5DKLA

Structure of the light-state dimer of the blue light photoreceptor aureochrome 1a lov from p. tricornutum
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
133
structure length
133
Chain Sequence
GAMGDFSFIKALQTAQQNFVVTDPSLPDNPIVYASQGFLNLTGYSLDQILGRNCRFLQGPETDPKAVERIRKAIEQGNDMSVCLLNYRVDGTTFWNQFFIAALRDAGGNVTNFVGVQCKVSDQYAATVTKQQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords LOV domain
publication title Blue light-induced LOV domain dimerization enhances the affinity of Aureochrome 1a for its target DNA sequence.
pubmed doi rcsb
source organism Phaeodactylum tricornutum
molecule tags Signaling protein
total genus 36
structure length 133
sequence length 133
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13426 PAS_9 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 5dklA00
1BYWA 2L4RA 1XFQA 4EETB 1V9YA 4EEUA 4R70A 2QWSA 2KX6A 4EEPA 2CMNA 3EWKA 3LI9A 3C2WA 1LSVA 2EA9A 4HI4A 1LSWA 5HDCA 3C8CA 1VB6A 1OJ5A 1XJ2A 3A0SA 4F3LA 5DKLA 2OOLA 2V1BA 3NOPC 1DP8A 4LRZE 2M1CA 3UB9A 4WL9A 1T1BA 3EEHA 5HDDA 2GJ3A 1XJ4A 1N9NA 1WA9A 4HH3A 3VE4A 1KOUA 4H6JA 4PKYA 1Y28A 3CLOA 3MJQA 3LICA 2PYPA 3VOLA 2A24A 3K3DA 1LT0A 4L9EA 3UB6A 5F69A 3CAXA 1LL8A 2D01A 2ZOIA 1LSXA 1MZUA 4EESA 2PD8A 2QJ7A 3NJAA 1OT6A 1TS7A 3ICYA 4JGRA 1TS8A 3K3CA 4LLOB 1S4SA 1T1CA 5TBMA 2PD7A 2B02A 4LPZA 3RTYA 4GCZA 3BY8A 3F1PA 4BBVA 1P97A 5HSQA 1OTDA 3IBRA 3P7NA 4F3LB 2QHKA 3G6OA 3UMDA 4HQAA 4PKYG 2VLGA 4WUJA 2QJ5A 2VV7A 4LRXC 3LIAA 3MXQA 3T50A 2QKPA 3D72A 4EQ1A 2J80A 2R78A 3UMEA 5F68A 3ULFA 4WF0A 4R3AA 5EFWA 5G4YA 2V9AA 2JN7A 2WKRA 5HD5A 4H6JB 3BY9A 2K7SA 2I9VA 1OTEA 2YKHA 4NXGA 3MR0A 4KQDA 4NXEA 3GDIA 3LYXA 2A24B 1DP6A 3UB7A 3LIFA 5HWWA 1F98A 4E04A 1D7EA 5I5LA 5IS1A 4EXOA 2WKQA 1T19A 4HJ4A 2Z6DA 1X0OA 4GS9A 4I38A 5IU1A 5HWVA 1GSXA 4JGQA 5F6AA 3E4PA 4EERA 2HV1A 5KIZA 4HOIA 1EW0A 3HJKA 1OTAA 2KDKA 4WLAA 3IS2B 3OLOA 1XJ3A 2D02A 5TBMB 3H7WB 3F1NA 3B33A 3LIBA 4HIAA 4NXBA 4DJ3A 3F1PB 2YKFA 1V9ZA 4KUKA 4HNBA 4HP9A 4GHIA 2BASA 3E4QA 4HY8A 4EW7A 1S1YA 2VV6A 1G28A 4BBUA 5F5YA 3A0RA 3IS2A 3GECA 1P0ZA 4MN5A 3H7WA 4I3AA 1TS0A 1T1AA 4HJ3A 3HJIA 3A0VA 1UWPX 5AVEA 2PHYA 5DJTA 4I5SA 1JNUA 2ZOHA 5J7EA 4L9GA 1XFNA 4BBTA 3BWLA 2JHEA 1GSWA 1UGUA 5A8BA 4MN6A 2VV8A 3FG8A 4NXFA 4I3IA 3VE3A 5DJUA 4R6LA 5AVFA 3NOTC 1UWNX 4XT2A 4GW9A 3UB8A 1N9OA 2W27A 1TS6A 2VEAA 1S1ZA 3F1OA 4I3JA 2Z6CA 4GS9B 4HJ6A 1T18A 3NHQA 3H82B 1OT9A 1D06A 2PYRA 4R38A 3NOUC 3CWFA 2V1AA 4I39A 5J3WA 1S66L 5DKKA 3LI8A 3F1NB 2V0UA 3MQOA 5HZHA 2H28A 3UE6A 1S4RA 2OWJA 3MQQA 3SW1A 4LRYC 3H82A 4GHIB 2L0WA 1OTBA 4JGPA 1S67L 4L9FA 2WKPA 1OJGA 5G4ZA 3ZQ5A 4DJ2A 5HD3A 2PR5A 4HH2A 4YWZA 4K08A 1XJ6A 1DRMA 3MFXA 1GSVA 2V0WA 5J4EA 2OWHA 2W0NA 4KUOA 3H9WA 2PDRA 2INWA 3PYPA 1F9IA 5HWTA 4B9OA 3LUQA 4M4XA 2PR6A 3PHYA 1N9LA 4JGOA 2ZBBA 5HDSA 4XT2B 4RQ9A 1DP9A 3LIDA 3E4OA 4WN5A 3KX0X 1ODVA 3LIEA 3F1OB 4HHDA 1OTIA 1NWZA 4HP4A 3RH8B 2P7JA 2L1MA 3FC7A
chains in the Genus database with same CATH superfamily
1K25A 1MPLA 3HLWA 1XFQA 1YPRA 3CPTB 4P87A 2HP9A 1H3QA 2Z2LB 3VV4A 2G2UA 5KMWA 3EWKA 3LI9A 1XA7A 3C2WA 1LSVA 2EA9A 1FCNA 3IF5A 3MKFA 1LI9A 1VQQA 1MWRA 1JVJA 4U0XA 4CLCA 3Q07A 2WYXA 4CLCC 3C8CA 3KYQA 4UA7A 5EV0A 1YLWA 3IX8A 4F3LA 1CF0A 4C75A 2GX5A 3N7WA 4E3NA 4LFUA 2V1BA 4MDZA 1DP8A 3HUMA 4LRZE 3IXDA 5LBRA 3V5MA 3IWOA 3GQZA 3KSGA 2GZAA 3ZG0A 3W2ZA 3DAVA 4UAAA 3WRTA 1WE4A 2VJWA 4S2JA 3N8SA 2JE5A 2P9VB 1BTLA 2PT7A 5F1GA 4H6JA 5E2GA 3MJQA 1XP4A 3UPOA 3PBQA 5AJGA 1VEUB 4BJPA 2BTFP 2KLIA 5DF7A 4WM9A 1D1JA 2ZOIA 4WZ5A 1LSXA 4WZ5C 3E2KA 2J8YA 2EXAA 2PD8A 4ETXA 3NJAA 3ZG8B 3HREA 1OT6A 1TS7A 1PWCA 3DTIA 4LLOB 3OBFA 4BLMA 2O9AA 3IHAA 1T1CA 4FTXA 5L8MA 5TBMA 2B02A 3T4TA 2Y4AA 2JBFA 4LPZA 3T12B 4GCZA 3F1PA 4BBVA 3SS5A 4ESPA 1A0KA 3JPUA 2WZXA 2QHKA 3G6OA 4RYEA 4C6YA 3S7NA 4HQAA 4PKYG 4Y2FA 2VV7A 1MY8A 1XPBA 3WS5A 3CITA 1VETB 5HARA 5A90A 3IWIA 2ZMAA 4YOFA 1BULA 1FR6A 2BLSA 3ULFA 2O0YA 3C4PA 2V20A 3LEQA 5KSCA 1FQGA 1L0DA 3PBRA 4KZ7A 3N4IA 4YFMA 2WKRA 5HD5A 5EOEA 1L0GA 1W5DA 4QD4A 1M40A 1U60A 3QNBA 3GDIA 3O86A 2R9WA 4NETA 4GKUA 3UB7A 2WK0A 4Z1WA 5AQ9A 2G2WA 3UY6A 3LEZA 5CECA 2WKQA 4MBHA 4HJ4A 4GS9A 4I38A 5HWVA 4NG2A 1GHIA 1GSXA 2Y2GA 5E2HA 1PW8A 4GOGA 3E4PA 5TR7A 2HV1A 4HOIA 1EW0A 4X1MA 3OLOA 3DWZA 1K38A 3KSFA 4E6WA 3LIBA 1IEMA 4DN0A 3CUEA 5CHJA 3CUEC 1SKOB 3PR6A 4YINA 4HNBA 4HP9A 4UHUA 2FH5A 2BASA 1SZVA 3E4QA 4DKIA 4EW7A 4DF6A 4QJGA 4Q0JA 1SCWA 2XGNA 1YLPA 5K5BA 3A0RA 3IS2A 5EVLA 3SH9A 1QMEA 1RGZA 3CG5A 2OV5A 5GLDA 4MN5A 3AGDA 5HPIA 1YLTA 3C5AA 5C5KA 1L0FA 3C38A 2GDNA 1NLZA 2WUQA 4GD6A 3C7VA 1TS0A 1T1AA 5CX7A 4OLGA 1ACFA 1I2WA 2PHYA 1JNUA 2HJEA 4MBFA 5A8BA 5CTNA 1NYMA 2FZ0A 1IKIA 4EWFA 4NXFA 2PRFA 4JXGA 5DJUA 4R6LA 4FH2A 4QY5A 3QP2A 5CERA 4GN2A 3BFGA 4OP8A 4OOMA 4LCLA 1IYPA 1LL9A 3UB8A 2VKSA 2VEAA 3OPRA 2B5RA 3SOIA 1GHMA 5GHYA 3F1OA 2GNXA 2ZL1B 4I3JA 2O9CA 3H82B 4ME4A 3C30A 1MWUA 4R3JA 1GA0A 3CWFA 3VP2A 2Z2MB 1K6SA 3QP1A 5DF9A 2OLVA 2V1AA 2WAFA 1MC0A 5FDHA 5J3WA 3ZVTA 1S66L 1SHVA 5FDSA 5DKKA 3G31A 3CPTA 3IBJA 2NUPC 2CC1A 5HAQA 4IJGA 3ISGA 5FI6A 5HZHA 1FSYA 2OWJA 4H8RA 4D60A 4LRYC 4GHIB 3D9YA 2XA7M 5FASA 1OTBA 4UA6A 4BD0A 1NRJA 5I94A 1S67L 4E3MA 5CRFA 2VGKA 3D4FA 4XUXA 5G4ZA 4JF4A 1ES3A 3CHWP 3G30A 1OMEA 2PR5A 1KGFA 4YWZA 1FILA 4BD1A 1ZKJA 1XJ6A 5FQIA 1DRMA 1H5XA 3HVFA 4WMCD 3BFDA 3MFXA 3FZCA 3E2LA 1ZHHB 1IELA 2PDRA 3RXWA 1O07A 3ZDJA 3O5YA 2XRNA 1HTZA 4M4XA 1S6RA 4GJ4A 2ZBBA 5FQQA 4K0WA 1EROA 2JKFA 4RQ9A 2WZZA 3UDFA 3IXGA 4LENA 5EECA 1W63Q 4X1LA 1NWZA 4HP4A 4Q8IA 3BYDA 4N9KA 1Y54A 3KSIA 4CQHA 1EWZA 1KE3A 4G3KA 5TGFA 5CGXA 2OAQ1 1PW1A 5TFQA 1ES5A 2ZM0A 3QNCA 3S1YA 1BYWA 2L4RA 2Y91A 4EETB 2WKEA 2NUTC 5FAOA 4R70A 2QWSA 2K31A 4EEPA 4EQIA 1BLCA 2VA0A 1PZOA 1F5MA 3AGEA 1LSWA 1JWVA 3O3VA 5HDCA 2WKHA 4JBFA 3VFHA 1CEFA 1YLYA 3P98A 1C3BA 2WGWA 3MFDA 3A0SA 2OOLA 3BECA 1ERQA 1IOUA 4WELA 5FQ9A 1G5UA 2Y8HA 4LV0A 4WL9A 2X02A 1PIOA 1T1BA 1VETA 1KVLA 3S7OA 1TDLA 4EBPA 3A3IA 5EVEA 2UWXA 3FWLA 4DE2A 5F1FA 5M19A 4HH3A 1OPXA 1XKZA 5FQKA 4IUKA 3ZVWA 1Y28A 5CGSA 4JXVA 5CHUA 4OOYA 4JLFA 3LICA 5DFXA 1LI0A 3T1XA 2VK3A 3K3DA 4L9EA 5JYPA 4R4RA 1PYYA 5GHZA 1SKFA 1ALQA 4FCFA 2D01A 4LGWA 4DRTA 1W63M 4R23A 4GD8A 4JXSA 4GLQA 4IVIA 4G3WA 5G18A 3BLSA 3OC2A 3UE0A 2PU2A 3ICYA 4JGRA 1TS8A 2VZWA 2W3DA 2E8IA 3UB5P 2P74A 4MMNA 4P85A 4EV4A 5FI7A 2PD7A 5HAPA 4KQRA 3DTEA 3DTMA 4ARZB 1H8MA 2A2LA 3ITBA 1P97A 5IT5A 5EOOA 3EQVA 3NBLA 1OTDA 3TJZC 2W3EA 2FFFB 3W4PA 4ZDXA 1W7FA 2VLGA 3FV7A 1K56D 3LIAA 4Q0IA 4ZJ3A 4KZ9A 4X68A 5D3OA 3TRCA 2IWCA 1DY6A 2QKPA 2B18A 2HF6A 4LV3A 1ZG6A 2R78A 4X25A 1Q2PA 3V39A 3T4KA 1NZUA 3T4SA 1BLHA 1K6RA 2O9BA 5EFWA 4WMCA 5G4YA 4DXCA 2JN7A 3LR4A 5EUAA 1BT5A 4IBRA 3GMWA 2I9VA 1FIKA 4KQDA 1I2SA 2A24B 4FD8A 3PBOA 4KENB 2V2FF 3V3RA 3GVBA 1TDGA 4PM8A 5HWWA 4OPRA 1CJFA 3BQ8A 1P9WA 2EX8A 3K2NA 4EXOA 1K4EA 3BRMA 2Z6DA 2C5WB 2XF3A 1CK3A 5EVID 4JGQA 1VM1A 5F6AA 4KZ3A 4Y0OA 1H8YA 5TJJA 3A3DA 4O0PA 2PU4A 3IT9A 4ZTKA 3H7WB 1FCMA 3BW6A 3B33A 4EU0A 2DRWA 2IA2A 2LB9A 2HDSA 3B3XA 3Q7ZA 3ZCZA 3UN7A 3WS4A 1PFLA 3NIAA 4GHIA 4QPRA 4OKPA 4ID4A 4WEKA 1S1YA 4P6BA 1G28A 3W4QA 2J7VA 5GHXA 3GTCA 5F5YA 4KG2A 5HL6A 2XLNA 4QY6A 4HBUA 2OLUA 4B4XA 4F94A 2FFYA 1FCOA 4X55A 4I3AA 5DTSA 3FYZA 3ZG9B 3HJIA 1PZPA 3EGDC 1UWPX 5CTMA 3NDGA 4I5SA 1W79A 3T4LA 5J7EA 4L9GA 1XFNA 5CGWA 3EEAA 2JHEA 1GSWA 4O7DA 1IKGA 3G2YA 4ZBEA 2ZLYA 3SS3A 3HUNA 4I3IA 3VE3A 3OPLA 3PAEA 4DE3A 2H10A 1IYSA 3NOTC 5FATA 3DBAA 4OPZA 4GW9A 2Y2KA 4JF6A 3ZNYA 3U4LP 1S1ZA 1YSPA 1NY0A 4R3BA 1PRQA 4R4SA 1NZOA 2Z6CA 4S2LA 5J8XA 2EWWA 2PYRA 3NOUC 3WS1A 2JKRM 1SDEA 3BFFA 3VSLA 2ZQ7A 4PM7A 4OQGA 2IWBA 2WGVA 5FEFA 2Y2PA 2ZC7A 3BEBA 3N8RA 3LI8A 3MKEA 2V0UA 3UE6A 2H5SA 3SW1A 2JKGA 1YT4A 4OQIA 3BFEA 4XXRA 4JGPA 2J9PA 2Q9NA 2XA7S 1OJGA 3ZQ5A 5EE8A 3UE3A 4DJ2A 5HD3A 3OZHA 3HLGA 2QPNA 4K08A 4L0LA 3KYZA 1Y4OA 1K56A 1G6OA 2HGVA 5FSRA 1TEMA 3VSKA 3AGFA 2J9OA 4OONA 2M7UA 5J4EA 2OWHA 2W0NA 4KUOA 2RCXA 3HLEA 3GR2A 2ZMVA 4X53A 3NI9A 3Q7VB 3PHYA 4EUZA 4MCWA 2W3FA 5AQAA 4XT2B 3LIDA 4XUZA 3R7WA 3KX0X 1ODVA 1K4FA 3UPNA 2XSSA 4WBGA 2MJ6A 4Y17A 3HUOA 4EUVA 3UE1A 3L7HA 3O88A 3OPPA 2K2NA 4IUHA 2L1MA 4CLCB 3MBZA 1KGEA 4Y0UA 1L2SA 4BL3A 5EVIA 1V9YA 2ZMFA 5EVIC 4IEDA 3T4OA 1LLBA 4JPMA 3MS6A 3BFCA 3VOZA 5HPFA 3LR5A 4E3OA 1G68A 1TD5A 3IX3A 4S2IA 5DKLA 1BZAA 3TG9A 5GLCA 2Y2OA 5FA7A 3NOPC 3KYEA 2W3GA 4O8GA 3UNWA 3TW8A 1BUEA 2Q9MA 4NEED 3G32A 5GLAA 1XJ4A 2GJ3A 4MNRA 3BJNA 2XEPA 3T4JA 3MZFA 1YLZA 3VE4A 1CI8A 3SZTA 2V8FA 1RGYA 4KZ6A 4UQIM 4X56A 1KOUA 3CI6A 4PKYA 4DMZA 5L09A 4Z9QA 4Q0HA 1GA9A 2PYPA 4OVDA 3LGOA 1DJBA 2A24A 1LT0A 2XD1A 5F82A 3MXRA 3UB6A 1NXYA 4II7A 1I5QA 1PWDA 5F69A 1SDNA 4KQQA 4YNRA 2P9VA 2JKTI 2QYBA 4X69A 2JCHA 3TOIA 4EESA 2QJ7A 2W3HA 1XGJA 5FAQA 5CHMA 2J3TD 4PM5A 5HL1A 1S4SA 1VEUA 2Y79A 5GLBA 3B47A 4B4ZA 2V8CA 4D2OA 4QB8A 5A91A 3T1RA 1J9MA 1K54A 5HSQA 1K54C 3LR0A 4QWOA 1O7EA 3GV9A 2WKIA 3A3EA 4GZBA 4MEZA 4BMWA 2ZQ9A 4OOLA 2QJ5A 2P04A 1E3UD 5JYOA 3MXQA 3S4XA 1S0WA 5CEDA 3D72A 4EQ1A 2ZC3B 2J80A 3E98A 3HL9A 2ACGA 5HFOA 5EPHA 4GB7A 1K55A 4QU3A 3UPPA 1K55C 4WZ4A 1NLYA 4WF0A 4R3AA 3G2ZA 4N1XA 4CLCE 4P0MA 4EBNA 1YM1A 4UA9A 4RX2A 2K7SA 1VHMA 1K57A 1OTEA 3W8KA 1K57C 3MR0A 2P08A 3UO9A 2A49A 1YQSA 3LYXA 2HDUA 4PHTA 1DP6A 1G6AA 1DJAA 3U2AA 4E3JA 4QHCA 1F98A 4K91A 3TSGA 4E04A 4U3TA 5I5LA 5BOHA 1ZC2A 5IS1A 3PAGA 4OPYA 1T19A 1X0OA 2ZQCA 1GHPA 2KOIA 4IHQA 4EERA 5KIZA 3TE8A 1LHYA 4DE0A 2KDKA 5L10A 4WLAA 3IS2B 3BM6A 3EOIA 1WYCA 4OP5A 2OSUA 4S2MA 4ETZA 5U47A 4NXBA 2YKFA 5E2EA 2W1TB 3OOVA 1NYYA 4FUWA 5MC7A 3IH8A 3IF6B 4HY8A 2VV6A 4BBUA 1P0ZA 3WS0A 1BLPA 4JKTA 3VP0A 2UV0E 2Y2HA 5DF8A 1SKOA 3A0VA 2HDRA 2PAVP 3C4OA 5E2FA 2ZOHA 4DXBA 4OLDA 2Y59A 3BWLA 3NCKA 4KG6A 2C6WB 1GCEA 4P6ZS 3N6IA 4Y3IA 1JWPA 3IQAA 3T1SA 3GRJA 4ZJ1A 3Q7VA 3N8LA 4PM6A 2HJ9C 2H0TA 4K0XA 1BLSA 4XT2A 2WGIA 2W27A 1TS6A 3GSGA 3HLDA 1P9RA 3V3SA 5HW3A 4OPQA 4R1GA 1HZOA 1XA1A 1OT9A 5GL9A 2EX9A 5F83A 3NDEA 2E8JA 3T1QB 4I39A 1KE4A 4AFIA 2Y2JA 1DJCA 2XROA 3HLBA 4NKPA 3F1NB 1N9BA 3QP8A 4G3VA 3VOYA 1K0KA 5EM1A 4FOFA 2ZL1A 4C3QA 1S4RA 2I72A 2J3TC 3H82A 2ZD8A 2JKTM 3ZHHA 4GDNA 3ZGAB 1YLJA 4N1HA 5AQ7A 1ZTUA 4L9FA 3LR3A 2WKPA 3SS4A 2LB5A 3DWKA 1CEGA 4BL2A 2IWDA 4HH2A 5DVAA 3VP4A 2EFXA 1NRFA 1E3UA 2ZC5B 3JYIA 1E4DA 3VFFA 3H9WA 2INWA 3PYPA 1WYBA 5HWTA 3ZNTA 1YMSA 1HD8A 3D3OA 3M2JA 2PR6A 4Y0TA 4KQOA 3A3JA 4LCMA 1PI4A 4OH0A 4BQMA 4JF5A 3PXPA 1YAXA 5FAPA 4X6TA 5AQBA 3PBTA 5L2FA 3LCEA 4P6ZM 1QMFA 3UDXA 1IYQA 3MSHA 3E4OA 1MKMA 3Q81A 2PBYA 1BSGA 1ES2A 1OTIA 4PM9A 1TVFA 4GNUA 3RH8B 3CMZA 3P01A 3LY4A 3WS2A 5FEGA 3ZG7B 3IH9A 3KSHA 3IXBA 2WGWB 4S2PA 1MKIA 4EEUA 2EXBA 3B42A 4E6XA 3C7UA 4N92A 3E0YA 5E43A 2KX6A 2XH9A 2CMNA 4Y7PA 3WRZA 4CJNA 2EWVA 2QMIA 2EFUA 3NC8A 3S7PA 1RP5A 2HP5A 1MWTA 3S7QA 4HI4A 3L9KA 4CPKA 2DNSA 1PWGA 4Y13A 2W1RA 5CXWA 1VB6A 2ZM2A 4LV1A 1JWZA 1OJ5A 1XJ2A 3PBSA 3UDIA 1L3LA 3ITAA 2ZC6B 1J3WA 4BENA 2M1CA 2WAEA 3UB9A 3Q1FA 5FQMA 4S2KA 4RA7A 5A92A 3RXXA 3FPWA 2XFTA 4FH4A 2Y2NA 3EEHA 5HDDA 2XFSA 3SH8A 1KE0A 2XK1A 1N9NA 1WA9A 3M6BA 3NECA 4PPRA 4IVKA 3ZYTA 5M18A 4A5RA 3PBNA 3BLMA 1CQAA 3KO6A 4IBXA 2EX6A 4KG5A 2RL3A 3CLOA 2WADA 5FI2A 4UQIS 1N4OA 3MXSA 3VOLA 3DTKA 5DFYA 3PTEA 4HEFA 1MXOA 2DCFA 1YKDA 4HBTA 3EQUA 5HX9A 3CAXA 1LL8A 4KZBA 3HCYA 1XGIA 3Q82A 1MZUA 3LY3A 4DE1A 1FOFA 2HP6A 3OCLA 4B93A 2ZC4B 2HDQA 5FQJA 1Z09A 3K3CA 2VX8A 1F2KA 3NULA 1CI9A 2XDMA 3VMAA 3RTYA 3BY8A 5DTTA 3OCNA 2W1TA 2ZQAA 2ZQ8A 3IF6A 3IF6C 1MWSA 1NJ4A 3IBRA 3P7NA 5KZHA 4F3LB 3BQAA 1PI5A 3UMDA 4WUJA 5FL3A 4LRXC 1H8ZA 1HLUP 3T4QA 2VGLS 5A93A 4KZ8A 3P09A 3T50A 3MZEA 1IFQA 3O87A 4ARZA 1KGGA 3UMEA 2Y55A 3EGXC 5F68A 2Y2LA 3RFBA 2V9AA 3RJUA 2AVXA 4EBLA 4H6JB 3BY9A 1YSQA 2YKHA 4NXGA 3JVVA 5IHVA 1RCJA 1STZA 4NXEA 2VGJA 3VP3A 3HLCA 3MMHA 2R9XA 3OPHA 3LIFA 3FPVA 2XD5A 3QP6A 1D7EA 2EX2A 2B95A 5M1AA 4RVAA 5IU1A 2J3WA 3V67A 3FKVA 2Y2IA 3MF0A 5DTKA 4O01A 3HJKA 5EM0A 1OTAA 4KZ5A 4NK3A 4OQ0A 1XJ3A 4E3KA 2D02A 3I7JA 2ZM8A 5TBMB 4DDYA 3F1NA 4JXWA 1YMXA 4HIAA 1AXBA 2OAP1 1MBLA 4DJ3A 4ZAMA 3F1PB 4CLCD 2Y2QA 2ZQDA 3W4OA 1LL5A 1V9ZA 4KUKA 4OQHA 1KVMA 4S2NA 3HBRA 1KDSA 4S2NC 2Q0OA 3M2KA 3CJMA 4B88A 1ZG4A 4E3LA 3QHYA 3GECA 4WEJA 3JVUA 2X01A 2G7UA 3H7WA 3IHBA 2HZ5A 1HVBA 4S2OA 4HJ3A 1FR1A 2XQZA 5AVEA 4M3KA 1ONGA 2HPBA 3A3FA 5DJTA 3WWXA 3R4KA 4BBTA 4HESA 2VGLM 4GDBA 4FSFA 2V1ZA 4ZJ2A 1UGUA 1IYOA 4MN6A 2VV8A 1JTDA 4KZAA 3FG8A 2M7VA 3IX4A 5AVFA 2ZJ9A 1AWIA 1UWNX 1ESUA 3DW0A 2O99A 1N9OA 3LFVA 4N9LA 3MZDA 4PMAA 4Y5FA 4DDSA 2XR0A 4RX3A 4GS9B 4LV2A 4ZRRA 4HJ6A 1T18A 3NHQA 5L07A 3MQ0A 1W8QA 1M6KA 2Y2MA 1D06A 4R38A 3S22A 2QZ6A 4MLLA 3IXHA 3IWQA 3G35A 4UEYA 4U0TA 4E3IA 3MQOA 2H28A 1W8YA 2X71A 3MQQA 3CZDA 1ONHA 3V50A 2L0WA 1EI5A 2JC7A 3LO7A 3VP1A 1E25A 4BWIA 1JTGA 3QP5A 1PNEA 2BG1A 1ES4A 3QP4A 3NY4A 2JKRI 1TF1A 1XX2A 3HLFA 4PAUA 4MBKA 4MN7A 1L0EA 3M6HA 1GSVA 3R7WB 2H0YA 2V0WA 1XXMA 3SH7A 4Y15A 1F9IA 4KZ4A 3G34A 1FSWA 4B9OA 3LUQA 1N9LA 4JGOA 3ZG5A 2PBDP 5CEBA 1KDWA 1ERMA 1Z6FA 5HAIA 5HDSA 5EVIB 1DP9A 2DMWA 1H0MA 4WN5A 5KSHA 4WYYA 3LIEA 3F1OB 4HHDA 1Q2QA 2A3UA 1ESIA 3ZFZA 3G4PA 2P7JA 4R0QA 3FKWA 3FC7A
chains in the Genus database with same CATH topology
1BYWA 2L4RA 1XFQA 4EETB 1V9YA 2ZMFA 4EEUA 2NUTC 3B42A 4R70A 2QWSA 3E0YA 3T4OA 2KX6A 1H3QA 3VV4A 2K31A 4EEPA 2CMNA 3EWKA 3LI9A 2EWVA 2VA0A 3C2WA 1LSVA 2EA9A 3S7PA 1F5MA 3S7QA 4HI4A 1LSWA 5HDCA 4CLCA 5HPFA 3LR5A 4CLCC 3C8CA 2W1RA 3KYQA 1TD5A 1VB6A 1OJ5A 1XJ2A 3A0SA 4F3LA 5DKLA 2OOLA 2GX5A 3PBSA 1IOUA 4WELA 2V1BA 4MDZA 3NOPC 1DP8A 2W3GA 2Y8HA 4LRZE 2M1CA 4O8GA 3UB9A 4WL9A 5LBRA 1T1BA 3TW8A 3KSGA 3S7OA 4NEED 2GZAA 3FPWA 3EEHA 5HDDA 1XJ4A 2GJ3A 3W2ZA 3BJNA 3T4JA 1N9NA 1WA9A 4HH3A 1OPXA 2VJWA 3VE4A 3ZYTA 4IUKA 3PBNA 3KO6A 4UQIM 2PT7A 1KOUA 3CI6A 4H6JA 4PKYA 4DMZA 1Y28A 4Q0HA 3CLOA 3MJQA 3LICA 2PYPA 4UQIS 5DFXA 3VOLA 5DFYA 2A24A 3K3DA 1LT0A 3PBQA 4L9EA 5AJGA 1YKDA 3EQUA 3UB6A 4II7A 5F69A 4BJPA 2KLIA 3CAXA 1LL8A 2D01A 4YNRA 3HCYA 2ZOIA 2JKTI 1LSXA 1W63M 2QYBA 1MZUA 4EESA 2PD8A 3OCLA 2QJ7A 4GLQA 4G3WA 4ETXA 3NJAA 2W3HA 3OC2A 4B93A 1OT6A 1TS7A 3ICYA 4JGRA 1TS8A 2VZWA 2W3DA 3K3CA 4LLOB 2VX8A 3OBFA 2J3TD 4MMNA 2O9AA 1S4SA 1T1CA 5L8MA 2Y79A 5TBMA 3B47A 2PD7A 2B02A 3T4TA 4LPZA 3RTYA 4GCZA 3BY8A 3F1PA 4BBVA 4ARZB 1H8MA 2A2LA 3OCNA 2W1TA 1P97A 5IT5A 3EQVA 5HSQA 1OTDA 3TJZC 3LR0A 3IBRA 3P7NA 2W3EA 4F3LB 2QHKA 3BQAA 3G6OA 4BMWA 3UMDA 3S7NA 4HQAA 4PKYG 2VLGA 4OOLA 4WUJA 4Y2FA 2QJ5A 5FL3A 2VV7A 4LRXC 3LIAA 2P04A 4Q0IA 3T4QA 2VGLS 3MXQA 3TRCA 3CITA 3T50A 2QKPA 2B18A 2HF6A 3D72A 4EQ1A 1IFQA 2J80A 3E98A 4YOFA 4ARZA 2R78A 3UMEA 3EGXC 5F68A 3RFBA 3T4KA 3T4SA 3ULFA 2O0YA 2O9BA 1NLYA 4WF0A 4R3AA 5EFWA 5G4YA 3PBRA 4CLCE 2V9AA 2JN7A 3LR4A 2WKRA 5HD5A 4H6JB 3BY9A 2K7SA 1VHMA 2I9VA 1OTEA 1YSQA 2YKHA 4NXGA 3JVVA 3MR0A 2P08A 4KQDA 1STZA 4NXEA 3GDIA 3LYXA 2A24B 3MMHA 3PBOA 4PHTA 1DP6A 3UB7A 3U2AA 3LIFA 3FPVA 4Z1WA 5HWWA 1F98A 4E04A 1D7EA 5I5LA 3BQ8A 5IS1A 1P9WA 3K2NA 4EXOA 2WKQA 1T19A 4HJ4A 2Z6DA 1X0OA 4GS9A 4I38A 5IU1A 2J3WA 5HWVA 3V67A 1GSXA 2KOIA 4JGQA 5F6AA 3E4PA 4IHQA 4EERA 3MF0A 2HV1A 5KIZA 5TJJA 3TE8A 4HOIA 1EW0A 3HJKA 4O01A 4O0PA 1OTAA 2KDKA 4WLAA 3IS2B 3OLOA 1XJ3A 3EOIA 2D02A 4ETZA 3KSFA 5TBMB 3H7WB 3F1NA 3BW6A 3B33A 4EU0A 2IA2A 2LB9A 3LIBA 4HIAA 4DN0A 2OAP1 3CUEA 4NXBA 4DJ3A 3CUEC 2YKFA 3F1PB 4CLCD 2W1TB 3PR6A 1V9ZA 3OOVA 4KUKA 4HNBA 4HP9A 5MC7A 4GHIA 2FH5A 2BASA 3E4QA 4HY8A 4QPRA 4EW7A 4WEKA 1S1YA 2VV6A 4Q0JA 1G28A 4BBUA 5F5YA 5HL6A 5K5BA 3A0RA 3IS2A 3GECA 1P0ZA 4MN5A 4WEJA 3JVUA 5HPIA 2G7UA 3H7WA 5C5KA 4I3AA 3C38A 1NLZA 1TS0A 1T1AA 4HJ3A 5CX7A 3HJIA 3A0VA 3FC7A 3EGDC 1UWPX 5AVEA 2PHYA 4I5SA 5DJTA 1JNUA 2HJEA 2ZOHA 4L9GA 3T4LA 5J7EA 1XFNA 3R4KA 4BBTA 3BWLA 3EEAA 2VGLM 2JHEA 4FSFA 1GSWA 1UGUA 5A8BA 4P6ZS 4Y3IA 4MN6A 2FZ0A 2VV8A 3FG8A 4NXFA 4I3IA 3VE3A 2M7VA 2HJ9C 5DJUA 4R6LA 5AVFA 3NOTC 1UWNX 3DBAA 4OOMA 4XT2A 2O99A 4GW9A 3UB8A 1N9OA 2VKSA 2W27A 3LFVA 1TS6A 2VEAA 1S1ZA 1YSPA 4Y5FA 1P9RA 3F1OA 2GNXA 4I3JA 2Z6CA 4GS9B 4ZRRA 2O9CA 4HJ6A 1T18A 3NHQA 3H82B 4ME4A 3MQ0A 1OT9A 2EWWA 3C30A 1D06A 2PYRA 4R38A 3NOUC 2JKRM 3CWFA 5DF9A 2V1AA 4I39A 1MC0A 5J3WA 4AFIA 2XROA 1S66L 5DKKA 4NKPA 4UEYA 3LI8A 3F1NB 3IBJA 2NUPC 2V0UA 4IJGA 3MQOA 4G3VA 5HZHA 2H28A 3UE6A 4FOFA 1S4RA 2OWJA 3MQQA 3SW1A 2J3TC 3H82A 4LRYC 4GHIB 2JKTM 2XA7M 2L0WA 1OTBA 1NRJA 4JGPA 1ZTUA 1S67L 3LR3A 2WKPA 4L9FA 4BWIA 2XA7S 1OJGA 5G4ZA 3ZQ5A 2LB5A 3UE3A 4DJ2A 2JKRI 1TF1A 5HD3A 2PR5A 4HH2A 4YWZA 4K08A 4L0LA 4PAUA 3KYZA 1XJ6A 1G6OA 1DRMA 2HGVA 4MN7A 3MFXA 1GSVA 2M7UA 2V0WA 3R7WB 5J4EA 2OWHA 2W0NA 4KUOA 1ZHHB 3H9WA 2PDRA 2INWA 3PYPA 1F9IA 2ZMVA 3O5YA 5HWTA 4B9OA 2XRNA 3LUQA 3D3OA 4M4XA 2PR6A 4KQOA 4GJ4A 3PHYA 1N9LA 4JGOA 2ZBBA 4MCWA 2W3FA 3PXPA 1YAXA 5HDSA 4XT2B 4RQ9A 1DP9A 3PBTA 2DMWA 4P6ZM 3LIDA 3R7WA 3E4OA 4WN5A 3KX0X 1MKMA 1W63Q 1ODVA 5KSHA 3LIEA 3F1OB 4HHDA 1OTIA 1NWZA 2XSSA 4HP4A 2MJ6A 3RH8B 3P01A 4EUVA 3KSIA 4CQHA 4G3KA 2K2NA 4IUHA 2OAQ1 2P7JA 2L1MA 4CLCB 3KSHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BYW A;  2L4R A;  1XFQ A;  4EET B;  1V9Y A;  4EEU A;  4R70 A;  2QWS A;  2KX6 A;  4EEP A;  2CMN A;  3EWK A;  3LI9 A;  3C2W A;  1LSV A;  2EA9 A;  4HI4 A;  1LSW A;  5HDC A;  3C8C A;  1VB6 A;  1OJ5 A;  1XJ2 A;  3A0S A;  4F3L A;  5DKL A;  2OOL A;  2V1B A;  3NOP C;  1DP8 A;  4LRZ E;  2M1C A;  3UB9 A;  4WL9 A;  1T1B A;  3EEH A;  5HDD A;  2GJ3 A;  1XJ4 A;  1N9N A;  1WA9 A;  4HH3 A;  3VE4 A;  1KOU A;  4H6J A;  4PKY A;  1Y28 A;  3CLO A;  3MJQ A;  3LIC A;  2PYP A;  3VOL A;  2A24 A;  3K3D A;  1LT0 A;  4L9E A;  3UB6 A;  5F69 A;  3CAX A;  1LL8 A;  2D01 A;  2ZOI A;  1LSX A;  1MZU A;  4EES A;  2PD8 A;  2QJ7 A;  3NJA A;  1OT6 A;  1TS7 A;  3ICY A;  4JGR A;  1TS8 A;  3K3C A;  4LLO B;  1S4S A;  1T1C A;  5TBM A;  2PD7 A;  2B02 A;  4LPZ A;  3RTY A;  4GCZ A;  3BY8 A;  3F1P A;  4BBV A;  1P97 A;  5HSQ A;  1OTD A;  3IBR A;  3P7N A;  4F3L B;  2QHK A;  3G6O A;  3UMD A;  4HQA A;  4PKY G;  2VLG A;  4WUJ A;  2QJ5 A;  2VV7 A;  4LRX C;  3LIA A;  3MXQ A;  3T50 A;  2QKP A;  3D72 A;  4EQ1 A;  2J80 A;  2R78 A;  3UME A;  5F68 A;  3ULF A;  4WF0 A;  4R3A A;  5EFW A;  5G4Y A;  2V9A A;  2JN7 A;  2WKR A;  5HD5 A;  4H6J B;  3BY9 A;  2K7S A;  2I9V A;  1OTE A;  2YKH A;  4NXG A;  3MR0 A;  4KQD A;  4NXE A;  3GDI A;  3LYX A;  2A24 B;  1DP6 A;  3UB7 A;  3LIF A;  5HWW A;  1F98 A;  4E04 A;  1D7E A;  5I5L A;  5IS1 A;  4EXO A;  2WKQ A;  1T19 A;  4HJ4 A;  2Z6D A;  1X0O A;  4GS9 A;  4I38 A;  5IU1 A;  5HWV A;  1GSX A;  4JGQ A;  5F6A A;  3E4P A;  4EER A;  2HV1 A;  5KIZ A;  4HOI A;  1EW0 A;  3HJK A;  1OTA A;  2KDK A;  4WLA A;  3IS2 B;  3OLO A;  1XJ3 A;  2D02 A;  5TBM B;  3H7W B;  3F1N A;  3B33 A;  3LIB A;  4HIA A;  4NXB A;  4DJ3 A;  3F1P B;  2YKF A;  1V9Z A;  4KUK A;  4HNB A;  4HP9 A;  4GHI A;  2BAS A;  3E4Q A;  4HY8 A;  4EW7 A;  1S1Y A;  2VV6 A;  1G28 A;  4BBU A;  5F5Y A;  3A0R A;  3IS2 A;  3GEC A;  1P0Z A;  4MN5 A;  3H7W A;  4I3A A;  1TS0 A;  1T1A A;  4HJ3 A;  3HJI A;  3A0V A;  1UWP X;  5AVE A;  2PHY A;  5DJT A;  4I5S A;  1JNU A;  2ZOH A;  5J7E A;  4L9G A;  1XFN A;  4BBT A;  3BWL A;  2JHE A;  1GSW A;  1UGU A;  5A8B A;  4MN6 A;  2VV8 A;  3FG8 A;  4NXF A;  4I3I A;  3VE3 A;  5DJU A;  4R6L A;  5AVF A;  3NOT C;  1UWN X;  4XT2 A;  4GW9 A;  3UB8 A;  1N9O A;  2W27 A;  1TS6 A;  2VEA A;  1S1Z A;  3F1O A;  4I3J A;  2Z6C A;  4GS9 B;  4HJ6 A;  1T18 A;  3NHQ A;  3H82 B;  1OT9 A;  1D06 A;  2PYR A;  4R38 A;  3NOU C;  3CWF A;  2V1A A;  4I39 A;  5J3W A;  1S66 L;  5DKK A;  3LI8 A;  3F1N B;  2V0U A;  3MQO A;  5HZH A;  2H28 A;  3UE6 A;  1S4R A;  2OWJ A;  3MQQ A;  3SW1 A;  4LRY C;  3H82 A;  4GHI B;  2L0W A;  1OTB A;  4JGP A;  1S67 L;  4L9F A;  2WKP A;  1OJG A;  5G4Z A;  3ZQ5 A;  4DJ2 A;  5HD3 A;  2PR5 A;  4HH2 A;  4YWZ A;  4K08 A;  1XJ6 A;  1DRM A;  3MFX A;  1GSV A;  2V0W A;  5J4E A;  2OWH A;  2W0N A;  4KUO A;  3H9W A;  2PDR A;  2INW A;  3PYP A;  1F9I A;  5HWT A;  4B9O A;  3LUQ A;  4M4X A;  2PR6 A;  3PHY A;  1N9L A;  4JGO A;  2ZBB A;  5HDS A;  4XT2 B;  4RQ9 A;  1DP9 A;  3LID A;  3E4O A;  4WN5 A;  3KX0 X;  1ODV A;  3LIE A;  3F1O B;  4HHD A;  1OTI A;  1NWZ A;  4HP4 A;  3RH8 B;  2P7J A;  2L1M A;  3FC7 A; 
#chains in the Genus database with same CATH topology
 1K25 A;  1MPL A;  3HLW A;  1XFQ A;  1YPR A;  3CPT B;  4P87 A;  2HP9 A;  1H3Q A;  2Z2L B;  3VV4 A;  2G2U A;  5KMW A;  3EWK A;  3LI9 A;  1XA7 A;  3C2W A;  1LSV A;  2EA9 A;  1FCN A;  3IF5 A;  3MKF A;  1LI9 A;  1VQQ A;  1MWR A;  1JVJ A;  4U0X A;  4CLC A;  3Q07 A;  2WYX A;  4CLC C;  3C8C A;  3KYQ A;  4UA7 A;  5EV0 A;  1YLW A;  3IX8 A;  4F3L A;  1CF0 A;  4C75 A;  2GX5 A;  3N7W A;  4E3N A;  4LFU A;  2V1B A;  4MDZ A;  1DP8 A;  3HUM A;  4LRZ E;  3IXD A;  5LBR A;  3V5M A;  3IWO A;  3GQZ A;  3KSG A;  2GZA A;  3ZG0 A;  3W2Z A;  3DAV A;  4UAA A;  3WRT A;  1WE4 A;  2VJW A;  4S2J A;  3N8S A;  2JE5 A;  2P9V B;  1BTL A;  2PT7 A;  5F1G A;  4H6J A;  5E2G A;  3MJQ A;  1XP4 A;  3UPO A;  3PBQ A;  5AJG A;  1VEU B;  4BJP A;  2BTF P;  2KLI A;  5DF7 A;  4WM9 A;  1D1J A;  2ZOI A;  4WZ5 A;  1LSX A;  4WZ5 C;  3E2K A;  2J8Y A;  2EXA A;  2PD8 A;  4ETX A;  3NJA A;  3ZG8 B;  3HRE A;  1OT6 A;  1TS7 A;  1PWC A;  3DTI A;  4LLO B;  3OBF A;  4BLM A;  2O9A A;  3IHA A;  1T1C A;  4FTX A;  5L8M A;  5TBM A;  2B02 A;  3T4T A;  2Y4A A;  2JBF A;  4LPZ A;  3T12 B;  4GCZ A;  3F1P A;  4BBV A;  3SS5 A;  4ESP A;  1A0K A;  3JPU A;  2WZX A;  2QHK A;  3G6O A;  4RYE A;  4C6Y A;  3S7N A;  4HQA A;  4PKY G;  4Y2F A;  2VV7 A;  1MY8 A;  1XPB A;  3WS5 A;  3CIT A;  1VET B;  5HAR A;  5A90 A;  3IWI A;  2ZMA A;  4YOF A;  1BUL A;  1FR6 A;  2BLS A;  3ULF A;  2O0Y A;  3C4P A;  2V20 A;  3LEQ A;  5KSC A;  1FQG A;  1L0D A;  3PBR A;  4KZ7 A;  3N4I A;  4YFM A;  2WKR A;  5HD5 A;  5EOE A;  1L0G A;  1W5D A;  4QD4 A;  1M40 A;  1U60 A;  3QNB A;  3GDI A;  3O86 A;  2R9W A;  4NET A;  4GKU A;  3UB7 A;  2WK0 A;  4Z1W A;  5AQ9 A;  2G2W A;  3UY6 A;  3LEZ A;  5CEC A;  2WKQ A;  4MBH A;  4HJ4 A;  4GS9 A;  4I38 A;  5HWV A;  4NG2 A;  1GHI A;  1GSX A;  2Y2G A;  5E2H A;  1PW8 A;  4GOG A;  3E4P A;  5TR7 A;  2HV1 A;  4HOI A;  1EW0 A;  4X1M A;  3OLO A;  3DWZ A;  1K38 A;  3KSF A;  4E6W A;  3LIB A;  1IEM A;  4DN0 A;  3CUE A;  5CHJ A;  3CUE C;  1SKO B;  3PR6 A;  4YIN A;  4HNB A;  4HP9 A;  4UHU A;  2FH5 A;  2BAS A;  1SZV A;  3E4Q A;  4DKI A;  4EW7 A;  4DF6 A;  4QJG A;  4Q0J A;  1SCW A;  2XGN A;  1YLP A;  5K5B A;  3A0R A;  3IS2 A;  5EVL A;  3SH9 A;  1QME A;  1RGZ A;  3CG5 A;  2OV5 A;  5GLD A;  4MN5 A;  3AGD A;  5HPI A;  1YLT A;  3C5A A;  5C5K A;  1L0F A;  3C38 A;  2GDN A;  1NLZ A;  2WUQ A;  4GD6 A;  3C7V A;  1TS0 A;  1T1A A;  5CX7 A;  4OLG A;  1ACF A;  1I2W A;  2PHY A;  1JNU A;  2HJE A;  4MBF A;  5A8B A;  5CTN A;  1NYM A;  2FZ0 A;  1IKI A;  4EWF A;  4NXF A;  2PRF A;  4JXG A;  5DJU A;  4R6L A;  4FH2 A;  4QY5 A;  3QP2 A;  5CER A;  4GN2 A;  3BFG A;  4OP8 A;  4OOM A;  4LCL A;  1IYP A;  1LL9 A;  3UB8 A;  2VKS A;  2VEA A;  3OPR A;  2B5R A;  3SOI A;  1GHM A;  5GHY A;  3F1O A;  2GNX A;  2ZL1 B;  4I3J A;  2O9C A;  3H82 B;  4ME4 A;  3C30 A;  1MWU A;  4R3J A;  1GA0 A;  3CWF A;  3VP2 A;  2Z2M B;  1K6S A;  3QP1 A;  5DF9 A;  2OLV A;  2V1A A;  2WAF A;  1MC0 A;  5FDH A;  5J3W A;  3ZVT A;  1S66 L;  1SHV A;  5FDS A;  5DKK A;  3G31 A;  3CPT A;  3IBJ A;  2NUP C;  2CC1 A;  5HAQ A;  4IJG A;  3ISG A;  5FI6 A;  5HZH A;  1FSY A;  2OWJ A;  4H8R A;  4D60 A;  4LRY C;  4GHI B;  3D9Y A;  2XA7 M;  5FAS A;  1OTB A;  4UA6 A;  4BD0 A;  1NRJ A;  5I94 A;  1S67 L;  4E3M A;  5CRF A;  2VGK A;  3D4F A;  4XUX A;  5G4Z A;  4JF4 A;  1ES3 A;  3CHW P;  3G30 A;  1OME A;  2PR5 A;  1KGF A;  4YWZ A;  1FIL A;  4BD1 A;  1ZKJ A;  1XJ6 A;  5FQI A;  1DRM A;  1H5X A;  3HVF A;  4WMC D;  3BFD A;  3MFX A;  3FZC A;  3E2L A;  1ZHH B;  1IEL A;  2PDR A;  3RXW A;  1O07 A;  3ZDJ A;  3O5Y A;  2XRN A;  1HTZ A;  4M4X A;  1S6R A;  4GJ4 A;  2ZBB A;  5FQQ A;  4K0W A;  1ERO A;  2JKF A;  4RQ9 A;  2WZZ A;  3UDF A;  3IXG A;  4LEN A;  5EEC A;  1W63 Q;  4X1L A;  1NWZ A;  4HP4 A;  4Q8I A;  3BYD A;  4N9K A;  1Y54 A;  3KSI A;  4CQH A;  1EWZ A;  1KE3 A;  4G3K A;  5TGF A;  5CGX A;  2OAQ 1;  1PW1 A;  5TFQ A;  1ES5 A;  2ZM0 A;  3QNC A;  3S1Y A;  1BYW A;  2L4R A;  2Y91 A;  4EET B;  2WKE A;  2NUT C;  5FAO A;  4R70 A;  2QWS A;  2K31 A;  4EEP A;  4EQI A;  1BLC A;  2VA0 A;  1PZO A;  1F5M A;  3AGE A;  1LSW A;  1JWV A;  3O3V A;  5HDC A;  2WKH A;  4JBF A;  3VFH A;  1CEF A;  1YLY A;  3P98 A;  1C3B A;  2WGW A;  3MFD A;  3A0S A;  2OOL A;  3BEC A;  1ERQ A;  1IOU A;  4WEL A;  5FQ9 A;  1G5U A;  2Y8H A;  4LV0 A;  4WL9 A;  2X02 A;  1PIO A;  1T1B A;  1VET A;  1KVL A;  3S7O A;  1TDL A;  4EBP A;  3A3I A;  5EVE A;  2UWX A;  3FWL A;  4DE2 A;  5F1F A;  5M19 A;  4HH3 A;  1OPX A;  1XKZ A;  5FQK A;  4IUK A;  3ZVW A;  1Y28 A;  5CGS A;  4JXV A;  5CHU A;  4OOY A;  4JLF A;  3LIC A;  5DFX A;  1LI0 A;  3T1X A;  2VK3 A;  3K3D A;  4L9E A;  5JYP A;  4R4R A;  1PYY A;  5GHZ A;  1SKF A;  1ALQ A;  4FCF A;  2D01 A;  4LGW A;  4DRT A;  1W63 M;  4R23 A;  4GD8 A;  4JXS A;  4GLQ A;  4IVI A;  4G3W A;  5G18 A;  3BLS A;  3OC2 A;  3UE0 A;  2PU2 A;  3ICY A;  4JGR A;  1TS8 A;  2VZW A;  2W3D A;  2E8I A;  3UB5 P;  2P74 A;  4MMN A;  4P85 A;  4EV4 A;  5FI7 A;  2PD7 A;  5HAP A;  4KQR A;  3DTE A;  3DTM A;  4ARZ B;  1H8M A;  2A2L A;  3ITB A;  1P97 A;  5IT5 A;  5EOO A;  3EQV A;  3NBL A;  1OTD A;  3TJZ C;  2W3E A;  2FFF B;  3W4P A;  4ZDX A;  1W7F A;  2VLG A;  3FV7 A;  1K56 D;  3LIA A;  4Q0I A;  4ZJ3 A;  4KZ9 A;  4X68 A;  5D3O A;  3TRC A;  2IWC A;  1DY6 A;  2QKP A;  2B18 A;  2HF6 A;  4LV3 A;  1ZG6 A;  2R78 A;  4X25 A;  1Q2P A;  3V39 A;  3T4K A;  1NZU A;  3T4S A;  1BLH A;  1K6R A;  2O9B A;  5EFW A;  4WMC A;  5G4Y A;  4DXC A;  2JN7 A;  3LR4 A;  5EUA A;  1BT5 A;  4IBR A;  3GMW A;  2I9V A;  1FIK A;  4KQD A;  1I2S A;  2A24 B;  4FD8 A;  3PBO A;  4KEN B;  2V2F F;  3V3R A;  3GVB A;  1TDG A;  4PM8 A;  5HWW A;  4OPR A;  1CJF A;  3BQ8 A;  1P9W A;  2EX8 A;  3K2N A;  4EXO A;  1K4E A;  3BRM A;  2Z6D A;  2C5W B;  2XF3 A;  1CK3 A;  5EVI D;  4JGQ A;  1VM1 A;  5F6A A;  4KZ3 A;  4Y0O A;  1H8Y A;  5TJJ A;  3A3D A;  4O0P A;  2PU4 A;  3IT9 A;  4ZTK A;  3H7W B;  1FCM A;  3BW6 A;  3B33 A;  4EU0 A;  2DRW A;  2IA2 A;  2LB9 A;  2HDS A;  3B3X A;  3Q7Z A;  3ZCZ A;  3UN7 A;  3WS4 A;  1PFL A;  3NIA A;  4GHI A;  4QPR A;  4OKP A;  4ID4 A;  4WEK A;  1S1Y A;  4P6B A;  1G28 A;  3W4Q A;  2J7V A;  5GHX A;  3GTC A;  5F5Y A;  4KG2 A;  5HL6 A;  2XLN A;  4QY6 A;  4HBU A;  2OLU A;  4B4X A;  4F94 A;  2FFY A;  1FCO A;  4X55 A;  4I3A A;  5DTS A;  3FYZ A;  3ZG9 B;  3HJI A;  1PZP A;  3EGD C;  1UWP X;  5CTM A;  3NDG A;  4I5S A;  1W79 A;  3T4L A;  5J7E A;  4L9G A;  1XFN A;  5CGW A;  3EEA A;  2JHE A;  1GSW A;  4O7D A;  1IKG A;  3G2Y A;  4ZBE A;  2ZLY A;  3SS3 A;  3HUN A;  4I3I A;  3VE3 A;  3OPL A;  3PAE A;  4DE3 A;  2H10 A;  1IYS A;  3NOT C;  5FAT A;  3DBA A;  4OPZ A;  4GW9 A;  2Y2K A;  4JF6 A;  3ZNY A;  3U4L P;  1S1Z A;  1YSP A;  1NY0 A;  4R3B A;  1PRQ A;  4R4S A;  1NZO A;  2Z6C A;  4S2L A;  5J8X A;  2EWW A;  2PYR A;  3NOU C;  3WS1 A;  2JKR M;  1SDE A;  3BFF A;  3VSL A;  2ZQ7 A;  4PM7 A;  4OQG A;  2IWB A;  2WGV A;  5FEF A;  2Y2P A;  2ZC7 A;  3BEB A;  3N8R A;  3LI8 A;  3MKE A;  2V0U A;  3UE6 A;  2H5S A;  3SW1 A;  2JKG A;  1YT4 A;  4OQI A;  3BFE A;  4XXR A;  4JGP A;  2J9P A;  2Q9N A;  2XA7 S;  1OJG A;  3ZQ5 A;  5EE8 A;  3UE3 A;  4DJ2 A;  5HD3 A;  3OZH A;  3HLG A;  2QPN A;  4K08 A;  4L0L A;  3KYZ A;  1Y4O A;  1K56 A;  1G6O A;  2HGV A;  5FSR A;  1TEM A;  3VSK A;  3AGF A;  2J9O A;  4OON A;  2M7U A;  5J4E A;  2OWH A;  2W0N A;  4KUO A;  2RCX A;  3HLE A;  3GR2 A;  2ZMV A;  4X53 A;  3NI9 A;  3Q7V B;  3PHY A;  4EUZ A;  4MCW A;  2W3F A;  5AQA A;  4XT2 B;  3LID A;  4XUZ A;  3R7W A;  3KX0 X;  1ODV A;  1K4F A;  3UPN A;  2XSS A;  4WBG A;  2MJ6 A;  4Y17 A;  3HUO A;  4EUV A;  3UE1 A;  3L7H A;  3O88 A;  3OPP A;  2K2N A;  4IUH A;  2L1M A;  4CLC B;  3MBZ A;  1KGE A;  4Y0U A;  1L2S A;  4BL3 A;  5EVI A;  1V9Y A;  2ZMF A;  5EVI C;  4IED A;  3T4O A;  1LLB A;  4JPM A;  3MS6 A;  3BFC A;  3VOZ A;  5HPF A;  3LR5 A;  4E3O A;  1G68 A;  1TD5 A;  3IX3 A;  4S2I A;  5DKL A;  1BZA A;  3TG9 A;  5GLC A;  2Y2O A;  5FA7 A;  3NOP C;  3KYE A;  2W3G A;  4O8G A;  3UNW A;  3TW8 A;  1BUE A;  2Q9M A;  4NEE D;  3G32 A;  5GLA A;  1XJ4 A;  2GJ3 A;  4MNR A;  3BJN A;  2XEP A;  3T4J A;  3MZF A;  1YLZ A;  3VE4 A;  1CI8 A;  3SZT A;  2V8F A;  1RGY A;  4KZ6 A;  4UQI M;  4X56 A;  1KOU A;  3CI6 A;  4PKY A;  4DMZ A;  5L09 A;  4Z9Q A;  4Q0H A;  1GA9 A;  2PYP A;  4OVD A;  3LGO A;  1DJB A;  2A24 A;  1LT0 A;  2XD1 A;  5F82 A;  3MXR A;  3UB6 A;  1NXY A;  4II7 A;  1I5Q A;  1PWD A;  5F69 A;  1SDN A;  4KQQ A;  4YNR A;  2P9V A;  2JKT I;  2QYB A;  4X69 A;  2JCH A;  3TOI A;  4EES A;  2QJ7 A;  2W3H A;  1XGJ A;  5FAQ A;  5CHM A;  2J3T D;  4PM5 A;  5HL1 A;  1S4S A;  1VEU A;  2Y79 A;  5GLB A;  3B47 A;  4B4Z A;  2V8C A;  4D2O A;  4QB8 A;  5A91 A;  3T1R A;  1J9M A;  1K54 A;  5HSQ A;  1K54 C;  3LR0 A;  4QWO A;  1O7E A;  3GV9 A;  2WKI A;  3A3E A;  4GZB A;  4MEZ A;  4BMW A;  2ZQ9 A;  4OOL A;  2QJ5 A;  2P04 A;  1E3U D;  5JYO A;  3MXQ A;  3S4X A;  1S0W A;  5CED A;  3D72 A;  4EQ1 A;  2ZC3 B;  2J80 A;  3E98 A;  3HL9 A;  2ACG A;  5HFO A;  5EPH A;  4GB7 A;  1K55 A;  4QU3 A;  3UPP A;  1K55 C;  4WZ4 A;  1NLY A;  4WF0 A;  4R3A A;  3G2Z A;  4N1X A;  4CLC E;  4P0M A;  4EBN A;  1YM1 A;  4UA9 A;  4RX2 A;  2K7S A;  1VHM A;  1K57 A;  1OTE A;  3W8K A;  1K57 C;  3MR0 A;  2P08 A;  3UO9 A;  2A49 A;  1YQS A;  3LYX A;  2HDU A;  4PHT A;  1DP6 A;  1G6A A;  1DJA A;  3U2A A;  4E3J A;  4QHC A;  1F98 A;  4K91 A;  3TSG A;  4E04 A;  4U3T A;  5I5L A;  5BOH A;  1ZC2 A;  5IS1 A;  3PAG A;  4OPY A;  1T19 A;  1X0O A;  2ZQC A;  1GHP A;  2KOI A;  4IHQ A;  4EER A;  5KIZ A;  3TE8 A;  1LHY A;  4DE0 A;  2KDK A;  5L10 A;  4WLA A;  3IS2 B;  3BM6 A;  3EOI A;  1WYC A;  4OP5 A;  2OSU A;  4S2M A;  4ETZ A;  5U47 A;  4NXB A;  2YKF A;  5E2E A;  2W1T B;  3OOV A;  1NYY A;  4FUW A;  5MC7 A;  3IH8 A;  3IF6 B;  4HY8 A;  2VV6 A;  4BBU A;  1P0Z A;  3WS0 A;  1BLP A;  4JKT A;  3VP0 A;  2UV0 E;  2Y2H A;  5DF8 A;  1SKO A;  3A0V A;  2HDR A;  2PAV P;  3C4O A;  5E2F A;  2ZOH A;  4DXB A;  4OLD A;  2Y59 A;  3BWL A;  3NCK A;  4KG6 A;  2C6W B;  1GCE A;  4P6Z S;  3N6I A;  4Y3I A;  1JWP A;  3IQA A;  3T1S A;  3GRJ A;  4ZJ1 A;  3Q7V A;  3N8L A;  4PM6 A;  2HJ9 C;  2H0T A;  4K0X A;  1BLS A;  4XT2 A;  2WGI A;  2W27 A;  1TS6 A;  3GSG A;  3HLD A;  1P9R A;  3V3S A;  5HW3 A;  4OPQ A;  4R1G A;  1HZO A;  1XA1 A;  1OT9 A;  5GL9 A;  2EX9 A;  5F83 A;  3NDE A;  2E8J A;  3T1Q B;  4I39 A;  1KE4 A;  4AFI A;  2Y2J A;  1DJC A;  2XRO A;  3HLB A;  4NKP A;  3F1N B;  1N9B A;  3QP8 A;  4G3V A;  3VOY A;  1K0K A;  5EM1 A;  4FOF A;  2ZL1 A;  4C3Q A;  1S4R A;  2I72 A;  2J3T C;  3H82 A;  2ZD8 A;  2JKT M;  3ZHH A;  4GDN A;  3ZGA B;  1YLJ A;  4N1H A;  5AQ7 A;  1ZTU A;  4L9F A;  3LR3 A;  2WKP A;  3SS4 A;  2LB5 A;  3DWK A;  1CEG A;  4BL2 A;  2IWD A;  4HH2 A;  5DVA A;  3VP4 A;  2EFX A;  1NRF A;  1E3U A;  2ZC5 B;  3JYI A;  1E4D A;  3VFF A;  3H9W A;  2INW A;  3PYP A;  1WYB A;  5HWT A;  3ZNT A;  1YMS A;  1HD8 A;  3D3O A;  3M2J A;  2PR6 A;  4Y0T A;  4KQO A;  3A3J A;  4LCM A;  1PI4 A;  4OH0 A;  4BQM A;  4JF5 A;  3PXP A;  1YAX A;  5FAP A;  4X6T A;  5AQB A;  3PBT A;  5L2F A;  3LCE A;  4P6Z M;  1QMF A;  3UDX A;  1IYQ A;  3MSH A;  3E4O A;  1MKM A;  3Q81 A;  2PBY A;  1BSG A;  1ES2 A;  1OTI A;  4PM9 A;  1TVF A;  4GNU A;  3RH8 B;  3CMZ A;  3P01 A;  3LY4 A;  3WS2 A;  5FEG A;  3ZG7 B;  3IH9 A;  3KSH A;  3IXB A;  2WGW B;  4S2P A;  1MKI A;  4EEU A;  2EXB A;  3B42 A;  4E6X A;  3C7U A;  4N92 A;  3E0Y A;  5E43 A;  2KX6 A;  2XH9 A;  2CMN A;  4Y7P A;  3WRZ A;  4CJN A;  2EWV A;  2QMI A;  2EFU A;  3NC8 A;  3S7P A;  1RP5 A;  2HP5 A;  1MWT A;  3S7Q A;  4HI4 A;  3L9K A;  4CPK A;  2DNS A;  1PWG A;  4Y13 A;  2W1R A;  5CXW A;  1VB6 A;  2ZM2 A;  4LV1 A;  1JWZ A;  1OJ5 A;  1XJ2 A;  3PBS A;  3UDI A;  1L3L A;  3ITA A;  2ZC6 B;  1J3W A;  4BEN A;  2M1C A;  2WAE A;  3UB9 A;  3Q1F A;  5FQM A;  4S2K A;  4RA7 A;  5A92 A;  3RXX A;  3FPW A;  2XFT A;  4FH4 A;  2Y2N A;  3EEH A;  5HDD A;  2XFS A;  3SH8 A;  1KE0 A;  2XK1 A;  1N9N A;  1WA9 A;  3M6B A;  3NEC A;  4PPR A;  4IVK A;  3ZYT A;  5M18 A;  4A5R A;  3PBN A;  3BLM A;  1CQA A;  3KO6 A;  4IBX A;  2EX6 A;  4KG5 A;  2RL3 A;  3CLO A;  2WAD A;  5FI2 A;  4UQI S;  1N4O A;  3MXS A;  3VOL A;  3DTK A;  5DFY A;  3PTE A;  4HEF A;  1MXO A;  2DCF A;  1YKD A;  4HBT A;  3EQU A;  5HX9 A;  3CAX A;  1LL8 A;  4KZB A;  3HCY A;  1XGI A;  3Q82 A;  1MZU A;  3LY3 A;  4DE1 A;  1FOF A;  2HP6 A;  3OCL A;  4B93 A;  2ZC4 B;  2HDQ A;  5FQJ A;  1Z09 A;  3K3C A;  2VX8 A;  1F2K A;  3NUL A;  1CI9 A;  2XDM A;  3VMA A;  3RTY A;  3BY8 A;  5DTT A;  3OCN A;  2W1T A;  2ZQA A;  2ZQ8 A;  3IF6 A;  3IF6 C;  1MWS A;  1NJ4 A;  3IBR A;  3P7N A;  5KZH A;  4F3L B;  3BQA A;  1PI5 A;  3UMD A;  4WUJ A;  5FL3 A;  4LRX C;  1H8Z A;  1HLU P;  3T4Q A;  2VGL S;  5A93 A;  4KZ8 A;  3P09 A;  3T50 A;  3MZE A;  1IFQ A;  3O87 A;  4ARZ A;  1KGG A;  3UME A;  2Y55 A;  3EGX C;  5F68 A;  2Y2L A;  3RFB A;  2V9A A;  3RJU A;  2AVX A;  4EBL A;  4H6J B;  3BY9 A;  1YSQ A;  2YKH A;  4NXG A;  3JVV A;  5IHV A;  1RCJ A;  1STZ A;  4NXE A;  2VGJ A;  3VP3 A;  3HLC A;  3MMH A;  2R9X A;  3OPH A;  3LIF A;  3FPV A;  2XD5 A;  3QP6 A;  1D7E A;  2EX2 A;  2B95 A;  5M1A A;  4RVA A;  5IU1 A;  2J3W A;  3V67 A;  3FKV A;  2Y2I A;  3MF0 A;  5DTK A;  4O01 A;  3HJK A;  5EM0 A;  1OTA A;  4KZ5 A;  4NK3 A;  4OQ0 A;  1XJ3 A;  4E3K A;  2D02 A;  3I7J A;  2ZM8 A;  5TBM B;  4DDY A;  3F1N A;  4JXW A;  1YMX A;  4HIA A;  1AXB A;  2OAP 1;  1MBL A;  4DJ3 A;  4ZAM A;  3F1P B;  4CLC D;  2Y2Q A;  2ZQD A;  3W4O A;  1LL5 A;  1V9Z A;  4KUK A;  4OQH A;  1KVM A;  4S2N A;  3HBR A;  1KDS A;  4S2N C;  2Q0O A;  3M2K A;  3CJM A;  4B88 A;  1ZG4 A;  4E3L A;  3QHY A;  3GEC A;  4WEJ A;  3JVU A;  2X01 A;  2G7U A;  3H7W A;  3IHB A;  2HZ5 A;  1HVB A;  4S2O A;  4HJ3 A;  1FR1 A;  2XQZ A;  5AVE A;  4M3K A;  1ONG A;  2HPB A;  3A3F A;  5DJT A;  3WWX A;  3R4K A;  4BBT A;  4HES A;  2VGL M;  4GDB A;  4FSF A;  2V1Z A;  4ZJ2 A;  1UGU A;  1IYO A;  4MN6 A;  2VV8 A;  1JTD A;  4KZA A;  3FG8 A;  2M7V A;  3IX4 A;  5AVF A;  2ZJ9 A;  1AWI A;  1UWN X;  1ESU A;  3DW0 A;  2O99 A;  1N9O A;  3LFV A;  4N9L A;  3MZD A;  4PMA A;  4Y5F A;  4DDS A;  2XR0 A;  4RX3 A;  4GS9 B;  4LV2 A;  4ZRR A;  4HJ6 A;  1T18 A;  3NHQ A;  5L07 A;  3MQ0 A;  1W8Q A;  1M6K A;  2Y2M A;  1D06 A;  4R38 A;  3S22 A;  2QZ6 A;  4MLL A;  3IXH A;  3IWQ A;  3G35 A;  4UEY A;  4U0T A;  4E3I A;  3MQO A;  2H28 A;  1W8Y A;  2X71 A;  3MQQ A;  3CZD A;  1ONH A;  3V50 A;  2L0W A;  1EI5 A;  2JC7 A;  3LO7 A;  3VP1 A;  1E25 A;  4BWI A;  1JTG A;  3QP5 A;  1PNE A;  2BG1 A;  1ES4 A;  3QP4 A;  3NY4 A;  2JKR I;  1TF1 A;  1XX2 A;  3HLF A;  4PAU A;  4MBK A;  4MN7 A;  1L0E A;  3M6H A;  1GSV A;  3R7W B;  2H0Y A;  2V0W A;  1XXM A;  3SH7 A;  4Y15 A;  1F9I A;  4KZ4 A;  3G34 A;  1FSW A;  4B9O A;  3LUQ A;  1N9L A;  4JGO A;  3ZG5 A;  2PBD P;  5CEB A;  1KDW A;  1ERM A;  1Z6F A;  5HAI A;  5HDS A;  5EVI B;  1DP9 A;  2DMW A;  1H0M A;  4WN5 A;  5KSH A;  4WYY A;  3LIE A;  3F1O B;  4HHD A;  1Q2Q A;  2A3U A;  1ESI A;  3ZFZ A;  3G4P A;  2P7J A;  4R0Q A;  3FKW A;  3FC7 A; 
#chains in the Genus database with same CATH homology
 1BYW A;  2L4R A;  1XFQ A;  4EET B;  1V9Y A;  2ZMF A;  4EEU A;  2NUT C;  3B42 A;  4R70 A;  2QWS A;  3E0Y A;  3T4O A;  2KX6 A;  1H3Q A;  3VV4 A;  2K31 A;  4EEP A;  2CMN A;  3EWK A;  3LI9 A;  2EWV A;  2VA0 A;  3C2W A;  1LSV A;  2EA9 A;  3S7P A;  1F5M A;  3S7Q A;  4HI4 A;  1LSW A;  5HDC A;  4CLC A;  5HPF A;  3LR5 A;  4CLC C;  3C8C A;  2W1R A;  3KYQ A;  1TD5 A;  1VB6 A;  1OJ5 A;  1XJ2 A;  3A0S A;  4F3L A;  5DKL A;  2OOL A;  2GX5 A;  3PBS A;  1IOU A;  4WEL A;  2V1B A;  4MDZ A;  3NOP C;  1DP8 A;  2W3G A;  2Y8H A;  4LRZ E;  2M1C A;  4O8G A;  3UB9 A;  4WL9 A;  5LBR A;  1T1B A;  3TW8 A;  3KSG A;  3S7O A;  4NEE D;  2GZA A;  3FPW A;  3EEH A;  5HDD A;  1XJ4 A;  2GJ3 A;  3W2Z A;  3BJN A;  3T4J A;  1N9N A;  1WA9 A;  4HH3 A;  1OPX A;  2VJW A;  3VE4 A;  3ZYT A;  4IUK A;  3PBN A;  3KO6 A;  4UQI M;  2PT7 A;  1KOU A;  3CI6 A;  4H6J A;  4PKY A;  4DMZ A;  1Y28 A;  4Q0H A;  3CLO A;  3MJQ A;  3LIC A;  2PYP A;  4UQI S;  5DFX A;  3VOL A;  5DFY A;  2A24 A;  3K3D A;  1LT0 A;  3PBQ A;  4L9E A;  5AJG A;  1YKD A;  3EQU A;  3UB6 A;  4II7 A;  5F69 A;  4BJP A;  2KLI A;  3CAX A;  1LL8 A;  2D01 A;  4YNR A;  3HCY A;  2ZOI A;  2JKT I;  1LSX A;  1W63 M;  2QYB A;  1MZU A;  4EES A;  2PD8 A;  3OCL A;  2QJ7 A;  4GLQ A;  4G3W A;  4ETX A;  3NJA A;  2W3H A;  3OC2 A;  4B93 A;  1OT6 A;  1TS7 A;  3ICY A;  4JGR A;  1TS8 A;  2VZW A;  2W3D A;  3K3C A;  4LLO B;  2VX8 A;  3OBF A;  2J3T D;  4MMN A;  2O9A A;  1S4S A;  1T1C A;  5L8M A;  2Y79 A;  5TBM A;  3B47 A;  2PD7 A;  2B02 A;  3T4T A;  4LPZ A;  3RTY A;  4GCZ A;  3BY8 A;  3F1P A;  4BBV A;  4ARZ B;  1H8M A;  2A2L A;  3OCN A;  2W1T A;  1P97 A;  5IT5 A;  3EQV A;  5HSQ A;  1OTD A;  3TJZ C;  3LR0 A;  3IBR A;  3P7N A;  2W3E A;  4F3L B;  2QHK A;  3BQA A;  3G6O A;  4BMW A;  3UMD A;  3S7N A;  4HQA A;  4PKY G;  2VLG A;  4OOL A;  4WUJ A;  4Y2F A;  2QJ5 A;  5FL3 A;  2VV7 A;  4LRX C;  3LIA A;  2P04 A;  4Q0I A;  3T4Q A;  2VGL S;  3MXQ A;  3TRC A;  3CIT A;  3T50 A;  2QKP A;  2B18 A;  2HF6 A;  3D72 A;  4EQ1 A;  1IFQ A;  2J80 A;  3E98 A;  4YOF A;  4ARZ A;  2R78 A;  3UME A;  3EGX C;  5F68 A;  3RFB A;  3T4K A;  3T4S A;  3ULF A;  2O0Y A;  2O9B A;  1NLY A;  4WF0 A;  4R3A A;  5EFW A;  5G4Y A;  3PBR A;  4CLC E;  2V9A A;  2JN7 A;  3LR4 A;  2WKR A;  5HD5 A;  4H6J B;  3BY9 A;  2K7S A;  1VHM A;  2I9V A;  1OTE A;  1YSQ A;  2YKH A;  4NXG A;  3JVV A;  3MR0 A;  2P08 A;  4KQD A;  1STZ A;  4NXE A;  3GDI A;  3LYX A;  2A24 B;  3MMH A;  3PBO A;  4PHT A;  1DP6 A;  3UB7 A;  3U2A A;  3LIF A;  3FPV A;  4Z1W A;  5HWW A;  1F98 A;  4E04 A;  1D7E A;  5I5L A;  3BQ8 A;  5IS1 A;  1P9W A;  3K2N A;  4EXO A;  2WKQ A;  1T19 A;  4HJ4 A;  2Z6D A;  1X0O A;  4GS9 A;  4I38 A;  5IU1 A;  2J3W A;  5HWV A;  3V67 A;  1GSX A;  2KOI A;  4JGQ A;  5F6A A;  3E4P A;  4IHQ A;  4EER A;  3MF0 A;  2HV1 A;  5KIZ A;  5TJJ A;  3TE8 A;  4HOI A;  1EW0 A;  3HJK A;  4O01 A;  4O0P A;  1OTA A;  2KDK A;  4WLA A;  3IS2 B;  3OLO A;  1XJ3 A;  3EOI A;  2D02 A;  4ETZ A;  3KSF A;  5TBM B;  3H7W B;  3F1N A;  3BW6 A;  3B33 A;  4EU0 A;  2IA2 A;  2LB9 A;  3LIB A;  4HIA A;  4DN0 A;  2OAP 1;  3CUE A;  4NXB A;  4DJ3 A;  3CUE C;  2YKF A;  3F1P B;  4CLC D;  2W1T B;  3PR6 A;  1V9Z A;  3OOV A;  4KUK A;  4HNB A;  4HP9 A;  5MC7 A;  4GHI A;  2FH5 A;  2BAS A;  3E4Q A;  4HY8 A;  4QPR A;  4EW7 A;  4WEK A;  1S1Y A;  2VV6 A;  4Q0J A;  1G28 A;  4BBU A;  5F5Y A;  5HL6 A;  5K5B A;  3A0R A;  3IS2 A;  3GEC A;  1P0Z A;  4MN5 A;  4WEJ A;  3JVU A;  5HPI A;  2G7U A;  3H7W A;  5C5K A;  4I3A A;  3C38 A;  1NLZ A;  1TS0 A;  1T1A A;  4HJ3 A;  5CX7 A;  3HJI A;  3A0V A;  3FC7 A;  3EGD C;  1UWP X;  5AVE A;  2PHY A;  4I5S A;  5DJT A;  1JNU A;  2HJE A;  2ZOH A;  4L9G A;  3T4L A;  5J7E A;  1XFN A;  3R4K A;  4BBT A;  3BWL A;  3EEA A;  2VGL M;  2JHE A;  4FSF A;  1GSW A;  1UGU A;  5A8B A;  4P6Z S;  4Y3I A;  4MN6 A;  2FZ0 A;  2VV8 A;  3FG8 A;  4NXF A;  4I3I A;  3VE3 A;  2M7V A;  2HJ9 C;  5DJU A;  4R6L A;  5AVF A;  3NOT C;  1UWN X;  3DBA A;  4OOM A;  4XT2 A;  2O99 A;  4GW9 A;  3UB8 A;  1N9O A;  2VKS A;  2W27 A;  3LFV A;  1TS6 A;  2VEA A;  1S1Z A;  1YSP A;  4Y5F A;  1P9R A;  3F1O A;  2GNX A;  4I3J A;  2Z6C A;  4GS9 B;  4ZRR A;  2O9C A;  4HJ6 A;  1T18 A;  3NHQ A;  3H82 B;  4ME4 A;  3MQ0 A;  1OT9 A;  2EWW A;  3C30 A;  1D06 A;  2PYR A;  4R38 A;  3NOU C;  2JKR M;  3CWF A;  5DF9 A;  2V1A A;  4I39 A;  1MC0 A;  5J3W A;  4AFI A;  2XRO A;  1S66 L;  5DKK A;  4NKP A;  4UEY A;  3LI8 A;  3F1N B;  3IBJ A;  2NUP C;  2V0U A;  4IJG A;  3MQO A;  4G3V A;  5HZH A;  2H28 A;  3UE6 A;  4FOF A;  1S4R A;  2OWJ A;  3MQQ A;  3SW1 A;  2J3T C;  3H82 A;  4LRY C;  4GHI B;  2JKT M;  2XA7 M;  2L0W A;  1OTB A;  1NRJ A;  4JGP A;  1ZTU A;  1S67 L;  3LR3 A;  2WKP A;  4L9F A;  4BWI A;  2XA7 S;  1OJG A;  5G4Z A;  3ZQ5 A;  2LB5 A;  3UE3 A;  4DJ2 A;  2JKR I;  1TF1 A;  5HD3 A;  2PR5 A;  4HH2 A;  4YWZ A;  4K08 A;  4L0L A;  4PAU A;  3KYZ A;  1XJ6 A;  1G6O A;  1DRM A;  2HGV A;  4MN7 A;  3MFX A;  1GSV A;  2M7U A;  2V0W A;  3R7W B;  5J4E A;  2OWH A;  2W0N A;  4KUO A;  1ZHH B;  3H9W A;  2PDR A;  2INW A;  3PYP A;  1F9I A;  2ZMV A;  3O5Y A;  5HWT A;  4B9O A;  2XRN A;  3LUQ A;  3D3O A;  4M4X A;  2PR6 A;  4KQO A;  4GJ4 A;  3PHY A;  1N9L A;  4JGO A;  2ZBB A;  4MCW A;  2W3F A;  3PXP A;  1YAX A;  5HDS A;  4XT2 B;  4RQ9 A;  1DP9 A;  3PBT A;  2DMW A;  4P6Z M;  3LID A;  3R7W A;  3E4O A;  4WN5 A;  3KX0 X;  1MKM A;  1W63 Q;  1ODV A;  5KSH A;  3LIE A;  3F1O B;  4HHD A;  1OTI A;  1NWZ A;  2XSS A;  4HP4 A;  2MJ6 A;  3RH8 B;  3P01 A;  4EUV A;  3KSI A;  4CQH A;  4G3K A;  2K2N A;  4IUH A;  2OAQ 1;  2P7J A;  2L1M A;  4CLC B;  3KSH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...