2VV7A

Bjfixlh in unliganded ferrous form
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
105
structure length
105
Chain Sequence
PDAMIVIDGHGIIQLFSTAAERLFGWSELEAIGQNVNILMPEPDRSRHDSYISRYRTTSDPHIIGIGRIVTGKRRDGTTFPMHLSIGEMQSGGEPYFTGFVRDLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords SENSOR PROTEIN FIXL
publication title Changes in Quaternary Structure in the Signaling Mechanisms of Pas Domains.
pubmed doi rcsb
source organism Bradyrhizobium japonicum
molecule tags Signaling protein, transferase
total genus 28
structure length 105
sequence length 105
chains with identical sequence B, C, D
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2008-06-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2vv7A00
3LUQA 2A24B 3OLOA 4HQAA 4GW9A 1TS0A 2YKFA 1XJ6A 1WA9A 2HV1A 3UE6A 5I5LA 2PD7A 1D7EA 4WUJA 2KDKA 2I9VA 4PKYG 1UGUA 1DP6A 4R3AA 4I3IA 4KUOA 1X0OA 5DJUA 5EFWA 1EW0A 1S1ZA 4HJ6A 1XFNA 4LRYC 3EEHA 1T1CA 4H6JB 5HD3A 5F69A 3MQOA 2J80A 1LT0A 2Z6DA 3LIDA 5HZHA 1OTBA 4HP4A 3UB9A 3PHYA 5HDSA 4F3LB 2KX6A 3A0RA 1OTAA 1T18A 2V9AA 3H82A 2VV6A 2JHEA 3FC7A 3F1OA 1VB6A 3C8CA 2V1AA 3NJAA 3LI8A 1ODVA 4HIAA 4PKYA 5KIZA 1P97A 3A0SA 4NXGA 2ZOIA 4I39A 1P0ZA 1S4RA 2V1BA 4MN5A 1V9ZA 5DKKA 2PYRA 4BBUA 1XJ3A 2Z6CA 3SW1A 3C2WA 1XJ2A 3RTYA 3CWFA 4GHIA 3MFXA 4XT2A 3H7WB 4HJ4A 2JN7A 3B33A 2OOLA 3LIFA 4YWZA 2V0UA 4HNBA 5HDDA 2M1CA 3F1NB 5IS1A 2QHKA 2ZBBA 2L1MA 1OTEA 1DP9A 3LYXA 1GSXA 4NXEA 1F98A 3F1OB 5J4EA 2H28A 4K08A 2CMNA 4GS9B 3T50A 5HD5A 1UWNX 4NXBA 3ICYA 4JGQA 1TS6A 4HOIA 4NXFA 4I38A 3F1PA 4EXOA 1S67L 5TBMA 1T19A 3UMEA 1T1AA 3LICA 4RQ9A 4GCZA 2QJ7A 3A0VA 1XFQA 3UMDA 1N9NA 3NOPC 3MQQA 3BY9A 2YKHA 2GJ3A 2P7JA 5AVEA 4R38A 1OT6A 4HI4A 5F68A 3G6OA 4HH3A 1OTDA 5IU1A 5G4YA 5F5YA 3IS2A 4BBTA 5AVFA 3E4OA 1V9YA 3KX0X 1S66L 3LIBA 4M4XA 2VV8A 4LPZA 1D06A 4L9EA 3FG8A 4B9OA 3NOTC 1JNUA 2BASA 4R70A 2V0WA 1DRMA 4JGOA 4HY8A 2L0WA 4LRZE 4EEUA 4HJ3A 3UB6A 4EETB 4EERA 1G28A 3K3CA 4EEPA 2VV7A 1S4SA 1T1BA 1NWZA 3LIAA 4I3JA 1XJ4A 2QJ5A 2WKRA 1MZUA 1LL8A 3CLOA 4H6JA 1KOUA 3H82B 2PDRA 1LSWA 3MR0A 1OJGA 2QWSA 3NHQA 1N9LA 4MN6A 5A8BA 3PYPA 5HWWA 4EESA 4WL9A 2D01A 2VEAA 2OWJA 4EW7A 1DP8A 4WF0A 5J3WA 3MJQA 1OT9A 1LSXA 1GSVA 3K3DA 4HHDA 3P7NA 1S1YA 1TS8A 3HJIA 3E4QA 3ZQ5A 4WLAA 4KUKA 2PR5A 1UWPX 4GHIB 4XT2B 2WKQA 3MXQA 1OJ5A 3D72A 2OWHA 5HWTA 4DJ3A 5DJTA 3VE3A 3BWLA 2VLGA 2K7SA 5DKLA 2INWA 2PR6A 3ULFA 1GSWA 3VE4A 2W27A 3H7WA 4L9FA 2PYPA 1Y28A 2QKPA 3LI9A 2ZOHA 4WN5A 2PD8A 3LIEA 5HDCA 4HH2A 2WKPA 1TS7A 3F1NA 1OTIA 3VOLA 3GDIA 3RH8B 1F9IA 2R78A 3F1PB 2D02A 3NOUC 5TBMB 2A24A 4R6LA 4I3AA 4BBVA 2B02A 3UB7A 2EA9A 4GS9A 5G4ZA 2PHYA 4EQ1A 1LSVA 4LRXC 5HSQA 3HJKA 4JGRA 3EWKA 4L9GA 5J7EA 3H9WA 2W0NA 3CAXA 4E04A 4LLOB 3IBRA 4JGPA 2L4RA 3IS2B 1BYWA 3GECA 3E4PA 5F6AA 4I5SA 4HP9A 4DJ2A 5HWVA 4F3LA 3UB8A 3BY8A 1N9OA 4KQDA
chains in the Genus database with same CATH superfamily
2C5WB 1YMSA 4WZ4A 5GLAA 4Z1WA 4GW9A 2JCHA 3UE6A 4PPRA 4MMNA 1E4DA 4CLCE 4KZ4A 4JLFA 4DDSA 1I2WA 2KDKA 2I9VA 2IWDA 4IVKA 5F1GA 4RX3A 4R3AA 2Y2MA 3IXBA 3KYZA 3IXGA 5CHJA 2NUPC 5EFWA 4C6YA 4AFIA 3WRTA 4JXSA 1N4OA 3EEAA 3QNBA 1DY6A 1PI4A 3MQOA 2J80A 2Z6DA 3T4LA 5KMWA 1TF1A 3N7WA 5HZHA 1OTBA 1EI5A 1VETB 3IF6B 4HP4A 5GLCA 1CEFA 2V1ZA 4KENB 2Y59A 3U2AA 4F3LB 3Q7VB 1OTAA 5CTMA 4S2LA 1Y4OA 2Y55A 4D2OA 4QY6A 1TVFA 3HBRA 4OQGA 2O9AA 3FPWA 1P97A 3MZEA 3A3EA 4O01A 2ZOIA 1S4RA 3QP1A 4DXBA 2IWBA 3E2KA 1BT5A 3OOVA 3RTYA 4Y0OA 3IX8A 2DCFA 1NXYA 4XT2A 3W8KA 3H7WB 1Z09A 1IYSA 4A5RA 4WEJA 1BLHA 3WS5A 2Y2PA 3HUOA 3V67A 2M1CA 3F1NB 4X55A 1H8MA 1E25A 3C7VA 3TW8A 2HPBA 3PAGA 4FSFA 3MF0A 3O86A 2L1MA 3O87A 5EOOA 1DP9A 1GSXA 1M40A 3DTEA 4NXEA 5J4EA 4LCLA 2H28A 4K08A 5CGWA 2CMNA 3EGXC 4GS9B 3D4FA 4MN7A 4ZTKA 3IT9A 3AGEA 1FCOA 4UA6A 3S4XA 4OQIA 1UWNX 1MWRA 1Q2PA 4JF6A 3T12B 4HOIA 5L8MA 1YAXA 4NXFA 2PAVP 1TDGA 3D9YA 3EQUA 5GHZA 3V50A 1T19A 1U60A 4E3NA 3OPHA 4LV0A 3O5YA 1SHVA 5L2FA 3ZG9B 1S0WA 3MZFA 3BECA 3JVVA 1MC0A 1O07A 2YKHA 3OZHA 2GJ3A 4MEZA 1H0MA 4QU3A 4P85A 4R38A 1OT6A 4LGWA 5F68A 5F83A 4BENA 1IFQA 3HREA 1XA1A 1IYPA 2P9VB 3Q07A 1L0GA 4IBRA 3T1XA 4K0XA 2E8JA 4S2MA 5CXWA 2ZM2A 3RXWA 1H8YA 4FTXA 3IF5A 5TGFA 3D3OA 4XUZA 3LIBA 3MXSA 4PHTA 2O9CA 1CI9A 4RX2A 1K57C 5E2FA 1EROA 4LPZA 2ZQ9A 4L9EA 4YOFA 1NYYA 5FL3A 3FG8A 3IQAA 2O0YA 3HLCA 3T4JA 2W3FA 2ZJ9A 2BASA 3HCYA 2V2FF 3NC8A 2V0WA 4HY8A 2ZC7A 1ACFA 2B18A 2Q0OA 4WYYA 4HJ3A 1GHPA 5FQKA 4EU0A 1G28A 4S2OA 5IHVA 3BYDA 2NUTC 2VV7A 1NWZA 4DKIA 1L0FA 2ZC6B 4BQMA 3LR0A 1NRFA 4ZJ2A 1ALQA 1LL8A 4H6JA 1K4FA 1KOUA 4X1MA 4KZ5A 1LSWA 3ZVWA 5FAPA 2GX5A 1N9LA 4MN6A 5A8BA 1CI8A 1BLPA 3PYPA 2HJEA 5DF8A 2XA7S 3R4KA 1XXMA 3MQ0A 3OCNA 1YLPA 1NZUA 4KQQA 2JBFA 1FSYA 3E98A 1S1YA 4QJGA 2UV0E 2O99A 1TS8A 4PAUA 4ARZB 1YLWA 3B42A 4BJPA 1W63Q 4Q0IA 4GHIB 3MXQA 5DF9A 3S7OA 3G32A 4OP5A 2EFUA 4DJ3A 3HLDA 5DJTA 4WEKA 3VE3A 1L3LA 3BWLA 2ZQ7A 3VMAA 2Y2LA 5JYOA 4Y0UA 2JKGA 4UAAA 2HF6A 1Y28A 1K6SA 2ZOHA 4ZAMA 1KVMA 3PBRA 2G2WA 2HZ5A 4GOGA 4P6ZM 5EM0A 1IELA 1YKDA 1YT4A 2PD8A 4X1LA 4R3JA 2XD1A 5CTNA 4HH2A 4RA7A 4Q8IA 1K54A 4OP8A 1OTIA 2K2NA 1BULA 5I94A 5HPIA 1YLYA 2D02A 1FILA 5TBMB 2A24A 4Q0JA 4ID4A 5HX9A 4UEYA 3VFHA 1TEMA 4S2KA 4GNUA 3O3VA 1Z6FA 4N1XA 1VEUB 2X02A 1LSVA 3G2YA 3UO9A 1SDEA 5HSQA 3A3DA 3FZCA 1CK3A 1IYQA 3S7PA 2DMWA 3DW0A 3EWKA 4L9GA 3U4LP 4II7A 5U47A 3DAVA 4WM9A 3B3XA 3TE8A 1MY8A 3PBOA 4JGPA 3IS2B 5AJGA 4QD4A 3WS0A 1YM1A 5F6AA 4MBFA 3LR4A 4U3TA 3QHYA 2HGVA 2OAP1 3S7QA 1PI5A 1ES3A 4UHUA 3BJNA 3VSKA 4Y17A 1VM1A 5FEGA 1FIKA 1F2KA 2Z2MB 3CMZA 2A24B 4BD1A 3ISGA 1XJ6A 2ZMVA 3ZFZA 3IXHA 4BWIA 2QYBA 2PD7A 1ZC2A 4Y3IA 4IUKA 1PNEA 4FUWA 3GSGA 4XXRA 4WUJA 1WYBA 1UGUA 3BM6A 4I3IA 3BQ8A 4KUOA 2VGLM 1LI9A 1X0OA 5DJUA 1EW0A 3ZNYA 1ES2A 4KZAA 2HDQA 1XFNA 4LRYC 3EEHA 1XPBA 4BD0A 3CG5A 2W3EA 2FZ0A 4RYEA 2XF3A 3S7NA 3VFFA 3V3RA 5HAIA 5MC7A 2VZWA 1KGGA 4NKPA 3A3FA 4LFUA 5HDSA 2LB9A 2XRNA 1E3UD 1L0DA 1VQQA 3E0YA 3Q82A 2H10A 3H82A 5E2GA 5HL6A 2JHEA 3FC7A 4OQ0A 4ZJ1A 2P08A 2V1AA 3NCKA 3MSHA 1YPRA 2W1TA 3G2ZA 4EBLA 3BW6A 2PU2A 2WUQA 3A0SA 1BLSA 4YFMA 1XKZA 4MCWA 1YMXA 2VJWA 4C75A 5LBRA 2XR0A 4PM6A 1XA7A 4MN5A 2VGLS 2PYRA 4BBUA 1OPXA 5TFQA 2Y2GA 1XJ2A 2C6WB 3LGOA 2PBDP 4IJGA 1H3QA 3CWFA 1FCNA 3MFXA 4IVIA 2JN7A 4LV2A 1HLUP 4R0QA 3PR6A 2XK1A 1K56A 4KQOA 2Q9NA 3NIAA 4EWFA 2V0UA 4N9LA 4IEDA 3HUMA 1J9MA 4U0TA 2E8IA 5AQBA 3FYZA 2AVXA 3A3JA 5IS1A 2JKRI 5FASA 4MLLA 4PM9A 3FPVA 1CF0A 3DWZA 3QNCA 3Q81A 1K56D 3WS4A 5HFOA 1MWTA 1G6OA 2W1TB 3T50A 5HD5A 5CX7A 4NXBA 1PW8A 2VGJA 4PM7A 1MWSA 4I38A 3HVFA 2KOIA 5EVIB 3PAEA 5DFYA 4RQ9A 2KLIA 1RP5A 3A0VA 1SKOA 3NOPC 2EX8A 3MQQA 3DTKA 2XSSA 2I72A 2PBYA 3G30A 5AVEA 4CLCD 4HI4A 3G6OA 3UPOA 4PM5A 3BFCA 4Y15A 4BBTA 2CC1A 3W2ZA 3KX0X 4LCMA 5CGXA 2P74A 3OBFA 2J9OA 1W7FA 1HD8A 2ZC5B 3IHAA 3T4QA 4JF5A 3RJUA 4M4XA 3LEZA 1HTZA 3T1RA 3LY3A 1K57A 3MFDA 1ZTUA 3GR2A 3SS3A 2WZZA 5GLBA 3T4KA 1KGFA 3NOTC 1KGEA 1K6RA 3S1YA 2Y2HA 4R70A 4NETA 2O9BA 3FKWA 1IKGA 5L09A 3MZDA 3UDFA 2HJ9C 1SZVA 1RGYA 4MBHA 4Y13A 3W4PA 2FFYA 4HEFA 5DFXA 5A92A 3N4IA 3SH9A 4ETXA 3FV7A 4S2IA 3CZDA 4EBPA 3IXDA 4UQIM 4BL2A 1XJ4A 3V3SA 4DE2A 1KDSA 1D1JA 3NDEA 2WKRA 3CLOA 4GJ4A 2VA0A 2PDRA 3GVBA 1Y54A 3MR0A 5CHMA 3VP2A 3IF6C 2HDUA 5HWWA 1GHIA 5L10A 4WL9A 2D01A 4RVAA 1PZOA 4EW7A 4WF0A 5J3WA 2J3TD 1P9RA 1LSXA 3CUEC 1RCJA 1NRJA 4BLMA 5F1FA 4CLCC 2FH5A 3HJIA 3N8SA 2DNSA 5FSRA 1UWPX 4XT2B 3N8LA 3BEBA 3MKEA 5L07A 3PTEA 1JWVA 3VP1A 2OAQ1 1LLBA 5EVLA 3ZG7B 2FFFB 2HP5A 2K7SA 2EX6A 2JKTI 1GSWA 3VE4A 1JWZA 1N9BA 1YLTA 1KDWA 2XFTA 4B4XA 2QKPA 1JTDA 3LI9A 1BZAA 4OLDA 3ZCZA 4KZ7A 4GD6A 3HLBA 4WN5A 2J8YA 1JVJA 2WYXA 3SS5A 4S2NC 2Y2IA 5HARA 1O7EA 1PW1A 2XGNA 5M1AA 3K2NA 3NI9A 4WELA 3RH8B 1F9IA 5M18A 3FKVA 3PBNA 4E6WA 2EWVA 2Y4AA 3G35A 5EVEA 2M7UA 5HPFA 2GNXA 3P01A 5G4ZA 1YSPA 4DF6A 2PHYA 1K55C 2Y8HA 3OCLA 3KSIA 4MDZA 3HJKA 1WE4A 4ZJ3A 4GDNA 5J7EA 2W0NA 4E04A 1GCEA 2J3TC 4R4RA 3ITBA 4LLOB 1ZG6A 3SH7A 5FDSA 4EQIA 1BYWA 5HW3A 5EECA 3IX4A 1MKMA 5JYPA 3GECA 1PFLA 2VX8A 3LY4A 5EM1A 1W79A 4DXCA 4E6XA 5HWVA 2A49A 1EWZA 5FAOA 4JXVA 4HBTA 3LUQA 4DN0A 3CI6A 3I7JA 3ZDJA 1TS0A 5BOHA 3NBLA 1MWUA 4N92A 2WGVA 5FI7A 2PRFA 3N8RA 1ERMA 3MKFA 1W8YA 3EQVA 3PBQA 3QP2A 3P98A 1ERQA 5A93A 3KYEA 4Y7PA 3BQAA 3ZVTA 2HP9A 4UA9A 4ZDXA 4H6JB 5GLDA 4ETZA 4E3LA 3LIDA 3RXXA 5FA7A 4O0PA 2UWXA 4CQHA 3PHYA 4O7DA 3VSLA 4OPZA 1AXBA 5AQ9A 2V9AA 1J3WA 4DE3A 3F1OA 3BLMA 1FSWA 4D60A 1ODVA 4HIAA 3DWKA 4NXGA 2ZL1A 4I39A 2ZQCA 3UE1A 3G4PA 1I2SA 2HDSA 1XJ3A 3C2WA 3CJMA 5EE8A 3L7HA 3QP6A 3TSGA 4P6ZS 2ZLYA 4P87A 2OLUA 4K91A 2OOLA 2XEPA 4WMCD 4YWZA 1KE0A 3CPTA 4HNBA 3UY6A 2EWWA 1Q2QA 2Y2QA 3BLSA 4GKUA 1SDNA 4U0XA 5C5KA 2LB5A 5EPHA 1LL9A 2QHKA 3M6HA 5GHXA 4H8RA 3LYXA 1LHYA 3QP5A 1AWIA 4P6BA 1GHMA 1F98A 3F1OB 1PIOA 3M2JA 4JXWA 4MNRA 3ICYA 1TS6A 3F1PA 2WAEA 3VOYA 3GQZA 1S67L 3ZGAB 4CJNA 3LICA 5CECA 4E3IA 1E3UA 4BL3A 2QJ7A 1XFQA 3UMDA 4KZ6A 4X68A 2XLNA 2WKIA 2EXAA 3BY9A 3EGDC 3QP8A 2P7JA 2EXBA 2VK3A 1MPLA 5TR7A 4HH3A 3WS1A 3WS2A 4FH4A 2IA2A 4YNRA 3HLGA 2EX2A 3LCEA 5DVAA 5G4YA 5DTKA 5F5YA 5J8XA 3TRCA 5FDHA 3WWXA 2A2LA 1L0EA 3T4OA 2VGKA 5AVFA 3E4OA 1V9YA 4G3KA 4R3BA 3OPLA 1S66L 2OLVA 4C3QA 4LENA 3BFGA 2WADA 5E43A 3GMWA 1KE4A 2WGWA 5D3OA 5CGSA 1FR1A 3O88A 1JNUA 1ZG4A 3HL9A 1DRMA 1HZOA 4LRZE 4EETB 4OPYA 4LV1A 3K3CA 4FH2A 2R9XA 1IKIA 4K0WA 4EEPA 5CEDA 3ZNTA 2WKHA 4R4SA 3LIAA 4I3JA 3JVUA 1HVBA 2QJ5A 4X53A 1MZUA 5EOEA 3Q1FA 1C3BA 4E3JA 3H82B 3LR3A 4MBKA 1FR6A 1OJGA 3NHQA 5FAQA 2XFSA 2ZD8A 5GL9A 3UN7A 2ZQ8A 4B88A 3IF6A 1M6KA 4EESA 4Z9QA 4G3WA 2K31A 5EVID 2VEAA 2OWJA 1DP8A 4OH0A 2OV5A 1OT9A 1PRQA 3Q7VA 1F5MA 1GSVA 5IT5A 1QMEA 5DTSA 3K3DA 2WGWB 3CUEA 4OQHA 2J9PA 1SKFA 4JF4A 1LL5A 4QY5A 4CLCA 2BG1A 1NY0A 2JE5A 3E4QA 1ONGA 4WLAA 4EUZA 4KUKA 4X6TA 3CITA 2BLSA 3OC2A 1XGIA 1OJ5A 3D72A 1NLZA 5HWTA 5DTTA 4KG6A 3L9KA 2XQZA 2WKEA 1BUEA 1NLYA 1A0KA 5DKLA 1XX2A 5GHYA 2INWA 2PR6A 2H5SA 3ULFA 5EV0A 1ZKJA 3H7WA 4L9FA 2Z2LB 4O8GA 3VP0A 4DE1A 5G18A 4BMWA 5AQ7A 2WKPA 1ESUA 1TS7A 2XROA 4X25A 3F1NA 3VOLA 3TG9A 2G2UA 4S2NA 1NYMA 3GDIA 4OPQA 4ZBEA 3ZHHA 3WRZA 3NOUC 4CLCB 3QP4A 4I3AA 2B02A 3S22A 4GS9A 4EUVA 4EQ1A 1SKOB 1K55A 4WBGA 1LI0A 4LRXC 1RGZA 5HAQA 4QB8A 4WZ5C 1K0KA 5EVIC 3NECA 3CAXA 5FEFA 2EX9A 1OMEA 4L0LA 1K25A 1KE3A 4B93A 2RCXA 2PU4A 3NULA 1TD5A 4N1HA 1CEGA 4ESPA 4JXGA 5E2EA 1FQGA 3ZG5A 4JKTA 4HP9A 4NEED 3C4PA 4ME4A 4GZBA 3UB8A 4E3OA 3BY8A 3M2KA 2P9VA 1N9OA 4E3KA 4Q0HA 4KQDA 1YSQA 2J7VA 1G5UA 4KG2A 5FI2A 4KZ8A 3OLOA 3IH9A 4HQAA 2YKFA 1PWDA 2JKRM 4OLGA 1WA9A 1GA9A 2HV1A 4DMZA 2HDRA 5I5LA 2ZC3B 1DJBA 1XP4A 1D7EA 2RL3A 3CHWP 3RFBA 5A90A 4S2JA 1H8ZA 4PKYG 4YINA 1DP6A 3W4OA 1PWCA 2X71A 4UQIS 1W5DA 4E3MA 1IEMA 1G68A 1K4EA 1S1ZA 4HJ6A 3UE0A 3UDXA 1T1CA 5KSHA 5HD3A 2Y91A 5F69A 2ZQDA 1LT0A 2XD5A 5FATA 3SS4A 4S2PA 3MBZA 3UB9A 1PWGA 4NK3A 2KX6A 4OONA 3A0RA 3C4OA 5FQMA 4GB7A 4FCFA 1T18A 4OOMA 1MXOA 5FQJA 4G3VA 2VV6A 1K38A 4ZRRA 5F82A 4FOFA 1VB6A 3C8CA 3ZG0A 3C30A 4IUHA 3NJAA 5HAPA 2JKFA 4EV4A 3LI8A 5M19A 4PKYA 2XA7M 5KIZA 4OKPA 1PZPA 3UDIA 3M6BA 3UB5P 2Q9MA 1P0ZA 1W8QA 4FD8A 3JPUA 5FI6A 2V1BA 1V9ZA 3PBSA 5DKKA 4ARZA 5KZHA 3V5MA 2Z6CA 3DTIA 3SW1A 3C7UA 4Y2FA 3LEQA 3N6IA 4GHIA 4B4ZA 4HJ4A 4N9KA 3BFFA 2B95A 2W1RA 1FOFA 4GD8A 3AGDA 3B33A 2V8CA 3LIFA 3OPPA 2QPNA 2BTFP 5TJJA 1S6RA 3T1QB 1KVLA 5HDDA 3UPPA 2ACGA 2ZBBA 1YLJA 5CERA 1OTEA 5K5BA 4JPMA 5KSCA 3GRJA 4OPRA 3GTCA 3ZG8B 2H0TA 4KZ3A 4JBFA 2G7UA 4UA7A 2V8FA 3KSFA 1IYOA 2Y2NA 4JGQA 3VP4A 3EOIA 3PXPA 2Y2JA 3IH8A 4NG2A 4EXOA 3SOIA 4PMAA 1MKIA 5TBMA 3AGFA 2EFXA 1GA0A 1QMFA 3UMEA 1CJFA 3ZYTA 1T1AA 3NDGA 4GCZA 3VOZA 3KSHA 1VEUA 1N9NA 1ES4A 2MJ6A 2X01A 1NZOA 5A91A 2IWCA 3V39A 3UE3A 4Y0TA 4R1GA 4IHQA 3HUNA 4P0MA 3LR5A 1MBLA 2GZAA 1P9WA 3FWLA 1OTDA 5IU1A 1JWPA 3IS2A 4QHCA 3IWOA 2QMIA 3R7WA 2DRWA 3IBJA 2M7VA 3OPRA 2ZM8A 3KO6A 2JKTM 2B5RA 2P04A 3BRMA 4KZ9A 3C38A 4GN2A 3DTMA 5DF7A 4PM8A 2VV8A 3LFVA 1D06A 2WGIA 3MS6A 4WMCA 4B9OA 3G31A 1ONHA 3MXRA 1FCMA 2ZM0A 4CPKA 1XGJA 4JGOA 1WYCA 2Y2OA 2L0WA 2V20A 4EEUA 4QPRA 3UB6A 4EERA 4XUXA 4OVDA 3ITAA 2GDNA 2WK0A 3BFDA 2A3UA 1S4SA 1T1BA 4GDBA 4HBUA 4KG5A 3SH8A 3B47A 2ZMAA 3MMHA 3PBTA 3R7WB 1NJ4A 5E2HA 3UNWA 2QWSA 3HLEA 3IHBA 1ESIA 4OOYA 3TJZC 2OSUA 2PT7A 4GLQA 1JTGA 1L2SA 1SCWA 3BFEA 3LO7A 3MJQA 2WAFA 5EUAA 1ES5A 2ZL1B 2JC7A 3NY4A 2R9WA 4HHDA 3P7NA 3Q7ZA 4X56A 3TOIA 2Y79A 3HLFA 4OOLA 3ZQ5A 4KZBA 4LV3A 2PR5A 2QZ6A 3HLWA 3T1SA 2WKQA 1G6AA 3C5AA 5FQ9A 3T4TA 2OWHA 1BTLA 4Y5FA 5CRFA 3CPTB 4M3KA 4R23A 2VLGA 3GV9A 3P09A 2W27A 1W63M 2W3HA 2PYPA 3IWQA 4EBNA 4DRTA 3G34A 2XDMA 3SZTA 2XH9A 2ZC4B 3LIEA 2ZMFA 5HDCA 3T4SA 1K54C 2ZQAA 5HL1A 4HESA 3E2LA 1PYYA 1BLCA 2R78A 3F1PB 3VV4A 4R6LA 4BBVA 3UB7A 2EA9A 4DDYA 5FQIA 2Y2KA 2WZXA 3IX3A 3JYIA 3DBAA 1STZA 4JGRA 4DE0A 5CHUA 3UPNA 3A3IA 2HP6A 3W4QA 1CQAA 4WZ5A 3H9WA 1ZHHB 5EVIA 3IWIA 4F94A 1DJCA 5CEBA 3IBRA 4KQRA 2VKSA 3KYQA 4IBXA 2L4RA 1DJAA 1IOUA 4QWOA 1H5XA 5FQQA 3E4PA 1VETA 3KSGA 2W3GA 4I5SA 4DJ2A 5AQAA 1TDLA 2W3DA 1I5QA 4X69A 3VP3A 4F3LA 1YLZA 2J3WA 1BSGA 1YQSA 1VHMA 2H0YA
chains in the Genus database with same CATH topology
3LUQA 4DN0A 3CI6A 2A24B 3OLOA 4HQAA 4Z1WA 4GW9A 1TS0A 2YKFA 1XJ6A 2ZMVA 2JKRM 1WA9A 2HV1A 4DMZA 3UE6A 4BWIA 5I5LA 2QYBA 2PD7A 4MMNA 4CLCE 4Y3IA 4IUKA 1D7EA 3RFBA 4WUJA 3EQVA 2KDKA 2I9VA 3PBQA 4PKYG 1UGUA 1DP6A 4R3AA 4I3IA 3BQ8A 4UQIS 4KUOA 2VGLM 3KYZA 2NUPC 1X0OA 5DJUA 5EFWA 1EW0A 1S1ZA 4AFIA 4HJ6A 3BQAA 1XFNA 4LRYC 3EEHA 1T1CA 4H6JB 3EEAA 5KSHA 5HD3A 4ETZA 5F69A 3MQOA 2J80A 1LT0A 2W3EA 2Z6DA 3T4LA 2FZ0A 1TF1A 3LIDA 5HZHA 1OTBA 3S7NA 4HP4A 4O0PA 5MC7A 2VZWA 3UB9A 4NKPA 4CQHA 3PHYA 5HDSA 3U2AA 2LB9A 2XRNA 4F3LB 2KX6A 3A0RA 1OTAA 4OOMA 1T18A 3E0YA 2V9AA 3H82A 4G3VA 5HL6A 2VV6A 2JHEA 3FC7A 4ZRRA 3F1OA 4FOFA 1VB6A 3C8CA 2P08A 2V1AA 3C30A 4IUHA 3NJAA 2O9AA 2W1TA 3FPWA 3LI8A 1ODVA 3BW6A 4HIAA 2XA7M 4PKYA 5KIZA 1P97A 3A0SA 4O01A 4NXGA 2ZOIA 4I39A 1P0ZA 1S4RA 4MCWA 2VJWA 5LBRA 2V1BA 4MN5A 2VGLS 1V9ZA 3PBSA 5DKKA 2PYRA 4ARZA 4BBUA 1XJ3A 1OPXA 2Z6CA 3SW1A 3C2WA 3OOVA 1XJ2A 3RTYA 4Y2FA 4IJGA 1H3QA 3CWFA 4GHIA 3MFXA 4XT2A 3H7WB 4HJ4A 2W1RA 2JN7A 4P6ZS 3PR6A 3B33A 4WEJA 2OOLA 3LIFA 4KQOA 4YWZA 2V0UA 4HNBA 5TJJA 2EWWA 5HDDA 3V67A 2M1CA 3F1NB 5IS1A 2JKRI 1H8MA 5C5KA 2LB5A 3FPVA 3TW8A 2QHKA 4FSFA 3MF0A 2ZBBA 2L1MA 1OTEA 5K5BA 1DP9A 3LYXA 1GSXA 4NXEA 1F98A 3F1OB 5J4EA 2H28A 4K08A 2CMNA 3EGXC 4GS9B 4MN7A 1G6OA 2W1TB 3T50A 2G7UA 5HD5A 3KSFA 1UWNX 5CX7A 4NXBA 3ICYA 4JGQA 1TS6A 3EOIA 3PXPA 4HOIA 5L8MA 1YAXA 4NXFA 4I38A 3F1PA 3EQUA 4EXOA 1S67L 5TBMA 1T19A 2KOIA 3UMEA 3O5YA 3ZYTA 1T1AA 3LICA 5DFYA 4RQ9A 4GCZA 2QJ7A 2KLIA 3A0VA 1XFQA 3UMDA 3KSHA 1N9NA 3NOPC 3MQQA 2MJ6A 2XSSA 3JVVA 1MC0A 3BY9A 3EGDC 2YKHA 2GJ3A 3UE3A 2P7JA 5AVEA 4CLCD 4IHQA 4R38A 1OT6A 4HI4A 5F68A 3G6OA 4HH3A 1IFQA 3LR5A 2GZAA 1P9WA 1OTDA 2IA2A 4YNRA 5IU1A 5G4YA 5F5YA 3TRCA 3IS2A 2A2LA 4BBTA 3T4OA 3R7WA 3IBJA 2M7VA 5AVFA 3E4OA 3W2ZA 1V9YA 3KX0X 3KO6A 4G3KA 2JKTM 2P04A 3C38A 3OBFA 3D3OA 1S66L 3LIBA 4PHTA 2O9CA 3T4QA 4M4XA 2VV8A 4LPZA 3LFVA 1D06A 4L9EA 4YOFA 5FL3A 1ZTUA 3FG8A 2O0YA 4B9OA 3T4KA 3T4JA 2W3FA 3NOTC 1JNUA 2BASA 3HCYA 4R70A 2O9BA 2V0WA 1DRMA 4JGOA 4HY8A 2L0WA 4LRZE 2B18A 4EEUA 2HJ9C 4HJ3A 4QPRA 3UB6A 4EETB 4EERA 4Q0HA 1G28A 3K3CA 4EU0A 5DFXA 4ETXA 4EEPA 2NUTC 1S4SA 1T1BA 2VV7A 1NWZA 4UQIM 3LIAA 4I3JA 1XJ4A 3JVUA 3LR0A 2QJ5A 3B47A 2WKRA 1MZUA 1LL8A 3MMHA 3CLOA 4H6JA 4GJ4A 3PBTA 1KOUA 2VA0A 3H82B 2PDRA 1LSWA 3R7WB 3LR3A 3MR0A 2GX5A 1OJGA 2QWSA 3NHQA 1N9LA 4MN6A 5A8BA 3PYPA 5HWWA 4EESA 2HJEA 4WL9A 2D01A 4G3WA 3TJZC 2XA7S 2K31A 2PT7A 2VEAA 2OWJA 4GLQA 1DP8A 4WF0A 4EW7A 3R4KA 5J3WA 3MJQA 2J3TD 3MQ0A 1P9RA 1OT9A 3OCNA 1LSXA 1F5MA 1GSVA 3CUEC 5IT5A 1NRJA 3E98A 3CUEA 3K3DA 4HHDA 3P7NA 4CLCC 1S1YA 4CLCA 2O99A 1TS8A 2FH5A 4PAUA 3HJIA 2Y79A 3E4QA 4ARZB 3ZQ5A 4OOLA 4WLAA 4KUKA 3B42A 4BJPA 2PR5A 3CITA 1W63Q 1UWPX 3OC2A 4Q0IA 4GHIB 4XT2B 2WKQA 3MXQA 1OJ5A 3T4TA 5DF9A 3D72A 3S7OA 1NLZA 2OWHA 5HWTA 4DJ3A 2OAQ1 5DJTA 4WEKA 4Y5FA 3VE3A 3BWLA 2VLGA 2K7SA 1NLYA 5DKLA 2JKTI 2INWA 2PR6A 3ULFA 1GSWA 3VE4A 2W27A 1W63M 3H7WA 2W3HA 4L9FA 2PYPA 2HF6A 1Y28A 2QKPA 3LI9A 2ZOHA 4P6ZM 3PBRA 4O8GA 4BMWA 4WN5A 1YKDA 2PD8A 3LIEA 2ZMFA 5HDCA 3T4SA 4HH2A 2WKPA 1TS7A 2XROA 3F1NA 1OTIA 3VOLA 2K2NA 3K2NA 5HPIA 3GDIA 4WELA 3RH8B 1F9IA 2R78A 3F1PB 3PBNA 3VV4A 2D02A 3NOUC 2EWVA 4CLCB 5TBMB 2A24A 4Q0JA 4R6LA 4I3AA 2M7UA 2B02A 4BBVA 3UB7A 4UEYA 2EA9A 5HPFA 2GNXA 4GS9A 3P01A 5G4ZA 1YSPA 2PHYA 4EUVA 4EQ1A 2Y8HA 3OCLA 1LSVA 4LRXC 3DBAA 5HSQA 3KSIA 4MDZA 1STZA 3HJKA 3S7PA 2DMWA 4JGRA 3EWKA 4L9GA 5J7EA 4II7A 3H9WA 2W0NA 1ZHHB 3CAXA 4E04A 2J3TC 4LLOB 3IBRA 3TE8A 2VKSA 3KYQA 4L0LA 3PBOA 4JGPA 3IS2B 2L4RA 5AJGA 1BYWA 4B93A 1TD5A 1IOUA 1MKMA 3GECA 3E4PA 5F6AA 2VX8A 3KSGA 2W3GA 4I5SA 4HP9A 4DJ2A 3LR4A 4NEED 2W3DA 5HWVA 2HGVA 2OAP1 3S7QA 4ME4A 4F3LA 2J3WA 3UB8A 3BY8A 3BJNA 1VHMA 1N9OA 4KQDA 1YSQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LUQ A;  2A24 B;  3OLO A;  4HQA A;  4GW9 A;  1TS0 A;  2YKF A;  1XJ6 A;  1WA9 A;  2HV1 A;  3UE6 A;  5I5L A;  2PD7 A;  1D7E A;  4WUJ A;  2KDK A;  2I9V A;  4PKY G;  1UGU A;  1DP6 A;  4R3A A;  4I3I A;  4KUO A;  1X0O A;  5DJU A;  5EFW A;  1EW0 A;  1S1Z A;  4HJ6 A;  1XFN A;  4LRY C;  3EEH A;  1T1C A;  4H6J B;  5HD3 A;  5F69 A;  3MQO A;  2J80 A;  1LT0 A;  2Z6D A;  3LID A;  5HZH A;  1OTB A;  4HP4 A;  3UB9 A;  3PHY A;  5HDS A;  4F3L B;  2KX6 A;  3A0R A;  1OTA A;  1T18 A;  2V9A A;  3H82 A;  2VV6 A;  2JHE A;  3FC7 A;  3F1O A;  1VB6 A;  3C8C A;  2V1A A;  3NJA A;  3LI8 A;  1ODV A;  4HIA A;  4PKY A;  5KIZ A;  1P97 A;  3A0S A;  4NXG A;  2ZOI A;  4I39 A;  1P0Z A;  1S4R A;  2V1B A;  4MN5 A;  1V9Z A;  5DKK A;  2PYR A;  4BBU A;  1XJ3 A;  2Z6C A;  3SW1 A;  3C2W A;  1XJ2 A;  3RTY A;  3CWF A;  4GHI A;  3MFX A;  4XT2 A;  3H7W B;  4HJ4 A;  2JN7 A;  3B33 A;  2OOL A;  3LIF A;  4YWZ A;  2V0U A;  4HNB A;  5HDD A;  2M1C A;  3F1N B;  5IS1 A;  2QHK A;  2ZBB A;  2L1M A;  1OTE A;  1DP9 A;  3LYX A;  1GSX A;  4NXE A;  1F98 A;  3F1O B;  5J4E A;  2H28 A;  4K08 A;  2CMN A;  4GS9 B;  3T50 A;  5HD5 A;  1UWN X;  4NXB A;  3ICY A;  4JGQ A;  1TS6 A;  4HOI A;  4NXF A;  4I38 A;  3F1P A;  4EXO A;  1S67 L;  5TBM A;  1T19 A;  3UME A;  1T1A A;  3LIC A;  4RQ9 A;  4GCZ A;  2QJ7 A;  3A0V A;  1XFQ A;  3UMD A;  1N9N A;  3NOP C;  3MQQ A;  3BY9 A;  2YKH A;  2GJ3 A;  2P7J A;  5AVE A;  4R38 A;  1OT6 A;  4HI4 A;  5F68 A;  3G6O A;  4HH3 A;  1OTD A;  5IU1 A;  5G4Y A;  5F5Y A;  3IS2 A;  4BBT A;  5AVF A;  3E4O A;  1V9Y A;  3KX0 X;  1S66 L;  3LIB A;  4M4X A;  2VV8 A;  4LPZ A;  1D06 A;  4L9E A;  3FG8 A;  4B9O A;  3NOT C;  1JNU A;  2BAS A;  4R70 A;  2V0W A;  1DRM A;  4JGO A;  4HY8 A;  2L0W A;  4LRZ E;  4EEU A;  4HJ3 A;  3UB6 A;  4EET B;  4EER A;  1G28 A;  3K3C A;  4EEP A;  2VV7 A;  1S4S A;  1T1B A;  1NWZ A;  3LIA A;  4I3J A;  1XJ4 A;  2QJ5 A;  2WKR A;  1MZU A;  1LL8 A;  3CLO A;  4H6J A;  1KOU A;  3H82 B;  2PDR A;  1LSW A;  3MR0 A;  1OJG A;  2QWS A;  3NHQ A;  1N9L A;  4MN6 A;  5A8B A;  3PYP A;  5HWW A;  4EES A;  4WL9 A;  2D01 A;  2VEA A;  2OWJ A;  4EW7 A;  1DP8 A;  4WF0 A;  5J3W A;  3MJQ A;  1OT9 A;  1LSX A;  1GSV A;  3K3D A;  4HHD A;  3P7N A;  1S1Y A;  1TS8 A;  3HJI A;  3E4Q A;  3ZQ5 A;  4WLA A;  4KUK A;  2PR5 A;  1UWP X;  4GHI B;  4XT2 B;  2WKQ A;  3MXQ A;  1OJ5 A;  3D72 A;  2OWH A;  5HWT A;  4DJ3 A;  5DJT A;  3VE3 A;  3BWL A;  2VLG A;  2K7S A;  5DKL A;  2INW A;  2PR6 A;  3ULF A;  1GSW A;  3VE4 A;  2W27 A;  3H7W A;  4L9F A;  2PYP A;  1Y28 A;  2QKP A;  3LI9 A;  2ZOH A;  4WN5 A;  2PD8 A;  3LIE A;  5HDC A;  4HH2 A;  2WKP A;  1TS7 A;  3F1N A;  1OTI A;  3VOL A;  3GDI A;  3RH8 B;  1F9I A;  2R78 A;  3F1P B;  2D02 A;  3NOU C;  5TBM B;  2A24 A;  4R6L A;  4I3A A;  4BBV A;  2B02 A;  3UB7 A;  2EA9 A;  4GS9 A;  5G4Z A;  2PHY A;  4EQ1 A;  1LSV A;  4LRX C;  5HSQ A;  3HJK A;  4JGR A;  3EWK A;  4L9G A;  5J7E A;  3H9W A;  2W0N A;  3CAX A;  4E04 A;  4LLO B;  3IBR A;  4JGP A;  2L4R A;  3IS2 B;  1BYW A;  3GEC A;  3E4P A;  5F6A A;  4I5S A;  4HP9 A;  4DJ2 A;  5HWV A;  4F3L A;  3UB8 A;  3BY8 A;  1N9O A;  4KQD A; 
#chains in the Genus database with same CATH topology
 2C5W B;  1YMS A;  4WZ4 A;  5GLA A;  4Z1W A;  4GW9 A;  2JCH A;  3UE6 A;  4PPR A;  4MMN A;  1E4D A;  4CLC E;  4KZ4 A;  4JLF A;  4DDS A;  1I2W A;  2KDK A;  2I9V A;  2IWD A;  4IVK A;  5F1G A;  4RX3 A;  4R3A A;  2Y2M A;  3IXB A;  3KYZ A;  3IXG A;  5CHJ A;  2NUP C;  5EFW A;  4C6Y A;  4AFI A;  3WRT A;  4JXS A;  1N4O A;  3EEA A;  3QNB A;  1DY6 A;  1PI4 A;  3MQO A;  2J80 A;  2Z6D A;  3T4L A;  5KMW A;  1TF1 A;  3N7W A;  5HZH A;  1OTB A;  1EI5 A;  1VET B;  3IF6 B;  4HP4 A;  5GLC A;  1CEF A;  2V1Z A;  4KEN B;  2Y59 A;  3U2A A;  4F3L B;  3Q7V B;  1OTA A;  5CTM A;  4S2L A;  1Y4O A;  2Y55 A;  4D2O A;  4QY6 A;  1TVF A;  3HBR A;  4OQG A;  2O9A A;  3FPW A;  1P97 A;  3MZE A;  3A3E A;  4O01 A;  2ZOI A;  1S4R A;  3QP1 A;  4DXB A;  2IWB A;  3E2K A;  1BT5 A;  3OOV A;  3RTY A;  4Y0O A;  3IX8 A;  2DCF A;  1NXY A;  4XT2 A;  3W8K A;  3H7W B;  1Z09 A;  1IYS A;  4A5R A;  4WEJ A;  1BLH A;  3WS5 A;  2Y2P A;  3HUO A;  3V67 A;  2M1C A;  3F1N B;  4X55 A;  1H8M A;  1E25 A;  3C7V A;  3TW8 A;  2HPB A;  3PAG A;  4FSF A;  3MF0 A;  3O86 A;  2L1M A;  3O87 A;  5EOO A;  1DP9 A;  1GSX A;  1M40 A;  3DTE A;  4NXE A;  5J4E A;  4LCL A;  2H28 A;  4K08 A;  5CGW A;  2CMN A;  3EGX C;  4GS9 B;  3D4F A;  4MN7 A;  4ZTK A;  3IT9 A;  3AGE A;  1FCO A;  4UA6 A;  3S4X A;  4OQI A;  1UWN X;  1MWR A;  1Q2P A;  4JF6 A;  3T12 B;  4HOI A;  5L8M A;  1YAX A;  4NXF A;  2PAV P;  1TDG A;  3D9Y A;  3EQU A;  5GHZ A;  3V50 A;  1T19 A;  1U60 A;  4E3N A;  3OPH A;  4LV0 A;  3O5Y A;  1SHV A;  5L2F A;  3ZG9 B;  1S0W A;  3MZF A;  3BEC A;  3JVV A;  1MC0 A;  1O07 A;  2YKH A;  3OZH A;  2GJ3 A;  4MEZ A;  1H0M A;  4QU3 A;  4P85 A;  4R38 A;  1OT6 A;  4LGW A;  5F68 A;  5F83 A;  4BEN A;  1IFQ A;  3HRE A;  1XA1 A;  1IYP A;  2P9V B;  3Q07 A;  1L0G A;  4IBR A;  3T1X A;  4K0X A;  2E8J A;  4S2M A;  5CXW A;  2ZM2 A;  3RXW A;  1H8Y A;  4FTX A;  3IF5 A;  5TGF A;  3D3O A;  4XUZ A;  3LIB A;  3MXS A;  4PHT A;  2O9C A;  1CI9 A;  4RX2 A;  1K57 C;  5E2F A;  1ERO A;  4LPZ A;  2ZQ9 A;  4L9E A;  4YOF A;  1NYY A;  5FL3 A;  3FG8 A;  3IQA A;  2O0Y A;  3HLC A;  3T4J A;  2W3F A;  2ZJ9 A;  2BAS A;  3HCY A;  2V2F F;  3NC8 A;  2V0W A;  4HY8 A;  2ZC7 A;  1ACF A;  2B18 A;  2Q0O A;  4WYY A;  4HJ3 A;  1GHP A;  5FQK A;  4EU0 A;  1G28 A;  4S2O A;  5IHV A;  3BYD A;  2NUT C;  2VV7 A;  1NWZ A;  4DKI A;  1L0F A;  2ZC6 B;  4BQM A;  3LR0 A;  1NRF A;  4ZJ2 A;  1ALQ A;  1LL8 A;  4H6J A;  1K4F A;  1KOU A;  4X1M A;  4KZ5 A;  1LSW A;  3ZVW A;  5FAP A;  2GX5 A;  1N9L A;  4MN6 A;  5A8B A;  1CI8 A;  1BLP A;  3PYP A;  2HJE A;  5DF8 A;  2XA7 S;  3R4K A;  1XXM A;  3MQ0 A;  3OCN A;  1YLP A;  1NZU A;  4KQQ A;  2JBF A;  1FSY A;  3E98 A;  1S1Y A;  4QJG A;  2UV0 E;  2O99 A;  1TS8 A;  4PAU A;  4ARZ B;  1YLW A;  3B42 A;  4BJP A;  1W63 Q;  4Q0I A;  4GHI B;  3MXQ A;  5DF9 A;  3S7O A;  3G32 A;  4OP5 A;  2EFU A;  4DJ3 A;  3HLD A;  5DJT A;  4WEK A;  3VE3 A;  1L3L A;  3BWL A;  2ZQ7 A;  3VMA A;  2Y2L A;  5JYO A;  4Y0U A;  2JKG A;  4UAA A;  2HF6 A;  1Y28 A;  1K6S A;  2ZOH A;  4ZAM A;  1KVM A;  3PBR A;  2G2W A;  2HZ5 A;  4GOG A;  4P6Z M;  5EM0 A;  1IEL A;  1YKD A;  1YT4 A;  2PD8 A;  4X1L A;  4R3J A;  2XD1 A;  5CTN A;  4HH2 A;  4RA7 A;  4Q8I A;  1K54 A;  4OP8 A;  1OTI A;  2K2N A;  1BUL A;  5I94 A;  5HPI A;  1YLY A;  2D02 A;  1FIL A;  5TBM B;  2A24 A;  4Q0J A;  4ID4 A;  5HX9 A;  4UEY A;  3VFH A;  1TEM A;  4S2K A;  4GNU A;  3O3V A;  1Z6F A;  4N1X A;  1VEU B;  2X02 A;  1LSV A;  3G2Y A;  3UO9 A;  1SDE A;  5HSQ A;  3A3D A;  3FZC A;  1CK3 A;  1IYQ A;  3S7P A;  2DMW A;  3DW0 A;  3EWK A;  4L9G A;  3U4L P;  4II7 A;  5U47 A;  3DAV A;  4WM9 A;  3B3X A;  3TE8 A;  1MY8 A;  3PBO A;  4JGP A;  3IS2 B;  5AJG A;  4QD4 A;  3WS0 A;  1YM1 A;  5F6A A;  4MBF A;  3LR4 A;  4U3T A;  3QHY A;  2HGV A;  2OAP 1;  3S7Q A;  1PI5 A;  1ES3 A;  4UHU A;  3BJN A;  3VSK A;  4Y17 A;  1VM1 A;  5FEG A;  1FIK A;  1F2K A;  2Z2M B;  3CMZ A;  2A24 B;  4BD1 A;  3ISG A;  1XJ6 A;  2ZMV A;  3ZFZ A;  3IXH A;  4BWI A;  2QYB A;  2PD7 A;  1ZC2 A;  4Y3I A;  4IUK A;  1PNE A;  4FUW A;  3GSG A;  4XXR A;  4WUJ A;  1WYB A;  1UGU A;  3BM6 A;  4I3I A;  3BQ8 A;  4KUO A;  2VGL M;  1LI9 A;  1X0O A;  5DJU A;  1EW0 A;  3ZNY A;  1ES2 A;  4KZA A;  2HDQ A;  1XFN A;  4LRY C;  3EEH A;  1XPB A;  4BD0 A;  3CG5 A;  2W3E A;  2FZ0 A;  4RYE A;  2XF3 A;  3S7N A;  3VFF A;  3V3R A;  5HAI A;  5MC7 A;  2VZW A;  1KGG A;  4NKP A;  3A3F A;  4LFU A;  5HDS A;  2LB9 A;  2XRN A;  1E3U D;  1L0D A;  1VQQ A;  3E0Y A;  3Q82 A;  2H10 A;  3H82 A;  5E2G A;  5HL6 A;  2JHE A;  3FC7 A;  4OQ0 A;  4ZJ1 A;  2P08 A;  2V1A A;  3NCK A;  3MSH A;  1YPR A;  2W1T A;  3G2Z A;  4EBL A;  3BW6 A;  2PU2 A;  2WUQ A;  3A0S A;  1BLS A;  4YFM A;  1XKZ A;  4MCW A;  1YMX A;  2VJW A;  4C75 A;  5LBR A;  2XR0 A;  4PM6 A;  1XA7 A;  4MN5 A;  2VGL S;  2PYR A;  4BBU A;  1OPX A;  5TFQ A;  2Y2G A;  1XJ2 A;  2C6W B;  3LGO A;  2PBD P;  4IJG A;  1H3Q A;  3CWF A;  1FCN A;  3MFX A;  4IVI A;  2JN7 A;  4LV2 A;  1HLU P;  4R0Q A;  3PR6 A;  2XK1 A;  1K56 A;  4KQO A;  2Q9N A;  3NIA A;  4EWF A;  2V0U A;  4N9L A;  4IED A;  3HUM A;  1J9M A;  4U0T A;  2E8I A;  5AQB A;  3FYZ A;  2AVX A;  3A3J A;  5IS1 A;  2JKR I;  5FAS A;  4MLL A;  4PM9 A;  3FPV A;  1CF0 A;  3DWZ A;  3QNC A;  3Q81 A;  1K56 D;  3WS4 A;  5HFO A;  1MWT A;  1G6O A;  2W1T B;  3T50 A;  5HD5 A;  5CX7 A;  4NXB A;  1PW8 A;  2VGJ A;  4PM7 A;  1MWS A;  4I38 A;  3HVF A;  2KOI A;  5EVI B;  3PAE A;  5DFY A;  4RQ9 A;  2KLI A;  1RP5 A;  3A0V A;  1SKO A;  3NOP C;  2EX8 A;  3MQQ A;  3DTK A;  2XSS A;  2I72 A;  2PBY A;  3G30 A;  5AVE A;  4CLC D;  4HI4 A;  3G6O A;  3UPO A;  4PM5 A;  3BFC A;  4Y15 A;  4BBT A;  2CC1 A;  3W2Z A;  3KX0 X;  4LCM A;  5CGX A;  2P74 A;  3OBF A;  2J9O A;  1W7F A;  1HD8 A;  2ZC5 B;  3IHA A;  3T4Q A;  4JF5 A;  3RJU A;  4M4X A;  3LEZ A;  1HTZ A;  3T1R A;  3LY3 A;  1K57 A;  3MFD A;  1ZTU A;  3GR2 A;  3SS3 A;  2WZZ A;  5GLB A;  3T4K A;  1KGF A;  3NOT C;  1KGE A;  1K6R A;  3S1Y A;  2Y2H A;  4R70 A;  4NET A;  2O9B A;  3FKW A;  1IKG A;  5L09 A;  3MZD A;  3UDF A;  2HJ9 C;  1SZV A;  1RGY A;  4MBH A;  4Y13 A;  3W4P A;  2FFY A;  4HEF A;  5DFX A;  5A92 A;  3N4I A;  3SH9 A;  4ETX A;  3FV7 A;  4S2I A;  3CZD A;  4EBP A;  3IXD A;  4UQI M;  4BL2 A;  1XJ4 A;  3V3S A;  4DE2 A;  1KDS A;  1D1J A;  3NDE A;  2WKR A;  3CLO A;  4GJ4 A;  2VA0 A;  2PDR A;  3GVB A;  1Y54 A;  3MR0 A;  5CHM A;  3VP2 A;  3IF6 C;  2HDU A;  5HWW A;  1GHI A;  5L10 A;  4WL9 A;  2D01 A;  4RVA A;  1PZO A;  4EW7 A;  4WF0 A;  5J3W A;  2J3T D;  1P9R A;  1LSX A;  3CUE C;  1RCJ A;  1NRJ A;  4BLM A;  5F1F A;  4CLC C;  2FH5 A;  3HJI A;  3N8S A;  2DNS A;  5FSR A;  1UWP X;  4XT2 B;  3N8L A;  3BEB A;  3MKE A;  5L07 A;  3PTE A;  1JWV A;  3VP1 A;  2OAQ 1;  1LLB A;  5EVL A;  3ZG7 B;  2FFF B;  2HP5 A;  2K7S A;  2EX6 A;  2JKT I;  1GSW A;  3VE4 A;  1JWZ A;  1N9B A;  1YLT A;  1KDW A;  2XFT A;  4B4X A;  2QKP A;  1JTD A;  3LI9 A;  1BZA A;  4OLD A;  3ZCZ A;  4KZ7 A;  4GD6 A;  3HLB A;  4WN5 A;  2J8Y A;  1JVJ A;  2WYX A;  3SS5 A;  4S2N C;  2Y2I A;  5HAR A;  1O7E A;  1PW1 A;  2XGN A;  5M1A A;  3K2N A;  3NI9 A;  4WEL A;  3RH8 B;  1F9I A;  5M18 A;  3FKV A;  3PBN A;  4E6W A;  2EWV A;  2Y4A A;  3G35 A;  5EVE A;  2M7U A;  5HPF A;  2GNX A;  3P01 A;  5G4Z A;  1YSP A;  4DF6 A;  2PHY A;  1K55 C;  2Y8H A;  3OCL A;  3KSI A;  4MDZ A;  3HJK A;  1WE4 A;  4ZJ3 A;  4GDN A;  5J7E A;  2W0N A;  4E04 A;  1GCE A;  2J3T C;  4R4R A;  3ITB A;  4LLO B;  1ZG6 A;  3SH7 A;  5FDS A;  4EQI A;  1BYW A;  5HW3 A;  5EEC A;  3IX4 A;  1MKM A;  5JYP A;  3GEC A;  1PFL A;  2VX8 A;  3LY4 A;  5EM1 A;  1W79 A;  4DXC A;  4E6X A;  5HWV A;  2A49 A;  1EWZ A;  5FAO A;  4JXV A;  4HBT A;  3LUQ A;  4DN0 A;  3CI6 A;  3I7J A;  3ZDJ A;  1TS0 A;  5BOH A;  3NBL A;  1MWU A;  4N92 A;  2WGV A;  5FI7 A;  2PRF A;  3N8R A;  1ERM A;  3MKF A;  1W8Y A;  3EQV A;  3PBQ A;  3QP2 A;  3P98 A;  1ERQ A;  5A93 A;  3KYE A;  4Y7P A;  3BQA A;  3ZVT A;  2HP9 A;  4UA9 A;  4ZDX A;  4H6J B;  5GLD A;  4ETZ A;  4E3L A;  3LID A;  3RXX A;  5FA7 A;  4O0P A;  2UWX A;  4CQH A;  3PHY A;  4O7D A;  3VSL A;  4OPZ A;  1AXB A;  5AQ9 A;  2V9A A;  1J3W A;  4DE3 A;  3F1O A;  3BLM A;  1FSW A;  4D60 A;  1ODV A;  4HIA A;  3DWK A;  4NXG A;  2ZL1 A;  4I39 A;  2ZQC A;  3UE1 A;  3G4P A;  1I2S A;  2HDS A;  1XJ3 A;  3C2W A;  3CJM A;  5EE8 A;  3L7H A;  3QP6 A;  3TSG A;  4P6Z S;  2ZLY A;  4P87 A;  2OLU A;  4K91 A;  2OOL A;  2XEP A;  4WMC D;  4YWZ A;  1KE0 A;  3CPT A;  4HNB A;  3UY6 A;  2EWW A;  1Q2Q A;  2Y2Q A;  3BLS A;  4GKU A;  1SDN A;  4U0X A;  5C5K A;  2LB5 A;  5EPH A;  1LL9 A;  2QHK A;  3M6H A;  5GHX A;  4H8R A;  3LYX A;  1LHY A;  3QP5 A;  1AWI A;  4P6B A;  1GHM A;  1F98 A;  3F1O B;  1PIO A;  3M2J A;  4JXW A;  4MNR A;  3ICY A;  1TS6 A;  3F1P A;  2WAE A;  3VOY A;  3GQZ A;  1S67 L;  3ZGA B;  4CJN A;  3LIC A;  5CEC A;  4E3I A;  1E3U A;  4BL3 A;  2QJ7 A;  1XFQ A;  3UMD A;  4KZ6 A;  4X68 A;  2XLN A;  2WKI A;  2EXA A;  3BY9 A;  3EGD C;  3QP8 A;  2P7J A;  2EXB A;  2VK3 A;  1MPL A;  5TR7 A;  4HH3 A;  3WS1 A;  3WS2 A;  4FH4 A;  2IA2 A;  4YNR A;  3HLG A;  2EX2 A;  3LCE A;  5DVA A;  5G4Y A;  5DTK A;  5F5Y A;  5J8X A;  3TRC A;  5FDH A;  3WWX A;  2A2L A;  1L0E A;  3T4O A;  2VGK A;  5AVF A;  3E4O A;  1V9Y A;  4G3K A;  4R3B A;  3OPL A;  1S66 L;  2OLV A;  4C3Q A;  4LEN A;  3BFG A;  2WAD A;  5E43 A;  3GMW A;  1KE4 A;  2WGW A;  5D3O A;  5CGS A;  1FR1 A;  3O88 A;  1JNU A;  1ZG4 A;  3HL9 A;  1DRM A;  1HZO A;  4LRZ E;  4EET B;  4OPY A;  4LV1 A;  3K3C A;  4FH2 A;  2R9X A;  1IKI A;  4K0W A;  4EEP A;  5CED A;  3ZNT A;  2WKH A;  4R4S A;  3LIA A;  4I3J A;  3JVU A;  1HVB A;  2QJ5 A;  4X53 A;  1MZU A;  5EOE A;  3Q1F A;  1C3B A;  4E3J A;  3H82 B;  3LR3 A;  4MBK A;  1FR6 A;  1OJG A;  3NHQ A;  5FAQ A;  2XFS A;  2ZD8 A;  5GL9 A;  3UN7 A;  2ZQ8 A;  4B88 A;  3IF6 A;  1M6K A;  4EES A;  4Z9Q A;  4G3W A;  2K31 A;  5EVI D;  2VEA A;  2OWJ A;  1DP8 A;  4OH0 A;  2OV5 A;  1OT9 A;  1PRQ A;  3Q7V A;  1F5M A;  1GSV A;  5IT5 A;  1QME A;  5DTS A;  3K3D A;  2WGW B;  3CUE A;  4OQH A;  2J9P A;  1SKF A;  4JF4 A;  1LL5 A;  4QY5 A;  4CLC A;  2BG1 A;  1NY0 A;  2JE5 A;  3E4Q A;  1ONG A;  4WLA A;  4EUZ A;  4KUK A;  4X6T A;  3CIT A;  2BLS A;  3OC2 A;  1XGI A;  1OJ5 A;  3D72 A;  1NLZ A;  5HWT A;  5DTT A;  4KG6 A;  3L9K A;  2XQZ A;  2WKE A;  1BUE A;  1NLY A;  1A0K A;  5DKL A;  1XX2 A;  5GHY A;  2INW A;  2PR6 A;  2H5S A;  3ULF A;  5EV0 A;  1ZKJ A;  3H7W A;  4L9F A;  2Z2L B;  4O8G A;  3VP0 A;  4DE1 A;  5G18 A;  4BMW A;  5AQ7 A;  2WKP A;  1ESU A;  1TS7 A;  2XRO A;  4X25 A;  3F1N A;  3VOL A;  3TG9 A;  2G2U A;  4S2N A;  1NYM A;  3GDI A;  4OPQ A;  4ZBE A;  3ZHH A;  3WRZ A;  3NOU C;  4CLC B;  3QP4 A;  4I3A A;  2B02 A;  3S22 A;  4GS9 A;  4EUV A;  4EQ1 A;  1SKO B;  1K55 A;  4WBG A;  1LI0 A;  4LRX C;  1RGZ A;  5HAQ A;  4QB8 A;  4WZ5 C;  1K0K A;  5EVI C;  3NEC A;  3CAX A;  5FEF A;  2EX9 A;  1OME A;  4L0L A;  1K25 A;  1KE3 A;  4B93 A;  2RCX A;  2PU4 A;  3NUL A;  1TD5 A;  4N1H A;  1CEG A;  4ESP A;  4JXG A;  5E2E A;  1FQG A;  3ZG5 A;  4JKT A;  4HP9 A;  4NEE D;  3C4P A;  4ME4 A;  4GZB A;  3UB8 A;  4E3O A;  3BY8 A;  3M2K A;  2P9V A;  1N9O A;  4E3K A;  4Q0H A;  4KQD A;  1YSQ A;  2J7V A;  1G5U A;  4KG2 A;  5FI2 A;  4KZ8 A;  3OLO A;  3IH9 A;  4HQA A;  2YKF A;  1PWD A;  2JKR M;  4OLG A;  1WA9 A;  1GA9 A;  2HV1 A;  4DMZ A;  2HDR A;  5I5L A;  2ZC3 B;  1DJB A;  1XP4 A;  1D7E A;  2RL3 A;  3CHW P;  3RFB A;  5A90 A;  4S2J A;  1H8Z A;  4PKY G;  4YIN A;  1DP6 A;  3W4O A;  1PWC A;  2X71 A;  4UQI S;  1W5D A;  4E3M A;  1IEM A;  1G68 A;  1K4E A;  1S1Z A;  4HJ6 A;  3UE0 A;  3UDX A;  1T1C A;  5KSH A;  5HD3 A;  2Y91 A;  5F69 A;  2ZQD A;  1LT0 A;  2XD5 A;  5FAT A;  3SS4 A;  4S2P A;  3MBZ A;  3UB9 A;  1PWG A;  4NK3 A;  2KX6 A;  4OON A;  3A0R A;  3C4O A;  5FQM A;  4GB7 A;  4FCF A;  1T18 A;  4OOM A;  1MXO A;  5FQJ A;  4G3V A;  2VV6 A;  1K38 A;  4ZRR A;  5F82 A;  4FOF A;  1VB6 A;  3C8C A;  3ZG0 A;  3C30 A;  4IUH A;  3NJA A;  5HAP A;  2JKF A;  4EV4 A;  3LI8 A;  5M19 A;  4PKY A;  2XA7 M;  5KIZ A;  4OKP A;  1PZP A;  3UDI A;  3M6B A;  3UB5 P;  2Q9M A;  1P0Z A;  1W8Q A;  4FD8 A;  3JPU A;  5FI6 A;  2V1B A;  1V9Z A;  3PBS A;  5DKK A;  4ARZ A;  5KZH A;  3V5M A;  2Z6C A;  3DTI A;  3SW1 A;  3C7U A;  4Y2F A;  3LEQ A;  3N6I A;  4GHI A;  4B4Z A;  4HJ4 A;  4N9K A;  3BFF A;  2B95 A;  2W1R A;  1FOF A;  4GD8 A;  3AGD A;  3B33 A;  2V8C A;  3LIF A;  3OPP A;  2QPN A;  2BTF P;  5TJJ A;  1S6R A;  3T1Q B;  1KVL A;  5HDD A;  3UPP A;  2ACG A;  2ZBB A;  1YLJ A;  5CER A;  1OTE A;  5K5B A;  4JPM A;  5KSC A;  3GRJ A;  4OPR A;  3GTC A;  3ZG8 B;  2H0T A;  4KZ3 A;  4JBF A;  2G7U A;  4UA7 A;  2V8F A;  3KSF A;  1IYO A;  2Y2N A;  4JGQ A;  3VP4 A;  3EOI A;  3PXP A;  2Y2J A;  3IH8 A;  4NG2 A;  4EXO A;  3SOI A;  4PMA A;  1MKI A;  5TBM A;  3AGF A;  2EFX A;  1GA0 A;  1QMF A;  3UME A;  1CJF A;  3ZYT A;  1T1A A;  3NDG A;  4GCZ A;  3VOZ A;  3KSH A;  1VEU A;  1N9N A;  1ES4 A;  2MJ6 A;  2X01 A;  1NZO A;  5A91 A;  2IWC A;  3V39 A;  3UE3 A;  4Y0T A;  4R1G A;  4IHQ A;  3HUN A;  4P0M A;  3LR5 A;  1MBL A;  2GZA A;  1P9W A;  3FWL A;  1OTD A;  5IU1 A;  1JWP A;  3IS2 A;  4QHC A;  3IWO A;  2QMI A;  3R7W A;  2DRW A;  3IBJ A;  2M7V A;  3OPR A;  2ZM8 A;  3KO6 A;  2JKT M;  2B5R A;  2P04 A;  3BRM A;  4KZ9 A;  3C38 A;  4GN2 A;  3DTM A;  5DF7 A;  4PM8 A;  2VV8 A;  3LFV A;  1D06 A;  2WGI A;  3MS6 A;  4WMC A;  4B9O A;  3G31 A;  1ONH A;  3MXR A;  1FCM A;  2ZM0 A;  4CPK A;  1XGJ A;  4JGO A;  1WYC A;  2Y2O A;  2L0W A;  2V20 A;  4EEU A;  4QPR A;  3UB6 A;  4EER A;  4XUX A;  4OVD A;  3ITA A;  2GDN A;  2WK0 A;  3BFD A;  2A3U A;  1S4S A;  1T1B A;  4GDB A;  4HBU A;  4KG5 A;  3SH8 A;  3B47 A;  2ZMA A;  3MMH A;  3PBT A;  3R7W B;  1NJ4 A;  5E2H A;  3UNW A;  2QWS A;  3HLE A;  3IHB A;  1ESI A;  4OOY A;  3TJZ C;  2OSU A;  2PT7 A;  4GLQ A;  1JTG A;  1L2S A;  1SCW A;  3BFE A;  3LO7 A;  3MJQ A;  2WAF A;  5EUA A;  1ES5 A;  2ZL1 B;  2JC7 A;  3NY4 A;  2R9W A;  4HHD A;  3P7N A;  3Q7Z A;  4X56 A;  3TOI A;  2Y79 A;  3HLF A;  4OOL A;  3ZQ5 A;  4KZB A;  4LV3 A;  2PR5 A;  2QZ6 A;  3HLW A;  3T1S A;  2WKQ A;  1G6A A;  3C5A A;  5FQ9 A;  3T4T A;  2OWH A;  1BTL A;  4Y5F A;  5CRF A;  3CPT B;  4M3K A;  4R23 A;  2VLG A;  3GV9 A;  3P09 A;  2W27 A;  1W63 M;  2W3H A;  2PYP A;  3IWQ A;  4EBN A;  4DRT A;  3G34 A;  2XDM A;  3SZT A;  2XH9 A;  2ZC4 B;  3LIE A;  2ZMF A;  5HDC A;  3T4S A;  1K54 C;  2ZQA A;  5HL1 A;  4HES A;  3E2L A;  1PYY A;  1BLC A;  2R78 A;  3F1P B;  3VV4 A;  4R6L A;  4BBV A;  3UB7 A;  2EA9 A;  4DDY A;  5FQI A;  2Y2K A;  2WZX A;  3IX3 A;  3JYI A;  3DBA A;  1STZ A;  4JGR A;  4DE0 A;  5CHU A;  3UPN A;  3A3I A;  2HP6 A;  3W4Q A;  1CQA A;  4WZ5 A;  3H9W A;  1ZHH B;  5EVI A;  3IWI A;  4F94 A;  1DJC A;  5CEB A;  3IBR A;  4KQR A;  2VKS A;  3KYQ A;  4IBX A;  2L4R A;  1DJA A;  1IOU A;  4QWO A;  1H5X A;  5FQQ A;  3E4P A;  1VET A;  3KSG A;  2W3G A;  4I5S A;  4DJ2 A;  5AQA A;  1TDL A;  2W3D A;  1I5Q A;  4X69 A;  3VP3 A;  4F3L A;  1YLZ A;  2J3W A;  1BSG A;  1YQS A;  1VHM A;  2H0Y A; 
#chains in the Genus database with same CATH homology
 3LUQ A;  4DN0 A;  3CI6 A;  2A24 B;  3OLO A;  4HQA A;  4Z1W A;  4GW9 A;  1TS0 A;  2YKF A;  1XJ6 A;  2ZMV A;  2JKR M;  1WA9 A;  2HV1 A;  4DMZ A;  3UE6 A;  4BWI A;  5I5L A;  2QYB A;  2PD7 A;  4MMN A;  4CLC E;  4Y3I A;  4IUK A;  1D7E A;  3RFB A;  4WUJ A;  3EQV A;  2KDK A;  2I9V A;  3PBQ A;  4PKY G;  1UGU A;  1DP6 A;  4R3A A;  4I3I A;  3BQ8 A;  4UQI S;  4KUO A;  2VGL M;  3KYZ A;  2NUP C;  1X0O A;  5DJU A;  5EFW A;  1EW0 A;  1S1Z A;  4AFI A;  4HJ6 A;  3BQA A;  1XFN A;  4LRY C;  3EEH A;  1T1C A;  4H6J B;  3EEA A;  5KSH A;  5HD3 A;  4ETZ A;  5F69 A;  3MQO A;  2J80 A;  1LT0 A;  2W3E A;  2Z6D A;  3T4L A;  2FZ0 A;  1TF1 A;  3LID A;  5HZH A;  1OTB A;  3S7N A;  4HP4 A;  4O0P A;  5MC7 A;  2VZW A;  3UB9 A;  4NKP A;  4CQH A;  3PHY A;  5HDS A;  3U2A A;  2LB9 A;  2XRN A;  4F3L B;  2KX6 A;  3A0R A;  1OTA A;  4OOM A;  1T18 A;  3E0Y A;  2V9A A;  3H82 A;  4G3V A;  5HL6 A;  2VV6 A;  2JHE A;  3FC7 A;  4ZRR A;  3F1O A;  4FOF A;  1VB6 A;  3C8C A;  2P08 A;  2V1A A;  3C30 A;  4IUH A;  3NJA A;  2O9A A;  2W1T A;  3FPW A;  3LI8 A;  1ODV A;  3BW6 A;  4HIA A;  2XA7 M;  4PKY A;  5KIZ A;  1P97 A;  3A0S A;  4O01 A;  4NXG A;  2ZOI A;  4I39 A;  1P0Z A;  1S4R A;  4MCW A;  2VJW A;  5LBR A;  2V1B A;  4MN5 A;  2VGL S;  1V9Z A;  3PBS A;  5DKK A;  2PYR A;  4ARZ A;  4BBU A;  1XJ3 A;  1OPX A;  2Z6C A;  3SW1 A;  3C2W A;  3OOV A;  1XJ2 A;  3RTY A;  4Y2F A;  4IJG A;  1H3Q A;  3CWF A;  4GHI A;  3MFX A;  4XT2 A;  3H7W B;  4HJ4 A;  2W1R A;  2JN7 A;  4P6Z S;  3PR6 A;  3B33 A;  4WEJ A;  2OOL A;  3LIF A;  4KQO A;  4YWZ A;  2V0U A;  4HNB A;  5TJJ A;  2EWW A;  5HDD A;  3V67 A;  2M1C A;  3F1N B;  5IS1 A;  2JKR I;  1H8M A;  5C5K A;  2LB5 A;  3FPV A;  3TW8 A;  2QHK A;  4FSF A;  3MF0 A;  2ZBB A;  2L1M A;  1OTE A;  5K5B A;  1DP9 A;  3LYX A;  1GSX A;  4NXE A;  1F98 A;  3F1O B;  5J4E A;  2H28 A;  4K08 A;  2CMN A;  3EGX C;  4GS9 B;  4MN7 A;  1G6O A;  2W1T B;  3T50 A;  2G7U A;  5HD5 A;  3KSF A;  1UWN X;  5CX7 A;  4NXB A;  3ICY A;  4JGQ A;  1TS6 A;  3EOI A;  3PXP A;  4HOI A;  5L8M A;  1YAX A;  4NXF A;  4I38 A;  3F1P A;  3EQU A;  4EXO A;  1S67 L;  5TBM A;  1T19 A;  2KOI A;  3UME A;  3O5Y A;  3ZYT A;  1T1A A;  3LIC A;  5DFY A;  4RQ9 A;  4GCZ A;  2QJ7 A;  2KLI A;  3A0V A;  1XFQ A;  3UMD A;  3KSH A;  1N9N A;  3NOP C;  3MQQ A;  2MJ6 A;  2XSS A;  3JVV A;  1MC0 A;  3BY9 A;  3EGD C;  2YKH A;  2GJ3 A;  3UE3 A;  2P7J A;  5AVE A;  4CLC D;  4IHQ A;  4R38 A;  1OT6 A;  4HI4 A;  5F68 A;  3G6O A;  4HH3 A;  1IFQ A;  3LR5 A;  2GZA A;  1P9W A;  1OTD A;  2IA2 A;  4YNR A;  5IU1 A;  5G4Y A;  5F5Y A;  3TRC A;  3IS2 A;  2A2L A;  4BBT A;  3T4O A;  3R7W A;  3IBJ A;  2M7V A;  5AVF A;  3E4O A;  3W2Z A;  1V9Y A;  3KX0 X;  3KO6 A;  4G3K A;  2JKT M;  2P04 A;  3C38 A;  3OBF A;  3D3O A;  1S66 L;  3LIB A;  4PHT A;  2O9C A;  3T4Q A;  4M4X A;  2VV8 A;  4LPZ A;  3LFV A;  1D06 A;  4L9E A;  4YOF A;  5FL3 A;  1ZTU A;  3FG8 A;  2O0Y A;  4B9O A;  3T4K A;  3T4J A;  2W3F A;  3NOT C;  1JNU A;  2BAS A;  3HCY A;  4R70 A;  2O9B A;  2V0W A;  1DRM A;  4JGO A;  4HY8 A;  2L0W A;  4LRZ E;  2B18 A;  4EEU A;  2HJ9 C;  4HJ3 A;  4QPR A;  3UB6 A;  4EET B;  4EER A;  4Q0H A;  1G28 A;  3K3C A;  4EU0 A;  5DFX A;  4ETX A;  4EEP A;  2NUT C;  1S4S A;  1T1B A;  2VV7 A;  1NWZ A;  4UQI M;  3LIA A;  4I3J A;  1XJ4 A;  3JVU A;  3LR0 A;  2QJ5 A;  3B47 A;  2WKR A;  1MZU A;  1LL8 A;  3MMH A;  3CLO A;  4H6J A;  4GJ4 A;  3PBT A;  1KOU A;  2VA0 A;  3H82 B;  2PDR A;  1LSW A;  3R7W B;  3LR3 A;  3MR0 A;  2GX5 A;  1OJG A;  2QWS A;  3NHQ A;  1N9L A;  4MN6 A;  5A8B A;  3PYP A;  5HWW A;  4EES A;  2HJE A;  4WL9 A;  2D01 A;  4G3W A;  3TJZ C;  2XA7 S;  2K31 A;  2PT7 A;  2VEA A;  2OWJ A;  4GLQ A;  1DP8 A;  4WF0 A;  4EW7 A;  3R4K A;  5J3W A;  3MJQ A;  2J3T D;  3MQ0 A;  1P9R A;  1OT9 A;  3OCN A;  1LSX A;  1F5M A;  1GSV A;  3CUE C;  5IT5 A;  1NRJ A;  3E98 A;  3CUE A;  3K3D A;  4HHD A;  3P7N A;  4CLC C;  1S1Y A;  4CLC A;  2O99 A;  1TS8 A;  2FH5 A;  4PAU A;  3HJI A;  2Y79 A;  3E4Q A;  4ARZ B;  3ZQ5 A;  4OOL A;  4WLA A;  4KUK A;  3B42 A;  4BJP A;  2PR5 A;  3CIT A;  1W63 Q;  1UWP X;  3OC2 A;  4Q0I A;  4GHI B;  4XT2 B;  2WKQ A;  3MXQ A;  1OJ5 A;  3T4T A;  5DF9 A;  3D72 A;  3S7O A;  1NLZ A;  2OWH A;  5HWT A;  4DJ3 A;  2OAQ 1;  5DJT A;  4WEK A;  4Y5F A;  3VE3 A;  3BWL A;  2VLG A;  2K7S A;  1NLY A;  5DKL A;  2JKT I;  2INW A;  2PR6 A;  3ULF A;  1GSW A;  3VE4 A;  2W27 A;  1W63 M;  3H7W A;  2W3H A;  4L9F A;  2PYP A;  2HF6 A;  1Y28 A;  2QKP A;  3LI9 A;  2ZOH A;  4P6Z M;  3PBR A;  4O8G A;  4BMW A;  4WN5 A;  1YKD A;  2PD8 A;  3LIE A;  2ZMF A;  5HDC A;  3T4S A;  4HH2 A;  2WKP A;  1TS7 A;  2XRO A;  3F1N A;  1OTI A;  3VOL A;  2K2N A;  3K2N A;  5HPI A;  3GDI A;  4WEL A;  3RH8 B;  1F9I A;  2R78 A;  3F1P B;  3PBN A;  3VV4 A;  2D02 A;  3NOU C;  2EWV A;  4CLC B;  5TBM B;  2A24 A;  4Q0J A;  4R6L A;  4I3A A;  2M7U A;  2B02 A;  4BBV A;  3UB7 A;  4UEY A;  2EA9 A;  5HPF A;  2GNX A;  4GS9 A;  3P01 A;  5G4Z A;  1YSP A;  2PHY A;  4EUV A;  4EQ1 A;  2Y8H A;  3OCL A;  1LSV A;  4LRX C;  3DBA A;  5HSQ A;  3KSI A;  4MDZ A;  1STZ A;  3HJK A;  3S7P A;  2DMW A;  4JGR A;  3EWK A;  4L9G A;  5J7E A;  4II7 A;  3H9W A;  2W0N A;  1ZHH B;  3CAX A;  4E04 A;  2J3T C;  4LLO B;  3IBR A;  3TE8 A;  2VKS A;  3KYQ A;  4L0L A;  3PBO A;  4JGP A;  3IS2 B;  2L4R A;  5AJG A;  1BYW A;  4B93 A;  1TD5 A;  1IOU A;  1MKM A;  3GEC A;  3E4P A;  5F6A A;  2VX8 A;  3KSG A;  2W3G A;  4I5S A;  4HP9 A;  4DJ2 A;  3LR4 A;  4NEE D;  2W3D A;  5HWV A;  2HGV A;  2OAP 1;  3S7Q A;  4ME4 A;  4F3L A;  2J3W A;  3UB8 A;  3BY8 A;  3BJN A;  1VHM A;  1N9O A;  4KQD A;  1YSQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...