1YPRA

Saccharomyces cerevisiae (yeast) profilin
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
125
structure length
125
Chain Sequence
SWQAYTDNLIGTGKVDKAVIYSRAGDAVWATSGGLSLQPNEIGEIVQGFDNPAGLQSNGLHIQGQKFMLLRADDRSIYGRHDAEGVVCVRTKQTVIIAHYPPTVQAGEATKIVEQLADYLIGVQY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Actin-binding protein
molecule keywords PROFILIN
publication title Structure determination and characterization of Saccharomyces cerevisiae profilin
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 39
structure length 125
sequence length 125
chains with identical sequence B
ec nomenclature
pdb deposition date 1997-06-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.30 Alpha Beta 2-Layer Sandwich Beta-Lactamase Dynein light chain 2a, cytoplasmic 1yprA00
5EVEA 2E8JA 5EM0A 1K0KA 1PRQA 5EM1A 2PRFA 2BTFP 2ZL1B 3LEQA 3LGOA 1CF0A 3CHWP 2PAVP 1A0KA 1SZVA 1Y4OA 2PBDP 1VETB 1VEUA 1PNEA 1SKOB 2ZL1A 1PFLA 5FDSA 5FEGA 1VETA 2B95A 3CPTA 3D9YA 1FILA 2V8CA 3T12B 4X1MA 3L9KA 1Z09A 4D60A 1CJFA 2HZ5A 3NULA 1FIKA 3MS6A 3DAVA 1CQAA 5EV0A 3KYEA 4QWOA 1J3WA 3T1QB 1SKOA 3T1SA 3L7HA 4X25A 1G5UA 2V8FA 4FUWA 1D1JA 3T1RA 3UB5P 5FEFA 2JKFA 2VK3A 1AWIA 1ACFA 4X1LA 1HLUP 1VEUB 3T1XA 2ACGA 4FTXA 3NECA 2JKGA 4ESPA 1YPRA 1F2KA 3U4LP 3CPTB 3MSHA
chains in the Genus database with same CATH superfamily
4H6JB 2HF6A 1YM1A 2EXBA 4DXCA 4PM5A 4YINA 1KVMA 2PRFA 5HPFA 5HDCA 1GSVA 3S7QA 3HLEA 3G32A 1RP5A 2GDNA 4D2OA 1DJAA 4IVKA 2QHKA 4HY8A 3N6IA 4RX3A 3E98A 2J9PA 4ZDXA 1CK3A 2A24A 1WE4A 2V2FF 1FR6A 3KSIA 4Y5FA 2P08A 2XA7M 2QJ5A 4BD0A 1S4SA 1F9IA 5DTTA 4XUZA 4U0XA 1NRJA 4EBPA 2G2WA 1TVFA 4WZ5C 5FL3A 3HUNA 3H7WB 4OPQA 3LR0A 1FCNA 5GHXA 3SS3A 1BSGA 1BZAA 1ERMA 4IBXA 4OKPA 3BY9A 2J80A 2HZ5A 2EFUA 1CEFA 5BOHA 3F1NA 1YSQA 1DP6A 4GD6A 3CG5A 1LI0A 4NXEA 3QP2A 3M2KA 5E2GA 2WAFA 5DF8A 4B4ZA 5FQQA 4E3KA 3F1OA 4Y17A 4GB7A 3SW1A 2VK3A 4MN7A 5A8BA 3WWXA 2Z6CA 3OOVA 2FFFB 3WS2A 1OTIA 3ZHHA 4DF6A 2JKGA 3Q81A 1KGFA 1Z6FA 3D3OA 1KE3A 4LFUA 5EVLA 5D3OA 1K0KA 1N9LA 5TBMA 2GJ3A 2HP9A 4EXOA 1H5XA 3IXBA 4EQ1A 1YSPA 5DF9A 3HBRA 3NCKA 5L10A 1GA9A 2A49A 4FD8A 3MXQA 4Y0TA 3W4QA 2JKRI 4GD8A 1FCOA 4XT2A 4B93A 1LSVA 4NXFA 4EEUA 3BFCA 5CHUA 3SOIA 5FDSA 3WS5A 2PYRA 4PAUA 4ARZB 5CRFA 4OPRA 3BFFA 3CPTA 1IKGA 2Z2MB 4GZBA 1D06A 2P9VB 3HUMA 1TS6A 1KGEA 1L0EA 5EVID 3HLFA 2XFTA 3EOIA 4MCWA 2WKRA 3S1YA 1FIKA 2WKHA 3DW0A 4R4SA 2HJ9C 2Y2LA 3VSKA 1T1AA 3T1SA 1ODVA 3MQQA 2IWCA 3C4OA 4PM9A 2H28A 2JKFA 3AGDA 4WBGA 4U3TA 1ACFA 4S2LA 2FFYA 2VA0A 2ACGA 3LEZA 3QNCA 2PDRA 4ZTKA 2OLVA 1Y28A 2J3TD 2V1ZA 4OH0A 3IBRA 2W1TA 5AQ9A 3HLDA 3HJKA 4OLDA 2J8YA 3IXGA 5DVAA 5EM1A 4KZ7A 2D02A 1XA1A 3M6HA 3UN7A 2V0UA 3O88A 4G3VA 3Q1FA 1TDGA 4IJGA 3TW8A 2KX6A 3IWOA 4QY5A 2B18A 2BLSA 4UQIM 3A3FA 4BENA 3A3DA 4PKYA 3E4PA 3IBJA 1VM1A 3HJIA 1IYPA 5KSCA 3B42A 2Y4AA 5IS1A 3H82B 3LI9A 2KDKA 1G68A 1E3UA 1VQQA 3R4KA 5HDDA 3V39A 4H6JA 3OPLA 1H8ZA 2A2LA 1FSWA 1UGUA 4OQHA 2WKQA 4FH2A 1ES4A 2J9OA 3BLSA 4A5RA 3RJUA 3G31A 4GLQA 2ZLYA 3GV9A 1K56A 1MWUA 3C30A 3MQOA 1MPLA 4BWIA 5HAQA 4KG6A 4X53A 5A91A 2HGVA 4E3OA 3QP5A 3DTKA 4DDYA 2EWVA 2VZWA 2OV5A 5CXWA 2B02A 4F3LB 5FAQA 1ERQA 2V1BA 3ZVWA 3PBSA 3RH8B 1VEUB 3H7WA 3G2ZA 1IYOA 4JGPA 2LB9A 5FI7A 1CI8A 3GECA 1KVLA 5HSQA 1PZPA 1P9RA 2BTFP 5TFQA 4PKYG 2A24B 4KZ3A 3GQZA 4HH3A 5A93A 4MBKA 3P01A 3UE3A 5FSRA 4DDSA 5I5LA 4HJ3A 3LI8A 3IXHA 3OC2A 4Q8IA 3EEHA 4JF4A 3ZDJA 1K56D 3UY6A 3D72A 1MXOA 1PFLA 5TJJA 1KDSA 2Z2LB 3GDIA 2XK1A 1VETA 2V20A 2M7VA 3TJZC 1GHPA 5C5KA 2W27A 3MZDA 4K0XA 3LIAA 3MXSA 2V8CA 4ETXA 3ICYA 3T12B 4N1XA 3BM6A 4S2MA 3KYZA 3F1NB 2DRWA 3IF5A 3V67A 2PU4A 1CJFA 3UB8A 2HDSA 2PD8A 3CMZA 4PHTA 3NULA 2QYBA 1NY0A 2M1CA 3PXPA 3O86A 2QMIA 5EVIB 4WEJA 3CZDA 3MR0A 1U60A 5FQMA 3O5YA 2Y2JA 3UDIA 4E04A 4LENA 1NLZA 1LL9A 3ITAA 3BEBA 2ZC6B 4ARZA 5AVEA 1L2SA 1L0GA 3C7VA 3IH9A 3IS2B 4FCFA 1MWRA 4HBTA 2P9VA 5E43A 2VKSA 2P7JA 4RYEA 3E2KA 5CHJA 1TEMA 5DTKA 3A0RA 1G6OA 3RFBA 4P87A 5HX9A 2E8JA 3QNBA 1YMXA 5KMWA 2PR6A 2WKIA 5L8MA 2QKPA 4E6WA 2K31A 4CLCA 4BQMA 4XT2B 1LHYA 3EQVA 3T4SA 3P98A 1YLWA 4ETZA 3CI6A 3QP6A 4DMZA 4Y7PA 5F5YA 5F1GA 1JVJA 3FZCA 3UO9A 1JNUA 1H0MA 4I5SA 3R7WB 3IT9A 4EESA 5M19A 4X55A 4MNRA 2XRNA 1BLSA 3EWKA 3JVVA 2XFSA 5JYPA 4GHIB 3Q82A 5FQJA 3LCEA 2CMNA 2CC1A 5GL9A 5GHZA 4CLCE 1ESUA 4ZJ2A 2FZ0A 3FKWA 3W4OA 4B88A 5A90A 4X56A 3JYIA 4P6ZM 3LO7A 5AQ7A 2WZXA 4I3AA 3T1RA 4NK3A 2A3UA 3UB5P 2O99A 3I7JA 3P09A 3KSHA 2XQZA 4CLCD 3AGFA 3NIAA 1ONGA 2PR5A 3IQAA 1K4FA 1PIOA 2W1TB 3MBZA 1OPXA 2ZQ9A 2IA2A 1N4OA 4RVAA 1K55C 5DTSA 4MDZA 3E0YA 3VE4A 3G4PA 4JXGA 4LV1A 1K38A 4KZ5A 4O0PA 1KE0A 4PM6A 3W8KA 4S2NA 5J3WA 3PTEA 4II7A 4KZ8A 1PRQA 4P6ZS 3LR4A 1J9MA 4JPMA 4ZAMA 3MJQA 1DJCA 4KUKA 4YOFA 3FYZA 4X6TA 4M3KA 1YAXA 3D4FA 1XKZA 3PR6A 1PI4A 4S2OA 4WLAA 5TR7A 1VEUA 5AQAA 1BYWA 4OQGA 4FSFA 1ESIA 3PHYA 5CGWA 4UAAA 3EQUA 3IXDA 3S7OA 4S2IA 5DFYA 1PWDA 2WUQA 4NXGA 2Y8HA 3B47A 5G4YA 5GLCA 2V0WA 1PZOA 4IVIA 4Y15A 3BECA 5FI2A 3E4QA 1LSWA 3O87A 1SCWA 2AVXA 3LIDA 3DAVA 2WKPA 5EE8A 1IELA 1OJGA 2XEPA 3T1QB 3G6OA 2W3FA 3MF0A 2H0TA 4OPZA 1PI5A 4KZBA 4DE2A 4I3IA 1XGJA 1K57A 4U0TA 1VB6A 1W5DA 1ZG4A 5EPHA 3HUOA 4KZ9A 1GSWA 2ZMAA 3EGXC 2OSUA 4LV2A 4HEFA 4S2PA 4LRYC 2DCFA 4ME4A 5FI6A 4WZ4A 1GA0A 1MC0A 4NG2A 2ZQ8A 1XGIA 4EQIA 4C75A 5EFWA 5CEDA 4KQOA 5EVIA 2JHEA 5TGFA 4NEED 1W63M 5CECA 4R3AA 4X68A 3UB6A 2HV1A 4QB8A 1VETB 3IS2A 3RXWA 5HWTA 1TS7A 2YKHA 3VOLA 1BLHA 2M7UA 3T4KA 2EX8A 3K3CA 5CTNA 3NDEA 1LLBA 1STZA 4JGRA 3WRTA 3VP4A 1W7FA 4WELA 1NYYA 3G34A 1K57C 1Q2QA 3UB9A 1XX2A 3Q07A 4L0LA 1FR1A 1HTZA 1IFQA 2HP5A 3DWKA 3IX4A 2JCHA 1LSXA 3FV7A 5HPIA 5CGSA 1WYBA 1WYCA 1JTGA 5EV0A 4BBUA 1MWSA 2VGKA 4CQHA 4WF0A 3Q7ZA 3VMAA 5GLBA 1KDWA 4DRTA 1TF1A 3UPPA 5EVIC 1G28A 3R7WA 3CWFA 4Z1WA 3LY3A 4MBHA 4OP5A 1H8YA 3UB7A 4L9EA 1O7EA 5CHMA 4GCZA 4B4XA 4GHIA 3NDGA 3MXRA 3TRCA 3DWZA 4CLCB 2L0WA 3KO6A 1OT9A 2WK0A 2ZQCA 4HP9A 4L9GA 1ZHHB 1XFQA 1P9WA 1T19A 2XD5A 1PWCA 3MZEA 3MFDA 5E2FA 2PU2A 3LICA 2XF3A 1JWPA 1YLYA 1NXYA 4HQAA 3PBNA 3E2LA 3VP0A 2J3TC 4EWFA 2ZM2A 2HDUA 4K08A 1K6RA 3BLMA 3W4PA 3UMEA 3IX3A 3ZG0A 3FPVA 1RCJA 2HPBA 4IEDA 3BQAA 1T1CA 4PM7A 4EU0A 2B5RA 3IH8A 3CAXA 3K2NA 4I38A 3RTYA 2WGIA 3IX8A 4LV3A 4P0MA 4HJ6A 4E6XA 4BMWA 3IF6B 4NXBA 3G2YA 1P0ZA 2K7SA 5HAIA 4KZAA 4GDBA 2Y2HA 4KQQA 1DY6A 1HVBA 1YLPA 4MMNA 4MBFA 2KLIA 1J3WA 3HLGA 2VX8A 3LR5A 3S7NA 3KSFA 3RXXA 1JWVA 4FH4A 1IOUA 5DF7A 3JPUA 4JGQA 5FEFA 4HESA 3BRMA 2QJ7A 4MN5A 1OMEA 3Q7VB 1HLUP 4EUVA 4OP8A 3ZG9B 1MKIA 3UMDA 1XPBA 2ZM0A 1UWPX 4ZJ3A 4L9FA 4GJ4A 2Q0OA 1ONHA 3NC8A 4WM9A 5U47A 3KYQA 1OTEA 1SKFA 2MJ6A 1XA7A 3DBAA 5IT5A 1M6KA 1S1YA 2Y59A 2ZQDA 1L0DA 3S22A 1N9BA 4Y13A 3LUQA 3CHWP 5G4ZA 3K3DA 2O9CA 2WYXA 3LR3A 1SZVA 2W3EA 3T4QA 2XH9A 3C4PA 2QPNA 4UA7A 3P7NA 1I5QA 3M6BA 4GN2A 4IHQA 4R70A 3KX0X 1MKMA 4Y2FA 3PYPA 5CX7A 4OOMA 3BW6A 5HD5A 3FG8A 3FKVA 3IHBA 3UDFA 2XLNA 4HI4A 3HLBA 2X71A 1FCMA 3VOYA 4I39A 1FOFA 4QHCA 3G35A 3FPWA 2R9WA 4EBLA 2EX9A 2VV6A 2DMWA 1S0WA 4Z9QA 1H3QA 3ZQ5A 1LT0A 1S4RA 1YQSA 5CTMA 3ZG5A 5DKLA 1YT4A 4FTXA 3QP1A 1K4EA 1BTLA 3WS4A 3T4OA 1OJ5A 2RL3A 1IKIA 3MZFA 4N9LA 2INWA 1XJ4A 3V50A 4JF5A 1K6SA 3B3XA 4QU3A 1EWZA 3VOZA 4G3WA 3E4OA 1N9OA 2QZ6A 3LIBA 1LL5A 1IEMA 2PAVP 1A0KA 4R6LA 2WGVA 4BBVA 4OOYA 2PBDP 4NKPA 3ZNYA 3SH9A 1CEGA 2O9BA 1SDEA 4M4XA 4JLFA 3BY8A 2C6WB 3PBOA 3D9YA 4QD4A 2ZC3B 2ZM8A 2XSSA 3ZG7B 3T4TA 5L09A 4JXSA 4QY6A 2Y91A 1GSXA 3FC7A 1NLYA 4GOGA 4LRXC 4GDNA 5AQBA 4E3NA 5E2HA 4BL3A 3SH7A 5G18A 5FAOA 4OOLA 3GRJA 1W8QA 3NOPC 2ZMFA 2WGWA 4GNUA 2PD7A 3CUEA 3CLOA 2KOIA 5M1AA 4X1LA 1I2SA 1P97A 3VP2A 1G6AA 4Y3IA 4KENB 1TS8A 3IF6A 3NHQA 4KQDA 3OCNA 4WMCA 2GX5A 1YPRA 2JN7A 2W3DA 3ZCZA 3ZVTA 4CLCC 1IYSA 3UPNA 5F82A 5FQ9A 2X02A 5HFOA 1X0OA 4DN0A 5EUAA 1KOUA 3HVFA 2H0YA 2V1AA 1Y4OA 5FASA 3Q7VA 1CI9A 2BASA 4I3JA 1TS0A 2WAEA 3C38A 5GLAA 3A3JA 3OBFA 4DJ2A 4S2JA 2XR0A 3ISGA 3LIEA 1ZTUA 4LLOB 2OWJA 4S2KA 5KIZA 3AGEA 4LPZA 3DTMA 3PAEA 3VP3A 2FH5A 3VP1A 4CJNA 1D7EA 2ZQ7A 4HHDA 2VV7A 3CUEC 4PMAA 5FQIA 1QMEA 4UEYA 4Q0JA 4N9KA 1C3BA 3PBRA 3HLCA 2D01A 3V3RA 2V9AA 3T50A 3IF6C 2XROA 3ITBA 4P6BA 3HREA 1GHMA 2R78A 1CQAA 4BBTA 4WMCD 5LBRA 3BFGA 1DRMA 1GHIA 2K2NA 3L7HA 4X25A 2Q9NA 1ZG6A 4UA9A 2GZAA 1M40A 4O7DA 4ZBEA 1AWIA 4YFMA 3C7UA 1V9YA 3N7WA 5FA7A 4H8RA 2ZD8A 4WN5A 3JVUA 4QJGA 1L0FA 3SS4A 4R1GA 3LFVA 1F2KA 4HNBA 4S2NC 5F68A 4Q0HA 2IWDA 2L1MA 4HJ4A 1DJBA 3PAGA 2W1RA 1F98A 2HJEA 2OAP1 4BD1A 4WL9A 5HARA 3ZGAB 4OVDA 1CF0A 3DTIA 4GS9A 1JWZA 1LL8A 3VFHA 3NBLA 1XJ3A 1JTDA 3U2AA 5DJUA 1BULA 3OZHA 2Q9MA 3OCLA 2DNSA 1S1ZA 3GTCA 1IYQA 1YLJA 3NY4A 3OPHA 3QP8A 1HZOA 1FQGA 4R0QA 2I9VA 2VEAA 2XA7S 1ES3A 3NOTC 3L9KA 1Z09A 3C2WA 2PBYA 5AJGA 2UV0E 2HP6A 2LB5A 4N1HA 2ZC7A 3ZFZA 3A3IA 4Y0OA 4DJ3A 4IUHA 3MS6A 2EA9A 5DJTA 5AVFA 1F5MA 3HCYA 4OQ0A 2JC7A 3MKFA 4EEPA 4YNRA 3IHAA 1OTBA 2OAQ1 3TOIA 2E8IA 2VGLM 1E4DA 5HZHA 1WA9A 1FSYA 4N92A 4BJPA 4ESPA 2NUTC 3EGDC 3WS1A 3F1PA 4ZJ1A 3NJAA 1W8YA 5FAPA 5EECA 4B9OA 3N8RA 2Y55A 2R9XA 1BT5A 3UNWA 1VHMA 1ZC2A 3ZG8B 5HL1A 3UE0A 2Y2PA 5F1FA 1N9NA 4OLGA 4EERA 3MFXA 1I2WA 5FQKA 4LCMA 5F69A 3QP4A 3GVBA 1EI5A 1KE4A 1NWZA 4RA7A 2VGLS 4EUZA 4UHUA 2ZL1A 1XJ2A 3CJMA 5JYOA 4LRZE 1NZOA 5FEGA 4OONA 2IWBA 2WZZA 3MMHA 4C6YA 3MQ0A 5DKKA 4BLMA 1OTDA 1T18A 3FWLA 4E3LA 1E25A 2ZJ9A 1XFNA 4DXBA 4IBRA 1PW8A 1L3LA 3KSGA 3MKEA 1S6RA 2WGWB 3ULFA 3KYEA 3OPPA 4QWOA 3GR2A 5HD3A 1W79A 4LV0A 3SZTA 5KZHA 2J7VA 1RGYA 4G3KA 2VGJA 1O07A 1OTAA 3G30A 2O0YA 1XJ6A 4WEKA 1DP8A 1SDNA 3W2ZA 5FATA 5J7EA 5CEBA 2W3HA 2JKTM 4WYYA 5HDSA 5F6AA 1HD8A 2UWXA 5K5BA 2OOLA 4AFIA 1S67L 2ZMVA 2X01A 3BFDA 2VV8A 2H5SA 4XXRA 4JXVA 3UE6A 2VLGA 3HLWA 2OWHA 1LI9A 2Y2NA 1SKOB 4R3JA 4IUKA 2WADA 4LGWA 3IWIA 5HWWA 1TD5A 3A3EA 4KG5A 4ID4A 4OPYA 4O8GA 2RCXA 4UQIS 2EX2A 4KUOA 2B95A 1GCEA 4OQIA 1Q2PA 2EWWA 2I72A 1FILA 4X1MA 3N8LA 3BJNA 4MN6A 4DKIA 1DP9A 3H9WA 4DE1A 2ZOIA 4JXWA 3DTEA 1AXBA 4E3IA 1H8MA 4JKTA 4LCLA 4MEZA 2JBFA 4XUXA 3EEAA 5IU1A 3UPOA 3TG9A 1SHVA 3GMWA 2GNXA 2V8FA 1D1JA 3C5AA 2L4RA 5CERA 3LYXA 4HP4A 4JF6A 1XP4A 1K25A 1E3UD 3BYDA 2J3WA 4PM8A 4RQ9A 3TSGA 4R23A 2ZC4B 2Y2IA 1PW1A 4HOIA 3NECA 1BUEA 1BLPA 3IWQA 4KQRA 2PHYA 2HDQA 1NZUA 3BQ8A 1K54A 4GS9B 1QMFA 3PBQA 3OPRA 3N8SA 4ZRRA 4GW9A 2P74A 2PT7A 3LGOA 4KZ6A 4KZ4A 2Y2GA 1RGZA 3ZYTA 2JKRM 2JE5A 3ZNTA 3A0SA 3V5MA 4GKUA 1PWGA 3F1OB 5MC7A 3OLOA 4HIAA 2Y2MA 2W3GA 3BFEA 4EBNA 1BLCA 4FOFA 5FDHA 3WS0A 4QPRA 4F94A 4P85A 1V9ZA 2PYPA 2ZBBA 1Y54A 4NETA 2XD1A 1W63Q 5HW3A 3VSLA 1YLTA 1YLZA 3UE1A 4E3MA 3T4LA 5TBMB 4MLLA 1ZKJA 1K54C 2Y2QA 1ALQA 1G5UA 3V3SA 1MBLA 1ES2A 1TDLA 3CITA 3HL9A 1ES5A 2O9AA 1EROA 2OLUA 5L07A 3F1PB 2P04A 1KGGA 3VV4A 1YKDA 4UA6A 5J4EA 2XGNA 5IHVA 2W0NA 2ZOHA 3C8CA 1MWTA 2G7UA 1UWNX 3U4LP 3WRZA 3CPTB 1MZUA 5EVEA 3SS5A 5EM0A 1K55A 1YMSA 2H10A 2XDMA 5HAPA 2ZQAA 5F83A 4E3JA 4Y0UA 2YKFA 2ZL1B 3LEQA 1NRFA 2EX6A 2WKEA 3QHYA 3LIFA 5A92A 1T1BA 2HDRA 3A0VA 1PNEA 5DFXA 4K0WA 2Y79A 3N4IA 4EW7A 3NOUC 1OT6A 5J8XA 5GHYA 2BG1A 5KSHA 4K91A 5HL6A 3LY4A 5EOEA 4EV4A 2ZC5B 4JGOA 3H82A 2VJWA 3S4XA 3O3VA 3UDXA 2EXAA 4CPKA 4R38A 4O01A 1NJ4A 4YWZA 4EETB 4R3BA 4D60A 1S66L 4HBUA 5L2FA 1NYMA 2G2UA 2Y2KA 5M18A 3T4JA 3PBTA 4JBFA 5I94A 1XXMA 4DE3A 4Q0IA 4HH2A 1SKOA 4BL2A 4KG2A 4PPRA 5GLDA 2Y2OA 2NUPC 3S7PA 4FUWA 4WZ5A 2Z6DA 4X69A 1PYYA 3B33A 3GSGA 3NI9A 4WUJA 5E2EA 2EFXA 3TE8A 4C3QA 3T1XA 3M2JA 3BWLA 3SH8A 5HWVA 3VFFA 4DE0A 5EOOA 4F3LA 4R4RA 3VE3A 5CGXA 1MY8A 2C5WB 2QWSA 4RX2A 1EW0A 2JKTI 3MSHA
chains in the Genus database with same CATH topology
5EVEA 2E8JA 5EM0A 1K0KA 1PRQA 5EM1A 2PRFA 2BTFP 2ZL1B 3LEQA 3LGOA 1CF0A 3CHWP 2PAVP 1A0KA 1SZVA 1Y4OA 2PBDP 1VETB 1VEUA 1PNEA 1SKOB 2ZL1A 1PFLA 5FDSA 5FEGA 1VETA 2B95A 3CPTA 3D9YA 1FILA 2V8CA 3T12B 4X1MA 3L9KA 1Z09A 4D60A 1CJFA 2HZ5A 3NULA 1FIKA 3MS6A 3DAVA 1CQAA 5EV0A 3KYEA 4QWOA 1J3WA 3T1QB 1SKOA 3T1SA 3L7HA 4X25A 1G5UA 2V8FA 4FUWA 1D1JA 3T1RA 3UB5P 5FEFA 2JKFA 2VK3A 1AWIA 1ACFA 4X1LA 1HLUP 1VEUB 3T1XA 2ACGA 4FTXA 3NECA 2JKGA 4ESPA 1YPRA 1F2KA 3U4LP 3CPTB 3MSHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5EVE A;  2E8J A;  5EM0 A;  1K0K A;  1PRQ A;  5EM1 A;  2PRF A;  2BTF P;  2ZL1 B;  3LEQ A;  3LGO A;  1CF0 A;  3CHW P;  2PAV P;  1A0K A;  1SZV A;  1Y4O A;  2PBD P;  1VET B;  1VEU A;  1PNE A;  1SKO B;  2ZL1 A;  1PFL A;  5FDS A;  5FEG A;  1VET A;  2B95 A;  3CPT A;  3D9Y A;  1FIL A;  2V8C A;  3T12 B;  4X1M A;  3L9K A;  1Z09 A;  4D60 A;  1CJF A;  2HZ5 A;  3NUL A;  1FIK A;  3MS6 A;  3DAV A;  1CQA A;  5EV0 A;  3KYE A;  4QWO A;  1J3W A;  3T1Q B;  1SKO A;  3T1S A;  3L7H A;  4X25 A;  1G5U A;  2V8F A;  4FUW A;  1D1J A;  3T1R A;  3UB5 P;  5FEF A;  2JKF A;  2VK3 A;  1AWI A;  1ACF A;  4X1L A;  1HLU P;  1VEU B;  3T1X A;  2ACG A;  4FTX A;  3NEC A;  2JKG A;  4ESP A;  1YPR A;  1F2K A;  3U4L P;  3CPT B;  3MSH A; 
#chains in the Genus database with same CATH topology
 4H6J B;  2HF6 A;  1YM1 A;  2EXB A;  4DXC A;  4PM5 A;  4YIN A;  1KVM A;  2PRF A;  5HPF A;  5HDC A;  1GSV A;  3S7Q A;  3HLE A;  3G32 A;  1RP5 A;  2GDN A;  4D2O A;  1DJA A;  4IVK A;  2QHK A;  4HY8 A;  3N6I A;  4RX3 A;  3E98 A;  2J9P A;  4ZDX A;  1CK3 A;  2A24 A;  1WE4 A;  2V2F F;  1FR6 A;  3KSI A;  4Y5F A;  2P08 A;  2XA7 M;  2QJ5 A;  4BD0 A;  1S4S A;  1F9I A;  5DTT A;  4XUZ A;  4U0X A;  1NRJ A;  4EBP A;  2G2W A;  1TVF A;  4WZ5 C;  5FL3 A;  3HUN A;  3H7W B;  4OPQ A;  3LR0 A;  1FCN A;  5GHX A;  3SS3 A;  1BSG A;  1BZA A;  1ERM A;  4IBX A;  4OKP A;  3BY9 A;  2J80 A;  2HZ5 A;  2EFU A;  1CEF A;  5BOH A;  3F1N A;  1YSQ A;  1DP6 A;  4GD6 A;  3CG5 A;  1LI0 A;  4NXE A;  3QP2 A;  3M2K A;  5E2G A;  2WAF A;  5DF8 A;  4B4Z A;  5FQQ A;  4E3K A;  3F1O A;  4Y17 A;  4GB7 A;  3SW1 A;  2VK3 A;  4MN7 A;  5A8B A;  3WWX A;  2Z6C A;  3OOV A;  2FFF B;  3WS2 A;  1OTI A;  3ZHH A;  4DF6 A;  2JKG A;  3Q81 A;  1KGF A;  1Z6F A;  3D3O A;  1KE3 A;  4LFU A;  5EVL A;  5D3O A;  1K0K A;  1N9L A;  5TBM A;  2GJ3 A;  2HP9 A;  4EXO A;  1H5X A;  3IXB A;  4EQ1 A;  1YSP A;  5DF9 A;  3HBR A;  3NCK A;  5L10 A;  1GA9 A;  2A49 A;  4FD8 A;  3MXQ A;  4Y0T A;  3W4Q A;  2JKR I;  4GD8 A;  1FCO A;  4XT2 A;  4B93 A;  1LSV A;  4NXF A;  4EEU A;  3BFC A;  5CHU A;  3SOI A;  5FDS A;  3WS5 A;  2PYR A;  4PAU A;  4ARZ B;  5CRF A;  4OPR A;  3BFF A;  3CPT A;  1IKG A;  2Z2M B;  4GZB A;  1D06 A;  2P9V B;  3HUM A;  1TS6 A;  1KGE A;  1L0E A;  5EVI D;  3HLF A;  2XFT A;  3EOI A;  4MCW A;  2WKR A;  3S1Y A;  1FIK A;  2WKH A;  3DW0 A;  4R4S A;  2HJ9 C;  2Y2L A;  3VSK A;  1T1A A;  3T1S A;  1ODV A;  3MQQ A;  2IWC A;  3C4O A;  4PM9 A;  2H28 A;  2JKF A;  3AGD A;  4WBG A;  4U3T A;  1ACF A;  4S2L A;  2FFY A;  2VA0 A;  2ACG A;  3LEZ A;  3QNC A;  2PDR A;  4ZTK A;  2OLV A;  1Y28 A;  2J3T D;  2V1Z A;  4OH0 A;  3IBR A;  2W1T A;  5AQ9 A;  3HLD A;  3HJK A;  4OLD A;  2J8Y A;  3IXG A;  5DVA A;  5EM1 A;  4KZ7 A;  2D02 A;  1XA1 A;  3M6H A;  3UN7 A;  2V0U A;  3O88 A;  4G3V A;  3Q1F A;  1TDG A;  4IJG A;  3TW8 A;  2KX6 A;  3IWO A;  4QY5 A;  2B18 A;  2BLS A;  4UQI M;  3A3F A;  4BEN A;  3A3D A;  4PKY A;  3E4P A;  3IBJ A;  1VM1 A;  3HJI A;  1IYP A;  5KSC A;  3B42 A;  2Y4A A;  5IS1 A;  3H82 B;  3LI9 A;  2KDK A;  1G68 A;  1E3U A;  1VQQ A;  3R4K A;  5HDD A;  3V39 A;  4H6J A;  3OPL A;  1H8Z A;  2A2L A;  1FSW A;  1UGU A;  4OQH A;  2WKQ A;  4FH2 A;  1ES4 A;  2J9O A;  3BLS A;  4A5R A;  3RJU A;  3G31 A;  4GLQ A;  2ZLY A;  3GV9 A;  1K56 A;  1MWU A;  3C30 A;  3MQO A;  1MPL A;  4BWI A;  5HAQ A;  4KG6 A;  4X53 A;  5A91 A;  2HGV A;  4E3O A;  3QP5 A;  3DTK A;  4DDY A;  2EWV A;  2VZW A;  2OV5 A;  5CXW A;  2B02 A;  4F3L B;  5FAQ A;  1ERQ A;  2V1B A;  3ZVW A;  3PBS A;  3RH8 B;  1VEU B;  3H7W A;  3G2Z A;  1IYO A;  4JGP A;  2LB9 A;  5FI7 A;  1CI8 A;  3GEC A;  1KVL A;  5HSQ A;  1PZP A;  1P9R A;  2BTF P;  5TFQ A;  4PKY G;  2A24 B;  4KZ3 A;  3GQZ A;  4HH3 A;  5A93 A;  4MBK A;  3P01 A;  3UE3 A;  5FSR A;  4DDS A;  5I5L A;  4HJ3 A;  3LI8 A;  3IXH A;  3OC2 A;  4Q8I A;  3EEH A;  4JF4 A;  3ZDJ A;  1K56 D;  3UY6 A;  3D72 A;  1MXO A;  1PFL A;  5TJJ A;  1KDS A;  2Z2L B;  3GDI A;  2XK1 A;  1VET A;  2V20 A;  2M7V A;  3TJZ C;  1GHP A;  5C5K A;  2W27 A;  3MZD A;  4K0X A;  3LIA A;  3MXS A;  2V8C A;  4ETX A;  3ICY A;  3T12 B;  4N1X A;  3BM6 A;  4S2M A;  3KYZ A;  3F1N B;  2DRW A;  3IF5 A;  3V67 A;  2PU4 A;  1CJF A;  3UB8 A;  2HDS A;  2PD8 A;  3CMZ A;  4PHT A;  3NUL A;  2QYB A;  1NY0 A;  2M1C A;  3PXP A;  3O86 A;  2QMI A;  5EVI B;  4WEJ A;  3CZD A;  3MR0 A;  1U60 A;  5FQM A;  3O5Y A;  2Y2J A;  3UDI A;  4E04 A;  4LEN A;  1NLZ A;  1LL9 A;  3ITA A;  3BEB A;  2ZC6 B;  4ARZ A;  5AVE A;  1L2S A;  1L0G A;  3C7V A;  3IH9 A;  3IS2 B;  4FCF A;  1MWR A;  4HBT A;  2P9V A;  5E43 A;  2VKS A;  2P7J A;  4RYE A;  3E2K A;  5CHJ A;  1TEM A;  5DTK A;  3A0R A;  1G6O A;  3RFB A;  4P87 A;  5HX9 A;  2E8J A;  3QNB A;  1YMX A;  5KMW A;  2PR6 A;  2WKI A;  5L8M A;  2QKP A;  4E6W A;  2K31 A;  4CLC A;  4BQM A;  4XT2 B;  1LHY A;  3EQV A;  3T4S A;  3P98 A;  1YLW A;  4ETZ A;  3CI6 A;  3QP6 A;  4DMZ A;  4Y7P A;  5F5Y A;  5F1G A;  1JVJ A;  3FZC A;  3UO9 A;  1JNU A;  1H0M A;  4I5S A;  3R7W B;  3IT9 A;  4EES A;  5M19 A;  4X55 A;  4MNR A;  2XRN A;  1BLS A;  3EWK A;  3JVV A;  2XFS A;  5JYP A;  4GHI B;  3Q82 A;  5FQJ A;  3LCE A;  2CMN A;  2CC1 A;  5GL9 A;  5GHZ A;  4CLC E;  1ESU A;  4ZJ2 A;  2FZ0 A;  3FKW A;  3W4O A;  4B88 A;  5A90 A;  4X56 A;  3JYI A;  4P6Z M;  3LO7 A;  5AQ7 A;  2WZX A;  4I3A A;  3T1R A;  4NK3 A;  2A3U A;  3UB5 P;  2O99 A;  3I7J A;  3P09 A;  3KSH A;  2XQZ A;  4CLC D;  3AGF A;  3NIA A;  1ONG A;  2PR5 A;  3IQA A;  1K4F A;  1PIO A;  2W1T B;  3MBZ A;  1OPX A;  2ZQ9 A;  2IA2 A;  1N4O A;  4RVA A;  1K55 C;  5DTS A;  4MDZ A;  3E0Y A;  3VE4 A;  3G4P A;  4JXG A;  4LV1 A;  1K38 A;  4KZ5 A;  4O0P A;  1KE0 A;  4PM6 A;  3W8K A;  4S2N A;  5J3W A;  3PTE A;  4II7 A;  4KZ8 A;  1PRQ A;  4P6Z S;  3LR4 A;  1J9M A;  4JPM A;  4ZAM A;  3MJQ A;  1DJC A;  4KUK A;  4YOF A;  3FYZ A;  4X6T A;  4M3K A;  1YAX A;  3D4F A;  1XKZ A;  3PR6 A;  1PI4 A;  4S2O A;  4WLA A;  5TR7 A;  1VEU A;  5AQA A;  1BYW A;  4OQG A;  4FSF A;  1ESI A;  3PHY A;  5CGW A;  4UAA A;  3EQU A;  3IXD A;  3S7O A;  4S2I A;  5DFY A;  1PWD A;  2WUQ A;  4NXG A;  2Y8H A;  3B47 A;  5G4Y A;  5GLC A;  2V0W A;  1PZO A;  4IVI A;  4Y15 A;  3BEC A;  5FI2 A;  3E4Q A;  1LSW A;  3O87 A;  1SCW A;  2AVX A;  3LID A;  3DAV A;  2WKP A;  5EE8 A;  1IEL A;  1OJG A;  2XEP A;  3T1Q B;  3G6O A;  2W3F A;  3MF0 A;  2H0T A;  4OPZ A;  1PI5 A;  4KZB A;  4DE2 A;  4I3I A;  1XGJ A;  1K57 A;  4U0T A;  1VB6 A;  1W5D A;  1ZG4 A;  5EPH A;  3HUO A;  4KZ9 A;  1GSW A;  2ZMA A;  3EGX C;  2OSU A;  4LV2 A;  4HEF A;  4S2P A;  4LRY C;  2DCF A;  4ME4 A;  5FI6 A;  4WZ4 A;  1GA0 A;  1MC0 A;  4NG2 A;  2ZQ8 A;  1XGI A;  4EQI A;  4C75 A;  5EFW A;  5CED A;  4KQO A;  5EVI A;  2JHE A;  5TGF A;  4NEE D;  1W63 M;  5CEC A;  4R3A A;  4X68 A;  3UB6 A;  2HV1 A;  4QB8 A;  1VET B;  3IS2 A;  3RXW A;  5HWT A;  1TS7 A;  2YKH A;  3VOL A;  1BLH A;  2M7U A;  3T4K A;  2EX8 A;  3K3C A;  5CTN A;  3NDE A;  1LLB A;  1STZ A;  4JGR A;  3WRT A;  3VP4 A;  1W7F A;  4WEL A;  1NYY A;  3G34 A;  1K57 C;  1Q2Q A;  3UB9 A;  1XX2 A;  3Q07 A;  4L0L A;  1FR1 A;  1HTZ A;  1IFQ A;  2HP5 A;  3DWK A;  3IX4 A;  2JCH A;  1LSX A;  3FV7 A;  5HPI A;  5CGS A;  1WYB A;  1WYC A;  1JTG A;  5EV0 A;  4BBU A;  1MWS A;  2VGK A;  4CQH A;  4WF0 A;  3Q7Z A;  3VMA A;  5GLB A;  1KDW A;  4DRT A;  1TF1 A;  3UPP A;  5EVI C;  1G28 A;  3R7W A;  3CWF A;  4Z1W A;  3LY3 A;  4MBH A;  4OP5 A;  1H8Y A;  3UB7 A;  4L9E A;  1O7E A;  5CHM A;  4GCZ A;  4B4X A;  4GHI A;  3NDG A;  3MXR A;  3TRC A;  3DWZ A;  4CLC B;  2L0W A;  3KO6 A;  1OT9 A;  2WK0 A;  2ZQC A;  4HP9 A;  4L9G A;  1ZHH B;  1XFQ A;  1P9W A;  1T19 A;  2XD5 A;  1PWC A;  3MZE A;  3MFD A;  5E2F A;  2PU2 A;  3LIC A;  2XF3 A;  1JWP A;  1YLY A;  1NXY A;  4HQA A;  3PBN A;  3E2L A;  3VP0 A;  2J3T C;  4EWF A;  2ZM2 A;  2HDU A;  4K08 A;  1K6R A;  3BLM A;  3W4P A;  3UME A;  3IX3 A;  3ZG0 A;  3FPV A;  1RCJ A;  2HPB A;  4IED A;  3BQA A;  1T1C A;  4PM7 A;  4EU0 A;  2B5R A;  3IH8 A;  3CAX A;  3K2N A;  4I38 A;  3RTY A;  2WGI A;  3IX8 A;  4LV3 A;  4P0M A;  4HJ6 A;  4E6X A;  4BMW A;  3IF6 B;  4NXB A;  3G2Y A;  1P0Z A;  2K7S A;  5HAI A;  4KZA A;  4GDB A;  2Y2H A;  4KQQ A;  1DY6 A;  1HVB A;  1YLP A;  4MMN A;  4MBF A;  2KLI A;  1J3W A;  3HLG A;  2VX8 A;  3LR5 A;  3S7N A;  3KSF A;  3RXX A;  1JWV A;  4FH4 A;  1IOU A;  5DF7 A;  3JPU A;  4JGQ A;  5FEF A;  4HES A;  3BRM A;  2QJ7 A;  4MN5 A;  1OME A;  3Q7V B;  1HLU P;  4EUV A;  4OP8 A;  3ZG9 B;  1MKI A;  3UMD A;  1XPB A;  2ZM0 A;  1UWP X;  4ZJ3 A;  4L9F A;  4GJ4 A;  2Q0O A;  1ONH A;  3NC8 A;  4WM9 A;  5U47 A;  3KYQ A;  1OTE A;  1SKF A;  2MJ6 A;  1XA7 A;  3DBA A;  5IT5 A;  1M6K A;  1S1Y A;  2Y59 A;  2ZQD A;  1L0D A;  3S22 A;  1N9B A;  4Y13 A;  3LUQ A;  3CHW P;  5G4Z A;  3K3D A;  2O9C A;  2WYX A;  3LR3 A;  1SZV A;  2W3E A;  3T4Q A;  2XH9 A;  3C4P A;  2QPN A;  4UA7 A;  3P7N A;  1I5Q A;  3M6B A;  4GN2 A;  4IHQ A;  4R70 A;  3KX0 X;  1MKM A;  4Y2F A;  3PYP A;  5CX7 A;  4OOM A;  3BW6 A;  5HD5 A;  3FG8 A;  3FKV A;  3IHB A;  3UDF A;  2XLN A;  4HI4 A;  3HLB A;  2X71 A;  1FCM A;  3VOY A;  4I39 A;  1FOF A;  4QHC A;  3G35 A;  3FPW A;  2R9W A;  4EBL A;  2EX9 A;  2VV6 A;  2DMW A;  1S0W A;  4Z9Q A;  1H3Q A;  3ZQ5 A;  1LT0 A;  1S4R A;  1YQS A;  5CTM A;  3ZG5 A;  5DKL A;  1YT4 A;  4FTX A;  3QP1 A;  1K4E A;  1BTL A;  3WS4 A;  3T4O A;  1OJ5 A;  2RL3 A;  1IKI A;  3MZF A;  4N9L A;  2INW A;  1XJ4 A;  3V50 A;  4JF5 A;  1K6S A;  3B3X A;  4QU3 A;  1EWZ A;  3VOZ A;  4G3W A;  3E4O A;  1N9O A;  2QZ6 A;  3LIB A;  1LL5 A;  1IEM A;  2PAV P;  1A0K A;  4R6L A;  2WGV A;  4BBV A;  4OOY A;  2PBD P;  4NKP A;  3ZNY A;  3SH9 A;  1CEG A;  2O9B A;  1SDE A;  4M4X A;  4JLF A;  3BY8 A;  2C6W B;  3PBO A;  3D9Y A;  4QD4 A;  2ZC3 B;  2ZM8 A;  2XSS A;  3ZG7 B;  3T4T A;  5L09 A;  4JXS A;  4QY6 A;  2Y91 A;  1GSX A;  3FC7 A;  1NLY A;  4GOG A;  4LRX C;  4GDN A;  5AQB A;  4E3N A;  5E2H A;  4BL3 A;  3SH7 A;  5G18 A;  5FAO A;  4OOL A;  3GRJ A;  1W8Q A;  3NOP C;  2ZMF A;  2WGW A;  4GNU A;  2PD7 A;  3CUE A;  3CLO A;  2KOI A;  5M1A A;  4X1L A;  1I2S A;  1P97 A;  3VP2 A;  1G6A A;  4Y3I A;  4KEN B;  1TS8 A;  3IF6 A;  3NHQ A;  4KQD A;  3OCN A;  4WMC A;  2GX5 A;  1YPR A;  2JN7 A;  2W3D A;  3ZCZ A;  3ZVT A;  4CLC C;  1IYS A;  3UPN A;  5F82 A;  5FQ9 A;  2X02 A;  5HFO A;  1X0O A;  4DN0 A;  5EUA A;  1KOU A;  3HVF A;  2H0Y A;  2V1A A;  1Y4O A;  5FAS A;  3Q7V A;  1CI9 A;  2BAS A;  4I3J A;  1TS0 A;  2WAE A;  3C38 A;  5GLA A;  3A3J A;  3OBF A;  4DJ2 A;  4S2J A;  2XR0 A;  3ISG A;  3LIE A;  1ZTU A;  4LLO B;  2OWJ A;  4S2K A;  5KIZ A;  3AGE A;  4LPZ A;  3DTM A;  3PAE A;  3VP3 A;  2FH5 A;  3VP1 A;  4CJN A;  1D7E A;  2ZQ7 A;  4HHD A;  2VV7 A;  3CUE C;  4PMA A;  5FQI A;  1QME A;  4UEY A;  4Q0J A;  4N9K A;  1C3B A;  3PBR A;  3HLC A;  2D01 A;  3V3R A;  2V9A A;  3T50 A;  3IF6 C;  2XRO A;  3ITB A;  4P6B A;  3HRE A;  1GHM A;  2R78 A;  1CQA A;  4BBT A;  4WMC D;  5LBR A;  3BFG A;  1DRM A;  1GHI A;  2K2N A;  3L7H A;  4X25 A;  2Q9N A;  1ZG6 A;  4UA9 A;  2GZA A;  1M40 A;  4O7D A;  4ZBE A;  1AWI A;  4YFM A;  3C7U A;  1V9Y A;  3N7W A;  5FA7 A;  4H8R A;  2ZD8 A;  4WN5 A;  3JVU A;  4QJG A;  1L0F A;  3SS4 A;  4R1G A;  3LFV A;  1F2K A;  4HNB A;  4S2N C;  5F68 A;  4Q0H A;  2IWD A;  2L1M A;  4HJ4 A;  1DJB A;  3PAG A;  2W1R A;  1F98 A;  2HJE A;  2OAP 1;  4BD1 A;  4WL9 A;  5HAR A;  3ZGA B;  4OVD A;  1CF0 A;  3DTI A;  4GS9 A;  1JWZ A;  1LL8 A;  3VFH A;  3NBL A;  1XJ3 A;  1JTD A;  3U2A A;  5DJU A;  1BUL A;  3OZH A;  2Q9M A;  3OCL A;  2DNS A;  1S1Z A;  3GTC A;  1IYQ A;  1YLJ A;  3NY4 A;  3OPH A;  3QP8 A;  1HZO A;  1FQG A;  4R0Q A;  2I9V A;  2VEA A;  2XA7 S;  1ES3 A;  3NOT C;  3L9K A;  1Z09 A;  3C2W A;  2PBY A;  5AJG A;  2UV0 E;  2HP6 A;  2LB5 A;  4N1H A;  2ZC7 A;  3ZFZ A;  3A3I A;  4Y0O A;  4DJ3 A;  4IUH A;  3MS6 A;  2EA9 A;  5DJT A;  5AVF A;  1F5M A;  3HCY A;  4OQ0 A;  2JC7 A;  3MKF A;  4EEP A;  4YNR A;  3IHA A;  1OTB A;  2OAQ 1;  3TOI A;  2E8I A;  2VGL M;  1E4D A;  5HZH A;  1WA9 A;  1FSY A;  4N92 A;  4BJP A;  4ESP A;  2NUT C;  3EGD C;  3WS1 A;  3F1P A;  4ZJ1 A;  3NJA A;  1W8Y A;  5FAP A;  5EEC A;  4B9O A;  3N8R A;  2Y55 A;  2R9X A;  1BT5 A;  3UNW A;  1VHM A;  1ZC2 A;  3ZG8 B;  5HL1 A;  3UE0 A;  2Y2P A;  5F1F A;  1N9N A;  4OLG A;  4EER A;  3MFX A;  1I2W A;  5FQK A;  4LCM A;  5F69 A;  3QP4 A;  3GVB A;  1EI5 A;  1KE4 A;  1NWZ A;  4RA7 A;  2VGL S;  4EUZ A;  4UHU A;  2ZL1 A;  1XJ2 A;  3CJM A;  5JYO A;  4LRZ E;  1NZO A;  5FEG A;  4OON A;  2IWB A;  2WZZ A;  3MMH A;  4C6Y A;  3MQ0 A;  5DKK A;  4BLM A;  1OTD A;  1T18 A;  3FWL A;  4E3L A;  1E25 A;  2ZJ9 A;  1XFN A;  4DXB A;  4IBR A;  1PW8 A;  1L3L A;  3KSG A;  3MKE A;  1S6R A;  2WGW B;  3ULF A;  3KYE A;  3OPP A;  4QWO A;  3GR2 A;  5HD3 A;  1W79 A;  4LV0 A;  3SZT A;  5KZH A;  2J7V A;  1RGY A;  4G3K A;  2VGJ A;  1O07 A;  1OTA A;  3G30 A;  2O0Y A;  1XJ6 A;  4WEK A;  1DP8 A;  1SDN A;  3W2Z A;  5FAT A;  5J7E A;  5CEB A;  2W3H A;  2JKT M;  4WYY A;  5HDS A;  5F6A A;  1HD8 A;  2UWX A;  5K5B A;  2OOL A;  4AFI A;  1S67 L;  2ZMV A;  2X01 A;  3BFD A;  2VV8 A;  2H5S A;  4XXR A;  4JXV A;  3UE6 A;  2VLG A;  3HLW A;  2OWH A;  1LI9 A;  2Y2N A;  1SKO B;  4R3J A;  4IUK A;  2WAD A;  4LGW A;  3IWI A;  5HWW A;  1TD5 A;  3A3E A;  4KG5 A;  4ID4 A;  4OPY A;  4O8G A;  2RCX A;  4UQI S;  2EX2 A;  4KUO A;  2B95 A;  1GCE A;  4OQI A;  1Q2P A;  2EWW A;  2I72 A;  1FIL A;  4X1M A;  3N8L A;  3BJN A;  4MN6 A;  4DKI A;  1DP9 A;  3H9W A;  4DE1 A;  2ZOI A;  4JXW A;  3DTE A;  1AXB A;  4E3I A;  1H8M A;  4JKT A;  4LCL A;  4MEZ A;  2JBF A;  4XUX A;  3EEA A;  5IU1 A;  3UPO A;  3TG9 A;  1SHV A;  3GMW A;  2GNX A;  2V8F A;  1D1J A;  3C5A A;  2L4R A;  5CER A;  3LYX A;  4HP4 A;  4JF6 A;  1XP4 A;  1K25 A;  1E3U D;  3BYD A;  2J3W A;  4PM8 A;  4RQ9 A;  3TSG A;  4R23 A;  2ZC4 B;  2Y2I A;  1PW1 A;  4HOI A;  3NEC A;  1BUE A;  1BLP A;  3IWQ A;  4KQR A;  2PHY A;  2HDQ A;  1NZU A;  3BQ8 A;  1K54 A;  4GS9 B;  1QMF A;  3PBQ A;  3OPR A;  3N8S A;  4ZRR A;  4GW9 A;  2P74 A;  2PT7 A;  3LGO A;  4KZ6 A;  4KZ4 A;  2Y2G A;  1RGZ A;  3ZYT A;  2JKR M;  2JE5 A;  3ZNT A;  3A0S A;  3V5M A;  4GKU A;  1PWG A;  3F1O B;  5MC7 A;  3OLO A;  4HIA A;  2Y2M A;  2W3G A;  3BFE A;  4EBN A;  1BLC A;  4FOF A;  5FDH A;  3WS0 A;  4QPR A;  4F94 A;  4P85 A;  1V9Z A;  2PYP A;  2ZBB A;  1Y54 A;  4NET A;  2XD1 A;  1W63 Q;  5HW3 A;  3VSL A;  1YLT A;  1YLZ A;  3UE1 A;  4E3M A;  3T4L A;  5TBM B;  4MLL A;  1ZKJ A;  1K54 C;  2Y2Q A;  1ALQ A;  1G5U A;  3V3S A;  1MBL A;  1ES2 A;  1TDL A;  3CIT A;  3HL9 A;  1ES5 A;  2O9A A;  1ERO A;  2OLU A;  5L07 A;  3F1P B;  2P04 A;  1KGG A;  3VV4 A;  1YKD A;  4UA6 A;  5J4E A;  2XGN A;  5IHV A;  2W0N A;  2ZOH A;  3C8C A;  1MWT A;  2G7U A;  1UWN X;  3U4L P;  3WRZ A;  3CPT B;  1MZU A;  5EVE A;  3SS5 A;  5EM0 A;  1K55 A;  1YMS A;  2H10 A;  2XDM A;  5HAP A;  2ZQA A;  5F83 A;  4E3J A;  4Y0U A;  2YKF A;  2ZL1 B;  3LEQ A;  1NRF A;  2EX6 A;  2WKE A;  3QHY A;  3LIF A;  5A92 A;  1T1B A;  2HDR A;  3A0V A;  1PNE A;  5DFX A;  4K0W A;  2Y79 A;  3N4I A;  4EW7 A;  3NOU C;  1OT6 A;  5J8X A;  5GHY A;  2BG1 A;  5KSH A;  4K91 A;  5HL6 A;  3LY4 A;  5EOE A;  4EV4 A;  2ZC5 B;  4JGO A;  3H82 A;  2VJW A;  3S4X A;  3O3V A;  3UDX A;  2EXA A;  4CPK A;  4R38 A;  4O01 A;  1NJ4 A;  4YWZ A;  4EET B;  4R3B A;  4D60 A;  1S66 L;  4HBU A;  5L2F A;  1NYM A;  2G2U A;  2Y2K A;  5M18 A;  3T4J A;  3PBT A;  4JBF A;  5I94 A;  1XXM A;  4DE3 A;  4Q0I A;  4HH2 A;  1SKO A;  4BL2 A;  4KG2 A;  4PPR A;  5GLD A;  2Y2O A;  2NUP C;  3S7P A;  4FUW A;  4WZ5 A;  2Z6D A;  4X69 A;  1PYY A;  3B33 A;  3GSG A;  3NI9 A;  4WUJ A;  5E2E A;  2EFX A;  3TE8 A;  4C3Q A;  3T1X A;  3M2J A;  3BWL A;  3SH8 A;  5HWV A;  3VFF A;  4DE0 A;  5EOO A;  4F3L A;  4R4R A;  3VE3 A;  5CGX A;  1MY8 A;  2C5W B;  2QWS A;  4RX2 A;  1EW0 A;  2JKT I;  3MSH A; 
#chains in the Genus database with same CATH homology
 5EVE A;  2E8J A;  5EM0 A;  1K0K A;  1PRQ A;  5EM1 A;  2PRF A;  2BTF P;  2ZL1 B;  3LEQ A;  3LGO A;  1CF0 A;  3CHW P;  2PAV P;  1A0K A;  1SZV A;  1Y4O A;  2PBD P;  1VET B;  1VEU A;  1PNE A;  1SKO B;  2ZL1 A;  1PFL A;  5FDS A;  5FEG A;  1VET A;  2B95 A;  3CPT A;  3D9Y A;  1FIL A;  2V8C A;  3T12 B;  4X1M A;  3L9K A;  1Z09 A;  4D60 A;  1CJF A;  2HZ5 A;  3NUL A;  1FIK A;  3MS6 A;  3DAV A;  1CQA A;  5EV0 A;  3KYE A;  4QWO A;  1J3W A;  3T1Q B;  1SKO A;  3T1S A;  3L7H A;  4X25 A;  1G5U A;  2V8F A;  4FUW A;  1D1J A;  3T1R A;  3UB5 P;  5FEF A;  2JKF A;  2VK3 A;  1AWI A;  1ACF A;  4X1L A;  1HLU P;  1VEU B;  3T1X A;  2ACG A;  4FTX A;  3NEC A;  2JKG A;  4ESP A;  1YPR A;  1F2K A;  3U4L P;  3CPT B;  3MSH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...