3V5MA

Crystal structure of m69v mutant of shv beta-lactamase
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
265
structure length
265
Chain Sequence
SPQPLEQIKLSESQLSGRVGMIEMDLASGRTLTAWRADERFPMVSTFKVVLCGAVLARVDAGDEQLERKIHYRQQDLVDYSPVSEKHLADGMTVGELCAAAITMSDNSAANLLLATVGGPAGLTAFLRQIGDNVTRLDRWETELNEALPGDARDTTTPASMAATLRKLLTSQRLSARSQRQLLQWMVDDRVAGPLIRSVLPAGWFIADKTGAGERGARGIVALLGPNNKAERIVVIYLRDTPASMAERNQQIAGIGAALIEHWQR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Beta-lactamase
publication title The importance of the trans-enamine intermediate as a beta-lactamase inhibition strategy probed in inhibitor-resistant SHV beta-lactamase variants.
pubmed doi rcsb
source organism Klebsiella pneumoniae
total genus 96
structure length 265
sequence length 265
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2011-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 3v5mA00
4IBXA 3A3EA 5KZHA 5EOOA 2Y2HA 1DJAA 2Y2PA 1DJBA 5FAPA 2WAEA 4OONA 5CHMA 3M6BA 1RCJA 4X55A 3BFEA 5CEDA 3V39A 3MXRA 5M18A 3Q81A 5DTKA 3HLCA 3FKWA 5FQKA 4YINA 3RJUA 2ZM8A 2HDRA 4XUZA 4XUXA 4JBFA 4LV3A 4KG5A 4Z9QA 1ES2A 5HAPA 1PI5A 3ZHHA 3GVBA 5EVIC 4MBFA 1ERQA 4QU3A 3HL9A 3NDEA 3ZCZA 1S6RA 2ZC3B 2Y2LA 2ZJ9A 5AQAA 5HARA 4WMCA 2R9WA 2ZC7A 3FKVA 3UO9A 1ES5A 1XX2A 1GA0A 2WK0A 2ZQ8A 3TSGA 1BSGA 4B4ZA 3GRJA 3SH8A 2Y2MA 1GHMA 5DTSA 4PPRA 3ITAA 5CXWA 2QPNA 3RXWA 3S4XA 4GN2A 1BLCA 4GNUA 4S2NA 4PMAA 1L0EA 1VM1A 2OLUA 3DWKA 3HREA 2EX9A 1Q2PA 3SS3A 2ZC4B 2QZ6A 5GLDA 4LCLA 5EVLA 4BLMA 3IWIA 1MBLA 5M1AA 3BFFA 4P0MA 1BLHA 5E2EA 5EOEA 3ZVWA 1YLZA 3O87A 3IXBA 3PBRA 3WS5A 5AQBA 1E4DA 3O3VA 4WM9A 4BJPA 4OOMA 4OOLA 1G68A 1MWSA 2JBFA 5FQJA 5GLCA 1ZKJA 4R4RA 4KZ6A 4K91A 4BL3A 5I94A 1EROA 2EX2A 3UE1A 1NZUA 2HPBA 2I72A 4B88A 5EUAA 2EFUA 4CJNA 1FR6A 3G2YA 5E2GA 1K57A 3HLDA 2WZZA 1PWGA 1K56D 1MWRA 4KZAA 4OKPA 3QHYA 3DWZA 1H8ZA 5U47A 5FQMA 4X69A 5L2FA 1WYCA 2XDMA 4OP5A 4Y7PA 3HLFA 3B3XA 2ZM0A 4LCMA 4P6BA 3IHBA 4MLLA 3UDIA 3UY6A 4GKUA 1DJCA 3G34A 1K54C 4JXWA 3VOYA 4UAAA 3LY3A 2BG1A 4KZ9A 3S1YA 2V2FF 4X53A 4FD8A 4EBPA 2BLSA 1IKGA 1Y54A 3N6IA 3GV9A 1L0FA 1ERMA 2A49A 2H10A 2V20A 3Q7VA 4UA6A 4OPZA 2ZMAA 1VQQA 3SS5A 1E25A 4UA9A 1YLTA 1ESUA 1WE4A 3LCEA 2RCXA 1K25A 5CRFA 4M3KA 4FH4A 3OCLA 3UNWA 4H8RA 2XD1A 4JXVA 1O7EA 1PZOA 3M2JA 4Y0UA 2ZQDA 5FQIA 4BD0A 1KGEA 3IXDA 2EXAA 1IYPA 3C4OA 3HLBA 3Q82A 4R0QA 3ISGA 2WGVA 4S2LA 1NY0A 4ZDXA 3IF6A 4R3BA 4WEJA 4WZ5A 2PU4A 1O07A 3IF5A 3BFDA 1K38A 3VSLA 3VP1A 1LL5A 1QMEA 1FCNA 4X6TA 4UA7A 4E3MA 3M2KA 3PBQA 2ZLYA 3EQUA 3CMZA 4OPQA 1ALQA 3BFGA 3IXHA 3UE3A 1HD8A 3A3FA 5E43A 1K6SA 2PBYA 3TOIA 4QB8A 4KZ3A 3ZGAB 3PBTA 1PZPA 3CZDA 2Q9NA 1RGYA 3FV7A 5CTNA 2IWCA 1Z6FA 2Z2MB 1JWPA 2Y91A 2EX8A 4R1GA 3ZDJA 3C7UA 1EI5A 4KZBA 3ZNTA 2WKHA 2XK1A 4MBKA 1XGJA 2ZC6B 5A92A 3AGEA 5DTTA 1BLSA 3PBNA 3M6HA 5EECA 3Q7VB 1RP5A 3QNBA 5FI7A 1FSWA 1BT5A 4JXGA 1XPBA 2Y55A 3HUMA 1CK3A 3W4OA 3DW0A 1IKIA 5FI6A 1FSYA 4JF5A 4OQIA 3PBOA 3ZG5A 1E3UD 1G6AA 1KE4A 2HDSA 5AQ7A 1FOFA 1PW8A 5FAQA 2XF3A 3N4IA 1PWDA 4X56A 3OPLA 1YLYA 3IF6B 1YLJA 3PAEA 4XXRA 1BTLA 5HFOA 3BLSA 3FWLA 4OQHA 5HAIA 4D2OA 2J8YA 2ZQ7A 3GSGA 2ZM2A 4U3TA 4N9KA 4O7DA 4UHUA 3I7JA 5FI2A 5TGFA 1MY8A 1TDGA 1I5QA 1W5DA 2G2UA 5HX9A 1RGZA 4JF6A 3NDGA 2HP5A 4OQGA 5DF9A 4CPKA 2HDQA 3O86A 4GD6A 4B4XA 2XR0A 3IH8A 3OPPA 3N8LA 3G2ZA 5FASA 5A93A 3MBZA 2VGJA 3OZHA 5JYPA 1BLPA 3CG5A 4EUZA 5DF7A 3NBLA 5F82A 1ES3A 4OH0A 5EPHA 5TFQA 3Q7ZA 3GQZA 3GTCA 2XFTA 4PM7A 3S22A 4RA7A 2JE5A 1AXBA 1L0GA 1KGFA 2H5SA 3G32A 3VP2A 4OPRA 4OLGA 1J9MA 4S2PA 5GLAA 3UE0A 3UN7A 1C3BA 2WKEA 3BM6A 3SH9A 5A90A 4WEKA 2XD5A 4IEDA 1TVFA 1NJ4A 1M6KA 3VP0A 5FDHA 4C75A 2Q9MA 1GA9A 1W8YA 2OV5A 3UPNA 3ZG8B 1K54A 1BULA 2UWXA 4DXCA 4EWFA 4ID4A 5CHJA 4E3NA 3G31A 3WRZA 5AQ9A 2X71A 4GOGA 1NXYA 2Y2JA 3SOIA 1SDEA 2Y2QA 4KQRA 3G35A 3LO7A 5JYOA 4HESA 1SCWA 4U0TA 1U60A 1K56A 4ZJ1A 4DKIA 2B5RA 2XQZA 2Y2OA 1K4FA 3FYZA 4A5RA 4BQMA 1N4OA 4EBNA 1YLWA 2DRWA 4DXBA 3VP4A 1KGGA 4FCFA 4DE1A 4PM5A 5F83A 4KG2A 4QY5A 4NETA 1JVJA 1MWTA 5FA7A 5IHVA 1W8QA 1JTDA 1NZOA 1QMFA 3BEBA 1XKZA 4R4SA 3IQAA 1IYQA 5EE8A 2H0TA 5FAOA 5F1GA 3MXSA 4S2JA 4HBTA 5HL1A 1PW1A 4PM9A 3IT9A 3N8RA 3O88A 3A3JA 5FQ9A 3MKFA 4BD1A 4P85A 3VOZA 4EBLA 1GHIA 4E6XA 2QMIA 3V3SA 2J9PA 3ZG0A 2J9OA 4LV1A 3ITBA 3PAGA 3CJMA 1K55C 1ZC2A 1H5XA 3Q1FA 5FQQA 1YMSA 3NC8A 1M40A 4DE3A 1MPLA 4GDBA 5HAQA 4E6WA 4R3JA 1CI8A 3N7WA 4RX3A 1FQGA 2C5WB 3IHAA 3QNCA 1MKIA 4FH2A 3A3IA 3UPPA 5KSHA 1IELA 2ZC5B 5CGXA 3G30A 4JXSA 3WS2A 5G18A 1KDSA 5M19A 1OMEA 2XFSA 4QY6A 1PYYA 5D3OA 5J8XA 2GDNA 4PM6A 4MNRA 4JF4A 2IWDA 1K4EA 5EVIA 1BUEA 4E3JA 4S2MA 5BOHA 1PI4A 2WYXA 4EQIA 2Y4AA 1JTGA 3W4QA 4DF6A 3IWOA 4JKTA 1FCOA 4R23A 2Z2LB 3C7VA 4E3IA 3VSKA 1ZG4A 1MWUA 3WWXA 2WGWA 1XGIA 4ZAMA 5FSRA 1HZOA 3D4FA 4X68A 5GHYA 2XH9A 1LI9A 3SH7A 3MZFA 5GHXA 4WELA 5CGWA 3WRTA 3WS0A 3FZCA 2X01A 3DTMA 1XA7A 3UDXA 2Y2IA 3MKEA 1E3UA 3ZFZA 1NYMA 4HEFA 1HVBA 5TR7A 1SDNA 2OLVA 4WMCD 3HVFA 4KZ7A 1CEFA 2EX6A 1CEGA 2ZD8A 2WAFA 4Y0TA 1LL9A 1LI0A 3W8KA 2C6WB 1DY6A 3LY4A 3OCNA 4HBUA 1YM1A 4S2OA 2XLNA 3G4PA 5CHUA 1H8YA 3HBRA 3ZVTA 1XXMA 3VFHA 3IWQA 2CC1A 1W79A 4OQ0A 5GL9A 3C4PA 4C6YA 2E8IA 4GZBA 3C5AA 3PBSA 1KE0A 3V50A 1YMXA 3GMWA 4KQQA 3ZG7B 4E3OA 3AGDA 4OP8A 3HUNA 5DF8A 4FSFA 3VMAA 3WS1A 5EVIB 4N1XA 4NK3A 2FFFB 3BFCA 2JCHA 4RVAA 1W7FA 2PU2A 2WUQA 2Y2NA 5GHZA 3SS4A 3TG9A 3W4PA 5CTMA 3UPOA 2DCFA 4MEZA 4DE2A 2WGWB 2DNSA 5DVAA 5F1FA 2G2WA 4GB7A 4WYYA 3RXXA 5KMWA 2ZQAA 4N9LA 1L0DA 4Y0OA 1KDWA 4QHCA 1TEMA 4N92A 4OVDA 3V3RA 4S2NC 4IVIA 4KENB 4YFMA 1FR1A 1Q2QA 3OC2A 3VP3A 3LEZA 3Q07A 3BECA 4IVKA 1I2WA 5GLBA 4P87A 1JWVA 1KVMA 2HP9A 4PM8A 1XP4A 3AGFA 3IXGA 4QD4A 1I2SA 3WS4A 4DE0A 5CEBA 4DDSA 4KZ8A 2X02A 5CGSA 1KE3A 3N8SA 4OLDA 2R9XA 4WBGA 3JYIA 5FATA 4F94A 4E3LA 1ES4A 1HTZA 1ESIA 3ZG9B 1KVLA 2RL3A 1XA1A 3E2KA 2Y59A 2P9VA 3NIAA 1BZAA 3OPHA 2EXBA 2XGNA 4N1HA 4RX2A 5E2HA 3E2LA 1YLPA 4L0LA 4MBHA 4KG6A 1K55A 2ZQCA 1FCMA 3MFDA 4K0WA 2WKIA 3HLGA 4K0XA 4KZ4A 1ONHA 3VFFA 1N9BA 1K57C 2WGIA 3BRMA 3NY4A 3P09A 4GDNA 5CERA 4BL2A 4DRTA 2J7VA 2Y2KA 1S0WA 1SHVA 2Y2GA 1SKFA 4E3KA 3GR2A 2HP6A 4ZBEA 3ZNYA 2VGKA 2IWBA 1IYOA 3HLWA 4DDYA 3V5MA 3NCKA 1YT4A 4JPMA 4KZ5A 1IYSA 4WZ4A 1K6RA 4QJGA 4KQOA 1ZG6A 3A3DA 3OPRA 3HUOA 3IH9A 3MZEA 3PTEA 1GHPA 1PIOA 2H0YA 3P98A 3HLEA 4OPYA 3UDFA 2FFYA 1JWZA 4GD8A 4BENA 2OSUA 1LLBA 5KSCA 2EFXA 5A91A 1NRFA 3EQVA 1MXOA 3BYDA 4ZTKA 1CI9A 2A3UA 3BLMA 4U0XA 1PWCA 2XEPA 4IBRA 4LENA 4RYEA 2V1ZA 4S2KA 4ZJ2A 4LV2A 3NI9A 3IF6C 4OOYA 2ZQ9A 3MZDA 4WZ5C 4JLFA 5HW3A 1GCEA 5E2FA 2HDUA 4S2IA 2P9VB 2P74A 2WADA 2WZXA 4LV0A 5EVID 1TDLA 1EWZA 1L2SA 4EV4A 1NYYA 4Q8IA 1LHYA 4ZJ3A 1YQSA 1WYBA 5CECA 4C3QA 2JC7A 1ONGA 1IEMA
chains in the Genus database with same CATH superfamily
5EOOA 2Y2HA 1T1AA 4OONA 3M6BA 3BFEA 3V39A 3MXRA 1OTEA 2OWHA 2ZM8A 5AVEA 3QP8A 4I3IA 4KG5A 2W3EA 5HAPA 4II7A 5EVIC 1G5UA 5AQAA 4WMCA 3LR4A 2W1TA 1XX2A 3LIBA 2Y2MA 5DTSA 5J4EA 3DTKA 3S4XA 1BLCA 4PHTA 4PMAA 1VM1A 3DWKA 1Q2PA 5GLDA 3BY9A 2E8JA 4BLMA 4P0MA 3P7NA 5HWTA 3O87A 3WS5A 5AQBA 1E4DA 1MWSA 3PR6A 4BL3A 5I94A 3T1RA 1K57A 2EWWA 4O0PA 3W2ZA 1MWRA 4R6LA 3DWZA 1H8ZA 1VHMA 3B3XA 4P6ZM 4GKUA 1VEUB 3G34A 2BG1A 3LICA 3BQAA 1Y54A 3GV9A 3LIAA 2A49A 3Q7VA 1E25A 1YLTA 3LCEA 4GHIB 1STZA 4Y0UA 2P04A 4HP4A 1KGEA 4NG2A 2VA0A 1XJ6A 3IF5A 4E3MA 2KLIA 1VETA 3LEQA 4LFUA 3BFGA 1HD8A 4HI4A 2JHEA 4QB8A 3VV4A 3H82A 3FV7A 2IWCA 1JWPA 2Y91A 3ZDJA 3C7UA 1EI5A 1OJ5A 4KZBA 4EU0A 3M6HA 1FSWA 3ULFA 4CLCC 2VV8A 1XPBA 2HZ5A 3HUMA 3W4OA 4HJ6A 4OQIA 4LPZA 1G6AA 1FOFA 5HFOA 1V9ZA 3OBFA 3IBRA 2WKPA 2ZBBA 2ZQ7A 1SKOB 5TGFA 3UB5P 1W5DA 3BWLA 4JF6A 3SW1A 3P01A 4OQGA 4CPKA 1OPXA 3OPPA 3MFXA 5JYPA 4F3LA 2L0WA 3CG5A 2QJ5A 2D01A 5F82A 1AWIA 5TFQA 3GTCA 4WF0A 4HJ3A 3IX4A 2JE5A 2H5SA 4OPRA 4OLGA 4S2PA 3UE0A 3VE4A 1S66L 4E04A 2WKEA 3BM6A 5A90A 4WEKA 2XD5A 4IEDA 1TS6A 4GS9B 4IJGA 4C75A 2OV5A 3ZG8B 2J80A 1BULA 2UWXA 4EWFA 1OTBA 2V0UA 4KQRA 1G28A 3G35A 3LO7A 5JYOA 4U0TA 1U60A 4DKIA 2Y2OA 1N4OA 4KG2A 4NETA 3T4LA 1LSXA 5IHVA 1W8QA 3T4JA 1QMFA 3BEBA 2L4RA 3MMHA 5HDCA 2H0TA 5FAOA 2XA7M 4PM9A 3O88A 4E6XA 2G7UA 3ZG0A 2J9OA 4LV1A 3PAGA 3NC8A 4DE3A 1UWNX 4EESA 3QNCA 3GDIA 3S7QA 3UPPA 1IELA 5CGXA 5HL6A 3E4OA 2ZL1B 4QY6A 3CPTA 5L09A 3B42A 1TS8A 3IWOA 4JGOA 3VSKA 3WWXA 2WGWA 1VB6A 3D4FA 3BY8A 4LRZE 4WELA 5CGWA 5GHXA 2X01A 3DTMA 3F1NB 3MS6A 3UDXA 5FEGA 3NJAA 3QP2A 1N9NA 4NXEA 2OLVA 5DJUA 3HVFA 2JKFA 1CEGA 2ZD8A 1DY6A 5TBMA 4HBUA 4CLCB 3BJNA 3HBRA 3ZVTA 2VV7A 1VEUA 2CC1A 1W79A 4HNBA 3V50A 3GMWA 4KQQA 3ZG7B 5DF8A 4N1XA 2P08A 3BFCA 3LR0A 2WUQA 4BBUA 1GSWA 5GHZA 4R70A 2Q0OA 4MEZA 4DE2A 5DVAA 2NUTC 5KMWA 2PRFA 2ZQAA 1TEMA 1EW0A 4IVIA 1Q2QA 3OC2A 2Z6DA 4H6JA 3BQ8A 3BECA 1K0KA 4L9GA 5DJTA 5F69A 1XP4A 3IXGA 3T4TA 3WS4A 1I2SA 3C30A 2X02A 1KE3A 2R9XA 4E3LA 1HTZA 2B02A 1OJGA 3NIAA 1OTDA 3F1OB 4N1HA 4KG6A 1K55A 1FCMA 4K0WA 1ONHA 2VLGA 2H28A 3P09A 1SHVA 4Z1WA 1NLYA 2IA2A 1S67L 1YAXA 3ZNYA 2V1AA 4ME4A 4JPMA 4WZ4A 4GW9A 4QJGA 4KQOA 1ZG6A 3IH9A 3PTEA 2VV6A 2H0YA 4EETB 2FFYA 3QP6A 4BENA 1XJ4A 2W0NA 3H7WB 4ETXA 3EQVA 1MXOA 5F5YA 3S7PA 3BYDA 3BLMA 4RYEA 2V1ZA 3NI9A 4MN7A 2ZQ9A 5HW3A 4JLFA 1GCEA 3T4KA 4S2IA 3KSFA 2P9VB 2WKRA 3B33A 2P74A 2WADA 5KIZA 1EWZA 4ZJ3A 1YQSA 4DMZA 4Q0JA 3LGOA 5FQKA 4IBXA 1Y4OA 1DJAA 5FAPA 2QKPA 1H0MA 4UQIM 5M18A 5DTKA 4HH2A 3CAXA 2HDRA 3R7WB 4LV3A 4Z9QA 1ES2A 4MBFA 1ERQA 4QU3A 3ZCZA 2Y2LA 5HARA 2R9WA 3FKVA 3UO9A 1ES5A 1GA0A 2ZQ8A 4B4ZA 3ZQ5A 4PPRA 3ITAA 5CXWA 2QPNA 2PBDP 2B18A 1L0EA 2OLUA 1P97A 2ZC4B 3KYQA 4LCLA 3IWIA 1MBLA 5MC7A 1BLHA 5EOEA 3IXBA 3PBRA 4OOLA 2JBFA 3LR5A 5FQJA 5FL3A 5K5BA 4KZ6A 2EX2A 3UE1A 2HPBA 3K3CA 5EUAA 5I5LA 2V1BA 3HLDA 2WZZA 1PWGA 3FPWA 4OKPA 5U47A 1WYCA 2XDMA 4OP5A 2PR5A 3UY6A 1DJCA 4AFIA 1K54C 1J3WA 1MKMA 4UAAA 3LY3A 3S1YA 2BLSA 1IKGA 1L0FA 1ERMA 4OPZA 3LYXA 1WE4A 5CRFA 4FH4A 3C8CA 4H8RA 1S4RA 1UWPX 3PXPA 5FQIA 3IXDA 2EXAA 3C4OA 3HLBA 2WGVA 1NY0A 3IF6A 4R3BA 4WZ5A 1TS0A 3BFDA 2ZMFA 4X6TA 4UA7A 3M2KA 3PBQA 3IXHA 3A3FA 2Y79A 2QWSA 1PZPA 2Q9NA 3U4LP 1RGYA 1D06A 3F1PA 2PYPA 2XK1A 3AGEA 5DTTA 4NKPA 5EECA 3RFBA 5FI7A 5HZHA 1CK3A 1OTAA 1FSYA 4JF5A 2XROA 2HDSA 4ESPA 2ZMVA 2XF3A 3N4IA 4X56A 4Y13A 1YLYA 4BBTA 3PAEA 4XXRA 1N9OA 3GSGA 2ZM2A 4U3TA 4N9KA 2VZWA 2PYRA 1MY8A 1I5QA 2UV0E 2G2UA 5HX9A 2HP5A 4B4XA 2XR0A 4HJ4A 2K31A 1UGUA 3G2ZA 3F1OA 1BLPA 4EUZA 5DF7A 3NBLA 1ES3A 3UB9A 1DP9A 2PT7A 3Q7ZA 4PM7A 4RA7A 3G32A 3VP2A 1J9MA 1C3BA 2ACGA 2HGVA 1M6KA 1TF1A 5FDHA 5DFYA 1GA9A 1W8YA 3UPNA 5HWWA 4ID4A 3MF0A 1MC0A 3G31A 4D60A 3WRZA 5AQ9A 5L07A 4GOGA 2Y2JA 3CWFA 1SDEA 2Y2QA 3T4QA 5HD3A 3CLOA 4HESA 2K7SA 5HWVA 4ZJ1A 3L9KA 2XQZA 1K4FA 3FYZA 4A5RA 4BQMA 1YLWA 3HJIA 4DE1A 3A0RA 1T1BA 1XKZA 4R4SA 1IYQA 3MXSA 4S2JA 4HBTA 2K2NA 1PW1A 3IT9A 3N8RA 5FQ9A 4LLOB 4BD1A 3V3SA 2OAP1 3CJMA 3MQ0A 5FQQA 1H5XA 4I3AA 3VE3A 1YMSA 1M40A 4GDBA 2JKRM 5HAQA 4R3JA 1CI8A 5HPIA 3N7WA 4RX3A 1H8MA 3EOIA 3CI6A 1OMEA 4Y3IA 2XFSA 5D3OA 4MNRA 4JF4A 1D7EA 1K4EA 2IWDA 1BUEA 1PI4A 4I39A 4EQIA 2M1CA 2Z2LB 2W27A 1ZG4A 4O01A 4X68A 3D3OA 2VGLM 2XH9A 5GHYA 3FZCA 3CHWP 2Y2IA 3MKEA 1H3QA 2J3TC 2A24B 5TR7A 1SDNA 3LFVA 2C6WB 1L3LA 2XLNA 3TRCA 4FOFA 1H8YA 1XXMA 3VFHA 4OQ0A 3C4PA 1IOUA 1KE0A 1YMXA 3T4SA 1XFQA 3HUNA 2FZ0A 5EVIB 4NK3A 1CF0A 2JCHA 1W7FA 2GNXA 3JVVA 5G4ZA 3NHQA 5F1FA 3RXXA 4WYYA 4N9LA 4OVDA 1HLUP 3VP3A 3LEZA 1I2WA 4MMNA 2HP9A 3IS2A 2QJ7A 4DE0A 2EA9A 5CGSA 3SZTA 5L10A 3JYIA 1ESIA 5IT5A 1XA1A 3E2KA 2EXBA 1Y28A 4G3VA 4KZ4A 3VFFA 3MR0A 1K57C 2WGIA 3BRMA 3NY4A 5CERA 2Y2KA 2Y2GA 2NUPC 3DBAA 1IYOA 1LL8A 4DDYA 3V5MA 1K6RA 3A3DA 3MZEA 1PIOA 2VKSA 5IU1A 2OSUA 5KSCA 5DKLA 1CI9A 5HD5A 4L9EA 2D02A 2V0WA 4LV2A 4P6ZS 3MZDA 2PD7A 2WKQA 3EGXC 1N9LA 2WZXA 5EVID 4EV4A 4Q8IA 3DTIA 2JC7A 4P6BA 4QPRA 1ONGA 4MN5A 5HSQA 3T1QB 1OT9A 1RCJA 4X55A 5CEDA 4R38A 4YINA 3RJUA 4XUZA 5FEFA 3ZYTA 1PI5A 2BTFP 3GVBA 3NDEA 2ZC3B 3HCYA 2ZC7A 2YKHA 2WK0A 1ODVA 4HY8A 3SH8A 1GHMA 2LB9A 3RXWA 4ARZB 4GN2A 4S2NA 4X1LA 2EX9A 3CUEA 4GHIA 4WL9A 4BMWA 3FC7A 3JPUA 3BFFA 4LGWA 5E2EA 3ZVWA 1YLZA 2YKFA 3O3VA 4Q0IA 3QP4A 1G68A 2OAQ1 4Q0HA 1T18A 1EROA 4B88A 1NZUA 4KUOA 4MCWA 4CJNA 1FR6A 3EEAA 4RQ9A 4K08A 4X69A 3NOUC 4Y7PA 5EVEA 1A0KA 2JN7A 5EFWA 4LCMA 3UDIA 4MLLA 4EQ1A 4I38A 4JXWA 4KZ9A 5G4YA 1TD5A 2HF6A 2ZMAA 3SS5A 4UA9A 1ESUA 3OCLA 4JXVA 1O7EA 1YSQA 4EEUA 2ZQDA 3DAVA 3Q82A 2V8CA 3ISGA 4WEJA 1Z09A 1QMEA 1SKOA 3CMZA 4CLCD 3MJQA 1ALQA 3KO6A 3UE3A 5E43A 1CQAA 1K6SA 2PBYA 3TOIA 4KZ3A 3ZGAB 3PBTA 3CZDA 4EXOA 4PKYG 4XT2B 1Z6FA 2Z2MB 5LBRA 3UB7A 2EX8A 4R1GA 5J3WA 5IS1A 4EUVA 3ZNTA 2WKHA 1XGJA 5A8BA 2ZC6B 3TE8A 3Q7VB 1RP5A 3QNBA 3A0SA 3ICYA 2ZOIA 2XA7S 4GS9A 3DW0A 2KOIA 1IKIA 4ZRRA 1T1CA 5FI6A 3ZG5A 1PW8A 4NXGA 5FAQA 3UMDA 3EWKA 2DMWA 1BTLA 4D2OA 3I7JA 1VETB 2JKGA 1TDGA 1RGZA 3NDGA 2HDQA 4GD6A 3KX0X 3IH8A 3H82B 5FASA 5A93A 3MBZA 2O9AA 3MXQA 1GSVA 2OWJA 1OTIA 3PHYA 2XFTA 3S22A 1L0GA 1AXBA 1F5MA 3NECA 2PDRA 1TVFA 1NJ4A 4DXCA 2INWA 5CHJA 5F68A 1NXYA 1S4SA 4IHQA 3SOIA 1KOUA 2CMNA 2ZL1A 3NOTC 3UMEA 3VOLA 2O9BA 1SCWA 2B5RA 4LRYC 4NXFA 4EBNA 1SZVA 4DXBA 1KGGA 4PM5A 3EEHA 1MWTA 2ZOHA 1F2KA 1JTDA 1NZOA 4F3LB 5EE8A 5C5KA 3E98A 5HL1A 1BYWA 3F1NA 3A3JA 2JKRI 4P85A 3VOZA 4EBLA 3H9WA 1K55C 4FTXA 4EERA 4IUHA 4GJ4A 3UB8A 3KSIA 4B9OA 4Y5FA 4QWOA 3IHAA 4FH2A 5AJGA 4CLCA 3A3IA 5KSHA 2ZC5B 3R4KA 3G30A 3KSGA 3WS2A 5G18A 1KDSA 2GDNA 3T12B 5BOHA 4S2MA 2Y4AA 4DF6A 4JKTA 1FCOA 3C7VA 1XGIA 5FSRA 1HZOA 4BWIA 3MZFA 3WRTA 4G3WA 4FUWA 5HDDA 1NYMA 4HEFA 1DP6A 1HVBA 3IBJA 5J7EA 2GX5A 2VK3A 4KZ7A 1CEFA 2EX6A 1YSPA 3W8KA 3OCNA 3LY4A 4S2OA 5CHUA 3D72A 4JGQA 2PR6A 4HP9A 5GL9A 3PYPA 4Y17A 3C5AA 4E3OA 3CPTB 1LT0A 2I9VA 4FSFA 3VMAA 3WS1A 1MZUA 4RVAA 2Y2NA 3SS4A 3TG9A 3UPOA 2WGWB 2DNSA 2G2WA 5HDSA 4Y0OA 1KDWA 5EM0A 4N92A 1X0OA 4UQIS 1JNUA 3H7WA 1IFQA 5GLBA 4P87A 2FH5A 1JWVA 4PM8A 3AGFA 4QD4A 4DDSA 4KZ8A 4OLDA 3NOPC 4WBGA 5FATA 1ES4A 4XT2A 4WN5A 5TBMB 2P9VA 4RX2A 3E2LA 1YLPA 4L0LA 4BBVA 1DRMA 4K0XA 3V67A 2WKIA 4G3KA 1D1JA 4GDNA 4DRTA 2J7VA 2PAVP 1SKFA 3HLWA 4DJ2A 3NCKA 1YT4A 3R7WA 1PFLA 2W3HA 3HUOA 1GHPA 1W63Q 3P98A 4OPYA 3UDFA 4JGRA 1JWZA 4H6JB 2EFXA 1NRFA 4ZTKA 2A3UA 2XEPA 4B93A 4IBRA 4LENA 4S2KA 3IF6C 4OOYA 4WZ5C 1F98A 5E2FA 2JKTM 3OLOA 4O8GA 1L2SA 2QHKA 3TW8A 1NYYA 1LHYA 1WYBA 2O0YA 4Y15A 4KQDA 1IEMA 4F94A 3A3EA 5KZHA 2Z6CA 2KX6A 2Y2PA 1DJBA 2WAEA 5CHMA 1PRQA 3UB6A 4PAUA 3Q81A 3HLCA 3FKWA 1YPRA 3C38A 2V8FA 4XUXA 4JBFA 3KYZA 3LI8A 3ZHHA 3HL9A 1S6RA 4M4XA 1TS7A 2ZJ9A 4JGPA 3LIEA 4HHDA 3C2WA 3TSGA 1BSGA 3GRJA 4ETZA 4GNUA 1WA9A 3E0YA 3HREA 3SS3A 4YWZA 4DN0A 2QZ6A 3S7NA 3LR3A 3O5YA 5EVLA 1LSVA 5M1AA 2VEAA 2R78A 3MQQA 1LSWA 4WM9A 4BJPA 3DTEA 4OOMA 2HJ9C 5GLCA 1XJ3A 1ZKJA 3CITA 4R4RA 4K91A 2I72A 4X1MA 2EFUA 3G2YA 4WUJA 5E2GA 3NULA 1F9IA 5FDSA 1K56D 4KZAA 3QHYA 1ACFA 5FQMA 5L2FA 4GLQA 3HLFA 4NXBA 1YKDA 2ZM0A 3IHBA 3D9YA 3VOYA 2XSSA 2V2FF 4X53A 2VJWA 4FD8A 4EBPA 5AVFA 4DJ3A 3N6IA 3IX3A 2V20A 2H10A 4L9FA 4UA6A 3U2AA 1VQQA 3LIDA 3T4OA 2RCXA 1K25A 4M3KA 1P9RA 3UNWA 2XD1A 1PZOA 3M2JA 1ZHHB 3JVUA 4I5SA 4BD0A 3QP5A 1IYPA 4R0QA 4S2LA 4ZDXA 3T1SA 1O07A 2PU4A 2VX8A 1K38A 3VSLA 3VP1A 1LL5A 1FCNA 4Y2FA 2ZLYA 3EQUA 2W3GA 1FILA 4OPQA 2MJ6A 4HH3A 2PHYA 2BASA 2KDKA 4YOFA 1CJFA 1GSXA 5CTNA 4LRXC 2A2LA 3G6OA 4MBKA 1NWZA 4X25A 5A92A 1BLSA 3MSHA 3PBNA 1BT5A 4JXGA 3K3DA 2Y55A 4R3AA 3PBOA 1E3UD 1V9YA 1KE4A 5AQ7A 1PWDA 3OPLA 3IF6B 1YLJA 1P0ZA 1XJ2A 3BLSA 3FWLA 4OQHA 1S1ZA 5HAIA 2GZAA 2J8YA 5FI2A 4UHUA 4O7DA 3E4QA 5L8MA 3LUQA 3IX8A 5DF9A 2GJ3A 3O86A 2QYBA 2W3FA 2XRNA 4NEED 3N8LA 3OZHA 2VGJA 4MN6A 2LB5A 1NRJA 4OH0A 5EPHA 2W1RA 1OT6A 3F1PB 3GQZA 2HV1A 1KGFA 5GLAA 2AVXA 3UN7A 3SH9A 2VGLS 3VP0A 3T1XA 2Q9MA 4HQAA 1K54A 1W63M 4E3NA 4KUKA 2X71A 3LIFA 4EEPA 2O99A 4IUKA 2HJEA 2OOLA 2W1TB 1K56A 3GECA 2DRWA 2O9CA 3VP4A 4FCFA 5F83A 3L7HA 4QY5A 5DFXA 1JVJA 5FA7A 3IQAA 5F1GA 2M7UA 3S7OA 3KSHA 3MKFA 3E4PA 3B47A 1GHIA 4GCZA 2QMIA 2J9PA 2B95A 3ITBA 5CX7A 3Q1FA 1ZC2A 2A24A 1MPLA 2EWVA 4E6WA 1XFNA 1FQGA 2C5WB 1MKIA 4JXSA 4UEYA 5M19A 3K2NA 2J3TD 1PYYA 3HJKA 4CQHA 5J8XA 4PM6A 5EVIA 4E3JA 2WYXA 1JTGA 1PNEA 3W4QA 5EV0A 4R23A 4E3IA 3A0VA 1MWUA 4ZAMA 3KYEA 5HPFA 3SH7A 1LI9A 2P7JA 3WS0A 3QP1A 1XA7A 4YNRA 2J3WA 1E3UA 3ZFZA 2M7VA 3FG8A 3RH8B 4MDZA 2W3DA 3OOVA 4WMCD 4I3JA 4WLAA 2WAFA 4Y0TA 1LL9A 1LI0A 3BW6A 1YM1A 3G4PA 3LI9A 2L1MA 2Y8HA 3IWQA 4C6YA 2E8IA 4GZBA 3PBSA 3EGDC 3AGDA 4OP8A 2FFFB 2PU2A 4HOIA 3W4PA 5CTMA 2DCFA 4GB7A 1L0DA 3V3RA 4QHCA 4PKYA 4YFMA 4S2NC 4KENB 1FR1A 3FPVA 1S1YA 5EM1A 3CUEC 3Q07A 4IVKA 1P9WA 1KVMA 5CEBA 5F6AA 3N8SA 2V9AA 3ZG9B 1KVLA 2RL3A 2Y59A 3OPHA 1BZAA 2XGNA 1G6OA 5E2HA 1T19A 4MBHA 2ZQCA 3T50A 3MFDA 3HLGA 1N9BA 3UE6A 4BL2A 1S0WA 4E3KA 3GR2A 2HP6A 5TJJA 4ZBEA 2VGKA 2IWBA 4KZ5A 1IYSA 4EW7A 3OPRA 3HLEA 4GD8A 1LLBA 5A91A 4U0XA 3IS2B 4CLCE 1PWCA 2JKTI 4HIAA 1NLZA 2PD8A 4ZJ2A 4ARZA 3MQOA 1FIKA 2HDUA 5DKKA 3RTYA 4LV0A 3TJZC 1TDLA 1DP8A 5CECA 4C3QA 1ZTUA
chains in the Genus database with same CATH topology
4IBXA 3A3EA 5KZHA 5EOOA 2Y2HA 1DJAA 2Y2PA 1DJBA 5FAPA 2WAEA 4OONA 5CHMA 3M6BA 1RCJA 4X55A 3BFEA 5CEDA 3V39A 3MXRA 5M18A 3Q81A 5DTKA 3HLCA 3FKWA 5FQKA 4YINA 3RJUA 2ZM8A 2HDRA 4XUZA 4XUXA 4JBFA 4LV3A 4KG5A 4Z9QA 1ES2A 5HAPA 1PI5A 3ZHHA 3GVBA 5EVIC 4MBFA 1ERQA 4QU3A 3HL9A 3NDEA 3ZCZA 1S6RA 2ZC3B 2Y2LA 2ZJ9A 5AQAA 5HARA 4WMCA 2R9WA 2ZC7A 3FKVA 3UO9A 1ES5A 1XX2A 1GA0A 2WK0A 2ZQ8A 3TSGA 1BSGA 4B4ZA 3GRJA 3SH8A 2Y2MA 1GHMA 5DTSA 4PPRA 3ITAA 5CXWA 2QPNA 3RXWA 3S4XA 4GN2A 1BLCA 4GNUA 4S2NA 4PMAA 1L0EA 1VM1A 2OLUA 3DWKA 3HREA 2EX9A 1Q2PA 3SS3A 2ZC4B 2QZ6A 5GLDA 4LCLA 5EVLA 4BLMA 3IWIA 1MBLA 5M1AA 3BFFA 4P0MA 1BLHA 5E2EA 5EOEA 3ZVWA 1YLZA 3O87A 3IXBA 3PBRA 3WS5A 5AQBA 1E4DA 3O3VA 4WM9A 4BJPA 4OOMA 4OOLA 1G68A 1MWSA 2JBFA 5FQJA 5GLCA 1ZKJA 4R4RA 4KZ6A 4K91A 4BL3A 5I94A 1EROA 2EX2A 3UE1A 1NZUA 2HPBA 2I72A 4B88A 5EUAA 2EFUA 4CJNA 1FR6A 3G2YA 5E2GA 1K57A 3HLDA 2WZZA 1PWGA 1K56D 1MWRA 4KZAA 4OKPA 3QHYA 3DWZA 1H8ZA 5U47A 5FQMA 4X69A 5L2FA 1WYCA 2XDMA 4OP5A 4Y7PA 3HLFA 3B3XA 2ZM0A 4LCMA 4P6BA 3IHBA 4MLLA 3UDIA 3UY6A 4GKUA 1DJCA 3G34A 1K54C 4JXWA 3VOYA 4UAAA 3LY3A 2BG1A 4KZ9A 3S1YA 2V2FF 4X53A 4FD8A 4EBPA 2BLSA 1IKGA 1Y54A 3N6IA 3GV9A 1L0FA 1ERMA 2A49A 2H10A 2V20A 3Q7VA 4UA6A 4OPZA 2ZMAA 1VQQA 3SS5A 1E25A 4UA9A 1YLTA 1ESUA 1WE4A 3LCEA 2RCXA 1K25A 5CRFA 4M3KA 4FH4A 3OCLA 3UNWA 4H8RA 2XD1A 4JXVA 1O7EA 1PZOA 3M2JA 4Y0UA 2ZQDA 5FQIA 4BD0A 1KGEA 3IXDA 2EXAA 1IYPA 3C4OA 3HLBA 3Q82A 4R0QA 3ISGA 2WGVA 4S2LA 1NY0A 4ZDXA 3IF6A 4R3BA 4WEJA 4WZ5A 2PU4A 1O07A 3IF5A 3BFDA 1K38A 3VSLA 3VP1A 1LL5A 1QMEA 1FCNA 4X6TA 4UA7A 4E3MA 3M2KA 3PBQA 2ZLYA 3EQUA 3CMZA 4OPQA 1ALQA 3BFGA 3IXHA 3UE3A 1HD8A 3A3FA 5E43A 1K6SA 2PBYA 3TOIA 4QB8A 4KZ3A 3ZGAB 3PBTA 1PZPA 3CZDA 2Q9NA 1RGYA 3FV7A 5CTNA 2IWCA 1Z6FA 2Z2MB 1JWPA 2Y91A 2EX8A 4R1GA 3ZDJA 3C7UA 1EI5A 4KZBA 3ZNTA 2WKHA 2XK1A 4MBKA 1XGJA 2ZC6B 5A92A 3AGEA 5DTTA 1BLSA 3PBNA 3M6HA 5EECA 3Q7VB 1RP5A 3QNBA 5FI7A 1FSWA 1BT5A 4JXGA 1XPBA 2Y55A 3HUMA 1CK3A 3W4OA 3DW0A 1IKIA 5FI6A 1FSYA 4JF5A 4OQIA 3PBOA 3ZG5A 1E3UD 1G6AA 1KE4A 2HDSA 5AQ7A 1FOFA 1PW8A 5FAQA 2XF3A 3N4IA 1PWDA 4X56A 3OPLA 1YLYA 3IF6B 1YLJA 3PAEA 4XXRA 1BTLA 5HFOA 3BLSA 3FWLA 4OQHA 5HAIA 4D2OA 2J8YA 2ZQ7A 3GSGA 2ZM2A 4U3TA 4N9KA 4O7DA 4UHUA 3I7JA 5FI2A 5TGFA 1MY8A 1TDGA 1I5QA 1W5DA 2G2UA 5HX9A 1RGZA 4JF6A 3NDGA 2HP5A 4OQGA 5DF9A 4CPKA 2HDQA 3O86A 4GD6A 4B4XA 2XR0A 3IH8A 3OPPA 3N8LA 3G2ZA 5FASA 5A93A 3MBZA 2VGJA 3OZHA 5JYPA 1BLPA 3CG5A 4EUZA 5DF7A 3NBLA 5F82A 1ES3A 4OH0A 5EPHA 5TFQA 3Q7ZA 3GQZA 3GTCA 2XFTA 4PM7A 3S22A 4RA7A 2JE5A 1AXBA 1L0GA 1KGFA 2H5SA 3G32A 3VP2A 4OPRA 4OLGA 1J9MA 4S2PA 5GLAA 3UE0A 3UN7A 1C3BA 2WKEA 3BM6A 3SH9A 5A90A 4WEKA 2XD5A 4IEDA 1TVFA 1NJ4A 1M6KA 3VP0A 5FDHA 4C75A 2Q9MA 1GA9A 1W8YA 2OV5A 3UPNA 3ZG8B 1K54A 1BULA 2UWXA 4DXCA 4EWFA 4ID4A 5CHJA 4E3NA 3G31A 3WRZA 5AQ9A 2X71A 4GOGA 1NXYA 2Y2JA 3SOIA 1SDEA 2Y2QA 4KQRA 3G35A 3LO7A 5JYOA 4HESA 1SCWA 4U0TA 1U60A 1K56A 4ZJ1A 4DKIA 2B5RA 2XQZA 2Y2OA 1K4FA 3FYZA 4A5RA 4BQMA 1N4OA 4EBNA 1YLWA 2DRWA 4DXBA 3VP4A 1KGGA 4FCFA 4DE1A 4PM5A 5F83A 4KG2A 4QY5A 4NETA 1JVJA 1MWTA 5FA7A 5IHVA 1W8QA 1JTDA 1NZOA 1QMFA 3BEBA 1XKZA 4R4SA 3IQAA 1IYQA 5EE8A 2H0TA 5FAOA 5F1GA 3MXSA 4S2JA 4HBTA 5HL1A 1PW1A 4PM9A 3IT9A 3N8RA 3O88A 3A3JA 5FQ9A 3MKFA 4BD1A 4P85A 3VOZA 4EBLA 1GHIA 4E6XA 2QMIA 3V3SA 2J9PA 3ZG0A 2J9OA 4LV1A 3ITBA 3PAGA 3CJMA 1K55C 1ZC2A 1H5XA 3Q1FA 5FQQA 1YMSA 3NC8A 1M40A 4DE3A 1MPLA 4GDBA 5HAQA 4E6WA 4R3JA 1CI8A 3N7WA 4RX3A 1FQGA 2C5WB 3IHAA 3QNCA 1MKIA 4FH2A 3A3IA 3UPPA 5KSHA 1IELA 2ZC5B 5CGXA 3G30A 4JXSA 3WS2A 5G18A 1KDSA 5M19A 1OMEA 2XFSA 4QY6A 1PYYA 5D3OA 5J8XA 2GDNA 4PM6A 4MNRA 4JF4A 2IWDA 1K4EA 5EVIA 1BUEA 4E3JA 4S2MA 5BOHA 1PI4A 2WYXA 4EQIA 2Y4AA 1JTGA 3W4QA 4DF6A 3IWOA 4JKTA 1FCOA 4R23A 2Z2LB 3C7VA 4E3IA 3VSKA 1ZG4A 1MWUA 3WWXA 2WGWA 1XGIA 4ZAMA 5FSRA 1HZOA 3D4FA 4X68A 5GHYA 2XH9A 1LI9A 3SH7A 3MZFA 5GHXA 4WELA 5CGWA 3WRTA 3WS0A 3FZCA 2X01A 3DTMA 1XA7A 3UDXA 2Y2IA 3MKEA 1E3UA 3ZFZA 1NYMA 4HEFA 1HVBA 5TR7A 1SDNA 2OLVA 4WMCD 3HVFA 4KZ7A 1CEFA 2EX6A 1CEGA 2ZD8A 2WAFA 4Y0TA 1LL9A 1LI0A 3W8KA 2C6WB 1DY6A 3LY4A 3OCNA 4HBUA 1YM1A 4S2OA 2XLNA 3G4PA 5CHUA 1H8YA 3HBRA 3ZVTA 1XXMA 3VFHA 3IWQA 2CC1A 1W79A 4OQ0A 5GL9A 3C4PA 4C6YA 2E8IA 4GZBA 3C5AA 3PBSA 1KE0A 3V50A 1YMXA 3GMWA 4KQQA 3ZG7B 4E3OA 3AGDA 4OP8A 3HUNA 5DF8A 4FSFA 3VMAA 3WS1A 5EVIB 4N1XA 4NK3A 2FFFB 3BFCA 2JCHA 4RVAA 1W7FA 2PU2A 2WUQA 2Y2NA 5GHZA 3SS4A 3TG9A 3W4PA 5CTMA 3UPOA 2DCFA 4MEZA 4DE2A 2WGWB 2DNSA 5DVAA 5F1FA 2G2WA 4GB7A 4WYYA 3RXXA 5KMWA 2ZQAA 4N9LA 1L0DA 4Y0OA 1KDWA 4QHCA 1TEMA 4N92A 4OVDA 3V3RA 4S2NC 4IVIA 4KENB 4YFMA 1FR1A 1Q2QA 3OC2A 3VP3A 3LEZA 3Q07A 3BECA 4IVKA 1I2WA 5GLBA 4P87A 1JWVA 1KVMA 2HP9A 4PM8A 1XP4A 3AGFA 3IXGA 4QD4A 1I2SA 3WS4A 4DE0A 5CEBA 4DDSA 4KZ8A 2X02A 5CGSA 1KE3A 3N8SA 4OLDA 2R9XA 4WBGA 3JYIA 5FATA 4F94A 4E3LA 1ES4A 1HTZA 1ESIA 3ZG9B 1KVLA 2RL3A 1XA1A 3E2KA 2Y59A 2P9VA 3NIAA 1BZAA 3OPHA 2EXBA 2XGNA 4N1HA 4RX2A 5E2HA 3E2LA 1YLPA 4L0LA 4MBHA 4KG6A 1K55A 2ZQCA 1FCMA 3MFDA 4K0WA 2WKIA 3HLGA 4K0XA 4KZ4A 1ONHA 3VFFA 1N9BA 1K57C 2WGIA 3BRMA 3NY4A 3P09A 4GDNA 5CERA 4BL2A 4DRTA 2J7VA 2Y2KA 1S0WA 1SHVA 2Y2GA 1SKFA 4E3KA 3GR2A 2HP6A 4ZBEA 3ZNYA 2VGKA 2IWBA 1IYOA 3HLWA 4DDYA 3V5MA 3NCKA 1YT4A 4JPMA 4KZ5A 1IYSA 4WZ4A 1K6RA 4QJGA 4KQOA 1ZG6A 3A3DA 3OPRA 3HUOA 3IH9A 3MZEA 3PTEA 1GHPA 1PIOA 2H0YA 3P98A 3HLEA 4OPYA 3UDFA 2FFYA 1JWZA 4GD8A 4BENA 2OSUA 1LLBA 5KSCA 2EFXA 5A91A 1NRFA 3EQVA 1MXOA 3BYDA 4ZTKA 1CI9A 2A3UA 3BLMA 4U0XA 1PWCA 2XEPA 4IBRA 4LENA 4RYEA 2V1ZA 4S2KA 4ZJ2A 4LV2A 3NI9A 3IF6C 4OOYA 2ZQ9A 3MZDA 4WZ5C 4JLFA 5HW3A 1GCEA 5E2FA 2HDUA 4S2IA 2P9VB 2P74A 2WADA 2WZXA 4LV0A 5EVID 1TDLA 1EWZA 1L2SA 4EV4A 1NYYA 4Q8IA 1LHYA 4ZJ3A 1YQSA 1WYBA 5CECA 4C3QA 2JC7A 1ONGA 1IEMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IBX A;  3A3E A;  5KZH A;  5EOO A;  2Y2H A;  1DJA A;  2Y2P A;  1DJB A;  5FAP A;  2WAE A;  4OON A;  5CHM A;  3M6B A;  1RCJ A;  4X55 A;  3BFE A;  5CED A;  3V39 A;  3MXR A;  5M18 A;  3Q81 A;  5DTK A;  3HLC A;  3FKW A;  5FQK A;  4YIN A;  3RJU A;  2ZM8 A;  2HDR A;  4XUZ A;  4XUX A;  4JBF A;  4LV3 A;  4KG5 A;  4Z9Q A;  1ES2 A;  5HAP A;  1PI5 A;  3ZHH A;  3GVB A;  5EVI C;  4MBF A;  1ERQ A;  4QU3 A;  3HL9 A;  3NDE A;  3ZCZ A;  1S6R A;  2ZC3 B;  2Y2L A;  2ZJ9 A;  5AQA A;  5HAR A;  4WMC A;  2R9W A;  2ZC7 A;  3FKV A;  3UO9 A;  1ES5 A;  1XX2 A;  1GA0 A;  2WK0 A;  2ZQ8 A;  3TSG A;  1BSG A;  4B4Z A;  3GRJ A;  3SH8 A;  2Y2M A;  1GHM A;  5DTS A;  4PPR A;  3ITA A;  5CXW A;  2QPN A;  3RXW A;  3S4X A;  4GN2 A;  1BLC A;  4GNU A;  4S2N A;  4PMA A;  1L0E A;  1VM1 A;  2OLU A;  3DWK A;  3HRE A;  2EX9 A;  1Q2P A;  3SS3 A;  2ZC4 B;  2QZ6 A;  5GLD A;  4LCL A;  5EVL A;  4BLM A;  3IWI A;  1MBL A;  5M1A A;  3BFF A;  4P0M A;  1BLH A;  5E2E A;  5EOE A;  3ZVW A;  1YLZ A;  3O87 A;  3IXB A;  3PBR A;  3WS5 A;  5AQB A;  1E4D A;  3O3V A;  4WM9 A;  4BJP A;  4OOM A;  4OOL A;  1G68 A;  1MWS A;  2JBF A;  5FQJ A;  5GLC A;  1ZKJ A;  4R4R A;  4KZ6 A;  4K91 A;  4BL3 A;  5I94 A;  1ERO A;  2EX2 A;  3UE1 A;  1NZU A;  2HPB A;  2I72 A;  4B88 A;  5EUA A;  2EFU A;  4CJN A;  1FR6 A;  3G2Y A;  5E2G A;  1K57 A;  3HLD A;  2WZZ A;  1PWG A;  1K56 D;  1MWR A;  4KZA A;  4OKP A;  3QHY A;  3DWZ A;  1H8Z A;  5U47 A;  5FQM A;  4X69 A;  5L2F A;  1WYC A;  2XDM A;  4OP5 A;  4Y7P A;  3HLF A;  3B3X A;  2ZM0 A;  4LCM A;  4P6B A;  3IHB A;  4MLL A;  3UDI A;  3UY6 A;  4GKU A;  1DJC A;  3G34 A;  1K54 C;  4JXW A;  3VOY A;  4UAA A;  3LY3 A;  2BG1 A;  4KZ9 A;  3S1Y A;  2V2F F;  4X53 A;  4FD8 A;  4EBP A;  2BLS A;  1IKG A;  1Y54 A;  3N6I A;  3GV9 A;  1L0F A;  1ERM A;  2A49 A;  2H10 A;  2V20 A;  3Q7V A;  4UA6 A;  4OPZ A;  2ZMA A;  1VQQ A;  3SS5 A;  1E25 A;  4UA9 A;  1YLT A;  1ESU A;  1WE4 A;  3LCE A;  2RCX A;  1K25 A;  5CRF A;  4M3K A;  4FH4 A;  3OCL A;  3UNW A;  4H8R A;  2XD1 A;  4JXV A;  1O7E A;  1PZO A;  3M2J A;  4Y0U A;  2ZQD A;  5FQI A;  4BD0 A;  1KGE A;  3IXD A;  2EXA A;  1IYP A;  3C4O A;  3HLB A;  3Q82 A;  4R0Q A;  3ISG A;  2WGV A;  4S2L A;  1NY0 A;  4ZDX A;  3IF6 A;  4R3B A;  4WEJ A;  4WZ5 A;  2PU4 A;  1O07 A;  3IF5 A;  3BFD A;  1K38 A;  3VSL A;  3VP1 A;  1LL5 A;  1QME A;  1FCN A;  4X6T A;  4UA7 A;  4E3M A;  3M2K A;  3PBQ A;  2ZLY A;  3EQU A;  3CMZ A;  4OPQ A;  1ALQ A;  3BFG A;  3IXH A;  3UE3 A;  1HD8 A;  3A3F A;  5E43 A;  1K6S A;  2PBY A;  3TOI A;  4QB8 A;  4KZ3 A;  3ZGA B;  3PBT A;  1PZP A;  3CZD A;  2Q9N A;  1RGY A;  3FV7 A;  5CTN A;  2IWC A;  1Z6F A;  2Z2M B;  1JWP A;  2Y91 A;  2EX8 A;  4R1G A;  3ZDJ A;  3C7U A;  1EI5 A;  4KZB A;  3ZNT A;  2WKH A;  2XK1 A;  4MBK A;  1XGJ A;  2ZC6 B;  5A92 A;  3AGE A;  5DTT A;  1BLS A;  3PBN A;  3M6H A;  5EEC A;  3Q7V B;  1RP5 A;  3QNB A;  5FI7 A;  1FSW A;  1BT5 A;  4JXG A;  1XPB A;  2Y55 A;  3HUM A;  1CK3 A;  3W4O A;  3DW0 A;  1IKI A;  5FI6 A;  1FSY A;  4JF5 A;  4OQI A;  3PBO A;  3ZG5 A;  1E3U D;  1G6A A;  1KE4 A;  2HDS A;  5AQ7 A;  1FOF A;  1PW8 A;  5FAQ A;  2XF3 A;  3N4I A;  1PWD A;  4X56 A;  3OPL A;  1YLY A;  3IF6 B;  1YLJ A;  3PAE A;  4XXR A;  1BTL A;  5HFO A;  3BLS A;  3FWL A;  4OQH A;  5HAI A;  4D2O A;  2J8Y A;  2ZQ7 A;  3GSG A;  2ZM2 A;  4U3T A;  4N9K A;  4O7D A;  4UHU A;  3I7J A;  5FI2 A;  5TGF A;  1MY8 A;  1TDG A;  1I5Q A;  1W5D A;  2G2U A;  5HX9 A;  1RGZ A;  4JF6 A;  3NDG A;  2HP5 A;  4OQG A;  5DF9 A;  4CPK A;  2HDQ A;  3O86 A;  4GD6 A;  4B4X A;  2XR0 A;  3IH8 A;  3OPP A;  3N8L A;  3G2Z A;  5FAS A;  5A93 A;  3MBZ A;  2VGJ A;  3OZH A;  5JYP A;  1BLP A;  3CG5 A;  4EUZ A;  5DF7 A;  3NBL A;  5F82 A;  1ES3 A;  4OH0 A;  5EPH A;  5TFQ A;  3Q7Z A;  3GQZ A;  3GTC A;  2XFT A;  4PM7 A;  3S22 A;  4RA7 A;  2JE5 A;  1AXB A;  1L0G A;  1KGF A;  2H5S A;  3G32 A;  3VP2 A;  4OPR A;  4OLG A;  1J9M A;  4S2P A;  5GLA A;  3UE0 A;  3UN7 A;  1C3B A;  2WKE A;  3BM6 A;  3SH9 A;  5A90 A;  4WEK A;  2XD5 A;  4IED A;  1TVF A;  1NJ4 A;  1M6K A;  3VP0 A;  5FDH A;  4C75 A;  2Q9M A;  1GA9 A;  1W8Y A;  2OV5 A;  3UPN A;  3ZG8 B;  1K54 A;  1BUL A;  2UWX A;  4DXC A;  4EWF A;  4ID4 A;  5CHJ A;  4E3N A;  3G31 A;  3WRZ A;  5AQ9 A;  2X71 A;  4GOG A;  1NXY A;  2Y2J A;  3SOI A;  1SDE A;  2Y2Q A;  4KQR A;  3G35 A;  3LO7 A;  5JYO A;  4HES A;  1SCW A;  4U0T A;  1U60 A;  1K56 A;  4ZJ1 A;  4DKI A;  2B5R A;  2XQZ A;  2Y2O A;  1K4F A;  3FYZ A;  4A5R A;  4BQM A;  1N4O A;  4EBN A;  1YLW A;  2DRW A;  4DXB A;  3VP4 A;  1KGG A;  4FCF A;  4DE1 A;  4PM5 A;  5F83 A;  4KG2 A;  4QY5 A;  4NET A;  1JVJ A;  1MWT A;  5FA7 A;  5IHV A;  1W8Q A;  1JTD A;  1NZO A;  1QMF A;  3BEB A;  1XKZ A;  4R4S A;  3IQA A;  1IYQ A;  5EE8 A;  2H0T A;  5FAO A;  5F1G A;  3MXS A;  4S2J A;  4HBT A;  5HL1 A;  1PW1 A;  4PM9 A;  3IT9 A;  3N8R A;  3O88 A;  3A3J A;  5FQ9 A;  3MKF A;  4BD1 A;  4P85 A;  3VOZ A;  4EBL A;  1GHI A;  4E6X A;  2QMI A;  3V3S A;  2J9P A;  3ZG0 A;  2J9O A;  4LV1 A;  3ITB A;  3PAG A;  3CJM A;  1K55 C;  1ZC2 A;  1H5X A;  3Q1F A;  5FQQ A;  1YMS A;  3NC8 A;  1M40 A;  4DE3 A;  1MPL A;  4GDB A;  5HAQ A;  4E6W A;  4R3J A;  1CI8 A;  3N7W A;  4RX3 A;  1FQG A;  2C5W B;  3IHA A;  3QNC A;  1MKI A;  4FH2 A;  3A3I A;  3UPP A;  5KSH A;  1IEL A;  2ZC5 B;  5CGX A;  3G30 A;  4JXS A;  3WS2 A;  5G18 A;  1KDS A;  5M19 A;  1OME A;  2XFS A;  4QY6 A;  1PYY A;  5D3O A;  5J8X A;  2GDN A;  4PM6 A;  4MNR A;  4JF4 A;  2IWD A;  1K4E A;  5EVI A;  1BUE A;  4E3J A;  4S2M A;  5BOH A;  1PI4 A;  2WYX A;  4EQI A;  2Y4A A;  1JTG A;  3W4Q A;  4DF6 A;  3IWO A;  4JKT A;  1FCO A;  4R23 A;  2Z2L B;  3C7V A;  4E3I A;  3VSK A;  1ZG4 A;  1MWU A;  3WWX A;  2WGW A;  1XGI A;  4ZAM A;  5FSR A;  1HZO A;  3D4F A;  4X68 A;  5GHY A;  2XH9 A;  1LI9 A;  3SH7 A;  3MZF A;  5GHX A;  4WEL A;  5CGW A;  3WRT A;  3WS0 A;  3FZC A;  2X01 A;  3DTM A;  1XA7 A;  3UDX A;  2Y2I A;  3MKE A;  1E3U A;  3ZFZ A;  1NYM A;  4HEF A;  1HVB A;  5TR7 A;  1SDN A;  2OLV A;  4WMC D;  3HVF A;  4KZ7 A;  1CEF A;  2EX6 A;  1CEG A;  2ZD8 A;  2WAF A;  4Y0T A;  1LL9 A;  1LI0 A;  3W8K A;  2C6W B;  1DY6 A;  3LY4 A;  3OCN A;  4HBU A;  1YM1 A;  4S2O A;  2XLN A;  3G4P A;  5CHU A;  1H8Y A;  3HBR A;  3ZVT A;  1XXM A;  3VFH A;  3IWQ A;  2CC1 A;  1W79 A;  4OQ0 A;  5GL9 A;  3C4P A;  4C6Y A;  2E8I A;  4GZB A;  3C5A A;  3PBS A;  1KE0 A;  3V50 A;  1YMX A;  3GMW A;  4KQQ A;  3ZG7 B;  4E3O A;  3AGD A;  4OP8 A;  3HUN A;  5DF8 A;  4FSF A;  3VMA A;  3WS1 A;  5EVI B;  4N1X A;  4NK3 A;  2FFF B;  3BFC A;  2JCH A;  4RVA A;  1W7F A;  2PU2 A;  2WUQ A;  2Y2N A;  5GHZ A;  3SS4 A;  3TG9 A;  3W4P A;  5CTM A;  3UPO A;  2DCF A;  4MEZ A;  4DE2 A;  2WGW B;  2DNS A;  5DVA A;  5F1F A;  2G2W A;  4GB7 A;  4WYY A;  3RXX A;  5KMW A;  2ZQA A;  4N9L A;  1L0D A;  4Y0O A;  1KDW A;  4QHC A;  1TEM A;  4N92 A;  4OVD A;  3V3R A;  4S2N C;  4IVI A;  4KEN B;  4YFM A;  1FR1 A;  1Q2Q A;  3OC2 A;  3VP3 A;  3LEZ A;  3Q07 A;  3BEC A;  4IVK A;  1I2W A;  5GLB A;  4P87 A;  1JWV A;  1KVM A;  2HP9 A;  4PM8 A;  1XP4 A;  3AGF A;  3IXG A;  4QD4 A;  1I2S A;  3WS4 A;  4DE0 A;  5CEB A;  4DDS A;  4KZ8 A;  2X02 A;  5CGS A;  1KE3 A;  3N8S A;  4OLD A;  2R9X A;  4WBG A;  3JYI A;  5FAT A;  4F94 A;  4E3L A;  1ES4 A;  1HTZ A;  1ESI A;  3ZG9 B;  1KVL A;  2RL3 A;  1XA1 A;  3E2K A;  2Y59 A;  2P9V A;  3NIA A;  1BZA A;  3OPH A;  2EXB A;  2XGN A;  4N1H A;  4RX2 A;  5E2H A;  3E2L A;  1YLP A;  4L0L A;  4MBH A;  4KG6 A;  1K55 A;  2ZQC A;  1FCM A;  3MFD A;  4K0W A;  2WKI A;  3HLG A;  4K0X A;  4KZ4 A;  1ONH A;  3VFF A;  1N9B A;  1K57 C;  2WGI A;  3BRM A;  3NY4 A;  3P09 A;  4GDN A;  5CER A;  4BL2 A;  4DRT A;  2J7V A;  2Y2K A;  1S0W A;  1SHV A;  2Y2G A;  1SKF A;  4E3K A;  3GR2 A;  2HP6 A;  4ZBE A;  3ZNY A;  2VGK A;  2IWB A;  1IYO A;  3HLW A;  4DDY A;  3V5M A;  3NCK A;  1YT4 A;  4JPM A;  4KZ5 A;  1IYS A;  4WZ4 A;  1K6R A;  4QJG A;  4KQO A;  1ZG6 A;  3A3D A;  3OPR A;  3HUO A;  3IH9 A;  3MZE A;  3PTE A;  1GHP A;  1PIO A;  2H0Y A;  3P98 A;  3HLE A;  4OPY A;  3UDF A;  2FFY A;  1JWZ A;  4GD8 A;  4BEN A;  2OSU A;  1LLB A;  5KSC A;  2EFX A;  5A91 A;  1NRF A;  3EQV A;  1MXO A;  3BYD A;  4ZTK A;  1CI9 A;  2A3U A;  3BLM A;  4U0X A;  1PWC A;  2XEP A;  4IBR A;  4LEN A;  4RYE A;  2V1Z A;  4S2K A;  4ZJ2 A;  4LV2 A;  3NI9 A;  3IF6 C;  4OOY A;  2ZQ9 A;  3MZD A;  4WZ5 C;  4JLF A;  5HW3 A;  1GCE A;  5E2F A;  2HDU A;  4S2I A;  2P9V B;  2P74 A;  2WAD A;  2WZX A;  4LV0 A;  5EVI D;  1TDL A;  1EWZ A;  1L2S A;  4EV4 A;  1NYY A;  4Q8I A;  1LHY A;  4ZJ3 A;  1YQS A;  1WYB A;  5CEC A;  4C3Q A;  2JC7 A;  1ONG A;  1IEM A; 
#chains in the Genus database with same CATH topology
 5EOO A;  2Y2H A;  1T1A A;  4OON A;  3M6B A;  3BFE A;  3V39 A;  3MXR A;  1OTE A;  2OWH A;  2ZM8 A;  5AVE A;  3QP8 A;  4I3I A;  4KG5 A;  2W3E A;  5HAP A;  4II7 A;  5EVI C;  1G5U A;  5AQA A;  4WMC A;  3LR4 A;  2W1T A;  1XX2 A;  3LIB A;  2Y2M A;  5DTS A;  5J4E A;  3DTK A;  3S4X A;  1BLC A;  4PHT A;  4PMA A;  1VM1 A;  3DWK A;  1Q2P A;  5GLD A;  3BY9 A;  2E8J A;  4BLM A;  4P0M A;  3P7N A;  5HWT A;  3O87 A;  3WS5 A;  5AQB A;  1E4D A;  1MWS A;  3PR6 A;  4BL3 A;  5I94 A;  3T1R A;  1K57 A;  2EWW A;  4O0P A;  3W2Z A;  1MWR A;  4R6L A;  3DWZ A;  1H8Z A;  1VHM A;  3B3X A;  4P6Z M;  4GKU A;  1VEU B;  3G34 A;  2BG1 A;  3LIC A;  3BQA A;  1Y54 A;  3GV9 A;  3LIA A;  2A49 A;  3Q7V A;  1E25 A;  1YLT A;  3LCE A;  4GHI B;  1STZ A;  4Y0U A;  2P04 A;  4HP4 A;  1KGE A;  4NG2 A;  2VA0 A;  1XJ6 A;  3IF5 A;  4E3M A;  2KLI A;  1VET A;  3LEQ A;  4LFU A;  3BFG A;  1HD8 A;  4HI4 A;  2JHE A;  4QB8 A;  3VV4 A;  3H82 A;  3FV7 A;  2IWC A;  1JWP A;  2Y91 A;  3ZDJ A;  3C7U A;  1EI5 A;  1OJ5 A;  4KZB A;  4EU0 A;  3M6H A;  1FSW A;  3ULF A;  4CLC C;  2VV8 A;  1XPB A;  2HZ5 A;  3HUM A;  3W4O A;  4HJ6 A;  4OQI A;  4LPZ A;  1G6A A;  1FOF A;  5HFO A;  1V9Z A;  3OBF A;  3IBR A;  2WKP A;  2ZBB A;  2ZQ7 A;  1SKO B;  5TGF A;  3UB5 P;  1W5D A;  3BWL A;  4JF6 A;  3SW1 A;  3P01 A;  4OQG A;  4CPK A;  1OPX A;  3OPP A;  3MFX A;  5JYP A;  4F3L A;  2L0W A;  3CG5 A;  2QJ5 A;  2D01 A;  5F82 A;  1AWI A;  5TFQ A;  3GTC A;  4WF0 A;  4HJ3 A;  3IX4 A;  2JE5 A;  2H5S A;  4OPR A;  4OLG A;  4S2P A;  3UE0 A;  3VE4 A;  1S66 L;  4E04 A;  2WKE A;  3BM6 A;  5A90 A;  4WEK A;  2XD5 A;  4IED A;  1TS6 A;  4GS9 B;  4IJG A;  4C75 A;  2OV5 A;  3ZG8 B;  2J80 A;  1BUL A;  2UWX A;  4EWF A;  1OTB A;  2V0U A;  4KQR A;  1G28 A;  3G35 A;  3LO7 A;  5JYO A;  4U0T A;  1U60 A;  4DKI A;  2Y2O A;  1N4O A;  4KG2 A;  4NET A;  3T4L A;  1LSX A;  5IHV A;  1W8Q A;  3T4J A;  1QMF A;  3BEB A;  2L4R A;  3MMH A;  5HDC A;  2H0T A;  5FAO A;  2XA7 M;  4PM9 A;  3O88 A;  4E6X A;  2G7U A;  3ZG0 A;  2J9O A;  4LV1 A;  3PAG A;  3NC8 A;  4DE3 A;  1UWN X;  4EES A;  3QNC A;  3GDI A;  3S7Q A;  3UPP A;  1IEL A;  5CGX A;  5HL6 A;  3E4O A;  2ZL1 B;  4QY6 A;  3CPT A;  5L09 A;  3B42 A;  1TS8 A;  3IWO A;  4JGO A;  3VSK A;  3WWX A;  2WGW A;  1VB6 A;  3D4F A;  3BY8 A;  4LRZ E;  4WEL A;  5CGW A;  5GHX A;  2X01 A;  3DTM A;  3F1N B;  3MS6 A;  3UDX A;  5FEG A;  3NJA A;  3QP2 A;  1N9N A;  4NXE A;  2OLV A;  5DJU A;  3HVF A;  2JKF A;  1CEG A;  2ZD8 A;  1DY6 A;  5TBM A;  4HBU A;  4CLC B;  3BJN A;  3HBR A;  3ZVT A;  2VV7 A;  1VEU A;  2CC1 A;  1W79 A;  4HNB A;  3V50 A;  3GMW A;  4KQQ A;  3ZG7 B;  5DF8 A;  4N1X A;  2P08 A;  3BFC A;  3LR0 A;  2WUQ A;  4BBU A;  1GSW A;  5GHZ A;  4R70 A;  2Q0O A;  4MEZ A;  4DE2 A;  5DVA A;  2NUT C;  5KMW A;  2PRF A;  2ZQA A;  1TEM A;  1EW0 A;  4IVI A;  1Q2Q A;  3OC2 A;  2Z6D A;  4H6J A;  3BQ8 A;  3BEC A;  1K0K A;  4L9G A;  5DJT A;  5F69 A;  1XP4 A;  3IXG A;  3T4T A;  3WS4 A;  1I2S A;  3C30 A;  2X02 A;  1KE3 A;  2R9X A;  4E3L A;  1HTZ A;  2B02 A;  1OJG A;  3NIA A;  1OTD A;  3F1O B;  4N1H A;  4KG6 A;  1K55 A;  1FCM A;  4K0W A;  1ONH A;  2VLG A;  2H28 A;  3P09 A;  1SHV A;  4Z1W A;  1NLY A;  2IA2 A;  1S67 L;  1YAX A;  3ZNY A;  2V1A A;  4ME4 A;  4JPM A;  4WZ4 A;  4GW9 A;  4QJG A;  4KQO A;  1ZG6 A;  3IH9 A;  3PTE A;  2VV6 A;  2H0Y A;  4EET B;  2FFY A;  3QP6 A;  4BEN A;  1XJ4 A;  2W0N A;  3H7W B;  4ETX A;  3EQV A;  1MXO A;  5F5Y A;  3S7P A;  3BYD A;  3BLM A;  4RYE A;  2V1Z A;  3NI9 A;  4MN7 A;  2ZQ9 A;  5HW3 A;  4JLF A;  1GCE A;  3T4K A;  4S2I A;  3KSF A;  2P9V B;  2WKR A;  3B33 A;  2P74 A;  2WAD A;  5KIZ A;  1EWZ A;  4ZJ3 A;  1YQS A;  4DMZ A;  4Q0J A;  3LGO A;  5FQK A;  4IBX A;  1Y4O A;  1DJA A;  5FAP A;  2QKP A;  1H0M A;  4UQI M;  5M18 A;  5DTK A;  4HH2 A;  3CAX A;  2HDR A;  3R7W B;  4LV3 A;  4Z9Q A;  1ES2 A;  4MBF A;  1ERQ A;  4QU3 A;  3ZCZ A;  2Y2L A;  5HAR A;  2R9W A;  3FKV A;  3UO9 A;  1ES5 A;  1GA0 A;  2ZQ8 A;  4B4Z A;  3ZQ5 A;  4PPR A;  3ITA A;  5CXW A;  2QPN A;  2PBD P;  2B18 A;  1L0E A;  2OLU A;  1P97 A;  2ZC4 B;  3KYQ A;  4LCL A;  3IWI A;  1MBL A;  5MC7 A;  1BLH A;  5EOE A;  3IXB A;  3PBR A;  4OOL A;  2JBF A;  3LR5 A;  5FQJ A;  5FL3 A;  5K5B A;  4KZ6 A;  2EX2 A;  3UE1 A;  2HPB A;  3K3C A;  5EUA A;  5I5L A;  2V1B A;  3HLD A;  2WZZ A;  1PWG A;  3FPW A;  4OKP A;  5U47 A;  1WYC A;  2XDM A;  4OP5 A;  2PR5 A;  3UY6 A;  1DJC A;  4AFI A;  1K54 C;  1J3W A;  1MKM A;  4UAA A;  3LY3 A;  3S1Y A;  2BLS A;  1IKG A;  1L0F A;  1ERM A;  4OPZ A;  3LYX A;  1WE4 A;  5CRF A;  4FH4 A;  3C8C A;  4H8R A;  1S4R A;  1UWP X;  3PXP A;  5FQI A;  3IXD A;  2EXA A;  3C4O A;  3HLB A;  2WGV A;  1NY0 A;  3IF6 A;  4R3B A;  4WZ5 A;  1TS0 A;  3BFD A;  2ZMF A;  4X6T A;  4UA7 A;  3M2K A;  3PBQ A;  3IXH A;  3A3F A;  2Y79 A;  2QWS A;  1PZP A;  2Q9N A;  3U4L P;  1RGY A;  1D06 A;  3F1P A;  2PYP A;  2XK1 A;  3AGE A;  5DTT A;  4NKP A;  5EEC A;  3RFB A;  5FI7 A;  5HZH A;  1CK3 A;  1OTA A;  1FSY A;  4JF5 A;  2XRO A;  2HDS A;  4ESP A;  2ZMV A;  2XF3 A;  3N4I A;  4X56 A;  4Y13 A;  1YLY A;  4BBT A;  3PAE A;  4XXR A;  1N9O A;  3GSG A;  2ZM2 A;  4U3T A;  4N9K A;  2VZW A;  2PYR A;  1MY8 A;  1I5Q A;  2UV0 E;  2G2U A;  5HX9 A;  2HP5 A;  4B4X A;  2XR0 A;  4HJ4 A;  2K31 A;  1UGU A;  3G2Z A;  3F1O A;  1BLP A;  4EUZ A;  5DF7 A;  3NBL A;  1ES3 A;  3UB9 A;  1DP9 A;  2PT7 A;  3Q7Z A;  4PM7 A;  4RA7 A;  3G32 A;  3VP2 A;  1J9M A;  1C3B A;  2ACG A;  2HGV A;  1M6K A;  1TF1 A;  5FDH A;  5DFY A;  1GA9 A;  1W8Y A;  3UPN A;  5HWW A;  4ID4 A;  3MF0 A;  1MC0 A;  3G31 A;  4D60 A;  3WRZ A;  5AQ9 A;  5L07 A;  4GOG A;  2Y2J A;  3CWF A;  1SDE A;  2Y2Q A;  3T4Q A;  5HD3 A;  3CLO A;  4HES A;  2K7S A;  5HWV A;  4ZJ1 A;  3L9K A;  2XQZ A;  1K4F A;  3FYZ A;  4A5R A;  4BQM A;  1YLW A;  3HJI A;  4DE1 A;  3A0R A;  1T1B A;  1XKZ A;  4R4S A;  1IYQ A;  3MXS A;  4S2J A;  4HBT A;  2K2N A;  1PW1 A;  3IT9 A;  3N8R A;  5FQ9 A;  4LLO B;  4BD1 A;  3V3S A;  2OAP 1;  3CJM A;  3MQ0 A;  5FQQ A;  1H5X A;  4I3A A;  3VE3 A;  1YMS A;  1M40 A;  4GDB A;  2JKR M;  5HAQ A;  4R3J A;  1CI8 A;  5HPI A;  3N7W A;  4RX3 A;  1H8M A;  3EOI A;  3CI6 A;  1OME A;  4Y3I A;  2XFS A;  5D3O A;  4MNR A;  4JF4 A;  1D7E A;  1K4E A;  2IWD A;  1BUE A;  1PI4 A;  4I39 A;  4EQI A;  2M1C A;  2Z2L B;  2W27 A;  1ZG4 A;  4O01 A;  4X68 A;  3D3O A;  2VGL M;  2XH9 A;  5GHY A;  3FZC A;  3CHW P;  2Y2I A;  3MKE A;  1H3Q A;  2J3T C;  2A24 B;  5TR7 A;  1SDN A;  3LFV A;  2C6W B;  1L3L A;  2XLN A;  3TRC A;  4FOF A;  1H8Y A;  1XXM A;  3VFH A;  4OQ0 A;  3C4P A;  1IOU A;  1KE0 A;  1YMX A;  3T4S A;  1XFQ A;  3HUN A;  2FZ0 A;  5EVI B;  4NK3 A;  1CF0 A;  2JCH A;  1W7F A;  2GNX A;  3JVV A;  5G4Z A;  3NHQ A;  5F1F A;  3RXX A;  4WYY A;  4N9L A;  4OVD A;  1HLU P;  3VP3 A;  3LEZ A;  1I2W A;  4MMN A;  2HP9 A;  3IS2 A;  2QJ7 A;  4DE0 A;  2EA9 A;  5CGS A;  3SZT A;  5L10 A;  3JYI A;  1ESI A;  5IT5 A;  1XA1 A;  3E2K A;  2EXB A;  1Y28 A;  4G3V A;  4KZ4 A;  3VFF A;  3MR0 A;  1K57 C;  2WGI A;  3BRM A;  3NY4 A;  5CER A;  2Y2K A;  2Y2G A;  2NUP C;  3DBA A;  1IYO A;  1LL8 A;  4DDY A;  3V5M A;  1K6R A;  3A3D A;  3MZE A;  1PIO A;  2VKS A;  5IU1 A;  2OSU A;  5KSC A;  5DKL A;  1CI9 A;  5HD5 A;  4L9E A;  2D02 A;  2V0W A;  4LV2 A;  4P6Z S;  3MZD A;  2PD7 A;  2WKQ A;  3EGX C;  1N9L A;  2WZX A;  5EVI D;  4EV4 A;  4Q8I A;  3DTI A;  2JC7 A;  4P6B A;  4QPR A;  1ONG A;  4MN5 A;  5HSQ A;  3T1Q B;  1OT9 A;  1RCJ A;  4X55 A;  5CED A;  4R38 A;  4YIN A;  3RJU A;  4XUZ A;  5FEF A;  3ZYT A;  1PI5 A;  2BTF P;  3GVB A;  3NDE A;  2ZC3 B;  3HCY A;  2ZC7 A;  2YKH A;  2WK0 A;  1ODV A;  4HY8 A;  3SH8 A;  1GHM A;  2LB9 A;  3RXW A;  4ARZ B;  4GN2 A;  4S2N A;  4X1L A;  2EX9 A;  3CUE A;  4GHI A;  4WL9 A;  4BMW A;  3FC7 A;  3JPU A;  3BFF A;  4LGW A;  5E2E A;  3ZVW A;  1YLZ A;  2YKF A;  3O3V A;  4Q0I A;  3QP4 A;  1G68 A;  2OAQ 1;  4Q0H A;  1T18 A;  1ERO A;  4B88 A;  1NZU A;  4KUO A;  4MCW A;  4CJN A;  1FR6 A;  3EEA A;  4RQ9 A;  4K08 A;  4X69 A;  3NOU C;  4Y7P A;  5EVE A;  1A0K A;  2JN7 A;  5EFW A;  4LCM A;  3UDI A;  4MLL A;  4EQ1 A;  4I38 A;  4JXW A;  4KZ9 A;  5G4Y A;  1TD5 A;  2HF6 A;  2ZMA A;  3SS5 A;  4UA9 A;  1ESU A;  3OCL A;  4JXV A;  1O7E A;  1YSQ A;  4EEU A;  2ZQD A;  3DAV A;  3Q82 A;  2V8C A;  3ISG A;  4WEJ A;  1Z09 A;  1QME A;  1SKO A;  3CMZ A;  4CLC D;  3MJQ A;  1ALQ A;  3KO6 A;  3UE3 A;  5E43 A;  1CQA A;  1K6S A;  2PBY A;  3TOI A;  4KZ3 A;  3ZGA B;  3PBT A;  3CZD A;  4EXO A;  4PKY G;  4XT2 B;  1Z6F A;  2Z2M B;  5LBR A;  3UB7 A;  2EX8 A;  4R1G A;  5J3W A;  5IS1 A;  4EUV A;  3ZNT A;  2WKH A;  1XGJ A;  5A8B A;  2ZC6 B;  3TE8 A;  3Q7V B;  1RP5 A;  3QNB A;  3A0S A;  3ICY A;  2ZOI A;  2XA7 S;  4GS9 A;  3DW0 A;  2KOI A;  1IKI A;  4ZRR A;  1T1C A;  5FI6 A;  3ZG5 A;  1PW8 A;  4NXG A;  5FAQ A;  3UMD A;  3EWK A;  2DMW A;  1BTL A;  4D2O A;  3I7J A;  1VET B;  2JKG A;  1TDG A;  1RGZ A;  3NDG A;  2HDQ A;  4GD6 A;  3KX0 X;  3IH8 A;  3H82 B;  5FAS A;  5A93 A;  3MBZ A;  2O9A A;  3MXQ A;  1GSV A;  2OWJ A;  1OTI A;  3PHY A;  2XFT A;  3S22 A;  1L0G A;  1AXB A;  1F5M A;  3NEC A;  2PDR A;  1TVF A;  1NJ4 A;  4DXC A;  2INW A;  5CHJ A;  5F68 A;  1NXY A;  1S4S A;  4IHQ A;  3SOI A;  1KOU A;  2CMN A;  2ZL1 A;  3NOT C;  3UME A;  3VOL A;  2O9B A;  1SCW A;  2B5R A;  4LRY C;  4NXF A;  4EBN A;  1SZV A;  4DXB A;  1KGG A;  4PM5 A;  3EEH A;  1MWT A;  2ZOH A;  1F2K A;  1JTD A;  1NZO A;  4F3L B;  5EE8 A;  5C5K A;  3E98 A;  5HL1 A;  1BYW A;  3F1N A;  3A3J A;  2JKR I;  4P85 A;  3VOZ A;  4EBL A;  3H9W A;  1K55 C;  4FTX A;  4EER A;  4IUH A;  4GJ4 A;  3UB8 A;  3KSI A;  4B9O A;  4Y5F A;  4QWO A;  3IHA A;  4FH2 A;  5AJG A;  4CLC A;  3A3I A;  5KSH A;  2ZC5 B;  3R4K A;  3G30 A;  3KSG A;  3WS2 A;  5G18 A;  1KDS A;  2GDN A;  3T12 B;  5BOH A;  4S2M A;  2Y4A A;  4DF6 A;  4JKT A;  1FCO A;  3C7V A;  1XGI A;  5FSR A;  1HZO A;  4BWI A;  3MZF A;  3WRT A;  4G3W A;  4FUW A;  5HDD A;  1NYM A;  4HEF A;  1DP6 A;  1HVB A;  3IBJ A;  5J7E A;  2GX5 A;  2VK3 A;  4KZ7 A;  1CEF A;  2EX6 A;  1YSP A;  3W8K A;  3OCN A;  3LY4 A;  4S2O A;  5CHU A;  3D72 A;  4JGQ A;  2PR6 A;  4HP9 A;  5GL9 A;  3PYP A;  4Y17 A;  3C5A A;  4E3O A;  3CPT B;  1LT0 A;  2I9V A;  4FSF A;  3VMA A;  3WS1 A;  1MZU A;  4RVA A;  2Y2N A;  3SS4 A;  3TG9 A;  3UPO A;  2WGW B;  2DNS A;  2G2W A;  5HDS A;  4Y0O A;  1KDW A;  5EM0 A;  4N92 A;  1X0O A;  4UQI S;  1JNU A;  3H7W A;  1IFQ A;  5GLB A;  4P87 A;  2FH5 A;  1JWV A;  4PM8 A;  3AGF A;  4QD4 A;  4DDS A;  4KZ8 A;  4OLD A;  3NOP C;  4WBG A;  5FAT A;  1ES4 A;  4XT2 A;  4WN5 A;  5TBM B;  2P9V A;  4RX2 A;  3E2L A;  1YLP A;  4L0L A;  4BBV A;  1DRM A;  4K0X A;  3V67 A;  2WKI A;  4G3K A;  1D1J A;  4GDN A;  4DRT A;  2J7V A;  2PAV P;  1SKF A;  3HLW A;  4DJ2 A;  3NCK A;  1YT4 A;  3R7W A;  1PFL A;  2W3H A;  3HUO A;  1GHP A;  1W63 Q;  3P98 A;  4OPY A;  3UDF A;  4JGR A;  1JWZ A;  4H6J B;  2EFX A;  1NRF A;  4ZTK A;  2A3U A;  2XEP A;  4B93 A;  4IBR A;  4LEN A;  4S2K A;  3IF6 C;  4OOY A;  4WZ5 C;  1F98 A;  5E2F A;  2JKT M;  3OLO A;  4O8G A;  1L2S A;  2QHK A;  3TW8 A;  1NYY A;  1LHY A;  1WYB A;  2O0Y A;  4Y15 A;  4KQD A;  1IEM A;  4F94 A;  3A3E A;  5KZH A;  2Z6C A;  2KX6 A;  2Y2P A;  1DJB A;  2WAE A;  5CHM A;  1PRQ A;  3UB6 A;  4PAU A;  3Q81 A;  3HLC A;  3FKW A;  1YPR A;  3C38 A;  2V8F A;  4XUX A;  4JBF A;  3KYZ A;  3LI8 A;  3ZHH A;  3HL9 A;  1S6R A;  4M4X A;  1TS7 A;  2ZJ9 A;  4JGP A;  3LIE A;  4HHD A;  3C2W A;  3TSG A;  1BSG A;  3GRJ A;  4ETZ A;  4GNU A;  1WA9 A;  3E0Y A;  3HRE A;  3SS3 A;  4YWZ A;  4DN0 A;  2QZ6 A;  3S7N A;  3LR3 A;  3O5Y A;  5EVL A;  1LSV A;  5M1A A;  2VEA A;  2R78 A;  3MQQ A;  1LSW A;  4WM9 A;  4BJP A;  3DTE A;  4OOM A;  2HJ9 C;  5GLC A;  1XJ3 A;  1ZKJ A;  3CIT A;  4R4R A;  4K91 A;  2I72 A;  4X1M A;  2EFU A;  3G2Y A;  4WUJ A;  5E2G A;  3NUL A;  1F9I A;  5FDS A;  1K56 D;  4KZA A;  3QHY A;  1ACF A;  5FQM A;  5L2F A;  4GLQ A;  3HLF A;  4NXB A;  1YKD A;  2ZM0 A;  3IHB A;  3D9Y A;  3VOY A;  2XSS A;  2V2F F;  4X53 A;  2VJW A;  4FD8 A;  4EBP A;  5AVF A;  4DJ3 A;  3N6I A;  3IX3 A;  2V20 A;  2H10 A;  4L9F A;  4UA6 A;  3U2A A;  1VQQ A;  3LID A;  3T4O A;  2RCX A;  1K25 A;  4M3K A;  1P9R A;  3UNW A;  2XD1 A;  1PZO A;  3M2J A;  1ZHH B;  3JVU A;  4I5S A;  4BD0 A;  3QP5 A;  1IYP A;  4R0Q A;  4S2L A;  4ZDX A;  3T1S A;  1O07 A;  2PU4 A;  2VX8 A;  1K38 A;  3VSL A;  3VP1 A;  1LL5 A;  1FCN A;  4Y2F A;  2ZLY A;  3EQU A;  2W3G A;  1FIL A;  4OPQ A;  2MJ6 A;  4HH3 A;  2PHY A;  2BAS A;  2KDK A;  4YOF A;  1CJF A;  1GSX A;  5CTN A;  4LRX C;  2A2L A;  3G6O A;  4MBK A;  1NWZ A;  4X25 A;  5A92 A;  1BLS A;  3MSH A;  3PBN A;  1BT5 A;  4JXG A;  3K3D A;  2Y55 A;  4R3A A;  3PBO A;  1E3U D;  1V9Y A;  1KE4 A;  5AQ7 A;  1PWD A;  3OPL A;  3IF6 B;  1YLJ A;  1P0Z A;  1XJ2 A;  3BLS A;  3FWL A;  4OQH A;  1S1Z A;  5HAI A;  2GZA A;  2J8Y A;  5FI2 A;  4UHU A;  4O7D A;  3E4Q A;  5L8M A;  3LUQ A;  3IX8 A;  5DF9 A;  2GJ3 A;  3O86 A;  2QYB A;  2W3F A;  2XRN A;  4NEE D;  3N8L A;  3OZH A;  2VGJ A;  4MN6 A;  2LB5 A;  1NRJ A;  4OH0 A;  5EPH A;  2W1R A;  1OT6 A;  3F1P B;  3GQZ A;  2HV1 A;  1KGF A;  5GLA A;  2AVX A;  3UN7 A;  3SH9 A;  2VGL S;  3VP0 A;  3T1X A;  2Q9M A;  4HQA A;  1K54 A;  1W63 M;  4E3N A;  4KUK A;  2X71 A;  3LIF A;  4EEP A;  2O99 A;  4IUK A;  2HJE A;  2OOL A;  2W1T B;  1K56 A;  3GEC A;  2DRW A;  2O9C A;  3VP4 A;  4FCF A;  5F83 A;  3L7H A;  4QY5 A;  5DFX A;  1JVJ A;  5FA7 A;  3IQA A;  5F1G A;  2M7U A;  3S7O A;  3KSH A;  3MKF A;  3E4P A;  3B47 A;  1GHI A;  4GCZ A;  2QMI A;  2J9P A;  2B95 A;  3ITB A;  5CX7 A;  3Q1F A;  1ZC2 A;  2A24 A;  1MPL A;  2EWV A;  4E6W A;  1XFN A;  1FQG A;  2C5W B;  1MKI A;  4JXS A;  4UEY A;  5M19 A;  3K2N A;  2J3T D;  1PYY A;  3HJK A;  4CQH A;  5J8X A;  4PM6 A;  5EVI A;  4E3J A;  2WYX A;  1JTG A;  1PNE A;  3W4Q A;  5EV0 A;  4R23 A;  4E3I A;  3A0V A;  1MWU A;  4ZAM A;  3KYE A;  5HPF A;  3SH7 A;  1LI9 A;  2P7J A;  3WS0 A;  3QP1 A;  1XA7 A;  4YNR A;  2J3W A;  1E3U A;  3ZFZ A;  2M7V A;  3FG8 A;  3RH8 B;  4MDZ A;  2W3D A;  3OOV A;  4WMC D;  4I3J A;  4WLA A;  2WAF A;  4Y0T A;  1LL9 A;  1LI0 A;  3BW6 A;  1YM1 A;  3G4P A;  3LI9 A;  2L1M A;  2Y8H A;  3IWQ A;  4C6Y A;  2E8I A;  4GZB A;  3PBS A;  3EGD C;  3AGD A;  4OP8 A;  2FFF B;  2PU2 A;  4HOI A;  3W4P A;  5CTM A;  2DCF A;  4GB7 A;  1L0D A;  3V3R A;  4QHC A;  4PKY A;  4YFM A;  4S2N C;  4KEN B;  1FR1 A;  3FPV A;  1S1Y A;  5EM1 A;  3CUE C;  3Q07 A;  4IVK A;  1P9W A;  1KVM A;  5CEB A;  5F6A A;  3N8S A;  2V9A A;  3ZG9 B;  1KVL A;  2RL3 A;  2Y59 A;  3OPH A;  1BZA A;  2XGN A;  1G6O A;  5E2H A;  1T19 A;  4MBH A;  2ZQC A;  3T50 A;  3MFD A;  3HLG A;  1N9B A;  3UE6 A;  4BL2 A;  1S0W A;  4E3K A;  3GR2 A;  2HP6 A;  5TJJ A;  4ZBE A;  2VGK A;  2IWB A;  4KZ5 A;  1IYS A;  4EW7 A;  3OPR A;  3HLE A;  4GD8 A;  1LLB A;  5A91 A;  4U0X A;  3IS2 B;  4CLC E;  1PWC A;  2JKT I;  4HIA A;  1NLZ A;  2PD8 A;  4ZJ2 A;  4ARZ A;  3MQO A;  1FIK A;  2HDU A;  5DKK A;  3RTY A;  4LV0 A;  3TJZ C;  1TDL A;  1DP8 A;  5CEC A;  4C3Q A;  1ZTU A; 
#chains in the Genus database with same CATH homology
 4IBX A;  3A3E A;  5KZH A;  5EOO A;  2Y2H A;  1DJA A;  2Y2P A;  1DJB A;  5FAP A;  2WAE A;  4OON A;  5CHM A;  3M6B A;  1RCJ A;  4X55 A;  3BFE A;  5CED A;  3V39 A;  3MXR A;  5M18 A;  3Q81 A;  5DTK A;  3HLC A;  3FKW A;  5FQK A;  4YIN A;  3RJU A;  2ZM8 A;  2HDR A;  4XUZ A;  4XUX A;  4JBF A;  4LV3 A;  4KG5 A;  4Z9Q A;  1ES2 A;  5HAP A;  1PI5 A;  3ZHH A;  3GVB A;  5EVI C;  4MBF A;  1ERQ A;  4QU3 A;  3HL9 A;  3NDE A;  3ZCZ A;  1S6R A;  2ZC3 B;  2Y2L A;  2ZJ9 A;  5AQA A;  5HAR A;  4WMC A;  2R9W A;  2ZC7 A;  3FKV A;  3UO9 A;  1ES5 A;  1XX2 A;  1GA0 A;  2WK0 A;  2ZQ8 A;  3TSG A;  1BSG A;  4B4Z A;  3GRJ A;  3SH8 A;  2Y2M A;  1GHM A;  5DTS A;  4PPR A;  3ITA A;  5CXW A;  2QPN A;  3RXW A;  3S4X A;  4GN2 A;  1BLC A;  4GNU A;  4S2N A;  4PMA A;  1L0E A;  1VM1 A;  2OLU A;  3DWK A;  3HRE A;  2EX9 A;  1Q2P A;  3SS3 A;  2ZC4 B;  2QZ6 A;  5GLD A;  4LCL A;  5EVL A;  4BLM A;  3IWI A;  1MBL A;  5M1A A;  3BFF A;  4P0M A;  1BLH A;  5E2E A;  5EOE A;  3ZVW A;  1YLZ A;  3O87 A;  3IXB A;  3PBR A;  3WS5 A;  5AQB A;  1E4D A;  3O3V A;  4WM9 A;  4BJP A;  4OOM A;  4OOL A;  1G68 A;  1MWS A;  2JBF A;  5FQJ A;  5GLC A;  1ZKJ A;  4R4R A;  4KZ6 A;  4K91 A;  4BL3 A;  5I94 A;  1ERO A;  2EX2 A;  3UE1 A;  1NZU A;  2HPB A;  2I72 A;  4B88 A;  5EUA A;  2EFU A;  4CJN A;  1FR6 A;  3G2Y A;  5E2G A;  1K57 A;  3HLD A;  2WZZ A;  1PWG A;  1K56 D;  1MWR A;  4KZA A;  4OKP A;  3QHY A;  3DWZ A;  1H8Z A;  5U47 A;  5FQM A;  4X69 A;  5L2F A;  1WYC A;  2XDM A;  4OP5 A;  4Y7P A;  3HLF A;  3B3X A;  2ZM0 A;  4LCM A;  4P6B A;  3IHB A;  4MLL A;  3UDI A;  3UY6 A;  4GKU A;  1DJC A;  3G34 A;  1K54 C;  4JXW A;  3VOY A;  4UAA A;  3LY3 A;  2BG1 A;  4KZ9 A;  3S1Y A;  2V2F F;  4X53 A;  4FD8 A;  4EBP A;  2BLS A;  1IKG A;  1Y54 A;  3N6I A;  3GV9 A;  1L0F A;  1ERM A;  2A49 A;  2H10 A;  2V20 A;  3Q7V A;  4UA6 A;  4OPZ A;  2ZMA A;  1VQQ A;  3SS5 A;  1E25 A;  4UA9 A;  1YLT A;  1ESU A;  1WE4 A;  3LCE A;  2RCX A;  1K25 A;  5CRF A;  4M3K A;  4FH4 A;  3OCL A;  3UNW A;  4H8R A;  2XD1 A;  4JXV A;  1O7E A;  1PZO A;  3M2J A;  4Y0U A;  2ZQD A;  5FQI A;  4BD0 A;  1KGE A;  3IXD A;  2EXA A;  1IYP A;  3C4O A;  3HLB A;  3Q82 A;  4R0Q A;  3ISG A;  2WGV A;  4S2L A;  1NY0 A;  4ZDX A;  3IF6 A;  4R3B A;  4WEJ A;  4WZ5 A;  2PU4 A;  1O07 A;  3IF5 A;  3BFD A;  1K38 A;  3VSL A;  3VP1 A;  1LL5 A;  1QME A;  1FCN A;  4X6T A;  4UA7 A;  4E3M A;  3M2K A;  3PBQ A;  2ZLY A;  3EQU A;  3CMZ A;  4OPQ A;  1ALQ A;  3BFG A;  3IXH A;  3UE3 A;  1HD8 A;  3A3F A;  5E43 A;  1K6S A;  2PBY A;  3TOI A;  4QB8 A;  4KZ3 A;  3ZGA B;  3PBT A;  1PZP A;  3CZD A;  2Q9N A;  1RGY A;  3FV7 A;  5CTN A;  2IWC A;  1Z6F A;  2Z2M B;  1JWP A;  2Y91 A;  2EX8 A;  4R1G A;  3ZDJ A;  3C7U A;  1EI5 A;  4KZB A;  3ZNT A;  2WKH A;  2XK1 A;  4MBK A;  1XGJ A;  2ZC6 B;  5A92 A;  3AGE A;  5DTT A;  1BLS A;  3PBN A;  3M6H A;  5EEC A;  3Q7V B;  1RP5 A;  3QNB A;  5FI7 A;  1FSW A;  1BT5 A;  4JXG A;  1XPB A;  2Y55 A;  3HUM A;  1CK3 A;  3W4O A;  3DW0 A;  1IKI A;  5FI6 A;  1FSY A;  4JF5 A;  4OQI A;  3PBO A;  3ZG5 A;  1E3U D;  1G6A A;  1KE4 A;  2HDS A;  5AQ7 A;  1FOF A;  1PW8 A;  5FAQ A;  2XF3 A;  3N4I A;  1PWD A;  4X56 A;  3OPL A;  1YLY A;  3IF6 B;  1YLJ A;  3PAE A;  4XXR A;  1BTL A;  5HFO A;  3BLS A;  3FWL A;  4OQH A;  5HAI A;  4D2O A;  2J8Y A;  2ZQ7 A;  3GSG A;  2ZM2 A;  4U3T A;  4N9K A;  4O7D A;  4UHU A;  3I7J A;  5FI2 A;  5TGF A;  1MY8 A;  1TDG A;  1I5Q A;  1W5D A;  2G2U A;  5HX9 A;  1RGZ A;  4JF6 A;  3NDG A;  2HP5 A;  4OQG A;  5DF9 A;  4CPK A;  2HDQ A;  3O86 A;  4GD6 A;  4B4X A;  2XR0 A;  3IH8 A;  3OPP A;  3N8L A;  3G2Z A;  5FAS A;  5A93 A;  3MBZ A;  2VGJ A;  3OZH A;  5JYP A;  1BLP A;  3CG5 A;  4EUZ A;  5DF7 A;  3NBL A;  5F82 A;  1ES3 A;  4OH0 A;  5EPH A;  5TFQ A;  3Q7Z A;  3GQZ A;  3GTC A;  2XFT A;  4PM7 A;  3S22 A;  4RA7 A;  2JE5 A;  1AXB A;  1L0G A;  1KGF A;  2H5S A;  3G32 A;  3VP2 A;  4OPR A;  4OLG A;  1J9M A;  4S2P A;  5GLA A;  3UE0 A;  3UN7 A;  1C3B A;  2WKE A;  3BM6 A;  3SH9 A;  5A90 A;  4WEK A;  2XD5 A;  4IED A;  1TVF A;  1NJ4 A;  1M6K A;  3VP0 A;  5FDH A;  4C75 A;  2Q9M A;  1GA9 A;  1W8Y A;  2OV5 A;  3UPN A;  3ZG8 B;  1K54 A;  1BUL A;  2UWX A;  4DXC A;  4EWF A;  4ID4 A;  5CHJ A;  4E3N A;  3G31 A;  3WRZ A;  5AQ9 A;  2X71 A;  4GOG A;  1NXY A;  2Y2J A;  3SOI A;  1SDE A;  2Y2Q A;  4KQR A;  3G35 A;  3LO7 A;  5JYO A;  4HES A;  1SCW A;  4U0T A;  1U60 A;  1K56 A;  4ZJ1 A;  4DKI A;  2B5R A;  2XQZ A;  2Y2O A;  1K4F A;  3FYZ A;  4A5R A;  4BQM A;  1N4O A;  4EBN A;  1YLW A;  2DRW A;  4DXB A;  3VP4 A;  1KGG A;  4FCF A;  4DE1 A;  4PM5 A;  5F83 A;  4KG2 A;  4QY5 A;  4NET A;  1JVJ A;  1MWT A;  5FA7 A;  5IHV A;  1W8Q A;  1JTD A;  1NZO A;  1QMF A;  3BEB A;  1XKZ A;  4R4S A;  3IQA A;  1IYQ A;  5EE8 A;  2H0T A;  5FAO A;  5F1G A;  3MXS A;  4S2J A;  4HBT A;  5HL1 A;  1PW1 A;  4PM9 A;  3IT9 A;  3N8R A;  3O88 A;  3A3J A;  5FQ9 A;  3MKF A;  4BD1 A;  4P85 A;  3VOZ A;  4EBL A;  1GHI A;  4E6X A;  2QMI A;  3V3S A;  2J9P A;  3ZG0 A;  2J9O A;  4LV1 A;  3ITB A;  3PAG A;  3CJM A;  1K55 C;  1ZC2 A;  1H5X A;  3Q1F A;  5FQQ A;  1YMS A;  3NC8 A;  1M40 A;  4DE3 A;  1MPL A;  4GDB A;  5HAQ A;  4E6W A;  4R3J A;  1CI8 A;  3N7W A;  4RX3 A;  1FQG A;  2C5W B;  3IHA A;  3QNC A;  1MKI A;  4FH2 A;  3A3I A;  3UPP A;  5KSH A;  1IEL A;  2ZC5 B;  5CGX A;  3G30 A;  4JXS A;  3WS2 A;  5G18 A;  1KDS A;  5M19 A;  1OME A;  2XFS A;  4QY6 A;  1PYY A;  5D3O A;  5J8X A;  2GDN A;  4PM6 A;  4MNR A;  4JF4 A;  2IWD A;  1K4E A;  5EVI A;  1BUE A;  4E3J A;  4S2M A;  5BOH A;  1PI4 A;  2WYX A;  4EQI A;  2Y4A A;  1JTG A;  3W4Q A;  4DF6 A;  3IWO A;  4JKT A;  1FCO A;  4R23 A;  2Z2L B;  3C7V A;  4E3I A;  3VSK A;  1ZG4 A;  1MWU A;  3WWX A;  2WGW A;  1XGI A;  4ZAM A;  5FSR A;  1HZO A;  3D4F A;  4X68 A;  5GHY A;  2XH9 A;  1LI9 A;  3SH7 A;  3MZF A;  5GHX A;  4WEL A;  5CGW A;  3WRT A;  3WS0 A;  3FZC A;  2X01 A;  3DTM A;  1XA7 A;  3UDX A;  2Y2I A;  3MKE A;  1E3U A;  3ZFZ A;  1NYM A;  4HEF A;  1HVB A;  5TR7 A;  1SDN A;  2OLV A;  4WMC D;  3HVF A;  4KZ7 A;  1CEF A;  2EX6 A;  1CEG A;  2ZD8 A;  2WAF A;  4Y0T A;  1LL9 A;  1LI0 A;  3W8K A;  2C6W B;  1DY6 A;  3LY4 A;  3OCN A;  4HBU A;  1YM1 A;  4S2O A;  2XLN A;  3G4P A;  5CHU A;  1H8Y A;  3HBR A;  3ZVT A;  1XXM A;  3VFH A;  3IWQ A;  2CC1 A;  1W79 A;  4OQ0 A;  5GL9 A;  3C4P A;  4C6Y A;  2E8I A;  4GZB A;  3C5A A;  3PBS A;  1KE0 A;  3V50 A;  1YMX A;  3GMW A;  4KQQ A;  3ZG7 B;  4E3O A;  3AGD A;  4OP8 A;  3HUN A;  5DF8 A;  4FSF A;  3VMA A;  3WS1 A;  5EVI B;  4N1X A;  4NK3 A;  2FFF B;  3BFC A;  2JCH A;  4RVA A;  1W7F A;  2PU2 A;  2WUQ A;  2Y2N A;  5GHZ A;  3SS4 A;  3TG9 A;  3W4P A;  5CTM A;  3UPO A;  2DCF A;  4MEZ A;  4DE2 A;  2WGW B;  2DNS A;  5DVA A;  5F1F A;  2G2W A;  4GB7 A;  4WYY A;  3RXX A;  5KMW A;  2ZQA A;  4N9L A;  1L0D A;  4Y0O A;  1KDW A;  4QHC A;  1TEM A;  4N92 A;  4OVD A;  3V3R A;  4S2N C;  4IVI A;  4KEN B;  4YFM A;  1FR1 A;  1Q2Q A;  3OC2 A;  3VP3 A;  3LEZ A;  3Q07 A;  3BEC A;  4IVK A;  1I2W A;  5GLB A;  4P87 A;  1JWV A;  1KVM A;  2HP9 A;  4PM8 A;  1XP4 A;  3AGF A;  3IXG A;  4QD4 A;  1I2S A;  3WS4 A;  4DE0 A;  5CEB A;  4DDS A;  4KZ8 A;  2X02 A;  5CGS A;  1KE3 A;  3N8S A;  4OLD A;  2R9X A;  4WBG A;  3JYI A;  5FAT A;  4F94 A;  4E3L A;  1ES4 A;  1HTZ A;  1ESI A;  3ZG9 B;  1KVL A;  2RL3 A;  1XA1 A;  3E2K A;  2Y59 A;  2P9V A;  3NIA A;  1BZA A;  3OPH A;  2EXB A;  2XGN A;  4N1H A;  4RX2 A;  5E2H A;  3E2L A;  1YLP A;  4L0L A;  4MBH A;  4KG6 A;  1K55 A;  2ZQC A;  1FCM A;  3MFD A;  4K0W A;  2WKI A;  3HLG A;  4K0X A;  4KZ4 A;  1ONH A;  3VFF A;  1N9B A;  1K57 C;  2WGI A;  3BRM A;  3NY4 A;  3P09 A;  4GDN A;  5CER A;  4BL2 A;  4DRT A;  2J7V A;  2Y2K A;  1S0W A;  1SHV A;  2Y2G A;  1SKF A;  4E3K A;  3GR2 A;  2HP6 A;  4ZBE A;  3ZNY A;  2VGK A;  2IWB A;  1IYO A;  3HLW A;  4DDY A;  3V5M A;  3NCK A;  1YT4 A;  4JPM A;  4KZ5 A;  1IYS A;  4WZ4 A;  1K6R A;  4QJG A;  4KQO A;  1ZG6 A;  3A3D A;  3OPR A;  3HUO A;  3IH9 A;  3MZE A;  3PTE A;  1GHP A;  1PIO A;  2H0Y A;  3P98 A;  3HLE A;  4OPY A;  3UDF A;  2FFY A;  1JWZ A;  4GD8 A;  4BEN A;  2OSU A;  1LLB A;  5KSC A;  2EFX A;  5A91 A;  1NRF A;  3EQV A;  1MXO A;  3BYD A;  4ZTK A;  1CI9 A;  2A3U A;  3BLM A;  4U0X A;  1PWC A;  2XEP A;  4IBR A;  4LEN A;  4RYE A;  2V1Z A;  4S2K A;  4ZJ2 A;  4LV2 A;  3NI9 A;  3IF6 C;  4OOY A;  2ZQ9 A;  3MZD A;  4WZ5 C;  4JLF A;  5HW3 A;  1GCE A;  5E2F A;  2HDU A;  4S2I A;  2P9V B;  2P74 A;  2WAD A;  2WZX A;  4LV0 A;  5EVI D;  1TDL A;  1EWZ A;  1L2S A;  4EV4 A;  1NYY A;  4Q8I A;  1LHY A;  4ZJ3 A;  1YQS A;  1WYB A;  5CEC A;  4C3Q A;  2JC7 A;  1ONG A;  1IEM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...