;  3HLF A;  3IX3 A;  3UO9 A;  4HBT A;  1GCE A;  3MXQ A;  5HAI A;  1KVL A;  5KSH A;  5L07 A;  3NUL A;  3MQO A;  1XGJ A;  2V8F A;  3ZYT A;  5EVI C;  1NRJ A;  5FAP A;  4EEU A;  3BY8 A;  5GL9 A;  3MR0 A;  2P74 A;  5TBM B;  4HBU A;  4LFU A;  1ES5 A;  2H5S A;  2VV7 A;  5KZH A;  3A0V A;  4U3T A;  1YLJ A;  2V2F F;  4E6X A;  1S4R A;  3LCE A;  2WAF A;  3OLO A;  3K3C A;  1KDS A;  3UDX A;  3PAE A;  5DFX A;  4RX3 A;  3NOP C;  1ODV A;  2EX9 A;  3RFB A;  3UE6 A;  2ZC5 B;  5HAQ A;  1DP9 A;  3PYP A;  4HI4 A;  5EVI A;  4Y7P A;  3T50 A;  5F6A A;  4Z9Q A;  3QP1 A;  5CTN A;  2ZM8 A;  4D2O A;  4LLO B;  4QPR A;  4LGW A;  4FSF A;  3QP6 A;  1WE4 A;  2PDR A;  5TFQ A;  5TJJ A;  1KGG A;  2OOL A;  1G68 A;  2EX6 A;  5EUA A;  1GSV A;  2PYP A;  3UB8 A;  1HD8 A;  3IX4 A;  4LV2 A;  3HLC A;  3IXH A;  3SW1 A;  1O07 A;  1XPB A;  3G2Z A;  4L9F A;  3C38 A;  1K54 A;  1JWZ A;  4QU3 A;  4KQD A;  3ITA A;  3LFV A;  3DW0 A;  4S2J A;  4Q8I A;  4LRZ E;  3NDG A;  4S2K A;  3S4X A;  1QME A;  5F1G A;  2ZOH A;  1K6R A;  1BLS A;  1ERQ A;  4E3M A;  1Q2Q A;  5HD5 A;  5AVF A;  2ZQ8 A;  3ZFZ A;  2J3W A;  4NK3 A;  3JVU A;  5CXW A;  3BW6 A;  3OPL A;  1OJ5 A;  3NEC A;  3A0S A;  1BTL A;  2B95 A;  2UWX A;  2W3G A;  4IBX A;  2ZQ7 A;  2IWC A;  3ZQ5 A;  1PZP A;  1D1J A;  1DJC A;  4GN2 A;  3EQU A;  5M1A A;  1PW8 A;  3W2Z A;  1AXB A;  4N9L A;  2R78 A;  1ZC2 A;  3ZDJ A;  2OV5 A;  4X56 A;  4GJ4 A;  3BYD A;  1GSX A;  1CEG A;  3G34 A;  3M6B A;  1PRQ A;  3BQ8 A;  2P04 A;  1P9W A;  3NY4 A;  5CGS A;  2EXB A;  3MFD A;  5F1F A;  1PI4 A;  1MWS A;  3MQ0 A;  1MKI A;  1BYW A;  4MEZ A;  4HP4 A;  2IWB A;  3E4P A;  4QB8 A;  5D3O A;  2X02 A;  4WEJ A;  1GSW A;  4KQO A;  1Y4O A;  2M1C A;  3IH8 A;  2WGW A;  4ESP A;  2DCF A;  3NI9 A;  3HLD A;  4OQ0 A;  2EWV A;  4B88 A;  1NJ4 A;  3NOT C;  1N9B A;  3Q1F A;  3SH9 A;  3MZE A;  3CZD A;  4K0X A;  4MN6 A;  2W3F A;  5DKL A;  2WK0 A;  1S4S A;  1ALQ A;  3HRE A;  3Q7V A;  3FWL A;  2GX5 A;  3BFD A;  2OAQ 1;  3FPW A;  4B4X A;  2PR6 A;  3N8S A;  5FAT A;  4BD0 A;  1YSP A;  3DWK A;  1A0K A;  3LIE A;  1QMF A;  1ZG6 A;  2Z6D A;  2O9B A;  2OWJ A;  2QZ6 A;  3S7Q A;  4ETZ A;  5G18 A;  4OOM A;  1UWN X;  3S7O A;  3VSK A;  3IXD A;  4BJP A;  4U0X A;  4EBP A;  2R9W A;  2VX8 A;  4BD1 A;  5EVI B;  2XD5 A;  4E3O A;  4JXW A;  2HGV A;  1CEF A;  2WAE A;  2W27 A;  2IA2 A;  1XJ2 A;  3AGF A;  3ZGA B;  3BY9 A;  4GOG A;  2JKR M;  2WKP A;  4UAA A;  3JVV A;  1JTD A;  2W0N A;  1L2S A;  1VET B;  1HTZ A;  4EUZ A;  1LL9 A;  5HZH A;  1YAX A;  2ZD8 A;  3VFF A;  4EXO A;  2DNS A;  2ZC7 A;  3V67 A;  2D01 A;  5C5K A;  2HDS A;  2Y2P A;  4X6T A;  5J8X A;  4BL2 A;  3PBR A;  1KE0 A;  3DBA A;  3F1O A;  2IWD A;  2J3T D;  2Y2Q A;  3KSH A;  4RYE A;  2M7U A;  5E2F A;  2C5W B;  4R23 A;  4LV3 A;  4GZB A;  3P98 A;  3OPR A;  1I5Q A;  2EWW A;  2GZA A;  3O5Y A;  4D60 A;  2P7J A;  3GV9 A;  3N7W A;  1N9N A;  5GLD A;  4EBN A;  1LL8 A;  5F69 A;  5EVL A;  1FIL A;  4OOY A;  3HLE A;  4DRT A;  2H0Y A;  1ONH A;  5L09 A;  4O0P A;  2W3H A;  3CG5 A;  3NDE A;  3SS5 A;  3ZNT A;  3C7U A;  2V0W A;  2ZMA A;  5CER A;  1TS0 A;  4KZ6 A;  1YMX A;  1MXO A;  3KYE A;  3NIA A;  4OVD A;  5TBM A;  4ZAM A;  5HAP A;  3TG9 A;  4K0W A;  1KGE A;  1DP6 A;  1IKI A;  2HV1 A;  3NOU C;  4H6J B;  4R38 A;  3CI6 A;  4YWZ A;  2OSU A;  2Y2L A;  5HD3 A;  1BLP A;  2NUP C;  1BLH A;  4E3I A;  3TRC A;  1RP5 A;  1YMS A;  1XKZ A;  4OP8 A;  4KZA A;  1E3U A;  2G2W A;  2EFX A;  5A91 A;  1Q2P A;  1FCM A;  4GKU A;  4ARZ B;  4BQM A;  2WGW B;  4E3K A;  2OAP 1;  5HWV A;  2A2L A;  3EEH A;  3EGX C;  1PFL A;  3ITB A;  4WYY A;  1JWP A;  4MNR A;  3HLG A;  3NC8 A;  3VFH A;  1NZU A;  2LB5 A;  2OLU A;  1NYY A;  4JGO A;  2B18 A;  3Q7V B;  2ZC4 B;  1JNU A;  2XSS A;  2QPN A;  3C2W A;  3QHY A;  3ZVW A;  4PKY G;  4OLD A;  3T1R A;  2FH5 A;  1V9Z A;  1KVM A;  4OPY A;  4MMN A;  4OOL A;  2J9P A;  2JE5 A;  4GS9 A;  4YIN A;  1H0M A;  1FSW A;  1YLP A;  3VP2 A;  2W3D A;  2WZX A;  3G32 A;  1DP8 A;  1PWC A;  2Y8H A;  3R7W B;  3O86 A;  4B4Z A;  4PPR A;  4JXG A;  4KZB A;  4K08 A;  1SKF A;  2HP6 A;  3BFC A;  1D7E A;  3BFE A;  1GHP A;  1FR6 A;  4XUX A;  4Q0H A;  4IHQ A;  2CC1 A;  3FV7 A;  5DF7 A;  5F82 A;  3EOI A;  4MBH A;  2PD7 A;  5HDC A;  4KUK A;  4QJG A;  1PIO A;  4DE1 A;  4N92 A;  3Q07 A;  3E2K A;  5FDH A;  1TD5 A;  1V9Y A;  3A3J A;  2JBF A;  2HF6 A;  2VLG A;  2JHE A;  5AQA A;  3KSI A;  1MPL A;  3LYX A;  4AFI A;  2ZQ9 A;  3UME A;  5IHV A;  1ES4 A;  1IFQ A;  4ME4 A;  2V0U A;  2Y91 A;  1ACF A;  1DY6 A;  3F1O B;  4HES A;  5AVE A;  3LI9 A;  5GHY A;  3CUE C;  4X69 A;  3U2A A;  4JGQ A;  5FEG A;  5FL3 A;  3R4K A;  4UHU A;  4HH2 A;  1YLZ A;  2DMW A;  1ONG A;  4R6L A;  3CMZ A;  4PM5 A;  2ZOI A;  1NRF A;  4FOF A;  2WZZ A;  3IBR A;  5DJT A;  5CED A;  2QKP A;  2O9C A;  3OZH A;  3AGE A;  1VM1 A;  4EWF A;  1K4E A;  4HJ4 A;  4O01 A;  1Y54 A;  4IED A;  5CEC A;  4M4X A;  1CI9 A;  3CUE A;  5CTM A;  4G3K A;  3OPH A;  5J7E A;  1YT4 A;  5FDS A;  2VGL S;  2Y2O A;  5CHJ A;  1H8Z A;  5GHZ A;  3IHB A;  4Y3I A;  3ICY A;  1XA1 A;  3FYZ A;  3OPP A;  4HP9 A;  3B47 A;  4WN5 A;  1ES2 A;  5G4Z A;  3FZC A;  3IXG A;  2PYR A;  3WS4 A;  5A90 A;  4GCZ A;  2PR5 A;  1XFN A;  2VV8 A;  1XJ4 A;  5HDS A;  4DMZ A;  1JTG A;  2A24 B;  3NHQ A;  2JKR I;  2Z2M B;  2ZM2 A;  5IU1 A;  4HOI A;  3D72 A;  2H0T A; 
#chains in the Genus database with same CATH homology
 2Y2H A;  3VOY A;  1KE4 A;  1O7E A;  4K91 A;  4R0Q A;  4A5R A;  3WRZ A;  4JBF A;  3ZG5 A;  1LI9 A;  4WEJ A;  4WMC D;  4LV1 A;  4OKP A;  4KQO A;  2P9V A;  5CEB A;  5DTT A;  3BLM A;  1S0W A;  1RCJ A;  2ZJ9 A;  4IVK A;  3IH8 A;  2WGW A;  3PTE A;  4EQI A;  5HFO A;  1GA0 A;  4C6Y A;  2DCF A;  1CI8 A;  3ISG A;  3NI9 A;  3HLD A;  4OQ0 A;  4KG6 A;  2Y2N A;  5EEC A;  2ZQD A;  4B88 A;  4QHC A;  1NJ4 A;  5FQI A;  1N9B A;  1J9M A;  3Q1F A;  3IT9 A;  3SH9 A;  2V1Z A;  3MZE A;  4LV0 A;  5EE8 A;  3BFG A;  3CZD A;  2Y2I A;  3GQZ A;  4K0X A;  2HP9 A;  1XP4 A;  3UY6 A;  1HZO A;  3ZG7 B;  4S2L A;  1K55 A;  1E3U D;  3N6I A;  1E25 A;  2G2U A;  2WK0 A;  3Q82 A;  2B5R A;  4CJN A;  1GHM A;  3Q81 A;  4ZJ1 A;  3LY4 A;  3Q7V A;  1ALQ A;  2VGK A;  3HRE A;  3W4P A;  1I2W A;  3FWL A;  1EI5 A;  4R1G A;  3BFD A;  1FCN A;  1NY0 A;  3G2Y A;  3PBQ A;  5DF8 A;  4OQI A;  2HDR A;  3G31 A;  4KZ9 A;  3N8S A;  1JVJ A;  5FAT A;  4B4X A;  4BD0 A;  4DXC A;  5FQM A;  2WKI A;  2XR0 A;  3WS2 A;  3DWK A;  5DVA A;  4ZDX A;  2QMI A;  4BLM A;  1QMF A;  1ZG6 A;  4FH2 A;  3BEC A;  4M3K A;  3W4Q A;  3IXB A;  3MKF A;  2Y55 A;  2QZ6 A;  3VP4 A;  3UPO A;  1PWG A;  5G18 A;  4OOM A;  1Z6F A;  5HX9 A;  3VSK A;  3IXD A;  1LL5 A;  3MZF A;  4BJP A;  3C5A A;  3ZNY A;  4U0X A;  2PU4 A;  1IKG A;  4OP5 A;  4EBP A;  2DRW A;  2EFU A;  4LCL A;  2R9W A;  4WZ4 A;  1IYQ A;  1XXM A;  4BD1 A;  5EVI B;  1ES3 A;  4KQQ A;  1W7F A;  2XD5 A;  2WGV A;  5FAO A;  1M40 A;  4LCM A;  5FQJ A;  4E3O A;  4JXW A;  3MKE A;  1CEF A;  5M19 A;  2WAD A;  2WAE A;  3LO7 A;  1MY8 A;  3HLB A;  4PMA A;  3AGF A;  1TEM A;  3G30 A;  3ZGA B;  1RGZ A;  1W79 A;  3FKV A;  1IEM A;  1SDE A;  4JXV A;  4Y0T A;  5DTS A;  4MLL A;  3O88 A;  3SH7 A;  1WYB A;  4RVA A;  3IF6 C;  4R4S A;  1XA7 A;  2P9V B;  2XFT A;  5TGF A;  1SCW A;  4GOG A;  4UAA A;  3N8R A;  1XX2 A;  1JTD A;  5E43 A;  2Y2M A;  5FA7 A;  4ID4 A;  3NCK A;  4KZ8 A;  1BT5 A;  3SOI A;  3JYI A;  3QNC A;  2EXA A;  4YFM A;  2A49 A;  3HLW A;  3HBR A;  3V50 A;  2PU2 A;  1L2S A;  4L0L A;  1HTZ A;  1FQG A;  4OPZ A;  4EUZ A;  1FSY A;  2J8Y A;  3UDF A;  3A3E A;  1LL9 A;  1W8Q A;  3RXW A;  3PBN A;  2ZD8 A;  3DWZ A;  3HUM A;  1L0D A;  4QD4 A;  3VFF A;  5EVI D;  2DNS A;  2Y59 A;  5EPH A;  2ZC7 A;  1IYP A;  3HVF A;  4ZBE A;  2WGI A;  2HDS A;  1BSG A;  1K25 A;  1TVF A;  2WKH A;  2Y2P A;  4RA7 A;  4X6T A;  2XGN A;  5J8X A;  2OLV A;  4BL2 A;  4U0T A;  3PBR A;  3HL9 A;  3IF5 A;  3V5M A;  3ZHH A;  3N4I A;  3B3X A;  1KE0 A;  5CRF A;  4Y0O A;  1ERO A;  3IF6 A;  1ZG4 A;  5FQK A;  2XK1 A;  2IWD A;  2Y2Q A;  5M18 A;  4RYE A;  5E2F A;  2RCX A;  2C5W B;  3Q7Z A;  4R23 A;  4LV3 A;  1KDW A;  4GZB A;  3P98 A;  4XXR A;  3V39 A;  3VP3 A;  3HUO A;  3OPR A;  1BUE A;  2XQZ A;  5E2G A;  1I5Q A;  5GLC A;  1ERM A;  2JC7 A;  4S2P A;  2HDQ A;  3LEZ A;  4GNU A;  4FCF A;  2A3U A;  3GV9 A;  3EQV A;  3N7W A;  2XH9 A;  3GMW A;  4ZJ3 A;  1U60 A;  1K54 C;  5U47 A;  5GLD A;  3ZG9 B;  4EBN A;  1E4D A;  1FCO A;  4IVI A;  5EVL A;  1MWR A;  1GA9 A;  3HLE A;  4OOY A;  4DRT A;  2H0Y A;  1ONH A;  1PW1 A;  4KG2 A;  3CJM A;  3C4P A;  1HVB A;  3CG5 A;  2X01 A;  4PM6 A;  1BLC A;  3NDE A;  1LHY A;  3SS5 A;  4OQG A;  3C7U A;  3WWX A;  3ZNT A;  2H10 A;  1MWU A;  2ZMA A;  4MBF A;  5CER A;  2WKE A;  5L2F A;  1L0F A;  4GD6 A;  4KZ6 A;  5HL1 A;  4JF4 A;  1GHI A;  1YMX A;  4OLG A;  3PBS A;  3UDI A;  5A93 A;  5KSC A;  2WUQ A;  3VMA A;  3SS4 A;  4UA6 A;  2R9X A;  5GLA A;  1OME A;  3UE0 A;  1MXO A;  1FR1 A;  3NIA A;  1MWT A;  4OVD A;  3ZG0 A;  4ZAM A;  5HAP A;  4PM8 A;  4DE2 A;  3MXR A;  4R3B A;  2X71 A;  2XDM A;  3ZCZ A;  4P0M A;  1ESU A;  3V3S A;  3M2J A;  3TG9 A;  4K0W A;  1KGE A;  1ESI A;  5HW3 A;  5E2E A;  3N8L A;  4X55 A;  1NYM A;  4C3Q A;  1IEL A;  3RXX A;  5A92 A;  4FD8 A;  1IKI A;  2ZQA A;  1L0E A;  2Q9M A;  3BLS A;  3OC2 A;  5I94 A;  4DF6 A;  3MXS A;  3G35 A;  4N1X A;  5EOE A;  4C75 A;  5FI7 A;  4CPK A;  4RX2 A;  4F94 A;  1ZKJ A;  4X53 A;  4OPR A;  2RL3 A;  3SH8 A;  3DTM A;  1TDG A;  2OSU A;  1K56 A;  2Y2L A;  4EV4 A;  1BLP A;  4N1H A;  3IF6 B;  3BRM A;  1BLH A;  5EOO A;  1EWZ A;  3PAG A;  4JF5 A;  4OON A;  3IHA A;  4DDY A;  4E3I A;  3OCL A;  3I7J A;  3TSG A;  1RP5 A;  4P85 A;  1YMS A;  1XKZ A;  2Y4A A;  2ZQC A;  4HEF A;  4KZA A;  4OP8 A;  5AQ9 A;  1E3U A;  1H5X A;  1G6A A;  2G2W A;  2PBY A;  2WYX A;  4OPQ A;  4E6W A;  4KEN B;  1I2S A;  3UE1 A;  4S2O A;  2HP5 A;  1S6R A;  2EFX A;  5A91 A;  5F83 A;  3UPP A;  4DE3 A;  1Q2P A;  4O7D A;  1FCM A;  4ZTK A;  3RJU A;  4GKU A;  5FAS A;  3G4P A;  3UN7 A;  4KZ4 A;  4H8R A;  4JF6 A;  2GDN A;  1SHV A;  1NXY A;  4BQM A;  2E8I A;  2WGW B;  3WS5 A;  3HLF A;  3V3R A;  5CHU A;  2XD1 A;  4E3K A;  3UO9 A;  4OQH A;  4HBT A;  5AQB A;  1GCE A;  5HAI A;  4GD8 A;  1KVL A;  5KSH A;  3IWQ A;  1XGJ A;  1K57 C;  3ITB A;  5BOH A;  4WYY A;  1JWP A;  4MNR A;  3HLG A;  3NC8 A;  3WS0 A;  3VFH A;  1NZU A;  4XUZ A;  5CHM A;  5EVI C;  5FAP A;  2Y2K A;  4JPM A;  2OLU A;  1NYY A;  3VP0 A;  5GL9 A;  1IYO A;  3M2K A;  3W8K A;  3Q7V B;  4JXS A;  2P74 A;  2ZC4 B;  3HUN A;  4DDS A;  3PBT A;  4QY5 A;  4HBU A;  1SDN A;  4P6B A;  2QPN A;  1ES5 A;  2H5S A;  5KZH A;  4UA9 A;  1DJA A;  1PI5 A;  5FI6 A;  3QHY A;  4WEK A;  3ZVW A;  3LY3 A;  4OLD A;  4U3T A;  2J9O A;  1YLJ A;  2V2F F;  4WZ5 C;  1L0G A;  1YLW A;  4E6X A;  3LCE A;  1KVM A;  4OPY A;  4OOL A;  2J9P A;  2JE5 A;  2WAF A;  4YIN A;  3VSL A;  2C6W B;  1FSW A;  1YLP A;  3VP2 A;  4P87 A;  1KDS A;  3UDX A;  3PAE A;  5FI2 A;  3UPN A;  4RX3 A;  2WZX A;  3G32 A;  1LI0 A;  1PWC A;  4Y0U A;  2EX9 A;  3O86 A;  1K57 A;  2BLS A;  2Y2G A;  2ZC5 B;  5FAQ A;  5HAQ A;  4B4Z A;  5KMW A;  4PPR A;  4JXG A;  4GDB A;  4KZB A;  3UNW A;  5EVI A;  2FFF B;  4Y7P A;  1SKF A;  2HP6 A;  3BFC A;  3BFE A;  3C4O A;  5GHX A;  4Z9Q A;  1GHP A;  3IWI A;  1FR6 A;  4XUX A;  5CTN A;  3WRT A;  2ZM8 A;  4D2O A;  5JYP A;  3C7V A;  4FSF A;  4E3N A;  4QY6 A;  2ZC3 B;  1WE4 A;  5TFQ A;  3S22 A;  3BM6 A;  3A3F A;  2CC1 A;  5FSR A;  3FV7 A;  5DF7 A;  5AQ7 A;  3IWO A;  3ZG8 B;  1KGG A;  5F82 A;  4WZ5 A;  1G68 A;  4R4R A;  2EX6 A;  4MBH A;  1YLT A;  4PM7 A;  5EUA A;  1JWV A;  3GVB A;  4S2N C;  3UE3 A;  4QJG A;  1PIO A;  1HD8 A;  1PYY A;  2ZC6 B;  4LV2 A;  1IYS A;  2XLN A;  4DE1 A;  1WYC A;  3GSG A;  3HLC A;  4N92 A;  3Q07 A;  3E2K A;  3IXH A;  4LEN A;  5FDH A;  1O07 A;  3A3J A;  1XPB A;  1PZO A;  2JBF A;  3OCN A;  1K56 D;  3AGD A;  4S2I A;  4X68 A;  3G2Z A;  3IQA A;  1FOF A;  4WMC A;  3MZD A;  3O87 A;  5AQA A;  1MPL A;  3O3V A;  4MBK A;  1K54 A;  2Q9N A;  1YLY A;  1K38 A;  1JWZ A;  2ZQ9 A;  1PWD A;  3NBL A;  4QU3 A;  1MBL A;  1C3B A;  3ITA A;  2JCH A;  3DW0 A;  3P09 A;  4PM9 A;  5IHV A;  4DXB A;  4S2J A;  4Q8I A;  1ES4 A;  3ZVT A;  3S1Y A;  1RGY A;  5JYO A;  1M6K A;  2Y91 A;  4FH4 A;  1NZO A;  3QNB A;  3W4O A;  4S2M A;  3NDG A;  4S2K A;  1DY6 A;  2XEP A;  3GR2 A;  3S4X A;  1QME A;  4HES A;  5F1G A;  4JLF A;  3GRJ A;  1K6R A;  2XF3 A;  5E2H A;  1BLS A;  3FKW A;  5GHY A;  1ERQ A;  4E3M A;  3BFF A;  4X69 A;  4S2N A;  1YM1 A;  1Q2Q A;  4WM9 A;  4NET A;  5CGW A;  2ZQ8 A;  4KG5 A;  3ZFZ A;  3MBZ A;  3PBO A;  1W8Y A;  4NK3 A;  4UHU A;  4IBR A;  5CXW A;  4GB7 A;  1YLZ A;  1ONG A;  4R3J A;  3CMZ A;  4PM5 A;  3IH9 A;  1NRF A;  2WZZ A;  1KGF A;  2Z2L B;  3OPL A;  2FFY A;  1BTL A;  2VGJ A;  5FQ9 A;  3A3I A;  2UWX A;  4KZ3 A;  5DF9 A;  4IBX A;  4EBL A;  5CED A;  1KE3 A;  5HAR A;  2ZQ7 A;  1YQS A;  2IWC A;  3OZH A;  2BG1 A;  3AGE A;  1PZP A;  4DKI A;  1VM1 A;  2V20 A;  4WBG A;  1DJC A;  5CGX A;  4EWF A;  2Y2J A;  2HDU A;  4GN2 A;  1K4E A;  1CK3 A;  3EQU A;  4KZ7 A;  1Y54 A;  4IED A;  1K6S A;  5M1A A;  1PW8 A;  5CEC A;  1AXB A;  1CI9 A;  4N9L A;  4JKT A;  4WEL A;  3WS1 A;  3D4F A;  5CTM A;  1TDL A;  4UA7 A;  3OPH A;  3M6H A;  4BEN A;  2EX2 A;  1ZC2 A;  1YT4 A;  3ZDJ A;  2OV5 A;  3VOZ A;  4ZJ2 A;  4X56 A;  4E3J A;  3BYD A;  4N9K A;  1CEG A;  1LLB A;  2Y2O A;  3G34 A;  3M6B A;  5CHJ A;  1H8Z A;  5GHZ A;  4KQR A;  1XGI A;  5DTK A;  1W5D A;  3IHB A;  2XFS A;  1BZA A;  1XA1 A;  3E2L A;  3NY4 A;  3FYZ A;  3OPP A;  5CGS A;  4BL3 A;  1BUL A;  4DE0 A;  1ES2 A;  1K4F A;  2EXB A;  3SS3 A;  3MFD A;  3FZC A;  1H8Y A;  5F1F A;  2EX8 A;  1PI4 A;  1N4O A;  5GLB A;  1MWS A;  3IXG A;  3VP1 A;  2ZM0 A;  3WS4 A;  2ZLY A;  3BEB A;  5A90 A;  3TOI A;  1MKI A;  5TR7 A;  4MEZ A;  4OH0 A;  2HPB A;  1JTG A;  4GDN A;  2IWB A;  2Z2M B;  2ZM2 A;  3GTC A;  4E3L A;  2J7V A;  1K55 C;  4QB8 A;  1VQQ A;  3A3D A;  2H0T A;  2I72 A;  1DJB A;  5D3O A;  4KZ5 A;  5FQQ A;  2X02 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...