2VV7A

Bjfixlh in unliganded ferrous form
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
105
structure length
105
Chain Sequence
PDAMIVIDGHGIIQLFSTAAERLFGWSELEAIGQNVNILMPEPDRSRHDSYISRYRTTSDPHIIGIGRIVTGKRRDGTTFPMHLSIGEMQSGGEPYFTGFVRDLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Signaling protein, transferase
molecule keywords SENSOR PROTEIN FIXL
publication title Changes in Quaternary Structure in the Signaling Mechanisms of Pas Domains.
pubmed doi rcsb
source organism Bradyrhizobium japonicum
total genus 28
structure length 105
sequence length 105
chains with identical sequence B, C, D
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2008-06-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2vv7A00
3VOLA 2H28A 4WF0A 3F1OB 1OJGA 1X0OA 3ULFA 1TS8A 1OTBA 2PR5A 4KUKA 4I39A 1OTDA 5HD3A 2JN7A 4NXFA 4PKYG 3CWFA 4GW9A 4I3AA 5J4EA 5F6AA 1LSVA 2I9VA 2VEAA 4XT2A 3UMDA 3B33A 5HDDA 2A24A 2B02A 1GSVA 4XT2B 1N9NA 5AVEA 3ZQ5A 4I38A 3MR0A 1UWNX 2J80A 1NWZA 2EA9A 1UGUA 1TS7A 5F69A 1S67L 3LI9A 4JGQA 3UB7A 3LYXA 2Z6CA 2V1BA 3CAXA 5TBMA 3MFXA 1S4RA 3T50A 2GJ3A 3EEHA 1VB6A 4WUJA 3LIDA 2YKHA 1XFNA 1EW0A 4M4XA 3E4OA 4HQAA 2CMNA 3OLOA 1TS6A 4BBVA 2PDRA 3K3CA 3F1PB 4EETB 5I5LA 1N9LA 4WN5A 1T18A 3IBRA 1N9OA 2VV6A 4L9EA 1P97A 4KQDA 5G4YA 3C2WA 1D06A 4I3JA 2ZBBA 1MZUA 2QJ5A 3RTYA 1P0ZA 4LLOB 1JNUA 1DP8A 3E4PA 3HJKA 5HD5A 3IS2B 3NOUC 5G4ZA 3NOPC 2PR6A 2OWJA 3GECA 4HP9A 2OWHA 5HWVA 2QJ7A 5DJUA 2L4RA 4NXGA 1LL8A 1OTEA 2K7SA 3UB9A 5DJTA 4R38A 3SW1A 2VLGA 1DRMA 4JGRA 3A0RA 2OOLA 3FG8A 4R6LA 4MN6A 3EWKA 2QWSA 4PKYA 5DKKA 4LPZA 4EEUA 3CLOA 4WLAA 1S4SA 2A24B 1UWPX 3MQQA 4L9FA 2D02A 4GS9A 5J3WA 5IS1A 5IU1A 2PD8A 2V1AA 2YKFA 3H9WA 4HY8A 2QHKA 5HZHA 4KUOA 1OT6A 4EERA 3D72A 3E4QA 4GS9B 3HJIA 3LIEA 4EXOA 2ZOHA 4R3AA 1F9IA 3C8CA 3PHYA 1OTAA 2BASA 3NHQA 1T19A 1T1BA 3BY9A 3H82A 3LIFA 3NOTC 5TBMB 4H6JA 1LSXA 3LIAA 3P7NA 4HI4A 5HWTA 3H82B 4L9GA 4HJ3A 4HNBA 1GSWA 4H6JB 3UB6A 3K3DA 5F68A 1LSWA 2ZOIA 3KX0X 4LRZE 3NJAA 1LT0A 2PYRA 2VV8A 3UE6A 1V9ZA 3MXQA 2Z6DA 1GSXA 3PYPA 4YWZA 4HIAA 4EESA 5KIZA 2P7JA 2PD7A 2R78A 1V9YA 2KDKA 2INWA 4GCZA 3BY8A 5AVFA 4BBTA 4HHDA 2WKPA 4B9OA 3MJQA 4LRYC 4LRXC 1D7EA 2L1MA 1OTIA 1S1YA 1T1AA 3VE4A 4R70A 2VV7A 4I3IA 1WA9A 3F1NA 3UB8A 4HJ4A 1XJ4A 4F3LA 4DJ3A 3VE3A 1OJ5A 5EFWA 4EEPA 4F3LB 2M1CA 1OT9A 1XJ3A 1XFQA 5J7EA 1G28A 3MQOA 2W0NA 2V0WA 3A0SA 1Y28A 4K08A 2V9AA 3A0VA 2L0WA 4JGPA 1ODVA 5A8BA 1DP6A 4HJ6A 1S66L 4HH3A 4HOIA 3UMEA 4DJ2A 4I5SA 3G6OA 4EQ1A 1T1CA 2HV1A 4GHIA 1BYWA 4JGOA 4MN5A 4GHIB 5HWWA 1XJ6A 4E04A 1F98A 2KX6A 5HSQA 4EW7A 2WKQA 2QKPA 1DP9A 2WKRA 4RQ9A 1TS0A 2W27A 2PYPA 4NXEA 3F1PA 3H7WA 4BBUA 2D01A 3RH8B 3H7WB 4WL9A 1S1ZA 4HP4A 1XJ2A 2JHEA 1KOUA 3BWLA 5HDSA 4NXBA 5F5YA 3ICYA 3GDIA 3LI8A 3LUQA 3IS2A 3LIBA 3FC7A 5DKLA 4HH2A 3F1OA 3LICA 2PHYA 3F1NB 5HDCA 2V0UA
chains in the Genus database with same CATH superfamily
4OQ0A 2M7UA 1JTGA 1OJGA 1L2SA 3MBZA 3KSFA 3PBNA 4EBLA 5DTSA 3LEQA 4B4XA 1OTBA 3P09A 4M3KA 4I39A 4O0PA 3KYQA 4PKYG 4XXRA 3GSGA 3ZG5A 4ID4A 2J9OA 3UMDA 4BMWA 2A24A 4E3IA 1LLBA 2J3TC 4JF5A 1FCNA 3PBSA 4IHQA 5AVEA 3PAEA 2EA9A 1G6OA 5D3OA 4ZTKA 2NUTC 4R23A 5GHXA 3RXWA 3UB7A 1ONHA 5EOOA 2VK3A 4ESPA 1KGEA 2V20A 2HP5A 2V1BA 2HJ9C 1AXBA 5TBMA 3T50A 3CG5A 1XKZA 4BL3A 3EEHA 3QP2A 1S6RA 4WBGA 4WEJA 1STZA 1J9MA 5KMWA 4RX2A 4UA7A 4M4XA 3E4OA 3MKEA 2H0YA 3OLOA 1TS6A 3F1PB 4GLQA 2PT7A 4GD6A 1BUEA 1N9LA 5CHUA 4WN5A 4X68A 4L0LA 3E2KA 1WYCA 1P9WA 4QB8A 2PBYA 4KZ4A 1XP4A 3B42A 5EM1A 2XF3A 5KSCA 2ZBBA 4EBPA 3RJUA 3RTYA 1DJCA 3S7PA 5FAQA 1MWUA 2XFTA 4II7A 4Y17A 3A3JA 4WYYA 2IWBA 4K0WA 5IT5A 3IS2B 3NCKA 3BFFA 2PR6A 3O86A 3DBAA 2OWJA 4UEYA 4PM5A 5FI2A 2XRNA 2OLUA 2QJ7A 4LV1A 5CXWA 4HEFA 5CRFA 1OMEA 1WYBA 3HUMA 4MN7A 4A5RA 4R38A 2VLGA 3SH9A 4JGRA 1YLZA 3TW8A 3FG8A 4R6LA 4KZ9A 3HLFA 5HX9A 1FSYA 3NI9A 3IX4A 3CI6A 1NZOA 5CEDA 4S2IA 1MBLA 4BD1A 2ZM2A 2P9VA 4QJGA 2O9CA 3RXXA 4RYEA 2P9VB 2VKSA 5IS1A 1W63M 2A49A 1NLZA 2V1AA 2YKFA 1PIOA 5A91A 5F1FA 2JE5A 3PXPA 3LGOA 3SOIA 2C5WB 4O7DA 2Y91A 3D72A 1ALQA 3LIEA 3T4OA 1IKGA 4X1MA 1I2WA 5FQKA 4K91A 3PHYA 4B4ZA 2BASA 3N7WA 5BOHA 1T1BA 3H82A 3BY9A 4GNUA 1NLYA 5JYPA 3HUNA 3EQVA 4OPZA 4HI4A 4XUZA 4OH0A 3H82B 4L9GA 4IBRA 2J3TD 4WZ4A 1GSWA 4Q0IA 1K6RA 5C5KA 4OOMA 3A3EA 4QWOA 3NJAA 2BG1A 1LT0A 2PYRA 2XROA 1CF0A 5GLCA 2Y2QA 3MXSA 1XGJA 4U0TA 5HPFA 2FFFB 4HIAA 2WKHA 2IWCA 5E43A 3UDXA 2PD7A 1CEGA 5HL6A 1KDSA 3CMZA 4NKPA 3ZG8B 2Y2KA 3PBQA 4FD8A 4KQRA 1N9BA 5AVFA 1LI9A 4HHDA 2WKPA 3IWIA 5GHZA 2Y2MA 4LRYC 4MBHA 3PBTA 4NETA 2PU4A 1BT5A 5L09A 4Z1WA 5CTNA 5GLDA 2WGVA 4DRTA 4Y0UA 1YMSA 2I72A 1BTLA 3DWKA 1XA7A 1L0DA 2A2LA 4WMCD 3R7WA 1BSGA 1XJ4A 3Q7ZA 5FDHA 2HZ5A 3VE3A 1LHYA 1IELA 2Y4AA 3O87A 1OJ5A 5EFWA 1PW1A 2M1CA 5FASA 1OT9A 3V3SA 1XJ3A 2XDMA 3WS1A 4YNRA 5J7EA 1YPRA 5DTKA 3SS3A 5FATA 5EV0A 3TSGA 3OCLA 4MEZA 4BQMA 4Y0TA 3E98A 2IWDA 5KZHA 5F1GA 4JGPA 4NG2A 3T1QB 2WZZA 3N6IA 4JF6A 3W4PA 1NY0A 1M6KA 4DJ2A 3G6OA 3D3OA 3TOIA 1IKIA 1T1CA 2FFYA 1E3UA 1BYWA 1NYMA 3JYIA 3JVUA 1EROA 4S2NC 1Z09A 4Q0JA 4E04A 4DDSA 1F98A 2KX6A 1PWGA 2QKPA 3HVFA 2WKRA 5E2GA 3ISGA 5F82A 3S7NA 1EWZA 4N1HA 2PYPA 3E2LA 4LGWA 2VA0A 1YMXA 5JYOA 1MKIA 4DXCA 4WZ5A 1BLHA 2ZQ8A 2BTFP 4WL9A 4HP4A 1XJ2A 5L8MA 4GB7A 3KSGA 3NDEA 1KOUA 3NBLA 3BYDA 2Z2LB 5TFQA 4LCLA 4UHUA 1CI9A 3ZVTA 3LUQA 4XUXA 5L07A 2XLNA 4FH2A 3BRMA 2O0YA 1JWPA 3OPPA 3LICA 1PW8A 4IEDA 2PHYA 3KYEA 1ZC2A 3V5MA 2PRFA 3BFGA 3VOLA 2H28A 4WF0A 1DJAA 4OLDA 1RGZA 1IYPA 1H3QA 1MWTA 1PI5A 4LV3A 1TS8A 5EPHA 3VOZA 5AQAA 1XGIA 4OOYA 3LY4A 4K0XA 2PR5A 3D9YA 4R0QA 2WADA 2ZM0A 4HBUA 2JN7A 4OP5A 4NXFA 2VGKA 3MZDA 3VOYA 2VEAA 4RVAA 4ZJ1A 4WEKA 3T1RA 5EOEA 3M2KA 3IF5A 4CLCA 4DXBA 2E8JA 2XR0A 5EVLA 2VX8A 2ZD8A 1ZKJA 3ZQ5A 3MR0A 4JLFA 4JPMA 4D2OA 2J80A 1NWZA 3ZNYA 1UGUA 2OAP1 2XGNA 3OPLA 3NY4A 5F69A 4UA6A 4Y7PA 5HAPA 3LYXA 1SZVA 2Z6CA 1G5UA 2Y2NA 3FPWA 1L0EA 1GA0A 1S4RA 3IWOA 4YINA 3T1SA 1IYSA 2X02A 2HP6A 3N8RA 5GL9A 4WUJA 1ESUA 1TF1A 3LIDA 5DTTA 4JXSA 3OCNA 3HLDA 1TVFA 1H8ZA 3FKWA 2CMNA 3CPTA 2KLIA 1KVLA 4R4RA 3BFEA 4KZAA 3W8KA 3MSHA 4DE2A 1H0MA 1BZAA 5CGWA 3JVVA 3W4OA 1W8QA 3IBRA 3IBJA 2P04A 4JF4A 2ACGA 3K2NA 2VV6A 3L7HA 3T4TA 3WWXA 3UE1A 2HPBA 1Y4OA 3FZCA 1MZUA 3TRCA 1QMFA 3BQAA 1PZOA 4NEED 3E4PA 4ZJ3A 5HD5A 1MWSA 2EX9A 4WZ5C 2J9PA 3S4XA 1FCOA 3NOUC 1E4DA 4HP9A 2OWHA 5HWVA 5CX7A 1IYQA 1OTEA 1ZTUA 3MZFA 3N4IA 2EFXA 5A90A 1YAXA 3GMWA 1DRMA 1ACFA 3EGXC 1S0WA 4IBXA 4MN6A 4PKYA 4LPZA 3IX8A 3T1XA 2Y2OA 4WLAA 4UA9A 2A24B 4FUWA 4FSFA 3MQQA 3IHAA 3IXHA 5DVAA 3AGFA 1Q2PA 5IU1A 3T4LA 2WAFA 4OVDA 3C30A 3HJIA 2ZOHA 1NJ4A 3JPUA 1FSWA 2W3GA 3N8LA 4H8RA 2EFUA 2XA7M 1F9IA 3C8CA 3PR6A 4CLCC 4ZDXA 5TBMB 1DJBA 1TDGA 4H6JA 2EXBA 3KSIA 3P7NA 4PM9A 5DF9A 5FQJA 4KZ7A 1WE4A 4S2LA 4HNBA 2XA7S 4H6JB 3V50A 2P08A 4LRZE 2ZC3B 2HP9A 1MXOA 3UE6A 1K57C 1M40A 2EXAA 1PWCA 3PYPA 4E6WA 2ZLYA 4C6YA 5GLAA 3MFDA 1V9YA 3LR4A 2INWA 2O9BA 1Y54A 1K54A 4IVKA 4MDZA 4B9OA 3G30A 5L2FA 1KE0A 3C5AA 4DE0A 2DRWA 4GN2A 1PYYA 3QP1A 3WS4A 4FTXA 2W3FA 1E3UD 2VV7A 4I3IA 5EVIC 2WAEA 3QP6A 2DCFA 2JCHA 3VSKA 4ZJ2A 3EOIA 1G6AA 4CQHA 4HJ4A 3VFFA 4JXWA 4F3LA 2B18A 4DJ3A 3LR0A 2Q9MA 4EQIA 3O3VA 1YSQA 4EEPA 4F3LB 3A3IA 2ZL1A 2G2WA 1K4EA 3CJMA 4PAUA 4QPRA 4OONA 2ZMAA 2Y2HA 3A0SA 5MC7A 2ZL1B 2Y55A 4S2NA 1Q2QA 3A3DA 4Q0HA 4LV2A 4S2PA 5CHMA 4HJ6A 3BFCA 1OPXA 2WGWA 1ES3A 3VP1A 4OPYA 2ZQDA 4I5SA 4JXGA 3QNCA 4EQ1A 3MQ0A 4JXVA 2WGWB 3GTCA 4JGOA 1K4FA 1NYYA 3UPPA 5EECA 5HWWA 1XJ6A 1F2KA 4OOLA 5HSQA 2AVXA 4EW7A 2WKQA 4LCMA 1DP9A 1TS0A 3SS5A 4DF6A 3HLGA 1RP5A 2XK1A 4OLGA 2W27A 4NXEA 3HREA 3H7WA 3IF6A 4X25A 1K25A 3H7WB 3C4PA 4HESA 2VGLM 4CLCD 4UQIS 4R4SA 2HF6A 3CHWP 4G3KA 1ESIA 3BJNA 3HLCA 4HBTA 5M18A 5HDSA 2HDUA 2FH5A 2RCXA 4BENA 1CJFA 3DTMA 2VGLS 5EVEA 3ICYA 3LIBA 4PM6A 1GHIA 3LR3A 5DKLA 4HH2A 3G35A 2EWVA 2GNXA 3DTIA 1FR1A 1K55A 5HDCA 4O8GA 1HVBA 4DMZA 4ZAMA 2VGJA 1VEUA 2HDQA 4PPRA 1K54C 3R7WB 3PBOA 1ES4A 3LCEA 4PHTA 1IOUA 1CQAA 1FOFA 1VEUB 3MKFA 3FYZA 2GDNA 4PM7A 1DY6A 1GHMA 4OQIA 2DNSA 3CWFA 5HAIA 4C75A 2RL3A 5F6AA 2Y2JA 1LSVA 5FEGA 4FH4A 4XT2A 5FEFA 3PTEA 2G2UA 4E3JA 2B02A 5FAPA 4Y15A 5L10A 1GSVA 3ITBA 3UE3A 3WS5A 4XT2B 1N9NA 4E3OA 4I38A 1UWNX 3G4PA 3M6BA 2C6WB 1L3LA 1ES5A 1TS7A 4GKUA 4P0MA 2WZXA 5K5BA 5FQIA 4JGQA 4B93A 2JKRM 3BFDA 4OP8A 4N9LA 1KVMA 1VETA 5E2FA 4PM8A 1PWDA 4OKPA 1G68A 3BM6A 1ONGA 3NC8A 4X69A 1VETB 3MMHA 1YSPA 1CEFA 5FQMA 3I7JA 3RFBA 4QHCA 2Y59A 2Y8HA 2Q9NA 4KQQA 1ERMA 1XFNA 2EX2A 4LV0A 4AFIA 2WKIA 3N8SA 4S2JA 4HQAA 4GDBA 4MLLA 3TJZC 3M6HA 4BBVA 3K3CA 2HGVA 3MZEA 2P74A 4E3LA 4RA7A 5I5LA 3U2AA 2GX5A 4EUVA 5DFYA 3G2ZA 3T4JA 3ZG7B 2A3UA 1N9OA 1GA9A 4L9EA 3CITA 1W8YA 4KQOA 2Q0OA 2QJ5A 2X71A 4CLCE 3EEAA 1O07A 3LY3A 1FIKA 3BW6A 3ZYTA 1DP8A 4ZRRA 3Q82A 5M19A 3IF6C 3ZFZA 1XXMA 1MY8A 3KYZA 2PU2A 5G4ZA 2XQZA 4IUKA 1VHMA 3OBFA 2Z2MB 3GECA 1RGYA 2L4RA 2B5RA 3KSHA 4NXGA 1LL8A 2J8YA 5DJTA 5HARA 2R9XA 1KGFA 1FR6A 2G7UA 4QY6A 3FV7A 3A0RA 4ARZA 2OOLA 5TR7A 5IHVA 1CK3A 4MNRA 3T4QA 3D4FA 1BLCA 3S7OA 2Y2LA 5DKKA 2WUQA 4ARZB 3NIAA 5DF8A 1K55C 3CLOA 1A0KA 2R9WA 5G18A 1UWPX 5AJGA 3ZG9B 2ZQ7A 4L9FA 4OQHA 4CLCB 4DE1A 2D02A 5J3WA 2JKGA 2PD8A 2QHKA 1XX2A 5HZHA 2QZ6A 4KUOA 4EERA 4G3VA 5F83A 1GCEA 4R3AA 1K57A 4YOFA 1H8YA 1IFQA 1OTAA 4G3WA 3WRZA 4P85A 1T19A 3LIFA 3NOTC 4X55A 1LSXA 3V67A 3LIAA 5HWTA 4HJ3A 3IXDA 5F68A 2ZOIA 2VV8A 2JBFA 3UDFA 3CPTB 1HTZA 4EU0A 3W2ZA 1V9ZA 1GSXA 4YWZA 5EVIA 3TE8A 4JKTA 5FQQA 3UO9A 5KIZA 2P7JA 2R78A 1BLSA 2V1ZA 2KDKA 4KZ6A 5EVIB 4GCZA 1YLYA 3BY8A 2ZMVA 4FCFA 2GZAA 4BBTA 1EI5A 3LR5A 3EGDC 3IQAA 3MJQA 5U47A 4LRXC 1D7EA 3OZHA 4KG2A 2L1MA 1OTIA 1S1YA 3BLMA 3UY6A 4R70A 4OPRA 2JKFA 2V8CA 2Y79A 2ZQAA 3F1NA 4DDYA 5CTMA 4Y5FA 5CEBA 1LI0A 3LEZA 1JWZA 1YLTA 5I94A 3IH9A 1YM1A 4P6ZM 2MJ6A 3DTKA 1ES2A 3FWLA 5FQ9A 1W5DA 2EX8A 3OC2A 1G28A 3MQOA 4P6ZS 1SDEA 2W0NA 2V0WA 1PFLA 5AQ9A 1H8MA 3MF0A 4KZBA 5EM0A 5TGFA 1K56A 1MKMA 2V9AA 1XA1A 1JVJA 2ZC6B 3IHBA 1ODVA 1QMEA 1TEMA 4JBFA 4N1XA 4HH3A 5FAOA 3UMEA 4IVIA 3T4KA 4LFUA 2OV5A 4GHIA 3HCYA 3NDGA 4MN5A 1PNEA 1TD5A 4GHIB 4ETXA 1Z6FA 2IA2A 3MS6A 3BEBA 3S22A 2ZMFA 1ZHHB 4RQ9A 1J3WA 4EBNA 3NECA 3WS2A 3KO6A 4P6BA 3G34A 1NRJA 3F1PA 3P01A 1D1JA 3IH8A 2H5SA 2KOIA 4BWIA 2UWXA 1SKFA 3RH8B 1KE3A 1S1ZA 2DMWA 4O01A 4BLMA 4DN0A 2OLVA 2ZQ9A 3E0YA 5F5YA 1YQSA 4QD4A 3G31A 4S2KA 3VP3A 3ZCZA 3IS2A 1MC0A 2FZ0A 4R1GA 3IX3A 2NUPC 1YLWA 3F1OA 2W1RA 3SH8A 3V3RA 3W4QA 1BULA 2V0UA 4X56A 3F1OB 2WK0A 2Y2GA 4KZ5A 1SKOA 5CECA 1X0OA 1GHPA 1SCWA 3ULFA 3ZG0A 3P98A 3AGEA 3FPVA 3IT9A 1YKDA 1W63Q 2HJEA 2Y2IA 4KUKA 1OTDA 4E6XA 5HD3A 1SKOB 4GW9A 4I3AA 4OQGA 5J4EA 2XFSA 1LL9A 1O7EA 4GZBA 2I9VA 3B33A 5HDDA 2QYBA 2LB5A 3ZGAB 4CPKA 4Y0OA 3QP8A 2B95A 4DKIA 1W7FA 2XH9A 4WELA 2XEPA 3DWZA 4IJGA 1HD8A 1S67L 3LI9A 4Q8IA 3DW0A 4MBKA 2O99A 3CAXA 3MFXA 5CERA 1ERQA 2GJ3A 1K38A 1AWIA 1VB6A 3Q7VA 1FILA 3UN7A 2K31A 3CUEA 2YKHA 1PI4A 4ETZA 1PRQA 2ZM8A 4UQIM 3Q7VB 3ZNTA 1EW0A 2O9AA 2EX6A 1VM1A 5FI6A 4MMNA 3Q1FA 3OPHA 2PDRA 4C3QA 4EETB 1KE4A 1ZG4A 2W3DA 3IF6B 3HUOA 3BQ8A 3GRJA 3O5YA 4E3KA 3T12B 1T18A 3QP5A 4MCWA 4B88A 3DTEA 4GD8A 3FKVA 5KSHA 2EWWA 2QPNA 1P97A 4KQDA 3ITAA 5G4YA 4I3JA 2WKEA 1D06A 3C2WA 3M2JA 1FCMA 4Y13A 4GDNA 1P0ZA 4LLOB 1JNUA 2OSUA 4RX3A 3HJKA 2WGIA 3GR2A 2H0TA 3NOPC 4YFMA 1CI8A 2XSSA 4EV4A 1K6SA 3IWQA 5DJUA 3V39A 1C3BA 1JWVA 3CZDA 1LL5A 2K7SA 3UB9A 1NXYA 5EUAA 3B3XA 5TJJA 5J8XA 5HL1A 3OOVA 4Y3IA 1H5XA 1RCJA 2ZC7A 2J3WA 3SW1A 2H10A 2W1TA 4N92A 3O88A 5FA7A 3TG9A 1JTDA 1HLUP 3HLWA 1FQGA 3EWKA 2QWSA 1TDLA 2W1TB 2W3HA 4KZ3A 5FL3A 4EEUA 1IEMA 2V2FF 1VQQA 5EE8A 3HBRA 1BLPA 2XD5A 4KG6A 3QNBA 5EVID 3BLSA 1S4SA 3UE0A 1P9RA 4Y2FA 1MWRA 5FDSA 3VSLA 4F94A 1KGGA 2ZQCA 2VJWA 4GS9A 3IXGA 3H9WA 4MBFA 4X53A 5AQBA 4HY8A 4UAAA 1OT6A 3E4QA 4GS9B 4EXOA 4R3JA 1SHVA 1IYOA 2JKTM 4FOFA 4EUZA 5HW3A 4ZBEA 4EWFA 4IUHA 3NHQA 2E8IA 4U3TA 2HDSA 2X01A 3NULA 3WS0A 5HAQA 4X1LA 3LFVA 3VMAA 2XD1A 1HZOA 3UB6A 3K3DA 1K0KA 4P87A 3G2YA 3BECA 4KG5A 1LSWA 1N4OA 3KX0X 4S2MA 2WYXA 4R3BA 1NRFA 2V8FA 3B47A 3MXQA 2Z6DA 4QY5A 5E2HA 3C7VA 3VP2A 1F5MA 3HL9A 1W79A 3C38A 2K2NA 4EESA 2QMIA 1K56D 3CUEC 4OPQA 4LENA 3SZTA 4S2OA 4QU3A 4BD0A 3C7UA 3VV4A 5AQ7A 4Z9QA 2M7VA 2LB9A 1T1AA 3VE4A 4D60A 1XPBA 3VP4A 1WA9A 2HDRA 3UB8A 3LO7A 5A93A 1E25A 2BLSA 4ME4A 1NZUA 5CHJA 2PAVP 4E3MA 4KENB 4CJNA 5CGSA 3UPNA 2JC7A 4KZ8A 4NK3A 2W3EA 5M1AA 1L0FA 1XFQA 2UV0E 3S1YA 4E3NA 3QHYA 1PZPA 3AGDA 1Y28A 3UDIA 4K08A 4DE3A 1I5QA 1L0GA 3L9KA 3Q81A 3IXBA 3A0VA 2L0WA 5A8BA 3GVBA 1DP6A 3UPOA 1MPLA 2Y2PA 1S66L 4HOIA 2VZWA 2CC1A 5HPIA 2HV1A 5HFOA 3VFHA 2ZC5B 5FSRA 3VP0A 3C4OA 3A3FA 5CGXA 4BJPA 4WMCA 3R4KA 3T4SA 1SDNA 3SH7A 5GHYA 3ZVWA 1I2SA 3UB5P 3HLEA 4U0XA 4WM9A 3Q07A 2PBDP 5E2EA 3ZDJA 1YT4A 2ZJ9A 4PMAA 4BBUA 1YLPA 3OPRA 3UNWA 3GQZA 4GOGA 2J7VA 2D01A 5DF7A 4N9KA 3DAVA 1YLJA 5A92A 3PAGA 3HLBA 2JHEA 3U4LP 2ZC4B 3BWLA 3QP4A 3S7QA 4X6TA 5FI7A 5LBRA 3GV9A 3WRTA 1ZG6A 4NXBA 1KDWA 4GJ4A 5DFXA 3GDIA 3LI8A 3ZHHA 2JKRI 3MXRA 3FC7A 3SS4A 3EQUA 3G32A 4BL2A 2OAQ1 3PBRA 3F1NB 1U60A 2JKTI 5GLBA
chains in the Genus database with same CATH topology
4DMZA 3VOLA 2H28A 2M7UA 4WF0A 3F1OB 1OJGA 1H3QA 3R7WB 3PBOA 1X0OA 3KSFA 3PBNA 3ULFA 1TS8A 1OTBA 3FPVA 4PHTA 1IOUA 1YKDA 2PR5A 1W63Q 2HJEA 4KUKA 4I39A 1OTDA 4O0PA 5HD3A 2JN7A 3KYQA 4NXFA 4PKYG 3CWFA 4GW9A 4I3AA 5J4EA 5F6AA 1LSVA 2I9VA 2VEAA 4XT2A 3UMDA 4WEKA 3B33A 5HDDA 4BMWA 2A24A 2B02A 2QYBA 2LB5A 4CLCA 1GSVA 2J3TC 3UE3A 4XT2B 1N9NA 3PBSA 4IHQA 2VX8A 5AVEA 3ZQ5A 4I38A 3MR0A 1UWNX 2J80A 1NWZA 2EA9A 1UGUA 2OAP1 1G6OA 4WELA 1TS7A 5F69A 4IJGA 2NUTC 1S67L 3LI9A 5K5BA 4JGQA 4B93A 3UB7A 2JKRM 3LYXA 2Z6CA 3FPWA 2O99A 2V1BA 2HJ9C 3CAXA 5TBMA 3MFXA 1S4RA 3T50A 2GJ3A 3EEHA 1VB6A 3MMHA 4WEJA 1STZA 1YSPA 4WUJA 1TF1A 3LIDA 3RFBA 2K31A 3CUEA 2Y8HA 2YKHA 1XFNA 4ETZA 4UQIM 3OCNA 1EW0A 4M4XA 3E4OA 4AFIA 2O9AA 4HQAA 2CMNA 3OLOA 1TS6A 3TJZC 2KLIA 4MMNA 4BBVA 2PDRA 3K3CA 3F1PB 2HGVA 4GLQA 2PT7A 4EETB 3U2AA 5I5LA 2W3DA 1N9LA 4WN5A 2GX5A 3JVVA 3BQ8A 3O5YA 4EUVA 4L0LA 5DFYA 3T4JA 1T18A 1P9WA 4MCWA 3IBRA 3IBJA 2P04A 1N9OA 3K2NA 3B42A 2EWWA 2VV6A 3T4TA 5KSHA 4L9EA 3CITA 1P97A 4KQDA 4KQOA 3C2WA 1D06A 4I3JA 2ZBBA 5G4YA 1MZUA 3TRCA 2QJ5A 3RTYA 4CLCE 3EEAA 1P0ZA 3BQAA 3S7PA 3BW6A 4II7A 4LLOB 1JNUA 3ZYTA 1DP8A 4ZRRA 4NEED 3E4PA 5IT5A 3HJKA 5HD5A 3IS2B 3KYZA 3NOUC 5G4ZA 3NOPC 4IUKA 1VHMA 3OBFA 2PR6A 3DBAA 2OWJA 4UEYA 3GECA 4HP9A 2OWHA 2XSSA 5HWVA 2XRNA 2QJ7A 2L4RA 5DJUA 3KSHA 4NXGA 5CX7A 1LL8A 1OTEA 2K7SA 3UB9A 5DJTA 5TJJA 3OOVA 4Y3IA 1ZTUA 4MN7A 4R38A 2J3WA 3SW1A 2W1TA 1YAXA 2VLGA 2G7UA 1DRMA 4JGRA 3A0RA 4ARZA 3TW8A 2OOLA 3EGXC 3FG8A 4R6LA 4MN6A 3EWKA 2QWSA 3T4QA 4PKYA 2W1TB 2W3HA 3S7OA 3CI6A 5DKKA 5FL3A 4LPZA 4EEUA 4ARZB 3CLOA 2O9CA 4WLAA 1S4SA 1P9RA 2A24B 1UWPX 5AJGA 4Y2FA 4FSFA 3MQQA 4L9FA 4CLCB 2D02A 2VJWA 2VKSA 4GS9A 5J3WA 1W63M 5IS1A 5IU1A 3T4LA 2PD8A 1NLZA 2V1AA 2YKFA 3H9WA 3PXPA 4HY8A 2QHKA 3C30A 5HZHA 4KUOA 1OT6A 4EERA 3D72A 3E4QA 4GS9B 3HJIA 3LIEA 3T4OA 4EXOA 4G3VA 2ZOHA 4R3AA 4YOFA 2W3GA 2JKTM 2XA7M 1F9IA 3C8CA 4FOFA 3PHYA 1IFQA 1OTAA 2BASA 3PR6A 4G3WA 4CLCC 4IUHA 3NHQA 1T19A 1T1BA 3BY9A 3H82A 3LIFA 3NOTC 5TBMB 4H6JA 1LSXA 3V67A 3LIAA 1NLYA 3KSIA 3P7NA 5DF9A 3EQVA 4HI4A 5HWTA 3H82B 4L9GA 3LFVA 4HJ3A 2J3TD 4HNBA 1GSWA 2XA7S 4H6JB 4Q0IA 3UB6A 3K3DA 5C5KA 5F68A 1LSWA 2ZOIA 4OOMA 3KX0X 2P08A 4LRZE 3NJAA 1LT0A 2PYRA 2VV8A 2XROA 3UE6A 4EU0A 3W2ZA 1V9ZA 3B47A 3MXQA 2Z6DA 1GSXA 3PYPA 5HPFA 4YWZA 4HIAA 1F5MA 3C38A 2K2NA 3TE8A 4EESA 5KIZA 2P7JA 2PD7A 2R78A 5HL6A 1V9YA 2KDKA 3LR4A 2INWA 3CUEC 2O9BA 4GCZA 4NKPA 3PBQA 3BY8A 2ZMVA 2GZAA 5AVFA 4BBTA 3LR5A 4HHDA 2WKPA 3EGDC 4MDZA 4B9OA 3MJQA 3VV4A 4LRYC 4LRXC 3PBTA 1D7EA 2M7VA 2L1MA 2LB9A 1OTIA 1S1YA 2W3FA 1T1AA 3VE4A 4R70A 2VV7A 4I3IA 4Z1WA 1WA9A 2Y79A 3F1NA 3UB8A 4Y5FA 3EOIA 2A2LA 4CQHA 4HJ4A 3R7WA 1XJ4A 4F3LA 2B18A 4DJ3A 4P6ZM 3LR0A 2MJ6A 3VE3A 1YSQA 4ME4A 1OJ5A 5EFWA 4EEPA 4F3LB 2M1CA 1OT9A 1XJ3A 2W3EA 1XFQA 3OC2A 4YNRA 4PAUA 4QPRA 5J7EA 1G28A 3MQOA 4P6ZS 2W0NA 2V0WA 3A0SA 5MC7A 1H8MA 3MF0A 1Y28A 3OCLA 4K08A 1MKMA 3E98A 2V9AA 4Q0HA 3A0VA 2L0WA 4JGPA 1ODVA 5A8BA 1DP6A 4HJ6A 1OPXA 1S66L 4HH3A 4HOIA 3UMEA 2VZWA 4DJ2A 4I5SA 3T4KA 3G6OA 3D3OA 4EQ1A 3MQ0A 1T1CA 5HPIA 2HV1A 4GHIA 3HCYA 1BYWA 4JGOA 4MN5A 3JVUA 1TD5A 4GHIB 4ETXA 4BJPA 5HWWA 4Q0JA 1XJ6A 4E04A 2IA2A 3R4KA 3T4SA 1F98A 2KX6A 4OOLA 5HSQA 4EW7A 2WKQA 2QKPA 2ZMFA 1DP9A 1ZHHB 2WKRA 4RQ9A 1TS0A 3S7NA 3KO6A 2W27A 1NRJA 2PYPA 4NXEA 3F1PA 3P01A 2VA0A 3H7WA 4BBUA 4BWIA 2KOIA 2D01A 3RH8B 3H7WB 4WL9A 2VGLM 4CLCD 4UQIS 1S1ZA 4HP4A 1XJ2A 5L8MA 2HF6A 2JHEA 2DMWA 3KSGA 1KOUA 3BWLA 4G3KA 3S7QA 3BJNA 4O01A 5HDSA 2FH5A 5LBRA 4NXBA 4DN0A 3E0YA 5F5YA 2VGLS 4GJ4A 3ICYA 5DFXA 3GDIA 3LI8A 3LUQA 3IS2A 1MC0A 2FZ0A 2JKRI 3LIBA 3FC7A 3EQUA 3LR3A 2O0YA 5DKLA 2NUPC 4HH2A 2EWVA 2GNXA 3F1OA 2W1RA 2OAQ1 3LICA 2PHYA 3PBRA 3F1NB 5HDCA 2V0UA 2JKTI 4O8GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VOL A;  2H28 A;  4WF0 A;  3F1O B;  1OJG A;  1X0O A;  3ULF A;  1TS8 A;  1OTB A;  2PR5 A;  4KUK A;  4I39 A;  1OTD A;  5HD3 A;  2JN7 A;  4NXF A;  4PKY G;  3CWF A;  4GW9 A;  4I3A A;  5J4E A;  5F6A A;  1LSV A;  2I9V A;  2VEA A;  4XT2 A;  3UMD A;  3B33 A;  5HDD A;  2A24 A;  2B02 A;  1GSV A;  4XT2 B;  1N9N A;  5AVE A;  3ZQ5 A;  4I38 A;  3MR0 A;  1UWN X;  2J80 A;  1NWZ A;  2EA9 A;  1UGU A;  1TS7 A;  5F69 A;  1S67 L;  3LI9 A;  4JGQ A;  3UB7 A;  3LYX A;  2Z6C A;  2V1B A;  3CAX A;  5TBM A;  3MFX A;  1S4R A;  3T50 A;  2GJ3 A;  3EEH A;  1VB6 A;  4WUJ A;  3LID A;  2YKH A;  1XFN A;  1EW0 A;  4M4X A;  3E4O A;  4HQA A;  2CMN A;  3OLO A;  1TS6 A;  4BBV A;  2PDR A;  3K3C A;  3F1P B;  4EET B;  5I5L A;  1N9L A;  4WN5 A;  1T18 A;  3IBR A;  1N9O A;  2VV6 A;  4L9E A;  1P97 A;  4KQD A;  5G4Y A;  3C2W A;  1D06 A;  4I3J A;  2ZBB A;  1MZU A;  2QJ5 A;  3RTY A;  1P0Z A;  4LLO B;  1JNU A;  1DP8 A;  3E4P A;  3HJK A;  5HD5 A;  3IS2 B;  3NOU C;  5G4Z A;  3NOP C;  2PR6 A;  2OWJ A;  3GEC A;  4HP9 A;  2OWH A;  5HWV A;  2QJ7 A;  5DJU A;  2L4R A;  4NXG A;  1LL8 A;  1OTE A;  2K7S A;  3UB9 A;  5DJT A;  4R38 A;  3SW1 A;  2VLG A;  1DRM A;  4JGR A;  3A0R A;  2OOL A;  3FG8 A;  4R6L A;  4MN6 A;  3EWK A;  2QWS A;  4PKY A;  5DKK A;  4LPZ A;  4EEU A;  3CLO A;  4WLA A;  1S4S A;  2A24 B;  1UWP X;  3MQQ A;  4L9F A;  2D02 A;  4GS9 A;  5J3W A;  5IS1 A;  5IU1 A;  2PD8 A;  2V1A A;  2YKF A;  3H9W A;  4HY8 A;  2QHK A;  5HZH A;  4KUO A;  1OT6 A;  4EER A;  3D72 A;  3E4Q A;  4GS9 B;  3HJI A;  3LIE A;  4EXO A;  2ZOH A;  4R3A A;  1F9I A;  3C8C A;  3PHY A;  1OTA A;  2BAS A;  3NHQ A;  1T19 A;  1T1B A;  3BY9 A;  3H82 A;  3LIF A;  3NOT C;  5TBM B;  4H6J A;  1LSX A;  3LIA A;  3P7N A;  4HI4 A;  5HWT A;  3H82 B;  4L9G A;  4HJ3 A;  4HNB A;  1GSW A;  4H6J B;  3UB6 A;  3K3D A;  5F68 A;  1LSW A;  2ZOI A;  3KX0 X;  4LRZ E;  3NJA A;  1LT0 A;  2PYR A;  2VV8 A;  3UE6 A;  1V9Z A;  3MXQ A;  2Z6D A;  1GSX A;  3PYP A;  4YWZ A;  4HIA A;  4EES A;  5KIZ A;  2P7J A;  2PD7 A;  2R78 A;  1V9Y A;  2KDK A;  2INW A;  4GCZ A;  3BY8 A;  5AVF A;  4BBT A;  4HHD A;  2WKP A;  4B9O A;  3MJQ A;  4LRY C;  4LRX C;  1D7E A;  2L1M A;  1OTI A;  1S1Y A;  1T1A A;  3VE4 A;  4R70 A;  2VV7 A;  4I3I A;  1WA9 A;  3F1N A;  3UB8 A;  4HJ4 A;  1XJ4 A;  4F3L A;  4DJ3 A;  3VE3 A;  1OJ5 A;  5EFW A;  4EEP A;  4F3L B;  2M1C A;  1OT9 A;  1XJ3 A;  1XFQ A;  5J7E A;  1G28 A;  3MQO A;  2W0N A;  2V0W A;  3A0S A;  1Y28 A;  4K08 A;  2V9A A;  3A0V A;  2L0W A;  4JGP A;  1ODV A;  5A8B A;  1DP6 A;  4HJ6 A;  1S66 L;  4HH3 A;  4HOI A;  3UME A;  4DJ2 A;  4I5S A;  3G6O A;  4EQ1 A;  1T1C A;  2HV1 A;  4GHI A;  1BYW A;  4JGO A;  4MN5 A;  4GHI B;  5HWW A;  1XJ6 A;  4E04 A;  1F98 A;  2KX6 A;  5HSQ A;  4EW7 A;  2WKQ A;  2QKP A;  1DP9 A;  2WKR A;  4RQ9 A;  1TS0 A;  2W27 A;  2PYP A;  4NXE A;  3F1P A;  3H7W A;  4BBU A;  2D01 A;  3RH8 B;  3H7W B;  4WL9 A;  1S1Z A;  4HP4 A;  1XJ2 A;  2JHE A;  1KOU A;  3BWL A;  5HDS A;  4NXB A;  5F5Y A;  3ICY A;  3GDI A;  3LI8 A;  3LUQ A;  3IS2 A;  3LIB A;  3FC7 A;  5DKL A;  4HH2 A;  3F1O A;  3LIC A;  2PHY A;  3F1N B;  5HDC A;  2V0U A; 
#chains in the Genus database with same CATH topology
 4OQ0 A;  2M7U A;  1JTG A;  1OJG A;  1L2S A;  3MBZ A;  3KSF A;  3PBN A;  4EBL A;  5DTS A;  3LEQ A;  4B4X A;  1OTB A;  3P09 A;  4M3K A;  4I39 A;  4O0P A;  3KYQ A;  4PKY G;  4XXR A;  3GSG A;  3ZG5 A;  4ID4 A;  2J9O A;  3UMD A;  4BMW A;  2A24 A;  4E3I A;  1LLB A;  2J3T C;  4JF5 A;  1FCN A;  3PBS A;  4IHQ A;  5AVE A;  3PAE A;  2EA9 A;  1G6O A;  5D3O A;  4ZTK A;  2NUT C;  4R23 A;  5GHX A;  3RXW A;  3UB7 A;  1ONH A;  5EOO A;  2VK3 A;  4ESP A;  1KGE A;  2V20 A;  2HP5 A;  2V1B A;  2HJ9 C;  1AXB A;  5TBM A;  3T50 A;  3CG5 A;  1XKZ A;  4BL3 A;  3EEH A;  3QP2 A;  1S6R A;  4WBG A;  4WEJ A;  1STZ A;  1J9M A;  5KMW A;  4RX2 A;  4UA7 A;  4M4X A;  3E4O A;  3MKE A;  2H0Y A;  3OLO A;  1TS6 A;  3F1P B;  4GLQ A;  2PT7 A;  4GD6 A;  1BUE A;  1N9L A;  5CHU A;  4WN5 A;  4X68 A;  4L0L A;  3E2K A;  1WYC A;  1P9W A;  4QB8 A;  2PBY A;  4KZ4 A;  1XP4 A;  3B42 A;  5EM1 A;  2XF3 A;  5KSC A;  2ZBB A;  4EBP A;  3RJU A;  3RTY A;  1DJC A;  3S7P A;  5FAQ A;  1MWU A;  2XFT A;  4II7 A;  4Y17 A;  3A3J A;  4WYY A;  2IWB A;  4K0W A;  5IT5 A;  3IS2 B;  3NCK A;  3BFF A;  2PR6 A;  3O86 A;  3DBA A;  2OWJ A;  4UEY A;  4PM5 A;  5FI2 A;  2XRN A;  2OLU A;  2QJ7 A;  4LV1 A;  5CXW A;  4HEF A;  5CRF A;  1OME A;  1WYB A;  3HUM A;  4MN7 A;  4A5R A;  4R38 A;  2VLG A;  3SH9 A;  4JGR A;  1YLZ A;  3TW8 A;  3FG8 A;  4R6L A;  4KZ9 A;  3HLF A;  5HX9 A;  1FSY A;  3NI9 A;  3IX4 A;  3CI6 A;  1NZO A;  5CED A;  4S2I A;  1MBL A;  4BD1 A;  2ZM2 A;  2P9V A;  4QJG A;  2O9C A;  3RXX A;  4RYE A;  2P9V B;  2VKS A;  5IS1 A;  1W63 M;  2A49 A;  1NLZ A;  2V1A A;  2YKF A;  1PIO A;  5A91 A;  5F1F A;  2JE5 A;  3PXP A;  3LGO A;  3SOI A;  2C5W B;  4O7D A;  2Y91 A;  3D72 A;  1ALQ A;  3LIE A;  3T4O A;  1IKG A;  4X1M A;  1I2W A;  5FQK A;  4K91 A;  3PHY A;  4B4Z A;  2BAS A;  3N7W A;  5BOH A;  1T1B A;  3H82 A;  3BY9 A;  4GNU A;  1NLY A;  5JYP A;  3HUN A;  3EQV A;  4OPZ A;  4HI4 A;  4XUZ A;  4OH0 A;  3H82 B;  4L9G A;  4IBR A;  2J3T D;  4WZ4 A;  1GSW A;  4Q0I A;  1K6R A;  5C5K A;  4OOM A;  3A3E A;  4QWO A;  3NJA A;  2BG1 A;  1LT0 A;  2PYR A;  2XRO A;  1CF0 A;  5GLC A;  2Y2Q A;  3MXS A;  1XGJ A;  4U0T A;  5HPF A;  2FFF B;  4HIA A;  2WKH A;  2IWC A;  5E43 A;  3UDX A;  2PD7 A;  1CEG A;  5HL6 A;  1KDS A;  3CMZ A;  4NKP A;  3ZG8 B;  2Y2K A;  3PBQ A;  4FD8 A;  4KQR A;  1N9B A;  5AVF A;  1LI9 A;  4HHD A;  2WKP A;  3IWI A;  5GHZ A;  2Y2M A;  4LRY C;  4MBH A;  3PBT A;  4NET A;  2PU4 A;  1BT5 A;  5L09 A;  4Z1W A;  5CTN A;  5GLD A;  2WGV A;  4DRT A;  4Y0U A;  1YMS A;  2I72 A;  1BTL A;  3DWK A;  1XA7 A;  1L0D A;  2A2L A;  4WMC D;  3R7W A;  1BSG A;  1XJ4 A;  3Q7Z A;  5FDH A;  2HZ5 A;  3VE3 A;  1LHY A;  1IEL A;  2Y4A A;  3O87 A;  1OJ5 A;  5EFW A;  1PW1 A;  2M1C A;  5FAS A;  1OT9 A;  3V3S A;  1XJ3 A;  2XDM A;  3WS1 A;  4YNR A;  5J7E A;  1YPR A;  5DTK A;  3SS3 A;  5FAT A;  5EV0 A;  3TSG A;  3OCL A;  4MEZ A;  4BQM A;  4Y0T A;  3E98 A;  2IWD A;  5KZH A;  5F1G A;  4JGP A;  4NG2 A;  3T1Q B;  2WZZ A;  3N6I A;  4JF6 A;  3W4P A;  1NY0 A;  1M6K A;  4DJ2 A;  3G6O A;  3D3O A;  3TOI A;  1IKI A;  1T1C A;  2FFY A;  1E3U A;  1BYW A;  1NYM A;  3JYI A;  3JVU A;  1ERO A;  4S2N C;  1Z09 A;  4Q0J A;  4E04 A;  4DDS A;  1F98 A;  2KX6 A;  1PWG A;  2QKP A;  3HVF A;  2WKR A;  5E2G A;  3ISG A;  5F82 A;  3S7N A;  1EWZ A;  4N1H A;  2PYP A;  3E2L A;  4LGW A;  2VA0 A;  1YMX A;  5JYO A;  1MKI A;  4DXC A;  4WZ5 A;  1BLH A;  2ZQ8 A;  2BTF P;  4WL9 A;  4HP4 A;  1XJ2 A;  5L8M A;  4GB7 A;  3KSG A;  3NDE A;  1KOU A;  3NBL A;  3BYD A;  2Z2L B;  5TFQ A;  4LCL A;  4UHU A;  1CI9 A;  3ZVT A;  3LUQ A;  4XUX A;  5L07 A;  2XLN A;  4FH2 A;  3BRM A;  2O0Y A;  1JWP A;  3OPP A;  3LIC A;  1PW8 A;  4IED A;  2PHY A;  3KYE A;  1ZC2 A;  3V5M A;  2PRF A;  3BFG A;  3VOL A;  2H28 A;  4WF0 A;  1DJA A;  4OLD A;  1RGZ A;  1IYP A;  1H3Q A;  1MWT A;  1PI5 A;  4LV3 A;  1TS8 A;  5EPH A;  3VOZ A;  5AQA A;  1XGI A;  4OOY A;  3LY4 A;  4K0X A;  2PR5 A;  3D9Y A;  4R0Q A;  2WAD A;  2ZM0 A;  4HBU A;  2JN7 A;  4OP5 A;  4NXF A;  2VGK A;  3MZD A;  3VOY A;  2VEA A;  4RVA A;  4ZJ1 A;  4WEK A;  3T1R A;  5EOE A;  3M2K A;  3IF5 A;  4CLC A;  4DXB A;  2E8J A;  2XR0 A;  5EVL A;  2VX8 A;  2ZD8 A;  1ZKJ A;  3ZQ5 A;  3MR0 A;  4JLF A;  4JPM A;  4D2O A;  2J80 A;  1NWZ A;  3ZNY A;  1UGU A;  2OAP 1;  2XGN A;  3OPL A;  3NY4 A;  5F69 A;  4UA6 A;  4Y7P A;  5HAP A;  3LYX A;  1SZV A;  2Z6C A;  1G5U A;  2Y2N A;  3FPW A;  1L0E A;  1GA0 A;  1S4R A;  3IWO A;  4YIN A;  3T1S A;  1IYS A;  2X02 A;  2HP6 A;  3N8R A;  5GL9 A;  4WUJ A;  1ESU A;  1TF1 A;  3LID A;  5DTT A;  4JXS A;  3OCN A;  3HLD A;  1TVF A;  1H8Z A;  3FKW A;  2CMN A;  3CPT A;  2KLI A;  1KVL A;  4R4R A;  3BFE A;  4KZA A;  3W8K A;  3MSH A;  4DE2 A;  1H0M A;  1BZA A;  5CGW A;  3JVV A;  3W4O A;  1W8Q A;  3IBR A;  3IBJ A;  2P04 A;  4JF4 A;  2ACG A;  3K2N A;  2VV6 A;  3L7H A;  3T4T A;  3WWX A;  3UE1 A;  2HPB A;  1Y4O A;  3FZC A;  1MZU A;  3TRC A;  1QMF A;  3BQA A;  1PZO A;  4NEE D;  3E4P A;  4ZJ3 A;  5HD5 A;  1MWS A;  2EX9 A;  4WZ5 C;  2J9P A;  3S4X A;  1FCO A;  3NOU C;  1E4D A;  4HP9 A;  2OWH A;  5HWV A;  5CX7 A;  1IYQ A;  1OTE A;  1ZTU A;  3MZF A;  3N4I A;  2EFX A;  5A90 A;  1YAX A;  3GMW A;  1DRM A;  1ACF A;  3EGX C;  1S0W A;  4IBX A;  4MN6 A;  4PKY A;  4LPZ A;  3IX8 A;  3T1X A;  2Y2O A;  4WLA A;  4UA9 A;  2A24 B;  4FUW A;  4FSF A;  3MQQ A;  3IHA A;  3IXH A;  5DVA A;  3AGF A;  1Q2P A;  5IU1 A;  3T4L A;  2WAF A;  4OVD A;  3C30 A;  3HJI A;  2ZOH A;  1NJ4 A;  3JPU A;  1FSW A;  2W3G A;  3N8L A;  4H8R A;  2EFU A;  2XA7 M;  1F9I A;  3C8C A;  3PR6 A;  4CLC C;  4ZDX A;  5TBM B;  1DJB A;  1TDG A;  4H6J A;  2EXB A;  3KSI A;  3P7N A;  4PM9 A;  5DF9 A;  5FQJ A;  4KZ7 A;  1WE4 A;  4S2L A;  4HNB A;  2XA7 S;  4H6J B;  3V50 A;  2P08 A;  4LRZ E;  2ZC3 B;  2HP9 A;  1MXO A;  3UE6 A;  1K57 C;  1M40 A;  2EXA A;  1PWC A;  3PYP A;  4E6W A;  2ZLY A;  4C6Y A;  5GLA A;  3MFD A;  1V9Y A;  3LR4 A;  2INW A;  2O9B A;  1Y54 A;  1K54 A;  4IVK A;  4MDZ A;  4B9O A;  3G30 A;  5L2F A;  1KE0 A;  3C5A A;  4DE0 A;  2DRW A;  4GN2 A;  1PYY A;  3QP1 A;  3WS4 A;  4FTX A;  2W3F A;  1E3U D;  2VV7 A;  4I3I A;  5EVI C;  2WAE A;  3QP6 A;  2DCF A;  2JCH A;  3VSK A;  4ZJ2 A;  3EOI A;  1G6A A;  4CQH A;  4HJ4 A;  3VFF A;  4JXW A;  4F3L A;  2B18 A;  4DJ3 A;  3LR0 A;  2Q9M A;  4EQI A;  3O3V A;  1YSQ A;  4EEP A;  4F3L B;  3A3I A;  2ZL1 A;  2G2W A;  1K4E A;  3CJM A;  4PAU A;  4QPR A;  4OON A;  2ZMA A;  2Y2H A;  3A0S A;  5MC7 A;  2ZL1 B;  2Y55 A;  4S2N A;  1Q2Q A;  3A3D A;  4Q0H A;  4LV2 A;  4S2P A;  5CHM A;  4HJ6 A;  3BFC A;  1OPX A;  2WGW A;  1ES3 A;  3VP1 A;  4OPY A;  2ZQD A;  4I5S A;  4JXG A;  3QNC A;  4EQ1 A;  3MQ0 A;  4JXV A;  2WGW B;  3GTC A;  4JGO A;  1K4F A;  1NYY A;  3UPP A;  5EEC A;  5HWW A;  1XJ6 A;  1F2K A;  4OOL A;  5HSQ A;  2AVX A;  4EW7 A;  2WKQ A;  4LCM A;  1DP9 A;  1TS0 A;  3SS5 A;  4DF6 A;  3HLG A;  1RP5 A;  2XK1 A;  4OLG A;  2W27 A;  4NXE A;  3HRE A;  3H7W A;  3IF6 A;  4X25 A;  1K25 A;  3H7W B;  3C4P A;  4HES A;  2VGL M;  4CLC D;  4UQI S;  4R4S A;  2HF6 A;  3CHW P;  4G3K A;  1ESI A;  3BJN A;  3HLC A;  4HBT A;  5M18 A;  5HDS A;  2HDU A;  2FH5 A;  2RCX A;  4BEN A;  1CJF A;  3DTM A;  2VGL S;  5EVE A;  3ICY A;  3LIB A;  4PM6 A;  1GHI A;  3LR3 A;  5DKL A;  4HH2 A;  3G35 A;  2EWV A;  2GNX A;  3DTI A;  1FR1 A;  1K55 A;  5HDC A;  4O8G A;  1HVB A;  4DMZ A;  4ZAM A;  2VGJ A;  1VEU A;  2HDQ A;  4PPR A;  1K54 C;  3R7W B;  3PBO A;  1ES4 A;  3LCE A;  4PHT A;  1IOU A;  1CQA A;  1FOF A;  1VEU B;  3MKF A;  3FYZ A;  2GDN A;  4PM7 A;  1DY6 A;  1GHM A;  4OQI A;  2DNS A;  3CWF A;  5HAI A;  4C75 A;  2RL3 A;  5F6A A;  2Y2J A;  1LSV A;  5FEG A;  4FH4 A;  4XT2 A;  5FEF A;  3PTE A;  2G2U A;  4E3J A;  2B02 A;  5FAP A;  4Y15 A;  5L10 A;  1GSV A;  3ITB A;  3UE3 A;  3WS5 A;  4XT2 B;  1N9N A;  4E3O A;  4I38 A;  1UWN X;  3G4P A;  3M6B A;  2C6W B;  1L3L A;  1ES5 A;  1TS7 A;  4GKU A;  4P0M A;  2WZX A;  5K5B A;  5FQI A;  4JGQ A;  4B93 A;  2JKR M;  3BFD A;  4OP8 A;  4N9L A;  1KVM A;  1VET A;  5E2F A;  4PM8 A;  1PWD A;  4OKP A;  1G68 A;  3BM6 A;  1ONG A;  3NC8 A;  4X69 A;  1VET B;  3MMH A;  1YSP A;  1CEF A;  5FQM A;  3I7J A;  3RFB A;  4QHC A;  2Y59 A;  2Y8H A;  2Q9N A;  4KQQ A;  1ERM A;  1XFN A;  2EX2 A;  4LV0 A;  4AFI A;  2WKI A;  3N8S A;  4S2J A;  4HQA A;  4GDB A;  4MLL A;  3TJZ C;  3M6H A;  4BBV A;  3K3C A;  2HGV A;  3MZE A;  2P74 A;  4E3L A;  4RA7 A;  5I5L A;  3U2A A;  2GX5 A;  4EUV A;  5DFY A;  3G2Z A;  3T4J A;  3ZG7 B;  2A3U A;  1N9O A;  1GA9 A;  4L9E A;  3CIT A;  1W8Y A;  4KQO A;  2Q0O A;  2QJ5 A;  2X71 A;  4CLC E;  3EEA A;  1O07 A;  3LY3 A;  1FIK A;  3BW6 A;  3ZYT A;  1DP8 A;  4ZRR A;  3Q82 A;  5M19 A;  3IF6 C;  3ZFZ A;  1XXM A;  1MY8 A;  3KYZ A;  2PU2 A;  5G4Z A;  2XQZ A;  4IUK A;  1VHM A;  3OBF A;  2Z2M B;  3GEC A;  1RGY A;  2L4R A;  2B5R A;  3KSH A;  4NXG A;  1LL8 A;  2J8Y A;  5DJT A;  5HAR A;  2R9X A;  1KGF A;  1FR6 A;  2G7U A;  4QY6 A;  3FV7 A;  3A0R A;  4ARZ A;  2OOL A;  5TR7 A;  5IHV A;  1CK3 A;  4MNR A;  3T4Q A;  3D4F A;  1BLC A;  3S7O A;  2Y2L A;  5DKK A;  2WUQ A;  4ARZ B;  3NIA A;  5DF8 A;  1K55 C;  3CLO A;  1A0K A;  2R9W A;  5G18 A;  1UWP X;  5AJG A;  3ZG9 B;  2ZQ7 A;  4L9F A;  4OQH A;  4CLC B;  4DE1 A;  2D02 A;  5J3W A;  2JKG A;  2PD8 A;  2QHK A;  1XX2 A;  5HZH A;  2QZ6 A;  4KUO A;  4EER A;  4G3V A;  5F83 A;  1GCE A;  4R3A A;  1K57 A;  4YOF A;  1H8Y A;  1IFQ A;  1OTA A;  4G3W A;  3WRZ A;  4P85 A;  1T19 A;  3LIF A;  3NOT C;  4X55 A;  1LSX A;  3V67 A;  3LIA A;  5HWT A;  4HJ3 A;  3IXD A;  5F68 A;  2ZOI A;  2VV8 A;  2JBF A;  3UDF A;  3CPT B;  1HTZ A;  4EU0 A;  3W2Z A;  1V9Z A;  1GSX A;  4YWZ A;  5EVI A;  3TE8 A;  4JKT A;  5FQQ A;  3UO9 A;  5KIZ A;  2P7J A;  2R78 A;  1BLS A;  2V1Z A;  2KDK A;  4KZ6 A;  5EVI B;  4GCZ A;  1YLY A;  3BY8 A;  2ZMV A;  4FCF A;  2GZA A;  4BBT A;  1EI5 A;  3LR5 A;  3EGD C;  3IQA A;  3MJQ A;  5U47 A;  4LRX C;  1D7E A;  3OZH A;  4KG2 A;  2L1M A;  1OTI A;  1S1Y A;  3BLM A;  3UY6 A;  4R70 A;  4OPR A;  2JKF A;  2V8C A;  2Y79 A;  2ZQA A;  3F1N A;  4DDY A;  5CTM A;  4Y5F A;  5CEB A;  1LI0 A;  3LEZ A;  1JWZ A;  1YLT A;  5I94 A;  3IH9 A;  1YM1 A;  4P6Z M;  2MJ6 A;  3DTK A;  1ES2 A;  3FWL A;  5FQ9 A;  1W5D A;  2EX8 A;  3OC2 A;  1G28 A;  3MQO A;  4P6Z S;  1SDE A;  2W0N A;  2V0W A;  1PFL A;  5AQ9 A;  1H8M A;  3MF0 A;  4KZB A;  5EM0 A;  5TGF A;  1K56 A;  1MKM A;  2V9A A;  1XA1 A;  1JVJ A;  2ZC6 B;  3IHB A;  1ODV A;  1QME A;  1TEM A;  4JBF A;  4N1X A;  4HH3 A;  5FAO A;  3UME A;  4IVI A;  3T4K A;  4LFU A;  2OV5 A;  4GHI A;  3HCY A;  3NDG A;  4MN5 A;  1PNE A;  1TD5 A;  4GHI B;  4ETX A;  1Z6F A;  2IA2 A;  3MS6 A;  3BEB A;  3S22 A;  2ZMF A;  1ZHH B;  4RQ9 A;  1J3W A;  4EBN A;  3NEC A;  3WS2 A;  3KO6 A;  4P6B A;  3G34 A;  1NRJ A;  3F1P A;  3P01 A;  1D1J A;  3IH8 A;  2H5S A;  2KOI A;  4BWI A;  2UWX A;  1SKF A;  3RH8 B;  1KE3 A;  1S1Z A;  2DMW A;  4O01 A;  4BLM A;  4DN0 A;  2OLV A;  2ZQ9 A;  3E0Y A;  5F5Y A;  1YQS A;  4QD4 A;  3G31 A;  4S2K A;  3VP3 A;  3ZCZ A;  3IS2 A;  1MC0 A;  2FZ0 A;  4R1G A;  3IX3 A;  2NUP C;  1YLW A;  3F1O A;  2W1R A;  3SH8 A;  3V3R A;  3W4Q A;  1BUL A;  2V0U A;  4X56 A;  3F1O B;  2WK0 A;  2Y2G A;  4KZ5 A;  1SKO A;  5CEC A;  1X0O A;  1GHP A;  1SCW A;  3ULF A;  3ZG0 A;  3P98 A;  3AGE A;  3FPV A;  3IT9 A;  1YKD A;  1W63 Q;  2HJE A;  2Y2I A;  4KUK A;  1OTD A;  4E6X A;  5HD3 A;  1SKO B;  4GW9 A;  4I3A A;  4OQG A;  5J4E A;  2XFS A;  1LL9 A;  1O7E A;  4GZB A;  2I9V A;  3B33 A;  5HDD A;  2QYB A;  2LB5 A;  3ZGA B;  4CPK A;  4Y0O A;  3QP8 A;  2B95 A;  4DKI A;  1W7F A;  2XH9 A;  4WEL A;  2XEP A;  3DWZ A;  4IJG A;  1HD8 A;  1S67 L;  3LI9 A;  4Q8I A;  3DW0 A;  4MBK A;  2O99 A;  3CAX A;  3MFX A;  5CER A;  1ERQ A;  2GJ3 A;  1K38 A;  1AWI A;  1VB6 A;  3Q7V A;  1FIL A;  3UN7 A;  2K31 A;  3CUE A;  2YKH A;  1PI4 A;  4ETZ A;  1PRQ A;  2ZM8 A;  4UQI M;  3Q7V B;  3ZNT A;  1EW0 A;  2O9A A;  2EX6 A;  1VM1 A;  5FI6 A;  4MMN A;  3Q1F A;  3OPH A;  2PDR A;  4C3Q A;  4EET B;  1KE4 A;  1ZG4 A;  2W3D A;  3IF6 B;  3HUO A;  3BQ8 A;  3GRJ A;  3O5Y A;  4E3K A;  3T12 B;  1T18 A;  3QP5 A;  4MCW A;  4B88 A;  3DTE A;  4GD8 A;  3FKV A;  5KSH A;  2EWW A;  2QPN A;  1P97 A;  4KQD A;  3ITA A;  5G4Y A;  4I3J A;  2WKE A;  1D06 A;  3C2W A;  3M2J A;  1FCM A;  4Y13 A;  4GDN A;  1P0Z A;  4LLO B;  1JNU A;  2OSU A;  4RX3 A;  3HJK A;  2WGI A;  3GR2 A;  2H0T A;  3NOP C;  4YFM A;  1CI8 A;  2XSS A;  4EV4 A;  1K6S A;  3IWQ A;  5DJU A;  3V39 A;  1C3B A;  1JWV A;  3CZD A;  1LL5 A;  2K7S A;  3UB9 A;  1NXY A;  5EUA A;  3B3X A;  5TJJ A;  5J8X A;  5HL1 A;  3OOV A;  4Y3I A;  1H5X A;  1RCJ A;  2ZC7 A;  2J3W A;  3SW1 A;  2H10 A;  2W1T A;  4N92 A;  3O88 A;  5FA7 A;  3TG9 A;  1JTD A;  1HLU P;  3HLW A;  1FQG A;  3EWK A;  2QWS A;  1TDL A;  2W1T B;  2W3H A;  4KZ3 A;  5FL3 A;  4EEU A;  1IEM A;  2V2F F;  1VQQ A;  5EE8 A;  3HBR A;  1BLP A;  2XD5 A;  4KG6 A;  3QNB A;  5EVI D;  3BLS A;  1S4S A;  3UE0 A;  1P9R A;  4Y2F A;  1MWR A;  5FDS A;  3VSL A;  4F94 A;  1KGG A;  2ZQC A;  2VJW A;  4GS9 A;  3IXG A;  3H9W A;  4MBF A;  4X53 A;  5AQB A;  4HY8 A;  4UAA A;  1OT6 A;  3E4Q A;  4GS9 B;  4EXO A;  4R3J A;  1SHV A;  1IYO A;  2JKT M;  4FOF A;  4EUZ A;  5HW3 A;  4ZBE A;  4EWF A;  4IUH A;  3NHQ A;  2E8I A;  4U3T A;  2HDS A;  2X01 A;  3NUL A;  3WS0 A;  5HAQ A;  4X1L A;  3LFV A;  3VMA A;  2XD1 A;  1HZO A;  3UB6 A;  3K3D A;  1K0K A;  4P87 A;  3G2Y A;  3BEC A;  4KG5 A;  1LSW A;  1N4O A;  3KX0 X;  4S2M A;  2WYX A;  4R3B A;  1NRF A;  2V8F A;  3B47 A;  3MXQ A;  2Z6D A;  4QY5 A;  5E2H A;  3C7V A;  3VP2 A;  1F5M A;  3HL9 A;  1W79 A;  3C38 A;  2K2N A;  4EES A;  2QMI A;  1K56 D;  3CUE C;  4OPQ A;  4LEN A;  3SZT A;  4S2O A;  4QU3 A;  4BD0 A;  3C7U A;  3VV4 A;  5AQ7 A;  4Z9Q A;  2M7V A;  2LB9 A;  1T1A A;  3VE4 A;  4D60 A;  1XPB A;  3VP4 A;  1WA9 A;  2HDR A;  3UB8 A;  3LO7 A;  5A93 A;  1E25 A;  2BLS A;  4ME4 A;  1NZU A;  5CHJ A;  2PAV P;  4E3M A;  4KEN B;  4CJN A;  5CGS A;  3UPN A;  2JC7 A;  4KZ8 A;  4NK3 A;  2W3E A;  5M1A A;  1L0F A;  1XFQ A;  2UV0 E;  3S1Y A;  4E3N A;  3QHY A;  1PZP A;  3AGD A;  1Y28 A;  3UDI A;  4K08 A;  4DE3 A;  1I5Q A;  1L0G A;  3L9K A;  3Q81 A;  3IXB A;  3A0V A;  2L0W A;  5A8B A;  3GVB A;  1DP6 A;  3UPO A;  1MPL A;  2Y2P A;  1S66 L;  4HOI A;  2VZW A;  2CC1 A;  5HPI A;  2HV1 A;  5HFO A;  3VFH A;  2ZC5 B;  5FSR A;  3VP0 A;  3C4O A;  3A3F A;  5CGX A;  4BJP A;  4WMC A;  3R4K A;  3T4S A;  1SDN A;  3SH7 A;  5GHY A;  3ZVW A;  1I2S A;  3UB5 P;  3HLE A;  4U0X A;  4WM9 A;  3Q07 A;  2PBD P;  5E2E A;  3ZDJ A;  1YT4 A;  2ZJ9 A;  4PMA A;  4BBU A;  1YLP A;  3OPR A;  3UNW A;  3GQZ A;  4GOG A;  2J7V A;  2D01 A;  5DF7 A;  4N9K A;  3DAV A;  1YLJ A;  5A92 A;  3PAG A;  3HLB A;  2JHE A;  3U4L P;  2ZC4 B;  3BWL A;  3QP4 A;  3S7Q A;  4X6T A;  5FI7 A;  5LBR A;  3GV9 A;  3WRT A;  1ZG6 A;  4NXB A;  1KDW A;  4GJ4 A;  5DFX A;  3GDI A;  3LI8 A;  3ZHH A;  2JKR I;  3MXR A;  3FC7 A;  3SS4 A;  3EQU A;  3G32 A;  4BL2 A;  2OAQ 1;  3PBR A;  3F1N B;  1U60 A;  2JKT I;  5GLB A; 
#chains in the Genus database with same CATH homology
 4DMZ A;  3VOL A;  2H28 A;  2M7U A;  4WF0 A;  3F1O B;  1OJG A;  1H3Q A;  3R7W B;  3PBO A;  1X0O A;  3KSF A;  3PBN A;  3ULF A;  1TS8 A;  1OTB A;  3FPV A;  4PHT A;  1IOU A;  1YKD A;  2PR5 A;  1W63 Q;  2HJE A;  4KUK A;  4I39 A;  1OTD A;  4O0P A;  5HD3 A;  2JN7 A;  3KYQ A;  4NXF A;  4PKY G;  3CWF A;  4GW9 A;  4I3A A;  5J4E A;  5F6A A;  1LSV A;  2I9V A;  2VEA A;  4XT2 A;  3UMD A;  4WEK A;  3B33 A;  5HDD A;  4BMW A;  2A24 A;  2B02 A;  2QYB A;  2LB5 A;  4CLC A;  1GSV A;  2J3T C;  3UE3 A;  4XT2 B;  1N9N A;  3PBS A;  4IHQ A;  2VX8 A;  5AVE A;  3ZQ5 A;  4I38 A;  3MR0 A;  1UWN X;  2J80 A;  1NWZ A;  2EA9 A;  1UGU A;  2OAP 1;  1G6O A;  4WEL A;  1TS7 A;  5F69 A;  4IJG A;  2NUT C;  1S67 L;  3LI9 A;  5K5B A;  4JGQ A;  4B93 A;  3UB7 A;  2JKR M;  3LYX A;  2Z6C A;  3FPW A;  2O99 A;  2V1B A;  2HJ9 C;  3CAX A;  5TBM A;  3MFX A;  1S4R A;  3T50 A;  2GJ3 A;  3EEH A;  1VB6 A;  3MMH A;  4WEJ A;  1STZ A;  1YSP A;  4WUJ A;  1TF1 A;  3LID A;  3RFB A;  2K31 A;  3CUE A;  2Y8H A;  2YKH A;  1XFN A;  4ETZ A;  4UQI M;  3OCN A;  1EW0 A;  4M4X A;  3E4O A;  4AFI A;  2O9A A;  4HQA A;  2CMN A;  3OLO A;  1TS6 A;  3TJZ C;  2KLI A;  4MMN A;  4BBV A;  2PDR A;  3K3C A;  3F1P B;  2HGV A;  4GLQ A;  2PT7 A;  4EET B;  3U2A A;  5I5L A;  2W3D A;  1N9L A;  4WN5 A;  2GX5 A;  3JVV A;  3BQ8 A;  3O5Y A;  4EUV A;  4L0L A;  5DFY A;  3T4J A;  1T18 A;  1P9W A;  4MCW A;  3IBR A;  3IBJ A;  2P04 A;  1N9O A;  3K2N A;  3B42 A;  2EWW A;  2VV6 A;  3T4T A;  5KSH A;  4L9E A;  3CIT A;  1P97 A;  4KQD A;  4KQO A;  3C2W A;  1D06 A;  4I3J A;  2ZBB A;  5G4Y A;  1MZU A;  3TRC A;  2QJ5 A;  3RTY A;  4CLC E;  3EEA A;  1P0Z A;  3BQA A;  3S7P A;  3BW6 A;  4II7 A;  4LLO B;  1JNU A;  3ZYT A;  1DP8 A;  4ZRR A;  4NEE D;  3E4P A;  5IT5 A;  3HJK A;  5HD5 A;  3IS2 B;  3KYZ A;  3NOU C;  5G4Z A;  3NOP C;  4IUK A;  1VHM A;  3OBF A;  2PR6 A;  3DBA A;  2OWJ A;  4UEY A;  3GEC A;  4HP9 A;  2OWH A;  2XSS A;  5HWV A;  2XRN A;  2QJ7 A;  2L4R A;  5DJU A;  3KSH A;  4NXG A;  5CX7 A;  1LL8 A;  1OTE A;  2K7S A;  3UB9 A;  5DJT A;  5TJJ A;  3OOV A;  4Y3I A;  1ZTU A;  4MN7 A;  4R38 A;  2J3W A;  3SW1 A;  2W1T A;  1YAX A;  2VLG A;  2G7U A;  1DRM A;  4JGR A;  3A0R A;  4ARZ A;  3TW8 A;  2OOL A;  3EGX C;  3FG8 A;  4R6L A;  4MN6 A;  3EWK A;  2QWS A;  3T4Q A;  4PKY A;  2W1T B;  2W3H A;  3S7O A;  3CI6 A;  5DKK A;  5FL3 A;  4LPZ A;  4EEU A;  4ARZ B;  3CLO A;  2O9C A;  4WLA A;  1S4S A;  1P9R A;  2A24 B;  1UWP X;  5AJG A;  4Y2F A;  4FSF A;  3MQQ A;  4L9F A;  4CLC B;  2D02 A;  2VJW A;  2VKS A;  4GS9 A;  5J3W A;  1W63 M;  5IS1 A;  5IU1 A;  3T4L A;  2PD8 A;  1NLZ A;  2V1A A;  2YKF A;  3H9W A;  3PXP A;  4HY8 A;  2QHK A;  3C30 A;  5HZH A;  4KUO A;  1OT6 A;  4EER A;  3D72 A;  3E4Q A;  4GS9 B;  3HJI A;  3LIE A;  3T4O A;  4EXO A;  4G3V A;  2ZOH A;  4R3A A;  4YOF A;  2W3G A;  2JKT M;  2XA7 M;  1F9I A;  3C8C A;  4FOF A;  3PHY A;  1IFQ A;  1OTA A;  2BAS A;  3PR6 A;  4G3W A;  4CLC C;  4IUH A;  3NHQ A;  1T19 A;  1T1B A;  3BY9 A;  3H82 A;  3LIF A;  3NOT C;  5TBM B;  4H6J A;  1LSX A;  3V67 A;  3LIA A;  1NLY A;  3KSI A;  3P7N A;  5DF9 A;  3EQV A;  4HI4 A;  5HWT A;  3H82 B;  4L9G A;  3LFV A;  4HJ3 A;  2J3T D;  4HNB A;  1GSW A;  2XA7 S;  4H6J B;  4Q0I A;  3UB6 A;  3K3D A;  5C5K A;  5F68 A;  1LSW A;  2ZOI A;  4OOM A;  3KX0 X;  2P08 A;  4LRZ E;  3NJA A;  1LT0 A;  2PYR A;  2VV8 A;  2XRO A;  3UE6 A;  4EU0 A;  3W2Z A;  1V9Z A;  3B47 A;  3MXQ A;  2Z6D A;  1GSX A;  3PYP A;  5HPF A;  4YWZ A;  4HIA A;  1F5M A;  3C38 A;  2K2N A;  3TE8 A;  4EES A;  5KIZ A;  2P7J A;  2PD7 A;  2R78 A;  5HL6 A;  1V9Y A;  2KDK A;  3LR4 A;  2INW A;  3CUE C;  2O9B A;  4GCZ A;  4NKP A;  3PBQ A;  3BY8 A;  2ZMV A;  2GZA A;  5AVF A;  4BBT A;  3LR5 A;  4HHD A;  2WKP A;  3EGD C;  4MDZ A;  4B9O A;  3MJQ A;  3VV4 A;  4LRY C;  4LRX C;  3PBT A;  1D7E A;  2M7V A;  2L1M A;  2LB9 A;  1OTI A;  1S1Y A;  2W3F A;  1T1A A;  3VE4 A;  4R70 A;  2VV7 A;  4I3I A;  4Z1W A;  1WA9 A;  2Y79 A;  3F1N A;  3UB8 A;  4Y5F A;  3EOI A;  2A2L A;  4CQH A;  4HJ4 A;  3R7W A;  1XJ4 A;  4F3L A;  2B18 A;  4DJ3 A;  4P6Z M;  3LR0 A;  2MJ6 A;  3VE3 A;  1YSQ A;  4ME4 A;  1OJ5 A;  5EFW A;  4EEP A;  4F3L B;  2M1C A;  1OT9 A;  1XJ3 A;  2W3E A;  1XFQ A;  3OC2 A;  4YNR A;  4PAU A;  4QPR A;  5J7E A;  1G28 A;  3MQO A;  4P6Z S;  2W0N A;  2V0W A;  3A0S A;  5MC7 A;  1H8M A;  3MF0 A;  1Y28 A;  3OCL A;  4K08 A;  1MKM A;  3E98 A;  2V9A A;  4Q0H A;  3A0V A;  2L0W A;  4JGP A;  1ODV A;  5A8B A;  1DP6 A;  4HJ6 A;  1OPX A;  1S66 L;  4HH3 A;  4HOI A;  3UME A;  2VZW A;  4DJ2 A;  4I5S A;  3T4K A;  3G6O A;  3D3O A;  4EQ1 A;  3MQ0 A;  1T1C A;  5HPI A;  2HV1 A;  4GHI A;  3HCY A;  1BYW A;  4JGO A;  4MN5 A;  3JVU A;  1TD5 A;  4GHI B;  4ETX A;  4BJP A;  5HWW A;  4Q0J A;  1XJ6 A;  4E04 A;  2IA2 A;  3R4K A;  3T4S A;  1F98 A;  2KX6 A;  4OOL A;  5HSQ A;  4EW7 A;  2WKQ A;  2QKP A;  2ZMF A;  1DP9 A;  1ZHH B;  2WKR A;  4RQ9 A;  1TS0 A;  3S7N A;  3KO6 A;  2W27 A;  1NRJ A;  2PYP A;  4NXE A;  3F1P A;  3P01 A;  2VA0 A;  3H7W A;  4BBU A;  4BWI A;  2KOI A;  2D01 A;  3RH8 B;  3H7W B;  4WL9 A;  2VGL M;  4CLC D;  4UQI S;  1S1Z A;  4HP4 A;  1XJ2 A;  5L8M A;  2HF6 A;  2JHE A;  2DMW A;  3KSG A;  1KOU A;  3BWL A;  4G3K A;  3S7Q A;  3BJN A;  4O01 A;  5HDS A;  2FH5 A;  5LBR A;  4NXB A;  4DN0 A;  3E0Y A;  5F5Y A;  2VGL S;  4GJ4 A;  3ICY A;  5DFX A;  3GDI A;  3LI8 A;  3LUQ A;  3IS2 A;  1MC0 A;  2FZ0 A;  2JKR I;  3LIB A;  3FC7 A;  3EQU A;  3LR3 A;  2O0Y A;  5DKL A;  2NUP C;  4HH2 A;  2EWV A;  2GNX A;  3F1O A;  2W1R A;  2OAQ 1;  3LIC A;  2PHY A;  3PBR A;  3F1N B;  5HDC A;  2V0U A;  2JKT I;  4O8G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...