1YPRA

Saccharomyces cerevisiae (yeast) profilin
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
125
structure length
125
Chain Sequence
b'SWQAYTDNLIGTGKVDKAVIYSRAGDAVWATSGGLSLQPNEIGEIVQGFDNPAGLQSNGLHIQGQKFMLLRADDRSIYGRHDAEGVVCVRTKQTVIIAHYPPTVQAGEATKIVEQLADYLIGVQY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROFILIN
molecule tags Actin-binding protein
source organism Saccharomyces cerevisiae
publication title Structure determination and characterization of Saccharomyces cerevisiae profilin
pubmed doi rcsb
total genus 39
structure length 125
sequence length 125
chains with identical sequence B
ec nomenclature
pdb deposition date 1997-06-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.30 Alpha Beta 2-Layer Sandwich Beta-Lactamase Dynein light chain 2a, cytoplasmic 1yprA00
4X1LA 2PAVP 3NULA 1SKOA 4X1MA 2ZL1B 3T1QB 2PBDP 3DAVA 1ACFA 2V8FA 2BTFP 1AWIA 1A0KA 1Z09A 3UB5P 1F2KA 2JKFA 2ZL1A 1Y4OA 3T1SA 2JKGA 5FEFA 1FILA 3T1RA 3CHWP 2HZ5A 4QWOA 1VEUA 1VETB 1CF0A 3CPTB 1SZVA 2B95A 3LGOA 4X25A 5EM1A 3T12B 2PRFA 1CJFA 3L7HA 5EV0A 2V8CA 3L9KA 5FDSA 4D60A 3T1XA 1PFLA 1FIKA 1PRQA 1VEUB 3CPTA 3MS6A 5FEGA 3KYEA 1G5UA 4ESPA 3LEQA 5EVEA 1SKOB 1HLUP 4FUWA 3D9YA 2E8JA 3NECA 2ACGA 3MSHA 1D1JA 3U4LP 1J3WA 1K0KA 1CQAA 1VETA 1YPRA 5EM0A 4FTXA 2VK3A 1PNEA
chains in the Genus database with same CATH superfamily
3LR4A 1K4EA 1HVBA 4DJ2A 4EQIA 2ZMFA 3ISGA 2FFFB 1T19A 4WMCD 2OSUA 3ZDJA 1XGJA 5FAPA 3ITAA 3N8RA 1HZOA 5FEGA 1FQGA 4QJGA 2OWHA 1CEFA 1PW8A 3IXHA 1ESUA 3MKFA 3MR0A 4ID4A 2Y2GA 1YLPA 3LI9A 1Y54A 4HJ6A 4UA9A 1SKFA 3UDIA 2ZQCA 3O86A 4P6ZM 2HZ5A 1ZKJA 4JLFA 2ZM2A 2ZMVA 4KG5A 1MPLA 3UE1A 4N1XA 4DE0A 1V9ZA 3NI9A 4ZTKA 2NUTC 3SS4A 4EU0A 1RCJA 1NRFA 5KSCA 5CTMA 5DKKA 4HESA 1VEUA 2PR6A 2D01A 4OQ0A 5J7EA 1GCEA 5LBRA 1S0WA 1SKOB 4BJPA 1N9LA 3HREA 2D02A 3JPUA 4WEJA 3R4KA 1L0GA 3OBFA 2BLSA 1BLSA 3CHWP 4HHDA 4EXOA 1P9WA 3T1XA 1YSQA 4GJ4A 1BLPA 5HDDA 2LB5A 4LGWA 3H9WA 5F83A 3ZGAB 4RVAA 3CAXA 1IYSA 3IHAA 4LPZA 3T4JA 5FSRA 3ZFZA 3IX8A 4NXFA 4XUZA 4DXBA 4IVKA 4BENA 4XXRA 5FQKA 2BASA 3F1NA 2Y59A 4ETXA 3E2KA 1LT0A 2HGVA 4EV4A 2VK3A 4KUOA 3NOUC 4P6ZS 4Y2FA 4BD0A 1Z09A 5M1AA 5FDHA 2W3DA 2W3EA 4ZDXA 1K54C 4QWOA 3C8CA 2XR0A 2AVXA 5GLAA 1P9RA 1DP8A 2PT7A 2L4RA 4CLCA 2Y8HA 5A8BA 1PWCA 2WGVA 3UDFA 1W7FA 2ZLYA 5CGSA 2XFTA 3IF6A 5FATA 1E3UD 3A3FA 3ZNTA 1ODVA 3O3VA 1K25A 2P9VB 4GHIA 3KYZA 2G2UA 5EVIB 1OMEA 4IUKA 3EGXC 5A90A 4EETB 3M6HA 2G2WA 4S2NA 2ZM0A 2H5SA 5HFOA 1H8ZA 1YKDA 1VB6A 2W27A 1PRQA 1G5UA 4X55A 5FI2A 4LLOB 3C4PA 4DDSA 3T4KA 5BOHA 1XJ3A 4KZ9A 3Q7VB 4KQQA 2P74A 2W1TB 3MBZA 5HDSA 4IBRA 1Z6FA 3IWIA 2EXAA 3GRJA 4EBNA 2ZMAA 2WKHA 4HY8A 3G32A 4NK3A 5E2GA 4Z1WA 3V3RA 4JXWA 2W0NA 4MDZA 3RFBA 1WYBA 2C6WB 4CPKA 1F2KA 3UDXA 3A3IA 2LB9A 3EQVA 2HDUA 2WK0A 1LL9A 4OLDA 3KX0X 4AFIA 1ZC2A 1BT5A 4JF6A 3CZDA 3T4OA 1AWIA 3WRTA 4KZ6A 4Y13A 4NXEA 2JKGA 1ZTUA 4I39A 1I2WA 2V0WA 5TGFA 3OPLA 2V8CA 1M40A 1EI5A 1K55A 4WBGA 4Y5FA 3K3DA 2XROA 2BG1A 4GD6A 1UWPX 1CQAA 4LV3A 4H8RA 3CG5A 3S7QA 2Y2JA 5DFXA 3CI6A 1Y4OA 3E4PA 1TS6A 5DFYA 1XA1A 3RTYA 4E3LA 3H82A 2JCHA 1K6RA 1D7EA 1TDLA 1FIKA 1ES2A 1ERMA 3SH8A 4LENA 2HDQA 3HJIA 4EUVA 2XA7S 1H8MA 3BW6A 2W1RA 2V8FA 4MN6A 4E3KA 3WS1A 4BBVA 3WWXA 3B47A 1NWZA 3DWZA 4BQMA 4JGRA 2UWXA 2X71A 4GS9A 5L09A 3HJKA 1LSVA 2ZC5B 4ZBEA 2K7SA 1JTDA 1OTAA 1X0OA 4MNRA 1BTLA 3EEHA 2HJ9C 4CLCD 4B88A 4HJ4A 2P7JA 4S2PA 3LIFA 2VA0A 3T50A 1NRJA 3KSHA 2YKFA 1N4OA 4CJNA 3BFCA 3BEBA 4OQHA 5HD5A 1SDNA 3K2NA 5GHYA 1E3UA 4GOGA 4Q0JA 1YQSA 3NBLA 2EWWA 2Y2MA 3CLOA 4Q0IA 3DTMA 4HEFA 5E2FA 3T1SA 3OOVA 3IS2A 2WKQA 2W3HA 4X25A 4DMZA 4GHIB 1G6AA 2IWBA 2V9AA 2ZQDA 2WKRA 3SH9A 2PU4A 3VFHA 3D4FA 3UE0A 4CLCB 3AGEA 2CC1A 1N9BA 3LY4A 3LIDA 3D3OA 1KGFA 2VV6A 4DF6A 1ES3A 2JC7A 2XQZA 2PHYA 4OH0A 1SZVA 3H82B 1LI9A 4FH2A 2J8YA 2WAEA 3P09A 4LRZE 1KVMA 1M6KA 4I38A 4LRXC 3PAEA 2OV5A 3TW8A 3WS2A 4FSFA 1W8YA 2J3WA 1T18A 3ZG5A 2XFSA 3C4OA 1NY0A 2ZQ9A 1MKIA 4QU3A 4ZJ1A 3HLBA 2VV7A 4OQIA 1GSWA 3HLDA 2KOIA 3LR0A 3SOIA 2OLVA 1IKGA 2Y2OA 3UB6A 2VGLS 1MWTA 3G4PA 5FEFA 5TJJA 2WGWB 1CI9A 3LCEA 5GLCA 3W4PA 2Y4AA 4PAUA 4Z9QA 4P85A 4PKYA 3W2ZA 3UPNA 2PBDP 3DAVA 2H0YA 4BMWA 3M2JA 4R4SA 5FQIA 4DKIA 2MJ6A 4MBKA 1JVJA 5CECA 3IH8A 1P97A 5AQBA 1GHIA 3LUQA 1MZUA 1VETB 2V1AA 5A92A 2Y2PA 1OPXA 2HDRA 3D72A 3C7UA 2ZM8A 1S1ZA 3GVBA 3MFXA 1YMXA 4OQGA 3G2YA 3IBJA 3CMZA 2WZXA 3MKEA 1ONHA 1G6OA 1PWGA 3HUOA 1NLZA 2K2NA 3F1OB 3PAGA 1KE0A 2QWSA 1LLBA 5TBMB 2XLNA 3S1YA 3ZG9B 4DE1A 5F5YA 3UNWA 3FWLA 3N7WA 4R3BA 2JE5A 4Y0UA 2EXBA 4GCZA 4B93A 1WE4A 3U4LP 4BWIA 2Y2LA 3OCLA 4FOFA 3JVUA 5I5LA 3IQAA 4M4XA 3PR6A 1FILA 4S2KA 3DTIA 1TVFA 4CLCE 1VM1A 3R7WA 3ZVWA 3H7WA 1XGIA 4YWZA 3FYZA 3G2ZA 1BUEA 4N92A 5HL1A 1EROA 4I3JA 3PYPA 3JYIA 3RXWA 3MFDA 4DRTA 3N8LA 1KDWA 4NXBA 4E3OA 4Y15A 1D06A 1OTIA 2Y2KA 4ESPA 3IX4A 3K3CA 3CJMA 5EM0A 3NY4A 2J80A 5CX7A 1NZUA 5F68A 4ZJ2A 3CPTB 1NYYA 5M18A 1PFLA 3TJZC 4BLMA 1IYOA 3MSHA 1BYWA 2WKPA 4S2NC 5L2FA 1E4DA 3W4QA 1SDEA 1T1CA 3T1QB 2A24A 4PM8A 1FCMA 3GR2A 3LR5A 5DTKA 3C5AA 3C7VA 5A91A 3VP2A 3OC2A 2J7VA 4P0MA 2ZQ7A 3OZHA 4EBPA 3MZFA 3W4OA 4QY5A 5HARA 2ZD8A 4DXCA 3IF6C 1XJ2A 1KGGA 4S2OA 2O9BA 2Y91A 3MF0A 5FQMA 3Q82A 5AQ7A 2L0WA 1BZAA 5M19A 3A3EA 2ZC4B 1G28A 2PBYA 3QP1A 3FPVA 1BSGA 3A0VA 5MC7A 3CITA 2QMIA 4KQOA 2XSSA 1XJ6A 1ZG6A 2KLIA 4X1LA 3F1PB 3VOYA 1K56A 1T1BA 4HI4A 1XFQA 3CUEA 2JKRM 1MWUA 4WZ5C 2XD5A 4P87A 5G4ZA 3UPOA 4O0PA 4BL2A 2GJ3A 4E3JA 3VOZA 2CMNA 4YINA 2O9AA 3VMAA 3V39A 3P01A 1OTDA 4R38A 3CWFA 4OOLA 4UQIS 1Q2PA 3AGFA 2B95A 1NLYA 4U3TA 2W3GA 3MS6A 1TS8A 5FI7A 3ZHHA 3N6IA 2PYPA 5GL9A 4BBTA 1IYPA 5EPHA 3VP1A 4WUJA 1S66L 2JBFA 1PYYA 1FCNA 3B42A 4PMAA 4YNRA 3Q81A 1TS0A 3L7HA 3G6OA 4KG2A 1BULA 4O01A 5GLBA 4ARZB 1FCOA 4R23A 4S2JA 4MBHA 3A3DA 4ARZA 4EEUA 1BLCA 1KOUA 2J9OA 1LL5A 3BFDA 5CHMA 3T4QA 5GHXA 5C5KA 3SS3A 3UN7A 1YMSA 4JXSA 2Z6CA 3ZG8B 5L8MA 4UQIM 5EFWA 4GDNA 3QNCA 2J3TC 4LCLA 2WADA 1VETA 5HL6A 4FD8A 2X02A 4GB7A 4X6TA 2H0TA 4II7A 4F3LA 3UE3A 4R3JA 5J8XA 4HNBA 4Y0TA 4B4XA 4LV0A 3NJAA 2E8IA 4K91A 4JGQA 2DMWA 4NXGA 2INWA 1OJ5A 2HPBA 4GW9A 3PBNA 1K57A 1CI8A 3AGDA 3IXGA 4PM7A 1FSWA 2QJ5A 1H8YA 5FQQA 1F5MA 4FUWA 4Y17A 3UPPA 2O0YA 2XH9A 2OOLA 3SZTA 3IH9A 2ZOHA 3NULA 4EERA 1W8QA 3BY9A 1JTGA 5HZHA 4IVIA 3QP8A 4QD4A 2Z6DA 3T12B 5HSQA 3GSGA 2XRNA 3Q7VA 2VZWA 3CPTA 5HW3A 3IXBA 3BY8A 5CEBA 4K08A 2RL3A 4PM5A 4E6XA 3EGDC 4UAAA 5IU1A 1H0MA 3OCNA 5KMWA 1AXBA 3ZNYA 2VLGA 3UE6A 1S4SA 3P98A 1KVLA 4GKUA 1IELA 1MXOA 5CERA 4R0QA 1ZHHB 3MZDA 2J9PA 3F1PA 5EVID 4LCMA 2Q9NA 1HD8A 5FASA 3UB8A 5DF8A 1YLJA 4WYYA 2WYXA 2B18A 3FKVA 3HCYA 3O5YA 3IBRA 1L0DA 1MY8A 2Y79A 1CJFA 2QHKA 4OOMA 3BFEA 2VEAA 3HLWA 3PBRA 1PI5A 1DP6A 4FTXA 2QPNA 4DJ3A 5DF9A 2X01A 4KZ3A 4EUZA 2ZC3B 3EOIA 4WL9A 3UMEA 1OJGA 3R7WB 1MWRA 4EW7A 3VP0A 4QB8A 2L1MA 5CRFA 3VE3A 3SH7A 3W8KA 1W63Q 2B5RA 4OLGA 1F9IA 1S1YA 3NC8A 2QYBA 3E98A 4WZ4A 5K5BA 1YLYA 2XDMA 1YAXA 2M7VA 1CEGA 4R1GA 4JGOA 3MXRA 5DTSA 3MXQA 4LRYC 5F69A 3ZCZA 1PI4A 4R3AA 2KDKA 2HP9A 5HAIA 1NXYA 1W79A 1O07A 2Y55A 2ZL1B 2EX9A 3G34A 3MJQA 3Q7ZA 2FH5A 1K54A 3WRZA 4MEZA 3OPRA 3UY6A 1IEMA 4WN5A 3B33A 1XPBA 3VE4A 1F98A 3BLSA 4PM9A 3FV7A 3NDGA 2JKTI 1LHYA 4N1HA 3LICA 3M6BA 4ETZA 4KQRA 2FZ0A 3SW1A 2ZC7A 1H5XA 4EESA 3HUNA 3IWQA 5FDSA 3LFVA 3LY3A 3HLEA 4S2MA 3KYEA 1JWPA 1LSWA 4RYEA 4WLAA 3VFFA 5DJTA 3V3SA 4EBLA 2PR5A 5DF7A 3BECA 1OTEA 2XA7M 4N9LA 3VV4A 1TF1A 3S22A 3QP6A 3DW0A 3F1OA 2JKFA 3RJUA 1DJBA 1QMEA 3KO6A 5CHUA 3PHYA 1ZG4A 4WMCA 3IF5A 2GX5A 5G18A 3NIAA 3LIAA 2WKIA 1C3BA 4OOYA 3NOTC 5GLDA 3UB5P 2UV0E 3PTEA 3E0YA 5DVAA 4OVDA 1K6SA 2Y2HA 2VGKA 1BLHA 4FCFA 3PBSA 5F6AA 2A24B 4OKPA 3IF6B 5CXWA 1J3WA 4Y0OA 4Q0HA 5HPFA 4H6JA 2WKEA 3DTEA 4XT2A 4OPQA 4H6JB 4WELA 1VHMA 1L3LA 4LV1A 4K0WA 5EE8A 3WS4A 2V1ZA 1XX2A 4R6LA 3GMWA 4NKPA 4CQHA 1EW0A 2Y2NA 2NUPC 4KZBA 1ALQA 4OONA 4M3KA 3Q07A 1NZOA 1K38A 3HLGA 3FG8A 2A49A 5FAQA 3BQAA 3KSFA 1ES4A 2R9XA 3UO9A 4XUXA 4OPYA 5F82A 5JYOA 1MKMA 4KZ8A 4CLCC 1STZA 4X69A 1IKIA 2O99A 3GTCA 5HWWA 5KZHA 4EQ1A 4EWFA 3HL9A 3LYXA 1QMFA 2M1CA 4HOIA 4G3KA 1IOUA 2W3FA 3MZEA 1EWZA 3MQQA 3VP3A 1S67L 4E3MA 5J4EA 2KX6A 1FOFA 3KYQA 3A0SA 4FH4A 3BLMA 4HH3A 4L9GA 2VKSA 1CF0A 3LGOA 3CUEC 5EV0A 4D60A 4YOFA 2DNSA 4UEYA 2VX8A 5EVIC 4Y7PA 3LR3A 2E8JA 1K56D 5F1FA 4JXVA 5FL3A 3IX3A 3I7JA 4I3AA 3H7WB 4L9FA 3QP4A 4X68A 3PBOA 1K4FA 3PBQA 3G30A 1I2SA 1OTBA 4JBFA 1J9MA 1Y28A 3L9KA 3KSIA 5HWVA 1GHMA 4HQAA 2Z2MB 5IHVA 4MMNA 3ZG7B 3ZQ5A 3E4QA 5GHZA 3OLOA 4PPRA 3T4LA 2PAVP 1GSVA 1DP9A 1WYCA 3A0RA 2K31A 5CEDA 1RGZA 4P6BA 5DJUA 1N9NA 4KUKA 1K55C 2DCFA 5HD3A 2VGLM 4E3NA 3NECA 3DWKA 5A93A 2V1BA 1DRMA 4B9OA 4GDBA 2Y2IA 4UA7A 3E2LA 4IUHA 4EEPA 4JF5A 4ZAMA 3A3JA 1A0KA 2OWJA 4U0TA 1FR6A 3PBTA 3M2KA 3FC7A 4E04A 2OAQ1 4U0XA 3C38A 3BJNA 4C75A 5TBMA 1KGEA 1YLTA 4Q8IA 1TD5A 3ZYTA 1HTZA 1ESIA 3VSLA 2A3UA 4E3IA 1I5QA 4X53A 5HPIA 1PWDA 2V20A 2W1TA 1JWZA 3P7NA 1ERQA 3V67A 4IJGA 2YKHA 2M7UA 3KSGA 2HF6A 5FQ9A 5FQJA 3C2WA 3HVFA 3B3XA 2R9WA 3MQ0A 3IWOA 5D3OA 3OPHA 3S7NA 5EECA 3UMDA 3NDEA 1ACFA 4N9KA 4RX2A 4UA6A 4KZ5A 5DKLA 1TEMA 1SHVA 2EX2A 5EVIA 3WS0A 1XFNA 4GZBA 2QJ7A 4S2IA 2VJWA 4HBUA 5EVEA 5KIZA 3LO7A 1CK3A 5FA7A 3UB7A 4ME4A 2GDNA 1IYQA 4HJ3A 2WUQA 4DE2A 3GQZA 3IT9A 5E43A 2HP5A 1SCWA 5AVEA 1YM1A 4KZ4A 1PZPA 1N9OA 2EX6A 4OPZA 5AQAA 1LL8A 1FSYA 2PRFA 4E6WA 1XP4A 2WAFA 1G68A 2IWCA 1H3QA 5CHJA 3D9YA 2IA2A 2ZQ8A 2V0UA 5TFQA 4MN5A 3BQ8A 3IHBA 4QPRA 2Q9MA 3QHYA 4R4RA 1T1AA 1TDGA 1XA7A 1DY6A 4K0XA 3FZCA 2XF3A 3HLFA 1DJAA 1VEUB 2PD8A 4XT2B 3JVVA 2Z2LB 3ZG0A 3F1NB 4HP4A 4HH2A 3T4TA 2C5WB 2EFXA 3NHQA 3TSGA 1VQQA 3HBRA 3T4SA 2J3TD 4IHQA 1W63M 4JF4A 4GLQA 2XK1A 4NG2A 4DN0A 4GN2A 4OPRA 3S4XA 2ZOIA 2H28A 4G3WA 2JKRI 4KZAA 2A2LA 3LI8A 2XGNA 3G35A 2P08A 1GSXA 3FPWA 3ICYA 4A5RA 4GS9B 4C3QA 3ITBA 3U2AA 1TS7A 4L9EA 5FAOA 2V2FF 3V5MA 4RX3A 2JKTM 2RCXA 4NEED 2ZC6B 3LEQA 3VSKA 4OP5A 4G3VA 4RQ9A 3MQOA 1E25A 4MN7A 1JWVA 3BFFA 3QP5A 5EOOA 5CTNA 5EOEA 4PM6A 4X1MA 1MBLA 3TOIA 2OLUA 4WZ5A 1YLWA 2I9VA 4WF0A 4BL3A 4LFUA 2EFUA 3TE8A 1PIOA 1KDSA 3N4IA 1GHPA 3BWLA 2VGJA 3PXPA 1OT6A 1S4RA 3C30A 4JKTA 3EQUA 1WA9A 3HLCA 1D1JA 5F1GA 3IXDA 4F94A 1PNEA 3TG9A 4R70A 2HV1A 3QNBA 2ZJ9A 5FI6A 2EWVA 5AQ9A 4DE3A 1YLZA 4JPMA 4F3LB 1UWNX 4KQDA 1OT9A 3DBAA 2PYRA 1Q2QA 4WEKA 2JHEA 4ZRRA 3DTKA 5EVLA 4LV2A 2P04A 4HIAA 1S6RA 1YT4A 1ES5A 2Q0OA 4YFMA 4UHUA 5HAPA 2B02A 5E2EA 3OPPA 1ONGA 2O9CA 4Y3IA 1RP5A 5G4YA 1NJ4A 1W5DA 3S7OA 1YPRA 4QHCA 1V9YA 4GNUA 4KG6A 4MLLA 4IEDA 3BYDA 2H10A 5DTTA 4HP9A 2XEPA 2PD7A 2PU2A 3BFGA 3S7PA 1XXMA 3TRCA 2WGWA 4KENB 2R78A 3N8SA 3QP2A 1U60A 3VOLA 1DJCA 3O88A 5HAQA 1KE3A 4PHTA 3SS5A 3WS5A 2I72A 2QKPA 4NETA 2ZL1A 5CGXA 1NYMA 2ZQAA 2JN7A 2HJEA 2HDSA 2ACGA 3HUMA 1KE4A 4QY6A 2VV8A 3G31A 4JXGA 3VP4A 1L0FA 4BD1A 1LSXA 5AJGA 3UB9A 3MXSA 4I3IA 4PKYG 1XKZA 5HDCA 2WZZA 3E4OA 3BM6A 1GA9A 2GNXA 3NCKA 2EA9A 5JYPA 1LI0A 2OAP1 2P9VA 4RA7A 1XJ4A 4DDYA 3MMHA 5J3WA 2ZBBA 4BBUA 3GDIA 4O8GA 5U47A 5EM1A 4JGPA 1FR1A 2PDRA 1RGYA 4KZ7A 3ZVTA 3BRMA 3LIBA 4S2LA 2FFYA 2DRWA 4MBFA 1O7EA 5TR7A 4I5SA 4D2OA 2HP6A 4O7DA 4MCWA 5EUAA 2EX8A 5HWTA 3EEAA 3LIEA 4GD8A 1JNUA 1HLUP 3Q1FA 3NOPC 5KSHA 3V50A 1K57C 1GA0A 3LEZA 5HX9A 3GV9A 3RXXA 5IT5A 3EWKA 5AVFA 2QZ6A 3GECA 1P0ZA 3IS2B 4HBTA 1PZOA 4B4ZA 1IFQA 2WGIA 3FKWA 1L2SA 4IBXA 1SKOA 4ZJ3A 5L10A 2GZAA 1MWSA 2BTFP 4L0LA 2Y2QA 5I94A 2G7UA 4C6YA 3T1RA 5IS1A 1YSPA 3ULFA 2XD1A 4WM9A 1UGUA 1PW1A 2IWDA 5L07A 1MC0A 3O87A 4OP8A 3RH8B 1L0EA 4X56A 1K0KA 5E2HA 5CGWA
chains in the Genus database with same CATH topology
4X1LA 2PAVP 3NULA 1SKOA 4X1MA 2ZL1B 3T1QB 2PBDP 3DAVA 1ACFA 2V8FA 2BTFP 1AWIA 1A0KA 1Z09A 3UB5P 1F2KA 2JKFA 2ZL1A 1Y4OA 3T1SA 2JKGA 5FEFA 1FILA 3T1RA 3CHWP 2HZ5A 4QWOA 1VEUA 1VETB 1CF0A 3CPTB 1SZVA 2B95A 3LGOA 4X25A 5EM1A 3T12B 2PRFA 1CJFA 3L7HA 5EV0A 2V8CA 3L9KA 5FDSA 4D60A 3T1XA 1PFLA 1FIKA 1PRQA 1VEUB 3CPTA 3MS6A 5FEGA 3KYEA 1G5UA 4ESPA 3LEQA 5EVEA 1SKOB 1HLUP 4FUWA 3D9YA 2E8JA 3NECA 2ACGA 3MSHA 1D1JA 3U4LP 1J3WA 1K0KA 1CQAA 1VETA 1YPRA 5EM0A 4FTXA 2VK3A 1PNEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4X1L A;  2PAV P;  3NUL A;  1SKO A;  4X1M A;  2ZL1 B;  3T1Q B;  2PBD P;  3DAV A;  1ACF A;  2V8F A;  2BTF P;  1AWI A;  1A0K A;  1Z09 A;  3UB5 P;  1F2K A;  2JKF A;  2ZL1 A;  1Y4O A;  3T1S A;  2JKG A;  5FEF A;  1FIL A;  3T1R A;  3CHW P;  2HZ5 A;  4QWO A;  1VEU A;  1VET B;  1CF0 A;  3CPT B;  1SZV A;  2B95 A;  3LGO A;  4X25 A;  5EM1 A;  3T12 B;  2PRF A;  1CJF A;  3L7H A;  5EV0 A;  2V8C A;  3L9K A;  5FDS A;  4D60 A;  3T1X A;  1PFL A;  1FIK A;  1PRQ A;  1VEU B;  3CPT A;  3MS6 A;  5FEG A;  3KYE A;  1G5U A;  4ESP A;  3LEQ A;  5EVE A;  1SKO B;  1HLU P;  4FUW A;  3D9Y A;  2E8J A;  3NEC A;  2ACG A;  3MSH A;  1D1J A;  3U4L P;  1J3W A;  1K0K A;  1CQA A;  1VET A;  1YPR A;  5EM0 A;  4FTX A;  2VK3 A;  1PNE A; 
#chains in the Genus database with same CATH topology
 3LR4 A;  1K4E A;  1HVB A;  4DJ2 A;  4EQI A;  2ZMF A;  3ISG A;  2FFF B;  1T19 A;  4WMC D;  2OSU A;  3ZDJ A;  1XGJ A;  5FAP A;  3ITA A;  3N8R A;  1HZO A;  5FEG A;  1FQG A;  4QJG A;  2OWH A;  1CEF A;  1PW8 A;  3IXH A;  1ESU A;  3MKF A;  3MR0 A;  4ID4 A;  2Y2G A;  1YLP A;  3LI9 A;  1Y54 A;  4HJ6 A;  4UA9 A;  1SKF A;  3UDI A;  2ZQC A;  3O86 A;  4P6Z M;  2HZ5 A;  1ZKJ A;  4JLF A;  2ZM2 A;  2ZMV A;  4KG5 A;  1MPL A;  3UE1 A;  4N1X A;  4DE0 A;  1V9Z A;  3NI9 A;  4ZTK A;  2NUT C;  3SS4 A;  4EU0 A;  1RCJ A;  1NRF A;  5KSC A;  5CTM A;  5DKK A;  4HES A;  1VEU A;  2PR6 A;  2D01 A;  4OQ0 A;  5J7E A;  1GCE A;  5LBR A;  1S0W A;  1SKO B;  4BJP A;  1N9L A;  3HRE A;  2D02 A;  3JPU A;  4WEJ A;  3R4K A;  1L0G A;  3OBF A;  2BLS A;  1BLS A;  3CHW P;  4HHD A;  4EXO A;  1P9W A;  3T1X A;  1YSQ A;  4GJ4 A;  1BLP A;  5HDD A;  2LB5 A;  4LGW A;  3H9W A;  5F83 A;  3ZGA B;  4RVA A;  3CAX A;  1IYS A;  3IHA A;  4LPZ A;  3T4J A;  5FSR A;  3ZFZ A;  3IX8 A;  4NXF A;  4XUZ A;  4DXB A;  4IVK A;  4BEN A;  4XXR A;  5FQK A;  2BAS A;  3F1N A;  2Y59 A;  4ETX A;  3E2K A;  1LT0 A;  2HGV A;  4EV4 A;  2VK3 A;  4KUO A;  3NOU C;  4P6Z S;  4Y2F A;  4BD0 A;  1Z09 A;  5M1A A;  5FDH A;  2W3D A;  2W3E A;  4ZDX A;  1K54 C;  4QWO A;  3C8C A;  2XR0 A;  2AVX A;  5GLA A;  1P9R A;  1DP8 A;  2PT7 A;  2L4R A;  4CLC A;  2Y8H A;  5A8B A;  1PWC A;  2WGV A;  3UDF A;  1W7F A;  2ZLY A;  5CGS A;  2XFT A;  3IF6 A;  5FAT A;  1E3U D;  3A3F A;  3ZNT A;  1ODV A;  3O3V A;  1K25 A;  2P9V B;  4GHI A;  3KYZ A;  2G2U A;  5EVI B;  1OME A;  4IUK A;  3EGX C;  5A90 A;  4EET B;  3M6H A;  2G2W A;  4S2N A;  2ZM0 A;  2H5S A;  5HFO A;  1H8Z A;  1YKD A;  1VB6 A;  2W27 A;  1PRQ A;  1G5U A;  4X55 A;  5FI2 A;  4LLO B;  3C4P A;  4DDS A;  3T4K A;  5BOH A;  1XJ3 A;  4KZ9 A;  3Q7V B;  4KQQ A;  2P74 A;  2W1T B;  3MBZ A;  5HDS A;  4IBR A;  1Z6F A;  3IWI A;  2EXA A;  3GRJ A;  4EBN A;  2ZMA A;  2WKH A;  4HY8 A;  3G32 A;  4NK3 A;  5E2G A;  4Z1W A;  3V3R A;  4JXW A;  2W0N A;  4MDZ A;  3RFB A;  1WYB A;  2C6W B;  4CPK A;  1F2K A;  3UDX A;  3A3I A;  2LB9 A;  3EQV A;  2HDU A;  2WK0 A;  1LL9 A;  4OLD A;  3KX0 X;  4AFI A;  1ZC2 A;  1BT5 A;  4JF6 A;  3CZD A;  3T4O A;  1AWI A;  3WRT A;  4KZ6 A;  4Y13 A;  4NXE A;  2JKG A;  1ZTU A;  4I39 A;  1I2W A;  2V0W A;  5TGF A;  3OPL A;  2V8C A;  1M40 A;  1EI5 A;  1K55 A;  4WBG A;  4Y5F A;  3K3D A;  2XRO A;  2BG1 A;  4GD6 A;  1UWP X;  1CQA A;  4LV3 A;  4H8R A;  3CG5 A;  3S7Q A;  2Y2J A;  5DFX A;  3CI6 A;  1Y4O A;  3E4P A;  1TS6 A;  5DFY A;  1XA1 A;  3RTY A;  4E3L A;  3H82 A;  2JCH A;  1K6R A;  1D7E A;  1TDL A;  1FIK A;  1ES2 A;  1ERM A;  3SH8 A;  4LEN A;  2HDQ A;  3HJI A;  4EUV A;  2XA7 S;  1H8M A;  3BW6 A;  2W1R A;  2V8F A;  4MN6 A;  4E3K A;  3WS1 A;  4BBV A;  3WWX A;  3B47 A;  1NWZ A;  3DWZ A;  4BQM A;  4JGR A;  2UWX A;  2X71 A;  4GS9 A;  5L09 A;  3HJK A;  1LSV A;  2ZC5 B;  4ZBE A;  2K7S A;  1JTD A;  1OTA A;  1X0O A;  4MNR A;  1BTL A;  3EEH A;  2HJ9 C;  4CLC D;  4B88 A;  4HJ4 A;  2P7J A;  4S2P A;  3LIF A;  2VA0 A;  3T50 A;  1NRJ A;  3KSH A;  2YKF A;  1N4O A;  4CJN A;  3BFC A;  3BEB A;  4OQH A;  5HD5 A;  1SDN A;  3K2N A;  5GHY A;  1E3U A;  4GOG A;  4Q0J A;  1YQS A;  3NBL A;  2EWW A;  2Y2M A;  3CLO A;  4Q0I A;  3DTM A;  4HEF A;  5E2F A;  3T1S A;  3OOV A;  3IS2 A;  2WKQ A;  2W3H A;  4X25 A;  4DMZ A;  4GHI B;  1G6A A;  2IWB A;  2V9A A;  2ZQD A;  2WKR A;  3SH9 A;  2PU4 A;  3VFH A;  3D4F A;  3UE0 A;  4CLC B;  3AGE A;  2CC1 A;  1N9B A;  3LY4 A;  3LID A;  3D3O A;  1KGF A;  2VV6 A;  4DF6 A;  1ES3 A;  2JC7 A;  2XQZ A;  2PHY A;  4OH0 A;  1SZV A;  3H82 B;  1LI9 A;  4FH2 A;  2J8Y A;  2WAE A;  3P09 A;  4LRZ E;  1KVM A;  1M6K A;  4I38 A;  4LRX C;  3PAE A;  2OV5 A;  3TW8 A;  3WS2 A;  4FSF A;  1W8Y A;  2J3W A;  1T18 A;  3ZG5 A;  2XFS A;  3C4O A;  1NY0 A;  2ZQ9 A;  1MKI A;  4QU3 A;  4ZJ1 A;  3HLB A;  2VV7 A;  4OQI A;  1GSW A;  3HLD A;  2KOI A;  3LR0 A;  3SOI A;  2OLV A;  1IKG A;  2Y2O A;  3UB6 A;  2VGL S;  1MWT A;  3G4P A;  5FEF A;  5TJJ A;  2WGW B;  1CI9 A;  3LCE A;  5GLC A;  3W4P A;  2Y4A A;  4PAU A;  4Z9Q A;  4P85 A;  4PKY A;  3W2Z A;  3UPN A;  2PBD P;  3DAV A;  2H0Y A;  4BMW A;  3M2J A;  4R4S A;  5FQI A;  4DKI A;  2MJ6 A;  4MBK A;  1JVJ A;  5CEC A;  3IH8 A;  1P97 A;  5AQB A;  1GHI A;  3LUQ A;  1MZU A;  1VET B;  2V1A A;  5A92 A;  2Y2P A;  1OPX A;  2HDR A;  3D72 A;  3C7U A;  2ZM8 A;  1S1Z A;  3GVB A;  3MFX A;  1YMX A;  4OQG A;  3G2Y A;  3IBJ A;  3CMZ A;  2WZX A;  3MKE A;  1ONH A;  1G6O A;  1PWG A;  3HUO A;  1NLZ A;  2K2N A;  3F1O B;  3PAG A;  1KE0 A;  2QWS A;  1LLB A;  5TBM B;  2XLN A;  3S1Y A;  3ZG9 B;  4DE1 A;  5F5Y A;  3UNW A;  3FWL A;  3N7W A;  4R3B A;  2JE5 A;  4Y0U A;  2EXB A;  4GCZ A;  4B93 A;  1WE4 A;  3U4L P;  4BWI A;  2Y2L A;  3OCL A;  4FOF A;  3JVU A;  5I5L A;  3IQA A;  4M4X A;  3PR6 A;  1FIL A;  4S2K A;  3DTI A;  1TVF A;  4CLC E;  1VM1 A;  3R7W A;  3ZVW A;  3H7W A;  1XGI A;  4YWZ A;  3FYZ A;  3G2Z A;  1BUE A;  4N92 A;  5HL1 A;  1ERO A;  4I3J A;  3PYP A;  3JYI A;  3RXW A;  3MFD A;  4DRT A;  3N8L A;  1KDW A;  4NXB A;  4E3O A;  4Y15 A;  1D06 A;  1OTI A;  2Y2K A;  4ESP A;  3IX4 A;  3K3C A;  3CJM A;  5EM0 A;  3NY4 A;  2J80 A;  5CX7 A;  1NZU A;  5F68 A;  4ZJ2 A;  3CPT B;  1NYY A;  5M18 A;  1PFL A;  3TJZ C;  4BLM A;  1IYO A;  3MSH A;  1BYW A;  2WKP A;  4S2N C;  5L2F A;  1E4D A;  3W4Q A;  1SDE A;  1T1C A;  3T1Q B;  2A24 A;  4PM8 A;  1FCM A;  3GR2 A;  3LR5 A;  5DTK A;  3C5A A;  3C7V A;  5A91 A;  3VP2 A;  3OC2 A;  2J7V A;  4P0M A;  2ZQ7 A;  3OZH A;  4EBP A;  3MZF A;  3W4O A;  4QY5 A;  5HAR A;  2ZD8 A;  4DXC A;  3IF6 C;  1XJ2 A;  1KGG A;  4S2O A;  2O9B A;  2Y91 A;  3MF0 A;  5FQM A;  3Q82 A;  5AQ7 A;  2L0W A;  1BZA A;  5M19 A;  3A3E A;  2ZC4 B;  1G28 A;  2PBY A;  3QP1 A;  3FPV A;  1BSG A;  3A0V A;  5MC7 A;  3CIT A;  2QMI A;  4KQO A;  2XSS A;  1XJ6 A;  1ZG6 A;  2KLI A;  4X1L A;  3F1P B;  3VOY A;  1K56 A;  1T1B A;  4HI4 A;  1XFQ A;  3CUE A;  2JKR M;  1MWU A;  4WZ5 C;  2XD5 A;  4P87 A;  5G4Z A;  3UPO A;  4O0P A;  4BL2 A;  2GJ3 A;  4E3J A;  3VOZ A;  2CMN A;  4YIN A;  2O9A A;  3VMA A;  3V39 A;  3P01 A;  1OTD A;  4R38 A;  3CWF A;  4OOL A;  4UQI S;  1Q2P A;  3AGF A;  2B95 A;  1NLY A;  4U3T A;  2W3G A;  3MS6 A;  1TS8 A;  5FI7 A;  3ZHH A;  3N6I A;  2PYP A;  5GL9 A;  4BBT A;  1IYP A;  5EPH A;  3VP1 A;  4WUJ A;  1S66 L;  2JBF A;  1PYY A;  1FCN A;  3B42 A;  4PMA A;  4YNR A;  3Q81 A;  1TS0 A;  3L7H A;  3G6O A;  4KG2 A;  1BUL A;  4O01 A;  5GLB A;  4ARZ B;  1FCO A;  4R23 A;  4S2J A;  4MBH A;  3A3D A;  4ARZ A;  4EEU A;  1BLC A;  1KOU A;  2J9O A;  1LL5 A;  3BFD A;  5CHM A;  3T4Q A;  5GHX A;  5C5K A;  3SS3 A;  3UN7 A;  1YMS A;  4JXS A;  2Z6C A;  3ZG8 B;  5L8M A;  4UQI M;  5EFW A;  4GDN A;  3QNC A;  2J3T C;  4LCL A;  2WAD A;  1VET A;  5HL6 A;  4FD8 A;  2X02 A;  4GB7 A;  4X6T A;  2H0T A;  4II7 A;  4F3L A;  3UE3 A;  4R3J A;  5J8X A;  4HNB A;  4Y0T A;  4B4X A;  4LV0 A;  3NJA A;  2E8I A;  4K91 A;  4JGQ A;  2DMW A;  4NXG A;  2INW A;  1OJ5 A;  2HPB A;  4GW9 A;  3PBN A;  1K57 A;  1CI8 A;  3AGD A;  3IXG A;  4PM7 A;  1FSW A;  2QJ5 A;  1H8Y A;  5FQQ A;  1F5M A;  4FUW A;  4Y17 A;  3UPP A;  2O0Y A;  2XH9 A;  2OOL A;  3SZT A;  3IH9 A;  2ZOH A;  3NUL A;  4EER A;  1W8Q A;  3BY9 A;  1JTG A;  5HZH A;  4IVI A;  3QP8 A;  4QD4 A;  2Z6D A;  3T12 B;  5HSQ A;  3GSG A;  2XRN A;  3Q7V A;  2VZW A;  3CPT A;  5HW3 A;  3IXB A;  3BY8 A;  5CEB A;  4K08 A;  2RL3 A;  4PM5 A;  4E6X A;  3EGD C;  4UAA A;  5IU1 A;  1H0M A;  3OCN A;  5KMW A;  1AXB A;  3ZNY A;  2VLG A;  3UE6 A;  1S4S A;  3P98 A;  1KVL A;  4GKU A;  1IEL A;  1MXO A;  5CER A;  4R0Q A;  1ZHH B;  3MZD A;  2J9P A;  3F1P A;  5EVI D;  4LCM A;  2Q9N A;  1HD8 A;  5FAS A;  3UB8 A;  5DF8 A;  1YLJ A;  4WYY A;  2WYX A;  2B18 A;  3FKV A;  3HCY A;  3O5Y A;  3IBR A;  1L0D A;  1MY8 A;  2Y79 A;  1CJF A;  2QHK A;  4OOM A;  3BFE A;  2VEA A;  3HLW A;  3PBR A;  1PI5 A;  1DP6 A;  4FTX A;  2QPN A;  4DJ3 A;  5DF9 A;  2X01 A;  4KZ3 A;  4EUZ A;  2ZC3 B;  3EOI A;  4WL9 A;  3UME A;  1OJG A;  3R7W B;  1MWR A;  4EW7 A;  3VP0 A;  4QB8 A;  2L1M A;  5CRF A;  3VE3 A;  3SH7 A;  3W8K A;  1W63 Q;  2B5R A;  4OLG A;  1F9I A;  1S1Y A;  3NC8 A;  2QYB A;  3E98 A;  4WZ4 A;  5K5B A;  1YLY A;  2XDM A;  1YAX A;  2M7V A;  1CEG A;  4R1G A;  4JGO A;  3MXR A;  5DTS A;  3MXQ A;  4LRY C;  5F69 A;  3ZCZ A;  1PI4 A;  4R3A A;  2KDK A;  2HP9 A;  5HAI A;  1NXY A;  1W79 A;  1O07 A;  2Y55 A;  2ZL1 B;  2EX9 A;  3G34 A;  3MJQ A;  3Q7Z A;  2FH5 A;  1K54 A;  3WRZ A;  4MEZ A;  3OPR A;  3UY6 A;  1IEM A;  4WN5 A;  3B33 A;  1XPB A;  3VE4 A;  1F98 A;  3BLS A;  4PM9 A;  3FV7 A;  3NDG A;  2JKT I;  1LHY A;  4N1H A;  3LIC A;  3M6B A;  4ETZ A;  4KQR A;  2FZ0 A;  3SW1 A;  2ZC7 A;  1H5X A;  4EES A;  3HUN A;  3IWQ A;  5FDS A;  3LFV A;  3LY3 A;  3HLE A;  4S2M A;  3KYE A;  1JWP A;  1LSW A;  4RYE A;  4WLA A;  3VFF A;  5DJT A;  3V3S A;  4EBL A;  2PR5 A;  5DF7 A;  3BEC A;  1OTE A;  2XA7 M;  4N9L A;  3VV4 A;  1TF1 A;  3S22 A;  3QP6 A;  3DW0 A;  3F1O A;  2JKF A;  3RJU A;  1DJB A;  1QME A;  3KO6 A;  5CHU A;  3PHY A;  1ZG4 A;  4WMC A;  3IF5 A;  2GX5 A;  5G18 A;  3NIA A;  3LIA A;  2WKI A;  1C3B A;  4OOY A;  3NOT C;  5GLD A;  3UB5 P;  2UV0 E;  3PTE A;  3E0Y A;  5DVA A;  4OVD A;  1K6S A;  2Y2H A;  2VGK A;  1BLH A;  4FCF A;  3PBS A;  5F6A A;  2A24 B;  4OKP A;  3IF6 B;  5CXW A;  1J3W A;  4Y0O A;  4Q0H A;  5HPF A;  4H6J A;  2WKE A;  3DTE A;  4XT2 A;  4OPQ A;  4H6J B;  4WEL A;  1VHM A;  1L3L A;  4LV1 A;  4K0W A;  5EE8 A;  3WS4 A;  2V1Z A;  1XX2 A;  4R6L A;  3GMW A;  4NKP A;  4CQH A;  1EW0 A;  2Y2N A;  2NUP C;  4KZB A;  1ALQ A;  4OON A;  4M3K A;  3Q07 A;  1NZO A;  1K38 A;  3HLG A;  3FG8 A;  2A49 A;  5FAQ A;  3BQA A;  3KSF A;  1ES4 A;  2R9X A;  3UO9 A;  4XUX A;  4OPY A;  5F82 A;  5JYO A;  1MKM A;  4KZ8 A;  4CLC C;  1STZ A;  4X69 A;  1IKI A;  2O99 A;  3GTC A;  5HWW A;  5KZH A;  4EQ1 A;  4EWF A;  3HL9 A;  3LYX A;  1QMF A;  2M1C A;  4HOI A;  4G3K A;  1IOU A;  2W3F A;  3MZE A;  1EWZ A;  3MQQ A;  3VP3 A;  1S67 L;  4E3M A;  5J4E A;  2KX6 A;  1FOF A;  3KYQ A;  3A0S A;  4FH4 A;  3BLM A;  4HH3 A;  4L9G A;  2VKS A;  1CF0 A;  3LGO A;  3CUE C;  5EV0 A;  4D60 A;  4YOF A;  2DNS A;  4UEY A;  2VX8 A;  5EVI C;  4Y7P A;  3LR3 A;  2E8J A;  1K56 D;  5F1F A;  4JXV A;  5FL3 A;  3IX3 A;  3I7J A;  4I3A A;  3H7W B;  4L9F A;  3QP4 A;  4X68 A;  3PBO A;  1K4F A;  3PBQ A;  3G30 A;  1I2S A;  1OTB A;  4JBF A;  1J9M A;  1Y28 A;  3L9K A;  3KSI A;  5HWV A;  1GHM A;  4HQA A;  2Z2M B;  5IHV A;  4MMN A;  3ZG7 B;  3ZQ5 A;  3E4Q A;  5GHZ A;  3OLO A;  4PPR A;  3T4L A;  2PAV P;  1GSV A;  1DP9 A;  1WYC A;  3A0R A;  2K31 A;  5CED A;  1RGZ A;  4P6B A;  5DJU A;  1N9N A;  4KUK A;  1K55 C;  2DCF A;  5HD3 A;  2VGL M;  4E3N A;  3NEC A;  3DWK A;  5A93 A;  2V1B A;  1DRM A;  4B9O A;  4GDB A;  2Y2I A;  4UA7 A;  3E2L A;  4IUH A;  4EEP A;  4JF5 A;  4ZAM A;  3A3J A;  1A0K A;  2OWJ A;  4U0T A;  1FR6 A;  3PBT A;  3M2K A;  3FC7 A;  4E04 A;  2OAQ 1;  4U0X A;  3C38 A;  3BJN A;  4C75 A;  5TBM A;  1KGE A;  1YLT A;  4Q8I A;  1TD5 A;  3ZYT A;  1HTZ A;  1ESI A;  3VSL A;  2A3U A;  4E3I A;  1I5Q A;  4X53 A;  5HPI A;  1PWD A;  2V20 A;  2W1T A;  1JWZ A;  3P7N A;  1ERQ A;  3V67 A;  4IJG A;  2YKH A;  2M7U A;  3KSG A;  2HF6 A;  5FQ9 A;  5FQJ A;  3C2W A;  3HVF A;  3B3X A;  2R9W A;  3MQ0 A;  3IWO A;  5D3O A;  3OPH A;  3S7N A;  5EEC A;  3UMD A;  3NDE A;  1ACF A;  4N9K A;  4RX2 A;  4UA6 A;  4KZ5 A;  5DKL A;  1TEM A;  1SHV A;  2EX2 A;  5EVI A;  3WS0 A;  1XFN A;  4GZB A;  2QJ7 A;  4S2I A;  2VJW A;  4HBU A;  5EVE A;  5KIZ A;  3LO7 A;  1CK3 A;  5FA7 A;  3UB7 A;  4ME4 A;  2GDN A;  1IYQ A;  4HJ3 A;  2WUQ A;  4DE2 A;  3GQZ A;  3IT9 A;  5E43 A;  2HP5 A;  1SCW A;  5AVE A;  1YM1 A;  4KZ4 A;  1PZP A;  1N9O A;  2EX6 A;  4OPZ A;  5AQA A;  1LL8 A;  1FSY A;  2PRF A;  4E6W A;  1XP4 A;  2WAF A;  1G68 A;  2IWC A;  1H3Q A;  5CHJ A;  3D9Y A;  2IA2 A;  2ZQ8 A;  2V0U A;  5TFQ A;  4MN5 A;  3BQ8 A;  3IHB A;  4QPR A;  2Q9M A;  3QHY A;  4R4R A;  1T1A A;  1TDG A;  1XA7 A;  1DY6 A;  4K0X A;  3FZC A;  2XF3 A;  3HLF A;  1DJA A;  1VEU B;  2PD8 A;  4XT2 B;  3JVV A;  2Z2L B;  3ZG0 A;  3F1N B;  4HP4 A;  4HH2 A;  3T4T A;  2C5W B;  2EFX A;  3NHQ A;  3TSG A;  1VQQ A;  3HBR A;  3T4S A;  2J3T D;  4IHQ A;  1W63 M;  4JF4 A;  4GLQ A;  2XK1 A;  4NG2 A;  4DN0 A;  4GN2 A;  4OPR A;  3S4X A;  2ZOI A;  2H28 A;  4G3W A;  2JKR I;  4KZA A;  2A2L A;  3LI8 A;  2XGN A;  3G35 A;  2P08 A;  1GSX A;  3FPW A;  3ICY A;  4A5R A;  4GS9 B;  4C3Q A;  3ITB A;  3U2A A;  1TS7 A;  4L9E A;  5FAO A;  2V2F F;  3V5M A;  4RX3 A;  2JKT M;  2RCX A;  4NEE D;  2ZC6 B;  3LEQ A;  3VSK A;  4OP5 A;  4G3V A;  4RQ9 A;  3MQO A;  1E25 A;  4MN7 A;  1JWV A;  3BFF A;  3QP5 A;  5EOO A;  5CTN A;  5EOE A;  4PM6 A;  4X1M A;  1MBL A;  3TOI A;  2OLU A;  4WZ5 A;  1YLW A;  2I9V A;  4WF0 A;  4BL3 A;  4LFU A;  2EFU A;  3TE8 A;  1PIO A;  1KDS A;  3N4I A;  1GHP A;  3BWL A;  2VGJ A;  3PXP A;  1OT6 A;  1S4R A;  3C30 A;  4JKT A;  3EQU A;  1WA9 A;  3HLC A;  1D1J A;  5F1G A;  3IXD A;  4F94 A;  1PNE A;  3TG9 A;  4R70 A;  2HV1 A;  3QNB A;  2ZJ9 A;  5FI6 A;  2EWV A;  5AQ9 A;  4DE3 A;  1YLZ A;  4JPM A;  4F3L B;  1UWN X;  4KQD A;  1OT9 A;  3DBA A;  2PYR A;  1Q2Q A;  4WEK A;  2JHE A;  4ZRR A;  3DTK A;  5EVL A;  4LV2 A;  2P04 A;  4HIA A;  1S6R A;  1YT4 A;  1ES5 A;  2Q0O A;  4YFM A;  4UHU A;  5HAP A;  2B02 A;  5E2E A;  3OPP A;  1ONG A;  2O9C A;  4Y3I A;  1RP5 A;  5G4Y A;  1NJ4 A;  1W5D A;  3S7O A;  1YPR A;  4QHC A;  1V9Y A;  4GNU A;  4KG6 A;  4MLL A;  4IED A;  3BYD A;  2H10 A;  5DTT A;  4HP9 A;  2XEP A;  2PD7 A;  2PU2 A;  3BFG A;  3S7P A;  1XXM A;  3TRC A;  2WGW A;  4KEN B;  2R78 A;  3N8S A;  3QP2 A;  1U60 A;  3VOL A;  1DJC A;  3O88 A;  5HAQ A;  1KE3 A;  4PHT A;  3SS5 A;  3WS5 A;  2I72 A;  2QKP A;  4NET A;  2ZL1 A;  5CGX A;  1NYM A;  2ZQA A;  2JN7 A;  2HJE A;  2HDS A;  2ACG A;  3HUM A;  1KE4 A;  4QY6 A;  2VV8 A;  3G31 A;  4JXG A;  3VP4 A;  1L0F A;  4BD1 A;  1LSX A;  5AJG A;  3UB9 A;  3MXS A;  4I3I A;  4PKY G;  1XKZ A;  5HDC A;  2WZZ A;  3E4O A;  3BM6 A;  1GA9 A;  2GNX A;  3NCK A;  2EA9 A;  5JYP A;  1LI0 A;  2OAP 1;  2P9V A;  4RA7 A;  1XJ4 A;  4DDY A;  3MMH A;  5J3W A;  2ZBB A;  4BBU A;  3GDI A;  4O8G A;  5U47 A;  5EM1 A;  4JGP A;  1FR1 A;  2PDR A;  1RGY A;  4KZ7 A;  3ZVT A;  3BRM A;  3LIB A;  4S2L A;  2FFY A;  2DRW A;  4MBF A;  1O7E A;  5TR7 A;  4I5S A;  4D2O A;  2HP6 A;  4O7D A;  4MCW A;  5EUA A;  2EX8 A;  5HWT A;  3EEA A;  3LIE A;  4GD8 A;  1JNU A;  1HLU P;  3Q1F A;  3NOP C;  5KSH A;  3V50 A;  1K57 C;  1GA0 A;  3LEZ A;  5HX9 A;  3GV9 A;  3RXX A;  5IT5 A;  3EWK A;  5AVF A;  2QZ6 A;  3GEC A;  1P0Z A;  3IS2 B;  4HBT A;  1PZO A;  4B4Z A;  1IFQ A;  2WGI A;  3FKW A;  1L2S A;  4IBX A;  1SKO A;  4ZJ3 A;  5L10 A;  2GZA A;  1MWS A;  2BTF P;  4L0L A;  2Y2Q A;  5I94 A;  2G7U A;  4C6Y A;  3T1R A;  5IS1 A;  1YSP A;  3ULF A;  2XD1 A;  4WM9 A;  1UGU A;  1PW1 A;  2IWD A;  5L07 A;  1MC0 A;  3O87 A;  4OP8 A;  3RH8 B;  1L0E A;  4X56 A;  1K0K A;  5E2H A;  5CGW A; 
#chains in the Genus database with same CATH homology
 4X1L A;  2PAV P;  3NUL A;  1SKO A;  4X1M A;  2ZL1 B;  3T1Q B;  2PBD P;  3DAV A;  1ACF A;  2V8F A;  2BTF P;  1AWI A;  1A0K A;  1Z09 A;  3UB5 P;  1F2K A;  2JKF A;  2ZL1 A;  1Y4O A;  3T1S A;  2JKG A;  5FEF A;  1FIL A;  3T1R A;  3CHW P;  2HZ5 A;  4QWO A;  1VEU A;  1VET B;  1CF0 A;  3CPT B;  1SZV A;  2B95 A;  3LGO A;  4X25 A;  5EM1 A;  3T12 B;  2PRF A;  1CJF A;  3L7H A;  5EV0 A;  2V8C A;  3L9K A;  5FDS A;  4D60 A;  3T1X A;  1PFL A;  1FIK A;  1PRQ A;  1VEU B;  3CPT A;  3MS6 A;  5FEG A;  3KYE A;  1G5U A;  4ESP A;  3LEQ A;  5EVE A;  1SKO B;  1HLU P;  4FUW A;  3D9Y A;  2E8J A;  3NEC A;  2ACG A;  3MSH A;  1D1J A;  3U4L P;  1J3W A;  1K0K A;  1CQA A;  1VET A;  1YPR A;  5EM0 A;  4FTX A;  2VK3 A;  1PNE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...