2PD8A

1.8 angstrom crystal structure of the cys71ser mutant of vivid
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
148
structure length
148
Chain Sequence
HTLYAPGGYDIMGYLIQIMNRPNPQVELGPVDTSSALILCDLKQKDTPIVYASEAFLYMTGYSNAEVLGRNCRFLQSPDGMVKPKSTRKYVDSNTINTMRKAIDRNAEVQVEVVNFKKNGQRFVNFLTMIPVRDETGEYRYSMGFQCE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Circadian clock protein
molecule keywords Vivid PAS protein VVD
publication title Conformational switching in the fungal light sensor Vivid
pubmed doi rcsb
source organism Neurospora crassa
total genus 37
structure length 148
sequence length 148
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13426 PAS_9 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2pd8A00
2PHYA 2YKHA 2L0WA 3E4PA 1G28A 5G4YA 3HJKA 1S4RA 4HH2A 4K08A 2J80A 3E4OA 4GS9A 5HWWA 4H6JA 2Z6CA 1LSWA 3PHYA 1UWPX 3IS2B 1KOUA 2QJ5A 3CLOA 2PDRA 4KQDA 1GSXA 4L9FA 4XT2A 4R6LA 5DJUA 4HHDA 3HJIA 4R38A 4I39A 5KIZA 3GDIA 2VEAA 3MJQA 3IBRA 4NXEA 5DJTA 3LYXA 5J4EA 2V1AA 4I38A 3UB8A 4YWZA 5IS1A 5F68A 2OWHA 2Z6DA 2W0NA 3EEHA 3LIAA 2K7SA 3K3CA 5HD5A 4EXOA 1N9NA 3P7NA 1OTAA 3UMEA 1ODVA 3FG8A 1S1YA 4MN6A 4GS9B 4HNBA 1OJGA 2R78A 2L1MA 4F3LA 4HI4A 1VB6A 2CMNA 3K3DA 2PD7A 2H28A 1D7EA 3C8CA 2WKPA 3ICYA 2I9VA 4BBVA 4I3IA 2VV8A 3UE6A 3NOTC 1OT9A 3H82A 5EFWA 1D06A 4XT2B 5HDCA 5AVFA 4LLOB 3F1OB 5F5YA 2L4RA 3B33A 4BBTA 1DP6A 2VLGA 4PKYG 3RH8B 4JGRA 4HY8A 2B02A 2KDKA 3VE3A 3ZQ5A 1OTIA 5DKKA 4HQAA 1XJ6A 2P7JA 3MXQA 3UMDA 4B9OA 4DJ2A 3MQQA 5I5LA 3A0VA 2ZOIA 3F1PA 4WLAA 4WF0A 5J7EA 4LRZE 2QHKA 4JGQA 4NXFA 3NOUC 2HV1A 2WKQA 3RTYA 3LICA 2JHEA 1DRMA 4WN5A 3CWFA 4LPZA 1UWNX 3BY8A 3SW1A 1XJ2A 1LT0A 3CAXA 4JGOA 1X0OA 1GSVA 1OT6A 4DJ3A 2M1CA 5J3WA 3NJAA 3VE4A 1P0ZA 4KUKA 2A24B 5TBMB 2ZOHA 4PKYA 2PR6A 2WKRA 3UB7A 1OTDA 1F9IA 4GW9A 4EESA 1T1AA 2VV7A 4RQ9A 3LIEA 3LI9A 5HD3A 1S4SA 2D01A 5G4ZA 3MR0A 4HP4A 2W27A 3F1PB 2QKPA 4WUJA 4M4XA 4H6JB 1NWZA 2PD8A 1T19A 4R70A 1N9OA 4I3AA 4HP9A 4EETB 1OTBA 3UB6A 3ULFA 4HOIA 5IU1A 2PYPA 1V9YA 3A0SA 1TS7A 2ZBBA 3H9WA 4NXBA 1S67L 4GHIA 1F98A 1T1BA 3C2WA 5HZHA 2INWA 1LSXA 2PYRA 3G6OA 5HDSA 4EEUA 5F69A 4NXGA 2OOLA 2QWSA 1XJ4A 5F6AA 4EW7A 2OWJA 3T50A 1TS8A 5HSQA 2EA9A 3LIBA 4WL9A 4F3LB 1EW0A 4HH3A 3NHQA 1S1ZA 3H7WA 1WA9A 3H82B 1BYWA 5AVEA 1N9LA 1TS0A 1LL8A 2VV6A 3EWKA 2PR5A 3F1NA 3MFXA 4KUOA 4L9EA 3MQOA 4GHIB 4EERA 4JGPA 3BWLA 3LIDA 1JNUA 4R3AA 5HWTA 3E4QA 3BY9A 3F1OA 1XJ3A 1P97A 3LUQA 4EEPA 1TS6A 3GECA 2V0WA 4GCZA 1MZUA 2D02A 2KX6A 1S66L 3UB9A 3LIFA 2JN7A 2QJ7A 4HIAA 1UGUA 4EQ1A 4LRYC 2GJ3A 5A8BA 3OLOA 2V0UA 3KX0X 4L9GA 1T1CA 1LSVA 3H7WB 3FC7A 4E04A 4HJ4A 2YKFA 4LRXC 3IS2A 3A0RA 2V9AA 1GSWA 4I5SA 1DP8A 2V1BA 3F1NB 3LI8A 3D72A 3NOPC 1DP9A 4HJ6A 1Y28A 5HWVA 2A24A 4MN5A 5TBMA 5DKLA 3VOLA 1OTEA 4HJ3A 1V9ZA 4I3JA 1XFQA 1OJ5A 5HDDA 2BASA 3PYPA 4BBUA 1XFNA 1T18A
chains in the Genus database with same CATH superfamily
3WS0A 5AQ7A 2PHYA 4N1XA 1Q2QA 3VSKA 5JYPA 5F82A 3LY4A 4Q0IA 3EQUA 1S4RA 3E4OA 2XA7M 1PI5A 4GS9A 5HWWA 3IF5A 1FIKA 4GKUA 4OOYA 1H8YA 1BSGA 2QJ5A 2GZAA 3SH7A 3MKFA 3CLOA 4DKIA 2WK0A 4FOFA 4LFUA 4ZTKA 2M7UA 2PBYA 4L9FA 1KGGA 2Y2PA 2VA0A 4MNRA 1H0MA 2JKRM 1HD8A 2JC7A 4QD4A 2J8YA 4S2MA 4YINA 2ZL1B 3T4OA 2VEAA 3IWIA 4MBKA 4OQHA 5DJTA 5J4EA 1IKIA 1KVMA 4YNRA 2W1RA 5GHZA 2G2UA 5CRFA 4HBTA 4JXWA 2ZQ9A 4EXOA 3ZVWA 4Y2FA 2HP9A 2DMWA 3UMEA 3HREA 4ZDXA 4MN6A 2G7UA 2O0YA 3A3JA 3QP5A 3BLSA 3LFVA 3Q81A 3NECA 5KZHA 3GQZA 1VB6A 1ES3A 1OMEA 3ICYA 1FR1A 4CLCA 2VV8A 3UE6A 3E2LA 1O7EA 4GNUA 4XT2B 2ZQ8A 5AVFA 4LLOB 4U3TA 4X68A 4JKTA 3M6BA 3S7PA 3R7WB 3T12B 1MPLA 3B33A 4BBTA 1K54A 2WADA 2ZC6B 5M1AA 5A93A 4GN2A 1GCEA 3ZQ5A 5DKKA 4S2NC 4HQAA 1HLUP 3EOIA 2PBDP 2QPNA 3W4OA 3MXQA 4B9OA 3FV7A 5IT5A 3PAGA 4QY6A 1VM1A 1VEUB 2EXAA 3RXWA 1VETB 5I94A 5EV0A 2WKQA 1XP4A 4P6ZM 2VGJA 1RGZA 2WGIA 3N8LA 1DRMA 2ZQDA 3BY8A 3PAEA 1LT0A 4P85A 4CLCE 4IVKA 4IEDA 1JVJA 3O86A 5A90A 4EU0A 2HF6A 1M40A 5G18A 2A24B 1XXMA 5HFOA 1IOUA 4LGWA 4X1MA 5TR7A 3W4QA 4AFIA 2J3TC 3A3FA 3P98A 5A92A 4X25A 5U47A 4FD8A 4UA7A 4C3QA 4XUXA 1LLBA 2EX2A 1T1AA 5L07A 3OPPA 4RQ9A 5HARA 5D3OA 3LIEA 3RXXA 5A91A 4MBHA 3IX3A 4JXSA 3MR0A 1RCJA 2J9OA 1KDSA 3PBQA 3HLWA 5F1GA 3M2JA 4K0WA 3IXDA 1LL5A 1JWVA 3LY3A 4WUJA 4WBGA 4H6JB 3FKVA 3UE3A 5DF7A 1CJFA 4YOFA 3VV4A 3E0YA 2P08A 1N9OA 1P9RA 1YQSA 2Y79A 1KE0A 3U4LP 1OTBA 1AXBA 2Y2KA 3T4SA 3ZNYA 3HLGA 2HPBA 3HUOA 3O88A 3W2ZA 3EEAA 5EM1A 2PYPA 4DF6A 1YLTA 1VHMA 1GA0A 1ONGA 3VP4A 2PU4A 3T1SA 2XFSA 2ZLYA 3IF6A 3PBSA 1T1BA 3PBRA 1KE3A 1LSXA 5HDSA 3HLEA 1ES2A 5CEBA 2QWSA 3C4PA 3NCKA 1K6RA 2VJWA 3ZG8B 5F6AA 3HL9A 4Y13A 1SCWA 1PW8A 4X53A 3QNCA 3ITAA 3OZHA 4L0LA 1ZTUA 4HBUA 4ZJ3A 3IWQA 2E8JA 2FH5A 3HLBA 5DF9A 4CLCC 1J9MA 1XX2A 3LR5A 1ZKJA 1K0KA 1IYQA 5TJJA 4ZJ2A 3CITA 4Y5FA 5EVLA 4II7A 1N9LA 1K54C 2GDNA 5CX7A 4LV1A 2VV6A 2PR5A 1BZAA 3F1NA 3MFXA 4KUOA 1ZC2A 1BLSA 2ZC4B 3DTIA 1W63Q 3PR6A 2G2WA 2Q9MA 5FA7A 2PU2A 3WS2A 4KQOA 4MEZA 2Q0OA 4GD6A 1TS6A 5DFYA 3WS1A 4HEFA 1ZG4A 4R3BA 1K57A 1ESIA 2Y2GA 3DBAA 4BJPA 2LB9A 4WELA 1YLZA 4CPKA 4HIAA 2JKGA 4WZ5A 2GJ3A 3M6HA 3PBNA 4N92A 3KX0X 4Z1WA 3V3SA 5KSCA 1W79A 1YLYA 2RCXA 4MMNA 5FSRA 3KSFA 1NZOA 2YKFA 4R1GA 5HPIA 2X02A 1FSYA 1GSWA 4I5SA 4OVDA 2BTFP 3D72A 3WS5A 1L3LA 1MKMA 2XA7S 3HBRA 2ZM8A 1PFLA 3DWKA 4OH0A 3ZHHA 2GNXA 4JXGA 2VGLM 1OPXA 1F2KA 3TJZC 4KZ8A 1ESUA 1V9ZA 5CHJA 1WYBA 2WGWB 1OJ5A 1NXYA 2WYXA 2XEPA 4X69A 3BQAA 5DFXA 2W3DA 3MZFA 2WKEA 5CHMA 5EECA 2QYBA 4GDNA 1SDEA 4DDSA 5HPFA 3IX4A 5G4YA 4N1HA 1F5MA 2KLIA 2ZC5B 2Y2OA 5EVID 4R23A 1LSWA 3IXGA 3PHYA 3IF6C 1K4FA 4BD1A 3Q1FA 1UWPX 3IS2B 5JYOA 3N8SA 4N9KA 5J8XA 3C5AA 4D60A 2VZWA 3MFDA 4OQGA 4KQDA 3N7WA 1Y4OA 3JVVA 1QMEA 5AQ9A 5CECA 2XQZA 3MXSA 1RGYA 2ZM0A 3OOVA 3IQAA 2Y2NA 3CI6A 1FCMA 3CUEA 2EWWA 2ACGA 3PBTA 4OLGA 4DMZA 1FR6A 3GVBA 3KYQA 3BRMA 3CPTA 2EFUA 1S6RA 1DY6A 3EEHA 1ODVA 1IYOA 4OOLA 4GS9B 1OJGA 1HTZA 2XH9A 3LR0A 2CMNA 2PRFA 3Q7ZA 3N6IA 1NZUA 3C8CA 2O99A 2I9VA 4BBVA 2R9XA 1BUEA 1S0WA 4OKPA 3H82A 3I7JA 5EFWA 4P6ZS 3VOYA 3F1OB 2EWVA 5F5YA 1MBLA 1N4OA 2W1TA 2VLGA 4FUWA 4A5RA 3G30A 3S7NA 4WZ5C 1H3QA 4JLFA 4GB7A 4S2KA 4JPMA 2HZ5A 3Q7VB 3MF0A 3IBJA 1RP5A 1MWRA 3UMDA 1IEMA 3MQQA 3A0VA 2ZOIA 1O07A 5KMWA 4NXFA 3ZNTA 2HDSA 1I2WA 4PM6A 3S1YA 3NBLA 2JHEA 5HL6A 1UWNX 2A49A 1XJ2A 1BULA 3T1QB 2JKTI 1X0OA 3BYDA 3VFFA 1GSVA 2O9CA 1OT6A 2BLSA 3TRCA 1ERQA 5J3WA 3FKWA 1EI5A 4K91A 2C5WB 5TBMB 4Z9QA 2ZOHA 3LR4A 4PKYA 4KG6A 3NY4A 2HGVA 4PAUA 3BFDA 3BQ8A 4QHCA 4JF6A 5CTMA 1EWZA 4Y0UA 4EESA 4FH4A 2VV7A 1XKZA 2W3HA 1ONHA 5HD3A 1S4SA 2D01A 4H8RA 4ETZA 3QP1A 2HDUA 4O7DA 2EX6A 1W8YA 5CERA 3C38A 3KO6A 5EVIA 2P04A 1SHVA 4P6BA 4M4XA 1NWZA 2Y2QA 4E3NA 4R70A 4OQ0A 1HZOA 1YM1A 5E2GA 1GHMA 2EXBA 1PRQA 3UB6A 4S2LA 3ULFA 4HOIA 2V1ZA 4ZAMA 1V9YA 3G31A 3CUEC 3DTMA 1TS7A 5E43A 2ZBBA 3QNBA 1M6KA 4KZAA 2J3WA 4DE0A 3CHWP 2Y2LA 4GHIA 1BTLA 2UWXA 4UQIM 3UPNA 4LV0A 3T1RA 3UNWA 4DE3A 2DCFA 3SS5A 3EGDC 4ARZB 4NEED 4R4RA 2JKRI 3SS4A 5L8MA 1TS8A 2DNSA 4K0XA 5E2EA 4LCLA 4HESA 5FI7A 1PWGA 2XRNA 4C75A 3T1XA 4F3LB 3OBFA 1EW0A 1S1ZA 2Z2LB 3E2KA 3QP2A 2OSUA 1G68A 3ZYTA 4DDYA 4Y3IA 4KZ6A 3UE0A 3QP4A 2DRWA 1L0GA 2P9VB 4X6TA 3ISGA 2H5SA 4B4XA 4OQIA 4KQRA 4NKPA 4S2PA 1PWCA 3EWKA 4L9EA 4ETXA 3MQ0A 5AJGA 3MQOA 3FPVA 4GD8A 3IF6B 3C4OA 4WMCD 2JE5A 4UHUA 2V2FF 2W3GA 3WWXA 4D2OA 3BY9A 3ZFZA 5HW3A 3VOZA 4EEPA 1KGEA 3OC2A 4MN7A 1MZUA 2HP5A 4DE1A 1YPRA 2ZM2A 3UB9A 1LI0A 2Y91A 5FI6A 1NJ4A 2HJ9C 4ZBEA 4O01A 5AQAA 4EQ1A 2VGLS 2V8FA 2HP6A 1N9BA 2XLNA 3IWOA 4KENB 1HVBA 1MY8A 4L9GA 2EX9A 3AGEA 1LL9A 4IUKA 1VETA 2Y59A 4X55A 4KQQA 1TEMA 4E04A 3L9KA 3HUMA 3UN7A 4HJ4A 3S4XA 1Z6FA 2VX8A 3NI9A 4LRXC 2HJEA 5TGFA 2H10A 3A0RA 3T4QA 2V9AA 3SS3A 4MBFA 4IBRA 4QWOA 1DP8A 2V1BA 4WM9A 3F1NB 1MC0A 1KE4A 5FL3A 4KG5A 1SKOA 2A24A 3OCLA 3K2NA 3UY6A 3HLDA 1YLWA 1CF0A 3VOLA 1L0FA 5EVIC 4IVIA 1C3BA 4DN0A 3NDGA 1W8QA 1LHYA 5HDDA 2VK3A 4QPRA 2OLUA 5FEGA 2V8CA 3IH9A 3FPWA 4Y7PA 2ZMAA 1XFNA 2QZ6A 4G3KA 4ZRRA 1MWUA 3DW0A 5FAQA 4QY5A 2YKHA 3V5MA 4OPZA 3E4PA 1G28A 1PNEA 4HH2A 1MWTA 4K08A 2J80A 3BM6A 3A3IA 4H6JA 2Z6CA 3LR3A 5EPHA 2UV0E 2H0TA 1CQAA 4UEYA 3MBZA 4B93A 3KSIA 4XXRA 3FWLA 2B5RA 3Q07A 4OPYA 1GSXA 4RA7A 5F1FA 5DJUA 5C5KA 4HHDA 4OPQA 4RX2A 3ITBA 2GX5A 3HJIA 4R38A 4I39A 3IH8A 5EOOA 2W3FA 3ZCZA 2IWDA 5KIZA 3MJQA 4NETA 4NXEA 3LYXA 1GHIA 3ZVTA 3PXPA 3UB8A 4YWZA 3UDFA 1E25A 2OWHA 2Z6DA 3VFHA 1Q2PA 2K7SA 1STZA 5HD5A 1JTGA 3P7NA 1XGIA 3CJMA 1OTAA 1I2SA 3LEZA 4B4ZA 2C6WB 3SZTA 3FG8A 3ZG7B 2XROA 4HNBA 1K56D 2Y55A 5KSHA 2J3TD 3IXBA 2R78A 2L1MA 1CEFA 5M19A 2XD5A 3DTKA 1D7EA 4EUVA 4QB8A 2WKPA 3TG9A 4PHTA 4I3IA 4EV4A 3NOTC 3KYEA 2HDRA 2OAQ1 1D06A 1NRFA 1H5XA 5HDCA 2WZZA 3IHAA 3QHYA 3EQVA 4U0XA 3UO9A 1BT5A 5FQJA 4JGRA 4HY8A 3P01A 1MXOA 4CJNA 2ZQAA 1G6OA 3CPTB 4M3KA 2B95A 5CGXA 3BLMA 1ACFA 3WRZA 2XDMA 4EUZA 3SOIA 3BECA 2XF3A 3F1PA 4WLAA 4WF0A 1YAXA 5J7EA 4LRZE 4JGQA 1XGJA 3NOUC 3V50A 3B47A 3RTYA 1NLZA 3LICA 3TW8A 3JPUA 1YT4A 4R3JA 2WKHA 3SW1A 1CK3A 3C7UA 4DJ3A 4DXCA 4NK3A 2M1CA 2XSSA 3NJAA 3DAVA 3BEBA 4KZ9A 2WGVA 1XA1A 1K38A 4E3OA 2W1TB 1FCOA 2PR6A 3OPHA 4QJGA 3UB7A 1FOFA 3CG5A 4E6XA 4C6YA 3ZG9B 3UE1A 1YKDA 5DVAA 1U60A 2ZQCA 1JWZA 2MJ6A 2P74A 3LI9A 3O3VA 5G4ZA 2WUQA 4HP4A 3BFEA 2W27A 2WGWA 5MC7A 2O9BA 3D9YA 4UQIS 3VP0A 1WE4A 3OPRA 2PD8A 4IBXA 1T19A 5FI2A 3IT9A 4I3AA 5HAPA 3QP8A 1FILA 4EBLA 2FFFB 5M18A 3V3RA 1IKGA 2OV5A 3A0SA 2M7VA 3H9WA 3MKEA 3RJUA 4NXBA 4Y0OA 3GRJA 1F98A 5GHYA 4BENA 2K31A 4KZBA 3C2WA 5HZHA 4GZBA 3NIAA 5FEFA 2BG1A 1VQQA 1Z09A 4O0PA 3VP1A 4BLMA 4MDZA 5LBRA 4UAAA 3MS6A 2WKIA 1TD5A 4DXBA 4CQHA 2OWJA 3G2ZA 1K56A 2EA9A 3T4KA 3ZG0A 1E4DA 4E3KA 4Q8IA 4OP8A 4WL9A 4G3WA 2FFYA 4PM8A 4E3JA 3SH8A 3LEQA 1IELA 3NHQA 1K6SA 1NLYA 3H7WA 3QP6A 1IFQA 2R9WA 4CLCB 4Y17A 2JCHA 1XA7A 2NUTC 4WYYA 3DTEA 5DTKA 3WRTA 4EBPA 1LL8A 3R4KA 5DTTA 4MCWA 3E98A 1DJCA 4GHIB 3U2AA 4JGPA 1P9WA 3LIDA 3AGFA 4R3AA 3E4QA 5FDHA 4WEJA 3F1OA 1XJ3A 2ZC3B 1P97A 4ID4A 4P87A 3LUQA 5FDSA 1E3UD 1DJBA 5FAPA 3GECA 5CTNA 3IX8A 4Q0HA 2JN7A 5GLCA 3AGDA 3N4IA 5E2FA 3NULA 1NY0A 3Q7VA 1UGUA 4LRYC 4IJGA 5A8BA 3OLOA 3TE8A 3A3EA 2ZMVA 4GLQA 1CI9A 1G6AA 1LSVA 4DRTA 2J9PA 4UA9A 3WS4A 2V20A 5FQIA 3UPPA 3FYZA 3S7QA 3LI8A 2W3EA 3VSLA 1DP9A 1Y28A 5HWVA 1G5UA 4MN5A 3HLCA 3JYIA 1Y54A 5DKLA 5GHXA 5TBMA 3O87A 2Y2JA 4U0TA 2J7VA 2ZL1A 3VP3A 4OP5A 1H8MA 2K2NA 4EQIA 4HJ3A 1PI4A 3HCYA 4KZ7A 3KSHA 1PIOA 4O8GA 2O9AA 5CXWA 2JBFA 4FCFA 4P0MA 5CGWA 4BBUA 1L0DA 1T18A 3SH9A 2QMIA 4E3IA 3D3OA 2L0WA 3HJKA 5DTSA 1H8ZA 3S7OA 4EWFA 4G3VA 5GLDA 2WZXA 3T4LA 3HVFA 1KOUA 5GLBA 1FQGA 3G4PA 2PDRA 1TVFA 3C30A 1I5QA 4S2OA 3TSGA 4WEKA 2LB5A 3P09A 4XT2A 4R6LA 4KZ5A 1SKOB 1W63M 4EBNA 3O5YA 1JWPA 3R7WA 2ZQ7A 2WAFA 3GDIA 1MWSA 5EE8A 2Z2MB 3IBRA 5L09A 2V1AA 4I38A 5HAIA 4NG2A 5IS1A 3KSGA 1NYYA 4R4SA 2VKSA 4ARZA 5F68A 3W8KA 3VMAA 4PPRA 4RVAA 4Q0JA 2W0NA 3UB5P 4BWIA 3LIAA 3K3CA 1VEUA 2Y2MA 5K5BA 1N9NA 5F83A 3V39A 3G34A 5FQ9A 2PAVP 1S1YA 3B42A 4QU3A 1FCNA 2XFTA 4LENA 4F3LA 4HI4A 4BMWA 1CI8A 3K3DA 2PD7A 2H28A 3UPOA 3PTEA 2ZMFA 4X1LA 1OT9A 1IYSA 2P9VA 4IHQA 3BFFA 1WYCA 5CHUA 2JKFA 2ZC7A 1E3UA 3OCNA 1SZVA 5FATA 5EVEA 2L4RA 2H0YA 3V67A 2KOIA 1DP6A 4WZ4A 4PKYG 4PM5A 4UA6A 1FSWA 5EM0A 4ME4A 3RH8B 1KGFA 3MMHA 2B02A 2KDKA 3VE3A 1OTIA 3GR2A 1XJ6A 1K55A 2P7JA 1NYMA 4DJ2A 2EX8A 5GLAA 1YLJA 5I5LA 3GV9A 3MSHA 2FZ0A 4LCMA 1YSQA 1BLPA 3B3XA 2QHKA 3MXRA 2HV1A 1KVLA 3HUNA 1BLCA 4ZJ1A 3CZDA 1ALQA 1EROA 2RL3A 4KZ4A 4FTXA 1IYPA 4WN5A 3CWFA 2Y4AA 3VP2A 4LPZA 5EOEA 3T4TA 4Y0TA 2B18A 1K4EA 3CAXA 2AVXA 4JGOA 5FQKA 1YMXA 1ES4A 4FSFA 5EUAA 4IUHA 2CC1A 4OOMA 5BOHA 1JTDA 3VE4A 1P0ZA 1XPBA 4KUKA 4PM9A 4Y15A 4BD0A 1AWIA 2OAP1 5TFQA 5CEDA 1ZHHB 2WKRA 3BJNA 4E3LA 3D4FA 3LCEA 3N8RA 1OTDA 1F9IA 4GW9A 1L2SA 2IWCA 1ERMA 2Y8HA 1YLPA 3CMZA 5FAOA 5L10A 1PWDA 3F1PB 2QKPA 1GA9A 5IHVA 2EFXA 4F94A 2WAEA 2IA2A 3GMWA 3RFBA 3UDXA 5HL1A 1J3WA 4E6WA 4PMAA 1ES5A 4GJ4A 4EETB 4HP9A 4BL2A 3EGXC 4WMCA 2NUPC 1PYYA 5IU1A 4JBFA 4S2IA 3MZDA 1BLHA 5HAQA 4E3MA 1YMSA 5L2FA 4BL3A 1S67L 5GL9A 3GTCA 3BFCA 4X56A 4LV3A 2XR0A 4GDBA 1W5DA 1TF1A 2INWA 2PYRA 3G6OA 3NDEA 3M2KA 3C7VA 4EEUA 5F69A 2A2LA 4NXGA 2OOLA 2HDQA 1K25A 4R0QA 1XJ4A 2Q9NA 5FQQA 4EW7A 3OPLA 3L7HA 4S2JA 3T50A 2XGNA 2IWBA 1ZG6A 5HSQA 4OLDA 5FASA 3LIBA 4JF5A 3IHBA 3BW6A 2VGKA 3T4JA 2OLVA 5DF8A 1PZPA 4HH3A 3PBOA 2ZD8A 5AQBA 4KZ3A 1WA9A 2XK1A 4XUZA 3H82B 1BYWA 1PW1A 1QMFA 5AVEA 1TS0A 4FH2A 4BQMA 2X01A 3ZG5A 3NC8A 3S22A 1KDWA 3ZGAB 1YSPA 3Q82A 4N9LA 2ZJ9A 4EERA 1K55C 3BWLA 4CLCD 1JNUA 3DWZA 3UDIA 5HWTA 4ESPA 1W7FA 4GOGA 5E2HA 3G2YA 4DE2A 2A3UA 2V0WA 1DJAA 4KG2A 4GCZA 5CGSA 2D02A 3G35A 2KX6A 1S66L 4PM7A 2Y2IA 2I72A 3LIFA 4OONA 2X71A 2QJ7A 2JKTM 1LI9A 4LV2A 4RYEA 2E8IA 4B88A 2XD1A 2V0UA 4S2NA 1A0KA 1T1CA 4OPRA 4JXVA 3IXHA 3H7WB 3G32A 2Y2HA 3FC7A 2PT7A 4MLLA 1D1JA 1MKIA 4YFMA 3FZCA 5HX9A 3IS2A 3TOIA 1NRJA 3BFGA 3W4PA 3NOPC 1PZOA 4JF4A 3GSGA 4HJ6A 1TDGA 4RX3A 1CEGA 1K57C 3KYZA 3LGOA 3LO7A 3ZDJA 3A3DA 1OTEA 1GHPA 1SKFA 4I3JA 3HLFA 1TDLA 5FQMA 1XFQA 3JVUA 3MZEA 5EVIB 1SDNA 2BASA 3PYPA 1L0EA
chains in the Genus database with same CATH topology
2W3DA 4G3KA 2PHYA 2QYBA 4ZRRA 2YKHA 3D3OA 4Q0IA 5HPFA 2L0WA 3E4PA 3EQUA 1G28A 5G4YA 3HJKA 1S4RA 3S7OA 4HH2A 4K08A 2J80A 1F5MA 3E4OA 2KLIA 2XA7M 4GS9A 5HWWA 4G3VA 4H6JA 2Z6CA 3LR3A 1LSWA 3PHYA 3T4LA 1UWPX 3IS2B 1KOUA 2QJ5A 4UEYA 4B93A 2GZAA 3KSIA 2VZWA 3CLOA 2PDRA 3C30A 4KQDA 1GSXA 4FOFA 3JVVA 4WEKA 2M7UA 2LB5A 4L9FA 4XT2A 4R6LA 5DJUA 5C5KA 4HHDA 1W63M 3O5YA 2VA0A 3OOVA 3R7WA 2GX5A 2JKRM 3HJIA 4R38A 4I39A 3CI6A 3CUEA 2W3FA 5KIZA 3T4OA 3GDIA 2VEAA 3MJQA 2EWWA 3IBRA 4NXEA 5DJTA 3PBTA 3LYXA 5J4EA 2V1AA 3PXPA 4YNRA 4DMZA 4I38A 2W1RA 3UB8A 4YWZA 5IS1A 3KSGA 2VKSA 4ARZA 5F68A 3KYQA 2OWHA 2Z6DA 4Q0JA 2W0NA 3EEHA 4BWIA 3LIAA 2K7SA 1STZA 3K3CA 5HD5A 4EXOA 5K5BA 1N9NA 3P7NA 4Y2FA 2DMWA 1OTAA 3UMEA 1ODVA 3FG8A 4OOLA 1S1YA 3B42A 4MN6A 4GS9B 2XROA 2G7UA 2O0YA 4HNBA 1OJGA 5KSHA 2J3TD 2R78A 2L1MA 3LFVA 4F3LA 3LR0A 4HI4A 1VB6A 2CMNA 4BMWA 3K3DA 2PD7A 2H28A 1D7EA 3C8CA 4EUVA 2O99A 2WKPA 3ICYA 2I9VA 4BBVA 4PHTA 4I3IA 4CLCA 2VV8A 3UE6A 3NOTC 2ZMFA 1OT9A 3H82A 5EFWA 2OAQ1 4P6ZS 1D06A 4IHQA 4XT2B 5HDCA 5AVFA 4LLOB 3S7PA 3F1OB 3OCNA 3R7WB 2EWVA 5F5YA 2L4RA 3B33A 4BBTA 3V67A 2KOIA 2W1TA 1DP6A 2VLGA 4PKYG 3EQVA 4ME4A 3RH8B 3S7NA 3MMHA 1H3QA 4JGRA 4HY8A 2B02A 3P01A 2KDKA 3VE3A 3ZQ5A 1OTIA 5DKKA 4HQAA 3EOIA 1G6OA 1XJ6A 3MF0A 2P7JA 3IBJA 3MXQA 3UMDA 4B9OA 4DJ2A 5IT5A 3MQQA 5I5LA 3A0VA 2ZOIA 2FZ0A 3F1PA 4WLAA 4WF0A 1YSQA 1YAXA 5J7EA 4LRZE 2QHKA 4JGQA 4NXFA 3NOUC 2HV1A 3B47A 2WKQA 3RTYA 1NLZA 3LICA 4P6ZM 3TW8A 2JHEA 1DRMA 4WN5A 3CWFA 5HL6A 4LPZA 1UWNX 3BY8A 3T4TA 3SW1A 2B18A 1XJ2A 1LT0A 3CAXA 4JGOA 2JKTI 1X0OA 4CLCE 1GSVA 2O9CA 1OT6A 4FSFA 3TRCA 4DJ3A 2M1CA 4IUHA 5J3WA 2XSSA 4EU0A 2HF6A 4OOMA 3NJAA 3VE4A 1P0ZA 4KUKA 2A24B 1IOUA 5TBMB 2ZOHA 3LR4A 4AFIA 2OAP1 2J3TC 4PKYA 2W1TB 2PR6A 2HGVA 4PAUA 1ZHHB 3BQ8A 2WKRA 3UB7A 3BJNA 1OTDA 1F9IA 1YKDA 4GW9A 4EESA 1T1AA 2VV7A 2Y8HA 4RQ9A 2MJ6A 2W3HA 3LIEA 3LI9A 5HD3A 1S4SA 2D01A 5G4ZA 4ETZA 3MR0A 4HP4A 2W27A 5MC7A 3F1PB 2QKPA 2O9BA 3C38A 3KO6A 3PBQA 4UQIS 2P04A 4WUJA 2IA2A 4M4XA 4H6JB 1NWZA 3RFBA 3UE3A 2PD8A 1T19A 4GJ4A 3VV4A 4YOFA 3E0YA 4R70A 2P08A 1N9OA 1P9RA 4I3AA 4HP9A 4EETB 2Y79A 1OTBA 3EGXC 2NUPC 3T4SA 3UB6A 3ULFA 4HOIA 5IU1A 3W2ZA 3EEAA 2PYPA 1V9YA 3CUEC 3A0SA 1VHMA 2M7VA 1TS7A 2ZBBA 3H9WA 2J3WA 4NXBA 1S67L 4GHIA 3PBSA 1F98A 1T1BA 3PBRA 2K31A 1TF1A 3C2WA 5HZHA 2INWA 1LSXA 2PYRA 3G6OA 5HDSA 4UQIM 4EEUA 5F69A 2A2LA 4NXGA 4O0PA 3EGDC 2OOLA 4MDZA 2QWSA 4ARZB 4NEED 5LBRA 1XJ4A 2VJWA 5F6AA 4EW7A 2JKRI 1TD5A 4CQHA 2OWJA 5L8MA 3T50A 1TS8A 4L0LA 5HSQA 2EA9A 3T4KA 1ZTUA 2XRNA 3LIBA 3BW6A 2FH5A 4G3WA 4WL9A 5DF9A 4CLCC 4F3LB 3T4JA 3OBFA 1EW0A 4HH3A 3PBOA 3LR5A 3NHQA 1S1ZA 1NLYA 3H7WA 5TJJA 1IFQA 3CITA 4Y5FA 4CLCB 3ZYTA 1WA9A 4Y3IA 2NUTC 3H82B 1BYWA 4II7A 5AVEA 1N9LA 1TS0A 1LL8A 4NKPA 3R4KA 5CX7A 2VV6A 3EWKA 2PR5A 3F1NA 3MFXA 3MQ0A 4KUOA 4L9EA 4ETXA 5AJGA 3MQOA 3FPVA 4MCWA 1YSPA 3E98A 4GHIB 3U2AA 4EERA 4JGPA 3BWLA 4CLCD 1P9WA 1JNUA 3LIDA 1W63Q 3PR6A 4R3AA 5HWTA 3E4QA 4WEJA 2W3GA 3BY9A 3F1OA 1XJ3A 1P97A 4KQOA 3LUQA 4EEPA 1TS6A 5DFYA 3GECA 2V0WA 3OC2A 4MN7A 4GCZA 1MZUA 2D02A 4Q0HA 2KX6A 1S66L 3DBAA 3UB9A 4BJPA 3LIFA 2LB9A 2JN7A 4WELA 2HJ9C 4O01A 2QJ7A 4HIAA 1UGUA 4EQ1A 4LRYC 4IJGA 2VGLS 2JKTM 2GJ3A 5A8BA 3OLOA 3TE8A 2ZMVA 4GLQA 3PBNA 2V0UA 3KX0X 4L9GA 4Z1WA 1T1CA 1LSVA 4IUKA 3H7WB 4MMNA 3FC7A 2PT7A 3KSFA 4E04A 4HJ4A 2YKFA 2VX8A 4LRXC 2HJEA 3IS2A 5HPIA 3A0RA 3T4QA 2V9AA 1NRJA 1GSWA 4I5SA 1DP8A 2V1BA 3F1NB 3S7QA 3LI8A 3D72A 3NOPC 2W3EA 1DP9A 1MKMA 2XA7S 1MC0A 4HJ6A 5FL3A 1Y28A 5HWVA 2A24A 3OCLA 3K2NA 2GNXA 4MN5A 2VGLM 5TBMA 5DKLA 1OPXA 3KYZA 3TJZC 3VOLA 1H8MA 1OTEA 2K2NA 4HJ3A 3HCYA 1V9ZA 3KSHA 4DN0A 4I3JA 4O8GA 1XFQA 1OJ5A 2O9AA 3JVUA 5HDDA 4QPRA 3BQAA 5DFXA 2BASA 3FPWA 3PYPA 4BBUA 1XFNA 1T18A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PHY A;  2YKH A;  2L0W A;  3E4P A;  1G28 A;  5G4Y A;  3HJK A;  1S4R A;  4HH2 A;  4K08 A;  2J80 A;  3E4O A;  4GS9 A;  5HWW A;  4H6J A;  2Z6C A;  1LSW A;  3PHY A;  1UWP X;  3IS2 B;  1KOU A;  2QJ5 A;  3CLO A;  2PDR A;  4KQD A;  1GSX A;  4L9F A;  4XT2 A;  4R6L A;  5DJU A;  4HHD A;  3HJI A;  4R38 A;  4I39 A;  5KIZ A;  3GDI A;  2VEA A;  3MJQ A;  3IBR A;  4NXE A;  5DJT A;  3LYX A;  5J4E A;  2V1A A;  4I38 A;  3UB8 A;  4YWZ A;  5IS1 A;  5F68 A;  2OWH A;  2Z6D A;  2W0N A;  3EEH A;  3LIA A;  2K7S A;  3K3C A;  5HD5 A;  4EXO A;  1N9N A;  3P7N A;  1OTA A;  3UME A;  1ODV A;  3FG8 A;  1S1Y A;  4MN6 A;  4GS9 B;  4HNB A;  1OJG A;  2R78 A;  2L1M A;  4F3L A;  4HI4 A;  1VB6 A;  2CMN A;  3K3D A;  2PD7 A;  2H28 A;  1D7E A;  3C8C A;  2WKP A;  3ICY A;  2I9V A;  4BBV A;  4I3I A;  2VV8 A;  3UE6 A;  3NOT C;  1OT9 A;  3H82 A;  5EFW A;  1D06 A;  4XT2 B;  5HDC A;  5AVF A;  4LLO B;  3F1O B;  5F5Y A;  2L4R A;  3B33 A;  4BBT A;  1DP6 A;  2VLG A;  4PKY G;  3RH8 B;  4JGR A;  4HY8 A;  2B02 A;  2KDK A;  3VE3 A;  3ZQ5 A;  1OTI A;  5DKK A;  4HQA A;  1XJ6 A;  2P7J A;  3MXQ A;  3UMD A;  4B9O A;  4DJ2 A;  3MQQ A;  5I5L A;  3A0V A;  2ZOI A;  3F1P A;  4WLA A;  4WF0 A;  5J7E A;  4LRZ E;  2QHK A;  4JGQ A;  4NXF A;  3NOU C;  2HV1 A;  2WKQ A;  3RTY A;  3LIC A;  2JHE A;  1DRM A;  4WN5 A;  3CWF A;  4LPZ A;  1UWN X;  3BY8 A;  3SW1 A;  1XJ2 A;  1LT0 A;  3CAX A;  4JGO A;  1X0O A;  1GSV A;  1OT6 A;  4DJ3 A;  2M1C A;  5J3W A;  3NJA A;  3VE4 A;  1P0Z A;  4KUK A;  2A24 B;  5TBM B;  2ZOH A;  4PKY A;  2PR6 A;  2WKR A;  3UB7 A;  1OTD A;  1F9I A;  4GW9 A;  4EES A;  1T1A A;  2VV7 A;  4RQ9 A;  3LIE A;  3LI9 A;  5HD3 A;  1S4S A;  2D01 A;  5G4Z A;  3MR0 A;  4HP4 A;  2W27 A;  3F1P B;  2QKP A;  4WUJ A;  4M4X A;  4H6J B;  1NWZ A;  2PD8 A;  1T19 A;  4R70 A;  1N9O A;  4I3A A;  4HP9 A;  4EET B;  1OTB A;  3UB6 A;  3ULF A;  4HOI A;  5IU1 A;  2PYP A;  1V9Y A;  3A0S A;  1TS7 A;  2ZBB A;  3H9W A;  4NXB A;  1S67 L;  4GHI A;  1F98 A;  1T1B A;  3C2W A;  5HZH A;  2INW A;  1LSX A;  2PYR A;  3G6O A;  5HDS A;  4EEU A;  5F69 A;  4NXG A;  2OOL A;  2QWS A;  1XJ4 A;  5F6A A;  4EW7 A;  2OWJ A;  3T50 A;  1TS8 A;  5HSQ A;  2EA9 A;  3LIB A;  4WL9 A;  4F3L B;  1EW0 A;  4HH3 A;  3NHQ A;  1S1Z A;  3H7W A;  1WA9 A;  3H82 B;  1BYW A;  5AVE A;  1N9L A;  1TS0 A;  1LL8 A;  2VV6 A;  3EWK A;  2PR5 A;  3F1N A;  3MFX A;  4KUO A;  4L9E A;  3MQO A;  4GHI B;  4EER A;  4JGP A;  3BWL A;  3LID A;  1JNU A;  4R3A A;  5HWT A;  3E4Q A;  3BY9 A;  3F1O A;  1XJ3 A;  1P97 A;  3LUQ A;  4EEP A;  1TS6 A;  3GEC A;  2V0W A;  4GCZ A;  1MZU A;  2D02 A;  2KX6 A;  1S66 L;  3UB9 A;  3LIF A;  2JN7 A;  2QJ7 A;  4HIA A;  1UGU A;  4EQ1 A;  4LRY C;  2GJ3 A;  5A8B A;  3OLO A;  2V0U A;  3KX0 X;  4L9G A;  1T1C A;  1LSV A;  3H7W B;  3FC7 A;  4E04 A;  4HJ4 A;  2YKF A;  4LRX C;  3IS2 A;  3A0R A;  2V9A A;  1GSW A;  4I5S A;  1DP8 A;  2V1B A;  3F1N B;  3LI8 A;  3D72 A;  3NOP C;  1DP9 A;  4HJ6 A;  1Y28 A;  5HWV A;  2A24 A;  4MN5 A;  5TBM A;  5DKL A;  3VOL A;  1OTE A;  4HJ3 A;  1V9Z A;  4I3J A;  1XFQ A;  1OJ5 A;  5HDD A;  2BAS A;  3PYP A;  4BBU A;  1XFN A;  1T18 A; 
#chains in the Genus database with same CATH topology
 3WS0 A;  5AQ7 A;  2PHY A;  4N1X A;  1Q2Q A;  3VSK A;  5JYP A;  5F82 A;  3LY4 A;  4Q0I A;  3EQU A;  1S4R A;  3E4O A;  2XA7 M;  1PI5 A;  4GS9 A;  5HWW A;  3IF5 A;  1FIK A;  4GKU A;  4OOY A;  1H8Y A;  1BSG A;  2QJ5 A;  2GZA A;  3SH7 A;  3MKF A;  3CLO A;  4DKI A;  2WK0 A;  4FOF A;  4LFU A;  4ZTK A;  2M7U A;  2PBY A;  4L9F A;  1KGG A;  2Y2P A;  2VA0 A;  4MNR A;  1H0M A;  2JKR M;  1HD8 A;  2JC7 A;  4QD4 A;  2J8Y A;  4S2M A;  4YIN A;  2ZL1 B;  3T4O A;  2VEA A;  3IWI A;  4MBK A;  4OQH A;  5DJT A;  5J4E A;  1IKI A;  1KVM A;  4YNR A;  2W1R A;  5GHZ A;  2G2U A;  5CRF A;  4HBT A;  4JXW A;  2ZQ9 A;  4EXO A;  3ZVW A;  4Y2F A;  2HP9 A;  2DMW A;  3UME A;  3HRE A;  4ZDX A;  4MN6 A;  2G7U A;  2O0Y A;  3A3J A;  3QP5 A;  3BLS A;  3LFV A;  3Q81 A;  3NEC A;  5KZH A;  3GQZ A;  1VB6 A;  1ES3 A;  1OME A;  3ICY A;  1FR1 A;  4CLC A;  2VV8 A;  3UE6 A;  3E2L A;  1O7E A;  4GNU A;  4XT2 B;  2ZQ8 A;  5AVF A;  4LLO B;  4U3T A;  4X68 A;  4JKT A;  3M6B A;  3S7P A;  3R7W B;  3T12 B;  1MPL A;  3B33 A;  4BBT A;  1K54 A;  2WAD A;  2ZC6 B;  5M1A A;  5A93 A;  4GN2 A;  1GCE A;  3ZQ5 A;  5DKK A;  4S2N C;  4HQA A;  1HLU P;  3EOI A;  2PBD P;  2QPN A;  3W4O A;  3MXQ A;  4B9O A;  3FV7 A;  5IT5 A;  3PAG A;  4QY6 A;  1VM1 A;  1VEU B;  2EXA A;  3RXW A;  1VET B;  5I94 A;  5EV0 A;  2WKQ A;  1XP4 A;  4P6Z M;  2VGJ A;  1RGZ A;  2WGI A;  3N8L A;  1DRM A;  2ZQD A;  3BY8 A;  3PAE A;  1LT0 A;  4P85 A;  4CLC E;  4IVK A;  4IED A;  1JVJ A;  3O86 A;  5A90 A;  4EU0 A;  2HF6 A;  1M40 A;  5G18 A;  2A24 B;  1XXM A;  5HFO A;  1IOU A;  4LGW A;  4X1M A;  5TR7 A;  3W4Q A;  4AFI A;  2J3T C;  3A3F A;  3P98 A;  5A92 A;  4X25 A;  5U47 A;  4FD8 A;  4UA7 A;  4C3Q A;  4XUX A;  1LLB A;  2EX2 A;  1T1A A;  5L07 A;  3OPP A;  4RQ9 A;  5HAR A;  5D3O A;  3LIE A;  3RXX A;  5A91 A;  4MBH A;  3IX3 A;  4JXS A;  3MR0 A;  1RCJ A;  2J9O A;  1KDS A;  3PBQ A;  3HLW A;  5F1G A;  3M2J A;  4K0W A;  3IXD A;  1LL5 A;  1JWV A;  3LY3 A;  4WUJ A;  4WBG A;  4H6J B;  3FKV A;  3UE3 A;  5DF7 A;  1CJF A;  4YOF A;  3VV4 A;  3E0Y A;  2P08 A;  1N9O A;  1P9R A;  1YQS A;  2Y79 A;  1KE0 A;  3U4L P;  1OTB A;  1AXB A;  2Y2K A;  3T4S A;  3ZNY A;  3HLG A;  2HPB A;  3HUO A;  3O88 A;  3W2Z A;  3EEA A;  5EM1 A;  2PYP A;  4DF6 A;  1YLT A;  1VHM A;  1GA0 A;  1ONG A;  3VP4 A;  2PU4 A;  3T1S A;  2XFS A;  2ZLY A;  3IF6 A;  3PBS A;  1T1B A;  3PBR A;  1KE3 A;  1LSX A;  5HDS A;  3HLE A;  1ES2 A;  5CEB A;  2QWS A;  3C4P A;  3NCK A;  1K6R A;  2VJW A;  3ZG8 B;  5F6A A;  3HL9 A;  4Y13 A;  1SCW A;  1PW8 A;  4X53 A;  3QNC A;  3ITA A;  3OZH A;  4L0L A;  1ZTU A;  4HBU A;  4ZJ3 A;  3IWQ A;  2E8J A;  2FH5 A;  3HLB A;  5DF9 A;  4CLC C;  1J9M A;  1XX2 A;  3LR5 A;  1ZKJ A;  1K0K A;  1IYQ A;  5TJJ A;  4ZJ2 A;  3CIT A;  4Y5F A;  5EVL A;  4II7 A;  1N9L A;  1K54 C;  2GDN A;  5CX7 A;  4LV1 A;  2VV6 A;  2PR5 A;  1BZA A;  3F1N A;  3MFX A;  4KUO A;  1ZC2 A;  1BLS A;  2ZC4 B;  3DTI A;  1W63 Q;  3PR6 A;  2G2W A;  2Q9M A;  5FA7 A;  2PU2 A;  3WS2 A;  4KQO A;  4MEZ A;  2Q0O A;  4GD6 A;  1TS6 A;  5DFY A;  3WS1 A;  4HEF A;  1ZG4 A;  4R3B A;  1K57 A;  1ESI A;  2Y2G A;  3DBA A;  4BJP A;  2LB9 A;  4WEL A;  1YLZ A;  4CPK A;  4HIA A;  2JKG A;  4WZ5 A;  2GJ3 A;  3M6H A;  3PBN A;  4N92 A;  3KX0 X;  4Z1W A;  3V3S A;  5KSC A;  1W79 A;  1YLY A;  2RCX A;  4MMN A;  5FSR A;  3KSF A;  1NZO A;  2YKF A;  4R1G A;  5HPI A;  2X02 A;  1FSY A;  1GSW A;  4I5S A;  4OVD A;  2BTF P;  3D72 A;  3WS5 A;  1L3L A;  1MKM A;  2XA7 S;  3HBR A;  2ZM8 A;  1PFL A;  3DWK A;  4OH0 A;  3ZHH A;  2GNX A;  4JXG A;  2VGL M;  1OPX A;  1F2K A;  3TJZ C;  4KZ8 A;  1ESU A;  1V9Z A;  5CHJ A;  1WYB A;  2WGW B;  1OJ5 A;  1NXY A;  2WYX A;  2XEP A;  4X69 A;  3BQA A;  5DFX A;  2W3D A;  3MZF A;  2WKE A;  5CHM A;  5EEC A;  2QYB A;  4GDN A;  1SDE A;  4DDS A;  5HPF A;  3IX4 A;  5G4Y A;  4N1H A;  1F5M A;  2KLI A;  2ZC5 B;  2Y2O A;  5EVI D;  4R23 A;  1LSW A;  3IXG A;  3PHY A;  3IF6 C;  1K4F A;  4BD1 A;  3Q1F A;  1UWP X;  3IS2 B;  5JYO A;  3N8S A;  4N9K A;  5J8X A;  3C5A A;  4D60 A;  2VZW A;  3MFD A;  4OQG A;  4KQD A;  3N7W A;  1Y4O A;  3JVV A;  1QME A;  5AQ9 A;  5CEC A;  2XQZ A;  3MXS A;  1RGY A;  2ZM0 A;  3OOV A;  3IQA A;  2Y2N A;  3CI6 A;  1FCM A;  3CUE A;  2EWW A;  2ACG A;  3PBT A;  4OLG A;  4DMZ A;  1FR6 A;  3GVB A;  3KYQ A;  3BRM A;  3CPT A;  2EFU A;  1S6R A;  1DY6 A;  3EEH A;  1ODV A;  1IYO A;  4OOL A;  4GS9 B;  1OJG A;  1HTZ A;  2XH9 A;  3LR0 A;  2CMN A;  2PRF A;  3Q7Z A;  3N6I A;  1NZU A;  3C8C A;  2O99 A;  2I9V A;  4BBV A;  2R9X A;  1BUE A;  1S0W A;  4OKP A;  3H82 A;  3I7J A;  5EFW A;  4P6Z S;  3VOY A;  3F1O B;  2EWV A;  5F5Y A;  1MBL A;  1N4O A;  2W1T A;  2VLG A;  4FUW A;  4A5R A;  3G30 A;  3S7N A;  4WZ5 C;  1H3Q A;  4JLF A;  4GB7 A;  4S2K A;  4JPM A;  2HZ5 A;  3Q7V B;  3MF0 A;  3IBJ A;  1RP5 A;  1MWR A;  3UMD A;  1IEM A;  3MQQ A;  3A0V A;  2ZOI A;  1O07 A;  5KMW A;  4NXF A;  3ZNT A;  2HDS A;  1I2W A;  4PM6 A;  3S1Y A;  3NBL A;  2JHE A;  5HL6 A;  1UWN X;  2A49 A;  1XJ2 A;  1BUL A;  3T1Q B;  2JKT I;  1X0O A;  3BYD A;  3VFF A;  1GSV A;  2O9C A;  1OT6 A;  2BLS A;  3TRC A;  1ERQ A;  5J3W A;  3FKW A;  1EI5 A;  4K91 A;  2C5W B;  5TBM B;  4Z9Q A;  2ZOH A;  3LR4 A;  4PKY A;  4KG6 A;  3NY4 A;  2HGV A;  4PAU A;  3BFD A;  3BQ8 A;  4QHC A;  4JF6 A;  5CTM A;  1EWZ A;  4Y0U A;  4EES A;  4FH4 A;  2VV7 A;  1XKZ A;  2W3H A;  1ONH A;  5HD3 A;  1S4S A;  2D01 A;  4H8R A;  4ETZ A;  3QP1 A;  2HDU A;  4O7D A;  2EX6 A;  1W8Y A;  5CER A;  3C38 A;  3KO6 A;  5EVI A;  2P04 A;  1SHV A;  4P6B A;  4M4X A;  1NWZ A;  2Y2Q A;  4E3N A;  4R70 A;  4OQ0 A;  1HZO A;  1YM1 A;  5E2G A;  1GHM A;  2EXB A;  1PRQ A;  3UB6 A;  4S2L A;  3ULF A;  4HOI A;  2V1Z A;  4ZAM A;  1V9Y A;  3G31 A;  3CUE C;  3DTM A;  1TS7 A;  5E43 A;  2ZBB A;  3QNB A;  1M6K A;  4KZA A;  2J3W A;  4DE0 A;  3CHW P;  2Y2L A;  4GHI A;  1BTL A;  2UWX A;  4UQI M;  3UPN A;  4LV0 A;  3T1R A;  3UNW A;  4DE3 A;  2DCF A;  3SS5 A;  3EGD C;  4ARZ B;  4NEE D;  4R4R A;  2JKR I;  3SS4 A;  5L8M A;  1TS8 A;  2DNS A;  4K0X A;  5E2E A;  4LCL A;  4HES A;  5FI7 A;  1PWG A;  2XRN A;  4C75 A;  3T1X A;  4F3L B;  3OBF A;  1EW0 A;  1S1Z A;  2Z2L B;  3E2K A;  3QP2 A;  2OSU A;  1G68 A;  3ZYT A;  4DDY A;  4Y3I A;  4KZ6 A;  3UE0 A;  3QP4 A;  2DRW A;  1L0G A;  2P9V B;  4X6T A;  3ISG A;  2H5S A;  4B4X A;  4OQI A;  4KQR A;  4NKP A;  4S2P A;  1PWC A;  3EWK A;  4L9E A;  4ETX A;  3MQ0 A;  5AJG A;  3MQO A;  3FPV A;  4GD8 A;  3IF6 B;  3C4O A;  4WMC D;  2JE5 A;  4UHU A;  2V2F F;  2W3G A;  3WWX A;  4D2O A;  3BY9 A;  3ZFZ A;  5HW3 A;  3VOZ A;  4EEP A;  1KGE A;  3OC2 A;  4MN7 A;  1MZU A;  2HP5 A;  4DE1 A;  1YPR A;  2ZM2 A;  3UB9 A;  1LI0 A;  2Y91 A;  5FI6 A;  1NJ4 A;  2HJ9 C;  4ZBE A;  4O01 A;  5AQA A;  4EQ1 A;  2VGL S;  2V8F A;  2HP6 A;  1N9B A;  2XLN A;  3IWO A;  4KEN B;  1HVB A;  1MY8 A;  4L9G A;  2EX9 A;  3AGE A;  1LL9 A;  4IUK A;  1VET A;  2Y59 A;  4X55 A;  4KQQ A;  1TEM A;  4E04 A;  3L9K A;  3HUM A;  3UN7 A;  4HJ4 A;  3S4X A;  1Z6F A;  2VX8 A;  3NI9 A;  4LRX C;  2HJE A;  5TGF A;  2H10 A;  3A0R A;  3T4Q A;  2V9A A;  3SS3 A;  4MBF A;  4IBR A;  4QWO A;  1DP8 A;  2V1B A;  4WM9 A;  3F1N B;  1MC0 A;  1KE4 A;  5FL3 A;  4KG5 A;  1SKO A;  2A24 A;  3OCL A;  3K2N A;  3UY6 A;  3HLD A;  1YLW A;  1CF0 A;  3VOL A;  1L0F A;  5EVI C;  4IVI A;  1C3B A;  4DN0 A;  3NDG A;  1W8Q A;  1LHY A;  5HDD A;  2VK3 A;  4QPR A;  2OLU A;  5FEG A;  2V8C A;  3IH9 A;  3FPW A;  4Y7P A;  2ZMA A;  1XFN A;  2QZ6 A;  4G3K A;  4ZRR A;  1MWU A;  3DW0 A;  5FAQ A;  4QY5 A;  2YKH A;  3V5M A;  4OPZ A;  3E4P A;  1G28 A;  1PNE A;  4HH2 A;  1MWT A;  4K08 A;  2J80 A;  3BM6 A;  3A3I A;  4H6J A;  2Z6C A;  3LR3 A;  5EPH A;  2UV0 E;  2H0T A;  1CQA A;  4UEY A;  3MBZ A;  4B93 A;  3KSI A;  4XXR A;  3FWL A;  2B5R A;  3Q07 A;  4OPY A;  1GSX A;  4RA7 A;  5F1F A;  5DJU A;  5C5K A;  4HHD A;  4OPQ A;  4RX2 A;  3ITB A;  2GX5 A;  3HJI A;  4R38 A;  4I39 A;  3IH8 A;  5EOO A;  2W3F A;  3ZCZ A;  2IWD A;  5KIZ A;  3MJQ A;  4NET A;  4NXE A;  3LYX A;  1GHI A;  3ZVT A;  3PXP A;  3UB8 A;  4YWZ A;  3UDF A;  1E25 A;  2OWH A;  2Z6D A;  3VFH A;  1Q2P A;  2K7S A;  1STZ A;  5HD5 A;  1JTG A;  3P7N A;  1XGI A;  3CJM A;  1OTA A;  1I2S A;  3LEZ A;  4B4Z A;  2C6W B;  3SZT A;  3FG8 A;  3ZG7 B;  2XRO A;  4HNB A;  1K56 D;  2Y55 A;  5KSH A;  2J3T D;  3IXB A;  2R78 A;  2L1M A;  1CEF A;  5M19 A;  2XD5 A;  3DTK A;  1D7E A;  4EUV A;  4QB8 A;  2WKP A;  3TG9 A;  4PHT A;  4I3I A;  4EV4 A;  3NOT C;  3KYE A;  2HDR A;  2OAQ 1;  1D06 A;  1NRF A;  1H5X A;  5HDC A;  2WZZ A;  3IHA A;  3QHY A;  3EQV A;  4U0X A;  3UO9 A;  1BT5 A;  5FQJ A;  4JGR A;  4HY8 A;  3P01 A;  1MXO A;  4CJN A;  2ZQA A;  1G6O A;  3CPT B;  4M3K A;  2B95 A;  5CGX A;  3BLM A;  1ACF A;  3WRZ A;  2XDM A;  4EUZ A;  3SOI A;  3BEC A;  2XF3 A;  3F1P A;  4WLA A;  4WF0 A;  1YAX A;  5J7E A;  4LRZ E;  4JGQ A;  1XGJ A;  3NOU C;  3V50 A;  3B47 A;  3RTY A;  1NLZ A;  3LIC A;  3TW8 A;  3JPU A;  1YT4 A;  4R3J A;  2WKH A;  3SW1 A;  1CK3 A;  3C7U A;  4DJ3 A;  4DXC A;  4NK3 A;  2M1C A;  2XSS A;  3NJA A;  3DAV A;  3BEB A;  4KZ9 A;  2WGV A;  1XA1 A;  1K38 A;  4E3O A;  2W1T B;  1FCO A;  2PR6 A;  3OPH A;  4QJG A;  3UB7 A;  1FOF A;  3CG5 A;  4E6X A;  4C6Y A;  3ZG9 B;  3UE1 A;  1YKD A;  5DVA A;  1U60 A;  2ZQC A;  1JWZ A;  2MJ6 A;  2P74 A;  3LI9 A;  3O3V A;  5G4Z A;  2WUQ A;  4HP4 A;  3BFE A;  2W27 A;  2WGW A;  5MC7 A;  2O9B A;  3D9Y A;  4UQI S;  3VP0 A;  1WE4 A;  3OPR A;  2PD8 A;  4IBX A;  1T19 A;  5FI2 A;  3IT9 A;  4I3A A;  5HAP A;  3QP8 A;  1FIL A;  4EBL A;  2FFF B;  5M18 A;  3V3R A;  1IKG A;  2OV5 A;  3A0S A;  2M7V A;  3H9W A;  3MKE A;  3RJU A;  4NXB A;  4Y0O A;  3GRJ A;  1F98 A;  5GHY A;  4BEN A;  2K31 A;  4KZB A;  3C2W A;  5HZH A;  4GZB A;  3NIA A;  5FEF A;  2BG1 A;  1VQQ A;  1Z09 A;  4O0P A;  3VP1 A;  4BLM A;  4MDZ A;  5LBR A;  4UAA A;  3MS6 A;  2WKI A;  1TD5 A;  4DXB A;  4CQH A;  2OWJ A;  3G2Z A;  1K56 A;  2EA9 A;  3T4K A;  3ZG0 A;  1E4D A;  4E3K A;  4Q8I A;  4OP8 A;  4WL9 A;  4G3W A;  2FFY A;  4PM8 A;  4E3J A;  3SH8 A;  3LEQ A;  1IEL A;  3NHQ A;  1K6S A;  1NLY A;  3H7W A;  3QP6 A;  1IFQ A;  2R9W A;  4CLC B;  4Y17 A;  2JCH A;  1XA7 A;  2NUT C;  4WYY A;  3DTE A;  5DTK A;  3WRT A;  4EBP A;  1LL8 A;  3R4K A;  5DTT A;  4MCW A;  3E98 A;  1DJC A;  4GHI B;  3U2A A;  4JGP A;  1P9W A;  3LID A;  3AGF A;  4R3A A;  3E4Q A;  5FDH A;  4WEJ A;  3F1O A;  1XJ3 A;  2ZC3 B;  1P97 A;  4ID4 A;  4P87 A;  3LUQ A;  5FDS A;  1E3U D;  1DJB A;  5FAP A;  3GEC A;  5CTN A;  3IX8 A;  4Q0H A;  2JN7 A;  5GLC A;  3AGD A;  3N4I A;  5E2F A;  3NUL A;  1NY0 A;  3Q7V A;  1UGU A;  4LRY C;  4IJG A;  5A8B A;  3OLO A;  3TE8 A;  3A3E A;  2ZMV A;  4GLQ A;  1CI9 A;  1G6A A;  1LSV A;  4DRT A;  2J9P A;  4UA9 A;  3WS4 A;  2V20 A;  5FQI A;  3UPP A;  3FYZ A;  3S7Q A;  3LI8 A;  2W3E A;  3VSL A;  1DP9 A;  1Y28 A;  5HWV A;  1G5U A;  4MN5 A;  3HLC A;  3JYI A;  1Y54 A;  5DKL A;  5GHX A;  5TBM A;  3O87 A;  2Y2J A;  4U0T A;  2J7V A;  2ZL1 A;  3VP3 A;  4OP5 A;  1H8M A;  2K2N A;  4EQI A;  4HJ3 A;  1PI4 A;  3HCY A;  4KZ7 A;  3KSH A;  1PIO A;  4O8G A;  2O9A A;  5CXW A;  2JBF A;  4FCF A;  4P0M A;  5CGW A;  4BBU A;  1L0D A;  1T18 A;  3SH9 A;  2QMI A;  4E3I A;  3D3O A;  2L0W A;  3HJK A;  5DTS A;  1H8Z A;  3S7O A;  4EWF A;  4G3V A;  5GLD A;  2WZX A;  3T4L A;  3HVF A;  1KOU A;  5GLB A;  1FQG A;  3G4P A;  2PDR A;  1TVF A;  3C30 A;  1I5Q A;  4S2O A;  3TSG A;  4WEK A;  2LB5 A;  3P09 A;  4XT2 A;  4R6L A;  4KZ5 A;  1SKO B;  1W63 M;  4EBN A;  3O5Y A;  1JWP A;  3R7W A;  2ZQ7 A;  2WAF A;  3GDI A;  1MWS A;  5EE8 A;  2Z2M B;  3IBR A;  5L09 A;  2V1A A;  4I38 A;  5HAI A;  4NG2 A;  5IS1 A;  3KSG A;  1NYY A;  4R4S A;  2VKS A;  4ARZ A;  5F68 A;  3W8K A;  3VMA A;  4PPR A;  4RVA A;  4Q0J A;  2W0N A;  3UB5 P;  4BWI A;  3LIA A;  3K3C A;  1VEU A;  2Y2M A;  5K5B A;  1N9N A;  5F83 A;  3V39 A;  3G34 A;  5FQ9 A;  2PAV P;  1S1Y A;  3B42 A;  4QU3 A;  1FCN A;  2XFT A;  4LEN A;  4F3L A;  4HI4 A;  4BMW A;  1CI8 A;  3K3D A;  2PD7 A;  2H28 A;  3UPO A;  3PTE A;  2ZMF A;  4X1L A;  1OT9 A;  1IYS A;  2P9V A;  4IHQ A;  3BFF A;  1WYC A;  5CHU A;  2JKF A;  2ZC7 A;  1E3U A;  3OCN A;  1SZV A;  5FAT A;  5EVE A;  2L4R A;  2H0Y A;  3V67 A;  2KOI A;  1DP6 A;  4WZ4 A;  4PKY G;  4PM5 A;  4UA6 A;  1FSW A;  5EM0 A;  4ME4 A;  3RH8 B;  1KGF A;  3MMH A;  2B02 A;  2KDK A;  3VE3 A;  1OTI A;  3GR2 A;  1XJ6 A;  1K55 A;  2P7J A;  1NYM A;  4DJ2 A;  2EX8 A;  5GLA A;  1YLJ A;  5I5L A;  3GV9 A;  3MSH A;  2FZ0 A;  4LCM A;  1YSQ A;  1BLP A;  3B3X A;  2QHK A;  3MXR A;  2HV1 A;  1KVL A;  3HUN A;  1BLC A;  4ZJ1 A;  3CZD A;  1ALQ A;  1ERO A;  2RL3 A;  4KZ4 A;  4FTX A;  1IYP A;  4WN5 A;  3CWF A;  2Y4A A;  3VP2 A;  4LPZ A;  5EOE A;  3T4T A;  4Y0T A;  2B18 A;  1K4E A;  3CAX A;  2AVX A;  4JGO A;  5FQK A;  1YMX A;  1ES4 A;  4FSF A;  5EUA A;  4IUH A;  2CC1 A;  4OOM A;  5BOH A;  1JTD A;  3VE4 A;  1P0Z A;  1XPB A;  4KUK A;  4PM9 A;  4Y15 A;  4BD0 A;  1AWI A;  2OAP 1;  5TFQ A;  5CED A;  1ZHH B;  2WKR A;  3BJN A;  4E3L A;  3D4F A;  3LCE A;  3N8R A;  1OTD A;  1F9I A;  4GW9 A;  1L2S A;  2IWC A;  1ERM A;  2Y8H A;  1YLP A;  3CMZ A;  5FAO A;  5L10 A;  1PWD A;  3F1P B;  2QKP A;  1GA9 A;  5IHV A;  2EFX A;  4F94 A;  2WAE A;  2IA2 A;  3GMW A;  3RFB A;  3UDX A;  5HL1 A;  1J3W A;  4E6W A;  4PMA A;  1ES5 A;  4GJ4 A;  4EET B;  4HP9 A;  4BL2 A;  3EGX C;  4WMC A;  2NUP C;  1PYY A;  5IU1 A;  4JBF A;  4S2I A;  3MZD A;  1BLH A;  5HAQ A;  4E3M A;  1YMS A;  5L2F A;  4BL3 A;  1S67 L;  5GL9 A;  3GTC A;  3BFC A;  4X56 A;  4LV3 A;  2XR0 A;  4GDB A;  1W5D A;  1TF1 A;  2INW A;  2PYR A;  3G6O A;  3NDE A;  3M2K A;  3C7V A;  4EEU A;  5F69 A;  2A2L A;  4NXG A;  2OOL A;  2HDQ A;  1K25 A;  4R0Q A;  1XJ4 A;  2Q9N A;  5FQQ A;  4EW7 A;  3OPL A;  3L7H A;  4S2J A;  3T50 A;  2XGN A;  2IWB A;  1ZG6 A;  5HSQ A;  4OLD A;  5FAS A;  3LIB A;  4JF5 A;  3IHB A;  3BW6 A;  2VGK A;  3T4J A;  2OLV A;  5DF8 A;  1PZP A;  4HH3 A;  3PBO A;  2ZD8 A;  5AQB A;  4KZ3 A;  1WA9 A;  2XK1 A;  4XUZ A;  3H82 B;  1BYW A;  1PW1 A;  1QMF A;  5AVE A;  1TS0 A;  4FH2 A;  4BQM A;  2X01 A;  3ZG5 A;  3NC8 A;  3S22 A;  1KDW A;  3ZGA B;  1YSP A;  3Q82 A;  4N9L A;  2ZJ9 A;  4EER A;  1K55 C;  3BWL A;  4CLC D;  1JNU A;  3DWZ A;  3UDI A;  5HWT A;  4ESP A;  1W7F A;  4GOG A;  5E2H A;  3G2Y A;  4DE2 A;  2A3U A;  2V0W A;  1DJA A;  4KG2 A;  4GCZ A;  5CGS A;  2D02 A;  3G35 A;  2KX6 A;  1S66 L;  4PM7 A;  2Y2I A;  2I72 A;  3LIF A;  4OON A;  2X71 A;  2QJ7 A;  2JKT M;  1LI9 A;  4LV2 A;  4RYE A;  2E8I A;  4B88 A;  2XD1 A;  2V0U A;  4S2N A;  1A0K A;  1T1C A;  4OPR A;  4JXV A;  3IXH A;  3H7W B;  3G32 A;  2Y2H A;  3FC7 A;  2PT7 A;  4MLL A;  1D1J A;  1MKI A;  4YFM A;  3FZC A;  5HX9 A;  3IS2 A;  3TOI A;  1NRJ A;  3BFG A;  3W4P A;  3NOP C;  1PZO A;  4JF4 A;  3GSG A;  4HJ6 A;  1TDG A;  4RX3 A;  1CEG A;  1K57 C;  3KYZ A;  3LGO A;  3LO7 A;  3ZDJ A;  3A3D A;  1OTE A;  1GHP A;  1SKF A;  4I3J A;  3HLF A;  1TDL A;  5FQM A;  1XFQ A;  3JVU A;  3MZE A;  5EVI B;  1SDN A;  2BAS A;  3PYP A;  1L0E A; 
#chains in the Genus database with same CATH homology
 2W3D A;  4G3K A;  2PHY A;  2QYB A;  4ZRR A;  2YKH A;  3D3O A;  4Q0I A;  5HPF A;  2L0W A;  3E4P A;  3EQU A;  1G28 A;  5G4Y A;  3HJK A;  1S4R A;  3S7O A;  4HH2 A;  4K08 A;  2J80 A;  1F5M A;  3E4O A;  2KLI A;  2XA7 M;  4GS9 A;  5HWW A;  4G3V A;  4H6J A;  2Z6C A;  3LR3 A;  1LSW A;  3PHY A;  3T4L A;  1UWP X;  3IS2 B;  1KOU A;  2QJ5 A;  4UEY A;  4B93 A;  2GZA A;  3KSI A;  2VZW A;  3CLO A;  2PDR A;  3C30 A;  4KQD A;  1GSX A;  4FOF A;  3JVV A;  4WEK A;  2M7U A;  2LB5 A;  4L9F A;  4XT2 A;  4R6L A;  5DJU A;  5C5K A;  4HHD A;  1W63 M;  3O5Y A;  2VA0 A;  3OOV A;  3R7W A;  2GX5 A;  2JKR M;  3HJI A;  4R38 A;  4I39 A;  3CI6 A;  3CUE A;  2W3F A;  5KIZ A;  3T4O A;  3GDI A;  2VEA A;  3MJQ A;  2EWW A;  3IBR A;  4NXE A;  5DJT A;  3PBT A;  3LYX A;  5J4E A;  2V1A A;  3PXP A;  4YNR A;  4DMZ A;  4I38 A;  2W1R A;  3UB8 A;  4YWZ A;  5IS1 A;  3KSG A;  2VKS A;  4ARZ A;  5F68 A;  3KYQ A;  2OWH A;  2Z6D A;  4Q0J A;  2W0N A;  3EEH A;  4BWI A;  3LIA A;  2K7S A;  1STZ A;  3K3C A;  5HD5 A;  4EXO A;  5K5B A;  1N9N A;  3P7N A;  4Y2F A;  2DMW A;  1OTA A;  3UME A;  1ODV A;  3FG8 A;  4OOL A;  1S1Y A;  3B42 A;  4MN6 A;  4GS9 B;  2XRO A;  2G7U A;  2O0Y A;  4HNB A;  1OJG A;  5KSH A;  2J3T D;  2R78 A;  2L1M A;  3LFV A;  4F3L A;  3LR0 A;  4HI4 A;  1VB6 A;  2CMN A;  4BMW A;  3K3D A;  2PD7 A;  2H28 A;  1D7E A;  3C8C A;  4EUV A;  2O99 A;  2WKP A;  3ICY A;  2I9V A;  4BBV A;  4PHT A;  4I3I A;  4CLC A;  2VV8 A;  3UE6 A;  3NOT C;  2ZMF A;  1OT9 A;  3H82 A;  5EFW A;  2OAQ 1;  4P6Z S;  1D06 A;  4IHQ A;  4XT2 B;  5HDC A;  5AVF A;  4LLO B;  3S7P A;  3F1O B;  3OCN A;  3R7W B;  2EWV A;  5F5Y A;  2L4R A;  3B33 A;  4BBT A;  3V67 A;  2KOI A;  2W1T A;  1DP6 A;  2VLG A;  4PKY G;  3EQV A;  4ME4 A;  3RH8 B;  3S7N A;  3MMH A;  1H3Q A;  4JGR A;  4HY8 A;  2B02 A;  3P01 A;  2KDK A;  3VE3 A;  3ZQ5 A;  1OTI A;  5DKK A;  4HQA A;  3EOI A;  1G6O A;  1XJ6 A;  3MF0 A;  2P7J A;  3IBJ A;  3MXQ A;  3UMD A;  4B9O A;  4DJ2 A;  5IT5 A;  3MQQ A;  5I5L A;  3A0V A;  2ZOI A;  2FZ0 A;  3F1P A;  4WLA A;  4WF0 A;  1YSQ A;  1YAX A;  5J7E A;  4LRZ E;  2QHK A;  4JGQ A;  4NXF A;  3NOU C;  2HV1 A;  3B47 A;  2WKQ A;  3RTY A;  1NLZ A;  3LIC A;  4P6Z M;  3TW8 A;  2JHE A;  1DRM A;  4WN5 A;  3CWF A;  5HL6 A;  4LPZ A;  1UWN X;  3BY8 A;  3T4T A;  3SW1 A;  2B18 A;  1XJ2 A;  1LT0 A;  3CAX A;  4JGO A;  2JKT I;  1X0O A;  4CLC E;  1GSV A;  2O9C A;  1OT6 A;  4FSF A;  3TRC A;  4DJ3 A;  2M1C A;  4IUH A;  5J3W A;  2XSS A;  4EU0 A;  2HF6 A;  4OOM A;  3NJA A;  3VE4 A;  1P0Z A;  4KUK A;  2A24 B;  1IOU A;  5TBM B;  2ZOH A;  3LR4 A;  4AFI A;  2OAP 1;  2J3T C;  4PKY A;  2W1T B;  2PR6 A;  2HGV A;  4PAU A;  1ZHH B;  3BQ8 A;  2WKR A;  3UB7 A;  3BJN A;  1OTD A;  1F9I A;  1YKD A;  4GW9 A;  4EES A;  1T1A A;  2VV7 A;  2Y8H A;  4RQ9 A;  2MJ6 A;  2W3H A;  3LIE A;  3LI9 A;  5HD3 A;  1S4S A;  2D01 A;  5G4Z A;  4ETZ A;  3MR0 A;  4HP4 A;  2W27 A;  5MC7 A;  3F1P B;  2QKP A;  2O9B A;  3C38 A;  3KO6 A;  3PBQ A;  4UQI S;  2P04 A;  4WUJ A;  2IA2 A;  4M4X A;  4H6J B;  1NWZ A;  3RFB A;  3UE3 A;  2PD8 A;  1T19 A;  4GJ4 A;  3VV4 A;  4YOF A;  3E0Y A;  4R70 A;  2P08 A;  1N9O A;  1P9R A;  4I3A A;  4HP9 A;  4EET B;  2Y79 A;  1OTB A;  3EGX C;  2NUP C;  3T4S A;  3UB6 A;  3ULF A;  4HOI A;  5IU1 A;  3W2Z A;  3EEA A;  2PYP A;  1V9Y A;  3CUE C;  3A0S A;  1VHM A;  2M7V A;  1TS7 A;  2ZBB A;  3H9W A;  2J3W A;  4NXB A;  1S67 L;  4GHI A;  3PBS A;  1F98 A;  1T1B A;  3PBR A;  2K31 A;  1TF1 A;  3C2W A;  5HZH A;  2INW A;  1LSX A;  2PYR A;  3G6O A;  5HDS A;  4UQI M;  4EEU A;  5F69 A;  2A2L A;  4NXG A;  4O0P A;  3EGD C;  2OOL A;  4MDZ A;  2QWS A;  4ARZ B;  4NEE D;  5LBR A;  1XJ4 A;  2VJW A;  5F6A A;  4EW7 A;  2JKR I;  1TD5 A;  4CQH A;  2OWJ A;  5L8M A;  3T50 A;  1TS8 A;  4L0L A;  5HSQ A;  2EA9 A;  3T4K A;  1ZTU A;  2XRN A;  3LIB A;  3BW6 A;  2FH5 A;  4G3W A;  4WL9 A;  5DF9 A;  4CLC C;  4F3L B;  3T4J A;  3OBF A;  1EW0 A;  4HH3 A;  3PBO A;  3LR5 A;  3NHQ A;  1S1Z A;  1NLY A;  3H7W A;  5TJJ A;  1IFQ A;  3CIT A;  4Y5F A;  4CLC B;  3ZYT A;  1WA9 A;  4Y3I A;  2NUT C;  3H82 B;  1BYW A;  4II7 A;  5AVE A;  1N9L A;  1TS0 A;  1LL8 A;  4NKP A;  3R4K A;  5CX7 A;  2VV6 A;  3EWK A;  2PR5 A;  3F1N A;  3MFX A;  3MQ0 A;  4KUO A;  4L9E A;  4ETX A;  5AJG A;  3MQO A;  3FPV A;  4MCW A;  1YSP A;  3E98 A;  4GHI B;  3U2A A;  4EER A;  4JGP A;  3BWL A;  4CLC D;  1P9W A;  1JNU A;  3LID A;  1W63 Q;  3PR6 A;  4R3A A;  5HWT A;  3E4Q A;  4WEJ A;  2W3G A;  3BY9 A;  3F1O A;  1XJ3 A;  1P97 A;  4KQO A;  3LUQ A;  4EEP A;  1TS6 A;  5DFY A;  3GEC A;  2V0W A;  3OC2 A;  4MN7 A;  4GCZ A;  1MZU A;  2D02 A;  4Q0H A;  2KX6 A;  1S66 L;  3DBA A;  3UB9 A;  4BJP A;  3LIF A;  2LB9 A;  2JN7 A;  4WEL A;  2HJ9 C;  4O01 A;  2QJ7 A;  4HIA A;  1UGU A;  4EQ1 A;  4LRY C;  4IJG A;  2VGL S;  2JKT M;  2GJ3 A;  5A8B A;  3OLO A;  3TE8 A;  2ZMV A;  4GLQ A;  3PBN A;  2V0U A;  3KX0 X;  4L9G A;  4Z1W A;  1T1C A;  1LSV A;  4IUK A;  3H7W B;  4MMN A;  3FC7 A;  2PT7 A;  3KSF A;  4E04 A;  4HJ4 A;  2YKF A;  2VX8 A;  4LRX C;  2HJE A;  3IS2 A;  5HPI A;  3A0R A;  3T4Q A;  2V9A A;  1NRJ A;  1GSW A;  4I5S A;  1DP8 A;  2V1B A;  3F1N B;  3S7Q A;  3LI8 A;  3D72 A;  3NOP C;  2W3E A;  1DP9 A;  1MKM A;  2XA7 S;  1MC0 A;  4HJ6 A;  5FL3 A;  1Y28 A;  5HWV A;  2A24 A;  3OCL A;  3K2N A;  2GNX A;  4MN5 A;  2VGL M;  5TBM A;  5DKL A;  1OPX A;  3KYZ A;  3TJZ C;  3VOL A;  1H8M A;  1OTE A;  2K2N A;  4HJ3 A;  3HCY A;  1V9Z A;  3KSH A;  4DN0 A;  4I3J A;  4O8G A;  1XFQ A;  1OJ5 A;  2O9A A;  3JVU A;  5HDD A;  4QPR A;  3BQA A;  5DFX A;  2BAS A;  3FPW A;  3PYP A;  4BBU A;  1XFN A;  1T18 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...