5DKLA

Structure of the light-state dimer of the blue light photoreceptor aureochrome 1a lov from p. tricornutum
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
133
structure length
133
Chain Sequence
GAMGDFSFIKALQTAQQNFVVTDPSLPDNPIVYASQGFLNLTGYSLDQILGRNCRFLQGPETDPKAVERIRKAIEQGNDMSVCLLNYRVDGTTFWNQFFIAALRDAGGNVTNFVGVQCKVSDQYAATVTKQQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Signaling protein
molecule keywords LOV domain
publication title Blue light-induced LOV domain dimerization enhances the affinity of Aureochrome 1a for its target DNA sequence.
pubmed doi rcsb
source organism Phaeodactylum tricornutum
total genus 36
structure length 133
sequence length 133
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13426 PAS_9 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 5dklA00
2PD8A 1MZUA 3IBRA 3H9WA 2JHEA 3A0VA 4GW9A 3MQOA 4HIAA 4XT2A 4H6JA 2QWSA 1UGUA 1OT9A 2KDKA 1DP6A 4HJ6A 1F9IA 3ZQ5A 5IU1A 3BY8A 3NOPC 1DP8A 2KX6A 1G28A 4RQ9A 4JGQA 4PKYG 3PHYA 2K7SA 3F1PA 1Y28A 3CLOA 1S66L 1JNUA 3IS2B 3H7WA 3BWLA 2L1MA 1N9LA 4I5SA 4LRYC 4LRXC 1XJ4A 2R78A 1OJGA 5HZHA 4JGRA 5HD3A 4EW7A 4I39A 4MN6A 1S4RA 3D72A 2OWHA 1DP9A 2EA9A 4R38A 1D06A 5EFWA 3ICYA 1S4SA 2A24A 1LL8A 3F1OB 3UMEA 4HY8A 3EEHA 5TBMA 4EEPA 1XFQA 4WF0A 2PR5A 1OT6A 2WKRA 4EEUA 1T18A 4WUJA 4F3LA 3LI9A 1EW0A 3H82B 2V1BA 1XJ6A 3P7NA 3LIFA 1LSWA 2YKHA 2VV7A 4GHIB 2B02A 2P7JA 4HOIA 2PYPA 3C2WA 1OTEA 4HJ3A 1F98A 3UB7A 4NXGA 4EQ1A 4I38A 1S67L 1KOUA 4R70A 1N9NA 2H28A 4WL9A 2WKPA 3FG8A 1LSXA 5F69A 5HWTA 1XJ2A 4HH3A 5DJTA 2PR6A 4HI4A 2M1CA 2ZOHA 1OTIA 3LIEA 1LSVA 2V0WA 4MN5A 4R3AA 3PYPA 4HNBA 4YWZA 5DKKA 3CAXA 2QKPA 4L9FA 3KX0X 4BBTA 4WN5A 5J4EA 3UB9A 3HJIA 3C8CA 4L9GA 1T19A 3SW1A 5HDDA 3E4QA 4B9OA 2L0WA 4K08A 1OTDA 1VB6A 5HSQA 1P0ZA 1S1YA 4LLOB 4NXFA 2VLGA 1TS6A 5G4YA 1XJ3A 5HDCA 3IS2A 4JGPA 1TS0A 5F6AA 3RTYA 2VEAA 5HD5A 4GS9B 2W0NA 4NXBA 3VE3A 4BBUA 2HV1A 3VOLA 3LICA 3ULFA 5HDSA 2VV8A 3HJKA 1ODVA 3LUQA 3NJAA 3K3CA 3F1NB 1V9ZA 2PDRA 3F1OA 3MFXA 1UWPX 1S1ZA 1NWZA 4HP9A 1GSWA 5A8BA 1XFNA 4I3AA 4KQDA 3NOTC 1GSVA 3LI8A 1WA9A 4L9EA 2QJ7A 4I3IA 5DJUA 4DJ3A 3UB8A 3A0SA 4HJ4A 3NOUC 1X0OA 2D02A 3GDIA 3BY9A 4XT2B 2Z6DA 4H6JB 4LRZE 2PD7A 3B33A 2CMNA 2OOLA 2ZBBA 5KIZA 1GSXA 3H82A 1V9YA 3F1PB 1OTAA 3E4PA 4R6LA 3H7WB 3UE6A 4EETB 4GHIA 2V9AA 5AVEA 4PKYA 1LT0A 1N9OA 3A0RA 3EWKA 5J7EA 1TS8A 2L4RA 1T1BA 3MQQA 1P97A 3UMDA 4WLAA 2I9VA 2JN7A 4BBVA 2GJ3A 4M4XA 2A24B 4HH2A 3MR0A 3LIBA 2W27A 2QHKA 3E4OA 5TBMB 3LIDA 2V0UA 4HHDA 2J80A 1T1CA 1TS7A 5G4ZA 3OLOA 3GECA 2ZOIA 4KUKA 3UB6A 1DRMA 1D7EA 3CWFA 2INWA 5IS1A 5I5LA 4F3LB 5HWVA 2BASA 1OTBA 4E04A 1T1AA 2PYRA 2OWJA 4EESA 2Z6CA 4KUOA 3VE4A 2QJ5A 4I3JA 4LPZA 5AVFA 3MJQA 4GCZA 1UWNX 5J3WA 2WKQA 3G6OA 3K3DA 4DJ2A 4HQAA 4EXOA 3T50A 3LIAA 2V1AA 1OJ5A 2VV6A 3FC7A 2D01A 4GS9A 5HWWA 3LYXA 4EERA 1BYWA 4JGOA 3NHQA 5DKLA 2PHYA 5F5YA 3F1NA 3MXQA 2YKFA 4NXEA 5F68A 3RH8B 4HP4A
chains in the Genus database with same CATH superfamily
2J3WA 3IBRA 1ERQA 3N8SA 4KZAA 2PU4A 2Q0OA 4LV1A 1YQSA 4BMWA 1MPLA 4HIAA 3MZDA 4FTXA 4XT2A 4YFMA 3M6HA 5KSHA 1DP6A 3TOIA 5CGSA 1F9IA 5IU1A 3ZFZA 1NRJA 3LCEA 3VOYA 4KENB 4PKYG 2WZXA 3C7UA 5FDHA 1YAXA 4IUKA 2AVXA 3NULA 3H7WA 1CK3A 4UAAA 2EX6A 1N9LA 2XA7M 4ZJ3A 2Y8HA 4LRXC 3ZG7B 2ZD8A 2Y2NA 5AJGA 1O7EA 4I39A 5TR7A 4Y0OA 3HLDA 4HEFA 1DP9A 4R38A 4EQIA 5FL3A 2ZM8A 4QPRA 2A24A 3SS3A 1AXBA 1PWCA 3F1OB 3WRTA 2OLVA 2O9CA 1BLSA 4N92A 5EVIB 5U47A 3CG5A 2P9VB 4BD1A 2A49A 3WS4A 3ZYTA 2PR5A 3KYQA 5A90A 4EEUA 1ZG4A 5EV0A 3UY6A 3H82B 3HLBA 1K38A 4PM7A 2M7UA 1LSWA 2IWBA 5L09A 2VV7A 4R4RA 4N1HA 3SZTA 2PYPA 5EVEA 3E98A 1KDSA 5CTNA 2H0YA 4NXGA 1ZKJA 4I38A 1E4DA 1S67L 1CI9A 1GCEA 1TVFA 4OPZA 4QU3A 4R70A 3HUMA 1LI0A 3O86A 4JPMA 4YINA 1N9NA 3P09A 3HL9A 4CLCA 4IHQA 3NECA 5EVLA 3UDXA 4RX3A 4LGWA 1XJ2A 2EX2A 1OPXA 2HDSA 3S4XA 3ITBA 3LIEA 3GQZA 4MN5A 1GHMA 3OC2A 5HPIA 5L10A 4YWZA 3IT9A 1A0KA 3W4QA 4L9FA 2VGLM 4WN5A 4MNRA 3OPRA 4CLCD 3BFGA 3P01A 2Z2MB 3C38A 3BM6A 5EPHA 3SW1A 2WADA 4X1LA 2H5SA 3WRZA 2WKEA 1NLYA 3KSGA 5FQMA 4K08A 1P0ZA 3T4QA 3IXBA 5CHUA 2CC1A 3JPUA 4P87A 4AFIA 1EROA 3EGXC 4BJPA 3MXRA 2J3TC 5AQ9A 4FOFA 1TEMA 4OONA 4GNUA 3WS1A 4JGPA 5TFQA 4PHTA 2XSSA 2W0NA 1MXOA 4P6ZM 1L3LA 3LR0A 3VOLA 2B95A 3ULFA 5HDSA 2ZQAA 3SH8A 1YLPA 2VV8A 2XFTA 4DF6A 4GJ4A 2JKRI 3BFCA 2V8FA 5DF9A 2G2WA 3NJAA 4Z1WA 4HBTA 4OVDA 4JKTA 1V9ZA 1BT5A 5CRFA 3HUNA 1H8ZA 1NWZA 1GSWA 2VX8A 1XFNA 4LCMA 4Y0UA 4I3AA 4ETZA 4OQHA 3NOTC 3DTKA 3WS0A 4DJ3A 3UB8A 3A3FA 4LRZE 5IHVA 4ZTKA 2PD7A 2HGVA 3B33A 2Y2IA 2M7VA 4R3JA 1VHMA 5GLDA 1HVBA 1NLZA 4BQMA 5KIZA 1IYSA 2JC7A 3IF6A 1MKIA 1PNEA 3F1PB 4D60A 3E4PA 4MDZA 3PXPA 2Y2PA 2GNXA 3UE6A 3G32A 5AVEA 1LT0A 3SOIA 3A0RA 1RGZA 2WAFA 1VEUB 3EWKA 3T1SA 4QWOA 2L4RA 1T1BA 4M3KA 4WLAA 1AWIA 3S7NA 4CLCE 3NDGA 1M6KA 2OAP1 2GJ3A 3UPPA 1W63M 2VJWA 1KGEA 4HH2A 5TJJA 1FSWA 3BJNA 2LB5A 3PBNA 3LR3A 4Q8IA 4P6BA 3E4OA 2QZ6A 3OOVA 3G35A 4KG6A 4GLQA 3O87A 1XGJA 1J9MA 2Y2HA 2PBDP 4Y3IA 2ZMAA 5IS1A 5IT5A 1PW8A 4UQIS 3O3VA 3IH9A 4F3LB 5HWVA 4U0TA 5A91A 3VMAA 4PM5A 3FKWA 2OWJA 4DE0A 1ES5A 5J8XA 3BRMA 4KUOA 3VE4A 2QJ5A 2H10A 1KGGA 5AVFA 3C5AA 1FILA 3IQAA 3MJQA 2JBFA 3NIAA 3RXXA 3SS4A 4K0WA 3MQ0A 4GD8A 4OH0A 3IWOA 4LENA 2XGNA 4EWFA 4R4SA 4DXBA 2WKQA 3Q82A 1S6RA 2O9AA 3BQ8A 3K3DA 4EXOA 1O07A 5EE8A 3PTEA 4WZ5A 1CJFA 3ZCZA 4BL3A 3FC7A 5E2FA 4KZ8A 3S7QA 4GS9A 4BLMA 2FFFB 3G2YA 4E3KA 4CJNA 4JGOA 2P74A 3NCKA 4BWIA 3LFVA 1ESUA 5CGXA 1TDGA 5F5YA 2PBYA 3F1NA 1NZUA 2ZM0A 4LV2A 4QD4A 1RP5A 2WGWA 5F68A 3L9KA 1YKDA 4HP4A 4KQRA 4NEED 1MZUA 3MKFA 1Z09A 4Y13A 3H9WA 4X68A 4QHCA 4JBFA 1NYMA 3IWQA 1XKZA 4GW9A 3MQOA 4IUHA 4E6WA 1GHIA 3CPTA 1PI5A 1UGUA 4KZ9A 4EBNA 4Y15A 2WUQA 5CHJA 4X25A 3T4SA 2XR0A 1DP8A 2ZMFA 4JGQA 3QNCA 4D2OA 3CLOA 5F1GA 1HD8A 3BWLA 1K57C 3FKVA 4JGRA 5FQQA 1MWTA 3E2KA 3BQAA 3EOIA 4H8RA 2HJEA 4MN6A 3D72A 2OWHA 3T12B 3IX8A 1P9WA 1D06A 4UEYA 1L0GA 2P08A 4Y0TA 4G3KA 2BTFP 1ESIA 4U0XA 3UMEA 4HY8A 3TSGA 3I7JA 4IBXA 4OQIA 5KZHA 3O5YA 5CX7A 1K6RA 3QP5A 4NETA 4QY6A 3Q7VA 1OT6A 2A3UA 2IWDA 2WKRA 1KDWA 5L2FA 5EECA 1W63Q 1EW0A 4NK3A 1PFLA 1XJ6A 3P7NA 4MEZA 4X69A 3AGFA 2WAEA 2FH5A 4GB7A 2HDQA 2YKHA 1JTGA 2P7JA 4HOIA 2RL3A 3ZG5A 3K2NA 4HJ3A 1F98A 3GVBA 3TE8A 4S2NC 4Q0IA 3O88A 3PBSA 1LL5A 3ZNYA 3CPTB 5M19A 3HCYA 1WYBA 4X53A 2XA7S 1NYYA 4X6TA 3HVFA 2H28A 2JKTI 4WL9A 4IBRA 3FG8A 2Y2GA 1LSXA 5F69A 2E8IA 4LV3A 5CTMA 5GLCA 4JXSA 2Q9NA 5HL1A 4HH3A 1NY0A 5DJTA 4HI4A 3PAGA 3G2ZA 3MZFA 1OTIA 3E0YA 3OBFA 2HP9A 4ZBEA 1LLBA 5CERA 4HNBA 2KOIA 3AGEA 4ARZA 2W1RA 5DKKA 3CAXA 1Y54A 3DWKA 4HESA 5FI6A 1FCOA 1T19A 3OCNA 2V1ZA 5HDDA 3BLMA 5E2EA 4GN2A 1CQAA 2QMIA 4RYEA 1OTDA 1VB6A 4KG5A 2RCXA 4E3MA 4PM9A 2G7UA 3NBLA 2VK3A 1S0WA 1ONHA 4ZAMA 1K54C 2VGKA 3SH9A 3VP4A 5EVIC 1W8YA 2OSUA 4UA7A 4MBKA 1TS6A 5HL6A 2J9OA 5G4YA 5HDCA 3IS2A 1PZPA 1H0MA 3LO7A 5F6AA 4LV0A 4EU0A 3UDIA 1I5QA 3VE3A 3GRJA 4BBUA 1W8QA 2ZQCA 3V50A 2VGJA 3CHWP 3C30A 2HDRA 1MKMA 4OPQA 2EX8A 4OP8A 5CGWA 3K3CA 1YM1A 4U3TA 1XGIA 5GHZA 5EOEA 2WKIA 3MFXA 1UWPX 1S1ZA 4MMNA 4HP9A 4DDSA 5A8BA 1XA7A 2XD5A 4KQDA 5DF7A 1GSVA 2XH9A 2Y55A 1KVLA 4MLLA 1U60A 1Y4OA 1BULA 4I3IA 2Y2LA 4X1MA 4X56A 4HJ4A 3NOUC 4OKPA 4ZJ2A 2D02A 1G5UA 3BY9A 4XT2B 5FEGA 2ZQ8A 4MN7A 2VGLS 4S2KA 2WGIA 3KYEA 1F5MA 5D3OA 2XFSA 2Y4AA 4C75A 2ZBBA 3RFBA 1BLCA 1VM1A 2Y2MA 1L0FA 4S2OA 1GSXA 1PWDA 4KZ3A 1OTAA 2ZC3B 1XX2A 1DJCA 2DRWA 3H7WB 1STZA 3TW8A 1SDEA 4FH2A 3IXGA 4GHIA 1OMEA 2V9AA 4CQHA 3Q7ZA 1JWVA 3WS5A 1YMXA 3UE0A 1NXYA 5CXWA 1H5XA 4C3QA 4BL2A 4N9LA 2XDMA 3MZEA 4M4XA 1G6AA 1G68A 2A24B 2Y2JA 4Q0JA 1GA0A 4P6ZS 1DY6A 2ZC4B 3LIBA 2W27A 1P9RA 4ME4A 2QHKA 3KSHA 4CPKA 3LIDA 4WBGA 2V0UA 2P04A 3ISGA 3Q81A 1YT4A 2ZL1A 5EM1A 3FYZA 2B5RA 3BYDA 3W4OA 4BENA 4KUKA 3UB6A 5FQJA 1D7EA 4GD6A 3TG9A 3L7HA 3ZG8B 1JWZA 4IEDA 3BFFA 4E04A 2PRFA 3HLFA 2Y91A 2Z6CA 1KE3A 3CMZA 4I3JA 2BLSA 2HJ9C 4S2MA 2QPNA 4GCZA 2JKRM 4EUZA 2JCHA 5C5KA 3V39A 2O99A 1YPRA 1K55C 4EUVA 3UE1A 4CLCC 2PT7A 3Q1FA 3IF5A 5JYOA 2IA2A 4DJ2A 1FOFA 2ZC6B 5F82A 5I94A 2EFXA 5AQBA 1OJ5A 2VV6A 4CLCB 2PAVP 4WM9A 2D01A 4UA6A 1BYWA 1IFQA 4DKIA 3LY3A 2V8CA 3MMHA 4OP5A 2ZM2A 5DKLA 5K5BA 3IHAA 2VZWA 3DTEA 3JYIA 5CHMA 3OZHA 4R0QA 2EXAA 3EEAA 4NXEA 3RH8B 3GR2A 1G6OA 1K56A 2PD8A 4N1XA 3VP0A 2HPBA 1PIOA 1QMFA 3LY4A 1PW1A 4UHUA 5LBRA 2HP6A 4WZ4A 4H6JA 2KDKA 4GKUA 4HJ6A 3ZQ5A 4BD0A 3BY8A 1PWGA 1Q2QA 3OPPA 5BOHA 4EBPA 2KX6A 3IXHA 4RQ9A 3IX3A 2ZC7A 2R9XA 3PHYA 2K7SA 4R23A 1Y28A 2FFYA 3MBZA 1LI9A 1SCWA 3FPWA 3EQUA 4ESPA 2L1MA 3NI9A 1IEMA 2B18A 5FSRA 3VFHA 1OJGA 5HAPA 5HZHA 5EUAA 3FV7A 1IYQA 1KGFA 1XPBA 4WMCA 2X71A 3N6IA 3LR4A 3MS6A 2EA9A 2H0TA 1JWPA 3IXDA 2OV5A 2Q9MA 3IWIA 2DCFA 3JVVA 5HPFA 5FQKA 3GMWA 3A3EA 5TBMA 2ZJ9A 3VV4A 4UA9A 2OLUA 3R7WA 2OAQ1 4X55A 4WMCD 1CI8A 5JYPA 4O7DA 3BLSA 1IKIA 4Y7PA 3IF6C 4O0PA 3PBRA 4KG2A 3UDFA 3ZG9B 4OOMA 1K57A 2KLIA 4WUJA 4XUZA 3IF6B 3LI9A 1XA1A 2W3FA 5DF8A 4ID4A 4IVKA 4B4XA 2JE5A 4DRTA 2B02A 3N7WA 2R9WA 4FSFA 5HW3A 4PPRA 1GA9A 2WYXA 2E8JA 1IYOA 2XD1A 1ZG6A 2EX9A 4OLGA 1KOUA 3S1YA 3DTMA 1ES3A 5CEDA 5AQAA 1K4EA 1C3BA 1NJ4A 1VETA 1FSYA 5HWTA 3CUEC 4F94A 1J3WA 5DTSA 2PR6A 2LB9A 5DTKA 1LSVA 5F1FA 3OPLA 4OPYA 1BLHA 3B42A 3HLWA 2QKPA 3W4PA 4BBTA 3W8KA 1YLWA 5KSCA 5J4EA 4Q0HA 3B3XA 3TRCA 5L07A 4KZ4A 1RGYA 3C8CA 3G34A 2UV0E 4O8GA 1WE4A 3C4OA 3E4QA 4S2NA 3HLCA 2L0WA 4IVIA 3R4KA 2XRNA 1MBLA 2J8YA 5L8MA 1BSGA 1IKGA 3EGDC 1KE0A 4JF4A 1RCJA 4NXFA 2GZAA 2VLGA 1QMEA 5GHXA 1KE4A 1I2SA 3MFDA 5E2GA 4RA7A 1VQQA 4WYYA 3T1QB 2G2UA 2Y2KA 2GX5A 3QP8A 4GS9B 2IWCA 4NXBA 2J7VA 4E3NA 2I72A 3HJKA 4GDNA 1W79A 2V20A 4PAUA 1ODVA 3LUQA 3RJUA 3DW0A 2PU2A 3F1NB 1FCMA 1HTZA 4GOGA 2Y2QA 2PDRA 2WGWB 3F1OA 1YLYA 1BZAA 3G4PA 3U2AA 3PAEA 2J9PA 3LI8A 1WA9A 3EQVA 2QJ7A 1K6SA 2FZ0A 1K0KA 5AQ7A 3GDIA 1TD5A 2P9VA 4QB8A 2XK1A 2Z6DA 1ONGA 3BFDA 1M40A 3BW6A 2W1TA 1TDLA 4KQOA 2OOLA 3QP6A 2A2LA 3H82A 1V9YA 2JKTM 2W3EA 4S2JA 1ERMA 1FR1A 1L0DA 1PZOA 4L0LA 2NUPC 4EETB 5FATA 4DN0A 4DE2A 5GHYA 1TS8A 3T1RA 1MC0A 4KZ6A 4NG2A 1P97A 3CI6A 1JTDA 2I9VA 2JN7A 3QP1A 3D3OA 5DFXA 3QHYA 3S7OA 3QP4A 4FCFA 1EI5A 4BBVA 2V2FF 4B88A 1YLZA 3MR0A 1ES4A 3NDEA 4P0MA 3HBRA 2Y2OA 2DNSA 4GDBA 5TGFA 3ZG0A 1D1JA 3T4KA 3OCLA 1ACFA 1JVJA 1PRQA 2HF6A 2J80A 1T1CA 5GL9A 5G4ZA 4KZ5A 1W5DA 3BFEA 3Q7VB 3GECA 2ZOIA 4DE1A 1BLPA 1ZTUA 3DWZA 1BUEA 1DRMA 1SKOA 1PI4A 4OOYA 5I5LA 1F2KA 5F83A 1H8YA 1T1AA 1CEFA 4E3IA 1E3UA 1KVMA 3C7VA 3W2ZA 1IYPA 5M18A 3V3SA 3A3DA 2Y59A 4IJGA 3AGDA 4FUWA 4OQ0A 3BEBA 3KSIA 2W1TB 2EWWA 4XUXA 2BG1A 2C5WB 1EWZA 3LIAA 1E3UD 1MY8A 3VSLA 3LYXA 4GZBA 3PBQA 5HAIA 4N9KA 3ZNTA 1HLUP 3HLEA 3IX4A 3NHQA 1YSQA 4ZRRA 4DXCA 2EXBA 4R3BA 4ARZB 5EM0A 3MXQA 3S22A 2YKFA 2HP5A 3CITA 2UWXA 2J3TD 3GV9A 4YOFA 2JHEA 1K55A 3A0VA 3V67A 4ETXA 3G31A 1H8MA 3D9YA 2Y79A 2QWSA 3LEZA 1OT9A 5FI7A 2QYBA 2W3DA 5FQIA 1SHVA 4A5RA 1BTLA 3NOPC 1SDNA 3MKEA 5FEFA 1G28A 2K31A 4II7A 4E3OA 3F1PA 1H3QA 1S66L 1JNUA 1SKOB 3IS2B 3Q07A 1HZOA 4I5SA 4LRYC 1XJ4A 2R78A 3S7PA 2WKHA 5HD3A 1VEUA 4EW7A 2WGVA 1S4RA 4K91A 3UPNA 2XLNA 4JLFA 5EFWA 1GHPA 3DBAA 3ICYA 1S4SA 1LL8A 4E6XA 4PMAA 4PM6A 4S2IA 3UNWA 3VSKA 2GDNA 4OPRA 4OQGA 3EEHA 4OOLA 4EEPA 1ZHHB 1XFQA 4KZ7A 1IELA 4WF0A 3MSHA 3GTCA 2ZC5B 4JXWA 4MCWA 1WYCA 3HREA 3C4PA 4RX2A 3IH8A 3PBTA 1SKFA 1K25A 1N4OA 4KQQA 1N9BA 1T18A 4F3LA 4QJGA 4Y17A 2V1BA 4JF5A 1ES2A 3LIFA 1MWRA 4GHIB 1FIKA 5G18A 3C2WA 1OTEA 2ZQ7A 3UB7A 5HFOA 4EQ1A 5FA7A 3LR5A 5E43A 5KMWA 2ZMVA 3VOZA 1E25A 2VKSA 3VFFA 2WKPA 1L2SA 3UE3A 1NRFA 4XXRA 3ZDJA 3N8RA 1XXMA 1CEGA 2M1CA 3VP2A 2ZOHA 2V0WA 4R3AA 3PYPA 2ZL1B 4PM8A 3SH7A 5DVAA 3VP3A 3QP2A 1K56D 3IHBA 3U4LP 3KX0X 4WEKA 2EFUA 1IOUA 3UB9A 3HJIA 3LGOA 4L9GA 2O9BA 3SS5A 3KO6A 1TF1A 1ALQA 4B9OA 3FPVA 2XQZA 3PBOA 4K0XA 3T4JA 4E3LA 5HSQA 2VA0A 1S1YA 4LLOB 3NC8A 3G30A 5FAPA 3T4LA 3MF0A 3RXWA 3DTIA 3CUEA 4C6YA 4MBHA 3M6BA 1XJ3A 1TS0A 3OPHA 3RTYA 5CEBA 2VEAA 4MBFA 5HD5A 2WZZA 2XROA 1FCNA 4JXVA 2HV1A 3V5MA 3LICA 5CECA 3KYZA 3PR6A 3V3RA 2ZQ9A 4B4ZA 3TJZC 1LHYA 3T1XA 3ZVWA 1MWUA 2W3GA 5DTTA 5MC7A 4UQIM 3D4FA 4L9EA 5M1AA 1I2WA 5DJUA 4E3JA 3A0SA 4YNRA 1X0OA 5FAOA 4H6JB 5E2HA 1K4FA 2WK0A 1DJBA 4DMZA 1ZC2A 4R1GA 2CMNA 3ZHHA 4FD8A 3P98A 1YLTA 3ITAA 3A3JA 3B47A 2X01A 4EBLA 2X02A 4Z9QA 4R6LA 5HARA 3M2KA 1NZOA 1FR6A 3QNBA 5A93A 4PKYA 1N9OA 1CF0A 5FAQA 5J7EA 2HZ5A 4LFUA 3MQQA 1YLJA 2JKFA 4RVAA 3UMDA 2HDUA 4B93A 4QY5A 4WEJA 3UN7A 3GSGA 5A92A 4WELA 2NUTC 4OLDA 5TBMB 2ZQDA 3HUOA 2ZLYA 3N8LA 4HHDA 3R7WB 4S2LA 2EWVA 3ZVTA 3N4IA 5FASA 1FQGA 4WZ5C 5FI2A 2JKGA 1TS7A 3UO9A 4O01A 4DE3A 2C6WB 3NY4A 3OLOA 4Y2FA 3HLGA 4LCLA 1L0EA 3CWFA 4EV4A 2INWA 3BECA 2XEPA 2Z2LB 4S2PA 3T4TA 2BASA 5GLAA 1OTBA 4FH4A 2MJ6A 5HX9A 3M2JA 1MWSA 2PYRA 2K2NA 4EESA 4NKPA 3FWLA 4ZJ1A 4LPZA 2ACGA 3KSFA 3ZGAB 5DFYA 3UPOA 2DMWA 2W3HA 4JF6A 3T4OA 2O0YA 1Z6FA 4P85A 5HAQA 1UWNX 5J3WA 4G3VA 1Q2PA 4Y5FA 5GLBA 1DJAA 3G6OA 3FZCA 4HQAA 4JXGA 1XP4A 5EOOA 3T50A 1K54A 1W7FA 3E2LA 2V1AA 3IBJA 3VP1A 5EVIA 1VETB 5HWWA 4EERA 4DDYA 4HBUA 3JVUA 3WS2A 2PHYA 3DAVA 5FQ9A 3LEQA 3WWXA 5FDSA 2XF3A 1LL9A 4G3WA 3CJMA 1YSPA 4KZBA 3A3IA 3MXSA 3CZDA 1YMSA 3UB5P 4ZDXA 5EVID 1SZVA 1PYYA
chains in the Genus database with same CATH topology
2J3WA 2PD8A 1MZUA 4NEED 2J3TD 3IBRA 3H9WA 4YOFA 2JHEA 3A0VA 5LBRA 3V67A 4ETXA 4GW9A 4BMWA 3MQOA 4HIAA 1H8MA 4IUHA 4XT2A 4H6JA 2Y79A 2QWSA 5KSHA 1UGUA 1OT9A 2KDKA 1DP6A 4HJ6A 2QYBA 1F9IA 2W3DA 3ZQ5A 5IU1A 3BY8A 3NOPC 3T4SA 1DP8A 1NRJA 2KX6A 1G28A 2K31A 2ZMFA 4JGQA 4RQ9A 4II7A 4PKYG 3PHYA 2K7SA 3F1PA 1Y28A 3CLOA 1H3QA 1YAXA 4IUKA 1S66L 1JNUA 3FPWA 3IS2B 3H7WA 3EQUA 3BWLA 2L1MA 1N9LA 2XA7M 2B18A 4I5SA 2Y8HA 4LRYC 4LRXC 1XJ4A 2R78A 3S7PA 1OJGA 5HZHA 4JGRA 5HD3A 5AJGA 4EW7A 3BQAA 4I39A 3EOIA 2HJEA 4MN6A 1S4RA 3D72A 2OWHA 1DP9A 2EA9A 3LR4A 4R38A 1P9WA 1D06A 5EFWA 3DBAA 4UEYA 5FL3A 3ICYA 3JVVA 4QPRA 2P08A 1S4SA 2A24A 1LL8A 4G3KA 3F1OB 5HPFA 3UMEA 4HY8A 3EEHA 5TBMA 4OOLA 4EEPA 3VV4A 1ZHHB 1XFQA 3R7WA 2OAQ1 2O9CA 4WF0A 3O5YA 5CX7A 4O0PA 3PBRA 4MCWA 3ZYTA 3PBTA 2PR5A 1OT6A 3KYQA 2WKRA 4EEUA 4OOMA 1T18A 2KLIA 4WUJA 4F3LA 3LI9A 1W63Q 1EW0A 3H82B 2W3FA 2V1BA 1XJ6A 3P7NA 2M7UA 2FH5A 3LIFA 1LSWA 2YKHA 2VV7A 4GHIB 2B02A 2P7JA 4HOIA 2PYPA 3E98A 3C2WA 1OTEA 3K2NA 4HJ3A 1F98A 3TE8A 4FSFA 3UB7A 4NXGA 4Q0IA 4EQ1A 3PBSA 4I38A 3HCYA 3LR5A 1S67L 2ZMVA 2XA7S 1KOUA 4R70A 1N9NA 2H28A 2JKTI 2VKSA 4WL9A 2WKPA 3FG8A 4CLCA 1LSXA 5F69A 4IHQA 3UE3A 5HWTA 1XJ2A 3CUEC 4HH3A 1OPXA 5DJTA 2PR6A 2LB9A 4HI4A 2M1CA 2ZOHA 1OTIA 3LIEA 1LSVA 2V0WA 3E0YA 4MN5A 3OBFA 3OC2A 4R3AA 3PYPA 5HPIA 4HNBA 2KOIA 4YWZA 3B42A 4ARZA 2W1RA 5DKKA 3CAXA 2QKPA 4L9FA 3KX0X 4BBTA 2VGLM 4WN5A 4WEKA 5J4EA 4Q0HA 4CLCD 3TRCA 1IOUA 3P01A 3UB9A 3HJIA 3C8CA 3C38A 4L9GA 1T19A 3OCNA 2O9BA 4O8GA 3SW1A 3KO6A 1TF1A 5HDDA 3E4QA 4B9OA 1NLYA 3KSGA 2L0WA 3FPVA 3R4KA 2XRNA 4K08A 3PBOA 3T4JA 1OTDA 1VB6A 5HSQA 1P0ZA 2VA0A 5L8MA 3T4QA 3EGDC 1S1YA 4LLOB 2G7UA 4NXFA 2GZAA 2VLGA 3T4LA 4AFIA 3MF0A 3EGXC 4BJPA 3CUEA 2J3TC 4FOFA 1TS6A 5HL6A 5G4YA 1XJ3A 5HDCA 3IS2A 4JGPA 1TS0A 5F6AA 2GX5A 3RTYA 4EU0A 2VEAA 4PHTA 2XSSA 5HD5A 4GS9B 2W0NA 4P6ZM 4NXBA 3VE3A 4BBUA 2XROA 3LR0A 2HV1A 3VOLA 3LICA 3ULFA 5HDSA 2VV8A 3HJKA 4GJ4A 2JKRI 3KYZA 4PAUA 1ODVA 3PR6A 3LUQA 5DF9A 3C30A 1MKMA 3NJAA 3K3CA 4Z1WA 3F1NB 3TJZC 1V9ZA 2PDRA 3F1OA 3MFXA 1UWPX 2W3GA 1S1ZA 4MMNA 5MC7A 1NWZA 4HP9A 1GSWA 2VX8A 5A8BA 1XFNA 4I3AA 3U2AA 4KQDA 4ETZA 3NOTC 4UQIM 1GSVA 3LI8A 1WA9A 3EQVA 4L9EA 2QJ7A 2FZ0A 4I3IA 5DJUA 4DJ3A 3UB8A 3A0SA 4YNRA 4HJ4A 3NOUC 1X0OA 2D02A 3GDIA 1TD5A 3BY9A 4XT2B 2Z6DA 4H6JB 4MN7A 2VGLS 4LRZE 1F5MA 4DMZA 3BW6A 2W1TA 2PD7A 2HGVA 3B33A 2M7VA 2CMNA 4KQOA 2OOLA 2ZBBA 3RFBA 1VHMA 1NLZA 5KIZA 2A2LA 1GSXA 3H82A 1V9YA 2JKTM 3F1PB 2W3EA 3B47A 1OTAA 3E4PA 4MDZA 3PXPA 4R6LA 3H7WB 1STZA 2GNXA 3UE6A 3TW8A 4L0LA 2NUPC 4EETB 4DN0A 4GHIA 2V9AA 5AVEA 4PKYA 1LT0A 4CQHA 1N9OA 3A0RA 3EWKA 5J7EA 1TS8A 1MC0A 2L4RA 1T1BA 3MQQA 1P97A 3UMDA 4WLAA 3CI6A 2I9VA 2JN7A 3S7NA 4CLCE 3D3OA 5DFXA 4B93A 3S7OA 2OAP1 4BBVA 2GJ3A 4WEJA 1W63M 4M4XA 4Q0JA 2A24B 2VJWA 4P6ZS 4HH2A 3MR0A 5TJJA 3BJNA 3LIBA 2LB5A 2W27A 3PBNA 1P9RA 3LR3A 4ME4A 4WELA 2NUTC 2QHKA 3E4OA 3KSHA 5TBMB 3LIDA 3T4KA 3OCLA 2V0UA 2P04A 4HHDA 3R7WB 2EWVA 3OOVA 2HF6A 4GLQA 2J80A 1T1CA 1TS7A 4O01A 5G4ZA 3OLOA 3GECA 2ZOIA 4Y2FA 4KUKA 3UB6A 1ZTUA 4Y3IA 1DRMA 1D7EA 3CWFA 2INWA 5IT5A 5IS1A 4UQIS 5I5LA 4F3LB 3T4TA 5HWVA 2BASA 1OTBA 2MJ6A 4E04A 1T1AA 2PYRA 2K2NA 2OWJA 4EESA 2Z6CA 4NKPA 4KUOA 3VE4A 2QJ5A 2HJ9C 3KSFA 4I3JA 4LPZA 5AVFA 5DFYA 3W2ZA 2DMWA 2W3HA 3T4OA 3MJQA 2O0YA 4GCZA 3MQ0A 4IJGA 2JKRM 1UWNX 5J3WA 5C5KA 2O99A 4G3VA 4EUVA 4Y5FA 4CLCC 2WKQA 2PT7A 3KSIA 2O9AA 3G6OA 3BQ8A 2IA2A 2W1TB 3K3DA 2EWWA 4HQAA 4DJ2A 4EXOA 3T50A 3LIAA 2V1AA 1OJ5A 3IBJA 2VV6A 4CLCB 3FC7A 2D01A 3S7QA 4GS9A 5HWWA 3LYXA 4EERA 1BYWA 3PBQA 1IFQA 4JGOA 4BWIA 3JVUA 3LFVA 3NHQA 3MMHA 1YSQA 5DKLA 2PHYA 5F5YA 5K5BA 2VZWA 4ZRRA 3F1NA 4ARZB 4G3WA 3MXQA 1YSPA 2YKFA 3EEAA 4NXEA 5F68A 3RH8B 3CITA 1YKDA 4HP4A 1G6OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PD8 A;  1MZU A;  3IBR A;  3H9W A;  2JHE A;  3A0V A;  4GW9 A;  3MQO A;  4HIA A;  4XT2 A;  4H6J A;  2QWS A;  1UGU A;  1OT9 A;  2KDK A;  1DP6 A;  4HJ6 A;  1F9I A;  3ZQ5 A;  5IU1 A;  3BY8 A;  3NOP C;  1DP8 A;  2KX6 A;  1G28 A;  4RQ9 A;  4JGQ A;  4PKY G;  3PHY A;  2K7S A;  3F1P A;  1Y28 A;  3CLO A;  1S66 L;  1JNU A;  3IS2 B;  3H7W A;  3BWL A;  2L1M A;  1N9L A;  4I5S A;  4LRY C;  4LRX C;  1XJ4 A;  2R78 A;  1OJG A;  5HZH A;  4JGR A;  5HD3 A;  4EW7 A;  4I39 A;  4MN6 A;  1S4R A;  3D72 A;  2OWH A;  1DP9 A;  2EA9 A;  4R38 A;  1D06 A;  5EFW A;  3ICY A;  1S4S A;  2A24 A;  1LL8 A;  3F1O B;  3UME A;  4HY8 A;  3EEH A;  5TBM A;  4EEP A;  1XFQ A;  4WF0 A;  2PR5 A;  1OT6 A;  2WKR A;  4EEU A;  1T18 A;  4WUJ A;  4F3L A;  3LI9 A;  1EW0 A;  3H82 B;  2V1B A;  1XJ6 A;  3P7N A;  3LIF A;  1LSW A;  2YKH A;  2VV7 A;  4GHI B;  2B02 A;  2P7J A;  4HOI A;  2PYP A;  3C2W A;  1OTE A;  4HJ3 A;  1F98 A;  3UB7 A;  4NXG A;  4EQ1 A;  4I38 A;  1S67 L;  1KOU A;  4R70 A;  1N9N A;  2H28 A;  4WL9 A;  2WKP A;  3FG8 A;  1LSX A;  5F69 A;  5HWT A;  1XJ2 A;  4HH3 A;  5DJT A;  2PR6 A;  4HI4 A;  2M1C A;  2ZOH A;  1OTI A;  3LIE A;  1LSV A;  2V0W A;  4MN5 A;  4R3A A;  3PYP A;  4HNB A;  4YWZ A;  5DKK A;  3CAX A;  2QKP A;  4L9F A;  3KX0 X;  4BBT A;  4WN5 A;  5J4E A;  3UB9 A;  3HJI A;  3C8C A;  4L9G A;  1T19 A;  3SW1 A;  5HDD A;  3E4Q A;  4B9O A;  2L0W A;  4K08 A;  1OTD A;  1VB6 A;  5HSQ A;  1P0Z A;  1S1Y A;  4LLO B;  4NXF A;  2VLG A;  1TS6 A;  5G4Y A;  1XJ3 A;  5HDC A;  3IS2 A;  4JGP A;  1TS0 A;  5F6A A;  3RTY A;  2VEA A;  5HD5 A;  4GS9 B;  2W0N A;  4NXB A;  3VE3 A;  4BBU A;  2HV1 A;  3VOL A;  3LIC A;  3ULF A;  5HDS A;  2VV8 A;  3HJK A;  1ODV A;  3LUQ A;  3NJA A;  3K3C A;  3F1N B;  1V9Z A;  2PDR A;  3F1O A;  3MFX A;  1UWP X;  1S1Z A;  1NWZ A;  4HP9 A;  1GSW A;  5A8B A;  1XFN A;  4I3A A;  4KQD A;  3NOT C;  1GSV A;  3LI8 A;  1WA9 A;  4L9E A;  2QJ7 A;  4I3I A;  5DJU A;  4DJ3 A;  3UB8 A;  3A0S A;  4HJ4 A;  3NOU C;  1X0O A;  2D02 A;  3GDI A;  3BY9 A;  4XT2 B;  2Z6D A;  4H6J B;  4LRZ E;  2PD7 A;  3B33 A;  2CMN A;  2OOL A;  2ZBB A;  5KIZ A;  1GSX A;  3H82 A;  1V9Y A;  3F1P B;  1OTA A;  3E4P A;  4R6L A;  3H7W B;  3UE6 A;  4EET B;  4GHI A;  2V9A A;  5AVE A;  4PKY A;  1LT0 A;  1N9O A;  3A0R A;  3EWK A;  5J7E A;  1TS8 A;  2L4R A;  1T1B A;  3MQQ A;  1P97 A;  3UMD A;  4WLA A;  2I9V A;  2JN7 A;  4BBV A;  2GJ3 A;  4M4X A;  2A24 B;  4HH2 A;  3MR0 A;  3LIB A;  2W27 A;  2QHK A;  3E4O A;  5TBM B;  3LID A;  2V0U A;  4HHD A;  2J80 A;  1T1C A;  1TS7 A;  5G4Z A;  3OLO A;  3GEC A;  2ZOI A;  4KUK A;  3UB6 A;  1DRM A;  1D7E A;  3CWF A;  2INW A;  5IS1 A;  5I5L A;  4F3L B;  5HWV A;  2BAS A;  1OTB A;  4E04 A;  1T1A A;  2PYR A;  2OWJ A;  4EES A;  2Z6C A;  4KUO A;  3VE4 A;  2QJ5 A;  4I3J A;  4LPZ A;  5AVF A;  3MJQ A;  4GCZ A;  1UWN X;  5J3W A;  2WKQ A;  3G6O A;  3K3D A;  4DJ2 A;  4HQA A;  4EXO A;  3T50 A;  3LIA A;  2V1A A;  1OJ5 A;  2VV6 A;  3FC7 A;  2D01 A;  4GS9 A;  5HWW A;  3LYX A;  4EER A;  1BYW A;  4JGO A;  3NHQ A;  5DKL A;  2PHY A;  5F5Y A;  3F1N A;  3MXQ A;  2YKF A;  4NXE A;  5F68 A;  3RH8 B;  4HP4 A; 
#chains in the Genus database with same CATH topology
 2J3W A;  3IBR A;  1ERQ A;  3N8S A;  4KZA A;  2PU4 A;  2Q0O A;  4LV1 A;  1YQS A;  4BMW A;  1MPL A;  4HIA A;  3MZD A;  4FTX A;  4XT2 A;  4YFM A;  3M6H A;  5KSH A;  1DP6 A;  3TOI A;  5CGS A;  1F9I A;  5IU1 A;  3ZFZ A;  1NRJ A;  3LCE A;  3VOY A;  4KEN B;  4PKY G;  2WZX A;  3C7U A;  5FDH A;  1YAX A;  4IUK A;  2AVX A;  3NUL A;  3H7W A;  1CK3 A;  4UAA A;  2EX6 A;  1N9L A;  2XA7 M;  4ZJ3 A;  2Y8H A;  4LRX C;  3ZG7 B;  2ZD8 A;  2Y2N A;  5AJG A;  1O7E A;  4I39 A;  5TR7 A;  4Y0O A;  3HLD A;  4HEF A;  1DP9 A;  4R38 A;  4EQI A;  5FL3 A;  2ZM8 A;  4QPR A;  2A24 A;  3SS3 A;  1AXB A;  1PWC A;  3F1O B;  3WRT A;  2OLV A;  2O9C A;  1BLS A;  4N92 A;  5EVI B;  5U47 A;  3CG5 A;  2P9V B;  4BD1 A;  2A49 A;  3WS4 A;  3ZYT A;  2PR5 A;  3KYQ A;  5A90 A;  4EEU A;  1ZG4 A;  5EV0 A;  3UY6 A;  3H82 B;  3HLB A;  1K38 A;  4PM7 A;  2M7U A;  1LSW A;  2IWB A;  5L09 A;  2VV7 A;  4R4R A;  4N1H A;  3SZT A;  2PYP A;  5EVE A;  3E98 A;  1KDS A;  5CTN A;  2H0Y A;  4NXG A;  1ZKJ A;  4I38 A;  1E4D A;  1S67 L;  1CI9 A;  1GCE A;  1TVF A;  4OPZ A;  4QU3 A;  4R70 A;  3HUM A;  1LI0 A;  3O86 A;  4JPM A;  4YIN A;  1N9N A;  3P09 A;  3HL9 A;  4CLC A;  4IHQ A;  3NEC A;  5EVL A;  3UDX A;  4RX3 A;  4LGW A;  1XJ2 A;  2EX2 A;  1OPX A;  2HDS A;  3S4X A;  3ITB A;  3LIE A;  3GQZ A;  4MN5 A;  1GHM A;  3OC2 A;  5HPI A;  5L10 A;  4YWZ A;  3IT9 A;  1A0K A;  3W4Q A;  4L9F A;  2VGL M;  4WN5 A;  4MNR A;  3OPR A;  4CLC D;  3BFG A;  3P01 A;  2Z2M B;  3C38 A;  3BM6 A;  5EPH A;  3SW1 A;  2WAD A;  4X1L A;  2H5S A;  3WRZ A;  2WKE A;  1NLY A;  3KSG A;  5FQM A;  4K08 A;  1P0Z A;  3T4Q A;  3IXB A;  5CHU A;  2CC1 A;  3JPU A;  4P87 A;  4AFI A;  1ERO A;  3EGX C;  4BJP A;  3MXR A;  2J3T C;  5AQ9 A;  4FOF A;  1TEM A;  4OON A;  4GNU A;  3WS1 A;  4JGP A;  5TFQ A;  4PHT A;  2XSS A;  2W0N A;  1MXO A;  4P6Z M;  1L3L A;  3LR0 A;  3VOL A;  2B95 A;  3ULF A;  5HDS A;  2ZQA A;  3SH8 A;  1YLP A;  2VV8 A;  2XFT A;  4DF6 A;  4GJ4 A;  2JKR I;  3BFC A;  2V8F A;  5DF9 A;  2G2W A;  3NJA A;  4Z1W A;  4HBT A;  4OVD A;  4JKT A;  1V9Z A;  1BT5 A;  5CRF A;  3HUN A;  1H8Z A;  1NWZ A;  1GSW A;  2VX8 A;  1XFN A;  4LCM A;  4Y0U A;  4I3A A;  4ETZ A;  4OQH A;  3NOT C;  3DTK A;  3WS0 A;  4DJ3 A;  3UB8 A;  3A3F A;  4LRZ E;  5IHV A;  4ZTK A;  2PD7 A;  2HGV A;  3B33 A;  2Y2I A;  2M7V A;  4R3J A;  1VHM A;  5GLD A;  1HVB A;  1NLZ A;  4BQM A;  5KIZ A;  1IYS A;  2JC7 A;  3IF6 A;  1MKI A;  1PNE A;  3F1P B;  4D60 A;  3E4P A;  4MDZ A;  3PXP A;  2Y2P A;  2GNX A;  3UE6 A;  3G32 A;  5AVE A;  1LT0 A;  3SOI A;  3A0R A;  1RGZ A;  2WAF A;  1VEU B;  3EWK A;  3T1S A;  4QWO A;  2L4R A;  1T1B A;  4M3K A;  4WLA A;  1AWI A;  3S7N A;  4CLC E;  3NDG A;  1M6K A;  2OAP 1;  2GJ3 A;  3UPP A;  1W63 M;  2VJW A;  1KGE A;  4HH2 A;  5TJJ A;  1FSW A;  3BJN A;  2LB5 A;  3PBN A;  3LR3 A;  4Q8I A;  4P6B A;  3E4O A;  2QZ6 A;  3OOV A;  3G35 A;  4KG6 A;  4GLQ A;  3O87 A;  1XGJ A;  1J9M A;  2Y2H A;  2PBD P;  4Y3I A;  2ZMA A;  5IS1 A;  5IT5 A;  1PW8 A;  4UQI S;  3O3V A;  3IH9 A;  4F3L B;  5HWV A;  4U0T A;  5A91 A;  3VMA A;  4PM5 A;  3FKW A;  2OWJ A;  4DE0 A;  1ES5 A;  5J8X A;  3BRM A;  4KUO A;  3VE4 A;  2QJ5 A;  2H10 A;  1KGG A;  5AVF A;  3C5A A;  1FIL A;  3IQA A;  3MJQ A;  2JBF A;  3NIA A;  3RXX A;  3SS4 A;  4K0W A;  3MQ0 A;  4GD8 A;  4OH0 A;  3IWO A;  4LEN A;  2XGN A;  4EWF A;  4R4S A;  4DXB A;  2WKQ A;  3Q82 A;  1S6R A;  2O9A A;  3BQ8 A;  3K3D A;  4EXO A;  1O07 A;  5EE8 A;  3PTE A;  4WZ5 A;  1CJF A;  3ZCZ A;  4BL3 A;  3FC7 A;  5E2F A;  4KZ8 A;  3S7Q A;  4GS9 A;  4BLM A;  2FFF B;  3G2Y A;  4E3K A;  4CJN A;  4JGO A;  2P74 A;  3NCK A;  4BWI A;  3LFV A;  1ESU A;  5CGX A;  1TDG A;  5F5Y A;  2PBY A;  3F1N A;  1NZU A;  2ZM0 A;  4LV2 A;  4QD4 A;  1RP5 A;  2WGW A;  5F68 A;  3L9K A;  1YKD A;  4HP4 A;  4KQR A;  4NEE D;  1MZU A;  3MKF A;  1Z09 A;  4Y13 A;  3H9W A;  4X68 A;  4QHC A;  4JBF A;  1NYM A;  3IWQ A;  1XKZ A;  4GW9 A;  3MQO A;  4IUH A;  4E6W A;  1GHI A;  3CPT A;  1PI5 A;  1UGU A;  4KZ9 A;  4EBN A;  4Y15 A;  2WUQ A;  5CHJ A;  4X25 A;  3T4S A;  2XR0 A;  1DP8 A;  2ZMF A;  4JGQ A;  3QNC A;  4D2O A;  3CLO A;  5F1G A;  1HD8 A;  3BWL A;  1K57 C;  3FKV A;  4JGR A;  5FQQ A;  1MWT A;  3E2K A;  3BQA A;  3EOI A;  4H8R A;  2HJE A;  4MN6 A;  3D72 A;  2OWH A;  3T12 B;  3IX8 A;  1P9W A;  1D06 A;  4UEY A;  1L0G A;  2P08 A;  4Y0T A;  4G3K A;  2BTF P;  1ESI A;  4U0X A;  3UME A;  4HY8 A;  3TSG A;  3I7J A;  4IBX A;  4OQI A;  5KZH A;  3O5Y A;  5CX7 A;  1K6R A;  3QP5 A;  4NET A;  4QY6 A;  3Q7V A;  1OT6 A;  2A3U A;  2IWD A;  2WKR A;  1KDW A;  5L2F A;  5EEC A;  1W63 Q;  1EW0 A;  4NK3 A;  1PFL A;  1XJ6 A;  3P7N A;  4MEZ A;  4X69 A;  3AGF A;  2WAE A;  2FH5 A;  4GB7 A;  2HDQ A;  2YKH A;  1JTG A;  2P7J A;  4HOI A;  2RL3 A;  3ZG5 A;  3K2N A;  4HJ3 A;  1F98 A;  3GVB A;  3TE8 A;  4S2N C;  4Q0I A;  3O88 A;  3PBS A;  1LL5 A;  3ZNY A;  3CPT B;  5M19 A;  3HCY A;  1WYB A;  4X53 A;  2XA7 S;  1NYY A;  4X6T A;  3HVF A;  2H28 A;  2JKT I;  4WL9 A;  4IBR A;  3FG8 A;  2Y2G A;  1LSX A;  5F69 A;  2E8I A;  4LV3 A;  5CTM A;  5GLC A;  4JXS A;  2Q9N A;  5HL1 A;  4HH3 A;  1NY0 A;  5DJT A;  4HI4 A;  3PAG A;  3G2Z A;  3MZF A;  1OTI A;  3E0Y A;  3OBF A;  2HP9 A;  4ZBE A;  1LLB A;  5CER A;  4HNB A;  2KOI A;  3AGE A;  4ARZ A;  2W1R A;  5DKK A;  3CAX A;  1Y54 A;  3DWK A;  4HES A;  5FI6 A;  1FCO A;  1T19 A;  3OCN A;  2V1Z A;  5HDD A;  3BLM A;  5E2E A;  4GN2 A;  1CQA A;  2QMI A;  4RYE A;  1OTD A;  1VB6 A;  4KG5 A;  2RCX A;  4E3M A;  4PM9 A;  2G7U A;  3NBL A;  2VK3 A;  1S0W A;  1ONH A;  4ZAM A;  1K54 C;  2VGK A;  3SH9 A;  3VP4 A;  5EVI C;  1W8Y A;  2OSU A;  4UA7 A;  4MBK A;  1TS6 A;  5HL6 A;  2J9O A;  5G4Y A;  5HDC A;  3IS2 A;  1PZP A;  1H0M A;  3LO7 A;  5F6A A;  4LV0 A;  4EU0 A;  3UDI A;  1I5Q A;  3VE3 A;  3GRJ A;  4BBU A;  1W8Q A;  2ZQC A;  3V50 A;  2VGJ A;  3CHW P;  3C30 A;  2HDR A;  1MKM A;  4OPQ A;  2EX8 A;  4OP8 A;  5CGW A;  3K3C A;  1YM1 A;  4U3T A;  1XGI A;  5GHZ A;  5EOE A;  2WKI A;  3MFX A;  1UWP X;  1S1Z A;  4MMN A;  4HP9 A;  4DDS A;  5A8B A;  1XA7 A;  2XD5 A;  4KQD A;  5DF7 A;  1GSV A;  2XH9 A;  2Y55 A;  1KVL A;  4MLL A;  1U60 A;  1Y4O A;  1BUL A;  4I3I A;  2Y2L A;  4X1M A;  4X56 A;  4HJ4 A;  3NOU C;  4OKP A;  4ZJ2 A;  2D02 A;  1G5U A;  3BY9 A;  4XT2 B;  5FEG A;  2ZQ8 A;  4MN7 A;  2VGL S;  4S2K A;  2WGI A;  3KYE A;  1F5M A;  5D3O A;  2XFS A;  2Y4A A;  4C75 A;  2ZBB A;  3RFB A;  1BLC A;  1VM1 A;  2Y2M A;  1L0F A;  4S2O A;  1GSX A;  1PWD A;  4KZ3 A;  1OTA A;  2ZC3 B;  1XX2 A;  1DJC A;  2DRW A;  3H7W B;  1STZ A;  3TW8 A;  1SDE A;  4FH2 A;  3IXG A;  4GHI A;  1OME A;  2V9A A;  4CQH A;  3Q7Z A;  1JWV A;  3WS5 A;  1YMX A;  3UE0 A;  1NXY A;  5CXW A;  1H5X A;  4C3Q A;  4BL2 A;  4N9L A;  2XDM A;  3MZE A;  4M4X A;  1G6A A;  1G68 A;  2A24 B;  2Y2J A;  4Q0J A;  1GA0 A;  4P6Z S;  1DY6 A;  2ZC4 B;  3LIB A;  2W27 A;  1P9R A;  4ME4 A;  2QHK A;  3KSH A;  4CPK A;  3LID A;  4WBG A;  2V0U A;  2P04 A;  3ISG A;  3Q81 A;  1YT4 A;  2ZL1 A;  5EM1 A;  3FYZ A;  2B5R A;  3BYD A;  3W4O A;  4BEN A;  4KUK A;  3UB6 A;  5FQJ A;  1D7E A;  4GD6 A;  3TG9 A;  3L7H A;  3ZG8 B;  1JWZ A;  4IED A;  3BFF A;  4E04 A;  2PRF A;  3HLF A;  2Y91 A;  2Z6C A;  1KE3 A;  3CMZ A;  4I3J A;  2BLS A;  2HJ9 C;  4S2M A;  2QPN A;  4GCZ A;  2JKR M;  4EUZ A;  2JCH A;  5C5K A;  3V39 A;  2O99 A;  1YPR A;  1K55 C;  4EUV A;  3UE1 A;  4CLC C;  2PT7 A;  3Q1F A;  3IF5 A;  5JYO A;  2IA2 A;  4DJ2 A;  1FOF A;  2ZC6 B;  5F82 A;  5I94 A;  2EFX A;  5AQB A;  1OJ5 A;  2VV6 A;  4CLC B;  2PAV P;  4WM9 A;  2D01 A;  4UA6 A;  1BYW A;  1IFQ A;  4DKI A;  3LY3 A;  2V8C A;  3MMH A;  4OP5 A;  2ZM2 A;  5DKL A;  5K5B A;  3IHA A;  2VZW A;  3DTE A;  3JYI A;  5CHM A;  3OZH A;  4R0Q A;  2EXA A;  3EEA A;  4NXE A;  3RH8 B;  3GR2 A;  1G6O A;  1K56 A;  2PD8 A;  4N1X A;  3VP0 A;  2HPB A;  1PIO A;  1QMF A;  3LY4 A;  1PW1 A;  4UHU A;  5LBR A;  2HP6 A;  4WZ4 A;  4H6J A;  2KDK A;  4GKU A;  4HJ6 A;  3ZQ5 A;  4BD0 A;  3BY8 A;  1PWG A;  1Q2Q A;  3OPP A;  5BOH A;  4EBP A;  2KX6 A;  3IXH A;  4RQ9 A;  3IX3 A;  2ZC7 A;  2R9X A;  3PHY A;  2K7S A;  4R23 A;  1Y28 A;  2FFY A;  3MBZ A;  1LI9 A;  1SCW A;  3FPW A;  3EQU A;  4ESP A;  2L1M A;  3NI9 A;  1IEM A;  2B18 A;  5FSR A;  3VFH A;  1OJG A;  5HAP A;  5HZH A;  5EUA A;  3FV7 A;  1IYQ A;  1KGF A;  1XPB A;  4WMC A;  2X71 A;  3N6I A;  3LR4 A;  3MS6 A;  2EA9 A;  2H0T A;  1JWP A;  3IXD A;  2OV5 A;  2Q9M A;  3IWI A;  2DCF A;  3JVV A;  5HPF A;  5FQK A;  3GMW A;  3A3E A;  5TBM A;  2ZJ9 A;  3VV4 A;  4UA9 A;  2OLU A;  3R7W A;  2OAQ 1;  4X55 A;  4WMC D;  1CI8 A;  5JYP A;  4O7D A;  3BLS A;  1IKI A;  4Y7P A;  3IF6 C;  4O0P A;  3PBR A;  4KG2 A;  3UDF A;  3ZG9 B;  4OOM A;  1K57 A;  2KLI A;  4WUJ A;  4XUZ A;  3IF6 B;  3LI9 A;  1XA1 A;  2W3F A;  5DF8 A;  4ID4 A;  4IVK A;  4B4X A;  2JE5 A;  4DRT A;  2B02 A;  3N7W A;  2R9W A;  4FSF A;  5HW3 A;  4PPR A;  1GA9 A;  2WYX A;  2E8J A;  1IYO A;  2XD1 A;  1ZG6 A;  2EX9 A;  4OLG A;  1KOU A;  3S1Y A;  3DTM A;  1ES3 A;  5CED A;  5AQA A;  1K4E A;  1C3B A;  1NJ4 A;  1VET A;  1FSY A;  5HWT A;  3CUE C;  4F94 A;  1J3W A;  5DTS A;  2PR6 A;  2LB9 A;  5DTK A;  1LSV A;  5F1F A;  3OPL A;  4OPY A;  1BLH A;  3B42 A;  3HLW A;  2QKP A;  3W4P A;  4BBT A;  3W8K A;  1YLW A;  5KSC A;  5J4E A;  4Q0H A;  3B3X A;  3TRC A;  5L07 A;  4KZ4 A;  1RGY A;  3C8C A;  3G34 A;  2UV0 E;  4O8G A;  1WE4 A;  3C4O A;  3E4Q A;  4S2N A;  3HLC A;  2L0W A;  4IVI A;  3R4K A;  2XRN A;  1MBL A;  2J8Y A;  5L8M A;  1BSG A;  1IKG A;  3EGD C;  1KE0 A;  4JF4 A;  1RCJ A;  4NXF A;  2GZA A;  2VLG A;  1QME A;  5GHX A;  1KE4 A;  1I2S A;  3MFD A;  5E2G A;  4RA7 A;  1VQQ A;  4WYY A;  3T1Q B;  2G2U A;  2Y2K A;  2GX5 A;  3QP8 A;  4GS9 B;  2IWC A;  4NXB A;  2J7V A;  4E3N A;  2I72 A;  3HJK A;  4GDN A;  1W79 A;  2V20 A;  4PAU A;  1ODV A;  3LUQ A;  3RJU A;  3DW0 A;  2PU2 A;  3F1N B;  1FCM A;  1HTZ A;  4GOG A;  2Y2Q A;  2PDR A;  2WGW B;  3F1O A;  1YLY A;  1BZA A;  3G4P A;  3U2A A;  3PAE A;  2J9P A;  3LI8 A;  1WA9 A;  3EQV A;  2QJ7 A;  1K6S A;  2FZ0 A;  1K0K A;  5AQ7 A;  3GDI A;  1TD5 A;  2P9V A;  4QB8 A;  2XK1 A;  2Z6D A;  1ONG A;  3BFD A;  1M40 A;  3BW6 A;  2W1T A;  1TDL A;  4KQO A;  2OOL A;  3QP6 A;  2A2L A;  3H82 A;  1V9Y A;  2JKT M;  2W3E A;  4S2J A;  1ERM A;  1FR1 A;  1L0D A;  1PZO A;  4L0L A;  2NUP C;  4EET B;  5FAT A;  4DN0 A;  4DE2 A;  5GHY A;  1TS8 A;  3T1R A;  1MC0 A;  4KZ6 A;  4NG2 A;  1P97 A;  3CI6 A;  1JTD A;  2I9V A;  2JN7 A;  3QP1 A;  3D3O A;  5DFX A;  3QHY A;  3S7O A;  3QP4 A;  4FCF A;  1EI5 A;  4BBV A;  2V2F F;  4B88 A;  1YLZ A;  3MR0 A;  1ES4 A;  3NDE A;  4P0M A;  3HBR A;  2Y2O A;  2DNS A;  4GDB A;  5TGF A;  3ZG0 A;  1D1J A;  3T4K A;  3OCL A;  1ACF A;  1JVJ A;  1PRQ A;  2HF6 A;  2J80 A;  1T1C A;  5GL9 A;  5G4Z A;  4KZ5 A;  1W5D A;  3BFE A;  3Q7V B;  3GEC A;  2ZOI A;  4DE1 A;  1BLP A;  1ZTU A;  3DWZ A;  1BUE A;  1DRM A;  1SKO A;  1PI4 A;  4OOY A;  5I5L A;  1F2K A;  5F83 A;  1H8Y A;  1T1A A;  1CEF A;  4E3I A;  1E3U A;  1KVM A;  3C7V A;  3W2Z A;  1IYP A;  5M18 A;  3V3S A;  3A3D A;  2Y59 A;  4IJG A;  3AGD A;  4FUW A;  4OQ0 A;  3BEB A;  3KSI A;  2W1T B;  2EWW A;  4XUX A;  2BG1 A;  2C5W B;  1EWZ A;  3LIA A;  1E3U D;  1MY8 A;  3VSL A;  3LYX A;  4GZB A;  3PBQ A;  5HAI A;  4N9K A;  3ZNT A;  1HLU P;  3HLE A;  3IX4 A;  3NHQ A;  1YSQ A;  4ZRR A;  4DXC A;  2EXB A;  4R3B A;  4ARZ B;  5EM0 A;  3MXQ A;  3S22 A;  2YKF A;  2HP5 A;  3CIT A;  2UWX A;  2J3T D;  3GV9 A;  4YOF A;  2JHE A;  1K55 A;  3A0V A;  3V67 A;  4ETX A;  3G31 A;  1H8M A;  3D9Y A;  2Y79 A;  2QWS A;  3LEZ A;  1OT9 A;  5FI7 A;  2QYB A;  2W3D A;  5FQI A;  1SHV A;  4A5R A;  1BTL A;  3NOP C;  1SDN A;  3MKE A;  5FEF A;  1G28 A;  2K31 A;  4II7 A;  4E3O A;  3F1P A;  1H3Q A;  1S66 L;  1JNU A;  1SKO B;  3IS2 B;  3Q07 A;  1HZO A;  4I5S A;  4LRY C;  1XJ4 A;  2R78 A;  3S7P A;  2WKH A;  5HD3 A;  1VEU A;  4EW7 A;  2WGV A;  1S4R A;  4K91 A;  3UPN A;  2XLN A;  4JLF A;  5EFW A;  1GHP A;  3DBA A;  3ICY A;  1S4S A;  1LL8 A;  4E6X A;  4PMA A;  4PM6 A;  4S2I A;  3UNW A;  3VSK A;  2GDN A;  4OPR A;  4OQG A;  3EEH A;  4OOL A;  4EEP A;  1ZHH B;  1XFQ A;  4KZ7 A;  1IEL A;  4WF0 A;  3MSH A;  3GTC A;  2ZC5 B;  4JXW A;  4MCW A;  1WYC A;  3HRE A;  3C4P A;  4RX2 A;  3IH8 A;  3PBT A;  1SKF A;  1K25 A;  1N4O A;  4KQQ A;  1N9B A;  1T18 A;  4F3L A;  4QJG A;  4Y17 A;  2V1B A;  4JF5 A;  1ES2 A;  3LIF A;  1MWR A;  4GHI B;  1FIK A;  5G18 A;  3C2W A;  1OTE A;  2ZQ7 A;  3UB7 A;  5HFO A;  4EQ1 A;  5FA7 A;  3LR5 A;  5E43 A;  5KMW A;  2ZMV A;  3VOZ A;  1E25 A;  2VKS A;  3VFF A;  2WKP A;  1L2S A;  3UE3 A;  1NRF A;  4XXR A;  3ZDJ A;  3N8R A;  1XXM A;  1CEG A;  2M1C A;  3VP2 A;  2ZOH A;  2V0W A;  4R3A A;  3PYP A;  2ZL1 B;  4PM8 A;  3SH7 A;  5DVA A;  3VP3 A;  3QP2 A;  1K56 D;  3IHB A;  3U4L P;  3KX0 X;  4WEK A;  2EFU A;  1IOU A;  3UB9 A;  3HJI A;  3LGO A;  4L9G A;  2O9B A;  3SS5 A;  3KO6 A;  1TF1 A;  1ALQ A;  4B9O A;  3FPV A;  2XQZ A;  3PBO A;  4K0X A;  3T4J A;  4E3L A;  5HSQ A;  2VA0 A;  1S1Y A;  4LLO B;  3NC8 A;  3G30 A;  5FAP A;  3T4L A;  3MF0 A;  3RXW A;  3DTI A;  3CUE A;  4C6Y A;  4MBH A;  3M6B A;  1XJ3 A;  1TS0 A;  3OPH A;  3RTY A;  5CEB A;  2VEA A;  4MBF A;  5HD5 A;  2WZZ A;  2XRO A;  1FCN A;  4JXV A;  2HV1 A;  3V5M A;  3LIC A;  5CEC A;  3KYZ A;  3PR6 A;  3V3R A;  2ZQ9 A;  4B4Z A;  3TJZ C;  1LHY A;  3T1X A;  3ZVW A;  1MWU A;  2W3G A;  5DTT A;  5MC7 A;  4UQI M;  3D4F A;  4L9E A;  5M1A A;  1I2W A;  5DJU A;  4E3J A;  3A0S A;  4YNR A;  1X0O A;  5FAO A;  4H6J B;  5E2H A;  1K4F A;  2WK0 A;  1DJB A;  4DMZ A;  1ZC2 A;  4R1G A;  2CMN A;  3ZHH A;  4FD8 A;  3P98 A;  1YLT A;  3ITA A;  3A3J A;  3B47 A;  2X01 A;  4EBL A;  2X02 A;  4Z9Q A;  4R6L A;  5HAR A;  3M2K A;  1NZO A;  1FR6 A;  3QNB A;  5A93 A;  4PKY A;  1N9O A;  1CF0 A;  5FAQ A;  5J7E A;  2HZ5 A;  4LFU A;  3MQQ A;  1YLJ A;  2JKF A;  4RVA A;  3UMD A;  2HDU A;  4B93 A;  4QY5 A;  4WEJ A;  3UN7 A;  3GSG A;  5A92 A;  4WEL A;  2NUT C;  4OLD A;  5TBM B;  2ZQD A;  3HUO A;  2ZLY A;  3N8L A;  4HHD A;  3R7W B;  4S2L A;  2EWV A;  3ZVT A;  3N4I A;  5FAS A;  1FQG A;  4WZ5 C;  5FI2 A;  2JKG A;  1TS7 A;  3UO9 A;  4O01 A;  4DE3 A;  2C6W B;  3NY4 A;  3OLO A;  4Y2F A;  3HLG A;  4LCL A;  1L0E A;  3CWF A;  4EV4 A;  2INW A;  3BEC A;  2XEP A;  2Z2L B;  4S2P A;  3T4T A;  2BAS A;  5GLA A;  1OTB A;  4FH4 A;  2MJ6 A;  5HX9 A;  3M2J A;  1MWS A;  2PYR A;  2K2N A;  4EES A;  4NKP A;  3FWL A;  4ZJ1 A;  4LPZ A;  2ACG A;  3KSF A;  3ZGA B;  5DFY A;  3UPO A;  2DMW A;  2W3H A;  4JF6 A;  3T4O A;  2O0Y A;  1Z6F A;  4P85 A;  5HAQ A;  1UWN X;  5J3W A;  4G3V A;  1Q2P A;  4Y5F A;  5GLB A;  1DJA A;  3G6O A;  3FZC A;  4HQA A;  4JXG A;  1XP4 A;  5EOO A;  3T50 A;  1K54 A;  1W7F A;  3E2L A;  2V1A A;  3IBJ A;  3VP1 A;  5EVI A;  1VET B;  5HWW A;  4EER A;  4DDY A;  4HBU A;  3JVU A;  3WS2 A;  2PHY A;  3DAV A;  5FQ9 A;  3LEQ A;  3WWX A;  5FDS A;  2XF3 A;  1LL9 A;  4G3W A;  3CJM A;  1YSP A;  4KZB A;  3A3I A;  3MXS A;  3CZD A;  1YMS A;  3UB5 P;  4ZDX A;  5EVI D;  1SZV A;  1PYY A; 
#chains in the Genus database with same CATH homology
 2J3W A;  2PD8 A;  1MZU A;  4NEE D;  2J3T D;  3IBR A;  3H9W A;  4YOF A;  2JHE A;  3A0V A;  5LBR A;  3V67 A;  4ETX A;  4GW9 A;  4BMW A;  3MQO A;  4HIA A;  1H8M A;  4IUH A;  4XT2 A;  4H6J A;  2Y79 A;  2QWS A;  5KSH A;  1UGU A;  1OT9 A;  2KDK A;  1DP6 A;  4HJ6 A;  2QYB A;  1F9I A;  2W3D A;  3ZQ5 A;  5IU1 A;  3BY8 A;  3NOP C;  3T4S A;  1DP8 A;  1NRJ A;  2KX6 A;  1G28 A;  2K31 A;  2ZMF A;  4JGQ A;  4RQ9 A;  4II7 A;  4PKY G;  3PHY A;  2K7S A;  3F1P A;  1Y28 A;  3CLO A;  1H3Q A;  1YAX A;  4IUK A;  1S66 L;  1JNU A;  3FPW A;  3IS2 B;  3H7W A;  3EQU A;  3BWL A;  2L1M A;  1N9L A;  2XA7 M;  2B18 A;  4I5S A;  2Y8H A;  4LRY C;  4LRX C;  1XJ4 A;  2R78 A;  3S7P A;  1OJG A;  5HZH A;  4JGR A;  5HD3 A;  5AJG A;  4EW7 A;  3BQA A;  4I39 A;  3EOI A;  2HJE A;  4MN6 A;  1S4R A;  3D72 A;  2OWH A;  1DP9 A;  2EA9 A;  3LR4 A;  4R38 A;  1P9W A;  1D06 A;  5EFW A;  3DBA A;  4UEY A;  5FL3 A;  3ICY A;  3JVV A;  4QPR A;  2P08 A;  1S4S A;  2A24 A;  1LL8 A;  4G3K A;  3F1O B;  5HPF A;  3UME A;  4HY8 A;  3EEH A;  5TBM A;  4OOL A;  4EEP A;  3VV4 A;  1ZHH B;  1XFQ A;  3R7W A;  2OAQ 1;  2O9C A;  4WF0 A;  3O5Y A;  5CX7 A;  4O0P A;  3PBR A;  4MCW A;  3ZYT A;  3PBT A;  2PR5 A;  1OT6 A;  3KYQ A;  2WKR A;  4EEU A;  4OOM A;  1T18 A;  2KLI A;  4WUJ A;  4F3L A;  3LI9 A;  1W63 Q;  1EW0 A;  3H82 B;  2W3F A;  2V1B A;  1XJ6 A;  3P7N A;  2M7U A;  2FH5 A;  3LIF A;  1LSW A;  2YKH A;  2VV7 A;  4GHI B;  2B02 A;  2P7J A;  4HOI A;  2PYP A;  3E98 A;  3C2W A;  1OTE A;  3K2N A;  4HJ3 A;  1F98 A;  3TE8 A;  4FSF A;  3UB7 A;  4NXG A;  4Q0I A;  4EQ1 A;  3PBS A;  4I38 A;  3HCY A;  3LR5 A;  1S67 L;  2ZMV A;  2XA7 S;  1KOU A;  4R70 A;  1N9N A;  2H28 A;  2JKT I;  2VKS A;  4WL9 A;  2WKP A;  3FG8 A;  4CLC A;  1LSX A;  5F69 A;  4IHQ A;  3UE3 A;  5HWT A;  1XJ2 A;  3CUE C;  4HH3 A;  1OPX A;  5DJT A;  2PR6 A;  2LB9 A;  4HI4 A;  2M1C A;  2ZOH A;  1OTI A;  3LIE A;  1LSV A;  2V0W A;  3E0Y A;  4MN5 A;  3OBF A;  3OC2 A;  4R3A A;  3PYP A;  5HPI A;  4HNB A;  2KOI A;  4YWZ A;  3B42 A;  4ARZ A;  2W1R A;  5DKK A;  3CAX A;  2QKP A;  4L9F A;  3KX0 X;  4BBT A;  2VGL M;  4WN5 A;  4WEK A;  5J4E A;  4Q0H A;  4CLC D;  3TRC A;  1IOU A;  3P01 A;  3UB9 A;  3HJI A;  3C8C A;  3C38 A;  4L9G A;  1T19 A;  3OCN A;  2O9B A;  4O8G A;  3SW1 A;  3KO6 A;  1TF1 A;  5HDD A;  3E4Q A;  4B9O A;  1NLY A;  3KSG A;  2L0W A;  3FPV A;  3R4K A;  2XRN A;  4K08 A;  3PBO A;  3T4J A;  1OTD A;  1VB6 A;  5HSQ A;  1P0Z A;  2VA0 A;  5L8M A;  3T4Q A;  3EGD C;  1S1Y A;  4LLO B;  2G7U A;  4NXF A;  2GZA A;  2VLG A;  3T4L A;  4AFI A;  3MF0 A;  3EGX C;  4BJP A;  3CUE A;  2J3T C;  4FOF A;  1TS6 A;  5HL6 A;  5G4Y A;  1XJ3 A;  5HDC A;  3IS2 A;  4JGP A;  1TS0 A;  5F6A A;  2GX5 A;  3RTY A;  4EU0 A;  2VEA A;  4PHT A;  2XSS A;  5HD5 A;  4GS9 B;  2W0N A;  4P6Z M;  4NXB A;  3VE3 A;  4BBU A;  2XRO A;  3LR0 A;  2HV1 A;  3VOL A;  3LIC A;  3ULF A;  5HDS A;  2VV8 A;  3HJK A;  4GJ4 A;  2JKR I;  3KYZ A;  4PAU A;  1ODV A;  3PR6 A;  3LUQ A;  5DF9 A;  3C30 A;  1MKM A;  3NJA A;  3K3C A;  4Z1W A;  3F1N B;  3TJZ C;  1V9Z A;  2PDR A;  3F1O A;  3MFX A;  1UWP X;  2W3G A;  1S1Z A;  4MMN A;  5MC7 A;  1NWZ A;  4HP9 A;  1GSW A;  2VX8 A;  5A8B A;  1XFN A;  4I3A A;  3U2A A;  4KQD A;  4ETZ A;  3NOT C;  4UQI M;  1GSV A;  3LI8 A;  1WA9 A;  3EQV A;  4L9E A;  2QJ7 A;  2FZ0 A;  4I3I A;  5DJU A;  4DJ3 A;  3UB8 A;  3A0S A;  4YNR A;  4HJ4 A;  3NOU C;  1X0O A;  2D02 A;  3GDI A;  1TD5 A;  3BY9 A;  4XT2 B;  2Z6D A;  4H6J B;  4MN7 A;  2VGL S;  4LRZ E;  1F5M A;  4DMZ A;  3BW6 A;  2W1T A;  2PD7 A;  2HGV A;  3B33 A;  2M7V A;  2CMN A;  4KQO A;  2OOL A;  2ZBB A;  3RFB A;  1VHM A;  1NLZ A;  5KIZ A;  2A2L A;  1GSX A;  3H82 A;  1V9Y A;  2JKT M;  3F1P B;  2W3E A;  3B47 A;  1OTA A;  3E4P A;  4MDZ A;  3PXP A;  4R6L A;  3H7W B;  1STZ A;  2GNX A;  3UE6 A;  3TW8 A;  4L0L A;  2NUP C;  4EET B;  4DN0 A;  4GHI A;  2V9A A;  5AVE A;  4PKY A;  1LT0 A;  4CQH A;  1N9O A;  3A0R A;  3EWK A;  5J7E A;  1TS8 A;  1MC0 A;  2L4R A;  1T1B A;  3MQQ A;  1P97 A;  3UMD A;  4WLA A;  3CI6 A;  2I9V A;  2JN7 A;  3S7N A;  4CLC E;  3D3O A;  5DFX A;  4B93 A;  3S7O A;  2OAP 1;  4BBV A;  2GJ3 A;  4WEJ A;  1W63 M;  4M4X A;  4Q0J A;  2A24 B;  2VJW A;  4P6Z S;  4HH2 A;  3MR0 A;  5TJJ A;  3BJN A;  3LIB A;  2LB5 A;  2W27 A;  3PBN A;  1P9R A;  3LR3 A;  4ME4 A;  4WEL A;  2NUT C;  2QHK A;  3E4O A;  3KSH A;  5TBM B;  3LID A;  3T4K A;  3OCL A;  2V0U A;  2P04 A;  4HHD A;  3R7W B;  2EWV A;  3OOV A;  2HF6 A;  4GLQ A;  2J80 A;  1T1C A;  1TS7 A;  4O01 A;  5G4Z A;  3OLO A;  3GEC A;  2ZOI A;  4Y2F A;  4KUK A;  3UB6 A;  1ZTU A;  4Y3I A;  1DRM A;  1D7E A;  3CWF A;  2INW A;  5IT5 A;  5IS1 A;  4UQI S;  5I5L A;  4F3L B;  3T4T A;  5HWV A;  2BAS A;  1OTB A;  2MJ6 A;  4E04 A;  1T1A A;  2PYR A;  2K2N A;  2OWJ A;  4EES A;  2Z6C A;  4NKP A;  4KUO A;  3VE4 A;  2QJ5 A;  2HJ9 C;  3KSF A;  4I3J A;  4LPZ A;  5AVF A;  5DFY A;  3W2Z A;  2DMW A;  2W3H A;  3T4O A;  3MJQ A;  2O0Y A;  4GCZ A;  3MQ0 A;  4IJG A;  2JKR M;  1UWN X;  5J3W A;  5C5K A;  2O99 A;  4G3V A;  4EUV A;  4Y5F A;  4CLC C;  2WKQ A;  2PT7 A;  3KSI A;  2O9A A;  3G6O A;  3BQ8 A;  2IA2 A;  2W1T B;  3K3D A;  2EWW A;  4HQA A;  4DJ2 A;  4EXO A;  3T50 A;  3LIA A;  2V1A A;  1OJ5 A;  3IBJ A;  2VV6 A;  4CLC B;  3FC7 A;  2D01 A;  3S7Q A;  4GS9 A;  5HWW A;  3LYX A;  4EER A;  1BYW A;  3PBQ A;  1IFQ A;  4JGO A;  4BWI A;  3JVU A;  3LFV A;  3NHQ A;  3MMH A;  1YSQ A;  5DKL A;  2PHY A;  5F5Y A;  5K5B A;  2VZW A;  4ZRR A;  3F1N A;  4ARZ B;  4G3W A;  3MXQ A;  1YSP A;  2YKF A;  3EEA A;  4NXE A;  5F68 A;  3RH8 B;  3CIT A;  1YKD A;  4HP4 A;  1G6O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...