1YPRA

Saccharomyces cerevisiae (yeast) profilin
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
125
structure length
125
Chain Sequence
SWQAYTDNLIGTGKVDKAVIYSRAGDAVWATSGGLSLQPNEIGEIVQGFDNPAGLQSNGLHIQGQKFMLLRADDRSIYGRHDAEGVVCVRTKQTVIIAHYPPTVQAGEATKIVEQLADYLIGVQY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure determination and characterization of Saccharomyces cerevisiae profilin
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Actin-binding protein
molecule keywords PROFILIN
total genus 39
structure length 125
sequence length 125
chains with identical sequence B
ec nomenclature
pdb deposition date 1997-06-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.30 Alpha Beta 2-Layer Sandwich Beta-Lactamase Dynein light chain 2a, cytoplasmic 1yprA00
4D60A 1HLUP 3CPTB 3D9YA 5EM1A 2PBDP 2JKFA 5EM0A 5EVEA 3UB5P 1PFLA 1SKOA 1VETA 2PRFA 5FEGA 1PRQA 1AWIA 4ESPA 3MSHA 2E8JA 1G5UA 3KYEA 3NECA 3L9KA 3LEQA 2ACGA 2ZL1A 3U4LP 2JKGA 4X1MA 3LGOA 2B95A 3T1QB 1FILA 4X1LA 1CJFA 1K0KA 5FEFA 1Z09A 1CQAA 1VEUB 2VK3A 3NULA 4X25A 3T12B 1SKOB 1VETB 1D1JA 1F2KA 1ACFA 5EV0A 2PAVP 1Y4OA 3CPTA 1VEUA 1J3WA 3L7HA 5FDSA 1SZVA 3DAVA 3MS6A 2ZL1B 2HZ5A 2BTFP 1A0KA 1YPRA 2V8FA 4FTXA 4QWOA 3T1SA 3CHWP 3T1XA 2V8CA 1FIKA 3T1RA 1CF0A 1PNEA 4FUWA
chains in the Genus database with same CATH superfamily
4JKTA 5C5KA 2ZM2A 5MC7A 3GV9A 4HP4A 4DE3A 4F3LB 5DF7A 2QYBA 4S2MA 3NHQA 4KZ8A 4JLFA 1XFNA 2XF3A 2O9BA 1RGZA 3H7WB 1VEUB 4WEJA 3TRCA 2PHYA 3BFDA 2J9PA 4JF6A 3ZCZA 1P0ZA 3A0SA 3BEBA 1IEMA 4X56A 3SH7A 2A24A 1V9ZA 1VETA 3AGFA 4P85A 1CQAA 3S7PA 4R38A 1ESUA 3UB8A 3P01A 5M1AA 4HBUA 2C5WB 1MC0A 4B9OA 5KMWA 4PM5A 4EBLA 4UHUA 5CGWA 2BASA 1K6SA 5JYPA 5FQMA 5AVEA 4ID4A 4E3KA 3C7UA 1W79A 4I38A 4XXRA 3IWQA 4P6ZS 2Q9NA 2Y2PA 3VP2A 3V50A 4EQIA 3OPRA 4ZJ2A 1ACFA 4LV1A 4X53A 4A5RA 2XD1A 3CWFA 2H10A 2P74A 5HFOA 3MKEA 3VV4A 1LL5A 5JYOA 2W27A 1VM1A 2V2FF 4LENA 4IVIA 1K0KA 2Z2MB 1LSXA 4MBKA 3ZQ5A 3IS2B 4WMCA 1S66L 4KZ4A 4XT2A 3VOYA 2ZL1B 4R23A 3W8KA 4GD8A 5HPIA 4KUOA 3V3SA 4MCWA 3CZDA 1H3QA 2XK1A 4UQIS 3LR4A 2XA7M 3KYQA 2ZOIA 2L0WA 2HJ9C 5HL1A 5AQ7A 5E43A 5GHZA 1IFQA 5KSHA 2ZC7A 4GD6A 1SHVA 4K91A 4XT2B 5AQ9A 3SS5A 4CJNA 2WKPA 4KZ7A 3PTEA 2ZM0A 1G5UA 3FG8A 2JN7A 2VEAA 1TF1A 4DMZA 4DDSA 3GECA 1FCNA 3HREA 2QJ7A 1OT9A 2Y4AA 4WF0A 3EQUA 4HESA 2Y79A 2PU4A 1H8MA 3F1NB 3UNWA 1KOUA 2J3TC 2JKRM 4MDZA 3OPLA 2XROA 3KSHA 4R6LA 4RX2A 4UAAA 5CEBA 1WYCA 1W63Q 1FIKA 3MJQA 5CECA 1K57A 5HDDA 3LFVA 3HJIA 4GB7A 1C3BA 3BY8A 4NXFA 3DTKA 1TS8A 5LBRA 1PI5A 5GLDA 1BULA 1NYYA 4OPQA 2KX6A 2VV6A 5HAQA 2EWVA 5K5BA 3CUEA 2L1MA 5DF8A 2JCHA 1MZUA 3HCYA 3CPTB 2Y2HA 2WYXA 1P97A 4HJ3A 2DCFA 1OJGA 1S67L 4DJ3A 3C30A 5EUAA 2V1ZA 2ZMFA 4G3WA 1VETB 4BBUA 3D4FA 2ZBBA 4HH2A 3B42A 4EESA 2M7VA 1YM1A 2M7UA 3E2LA 1W63M 4KZ6A 3H7WA 4GS9A 2QPNA 3HLCA 4R3BA 4GDBA 4S2KA 4DDYA 4Y15A 1FOFA 2VZWA 5GLAA 4IVKA 2BG1A 4KQOA 1J9MA 4ZJ1A 2R9XA 4QD4A 2R78A 4OPRA 3V3RA 1UWNX 1JWPA 3Q7VA 1ERMA 5CGSA 1DP9A 3PHYA 3SS4A 1MKIA 5F83A 5E2EA 3IHAA 3CLOA 4CLCD 3PXPA 4ZRRA 3MZFA 3RTYA 5TFQA 2WUQA 1LHYA 3O3VA 2HV1A 3PBOA 1KGFA 3O88A 2RCXA 1XX2A 3WRZA 1XJ2A 1DJAA 2J9OA 3LEQA 1X0OA 1DRMA 3UDIA 1XJ3A 1CEFA 4OVDA 3N4IA 1TEMA 4E3OA 3QP8A 1YPRA 3Q07A 4NEED 1K57C 1CF0A 4D60A 4WYYA 2HDUA 4EBPA 3O87A 3LIAA 1LI0A 3EWKA 1LT0A 4DKIA 3VSLA 1F98A 3EEHA 4GW9A 3ZVWA 1OT6A 3NULA 3HUNA 3G6OA 3D3OA 2EX9A 4EV4A 2NUPC 4NKPA 3Q1FA 1HLUP 2PBDP 5IU1A 4ZAMA 1ESIA 1KDWA 1V9YA 4EETB 1OTBA 1TDLA 4Y7PA 2NUTC 3JVVA 5DTSA 4DXBA 1JNUA 5HX9A 2PR5A 3IHBA 5TBMA 4OQHA 2J3TD 3BFCA 1NRJA 3OLOA 3D9YA 1PWCA 1T19A 1L0FA 1GSVA 4DN0A 1VB6A 2HPBA 4AFIA 1ZG4A 4OOMA 5U47A 2ZQAA 4Q0IA 1S1YA 4FUWA 3IQAA 2C6WB 1UGUA 3MR0A 2V0UA 4Y17A 2PYRA 2B18A 1FSYA 3PBSA 1MKMA 3EQVA 2JHEA 2OLVA 3R4KA 4LLOB 1DP8A 4EWFA 1PWDA 5AQBA 4N9LA 4S2NC 2XEPA 3TSGA 1K4EA 4HH3A 3UDFA 4IBXA 4NXGA 5KIZA 1XPBA 1JWVA 3OPHA 1M40A 1XXMA 5HDSA 3DTMA 2VK3A 5HD5A 2YKFA 1GSXA 4YNRA 3T4JA 1SZVA 3AGEA 5HAIA 4JGOA 2V20A 3S7QA 2PD8A 1K56A 5I94A 1OTDA 4KQQA 3C8CA 2EX2A 4JXVA 3SZTA 2JE5A 3G35A 3E2KA 2QJ5A 3IX4A 4H6JA 5CHJA 4G3VA 3E4PA 1YLZA 4N1XA 4EQ1A 1KE4A 1S4RA 3E4OA 3G34A 1W7FA 1S0WA 3HLDA 3VMAA 4JXWA 2OSUA 3NY4A 3HVFA 3NI9A 5G18A 2OOLA 3Q7VB 3R7WA 5EVEA 3NOTC 3VOZA 5HD3A 4RA7A 1G6AA 4X25A 4KENB 5F68A 2GX5A 3F1PB 5FQIA 4S2LA 4E3NA 1T18A 1VHMA 2P04A 3AGDA 1YKDA 3TOIA 5KZHA 3UE3A 3NECA 2XSSA 1ZC2A 1Z6FA 2O99A 1SDEA 3VFFA 1KGGA 3VOLA 2ZQ7A 5CHMA 1I5QA 4MN5A 1YLJA 3OCLA 3UY6A 4B4XA 2HJEA 5DKLA 3ZG9B 4JF4A 1SKOA 1F9IA 3MXRA 3H82B 2OV5A 3ZHHA 2HDSA 4KQRA 3W4QA 4DRTA 2PR6A 2ZD8A 3UB7A 4ARZA 3GR2A 3F1PA 5FI2A 5FQ9A 3NDEA 3G32A 4X55A 3BWLA 4OPZA 1LI9A 4HNBA 2ZM8A 3PBRA 1W5DA 4OKPA 3ZDJA 3A3IA 3G2YA 4LGWA 1NZOA 3KSIA 3QP4A 4ZDXA 1ONHA 4UQIM 4KUKA 3EEAA 2ZQ9A 4QB8A 4E6XA 1ODVA 2WGWB 3B33A 1SCWA 2Z6DA 1I2WA 1LSVA 3FZCA 1PFLA 3PR6A 3K2NA 1NYMA 3UPPA 5J7EA 1M6KA 3A3JA 5KSCA 1JTDA 1HVBA 2WK0A 1S4SA 3V5MA 2GZAA 3A0VA 3VSKA 4ETXA 4FSFA 1GSWA 4YWZA 3GSGA 3LY4A 3HBRA 1DP6A 5F69A 2BTFP 1LLBA 1RCJA 1YSQA 4LV3A 2HP6A 1N9LA 1CK3A 4K0WA 4EBNA 1BLHA 1PW8A 3BRMA 3NJAA 1YSPA 4EXOA 4ETZA 2CMNA 1CI8A 4WM9A 1N9BA 2WKQA 3ITBA 4RVAA 3LR0A 1YMSA 5CEDA 4R70A 4Z9QA 2PAVP 4UA6A 1K55C 1TS0A 2IWCA 4ARZB 2HP5A 1EWZA 4IUHA 4I3AA 3L9KA 2ZL1A 3WS1A 2Q9MA 2O9AA 4QPRA 4HBTA 5GHXA 2ZOHA 1PIOA 1E4DA 5EOEA 2JKTM 2W3HA 2HDRA 3W4OA 5CTNA 3B3XA 3UE6A 1FSWA 5HAPA 3IXGA 3RXXA 4LPZA 4ESPA 5EOOA 1OTAA 4BMWA 1O7EA 2VA0A 2DNSA 5HL6A 3LY3A 1NJ4A 1D06A 3ZNYA 3BLMA 3CHWP 5I5LA 1ONGA 3VP3A 2Y91A 5EM0A 4OQGA 3SH9A 2ZC4B 3DTEA 3ICYA 5HDCA 1TVFA 4BBVA 2VGLM 3SH8A 3S7NA 3DW0A 3N8SA 4H8RA 1BLSA 3GTCA 1H5XA 5HW3A 4QY5A 1YMXA 3JPUA 3T1XA 3RJUA 2JKRI 4LCLA 4UA9A 3KSGA 4K08A 4CQHA 2CC1A 3NC8A 2R9WA 1KE3A 3MMHA 4C3QA 2QHKA 5HWWA 4Y0OA 1JTGA 4PHTA 2XR0A 1Y4OA 2FFYA 1VEUA 3R7WB 5A92A 4M3KA 1XGJA 2A2LA 5J3WA 1BT5A 1CEGA 3DBAA 3PBQA 4Y0UA 5FASA 3T1SA 5AQAA 1DJCA 2PU2A 2EFXA 4RQ9A 2W0NA 1FCOA 4BL3A 3LIFA 2UV0E 5DFXA 4BQMA 1GHIA 1D1JA 5HZHA 4KZ3A 4JF5A 3ITAA 1PZPA 3A3FA 4FTXA 3WWXA 3GVBA 3LI9A 3MBZA 4OH0A 4HQAA 1XGIA 2HGVA 1PRQA 3T4KA 5CHUA 3IF6B 3T1QB 2AVXA 3F1OB 3ZG5A 4E6WA 1BZAA 2Y55A 1LL9A 3E4QA 4FOFA 1CI9A 4GS9B 2GJ3A 1G6OA 5L8MA 4U0TA 4JGQA 3BY9A 4PKYA 3N8RA 1Q2QA 4NG2A 3U4LP 2MJ6A 3MKFA 1L0GA 5FEFA 5G4ZA 2V9AA 1KDSA 4D2OA 2W1TA 5TGFA 4LCMA 1EI5A 5DJTA 5HARA 1BYWA 5TBMB 1EW0A 5FQQA 4M4XA 2W3DA 3LEZA 4O0PA 4Y5FA 4I5SA 4DJ2A 3QP6A 5DFYA 4X1LA 3P98A 3C5AA 3PBTA 4KG5A 1LSWA 4PM8A 3DWZA 4I3IA 3K3CA 4JXGA 1ES4A 3RFBA 4MEZA 3NIAA 1OMEA 3LGOA 2M1CA 3Q82A 1E3UA 1K56D 1VQQA 2PD7A 3GDIA 4R1GA 2JBFA 4HY8A 3KX0X 2EXAA 2WKHA 2W1RA 1RGYA 3UMEA 3H9WA 3UE1A 4HEFA 5BOHA 2VV8A 3GRJA 1IYPA 2UWXA 3DWKA 5F5YA 3QNBA 3OPPA 1NY0A 1YT4A 3DTIA 1K54A 1F2KA 3JVUA 4PMAA 3ZYTA 4BD0A 5CTMA 3FPVA 3EGDC 2ZC3B 4II7A 3T50A 1K6RA 5FEGA 3CG5A 3MSHA 3SOIA 2WKEA 3M2JA 2H0TA 3WS4A 1JVJA 5AJGA 1L2SA 5FL3A 4XUZA 4EUZA 2XLNA 3DAVA 2PBYA 5M18A 3UDXA 2V1AA 4Y3IA 1MWTA 5IT5A 2JKFA 3P7NA 2YKHA 3QNCA 1KGEA 1L0DA 3UO9A 2HDQA 1AWIA 1NLZA 2JC7A 3FV7A 3M2KA 4N9KA 3NDGA 5FQJA 2ZQDA 1G68A 1UWPX 2G2UA 3RH8B 4F94A 1MBLA 3C7VA 4S2OA 3IS2A 2EX6A 3BECA 4E3IA 2B02A 2ZLYA 2W3FA 1JWZA 2KDKA 1TDGA 1FCMA 4PM7A 4WELA 5FI7A 4P87A 5GHYA 1FR6A 4FD8A 2OWJA 3TJZC 4WL9A 2A49A 3MQOA 4Q8IA 2HP9A 2WGIA 3HUOA 4WZ5C 2EXBA 3VE3A 5TR7A 2XGNA 1XFQA 2O9CA 3VP1A 2WZXA 1S6RA 2P08A 3W2ZA 2Y8HA 1OPXA 4Y0TA 4DXCA 4F3LA 2VJWA 2VGLS 5E2GA 3HL9A 4OQIA 2V8FA 2O0YA 3B47A 2XDMA 4RX3A 2Z6CA 4ZBEA 4PM6A 3BQ8A 5GLBA 2EWWA 4JGPA 3PAEA 1HD8A 3KO6A 3LYXA 5EVIB 2K2NA 3FKVA 1GCEA 3QP5A 4FH4A 2J80A 4QJGA 1RP5A 4LRXC 2QMIA 3BJNA 4KZ9A 3N7WA 5DF9A 4S2PA 1OJ5A 3LUQA 5FAPA 5TJJA 1S1ZA 2KOIA 3BFEA 3G30A 5EPHA 2XFSA 4KZAA 4WUJA 3T1RA 5FI6A 3FC7A 5G4YA 2B95A 4Q0JA 4B4ZA 1H0MA 1SKFA 4QY6A 4P6ZM 4GJ4A 2HZ5A 4OP8A 2FZ0A 5FDHA 3OBFA 3BQAA 1XKZA 3CAXA 3FPWA 2ZJ9A 3VP4A 3CUEC 2Y2GA 1K25A 2Z2LB 2QWSA 4S2IA 2Y2LA 3Q7ZA 2VX8A 3UMDA 2WKIA 3MZEA 5GL9A 2K31A 2G7UA 1IKGA 1BLCA 2J3WA 3MF0A 1PNEA 3ZG7B 5DTTA 4O01A 1MWSA 1YLPA 2PRFA 3W4PA 1ZKJA 4Y2FA 2IWDA 2ZC5B 4HHDA 4HI4A 4EUVA 1K4FA 4L9GA 4PPRA 3O5YA 2X71A 4CLCC 3MZDA 2Y2OA 3LO7A 3BFFA 4WMCD 2A3UA 5FDSA 1PWGA 4PM9A 2P7JA 3LICA 4I39A 2XA7S 4LRZE 4OOYA 1IOUA 3G31A 3UB5P 3PYPA 3M6HA 3F1OA 3EGXC 3UB9A 1FR1A 3TE8A 4HP9A 3NOUC 3UPNA 4JXSA 3T4OA 5A8BA 4B88A 4DE2A 4DE1A 2G2WA 3HJKA 5L07A 4JGRA 4MNRA 4C75A 4IHQA 4ZJ3A 1D7EA 4O8GA 5CX7A 3K3DA 3MXQA 3LIDA 2JKTI 3OOVA 3VFHA 2J7VA 2PDRA 2QKPA 4FCFA 3IF6A 1E25A 5A90A 3O86A 4N92A 3L7HA 4HOIA 1GA9A 2OLUA 5CRFA 5HSQA 4GHIB 5L10A 3T4LA 1KVLA 4OONA 3C4OA 1WYBA 2H5SA 3IWIA 4I3JA 4EEPA 2FFFB 4OQ0A 2W1TB 4BD1A 3UB6A 2PYPA 3N8LA 2ZQ8A 4LFUA 5FA7A 4B93A 1P9WA 1O07A 5FQKA 1IYQA 1ES5A 1NLYA 2KLIA 2LB5A 2Y59A 1TD5A 3IT9A 2XQZA 2EA9A 2VGJA 3ZNTA 4WBGA 5EV0A 4GKUA 2X01A 3T4SA 1KVMA 1IYOA 1K38A 2GNXA 4CLCE 1MWRA 2B5RA 5FATA 3U2AA 3HLBA 3VP0A 3MFXA 2IA2A 1AXBA 4BWIA 4S2NA 2K7SA 3CI6A 2WGWA 1WA9A 1W8YA 3LR5A 1STZA 1N4OA 4EEUA 2W3EA 4R3JA 1J3WA 1XP4A 1LL8A 1A0KA 2V8CA 2DMWA 3F1NA 3IXDA 1ERQA 3IH9A 1FQGA 4HIAA 5EVLA 3C38A 1MPLA 3MXSA 2EX8A 5HWTA 3NBLA 4OOLA 1NZUA 3T12B 3A3DA 3BM6A 3BLSA 1YQSA 1H8YA 4L9FA 3PAGA 3HUMA 4GZBA 1BLPA 5A93A 5EVIC 4P0MA 2Y2MA 3IX8A 2H0YA 4MBHA 2IWBA 2WAEA 1IELA 3S1YA 1GA0A 4GOGA 2FH5A 1L3LA 3HLFA 2J8YA 1K54C 3ZG8B 1XJ4A 2ZQCA 3MQ0A 1PW1A 3ISGA 2D02A 1BTLA 1NXYA 3D72A 1YLWA 4GCZA 1TS7A 1E3UD 4EU0A 2X02A 5DTKA 1MY8A 3KYZA 1EROA 4E3JA 5EECA 4O7DA 3NCKA 5J4EA 1BSGA 3QP2A 5FSRA 5CERA 2XD5A 3CITA 5HWVA 1CJFA 1ALQA 4IBRA 1KE0A 3P09A 3FKWA 3IWOA 2WKRA 3N6IA 1ZG6A 4PAUA 3GMWA 2E8IA 3HLWA 2VLGA 5HPFA 2GDNA 2ZMVA 4X6TA 3LIBA 1GHPA 1ZHHB 4R4RA 4WZ5A 5M19A 3CMZA 4EERA 3IXHA 2JKGA 3IBJA 1HZOA 3ULFA 1Y54A 3IX3A 4OP5A 1YLTA 1PZOA 1SKOB 4XUXA 5E2HA 2BLSA 4U0XA 2ZC6B 3NOPC 1MWUA 1TS6A 3IH8A 4UA7A 2EFUA 5EM1A 3SW1A 4U3TA 4R0QA 4NK3A 1BUEA 1Q2PA 5EVIA 5IHVA 3V39A 5A91A 2VKSA 5D3OA 3H82A 1Z09A 3LI8A 1PYYA 3CPTA 4KG6A 3FYZA 2XFTA 3QP1A 5F82A 1K55A 2WZZA 4HJ6A 4LRYC 2RL3A 1ES2A 4PKYG 3T4QA 1DJBA 4LV0A 2D01A 5CGXA 1FILA 5GLCA 4LV2A 5DVAA 1F5MA 2XRNA 3BFGA 1T1BA 4Q0HA 3MFDA 4GN2A 4ME4A 2P9VA 4JBFA 3SS3A 1XA1A 4NXEA 1XJ6A 3PBNA 4QHCA 2I9VA 3A3EA 4BENA 3ZVTA 5E2FA 3MS6A 5L2FA 4DE0A 4GHIA 1L0EA 2L4RA 1GHMA 2Q0OA 3OCNA 4GDNA 3BYDA 3G4PA 4Z1WA 4H6JB 2V1BA 4IUKA 4X1MA 2A24B 1OTIA 4GNUA 4WLAA 4YOFA 5FAOA 3WS5A 4QWOA 2I72A 4HJ4A 4QU3A 3Q81A 4OLDA 4KG2A 4R4SA 5CXWA 3LR3A 5DJUA 5F6AA 4KZBA 5FAQA 3ZFZA 4RYEA 3UPOA 4L0LA 2ZMAA 3IF6C 4MLLA 1IKIA 2Y2IA 4Y13A 1NRFA 3TG9A 4WZ4A 3G2ZA 3GQZA 4ZTKA 1W8QA 4X69A 3OZHA 4CLCA 4FH2A 1OTEA 3WS2A 1NWZA 4E04A 1ZTUA 4NXBA 1T1CA 3BW6A 3E0YA 3VE4A 1DY6A 4WEKA 3CJMA 3UE0A 3TW8A 1P9RA 1IYSA 2QZ6A 3S4XA 5J8XA 3I7JA 3E98A 3ZGAB 5EFWA 3A0RA 3FWLA 2OAQ1 1HTZA 4EW7A 2Y2NA 3OC2A 1Y28A 2V0WA 3IF5A 4X68A 4C6YA 3JYIA 4BLMA 4K0XA 4L9EA 3QHYA 2Y2KA 4E3LA 4BBTA 3T4TA 3C4PA 2LB9A 4R3AA 1QMEA 1N9NA 2Y2JA 3LCEA 4MN7A 2WADA 3EOIA 1YAXA 3HLEA 5EVID 3WRTA 3C2WA 4NETA 4JPMA 4KZ5A 4MMNA 4KQDA 1G28A 3IXBA 2W3GA 3V67A 3LIEA 4N1HA 4CPKA 1MXOA 1ES3A 4DF6A 2VGKA 4E3MA 4IEDA 2OAP1 4P6BA 4YFMA 1I2SA 1H8ZA 4UEYA 5L09A 5IS1A 5DKKA 4GLQA 2WAFA 3S7OA 2E8JA 2XH9A 2ACGA 1WE4A 4OLGA 4S2JA 1SDNA 3M6BA 3KSFA 4OPYA 3ZG0A 2Y2QA 1U60A 5EE8A 4G3KA 1N9OA 4YINA 1YLYA 4MN6A 1PI4A 1T1AA 2PT7A 2VV7A 1QMFA 3WS0A 5F1GA 4IJGA 2H28A 2P9VB 4BJPA 2OWHA 3KYEA 3S22A 4CLCB 2DRWA 3MQQA 3UN7A 1XA7A 3IBRA 4MBFA 2HF6A 3RXWA 3HLGA 5F1FA 4BL2A 2INWA 4WN5A 5AVFA 2WGVA
chains in the Genus database with same CATH topology
4D60A 1HLUP 3CPTB 3D9YA 5EM1A 2PBDP 2JKFA 5EM0A 5EVEA 3UB5P 1PFLA 1SKOA 1VETA 2PRFA 5FEGA 1PRQA 1AWIA 4ESPA 3MSHA 2E8JA 1G5UA 3KYEA 3NECA 3L9KA 3LEQA 2ACGA 2ZL1A 3U4LP 2JKGA 4X1MA 3LGOA 2B95A 3T1QB 1FILA 4X1LA 1CJFA 1K0KA 5FEFA 1Z09A 1CQAA 1VEUB 2VK3A 3NULA 4X25A 3T12B 1SKOB 1VETB 1D1JA 1F2KA 1ACFA 5EV0A 2PAVP 1Y4OA 3CPTA 1VEUA 1J3WA 3L7HA 5FDSA 1SZVA 3DAVA 3MS6A 2ZL1B 2HZ5A 2BTFP 1A0KA 1YPRA 2V8FA 4FTXA 4QWOA 3T1SA 3CHWP 3T1XA 2V8CA 1FIKA 3T1RA 1CF0A 1PNEA 4FUWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4D60 A;  1HLU P;  3CPT B;  3D9Y A;  5EM1 A;  2PBD P;  2JKF A;  5EM0 A;  5EVE A;  3UB5 P;  1PFL A;  1SKO A;  1VET A;  2PRF A;  5FEG A;  1PRQ A;  1AWI A;  4ESP A;  3MSH A;  2E8J A;  1G5U A;  3KYE A;  3NEC A;  3L9K A;  3LEQ A;  2ACG A;  2ZL1 A;  3U4L P;  2JKG A;  4X1M A;  3LGO A;  2B95 A;  3T1Q B;  1FIL A;  4X1L A;  1CJF A;  1K0K A;  5FEF A;  1Z09 A;  1CQA A;  1VEU B;  2VK3 A;  3NUL A;  4X25 A;  3T12 B;  1SKO B;  1VET B;  1D1J A;  1F2K A;  1ACF A;  5EV0 A;  2PAV P;  1Y4O A;  3CPT A;  1VEU A;  1J3W A;  3L7H A;  5FDS A;  1SZV A;  3DAV A;  3MS6 A;  2ZL1 B;  2HZ5 A;  2BTF P;  1A0K A;  1YPR A;  2V8F A;  4FTX A;  4QWO A;  3T1S A;  3CHW P;  3T1X A;  2V8C A;  1FIK A;  3T1R A;  1CF0 A;  1PNE A;  4FUW A; 
#chains in the Genus database with same CATH topology
 4JKT A;  5C5K A;  2ZM2 A;  5MC7 A;  3GV9 A;  4HP4 A;  4DE3 A;  4F3L B;  5DF7 A;  2QYB A;  4S2M A;  3NHQ A;  4KZ8 A;  4JLF A;  1XFN A;  2XF3 A;  2O9B A;  1RGZ A;  3H7W B;  1VEU B;  4WEJ A;  3TRC A;  2PHY A;  3BFD A;  2J9P A;  4JF6 A;  3ZCZ A;  1P0Z A;  3A0S A;  3BEB A;  1IEM A;  4X56 A;  3SH7 A;  2A24 A;  1V9Z A;  1VET A;  3AGF A;  4P85 A;  1CQA A;  3S7P A;  4R38 A;  1ESU A;  3UB8 A;  3P01 A;  5M1A A;  4HBU A;  2C5W B;  1MC0 A;  4B9O A;  5KMW A;  4PM5 A;  4EBL A;  4UHU A;  5CGW A;  2BAS A;  1K6S A;  5JYP A;  5FQM A;  5AVE A;  4ID4 A;  4E3K A;  3C7U A;  1W79 A;  4I38 A;  4XXR A;  3IWQ A;  4P6Z S;  2Q9N A;  2Y2P A;  3VP2 A;  3V50 A;  4EQI A;  3OPR A;  4ZJ2 A;  1ACF A;  4LV1 A;  4X53 A;  4A5R A;  2XD1 A;  3CWF A;  2H10 A;  2P74 A;  5HFO A;  3MKE A;  3VV4 A;  1LL5 A;  5JYO A;  2W27 A;  1VM1 A;  2V2F F;  4LEN A;  4IVI A;  1K0K A;  2Z2M B;  1LSX A;  4MBK A;  3ZQ5 A;  3IS2 B;  4WMC A;  1S66 L;  4KZ4 A;  4XT2 A;  3VOY A;  2ZL1 B;  4R23 A;  3W8K A;  4GD8 A;  5HPI A;  4KUO A;  3V3S A;  4MCW A;  3CZD A;  1H3Q A;  2XK1 A;  4UQI S;  3LR4 A;  2XA7 M;  3KYQ A;  2ZOI A;  2L0W A;  2HJ9 C;  5HL1 A;  5AQ7 A;  5E43 A;  5GHZ A;  1IFQ A;  5KSH A;  2ZC7 A;  4GD6 A;  1SHV A;  4K91 A;  4XT2 B;  5AQ9 A;  3SS5 A;  4CJN A;  2WKP A;  4KZ7 A;  3PTE A;  2ZM0 A;  1G5U A;  3FG8 A;  2JN7 A;  2VEA A;  1TF1 A;  4DMZ A;  4DDS A;  3GEC A;  1FCN A;  3HRE A;  2QJ7 A;  1OT9 A;  2Y4A A;  4WF0 A;  3EQU A;  4HES A;  2Y79 A;  2PU4 A;  1H8M A;  3F1N B;  3UNW A;  1KOU A;  2J3T C;  2JKR M;  4MDZ A;  3OPL A;  2XRO A;  3KSH A;  4R6L A;  4RX2 A;  4UAA A;  5CEB A;  1WYC A;  1W63 Q;  1FIK A;  3MJQ A;  5CEC A;  1K57 A;  5HDD A;  3LFV A;  3HJI A;  4GB7 A;  1C3B A;  3BY8 A;  4NXF A;  3DTK A;  1TS8 A;  5LBR A;  1PI5 A;  5GLD A;  1BUL A;  1NYY A;  4OPQ A;  2KX6 A;  2VV6 A;  5HAQ A;  2EWV A;  5K5B A;  3CUE A;  2L1M A;  5DF8 A;  2JCH A;  1MZU A;  3HCY A;  3CPT B;  2Y2H A;  2WYX A;  1P97 A;  4HJ3 A;  2DCF A;  1OJG A;  1S67 L;  4DJ3 A;  3C30 A;  5EUA A;  2V1Z A;  2ZMF A;  4G3W A;  1VET B;  4BBU A;  3D4F A;  2ZBB A;  4HH2 A;  3B42 A;  4EES A;  2M7V A;  1YM1 A;  2M7U A;  3E2L A;  1W63 M;  4KZ6 A;  3H7W A;  4GS9 A;  2QPN A;  3HLC A;  4R3B A;  4GDB A;  4S2K A;  4DDY A;  4Y15 A;  1FOF A;  2VZW A;  5GLA A;  4IVK A;  2BG1 A;  4KQO A;  1J9M A;  4ZJ1 A;  2R9X A;  4QD4 A;  2R78 A;  4OPR A;  3V3R A;  1UWN X;  1JWP A;  3Q7V A;  1ERM A;  5CGS A;  1DP9 A;  3PHY A;  3SS4 A;  1MKI A;  5F83 A;  5E2E A;  3IHA A;  3CLO A;  4CLC D;  3PXP A;  4ZRR A;  3MZF A;  3RTY A;  5TFQ A;  2WUQ A;  1LHY A;  3O3V A;  2HV1 A;  3PBO A;  1KGF A;  3O88 A;  2RCX A;  1XX2 A;  3WRZ A;  1XJ2 A;  1DJA A;  2J9O A;  3LEQ A;  1X0O A;  1DRM A;  3UDI A;  1XJ3 A;  1CEF A;  4OVD A;  3N4I A;  1TEM A;  4E3O A;  3QP8 A;  1YPR A;  3Q07 A;  4NEE D;  1K57 C;  1CF0 A;  4D60 A;  4WYY A;  2HDU A;  4EBP A;  3O87 A;  3LIA A;  1LI0 A;  3EWK A;  1LT0 A;  4DKI A;  3VSL A;  1F98 A;  3EEH A;  4GW9 A;  3ZVW A;  1OT6 A;  3NUL A;  3HUN A;  3G6O A;  3D3O A;  2EX9 A;  4EV4 A;  2NUP C;  4NKP A;  3Q1F A;  1HLU P;  2PBD P;  5IU1 A;  4ZAM A;  1ESI A;  1KDW A;  1V9Y A;  4EET B;  1OTB A;  1TDL A;  4Y7P A;  2NUT C;  3JVV A;  5DTS A;  4DXB A;  1JNU A;  5HX9 A;  2PR5 A;  3IHB A;  5TBM A;  4OQH A;  2J3T D;  3BFC A;  1NRJ A;  3OLO A;  3D9Y A;  1PWC A;  1T19 A;  1L0F A;  1GSV A;  4DN0 A;  1VB6 A;  2HPB A;  4AFI A;  1ZG4 A;  4OOM A;  5U47 A;  2ZQA A;  4Q0I A;  1S1Y A;  4FUW A;  3IQA A;  2C6W B;  1UGU A;  3MR0 A;  2V0U A;  4Y17 A;  2PYR A;  2B18 A;  1FSY A;  3PBS A;  1MKM A;  3EQV A;  2JHE A;  2OLV A;  3R4K A;  4LLO B;  1DP8 A;  4EWF A;  1PWD A;  5AQB A;  4N9L A;  4S2N C;  2XEP A;  3TSG A;  1K4E A;  4HH3 A;  3UDF A;  4IBX A;  4NXG A;  5KIZ A;  1XPB A;  1JWV A;  3OPH A;  1M40 A;  1XXM A;  5HDS A;  3DTM A;  2VK3 A;  5HD5 A;  2YKF A;  1GSX A;  4YNR A;  3T4J A;  1SZV A;  3AGE A;  5HAI A;  4JGO A;  2V20 A;  3S7Q A;  2PD8 A;  1K56 A;  5I94 A;  1OTD A;  4KQQ A;  3C8C A;  2EX2 A;  4JXV A;  3SZT A;  2JE5 A;  3G35 A;  3E2K A;  2QJ5 A;  3IX4 A;  4H6J A;  5CHJ A;  4G3V A;  3E4P A;  1YLZ A;  4N1X A;  4EQ1 A;  1KE4 A;  1S4R A;  3E4O A;  3G34 A;  1W7F A;  1S0W A;  3HLD A;  3VMA A;  4JXW A;  2OSU A;  3NY4 A;  3HVF A;  3NI9 A;  5G18 A;  2OOL A;  3Q7V B;  3R7W A;  5EVE A;  3NOT C;  3VOZ A;  5HD3 A;  4RA7 A;  1G6A A;  4X25 A;  4KEN B;  5F68 A;  2GX5 A;  3F1P B;  5FQI A;  4S2L A;  4E3N A;  1T18 A;  1VHM A;  2P04 A;  3AGD A;  1YKD A;  3TOI A;  5KZH A;  3UE3 A;  3NEC A;  2XSS A;  1ZC2 A;  1Z6F A;  2O99 A;  1SDE A;  3VFF A;  1KGG A;  3VOL A;  2ZQ7 A;  5CHM A;  1I5Q A;  4MN5 A;  1YLJ A;  3OCL A;  3UY6 A;  4B4X A;  2HJE A;  5DKL A;  3ZG9 B;  4JF4 A;  1SKO A;  1F9I A;  3MXR A;  3H82 B;  2OV5 A;  3ZHH A;  2HDS A;  4KQR A;  3W4Q A;  4DRT A;  2PR6 A;  2ZD8 A;  3UB7 A;  4ARZ A;  3GR2 A;  3F1P A;  5FI2 A;  5FQ9 A;  3NDE A;  3G32 A;  4X55 A;  3BWL A;  4OPZ A;  1LI9 A;  4HNB A;  2ZM8 A;  3PBR A;  1W5D A;  4OKP A;  3ZDJ A;  3A3I A;  3G2Y A;  4LGW A;  1NZO A;  3KSI A;  3QP4 A;  4ZDX A;  1ONH A;  4UQI M;  4KUK A;  3EEA A;  2ZQ9 A;  4QB8 A;  4E6X A;  1ODV A;  2WGW B;  3B33 A;  1SCW A;  2Z6D A;  1I2W A;  1LSV A;  3FZC A;  1PFL A;  3PR6 A;  3K2N A;  1NYM A;  3UPP A;  5J7E A;  1M6K A;  3A3J A;  5KSC A;  1JTD A;  1HVB A;  2WK0 A;  1S4S A;  3V5M A;  2GZA A;  3A0V A;  3VSK A;  4ETX A;  4FSF A;  1GSW A;  4YWZ A;  3GSG A;  3LY4 A;  3HBR A;  1DP6 A;  5F69 A;  2BTF P;  1LLB A;  1RCJ A;  1YSQ A;  4LV3 A;  2HP6 A;  1N9L A;  1CK3 A;  4K0W A;  4EBN A;  1BLH A;  1PW8 A;  3BRM A;  3NJA A;  1YSP A;  4EXO A;  4ETZ A;  2CMN A;  1CI8 A;  4WM9 A;  1N9B A;  2WKQ A;  3ITB A;  4RVA A;  3LR0 A;  1YMS A;  5CED A;  4R70 A;  4Z9Q A;  2PAV P;  4UA6 A;  1K55 C;  1TS0 A;  2IWC A;  4ARZ B;  2HP5 A;  1EWZ A;  4IUH A;  4I3A A;  3L9K A;  2ZL1 A;  3WS1 A;  2Q9M A;  2O9A A;  4QPR A;  4HBT A;  5GHX A;  2ZOH A;  1PIO A;  1E4D A;  5EOE A;  2JKT M;  2W3H A;  2HDR A;  3W4O A;  5CTN A;  3B3X A;  3UE6 A;  1FSW A;  5HAP A;  3IXG A;  3RXX A;  4LPZ A;  4ESP A;  5EOO A;  1OTA A;  4BMW A;  1O7E A;  2VA0 A;  2DNS A;  5HL6 A;  3LY3 A;  1NJ4 A;  1D06 A;  3ZNY A;  3BLM A;  3CHW P;  5I5L A;  1ONG A;  3VP3 A;  2Y91 A;  5EM0 A;  4OQG A;  3SH9 A;  2ZC4 B;  3DTE A;  3ICY A;  5HDC A;  1TVF A;  4BBV A;  2VGL M;  3SH8 A;  3S7N A;  3DW0 A;  3N8S A;  4H8R A;  1BLS A;  3GTC A;  1H5X A;  5HW3 A;  4QY5 A;  1YMX A;  3JPU A;  3T1X A;  3RJU A;  2JKR I;  4LCL A;  4UA9 A;  3KSG A;  4K08 A;  4CQH A;  2CC1 A;  3NC8 A;  2R9W A;  1KE3 A;  3MMH A;  4C3Q A;  2QHK A;  5HWW A;  4Y0O A;  1JTG A;  4PHT A;  2XR0 A;  1Y4O A;  2FFY A;  1VEU A;  3R7W B;  5A92 A;  4M3K A;  1XGJ A;  2A2L A;  5J3W A;  1BT5 A;  1CEG A;  3DBA A;  3PBQ A;  4Y0U A;  5FAS A;  3T1S A;  5AQA A;  1DJC A;  2PU2 A;  2EFX A;  4RQ9 A;  2W0N A;  1FCO A;  4BL3 A;  3LIF A;  2UV0 E;  5DFX A;  4BQM A;  1GHI A;  1D1J A;  5HZH A;  4KZ3 A;  4JF5 A;  3ITA A;  1PZP A;  3A3F A;  4FTX A;  3WWX A;  3GVB A;  3LI9 A;  3MBZ A;  4OH0 A;  4HQA A;  1XGI A;  2HGV A;  1PRQ A;  3T4K A;  5CHU A;  3IF6 B;  3T1Q B;  2AVX A;  3F1O B;  3ZG5 A;  4E6W A;  1BZA A;  2Y55 A;  1LL9 A;  3E4Q A;  4FOF A;  1CI9 A;  4GS9 B;  2GJ3 A;  1G6O A;  5L8M A;  4U0T A;  4JGQ A;  3BY9 A;  4PKY A;  3N8R A;  1Q2Q A;  4NG2 A;  3U4L P;  2MJ6 A;  3MKF A;  1L0G A;  5FEF A;  5G4Z A;  2V9A A;  1KDS A;  4D2O A;  2W1T A;  5TGF A;  4LCM A;  1EI5 A;  5DJT A;  5HAR A;  1BYW A;  5TBM B;  1EW0 A;  5FQQ A;  4M4X A;  2W3D A;  3LEZ A;  4O0P A;  4Y5F A;  4I5S A;  4DJ2 A;  3QP6 A;  5DFY A;  4X1L A;  3P98 A;  3C5A A;  3PBT A;  4KG5 A;  1LSW A;  4PM8 A;  3DWZ A;  4I3I A;  3K3C A;  4JXG A;  1ES4 A;  3RFB A;  4MEZ A;  3NIA A;  1OME A;  3LGO A;  2M1C A;  3Q82 A;  1E3U A;  1K56 D;  1VQQ A;  2PD7 A;  3GDI A;  4R1G A;  2JBF A;  4HY8 A;  3KX0 X;  2EXA A;  2WKH A;  2W1R A;  1RGY A;  3UME A;  3H9W A;  3UE1 A;  4HEF A;  5BOH A;  2VV8 A;  3GRJ A;  1IYP A;  2UWX A;  3DWK A;  5F5Y A;  3QNB A;  3OPP A;  1NY0 A;  1YT4 A;  3DTI A;  1K54 A;  1F2K A;  3JVU A;  4PMA A;  3ZYT A;  4BD0 A;  5CTM A;  3FPV A;  3EGD C;  2ZC3 B;  4II7 A;  3T50 A;  1K6R A;  5FEG A;  3CG5 A;  3MSH A;  3SOI A;  2WKE A;  3M2J A;  2H0T A;  3WS4 A;  1JVJ A;  5AJG A;  1L2S A;  5FL3 A;  4XUZ A;  4EUZ A;  2XLN A;  3DAV A;  2PBY A;  5M18 A;  3UDX A;  2V1A A;  4Y3I A;  1MWT A;  5IT5 A;  2JKF A;  3P7N A;  2YKH A;  3QNC A;  1KGE A;  1L0D A;  3UO9 A;  2HDQ A;  1AWI A;  1NLZ A;  2JC7 A;  3FV7 A;  3M2K A;  4N9K A;  3NDG A;  5FQJ A;  2ZQD A;  1G68 A;  1UWP X;  2G2U A;  3RH8 B;  4F94 A;  1MBL A;  3C7V A;  4S2O A;  3IS2 A;  2EX6 A;  3BEC A;  4E3I A;  2B02 A;  2ZLY A;  2W3F A;  1JWZ A;  2KDK A;  1TDG A;  1FCM A;  4PM7 A;  4WEL A;  5FI7 A;  4P87 A;  5GHY A;  1FR6 A;  4FD8 A;  2OWJ A;  3TJZ C;  4WL9 A;  2A49 A;  3MQO A;  4Q8I A;  2HP9 A;  2WGI A;  3HUO A;  4WZ5 C;  2EXB A;  3VE3 A;  5TR7 A;  2XGN A;  1XFQ A;  2O9C A;  3VP1 A;  2WZX A;  1S6R A;  2P08 A;  3W2Z A;  2Y8H A;  1OPX A;  4Y0T A;  4DXC A;  4F3L A;  2VJW A;  2VGL S;  5E2G A;  3HL9 A;  4OQI A;  2V8F A;  2O0Y A;  3B47 A;  2XDM A;  4RX3 A;  2Z6C A;  4ZBE A;  4PM6 A;  3BQ8 A;  5GLB A;  2EWW A;  4JGP A;  3PAE A;  1HD8 A;  3KO6 A;  3LYX A;  5EVI B;  2K2N A;  3FKV A;  1GCE A;  3QP5 A;  4FH4 A;  2J80 A;  4QJG A;  1RP5 A;  4LRX C;  2QMI A;  3BJN A;  4KZ9 A;  3N7W A;  5DF9 A;  4S2P A;  1OJ5 A;  3LUQ A;  5FAP A;  5TJJ A;  1S1Z A;  2KOI A;  3BFE A;  3G30 A;  5EPH A;  2XFS A;  4KZA A;  4WUJ A;  3T1R A;  5FI6 A;  3FC7 A;  5G4Y A;  2B95 A;  4Q0J A;  4B4Z A;  1H0M A;  1SKF A;  4QY6 A;  4P6Z M;  4GJ4 A;  2HZ5 A;  4OP8 A;  2FZ0 A;  5FDH A;  3OBF A;  3BQA A;  1XKZ A;  3CAX A;  3FPW A;  2ZJ9 A;  3VP4 A;  3CUE C;  2Y2G A;  1K25 A;  2Z2L B;  2QWS A;  4S2I A;  2Y2L A;  3Q7Z A;  2VX8 A;  3UMD A;  2WKI A;  3MZE A;  5GL9 A;  2K31 A;  2G7U A;  1IKG A;  1BLC A;  2J3W A;  3MF0 A;  1PNE A;  3ZG7 B;  5DTT A;  4O01 A;  1MWS A;  1YLP A;  2PRF A;  3W4P A;  1ZKJ A;  4Y2F A;  2IWD A;  2ZC5 B;  4HHD A;  4HI4 A;  4EUV A;  1K4F A;  4L9G A;  4PPR A;  3O5Y A;  2X71 A;  4CLC C;  3MZD A;  2Y2O A;  3LO7 A;  3BFF A;  4WMC D;  2A3U A;  5FDS A;  1PWG A;  4PM9 A;  2P7J A;  3LIC A;  4I39 A;  2XA7 S;  4LRZ E;  4OOY A;  1IOU A;  3G31 A;  3UB5 P;  3PYP A;  3M6H A;  3F1O A;  3EGX C;  3UB9 A;  1FR1 A;  3TE8 A;  4HP9 A;  3NOU C;  3UPN A;  4JXS A;  3T4O A;  5A8B A;  4B88 A;  4DE2 A;  4DE1 A;  2G2W A;  3HJK A;  5L07 A;  4JGR A;  4MNR A;  4C75 A;  4IHQ A;  4ZJ3 A;  1D7E A;  4O8G A;  5CX7 A;  3K3D A;  3MXQ A;  3LID A;  2JKT I;  3OOV A;  3VFH A;  2J7V A;  2PDR A;  2QKP A;  4FCF A;  3IF6 A;  1E25 A;  5A90 A;  3O86 A;  4N92 A;  3L7H A;  4HOI A;  1GA9 A;  2OLU A;  5CRF A;  5HSQ A;  4GHI B;  5L10 A;  3T4L A;  1KVL A;  4OON A;  3C4O A;  1WYB A;  2H5S A;  3IWI A;  4I3J A;  4EEP A;  2FFF B;  4OQ0 A;  2W1T B;  4BD1 A;  3UB6 A;  2PYP A;  3N8L A;  2ZQ8 A;  4LFU A;  5FA7 A;  4B93 A;  1P9W A;  1O07 A;  5FQK A;  1IYQ A;  1ES5 A;  1NLY A;  2KLI A;  2LB5 A;  2Y59 A;  1TD5 A;  3IT9 A;  2XQZ A;  2EA9 A;  2VGJ A;  3ZNT A;  4WBG A;  5EV0 A;  4GKU A;  2X01 A;  3T4S A;  1KVM A;  1IYO A;  1K38 A;  2GNX A;  4CLC E;  1MWR A;  2B5R A;  5FAT A;  3U2A A;  3HLB A;  3VP0 A;  3MFX A;  2IA2 A;  1AXB A;  4BWI A;  4S2N A;  2K7S A;  3CI6 A;  2WGW A;  1WA9 A;  1W8Y A;  3LR5 A;  1STZ A;  1N4O A;  4EEU A;  2W3E A;  4R3J A;  1J3W A;  1XP4 A;  1LL8 A;  1A0K A;  2V8C A;  2DMW A;  3F1N A;  3IXD A;  1ERQ A;  3IH9 A;  1FQG A;  4HIA A;  5EVL A;  3C38 A;  1MPL A;  3MXS A;  2EX8 A;  5HWT A;  3NBL A;  4OOL A;  1NZU A;  3T12 B;  3A3D A;  3BM6 A;  3BLS A;  1YQS A;  1H8Y A;  4L9F A;  3PAG A;  3HUM A;  4GZB A;  1BLP A;  5A93 A;  5EVI C;  4P0M A;  2Y2M A;  3IX8 A;  2H0Y A;  4MBH A;  2IWB A;  2WAE A;  1IEL A;  3S1Y A;  1GA0 A;  4GOG A;  2FH5 A;  1L3L A;  3HLF A;  2J8Y A;  1K54 C;  3ZG8 B;  1XJ4 A;  2ZQC A;  3MQ0 A;  1PW1 A;  3ISG A;  2D02 A;  1BTL A;  1NXY A;  3D72 A;  1YLW A;  4GCZ A;  1TS7 A;  1E3U D;  4EU0 A;  2X02 A;  5DTK A;  1MY8 A;  3KYZ A;  1ERO A;  4E3J A;  5EEC A;  4O7D A;  3NCK A;  5J4E A;  1BSG A;  3QP2 A;  5FSR A;  5CER A;  2XD5 A;  3CIT A;  5HWV A;  1CJF A;  1ALQ A;  4IBR A;  1KE0 A;  3P09 A;  3FKW A;  3IWO A;  2WKR A;  3N6I A;  1ZG6 A;  4PAU A;  3GMW A;  2E8I A;  3HLW A;  2VLG A;  5HPF A;  2GDN A;  2ZMV A;  4X6T A;  3LIB A;  1GHP A;  1ZHH B;  4R4R A;  4WZ5 A;  5M19 A;  3CMZ A;  4EER A;  3IXH A;  2JKG A;  3IBJ A;  1HZO A;  3ULF A;  1Y54 A;  3IX3 A;  4OP5 A;  1YLT A;  1PZO A;  1SKO B;  4XUX A;  5E2H A;  2BLS A;  4U0X A;  2ZC6 B;  3NOP C;  1MWU A;  1TS6 A;  3IH8 A;  4UA7 A;  2EFU A;  5EM1 A;  3SW1 A;  4U3T A;  4R0Q A;  4NK3 A;  1BUE A;  1Q2P A;  5EVI A;  5IHV A;  3V39 A;  5A91 A;  2VKS A;  5D3O A;  3H82 A;  1Z09 A;  3LI8 A;  1PYY A;  3CPT A;  4KG6 A;  3FYZ A;  2XFT A;  3QP1 A;  5F82 A;  1K55 A;  2WZZ A;  4HJ6 A;  4LRY C;  2RL3 A;  1ES2 A;  4PKY G;  3T4Q A;  1DJB A;  4LV0 A;  2D01 A;  5CGX A;  1FIL A;  5GLC A;  4LV2 A;  5DVA A;  1F5M A;  2XRN A;  3BFG A;  1T1B A;  4Q0H A;  3MFD A;  4GN2 A;  4ME4 A;  2P9V A;  4JBF A;  3SS3 A;  1XA1 A;  4NXE A;  1XJ6 A;  3PBN A;  4QHC A;  2I9V A;  3A3E A;  4BEN A;  3ZVT A;  5E2F A;  3MS6 A;  5L2F A;  4DE0 A;  4GHI A;  1L0E A;  2L4R A;  1GHM A;  2Q0O A;  3OCN A;  4GDN A;  3BYD A;  3G4P A;  4Z1W A;  4H6J B;  2V1B A;  4IUK A;  4X1M A;  2A24 B;  1OTI A;  4GNU A;  4WLA A;  4YOF A;  5FAO A;  3WS5 A;  4QWO A;  2I72 A;  4HJ4 A;  4QU3 A;  3Q81 A;  4OLD A;  4KG2 A;  4R4S A;  5CXW A;  3LR3 A;  5DJU A;  5F6A A;  4KZB A;  5FAQ A;  3ZFZ A;  4RYE A;  3UPO A;  4L0L A;  2ZMA A;  3IF6 C;  4MLL A;  1IKI A;  2Y2I A;  4Y13 A;  1NRF A;  3TG9 A;  4WZ4 A;  3G2Z A;  3GQZ A;  4ZTK A;  1W8Q A;  4X69 A;  3OZH A;  4CLC A;  4FH2 A;  1OTE A;  3WS2 A;  1NWZ A;  4E04 A;  1ZTU A;  4NXB A;  1T1C A;  3BW6 A;  3E0Y A;  3VE4 A;  1DY6 A;  4WEK A;  3CJM A;  3UE0 A;  3TW8 A;  1P9R A;  1IYS A;  2QZ6 A;  3S4X A;  5J8X A;  3I7J A;  3E98 A;  3ZGA B;  5EFW A;  3A0R A;  3FWL A;  2OAQ 1;  1HTZ A;  4EW7 A;  2Y2N A;  3OC2 A;  1Y28 A;  2V0W A;  3IF5 A;  4X68 A;  4C6Y A;  3JYI A;  4BLM A;  4K0X A;  4L9E A;  3QHY A;  2Y2K A;  4E3L A;  4BBT A;  3T4T A;  3C4P A;  2LB9 A;  4R3A A;  1QME A;  1N9N A;  2Y2J A;  3LCE A;  4MN7 A;  2WAD A;  3EOI A;  1YAX A;  3HLE A;  5EVI D;  3WRT A;  3C2W A;  4NET A;  4JPM A;  4KZ5 A;  4MMN A;  4KQD A;  1G28 A;  3IXB A;  2W3G A;  3V67 A;  3LIE A;  4N1H A;  4CPK A;  1MXO A;  1ES3 A;  4DF6 A;  2VGK A;  4E3M A;  4IED A;  2OAP 1;  4P6B A;  4YFM A;  1I2S A;  1H8Z A;  4UEY A;  5L09 A;  5IS1 A;  5DKK A;  4GLQ A;  2WAF A;  3S7O A;  2E8J A;  2XH9 A;  2ACG A;  1WE4 A;  4OLG A;  4S2J A;  1SDN A;  3M6B A;  3KSF A;  4OPY A;  3ZG0 A;  2Y2Q A;  1U60 A;  5EE8 A;  4G3K A;  1N9O A;  4YIN A;  1YLY A;  4MN6 A;  1PI4 A;  1T1A A;  2PT7 A;  2VV7 A;  1QMF A;  3WS0 A;  5F1G A;  4IJG A;  2H28 A;  2P9V B;  4BJP A;  2OWH A;  3KYE A;  3S22 A;  4CLC B;  2DRW A;  3MQQ A;  3UN7 A;  1XA7 A;  3IBR A;  4MBF A;  2HF6 A;  3RXW A;  3HLG A;  5F1F A;  4BL2 A;  2INW A;  4WN5 A;  5AVF A;  2WGV A; 
#chains in the Genus database with same CATH homology
 4D60 A;  1HLU P;  3CPT B;  3D9Y A;  5EM1 A;  2PBD P;  2JKF A;  5EM0 A;  5EVE A;  3UB5 P;  1PFL A;  1SKO A;  1VET A;  2PRF A;  5FEG A;  1PRQ A;  1AWI A;  4ESP A;  3MSH A;  2E8J A;  1G5U A;  3KYE A;  3NEC A;  3L9K A;  3LEQ A;  2ACG A;  2ZL1 A;  3U4L P;  2JKG A;  4X1M A;  3LGO A;  2B95 A;  3T1Q B;  1FIL A;  4X1L A;  1CJF A;  1K0K A;  5FEF A;  1Z09 A;  1CQA A;  1VEU B;  2VK3 A;  3NUL A;  4X25 A;  3T12 B;  1SKO B;  1VET B;  1D1J A;  1F2K A;  1ACF A;  5EV0 A;  2PAV P;  1Y4O A;  3CPT A;  1VEU A;  1J3W A;  3L7H A;  5FDS A;  1SZV A;  3DAV A;  3MS6 A;  2ZL1 B;  2HZ5 A;  2BTF P;  1A0K A;  1YPR A;  2V8F A;  4FTX A;  4QWO A;  3T1S A;  3CHW P;  3T1X A;  2V8C A;  1FIK A;  3T1R A;  1CF0 A;  1PNE A;  4FUW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...