2VV7A

Bjfixlh in unliganded ferrous form
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
105
structure length
105
Chain Sequence
PDAMIVIDGHGIIQLFSTAAERLFGWSELEAIGQNVNILMPEPDRSRHDSYISRYRTTSDPHIIGIGRIVTGKRRDGTTFPMHLSIGEMQSGGEPYFTGFVRDLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords SENSOR PROTEIN FIXL
publication title Changes in Quaternary Structure in the Signaling Mechanisms of Pas Domains.
pubmed doi rcsb
source organism Bradyrhizobium japonicum
molecule tags Signaling protein, transferase
total genus 28
structure length 105
sequence length 105
chains with identical sequence B, C, D
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2008-06-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2vv7A00
3GECA 2PD8A 4L9EA 2V0WA 1F9IA 3H9WA 4I3JA 4BBUA 1XJ3A 1X0OA 1OTBA 4F3LB 1T1CA 3UB7A 4HNBA 5KIZA 2QJ7A 3BWLA 3CWFA 2D02A 1V9YA 4R6LA 3F1PA 1UGUA 4H6JA 3UB6A 4R38A 1XJ4A 4I5SA 5EFWA 2HV1A 2V1AA 4I39A 1G28A 2GJ3A 2VV6A 3RTYA 4GW9A 5HSQA 3E4PA 3IS2B 3EEHA 3MXQA 4GS9A 4DJ3A 5DKKA 4WLAA 2R78A 4WN5A 4HJ6A 5A8BA 1KOUA 1VB6A 2V9AA 4LRXC 1TS7A 1WA9A 3NOPC 4LPZA 4NXBA 1OTIA 2WKRA 3LYXA 2PR5A 2KX6A 4WF0A 1F98A 2OWJA 1EW0A 4L9FA 5DJTA 5I5LA 1XFQA 1LSVA 3LUQA 5F69A 3B33A 1XFNA 3F1NA 4LRYC 5TBMB 4LRZE 4EQ1A 4HOIA 2V1BA 1P0ZA 4NXGA 3ULFA 3IS2A 3LIDA 4GHIA 2JHEA 4EEUA 4L9GA 2P7JA 2Z6DA 2QJ5A 5HDDA 3LICA 3K3CA 1S4RA 4M4XA 4JGRA 5IU1A 4NXEA 1DRMA 4BBVA 3MQOA 2INWA 2ZBBA 4HJ4A 2D01A 1S4SA 3F1PB 3IBRA 5G4ZA 4H6JB 5DJUA 5DKLA 3G6OA 2PD7A 3FC7A 4E04A 2H28A 4I38A 3MJQA 1LSWA 3BY9A 3P7NA 2L1MA 4KUKA 3VE3A 3VE4A 4GS9B 2EA9A 3E4OA 2B02A 1BYWA 1DP9A 1Y28A 3UMEA 2VLGA 3K3DA 4HIAA 4HI4A 5HZHA 4JGPA 1UWPX 1LL8A 4HP9A 2ZOHA 3ICYA 3F1NB 2A24A 2WKQA 2YKFA 3NJAA 3NOUC 1DP8A 1D7EA 4GHIB 3HJIA 4HY8A 3T50A 5HDCA 1OJ5A 3A0RA 1D06A 4EETB 3H82B 4JGQA 2OWHA 4WL9A 1LSXA 2PHYA 4HH2A 3CLOA 1OT9A 3A0VA 2YKHA 4EESA 4K08A 3HJKA 3MFXA 2PYPA 5HD5A 2PYRA 3NOTC 1OTEA 2WKPA 1UWNX 3PYPA 1XJ6A 4B9OA 1N9OA 1OTAA 4MN5A 3H7WB 3H82A 3BY8A 4LLOB 3LIEA 4XT2B 4WUJA 4EERA 3PHYA 3LIBA 4HQAA 5HWVA 3CAXA 3E4QA 3SW1A 4GCZA 1OT6A 1JNUA 5G4YA 3UE6A 2A24B 3ZQ5A 4MN6A 1TS0A 5F68A 5F5YA 2PDRA 4PKYA 2VV7A 3MR0A 4EXOA 1GSWA 3H7WA 1P97A 1T18A 3GDIA 3LIFA 3A0SA 4EW7A 4XT2A 2M1CA 1S1ZA 2W0NA 4HP4A 2J80A 4HHDA 4HH3A 3LI9A 3LIAA 3LI8A 1T1AA 4KUOA 3FG8A 4R70A 5AVEA 2QHKA 3C2WA 1XJ2A 2JN7A 5F6AA 1T1BA 1S1YA 1V9ZA 4PKYG 1N9NA 5J7EA 3C8CA 1OTDA 4JGOA 2VEAA 2VV8A 4F3LA 3UB8A 3MQQA 2BASA 3KX0X 5HWTA 1S67L 4R3AA 4EEPA 3OLOA 1MZUA 2Z6CA 3RH8B 1S66L 4I3IA 1NWZA 2L4RA 3D72A 5J4EA 1GSXA 1DP6A 2OOLA 4RQ9A 1OJGA 2CMNA 4BBTA 3NHQA 1N9LA 3F1OB 5HWWA 2L0WA 5J3WA 3VOLA 2QWSA 1TS6A 1T19A 1TS8A 2K7SA 5HD3A 1ODVA 2W27A 4YWZA 2I9VA 2V0UA 1GSVA 2QKPA 2KDKA 3UMDA 5AVFA 1LT0A 3UB9A 5HDSA 4KQDA 4I3AA 2PR6A 5TBMA 5IS1A 4NXFA 4HJ3A 3F1OA 4DJ2A 2ZOIA 3EWKA
chains in the Genus database with same CATH superfamily
2HZ5A 2PD8A 4L9EA 2HPBA 1PFLA 3C4OA 1F9IA 3MZDA 4BBUA 3EGXC 4E3KA 1XJ3A 1OTBA 4Y3IA 3QP1A 2HP9A 1PI5A 5HAPA 1T1CA 3W8KA 4N9LA 3HLWA 2EX6A 2NUTC 3G34A 1L0GA 1BSGA 1Q2PA 3F1PA 1QMEA 1UGUA 3CPTB 4H6JA 4K0XA 3PBQA 3OBFA 4I5SA 3CUEA 2HF6A 2C6WB 4IBXA 4OLGA 3E2LA 1ONGA 1N4OA 3BJNA 2GJ3A 3RTYA 4GW9A 5HSQA 3BQAA 3E4PA 2XFTA 4LCMA 3IF6A 5E2HA 3OCLA 4PM9A 2V20A 3MKFA 1KOUA 1VB6A 1W8QA 2V9AA 3RXXA 3ZYTA 5FATA 1KGGA 1WA9A 2DMWA 5E2EA 4QHCA 1I2WA 2QZ6A 1OTIA 3Q81A 4UA6A 2PR5A 5CECA 3S1YA 1EW0A 1J9MA 4CJNA 5DJTA 2A2LA 2PRFA 1LSVA 1CK3A 4LRYC 5TBMB 3W4QA 1SCWA 1P0ZA 4Y13A 1ES3A 3LIDA 2BG1A 4GHIA 4S2IA 4X53A 2P7JA 1NYMA 5CHJA 4O0PA 3SS4A 2ZQ8A 4B93A 1S4RA 1K25A 5EOEA 1PW1A 4M4XA 3LGOA 3VOYA 5IU1A 4G3VA 4DE2A 2ZBBA 5EVIC 4N1HA 4QY5A 3SS5A 5DKLA 4N92A 4P0MA 1O7EA 3AGDA 4IUHA 4MMNA 2H28A 3PBOA 1LSWA 1EWZA 3SH9A 1ZTUA 4WZ4A 3BW6A 2L1MA 4EBNA 2EXAA 3VE4A 4GS9B 4WZ5A 3DAVA 2B02A 2HGVA 5FQQA 1Y28A 3UMEA 2FH5A 5HPFA 1K57A 1W63M 2QYBA 3K3DA 5L10A 1HLUP 1ZG4A 3T4OA 1G5UA 4HIAA 4HI4A 4NETA 4UAAA 4YOFA 4KZ7A 1LL8A 5EPHA 2EWVA 2Y55A 1S0WA 2MJ6A 2O99A 4KZ8A 4PM6A 2VGLS 1MKIA 4IVKA 4U0XA 2XK1A 1ONHA 1L0EA 1K54C 1OJ5A 1HVBA 3RXWA 4M3KA 3T4KA 1D06A 4EETB 4MCWA 3IXGA 4HEFA 2XA7S 2PBYA 4WL9A 5FL3A 5U47A 1OT9A 3NBLA 4Y15A 1PWGA 5HD5A 3ISGA 2WKHA 2J9OA 2PYRA 3ZG0A 2W1TA 1S6RA 4GDBA 2HDQA 2Y2KA 4FH4A 4JXVA 5HFOA 2HDUA 3MZFA 3SZTA 2OLVA 5D3OA 2J8YA 5DF8A 1FSWA 1K56A 3AGFA 1OPXA 1BULA 3PHYA 1NRFA 4X1LA 2XD1A 5AJGA 4KZ6A 1BTLA 3CAXA 2WGIA 1K55A 1TDLA 4GCZA 4S2LA 1HD8A 1PW8A 5G4YA 2A24B 3E0YA 4MBFA 2VV7A 3MR0A 2Y2LA 1DJAA 5DTKA 2Y59A 4EXOA 3HREA 2P9VB 4D60A 5FDHA 4QWOA 3HLCA 4NG2A 1XGJA 4Y0UA 3UDIA 4B4XA 2IWBA 3IXHA 3Q7ZA 5HX9A 1FCNA 4HBTA 4KZ3A 2WAFA 2DRWA 4JKTA 3DTEA 3MZEA 3D9YA 3LI8A 3NULA 4WELA 4CLCE 3UPPA 4BD0A 2VA0A 3FG8A 5AVEA 4GKUA 2WGWB 4Z9QA 3BRMA 3OPPA 3ZDJA 5LBRA 1IYPA 1T1BA 2Y91A 1S1YA 1CJFA 1N9BA 1PIOA 3U2AA 3C8CA 4JGOA 4F3LA 5DFXA 3UB8A 1E25A 2EX9A 2JKFA 3UY6A 2WGWA 3RH8B 2FFFB 1S66L 4I3IA 2R9XA 1YSPA 2JKRI 5EV0A 3IXBA 3NCKA 4LENA 4EU0A 3HLEA 2L4RA 3D72A 2OV5A 3RFBA 5J4EA 3OPLA 2OOLA 1H5XA 4GZBA 2HDRA 4LCLA 3TG9A 3NHQA 1VEUB 3O87A 3F1OB 4JXWA 3KSFA 1ERQA 3WS0A 3T4LA 1SKFA 1TS6A 5GL9A 5CGWA 1AWIA 5HD3A 4CLCB 3VP1A 1PRQA 4PAUA 1Y4OA 1BLSA 5HAQA 1W7FA 1ZG6A 2UV0E 2I9VA 2V0UA 1IKGA 1GSVA 3EGDC 2KDKA 1IELA 5HDSA 2ZC4B 5IS1A 2PR6A 5EVID 2Y2MA 3VP3A 1W5DA 1NRJA 4NXFA 1K6SA 4B88A 3F1OA 4DJ2A 4P87A 3VP4A 4ZJ3A 2ZOIA 2WZXA 3T4QA 3GECA 4OKPA 5FAPA 3UO9A 4I3JA 4RYEA 1X0OA 4D2OA 4OQIA 3BECA 4OOLA 1BUEA 5CERA 3BWLA 2JE5A 5CTNA 4R6LA 3G30A 4X25A 4S2KA 1XJ4A 1O07A 3N8LA 3LR0A 1RP5A 2VV6A 4P6ZM 5EVIA 3HBRA 2PU4A 3A3IA 5CGXA 4DJ3A 2W3EA 2R78A 3PBSA 4WN5A 5L07A 1JVJA 2XROA 4Q0HA 4LRXC 3LO7A 4WEKA 4Y17A 2XEPA 3NOPC 1CQAA 4RX3A 3QP4A 3BFCA 3WS5A 4WF0A 2A49A 1LI9A 2B5RA 5DTTA 1XFQA 4PM8A 3LUQA 3B33A 3BFDA 4EQ1A 5GLBA 2M7VA 2JC7A 3ULFA 1YKDA 4Y5FA 5HL6A 2ZLYA 1H8ZA 4KQRA 1FR1A 4OQGA 2G7UA 4DN0A 3N6IA 3PBTA 4H8RA 5CHMA 5EVLA 3LR3A 1G6AA 4PM7A 4R1GA 4NXEA 4Q8IA 3VV4A 1DRMA 1HTZA 3SOIA 4WMCA 4GD8A 3Q7VB 1ZKJA 3MQOA 1MY8A 2W3DA 2INWA 1S4SA 3FYZA 3F1PB 1K54A 1IKIA 1XPBA 2XRNA 3IBRA 4FH2A 4H6JB 5DJUA 5G4ZA 3UPNA 4NKPA 3BLMA 5F82A 1TVFA 2Q0OA 1IFQA 1SDEA 3S22A 3BY9A 5A90A 4IEDA 3KYQA 3VP2A 1ZHHB 1RGZA 3HLGA 2JKTM 3NDEA 3IQAA 3G2YA 4KUKA 1FCOA 1JTDA 3IF6B 3FKWA 3VE3A 2ACGA 3PTEA 2ZMAA 4LGWA 4UQIS 1WYBA 3E4OA 3Q7VA 1DP9A 2GNXA 3NECA 2OLUA 1PI4A 1L3LA 4OVDA 3GR2A 1F5MA 2WKQA 2YKFA 4CPKA 3NJAA 5FEGA 5CEBA 4O01A 3NOUC 4GHIB 4PM5A 1YLTA 5CX7A 3QNCA 4S2PA 5HDCA 1I5QA 1NLYA 1H8MA 2W3GA 3HCYA 3CZDA 3LCEA 3ZG8B 3H82B 3WS4A 3GVBA 3FV7A 2OWHA 4YFMA 1LSXA 1NXYA 3CLOA 1KVMA 2YKHA 4EESA 4OH0A 2Y2JA 4K08A 3O86A 4OQ0A 5FAQA 5DF7A 3FPVA 3B47A 2PYPA 2QMIA 1IYSA 2XLNA 3NOTC 3DWKA 2KLIA 3PYPA 4L0LA 4KZBA 1PWDA 1BT5A 3A3FA 2EX8A 1E4DA 1N9OA 1OTAA 3H7WB 3N8SA 3UE0A 5E2FA 3H82A 1CEFA 3LR5A 4BQMA 5TJJA 4E3JA 1ES4A 4WUJA 1ES2A 5CGSA 4ZBEA 1H0MA 4EWFA 5M1AA 5FI6A 3LEQA 2WUQA 3LR4A 3V5MA 1OT6A 1JNUA 2Q9NA 2HJEA 3SH8A 1KE3A 3MKEA 1TS0A 3VOZA 4C6YA 4KG2A 2PDRA 1YSQA 1YLPA 4GN2A 2AVXA 5F1GA 2Y2HA 3H7WA 3S7NA 5C5KA 3GDIA 5FA7A 4EW7A 1KVLA 3O3VA 4IUKA 3MSHA 3EQUA 1S1ZA 3R4KA 5L09A 3ZGAB 4HHDA 2B18A 4HH3A 4ETXA 4LV2A 3LIAA 3MF0A 1RCJA 2WGVA 1T1AA 3C7UA 4R70A 3P09A 1L0DA 2QHKA 3C2WA 1VETA 2JN7A 2HDSA 4ZJ2A 2VZWA 4G3WA 1CI8A 2W1TB 3LFVA 1V9ZA 1J3WA 5GHXA 2NUPC 1N9NA 4GNUA 5FQKA 1XGIA 4ESPA 1OTDA 2VV8A 4KZ9A 3HVFA 3LY3A 3MQQA 4MDZA 3CITA 4R3AA 4OPRA 2VGJA 3O88A 3OLOA 1XP4A 1ZC2A 4IBRA 4DDSA 5GLCA 2Z6CA 1HZOA 2K31A 1EI5A 2WADA 1IEMA 5AQ9A 3CMZA 3UE1A 1JWPA 4RQ9A 5FASA 4Y0OA 4KENB 1F2KA 4OP8A 3T4TA 1FR6A 5EE8A 4BBTA 4WEJA 3NC8A 1N9LA 1W79A 1QMFA 2VGLM 1FCMA 4E3MA 5HWWA 4ME4A 1FQGA 3GQZA 3IWQA 3K2NA 3GRJA 3KSIA 2LB5A 1L0FA 2XA7M 1BZAA 5HL1A 4OONA 1LT0A 2Y2OA 2Y2PA 3N8RA 3KYEA 2HP6A 3W2ZA 2EXBA 4KZ4A 1CEGA 4ID4A 5F83A 5EVEA 5KZHA 1H3QA 4BJPA 5EUAA 3EQVA 2Y2NA 3H9WA 4MLLA 3CI6A 1NZUA 4F3LB 4MBHA 3N7WA 3MXRA 4BENA 2Y2QA 5G18A 4HNBA 4OPQA 4P6BA 1U60A 4MN7A 2O9AA 1YM1A 4X69A 1SZVA 3R7WB 3UB6A 1P9RA 1K6RA 1TEMA 2H0TA 2HJ9C 4X55A 3UDFA 2XSSA 3GSGA 3O5YA 5EFWA 1XX2A 3KSHA 5IHVA 1I2SA 2J3TC 2ZM2A 3D4FA 1XXMA 3RJUA 1K38A 2OAQ1 2V1ZA 4BWIA 4JF4A 4WLAA 1BLHA 1VM1A 3Q07A 3G32A 5L8MA 1P9WA 1TS7A 4LPZA 4NXBA 3PAEA 3OZHA 1E3UD 3FWLA 3R7WA 4E6XA 3HLFA 1KDWA 3NDGA 4L9FA 3KO6A 3OPHA 3IWIA 3HL9A 5F69A 3F1NA 1C3BA 3SH7A 1M6KA 5A93A 4QY6A 4DF6A 2JHEA 4FTXA 4O7DA 4WM9A 4EEUA 1KGFA 1LHYA 4II7A 2Z6DA 2QJ5A 3QNBA 2UWXA 1MXOA 2ZL1B 5HDDA 4WBGA 3LICA 1BLPA 3K3CA 3VFHA 4YINA 2ZQ7A 3G31A 3IX3A 1TF1A 1ALQA 3ZFZA 3DWZA 4U0TA 4X68A 3G6OA 4UEYA 1YQSA 4O8GA 4EV4A 1E3UA 4R3JA 4NK3A 5GHZA 1NZOA 3MJQA 5KSHA 3VFFA 2ZMVA 2ZL1A 4C75A 3T1XA 2ZJ9A 5EVIB 3A3EA 4KG6A 2EA9A 2V8FA 5AQ7A 4PHTA 4OPYA 5HAIA 1FILA 1KGEA 1WE4A 5A92A 2OAP1 1XKZA 5EM0A 1RGYA 5HZHA 3WWXA 4LFUA 4R4SA 4HP9A 3ICYA 2WAEA 4QU3A 4BL2A 3ZG7B 2IWDA 1DP8A 1D7EA 2JKGA 3HJIA 1IOUA 3T50A 4DE1A 3BYDA 3LY4A 2ZQDA 3A0RA 4EBPA 5DFYA 3T4SA 3T1QB 1K55C 1SKOB 4RX2A 4E3NA 1PZPA 4U3TA 5GHYA 4KQQA 2P08A 1FOFA 2GDNA 3WS2A 1ACFA 3VSKA 2Y8HA 3HJKA 2XD5A 5DF9A 4FOFA 2Y2IA 4N9KA 4Y2FA 1OTEA 2WKPA 3PAGA 4EUZA 4FSFA 1FSYA 4DE0A 3MBZA 4YNRA 1LL5A 3EEAA 3A3DA 2PT7A 3IT9A 1SKOA 3UNWA 1JWVA 3BY8A 4GD6A 3WRZA 3KYZA 4LLOB 2WZZA 1MWTA 3LEZA 5CRFA 1PYYA 2ZM0A 4HQAA 4UHUA 5HWVA 3S4XA 3E4QA 3SW1A 5M19A 5JYOA 3IBJA 3PXPA 5DVAA 3TW8A 3ZG5A 3PBRA 5F68A 2ZMFA 4E3LA 1G6OA 4PKYA 3NIAA 1MWUA 2EFXA 1VQQA 1GSWA 5FAOA 1NYYA 1T18A 3A0SA 4P85A 3L7HA 2VX8A 1ES5A 2V8CA 2Y79A 2W0NA 4HP4A 5CXWA 1MPLA 3Q82A 2J80A 4OLDA 4OPZA 4MNRA 4GB7A 3LI9A 4F94A 3OOVA 1EROA 3T4JA 3OCNA 4DMZA 3BFGA 1KE4A 1PNEA 2ZQAA 4QJGA 1XJ2A 3IF5A 4DXBA 3T12B 3MS6A 5F6AA 3N4IA 5J8XA 5DTSA 3WS1A 4PKYG 2J3TD 3GMWA 3W4PA 1VHMA 2A3UA 3TE8A 4UQIM 3KX0X 1LL9A 5HWTA 4ETZA 1S67L 2WK0A 2Z2LB 2GZAA 2Y4AA 4ARZB 1OMEA 3P01A 1MZUA 4IVIA 1NLZA 3CPTA 4BLMA 2ZD8A 3TSGA 2C5WB 3ZNYA 3IXDA 3UDXA 4Y0TA 2H5SA 1GA0A 1GSXA 4QPRA 1DP6A 1Y54A 2ZC3B 1OJGA 4CLCC 1W63Q 3MXSA 1GHIA 1G68A 2O0YA 1YAXA 3HLBA 3IH8A 5EECA 2QWSA 2IA2A 2K7SA 4ARZA 1JWZA 3QP8A 3TJZC 1ODVA 4YWZA 1SHVA 3TOIA 2FZ0A 3V67A 3UMDA 1Z09A 4ZRRA 4DXCA 4KQDA 5TBMA 1DY6A 2VK3A 3CJMA 1W8YA 1VETB 5BOHA 1YMXA 4A5RA 1JTGA 5HARA 4GDNA 4EQIA 2O9CA 5FQMA 4UA9A 5E2GA 4OOMA 3EWKA 3P98A 4X1MA 5HPIA 2V0WA 2R9WA 5GLAA 4KG5A 3C38A 3V3SA 2RCXA 5KSCA 5FEFA 3DW0A 2Q9MA 2KOIA 1MBLA 2JKRM 3UB7A 3S7QA 3JYIA 5KIZA 2QJ7A 3C30A 3CWFA 3NY4A 4GJ4A 2D02A 3HUNA 1IYQA 1KDSA 1V9YA 3B42A 2Z2MB 4BMWA 2XF3A 4S2NC 1NY0A 4R38A 4JF5A 2B95A 4GLQA 2WKEA 1XA7A 3M2KA 2HV1A 2V1AA 5CEDA 4I39A 1G28A 5FSRA 2O9BA 2I72A 3JPUA 4OP5A 3IS2B 3EEHA 4JF6A 1Q2QA 3MXQA 5MC7A 2DCFA 4GS9A 5FI2A 5DKKA 1K56D 3FPWA 3ZCZA 4HJ6A 5A8BA 1TD5A 3ZVWA 2JKTI 3V39A 3OC2A 2WKRA 3LYXA 4S2OA 3IWOA 2JBFA 2KX6A 1F98A 2OWJA 4JBFA 4G3KA 5I5LA 1XFNA 4LV3A 4LRZE 3FZCA 4HOIA 2V1BA 4NXGA 2G2UA 2EWWA 3IS2A 2Y2GA 4L9GA 1FIKA 2ZC6B 3DTKA 2J9PA 1YT4A 4B4ZA 3ZNTA 2W3HA 2E8JA 1LI0A 4DRTA 4JLFA 5AQAA 1GA9A 3Q1FA 4JGRA 1DJBA 3CUEC 2W3FA 4NEED 1YMSA 4Z1WA 4BBVA 3DTIA 4QB8A 5TR7A 3W4OA 4WYYA 2XQZA 4HJ4A 2D01A 4Q0IA 3VP0A 3IF6C 1MWRA 2PD7A 4DE3A 3FC7A 4E04A 4JXSA 3D3OA 4MEZA 4I38A 5FQ9A 2K2NA 4AFIA 1GHMA 4XUZA 1MKMA 2M7UA 1ESIA 1KE0A 4ZDXA 4K91A 3PBNA 1TDGA 3P7NA 3UPOA 3ITBA 4FCFA 3KSGA 4OOYA 5FQIA 3VMAA 2ZQCA 3UN7A 3T1RA 5GLDA 5KMWA 1YLZA 4Y7PA 3MQ0A 3IHAA 1BYWA 2PBDP 2VLGA 4KQOA 4E3IA 3B3XA 4E3OA 4MBKA 3ZVTA 2VKSA 2XDMA 4ZAMA 2RL3A 4GOGA 4JGPA 3IX4A 1UWPX 2BLSA 2ZOHA 4N1XA 3BEBA 3F1NB 5IT5A 2A24A 1DJCA 2GX5A 4S2MA 4KZ5A 3G4PA 2X01A 5FI7A 3M6BA 5EM1A 3ITAA 5F1FA 1H8YA 2OSUA 2IWCA 1CI9A 2P9VA 4HY8A 4BL3A 2G2WA 5AQBA 3IH9A 5HW3A 2FFYA 3E98A 1GCEA 4EBLA 2E8IA 5L2FA 2W1RA 5EOOA 2DNSA 2XGNA 3IHBA 4JGQA 2EFUA 5I94A 1ESUA 3G2ZA 5K5BA 2PHYA 4HH2A 1L2SA 2CC1A 2VJWA 4UA7A 3A0VA 3BFEA 4R23A 3OPRA 4WZ5C 4PMAA 3MFXA 3U4LP 4PPRA 1K57C 1UWNX 4CQHA 1XJ6A 4ZTKA 1K4FA 2ZM8A 5TGFA 4B9OA 3V50A 4CLCD 1PZOA 4MN5A 3M6HA 3QP6A 5A91A 5JYPA 2JCHA 1NJ4A 1K4EA 5CHUA 2X71A 3LIEA 4XT2B 4E6WA 4EERA 3QHYA 4EUVA 3LIBA 2P04A 5M18A 1A0KA 2BTFP 3QP5A 3UB5P 2ZC5B 4R4RA 3HUOA 3G35A 2X02A 3S7OA 3JVUA 4FUWA 3UE6A 3L9KA 3ZQ5A 1MWSA 3HUMA 4MN6A 3EOIA 4P6ZS 5F5YA 4X6TA 1GHPA 4S2JA 1P97A 1VEUA 1XA1A 4JXGA 2WYXA 3LIFA 3BM6A 5TFQA 4DDYA 4RVAA 4XT2A 1IYOA 3CG5A 3CHWP 4R0QA 2M1CA 3MMHA 2H0YA 3ZG9B 4K0WA 4XXRA 1PWCA 4CLCA 4OQHA 4KZAA 3I7JA 1STZA 1YLYA 3M2JA 3NI9A 3WRTA 5FQJA 3AGEA 2ZQ9A 4KUOA 1YPRA 3GTCA 3C4PA 4LV1A 1K0KA 3BLSA 2J7VA 2HP5A 2EX2A 1D1JA 3T1SA 3A3JA 2P74A 2J3WA 4ZJ1A 4QD4A 3BFFA 5J7EA 4X56A 2VEAA 4JPMA 1WYCA 1YLJA 3IX8A 4IJGA 4WMCD 2BASA 3FKVA 4C3QA 1M40A 3DBAA 4HBUA 5CTMA 2WKIA 4EEPA 3PR6A 3QP2A 4R3BA 3ZHHA 2VGKA 1ERMA 4HESA 3BQ8A 3UE3A 1Z6FA 2LB9A 3DTMA 1BLCA 1AXBA 1NWZA 4DKIA 3TRCA 2XFSA 3JVVA 2CMNA 3C7VA 3SS3A 4BD1A 3VSLA 2PAVP 3V3RA 2H10A 4FD8A 3C5AA 2ZC7A 4S2NA 2L0WA 4LV0A 5J3WA 1SDNA 3VOLA 2QPNA 1T19A 1TS8A 5FDSA 4Q0JA 1MC0A 3MFDA 3GV9A 2W27A 2PU2A 2QKPA 4XUXA 2XH9A 5AVFA 2XR0A 1CF0A 3UB9A 3S7PA 2V2FF 4I3AA 4RA7A 4IHQA 5E43A 3E2KA 4HJ3A 1LLBA 3HLDA 1YLWA
chains in the Genus database with same CATH topology
3T4QA 3GECA 2PD8A 4L9EA 1H3QA 4BJPA 5HPIA 2V0WA 1F9IA 3EQVA 3H9WA 4I3JA 3CI6A 4BBUA 3EGXC 3C38A 1XJ3A 1X0OA 1OTBA 4Y3IA 4F3LB 2KOIA 2JKRM 1T1CA 3UB7A 3S7QA 4OOLA 4HNBA 5KIZA 2NUTC 2QJ7A 3BWLA 3C30A 3CWFA 4GJ4A 4MN7A 2D02A 1V9YA 4R6LA 3B42A 3F1PA 2O9AA 1UGUA 4H6JA 4BMWA 3PBQA 3R7WB 3UB6A 1P9RA 4R38A 2HJ9C 3OBFA 1XJ4A 4GLQA 4I5SA 2XSSA 3CUEA 2HF6A 3O5YA 5EFWA 3KSHA 2HV1A 2V1AA 3LR0A 4I39A 1G28A 2J3TC 2O9BA 3BJNA 2GJ3A 2VV6A 3RTYA 4GW9A 5HSQA 4P6ZM 3BQAA 3E4PA 3IS2B 2OAQ1 3EEHA 3MXQA 5MC7A 4BWIA 4GS9A 4DJ3A 5DKKA 3OCLA 3FPWA 4WLAA 2W3EA 2R78A 3PBSA 4WN5A 4HJ6A 5A8BA 1KOUA 1VB6A 4Q0HA 2V9AA 1TD5A 2XROA 4LRXC 5L8MA 1P9WA 3ZYTA 4WEKA 1TS7A 2JKTI 1WA9A 2DMWA 3NOPC 4LPZA 4NXBA 1OTIA 3OC2A 2WKRA 3LYXA 3R7WA 2PR5A 2KX6A 4WF0A 1F98A 2OWJA 1EW0A 4G3KA 4L9FA 5DJTA 3KO6A 5I5LA 1XFQA 2A2LA 1LSVA 3LUQA 5F69A 3B33A 1XFNA 3F1NA 4LRYC 5TBMB 4LRZE 4EQ1A 4HOIA 2V1BA 2M7VA 1P0ZA 4NXGA 3ULFA 2EWWA 3IS2A 1YKDA 4Y5FA 3LIDA 5HL6A 4GHIA 2JHEA 4EEUA 2G7UA 4L9GA 2P7JA 4II7A 2Z6DA 4DN0A 2QJ5A 3PBTA 5HDDA 4O0PA 3LICA 2W3HA 3K3CA 4B93A 1S4RA 3LR3A 4M4XA 4JGRA 5IU1A 4NXEA 3CUEC 1TF1A 3VV4A 4G3VA 1DRMA 2W3FA 4NEED 4Z1WA 4BBVA 3MQOA 2W3DA 2INWA 2ZBBA 4HJ4A 2D01A 4Q0IA 1S4SA 3F1PB 2XRNA 3IBRA 4H6JB 5G4ZA 5DJUA 5DKLA 3G6OA 2PD7A 4UEYA 4NKPA 4O8GA 3FC7A 4E04A 3D3OA 4IUHA 1IFQA 4MMNA 2H28A 3PBOA 4I38A 3MJQA 2K2NA 5KSHA 4AFIA 1LSWA 3BY9A 1MKMA 3KYQA 2M7UA 2ZMVA 3PBNA 1ZTUA 1ZHHB 3P7NA 2JKTM 3BW6A 2L1MA 3KSGA 4KUKA 3VE3A 3VE4A 4GS9B 2EA9A 4UQIS 3E4OA 3MQ0A 2B02A 4PHTA 2HGVA 1BYWA 1DP9A 1Y28A 3UMEA 2VLGA 4KQOA 2FH5A 2GNXA 5HPFA 1W63M 2OAP1 2QYBA 3K3DA 2VKSA 3T4OA 4HIAA 4HI4A 5HZHA 4JGPA 4YOFA 1UWPX 1LL8A 4HP9A 2ZOHA 3ICYA 3F1NB 5IT5A 2A24A 2EWVA 2GX5A 1F5MA 2WKQA 2YKFA 2MJ6A 3NJAA 2O99A 4O01A 3NOUC 1DP8A 1D7EA 4GHIB 2VGLS 3HJIA 1IOUA 4HY8A 5CX7A 3T50A 5HDCA 1OJ5A 3E98A 1NLYA 3A0RA 1H8MA 2W3GA 3T4KA 3HCYA 1D06A 5DFYA 3T4SA 2W1RA 4EETB 4MCWA 3H82B 4JGQA 2XA7S 5K5BA 2OWHA 4WL9A 5FL3A 1LSXA 2PHYA 2P08A 4HH2A 2VJWA 3CLOA 1OT9A 3A0VA 2YKHA 4EESA 2Y8HA 4K08A 3HJKA 5DF9A 3FPVA 3MFXA 3B47A 4FOFA 2PYPA 5HD5A 2PYRA 4Y2FA 3NOTC 1OTEA 2WKPA 1UWNX 2KLIA 3PYPA 2W1TA 4L0LA 4CQHA 4FSFA 1XJ6A 4B9OA 1N9OA 4YNRA 3EEAA 1OTAA 4CLCD 4MN5A 2PT7A 3H7WB 3H82A 3LR5A 3BY8A 5TJJA 3KYZA 4LLOB 3LIEA 4XT2B 1OPXA 4WUJA 4EERA 4EUVA 3PHYA 3LIBA 4HQAA 2P04A 5AJGA 5HWVA 3CAXA 3E4QA 3SW1A 4GCZA 3LR4A 1OT6A 3IBJA 3S7OA 1JNUA 2HJEA 3JVUA 5G4YA 3PXPA 3UE6A 2A24B 3ZQ5A 3TW8A 4MN6A 1TS0A 3E0YA 3PBRA 3EOIA 5F68A 4P6ZS 5F5YA 2ZMFA 1G6OA 2PDRA 4PKYA 2VV7A 3MR0A 1YSQA 4EXOA 1GSWA 3H7WA 3S7NA 1P97A 5C5KA 1T18A 3GDIA 3LIFA 3A0SA 4EW7A 4IUKA 4XT2A 3EQUA 2M1CA 2VX8A 1S1ZA 2Y79A 3MMHA 3R4KA 2W0NA 4HP4A 4CLCA 2J80A 4HHDA 2B18A 4HH3A 4ETXA 3LI9A 1STZA 3OOVA 3T4JA 3OCNA 3LIAA 4DMZA 3LI8A 3MF0A 4WELA 4CLCE 2VA0A 1T1AA 4KUOA 3FG8A 4R70A 5AVEA 2QHKA 3C2WA 1XJ2A 2JN7A 5F6AA 5LBRA 1T1BA 2VZWA 4G3WA 2W1TB 1S1YA 3LFVA 2J3WA 1V9ZA 2NUPC 4PKYG 2J3TD 1N9NA 5J7EA 3U2AA 3C8CA 1VHMA 1OTDA 4JGOA 2VEAA 2VV8A 4F3LA 5DFXA 3UB8A 3TE8A 4IJGA 4UQIM 3MQQA 2BASA 3KX0X 4MDZA 3DBAA 5HWTA 4ETZA 1S67L 3CITA 4R3AA 4EEPA 3PR6A 2GZAA 4ARZB 3P01A 3OLOA 1MZUA 3BQ8A 3UE3A 1NLZA 2Z6CA 3RH8B 2K31A 1S66L 2LB9A 4I3IA 1NWZA 1YSPA 2JKRI 4EU0A 3TRCA 2L4RA 3D72A 5J4EA 3RFBA 1GSXA 4QPRA 1DP6A 2OOLA 4RQ9A 1OJGA 3JVVA 2CMNA 4CLCC 1W63Q 3T4TA 4BBTA 3NHQA 4WEJA 1N9LA 2O0YA 3F1OB 2VGLM 1YAXA 3KSFA 5HWWA 2L0WA 5J3WA 3VOLA 2QWSA 2IA2A 4ME4A 3T4LA 1TS6A 1T19A 1TS8A 2K7SA 4ARZA 4Q0JA 5HD3A 4CLCB 3K2NA 3TJZC 1ODVA 4PAUA 3KSIA 1MC0A 2LB5A 2W27A 4YWZA 2I9VA 2XA7M 2V0UA 1GSVA 2FZ0A 2QKPA 3EGDC 3V67A 2KDKA 3UMDA 4ZRRA 5AVFA 1LT0A 3UB9A 3S7PA 5HDSA 4KQDA 4I3AA 2PR6A 5TBMA 5IS1A 4IHQA 3W2ZA 1NRJA 4NXFA 4HJ3A 3F1OA 2O9CA 4DJ2A 2ZOIA 4OOMA 3EWKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GEC A;  2PD8 A;  4L9E A;  2V0W A;  1F9I A;  3H9W A;  4I3J A;  4BBU A;  1XJ3 A;  1X0O A;  1OTB A;  4F3L B;  1T1C A;  3UB7 A;  4HNB A;  5KIZ A;  2QJ7 A;  3BWL A;  3CWF A;  2D02 A;  1V9Y A;  4R6L A;  3F1P A;  1UGU A;  4H6J A;  3UB6 A;  4R38 A;  1XJ4 A;  4I5S A;  5EFW A;  2HV1 A;  2V1A A;  4I39 A;  1G28 A;  2GJ3 A;  2VV6 A;  3RTY A;  4GW9 A;  5HSQ A;  3E4P A;  3IS2 B;  3EEH A;  3MXQ A;  4GS9 A;  4DJ3 A;  5DKK A;  4WLA A;  2R78 A;  4WN5 A;  4HJ6 A;  5A8B A;  1KOU A;  1VB6 A;  2V9A A;  4LRX C;  1TS7 A;  1WA9 A;  3NOP C;  4LPZ A;  4NXB A;  1OTI A;  2WKR A;  3LYX A;  2PR5 A;  2KX6 A;  4WF0 A;  1F98 A;  2OWJ A;  1EW0 A;  4L9F A;  5DJT A;  5I5L A;  1XFQ A;  1LSV A;  3LUQ A;  5F69 A;  3B33 A;  1XFN A;  3F1N A;  4LRY C;  5TBM B;  4LRZ E;  4EQ1 A;  4HOI A;  2V1B A;  1P0Z A;  4NXG A;  3ULF A;  3IS2 A;  3LID A;  4GHI A;  2JHE A;  4EEU A;  4L9G A;  2P7J A;  2Z6D A;  2QJ5 A;  5HDD A;  3LIC A;  3K3C A;  1S4R A;  4M4X A;  4JGR A;  5IU1 A;  4NXE A;  1DRM A;  4BBV A;  3MQO A;  2INW A;  2ZBB A;  4HJ4 A;  2D01 A;  1S4S A;  3F1P B;  3IBR A;  5G4Z A;  4H6J B;  5DJU A;  5DKL A;  3G6O A;  2PD7 A;  3FC7 A;  4E04 A;  2H28 A;  4I38 A;  3MJQ A;  1LSW A;  3BY9 A;  3P7N A;  2L1M A;  4KUK A;  3VE3 A;  3VE4 A;  4GS9 B;  2EA9 A;  3E4O A;  2B02 A;  1BYW A;  1DP9 A;  1Y28 A;  3UME A;  2VLG A;  3K3D A;  4HIA A;  4HI4 A;  5HZH A;  4JGP A;  1UWP X;  1LL8 A;  4HP9 A;  2ZOH A;  3ICY A;  3F1N B;  2A24 A;  2WKQ A;  2YKF A;  3NJA A;  3NOU C;  1DP8 A;  1D7E A;  4GHI B;  3HJI A;  4HY8 A;  3T50 A;  5HDC A;  1OJ5 A;  3A0R A;  1D06 A;  4EET B;  3H82 B;  4JGQ A;  2OWH A;  4WL9 A;  1LSX A;  2PHY A;  4HH2 A;  3CLO A;  1OT9 A;  3A0V A;  2YKH A;  4EES A;  4K08 A;  3HJK A;  3MFX A;  2PYP A;  5HD5 A;  2PYR A;  3NOT C;  1OTE A;  2WKP A;  1UWN X;  3PYP A;  1XJ6 A;  4B9O A;  1N9O A;  1OTA A;  4MN5 A;  3H7W B;  3H82 A;  3BY8 A;  4LLO B;  3LIE A;  4XT2 B;  4WUJ A;  4EER A;  3PHY A;  3LIB A;  4HQA A;  5HWV A;  3CAX A;  3E4Q A;  3SW1 A;  4GCZ A;  1OT6 A;  1JNU A;  5G4Y A;  3UE6 A;  2A24 B;  3ZQ5 A;  4MN6 A;  1TS0 A;  5F68 A;  5F5Y A;  2PDR A;  4PKY A;  2VV7 A;  3MR0 A;  4EXO A;  1GSW A;  3H7W A;  1P97 A;  1T18 A;  3GDI A;  3LIF A;  3A0S A;  4EW7 A;  4XT2 A;  2M1C A;  1S1Z A;  2W0N A;  4HP4 A;  2J80 A;  4HHD A;  4HH3 A;  3LI9 A;  3LIA A;  3LI8 A;  1T1A A;  4KUO A;  3FG8 A;  4R70 A;  5AVE A;  2QHK A;  3C2W A;  1XJ2 A;  2JN7 A;  5F6A A;  1T1B A;  1S1Y A;  1V9Z A;  4PKY G;  1N9N A;  5J7E A;  3C8C A;  1OTD A;  4JGO A;  2VEA A;  2VV8 A;  4F3L A;  3UB8 A;  3MQQ A;  2BAS A;  3KX0 X;  5HWT A;  1S67 L;  4R3A A;  4EEP A;  3OLO A;  1MZU A;  2Z6C A;  3RH8 B;  1S66 L;  4I3I A;  1NWZ A;  2L4R A;  3D72 A;  5J4E A;  1GSX A;  1DP6 A;  2OOL A;  4RQ9 A;  1OJG A;  2CMN A;  4BBT A;  3NHQ A;  1N9L A;  3F1O B;  5HWW A;  2L0W A;  5J3W A;  3VOL A;  2QWS A;  1TS6 A;  1T19 A;  1TS8 A;  2K7S A;  5HD3 A;  1ODV A;  2W27 A;  4YWZ A;  2I9V A;  2V0U A;  1GSV A;  2QKP A;  2KDK A;  3UMD A;  5AVF A;  1LT0 A;  3UB9 A;  5HDS A;  4KQD A;  4I3A A;  2PR6 A;  5TBM A;  5IS1 A;  4NXF A;  4HJ3 A;  3F1O A;  4DJ2 A;  2ZOI A;  3EWK A; 
#chains in the Genus database with same CATH topology
 2HZ5 A;  2PD8 A;  4L9E A;  2HPB A;  1PFL A;  3C4O A;  1F9I A;  3MZD A;  4BBU A;  3EGX C;  4E3K A;  1XJ3 A;  1OTB A;  4Y3I A;  3QP1 A;  2HP9 A;  1PI5 A;  5HAP A;  1T1C A;  3W8K A;  4N9L A;  3HLW A;  2EX6 A;  2NUT C;  3G34 A;  1L0G A;  1BSG A;  1Q2P A;  3F1P A;  1QME A;  1UGU A;  3CPT B;  4H6J A;  4K0X A;  3PBQ A;  3OBF A;  4I5S A;  3CUE A;  2HF6 A;  2C6W B;  4IBX A;  4OLG A;  3E2L A;  1ONG A;  1N4O A;  3BJN A;  2GJ3 A;  3RTY A;  4GW9 A;  5HSQ A;  3BQA A;  3E4P A;  2XFT A;  4LCM A;  3IF6 A;  5E2H A;  3OCL A;  4PM9 A;  2V20 A;  3MKF A;  1KOU A;  1VB6 A;  1W8Q A;  2V9A A;  3RXX A;  3ZYT A;  5FAT A;  1KGG A;  1WA9 A;  2DMW A;  5E2E A;  4QHC A;  1I2W A;  2QZ6 A;  1OTI A;  3Q81 A;  4UA6 A;  2PR5 A;  5CEC A;  3S1Y A;  1EW0 A;  1J9M A;  4CJN A;  5DJT A;  2A2L A;  2PRF A;  1LSV A;  1CK3 A;  4LRY C;  5TBM B;  3W4Q A;  1SCW A;  1P0Z A;  4Y13 A;  1ES3 A;  3LID A;  2BG1 A;  4GHI A;  4S2I A;  4X53 A;  2P7J A;  1NYM A;  5CHJ A;  4O0P A;  3SS4 A;  2ZQ8 A;  4B93 A;  1S4R A;  1K25 A;  5EOE A;  1PW1 A;  4M4X A;  3LGO A;  3VOY A;  5IU1 A;  4G3V A;  4DE2 A;  2ZBB A;  5EVI C;  4N1H A;  4QY5 A;  3SS5 A;  5DKL A;  4N92 A;  4P0M A;  1O7E A;  3AGD A;  4IUH A;  4MMN A;  2H28 A;  3PBO A;  1LSW A;  1EWZ A;  3SH9 A;  1ZTU A;  4WZ4 A;  3BW6 A;  2L1M A;  4EBN A;  2EXA A;  3VE4 A;  4GS9 B;  4WZ5 A;  3DAV A;  2B02 A;  2HGV A;  5FQQ A;  1Y28 A;  3UME A;  2FH5 A;  5HPF A;  1K57 A;  1W63 M;  2QYB A;  3K3D A;  5L10 A;  1HLU P;  1ZG4 A;  3T4O A;  1G5U A;  4HIA A;  4HI4 A;  4NET A;  4UAA A;  4YOF A;  4KZ7 A;  1LL8 A;  5EPH A;  2EWV A;  2Y55 A;  1S0W A;  2MJ6 A;  2O99 A;  4KZ8 A;  4PM6 A;  2VGL S;  1MKI A;  4IVK A;  4U0X A;  2XK1 A;  1ONH A;  1L0E A;  1K54 C;  1OJ5 A;  1HVB A;  3RXW A;  4M3K A;  3T4K A;  1D06 A;  4EET B;  4MCW A;  3IXG A;  4HEF A;  2XA7 S;  2PBY A;  4WL9 A;  5FL3 A;  5U47 A;  1OT9 A;  3NBL A;  4Y15 A;  1PWG A;  5HD5 A;  3ISG A;  2WKH A;  2J9O A;  2PYR A;  3ZG0 A;  2W1T A;  1S6R A;  4GDB A;  2HDQ A;  2Y2K A;  4FH4 A;  4JXV A;  5HFO A;  2HDU A;  3MZF A;  3SZT A;  2OLV A;  5D3O A;  2J8Y A;  5DF8 A;  1FSW A;  1K56 A;  3AGF A;  1OPX A;  1BUL A;  3PHY A;  1NRF A;  4X1L A;  2XD1 A;  5AJG A;  4KZ6 A;  1BTL A;  3CAX A;  2WGI A;  1K55 A;  1TDL A;  4GCZ A;  4S2L A;  1HD8 A;  1PW8 A;  5G4Y A;  2A24 B;  3E0Y A;  4MBF A;  2VV7 A;  3MR0 A;  2Y2L A;  1DJA A;  5DTK A;  2Y59 A;  4EXO A;  3HRE A;  2P9V B;  4D60 A;  5FDH A;  4QWO A;  3HLC A;  4NG2 A;  1XGJ A;  4Y0U A;  3UDI A;  4B4X A;  2IWB A;  3IXH A;  3Q7Z A;  5HX9 A;  1FCN A;  4HBT A;  4KZ3 A;  2WAF A;  2DRW A;  4JKT A;  3DTE A;  3MZE A;  3D9Y A;  3LI8 A;  3NUL A;  4WEL A;  4CLC E;  3UPP A;  4BD0 A;  2VA0 A;  3FG8 A;  5AVE A;  4GKU A;  2WGW B;  4Z9Q A;  3BRM A;  3OPP A;  3ZDJ A;  5LBR A;  1IYP A;  1T1B A;  2Y91 A;  1S1Y A;  1CJF A;  1N9B A;  1PIO A;  3U2A A;  3C8C A;  4JGO A;  4F3L A;  5DFX A;  3UB8 A;  1E25 A;  2EX9 A;  2JKF A;  3UY6 A;  2WGW A;  3RH8 B;  2FFF B;  1S66 L;  4I3I A;  2R9X A;  1YSP A;  2JKR I;  5EV0 A;  3IXB A;  3NCK A;  4LEN A;  4EU0 A;  3HLE A;  2L4R A;  3D72 A;  2OV5 A;  3RFB A;  5J4E A;  3OPL A;  2OOL A;  1H5X A;  4GZB A;  2HDR A;  4LCL A;  3TG9 A;  3NHQ A;  1VEU B;  3O87 A;  3F1O B;  4JXW A;  3KSF A;  1ERQ A;  3WS0 A;  3T4L A;  1SKF A;  1TS6 A;  5GL9 A;  5CGW A;  1AWI A;  5HD3 A;  4CLC B;  3VP1 A;  1PRQ A;  4PAU A;  1Y4O A;  1BLS A;  5HAQ A;  1W7F A;  1ZG6 A;  2UV0 E;  2I9V A;  2V0U A;  1IKG A;  1GSV A;  3EGD C;  2KDK A;  1IEL A;  5HDS A;  2ZC4 B;  5IS1 A;  2PR6 A;  5EVI D;  2Y2M A;  3VP3 A;  1W5D A;  1NRJ A;  4NXF A;  1K6S A;  4B88 A;  3F1O A;  4DJ2 A;  4P87 A;  3VP4 A;  4ZJ3 A;  2ZOI A;  2WZX A;  3T4Q A;  3GEC A;  4OKP A;  5FAP A;  3UO9 A;  4I3J A;  4RYE A;  1X0O A;  4D2O A;  4OQI A;  3BEC A;  4OOL A;  1BUE A;  5CER A;  3BWL A;  2JE5 A;  5CTN A;  4R6L A;  3G30 A;  4X25 A;  4S2K A;  1XJ4 A;  1O07 A;  3N8L A;  3LR0 A;  1RP5 A;  2VV6 A;  4P6Z M;  5EVI A;  3HBR A;  2PU4 A;  3A3I A;  5CGX A;  4DJ3 A;  2W3E A;  2R78 A;  3PBS A;  4WN5 A;  5L07 A;  1JVJ A;  2XRO A;  4Q0H A;  4LRX C;  3LO7 A;  4WEK A;  4Y17 A;  2XEP A;  3NOP C;  1CQA A;  4RX3 A;  3QP4 A;  3BFC A;  3WS5 A;  4WF0 A;  2A49 A;  1LI9 A;  2B5R A;  5DTT A;  1XFQ A;  4PM8 A;  3LUQ A;  3B33 A;  3BFD A;  4EQ1 A;  5GLB A;  2M7V A;  2JC7 A;  3ULF A;  1YKD A;  4Y5F A;  5HL6 A;  2ZLY A;  1H8Z A;  4KQR A;  1FR1 A;  4OQG A;  2G7U A;  4DN0 A;  3N6I A;  3PBT A;  4H8R A;  5CHM A;  5EVL A;  3LR3 A;  1G6A A;  4PM7 A;  4R1G A;  4NXE A;  4Q8I A;  3VV4 A;  1DRM A;  1HTZ A;  3SOI A;  4WMC A;  4GD8 A;  3Q7V B;  1ZKJ A;  3MQO A;  1MY8 A;  2W3D A;  2INW A;  1S4S A;  3FYZ A;  3F1P B;  1K54 A;  1IKI A;  1XPB A;  2XRN A;  3IBR A;  4FH2 A;  4H6J B;  5DJU A;  5G4Z A;  3UPN A;  4NKP A;  3BLM A;  5F82 A;  1TVF A;  2Q0O A;  1IFQ A;  1SDE A;  3S22 A;  3BY9 A;  5A90 A;  4IED A;  3KYQ A;  3VP2 A;  1ZHH B;  1RGZ A;  3HLG A;  2JKT M;  3NDE A;  3IQA A;  3G2Y A;  4KUK A;  1FCO A;  1JTD A;  3IF6 B;  3FKW A;  3VE3 A;  2ACG A;  3PTE A;  2ZMA A;  4LGW A;  4UQI S;  1WYB A;  3E4O A;  3Q7V A;  1DP9 A;  2GNX A;  3NEC A;  2OLU A;  1PI4 A;  1L3L A;  4OVD A;  3GR2 A;  1F5M A;  2WKQ A;  2YKF A;  4CPK A;  3NJA A;  5FEG A;  5CEB A;  4O01 A;  3NOU C;  4GHI B;  4PM5 A;  1YLT A;  5CX7 A;  3QNC A;  4S2P A;  5HDC A;  1I5Q A;  1NLY A;  1H8M A;  2W3G A;  3HCY A;  3CZD A;  3LCE A;  3ZG8 B;  3H82 B;  3WS4 A;  3GVB A;  3FV7 A;  2OWH A;  4YFM A;  1LSX A;  1NXY A;  3CLO A;  1KVM A;  2YKH A;  4EES A;  4OH0 A;  2Y2J A;  4K08 A;  3O86 A;  4OQ0 A;  5FAQ A;  5DF7 A;  3FPV A;  3B47 A;  2PYP A;  2QMI A;  1IYS A;  2XLN A;  3NOT C;  3DWK A;  2KLI A;  3PYP A;  4L0L A;  4KZB A;  1PWD A;  1BT5 A;  3A3F A;  2EX8 A;  1E4D A;  1N9O A;  1OTA A;  3H7W B;  3N8S A;  3UE0 A;  5E2F A;  3H82 A;  1CEF A;  3LR5 A;  4BQM A;  5TJJ A;  4E3J A;  1ES4 A;  4WUJ A;  1ES2 A;  5CGS A;  4ZBE A;  1H0M A;  4EWF A;  5M1A A;  5FI6 A;  3LEQ A;  2WUQ A;  3LR4 A;  3V5M A;  1OT6 A;  1JNU A;  2Q9N A;  2HJE A;  3SH8 A;  1KE3 A;  3MKE A;  1TS0 A;  3VOZ A;  4C6Y A;  4KG2 A;  2PDR A;  1YSQ A;  1YLP A;  4GN2 A;  2AVX A;  5F1G A;  2Y2H A;  3H7W A;  3S7N A;  5C5K A;  3GDI A;  5FA7 A;  4EW7 A;  1KVL A;  3O3V A;  4IUK A;  3MSH A;  3EQU A;  1S1Z A;  3R4K A;  5L09 A;  3ZGA B;  4HHD A;  2B18 A;  4HH3 A;  4ETX A;  4LV2 A;  3LIA A;  3MF0 A;  1RCJ A;  2WGV A;  1T1A A;  3C7U A;  4R70 A;  3P09 A;  1L0D A;  2QHK A;  3C2W A;  1VET A;  2JN7 A;  2HDS A;  4ZJ2 A;  2VZW A;  4G3W A;  1CI8 A;  2W1T B;  3LFV A;  1V9Z A;  1J3W A;  5GHX A;  2NUP C;  1N9N A;  4GNU A;  5FQK A;  1XGI A;  4ESP A;  1OTD A;  2VV8 A;  4KZ9 A;  3HVF A;  3LY3 A;  3MQQ A;  4MDZ A;  3CIT A;  4R3A A;  4OPR A;  2VGJ A;  3O88 A;  3OLO A;  1XP4 A;  1ZC2 A;  4IBR A;  4DDS A;  5GLC A;  2Z6C A;  1HZO A;  2K31 A;  1EI5 A;  2WAD A;  1IEM A;  5AQ9 A;  3CMZ A;  3UE1 A;  1JWP A;  4RQ9 A;  5FAS A;  4Y0O A;  4KEN B;  1F2K A;  4OP8 A;  3T4T A;  1FR6 A;  5EE8 A;  4BBT A;  4WEJ A;  3NC8 A;  1N9L A;  1W79 A;  1QMF A;  2VGL M;  1FCM A;  4E3M A;  5HWW A;  4ME4 A;  1FQG A;  3GQZ A;  3IWQ A;  3K2N A;  3GRJ A;  3KSI A;  2LB5 A;  1L0F A;  2XA7 M;  1BZA A;  5HL1 A;  4OON A;  1LT0 A;  2Y2O A;  2Y2P A;  3N8R A;  3KYE A;  2HP6 A;  3W2Z A;  2EXB A;  4KZ4 A;  1CEG A;  4ID4 A;  5F83 A;  5EVE A;  5KZH A;  1H3Q A;  4BJP A;  5EUA A;  3EQV A;  2Y2N A;  3H9W A;  4MLL A;  3CI6 A;  1NZU A;  4F3L B;  4MBH A;  3N7W A;  3MXR A;  4BEN A;  2Y2Q A;  5G18 A;  4HNB A;  4OPQ A;  4P6B A;  1U60 A;  4MN7 A;  2O9A A;  1YM1 A;  4X69 A;  1SZV A;  3R7W B;  3UB6 A;  1P9R A;  1K6R A;  1TEM A;  2H0T A;  2HJ9 C;  4X55 A;  3UDF A;  2XSS A;  3GSG A;  3O5Y A;  5EFW A;  1XX2 A;  3KSH A;  5IHV A;  1I2S A;  2J3T C;  2ZM2 A;  3D4F A;  1XXM A;  3RJU A;  1K38 A;  2OAQ 1;  2V1Z A;  4BWI A;  4JF4 A;  4WLA A;  1BLH A;  1VM1 A;  3Q07 A;  3G32 A;  5L8M A;  1P9W A;  1TS7 A;  4LPZ A;  4NXB A;  3PAE A;  3OZH A;  1E3U D;  3FWL A;  3R7W A;  4E6X A;  3HLF A;  1KDW A;  3NDG A;  4L9F A;  3KO6 A;  3OPH A;  3IWI A;  3HL9 A;  5F69 A;  3F1N A;  1C3B A;  3SH7 A;  1M6K A;  5A93 A;  4QY6 A;  4DF6 A;  2JHE A;  4FTX A;  4O7D A;  4WM9 A;  4EEU A;  1KGF A;  1LHY A;  4II7 A;  2Z6D A;  2QJ5 A;  3QNB A;  2UWX A;  1MXO A;  2ZL1 B;  5HDD A;  4WBG A;  3LIC A;  1BLP A;  3K3C A;  3VFH A;  4YIN A;  2ZQ7 A;  3G31 A;  3IX3 A;  1TF1 A;  1ALQ A;  3ZFZ A;  3DWZ A;  4U0T A;  4X68 A;  3G6O A;  4UEY A;  1YQS A;  4O8G A;  4EV4 A;  1E3U A;  4R3J A;  4NK3 A;  5GHZ A;  1NZO A;  3MJQ A;  5KSH A;  3VFF A;  2ZMV A;  2ZL1 A;  4C75 A;  3T1X A;  2ZJ9 A;  5EVI B;  3A3E A;  4KG6 A;  2EA9 A;  2V8F A;  5AQ7 A;  4PHT A;  4OPY A;  5HAI A;  1FIL A;  1KGE A;  1WE4 A;  5A92 A;  2OAP 1;  1XKZ A;  5EM0 A;  1RGY A;  5HZH A;  3WWX A;  4LFU A;  4R4S A;  4HP9 A;  3ICY A;  2WAE A;  4QU3 A;  4BL2 A;  3ZG7 B;  2IWD A;  1DP8 A;  1D7E A;  2JKG A;  3HJI A;  1IOU A;  3T50 A;  4DE1 A;  3BYD A;  3LY4 A;  2ZQD A;  3A0R A;  4EBP A;  5DFY A;  3T4S A;  3T1Q B;  1K55 C;  1SKO B;  4RX2 A;  4E3N A;  1PZP A;  4U3T A;  5GHY A;  4KQQ A;  2P08 A;  1FOF A;  2GDN A;  3WS2 A;  1ACF A;  3VSK A;  2Y8H A;  3HJK A;  2XD5 A;  5DF9 A;  4FOF A;  2Y2I A;  4N9K A;  4Y2F A;  1OTE A;  2WKP A;  3PAG A;  4EUZ A;  4FSF A;  1FSY A;  4DE0 A;  3MBZ A;  4YNR A;  1LL5 A;  3EEA A;  3A3D A;  2PT7 A;  3IT9 A;  1SKO A;  3UNW A;  1JWV A;  3BY8 A;  4GD6 A;  3WRZ A;  3KYZ A;  4LLO B;  2WZZ A;  1MWT A;  3LEZ A;  5CRF A;  1PYY A;  2ZM0 A;  4HQA A;  4UHU A;  5HWV A;  3S4X A;  3E4Q A;  3SW1 A;  5M19 A;  5JYO A;  3IBJ A;  3PXP A;  5DVA A;  3TW8 A;  3ZG5 A;  3PBR A;  5F68 A;  2ZMF A;  4E3L A;  1G6O A;  4PKY A;  3NIA A;  1MWU A;  2EFX A;  1VQQ A;  1GSW A;  5FAO A;  1NYY A;  1T18 A;  3A0S A;  4P85 A;  3L7H A;  2VX8 A;  1ES5 A;  2V8C A;  2Y79 A;  2W0N A;  4HP4 A;  5CXW A;  1MPL A;  3Q82 A;  2J80 A;  4OLD A;  4OPZ A;  4MNR A;  4GB7 A;  3LI9 A;  4F94 A;  3OOV A;  1ERO A;  3T4J A;  3OCN A;  4DMZ A;  3BFG A;  1KE4 A;  1PNE A;  2ZQA A;  4QJG A;  1XJ2 A;  3IF5 A;  4DXB A;  3T12 B;  3MS6 A;  5F6A A;  3N4I A;  5J8X A;  5DTS A;  3WS1 A;  4PKY G;  2J3T D;  3GMW A;  3W4P A;  1VHM A;  2A3U A;  3TE8 A;  4UQI M;  3KX0 X;  1LL9 A;  5HWT A;  4ETZ A;  1S67 L;  2WK0 A;  2Z2L B;  2GZA A;  2Y4A A;  4ARZ B;  1OME A;  3P01 A;  1MZU A;  4IVI A;  1NLZ A;  3CPT A;  4BLM A;  2ZD8 A;  3TSG A;  2C5W B;  3ZNY A;  3IXD A;  3UDX A;  4Y0T A;  2H5S A;  1GA0 A;  1GSX A;  4QPR A;  1DP6 A;  1Y54 A;  2ZC3 B;  1OJG A;  4CLC C;  1W63 Q;  3MXS A;  1GHI A;  1G68 A;  2O0Y A;  1YAX A;  3HLB A;  3IH8 A;  5EEC A;  2QWS A;  2IA2 A;  2K7S A;  4ARZ A;  1JWZ A;  3QP8 A;  3TJZ C;  1ODV A;  4YWZ A;  1SHV A;  3TOI A;  2FZ0 A;  3V67 A;  3UMD A;  1Z09 A;  4ZRR A;  4DXC A;  4KQD A;  5TBM A;  1DY6 A;  2VK3 A;  3CJM A;  1W8Y A;  1VET B;  5BOH A;  1YMX A;  4A5R A;  1JTG A;  5HAR A;  4GDN A;  4EQI A;  2O9C A;  5FQM A;  4UA9 A;  5E2G A;  4OOM A;  3EWK A;  3P98 A;  4X1M A;  5HPI A;  2V0W A;  2R9W A;  5GLA A;  4KG5 A;  3C38 A;  3V3S A;  2RCX A;  5KSC A;  5FEF A;  3DW0 A;  2Q9M A;  2KOI A;  1MBL A;  2JKR M;  3UB7 A;  3S7Q A;  3JYI A;  5KIZ A;  2QJ7 A;  3C30 A;  3CWF A;  3NY4 A;  4GJ4 A;  2D02 A;  3HUN A;  1IYQ A;  1KDS A;  1V9Y A;  3B42 A;  2Z2M B;  4BMW A;  2XF3 A;  4S2N C;  1NY0 A;  4R38 A;  4JF5 A;  2B95 A;  4GLQ A;  2WKE A;  1XA7 A;  3M2K A;  2HV1 A;  2V1A A;  5CED A;  4I39 A;  1G28 A;  5FSR A;  2O9B A;  2I72 A;  3JPU A;  4OP5 A;  3IS2 B;  3EEH A;  4JF6 A;  1Q2Q A;  3MXQ A;  5MC7 A;  2DCF A;  4GS9 A;  5FI2 A;  5DKK A;  1K56 D;  3FPW A;  3ZCZ A;  4HJ6 A;  5A8B A;  1TD5 A;  3ZVW A;  2JKT I;  3V39 A;  3OC2 A;  2WKR A;  3LYX A;  4S2O A;  3IWO A;  2JBF A;  2KX6 A;  1F98 A;  2OWJ A;  4JBF A;  4G3K A;  5I5L A;  1XFN A;  4LV3 A;  4LRZ E;  3FZC A;  4HOI A;  2V1B A;  4NXG A;  2G2U A;  2EWW A;  3IS2 A;  2Y2G A;  4L9G A;  1FIK A;  2ZC6 B;  3DTK A;  2J9P A;  1YT4 A;  4B4Z A;  3ZNT A;  2W3H A;  2E8J A;  1LI0 A;  4DRT A;  4JLF A;  5AQA A;  1GA9 A;  3Q1F A;  4JGR A;  1DJB A;  3CUE C;  2W3F A;  4NEE D;  1YMS A;  4Z1W A;  4BBV A;  3DTI A;  4QB8 A;  5TR7 A;  3W4O A;  4WYY A;  2XQZ A;  4HJ4 A;  2D01 A;  4Q0I A;  3VP0 A;  3IF6 C;  1MWR A;  2PD7 A;  4DE3 A;  3FC7 A;  4E04 A;  4JXS A;  3D3O A;  4MEZ A;  4I38 A;  5FQ9 A;  2K2N A;  4AFI A;  1GHM A;  4XUZ A;  1MKM A;  2M7U A;  1ESI A;  1KE0 A;  4ZDX A;  4K91 A;  3PBN A;  1TDG A;  3P7N A;  3UPO A;  3ITB A;  4FCF A;  3KSG A;  4OOY A;  5FQI A;  3VMA A;  2ZQC A;  3UN7 A;  3T1R A;  5GLD A;  5KMW A;  1YLZ A;  4Y7P A;  3MQ0 A;  3IHA A;  1BYW A;  2PBD P;  2VLG A;  4KQO A;  4E3I A;  3B3X A;  4E3O A;  4MBK A;  3ZVT A;  2VKS A;  2XDM A;  4ZAM A;  2RL3 A;  4GOG A;  4JGP A;  3IX4 A;  1UWP X;  2BLS A;  2ZOH A;  4N1X A;  3BEB A;  3F1N B;  5IT5 A;  2A24 A;  1DJC A;  2GX5 A;  4S2M A;  4KZ5 A;  3G4P A;  2X01 A;  5FI7 A;  3M6B A;  5EM1 A;  3ITA A;  5F1F A;  1H8Y A;  2OSU A;  2IWC A;  1CI9 A;  2P9V A;  4HY8 A;  4BL3 A;  2G2W A;  5AQB A;  3IH9 A;  5HW3 A;  2FFY A;  3E98 A;  1GCE A;  4EBL A;  2E8I A;  5L2F A;  2W1R A;  5EOO A;  2DNS A;  2XGN A;  3IHB A;  4JGQ A;  2EFU A;  5I94 A;  1ESU A;  3G2Z A;  5K5B A;  2PHY A;  4HH2 A;  1L2S A;  2CC1 A;  2VJW A;  4UA7 A;  3A0V A;  3BFE A;  4R23 A;  3OPR A;  4WZ5 C;  4PMA A;  3MFX A;  3U4L P;  4PPR A;  1K57 C;  1UWN X;  4CQH A;  1XJ6 A;  4ZTK A;  1K4F A;  2ZM8 A;  5TGF A;  4B9O A;  3V50 A;  4CLC D;  1PZO A;  4MN5 A;  3M6H A;  3QP6 A;  5A91 A;  5JYP A;  2JCH A;  1NJ4 A;  1K4E A;  5CHU A;  2X71 A;  3LIE A;  4XT2 B;  4E6W A;  4EER A;  3QHY A;  4EUV A;  3LIB A;  2P04 A;  5M18 A;  1A0K A;  2BTF P;  3QP5 A;  3UB5 P;  2ZC5 B;  4R4R A;  3HUO A;  3G35 A;  2X02 A;  3S7O A;  3JVU A;  4FUW A;  3UE6 A;  3L9K A;  3ZQ5 A;  1MWS A;  3HUM A;  4MN6 A;  3EOI A;  4P6Z S;  5F5Y A;  4X6T A;  1GHP A;  4S2J A;  1P97 A;  1VEU A;  1XA1 A;  4JXG A;  2WYX A;  3LIF A;  3BM6 A;  5TFQ A;  4DDY A;  4RVA A;  4XT2 A;  1IYO A;  3CG5 A;  3CHW P;  4R0Q A;  2M1C A;  3MMH A;  2H0Y A;  3ZG9 B;  4K0W A;  4XXR A;  1PWC A;  4CLC A;  4OQH A;  4KZA A;  3I7J A;  1STZ A;  1YLY A;  3M2J A;  3NI9 A;  3WRT A;  5FQJ A;  3AGE A;  2ZQ9 A;  4KUO A;  1YPR A;  3GTC A;  3C4P A;  4LV1 A;  1K0K A;  3BLS A;  2J7V A;  2HP5 A;  2EX2 A;  1D1J A;  3T1S A;  3A3J A;  2P74 A;  2J3W A;  4ZJ1 A;  4QD4 A;  3BFF A;  5J7E A;  4X56 A;  2VEA A;  4JPM A;  1WYC A;  1YLJ A;  3IX8 A;  4IJG A;  4WMC D;  2BAS A;  3FKV A;  4C3Q A;  1M40 A;  3DBA A;  4HBU A;  5CTM A;  2WKI A;  4EEP A;  3PR6 A;  3QP2 A;  4R3B A;  3ZHH A;  2VGK A;  1ERM A;  4HES A;  3BQ8 A;  3UE3 A;  1Z6F A;  2LB9 A;  3DTM A;  1BLC A;  1AXB A;  1NWZ A;  4DKI A;  3TRC A;  2XFS A;  3JVV A;  2CMN A;  3C7V A;  3SS3 A;  4BD1 A;  3VSL A;  2PAV P;  3V3R A;  2H10 A;  4FD8 A;  3C5A A;  2ZC7 A;  4S2N A;  2L0W A;  4LV0 A;  5J3W A;  1SDN A;  3VOL A;  2QPN A;  1T19 A;  1TS8 A;  5FDS A;  4Q0J A;  1MC0 A;  3MFD A;  3GV9 A;  2W27 A;  2PU2 A;  2QKP A;  4XUX A;  2XH9 A;  5AVF A;  2XR0 A;  1CF0 A;  3UB9 A;  3S7P A;  2V2F F;  4I3A A;  4RA7 A;  4IHQ A;  5E43 A;  3E2K A;  4HJ3 A;  1LLB A;  3HLD A;  1YLW A; 
#chains in the Genus database with same CATH homology
 3T4Q A;  3GEC A;  2PD8 A;  4L9E A;  1H3Q A;  4BJP A;  5HPI A;  2V0W A;  1F9I A;  3EQV A;  3H9W A;  4I3J A;  3CI6 A;  4BBU A;  3EGX C;  3C38 A;  1XJ3 A;  1X0O A;  1OTB A;  4Y3I A;  4F3L B;  2KOI A;  2JKR M;  1T1C A;  3UB7 A;  3S7Q A;  4OOL A;  4HNB A;  5KIZ A;  2NUT C;  2QJ7 A;  3BWL A;  3C30 A;  3CWF A;  4GJ4 A;  4MN7 A;  2D02 A;  1V9Y A;  4R6L A;  3B42 A;  3F1P A;  2O9A A;  1UGU A;  4H6J A;  4BMW A;  3PBQ A;  3R7W B;  3UB6 A;  1P9R A;  4R38 A;  2HJ9 C;  3OBF A;  1XJ4 A;  4GLQ A;  4I5S A;  2XSS A;  3CUE A;  2HF6 A;  3O5Y A;  5EFW A;  3KSH A;  2HV1 A;  2V1A A;  3LR0 A;  4I39 A;  1G28 A;  2J3T C;  2O9B A;  3BJN A;  2GJ3 A;  2VV6 A;  3RTY A;  4GW9 A;  5HSQ A;  4P6Z M;  3BQA A;  3E4P A;  3IS2 B;  2OAQ 1;  3EEH A;  3MXQ A;  5MC7 A;  4BWI A;  4GS9 A;  4DJ3 A;  5DKK A;  3OCL A;  3FPW A;  4WLA A;  2W3E A;  2R78 A;  3PBS A;  4WN5 A;  4HJ6 A;  5A8B A;  1KOU A;  1VB6 A;  4Q0H A;  2V9A A;  1TD5 A;  2XRO A;  4LRX C;  5L8M A;  1P9W A;  3ZYT A;  4WEK A;  1TS7 A;  2JKT I;  1WA9 A;  2DMW A;  3NOP C;  4LPZ A;  4NXB A;  1OTI A;  3OC2 A;  2WKR A;  3LYX A;  3R7W A;  2PR5 A;  2KX6 A;  4WF0 A;  1F98 A;  2OWJ A;  1EW0 A;  4G3K A;  4L9F A;  5DJT A;  3KO6 A;  5I5L A;  1XFQ A;  2A2L A;  1LSV A;  3LUQ A;  5F69 A;  3B33 A;  1XFN A;  3F1N A;  4LRY C;  5TBM B;  4LRZ E;  4EQ1 A;  4HOI A;  2V1B A;  2M7V A;  1P0Z A;  4NXG A;  3ULF A;  2EWW A;  3IS2 A;  1YKD A;  4Y5F A;  3LID A;  5HL6 A;  4GHI A;  2JHE A;  4EEU A;  2G7U A;  4L9G A;  2P7J A;  4II7 A;  2Z6D A;  4DN0 A;  2QJ5 A;  3PBT A;  5HDD A;  4O0P A;  3LIC A;  2W3H A;  3K3C A;  4B93 A;  1S4R A;  3LR3 A;  4M4X A;  4JGR A;  5IU1 A;  4NXE A;  3CUE C;  1TF1 A;  3VV4 A;  4G3V A;  1DRM A;  2W3F A;  4NEE D;  4Z1W A;  4BBV A;  3MQO A;  2W3D A;  2INW A;  2ZBB A;  4HJ4 A;  2D01 A;  4Q0I A;  1S4S A;  3F1P B;  2XRN A;  3IBR A;  4H6J B;  5G4Z A;  5DJU A;  5DKL A;  3G6O A;  2PD7 A;  4UEY A;  4NKP A;  4O8G A;  3FC7 A;  4E04 A;  3D3O A;  4IUH A;  1IFQ A;  4MMN A;  2H28 A;  3PBO A;  4I38 A;  3MJQ A;  2K2N A;  5KSH A;  4AFI A;  1LSW A;  3BY9 A;  1MKM A;  3KYQ A;  2M7U A;  2ZMV A;  3PBN A;  1ZTU A;  1ZHH B;  3P7N A;  2JKT M;  3BW6 A;  2L1M A;  3KSG A;  4KUK A;  3VE3 A;  3VE4 A;  4GS9 B;  2EA9 A;  4UQI S;  3E4O A;  3MQ0 A;  2B02 A;  4PHT A;  2HGV A;  1BYW A;  1DP9 A;  1Y28 A;  3UME A;  2VLG A;  4KQO A;  2FH5 A;  2GNX A;  5HPF A;  1W63 M;  2OAP 1;  2QYB A;  3K3D A;  2VKS A;  3T4O A;  4HIA A;  4HI4 A;  5HZH A;  4JGP A;  4YOF A;  1UWP X;  1LL8 A;  4HP9 A;  2ZOH A;  3ICY A;  3F1N B;  5IT5 A;  2A24 A;  2EWV A;  2GX5 A;  1F5M A;  2WKQ A;  2YKF A;  2MJ6 A;  3NJA A;  2O99 A;  4O01 A;  3NOU C;  1DP8 A;  1D7E A;  4GHI B;  2VGL S;  3HJI A;  1IOU A;  4HY8 A;  5CX7 A;  3T50 A;  5HDC A;  1OJ5 A;  3E98 A;  1NLY A;  3A0R A;  1H8M A;  2W3G A;  3T4K A;  3HCY A;  1D06 A;  5DFY A;  3T4S A;  2W1R A;  4EET B;  4MCW A;  3H82 B;  4JGQ A;  2XA7 S;  5K5B A;  2OWH A;  4WL9 A;  5FL3 A;  1LSX A;  2PHY A;  2P08 A;  4HH2 A;  2VJW A;  3CLO A;  1OT9 A;  3A0V A;  2YKH A;  4EES A;  2Y8H A;  4K08 A;  3HJK A;  5DF9 A;  3FPV A;  3MFX A;  3B47 A;  4FOF A;  2PYP A;  5HD5 A;  2PYR A;  4Y2F A;  3NOT C;  1OTE A;  2WKP A;  1UWN X;  2KLI A;  3PYP A;  2W1T A;  4L0L A;  4CQH A;  4FSF A;  1XJ6 A;  4B9O A;  1N9O A;  4YNR A;  3EEA A;  1OTA A;  4CLC D;  4MN5 A;  2PT7 A;  3H7W B;  3H82 A;  3LR5 A;  3BY8 A;  5TJJ A;  3KYZ A;  4LLO B;  3LIE A;  4XT2 B;  1OPX A;  4WUJ A;  4EER A;  4EUV A;  3PHY A;  3LIB A;  4HQA A;  2P04 A;  5AJG A;  5HWV A;  3CAX A;  3E4Q A;  3SW1 A;  4GCZ A;  3LR4 A;  1OT6 A;  3IBJ A;  3S7O A;  1JNU A;  2HJE A;  3JVU A;  5G4Y A;  3PXP A;  3UE6 A;  2A24 B;  3ZQ5 A;  3TW8 A;  4MN6 A;  1TS0 A;  3E0Y A;  3PBR A;  3EOI A;  5F68 A;  4P6Z S;  5F5Y A;  2ZMF A;  1G6O A;  2PDR A;  4PKY A;  2VV7 A;  3MR0 A;  1YSQ A;  4EXO A;  1GSW A;  3H7W A;  3S7N A;  1P97 A;  5C5K A;  1T18 A;  3GDI A;  3LIF A;  3A0S A;  4EW7 A;  4IUK A;  4XT2 A;  3EQU A;  2M1C A;  2VX8 A;  1S1Z A;  2Y79 A;  3MMH A;  3R4K A;  2W0N A;  4HP4 A;  4CLC A;  2J80 A;  4HHD A;  2B18 A;  4HH3 A;  4ETX A;  3LI9 A;  1STZ A;  3OOV A;  3T4J A;  3OCN A;  3LIA A;  4DMZ A;  3LI8 A;  3MF0 A;  4WEL A;  4CLC E;  2VA0 A;  1T1A A;  4KUO A;  3FG8 A;  4R70 A;  5AVE A;  2QHK A;  3C2W A;  1XJ2 A;  2JN7 A;  5F6A A;  5LBR A;  1T1B A;  2VZW A;  4G3W A;  2W1T B;  1S1Y A;  3LFV A;  2J3W A;  1V9Z A;  2NUP C;  4PKY G;  2J3T D;  1N9N A;  5J7E A;  3U2A A;  3C8C A;  1VHM A;  1OTD A;  4JGO A;  2VEA A;  2VV8 A;  4F3L A;  5DFX A;  3UB8 A;  3TE8 A;  4IJG A;  4UQI M;  3MQQ A;  2BAS A;  3KX0 X;  4MDZ A;  3DBA A;  5HWT A;  4ETZ A;  1S67 L;  3CIT A;  4R3A A;  4EEP A;  3PR6 A;  2GZA A;  4ARZ B;  3P01 A;  3OLO A;  1MZU A;  3BQ8 A;  3UE3 A;  1NLZ A;  2Z6C A;  3RH8 B;  2K31 A;  1S66 L;  2LB9 A;  4I3I A;  1NWZ A;  1YSP A;  2JKR I;  4EU0 A;  3TRC A;  2L4R A;  3D72 A;  5J4E A;  3RFB A;  1GSX A;  4QPR A;  1DP6 A;  2OOL A;  4RQ9 A;  1OJG A;  3JVV A;  2CMN A;  4CLC C;  1W63 Q;  3T4T A;  4BBT A;  3NHQ A;  4WEJ A;  1N9L A;  2O0Y A;  3F1O B;  2VGL M;  1YAX A;  3KSF A;  5HWW A;  2L0W A;  5J3W A;  3VOL A;  2QWS A;  2IA2 A;  4ME4 A;  3T4L A;  1TS6 A;  1T19 A;  1TS8 A;  2K7S A;  4ARZ A;  4Q0J A;  5HD3 A;  4CLC B;  3K2N A;  3TJZ C;  1ODV A;  4PAU A;  3KSI A;  1MC0 A;  2LB5 A;  2W27 A;  4YWZ A;  2I9V A;  2XA7 M;  2V0U A;  1GSV A;  2FZ0 A;  2QKP A;  3EGD C;  3V67 A;  2KDK A;  3UMD A;  4ZRR A;  5AVF A;  1LT0 A;  3UB9 A;  3S7P A;  5HDS A;  4KQD A;  4I3A A;  2PR6 A;  5TBM A;  5IS1 A;  4IHQ A;  3W2Z A;  1NRJ A;  4NXF A;  4HJ3 A;  3F1O A;  2O9C A;  4DJ2 A;  2ZOI A;  4OOM A;  3EWK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...