2PD8A

1.8 angstrom crystal structure of the cys71ser mutant of vivid
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
148
structure length
148
Chain Sequence
HTLYAPGGYDIMGYLIQIMNRPNPQVELGPVDTSSALILCDLKQKDTPIVYASEAFLYMTGYSNAEVLGRNCRFLQSPDGMVKPKSTRKYVDSNTINTMRKAIDRNAEVQVEVVNFKKNGQRFVNFLTMIPVRDETGEYRYSMGFQCE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Vivid PAS protein VVD
publication title Conformational switching in the fungal light sensor Vivid
pubmed doi rcsb
source organism Neurospora crassa
molecule tags Circadian clock protein
total genus 37
structure length 148
sequence length 148
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13426 PAS_9 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2pd8A00
2VV6A 1GSVA 3ZQ5A 2BASA 1WA9A 1KOUA 1P97A 2VEAA 3MJQA 1UWPX 3VE3A 2M1CA 1OJ5A 4I3JA 1NWZA 1ODVA 5TBMA 4NXFA 3MFXA 4K08A 2V1AA 5IU1A 3F1OA 3UB6A 3NOTC 2V1BA 2WKRA 2V9AA 5DKLA 4I39A 1BYWA 4HY8A 4RQ9A 1OTDA 4GHIA 2VV8A 4BBVA 1D7EA 5HZHA 4E04A 1LT0A 4GW9A 4XT2A 2L0WA 2QJ5A 2YKHA 1DP9A 5TBMB 4EQ1A 4LRXC 1V9YA 2PD7A 5I5LA 3LIFA 1TS8A 3F1OB 3BWLA 5HDCA 4R38A 4L9FA 2PYPA 1S4SA 2QWSA 2QHKA 4HH2A 3H9WA 1EW0A 1P0ZA 4GHIB 1F98A 3A0VA 1F9IA 2B02A 2WKQA 2L4RA 1DRMA 3G6OA 1V9ZA 3SW1A 2VV7A 3NOUC 4XT2B 2P7JA 1GSWA 4HJ6A 3K3CA 4KUOA 1UGUA 3F1NA 3GECA 3MQQA 3MXQA 3FC7A 2R78A 4YWZA 4HI4A 4EERA 4EETB 4WL9A 5DJUA 2VLGA 3CLOA 3E4OA 3LI8A 3BY8A 2JHEA 3LYXA 3IS2B 4HHDA 5HD3A 4JGQA 5HWVA 2CMNA 4NXEA 1LL8A 4PKYA 3MR0A 1XFNA 3LI9A 3F1PA 3BY9A 4EEPA 4EW7A 5HDDA 4HH3A 3T50A 5AVEA 4MN6A 4HQAA 1OTAA 4HIAA 4BBUA 2A24A 3CAXA 3P7NA 4HJ3A 4EESA 2OWHA 1LSXA 3KX0X 1S66L 5G4ZA 5F68A 1S4RA 2KDKA 1OJGA 5HWWA 3PYPA 3H7WA 2KX6A 5F69A 5KIZA 2K7SA 4HP9A 5J4EA 3VOLA 3F1PB 4F3LA 4HNBA 4M4XA 5F5YA 3HJIA 2ZBBA 2I9VA 4HJ4A 3IBRA 4B9OA 3OLOA 2OWJA 3LIDA 5J3WA 1LSVA 5HD5A 1T1AA 3GDIA 3UMDA 3A0SA 3LIEA 3UMEA 1TS7A 5A8BA 5HSQA 1XJ6A 4GCZA 1N9NA 1T1BA 3LUQA 4EEUA 4F3LB 5AVFA 1OT9A 4R6LA 1T19A 5EFWA 3C2WA 3PHYA 4KQDA 5IS1A 4I38A 3HJKA 4L9GA 3B33A 4JGRA 2V0WA 4R70A 3LIBA 1G28A 1N9LA 1MZUA 2J80A 3ULFA 4H6JA 2ZOIA 5F6AA 3K3DA 4BBTA 1UWNX 3LIAA 4KUKA 3EEHA 4WLAA 3F1NB 4HP4A 2PD8A 1D06A 3E4PA 3EWKA 2PDRA 1Y28A 4I3AA 3MQOA 2ZOHA 4LRZE 1GSXA 4DJ2A 4GS9A 1VB6A 1OT6A 1XJ4A 1DP8A 4WF0A 5DJTA 4H6JB 2PR5A 3NHQA 2D01A 4NXBA 4R3AA 2PYRA 2D02A 4MN5A 1LSWA 4I3IA 2L1MA 4JGOA 1XFQA 1X0OA 2EA9A 3FG8A 3UE6A 3E4QA 3UB8A 1T1CA 1OTEA 2Z6CA 3NOPC 2A24B 2YKFA 4GS9B 1DP6A 2GJ3A 4HOIA 2PR6A 2QJ7A 5HWTA 3A0RA 4LLOB 3RH8B 1TS0A 2HV1A 3LICA 5G4YA 5J7EA 2PHYA 3H82A 5DKKA 2INWA 4WN5A 3H7WB 4DJ3A 3C8CA 1OTBA 4L9EA 3IS2A 4PKYG 1S1YA 2W27A 1TS6A 2WKPA 2QKPA 1S1ZA 1XJ3A 1JNUA 4EXOA 2JN7A 3D72A 1T18A 4I5SA 1N9OA 1S67L 2Z6DA 5HDSA 2V0UA 3VE4A 3CWFA 3RTYA 1XJ2A 4LRYC 4NXGA 3UB7A 4LPZA 2OOLA 4WUJA 3ICYA 1OTIA 2H28A 3H82B 4JGPA 2W0NA 3NJAA 3UB9A
chains in the Genus database with same CATH superfamily
2B95A 2JBFA 4Q0IA 3S7OA 2VV6A 3GV9A 1GSVA 3BFGA 4X6TA 2BASA 3OPHA 5BOHA 3CJMA 2EFUA 3ZG5A 3TE8A 1P97A 1YKDA 2Y79A 3PXPA 4ESPA 1CQAA 1FCMA 3TOIA 3MJQA 1YLTA 1UWPX 2Y2QA 3VE3A 1OJ5A 4NXFA 5TFQA 4U0XA 4LFUA 3QP2A 3NOTC 5FDHA 3B3XA 2ZMVA 3M6HA 3DTKA 4LV0A 4IJGA 4KZ4A 3ZVWA 2Y91A 1D7EA 4E04A 4KZ6A 3V3RA 3IT9A 4GW9A 1ES5A 2PAVP 4E6WA 4OH0A 4LRXC 1V9YA 3K2NA 2PD7A 5FQIA 4DE1A 2V8CA 4KG6A 1FR6A 2X01A 4Y2FA 4WZ5A 1HVBA 1S4SA 5HAQA 4KZ3A 3L9KA 4NK3A 4UA6A 5FI6A 1EW0A 3HVFA 2ZMFA 2OV5A 4E3OA 1Q2PA 2WKQA 2L4RA 3RXXA 5FQKA 1BSGA 3NOUC 1LHYA 3TW8A 4EBPA 2JC7A 3HCYA 4KUOA 1IOUA 3GECA 5EOOA 3IWIA 3W2ZA 5HX9A 2WUQA 4QWOA 3UO9A 4YWZA 3VFFA 3LCEA 4WBGA 3CMZA 3MSHA 4E3LA 1MWUA 5CXWA 5DJUA 4NKPA 1DJBA 3SS5A 4OKPA 3LI8A 3HLGA 2G2WA 3BY8A 2JHEA 1E3UA 1ZHHB 5M1AA 4CLCA 4N1XA 1IYQA 2WZZA 4HBUA 1K57A 1CK3A 4NXEA 4MMNA 3MFDA 3DW0A 4YNRA 1ES2A 4D60A 5EECA 4E3JA 2ZJ9A 4KG2A 3O5YA 2XQZA 5HDDA 5EE8A 5AVEA 4MN6A 3UPNA 4BBUA 2A24A 3T4OA 4DDSA 2OWHA 2W1TA 4CLCB 4PMAA 3LGOA 3G2ZA 1W79A 2JKRM 3UPOA 3IX4A 5HWWA 3PYPA 3C7UA 3BM6A 5KIZA 5GHXA 4CLCC 2ZC3B 2ZBBA 5FEFA 5EVLA 2WK0A 4HJ4A 1K57C 3A3IA 1L0DA 2XRNA 5J3WA 3T4KA 3O88A 5DF7A 5GLDA 2W1TB 1XJ6A 1TD5A 1LI0A 4IBRA 4YOFA 4BJPA 1VHMA 3CUEA 5F83A 4EEUA 1MXOA 2RL3A 4KQOA 3UPPA 5FATA 5FAPA 3KYZA 3T1XA 2Y2JA 4O8GA 4KQDA 2PU4A 1GHPA 3HJKA 3FPWA 4S2NA 5L8MA 4OVDA 5HPFA 3KSIA 3C4PA 1H8ZA 1N9LA 5FSRA 5A93A 2J3WA 1MZUA 5CX7A 3MF0A 2PBDP 3BW6A 3C7VA 1L3LA 2V8FA 3ULFA 2ZOIA 1YLWA 5F6AA 3LIAA 4N1HA 2O9BA 3EEHA 1WE4A 1L0FA 3BYDA 4BMWA 3KSFA 4E3MA 4LV1A 1F2KA 4L0LA 4QJGA 2VGLS 3EWKA 2PDRA 3CUEC 1MC0A 3DBAA 4OPQA 1FCNA 1MWTA 2W3DA 2V2FF 4DDYA 4FSFA 4KQRA 3MMHA 1VB6A 1G68A 2Z2MB 2ZLYA 2ZC7A 3LR0A 4Y7PA 3ISGA 4P6ZS 4S2JA 3N6IA 2D01A 3NHQA 4S2NC 4NXBA 1KGGA 2PYRA 1YSPA 1LSWA 4S2LA 4I3IA 4KZ9A 3S22A 1KGEA 1NRJA 3UE6A 1K6SA 3UB8A 3VSKA 1T1CA 3VOYA 3D4FA 1NY0A 1OTEA 2HP6A 3NOPC 3C4OA 2O9CA 1YLPA 2VK3A 2NUTC 2PR6A 4DXBA 4LLOB 3RH8B 2HV1A 5K5BA 3IXDA 4IBXA 2J7VA 2EFXA 1XX2A 4KZAA 2GZAA 3IXBA 5DKKA 5FAQA 4WN5A 3H7WB 4IVKA 4DJ3A 4JF6A 2XR0A 2EWWA 1OTBA 3OPLA 4A5RA 3SOIA 2KOIA 2VGKA 1S1YA 1D1JA 1TS6A 2WADA 1XJ3A 1T18A 1JTDA 2JKTI 5FQJA 3BLSA 1A0KA 3JYIA 3V67A 4S2MA 1S67L 1NRFA 2Z6DA 3PTEA 3MKEA 2DCFA 4LRYC 1L2SA 3UNWA 3UB7A 3ZDJA 2P08A 1OTIA 1OPXA 5EPHA 4O01A 3PBQA 3IH9A 4UEYA 3UB9A 4G3WA 1L0EA 3V39A 4MLLA 3M6BA 3ZGAB 2OLVA 3IQAA 4ME4A 1FSWA 4OPZA 4LV2A 2VEAA 2H10A 1YMXA 4UQIM 4GB7A 4OP8A 5TBMA 1SZVA 5L09A 3MFXA 1FOFA 2J9OA 4GD8A 2V1AA 5FDSA 4UAAA 5GHZA 1O07A 3JVUA 2Y2IA 2PT7A 5IU1A 3F1OA 3OBFA 3T12B 2V1BA 1PYYA 2V9AA 2HJ9C 3LEQA 1BYWA 4PM8A 4MN7A 4GHIA 1PFLA 4MBFA 2O0YA 5FA7A 1SKOB 5HZHA 2FZ0A 3QNCA 1GHIA 3GSGA 4JF5A 3IHAA 3EQVA 5DTSA 4XT2A 2EXBA 2L0WA 1RGYA 2YKHA 3UN7A 5CEDA 1DP9A 5TBMB 5DFXA 2LB5A 5F1FA 1FSYA 1SHVA 4OQGA 3TRCA 4C75A 5KMWA 1TS8A 3F1OB 4XUZA 3BWLA 4GD6A 5HDCA 3V5MA 1FQGA 4R38A 4L9FA 2PYPA 1KE4A 1BLHA 5A91A 2WAFA 1JWPA 4NG2A 3LFVA 5IHVA 3H9WA 1P0ZA 4GHIB 3IXGA 3A0VA 1ES4A 4P87A 4FTXA 1O7EA 1DRMA 3G6OA 3HUOA 3SW1A 1TEMA 3PAGA 2J3TD 2VV7A 4XT2B 5AQBA 1GSWA 3K3CA 1FR1A 3T4JA 3F1NA 4FCFA 3MQQA 4WELA 4KZ5A 3MXQA 3FC7A 5KZHA 4B88A 5CTNA 4X53A 1I5QA 1K4EA 2HDUA 4OP5A 1JTGA 2BG1A 3CLOA 3E4OA 3IF6A 2JKFA 4EV4A 4WEKA 3LYXA 2H5SA 1YAXA 1RCJA 4ZJ1A 2ZD8A 3G31A 5HWVA 5HPIA 2QYBA 3NBLA 3MKFA 4WMCA 4PKYA 3CZDA 1H5XA 3LI9A 3F1PA 3BY9A 5E2EA 4EU0A 4GNUA 3T4SA 4HH3A 3T50A 4JKTA 4PAUA 5EVIA 2DNSA 1MY8A 4O7DA 2VZWA 4ETXA 4OLGA 1U60A 4R3JA 3ZG7B 4WM9A 4S2KA 2Y2PA 3CI6A 2WAEA 3KX0X 3T4TA 1S66L 1LL9A 4X25A 1PI4A 3IF6C 4CQHA 1S4RA 3M2JA 5DTKA 1VETA 3HREA 3MS6A 2MJ6A 5F69A 5CHJA 3Q81A 3F1PB 2XFSA 4M4XA 5HW3A 1DJCA 4LCLA 4RVAA 3IBRA 3T4LA 1YM1A 4B9OA 3PR6A 3VV4A 2VX8A 5EVIB 3LIDA 4G3KA 4MDZA 4U3TA 3L7HA 1MWRA 3GDIA 3BFCA 3UMDA 1BZAA 3A0SA 3LIEA 3ZG8B 3UMEA 4YINA 4PM6A 1TS7A 3D3OA 5EVIC 1NYYA 2EXAA 3N7WA 4LENA 1TDLA 4GCZA 4N9KA 2O9AA 4IUKA 4FOFA 1ZC2A 1K38A 1T1BA 2H0YA 4LGWA 2W3HA 3QP6A 3LUQA 3WS4A 3BQAA 4ZRRA 1OT9A 4Q0HA 1ESUA 4QD4A 5EFWA 1PW1A 3PHYA 3S1YA 3OCNA 2PU2A 3A3EA 3BLMA 4L9GA 1IELA 2V0WA 3LIBA 1G28A 4KQQA 1RGZA 4Y3IA 3UE0A 1GHMA 3KSHA 4EUZA 3VP3A 1PWCA 2ZM8A 2A2LA 4H6JA 2ZMAA 4BBTA 4KUKA 4WLAA 1KGFA 2PD8A 1W5DA 4R23A 3E4PA 4LCMA 4G3VA 2I72A 4I3AA 3SH9A 4IUHA 3WS0A 4OPYA 4HESA 2GX5A 4DJ2A 4GS9A 1K4FA 1MKMA 5E43A 3V3SA 3N8RA 1IEMA 4H6JB 5HAIA 2PR5A 2Y2NA 3BRMA 1ALQA 5FQMA 2D02A 1ES3A 1X0OA 3B47A 5HFOA 4H8RA 3E2KA 4KZBA 4OONA 4R3BA 5KSHA 2HDRA 1SDEA 2A3UA 4JLFA 2B18A 2Z6CA 3PBOA 1E4DA 2QMIA 3DTIA 2A24B 2IA2A 2ZM0A 2YKFA 5CGSA 4GOGA 4GS9B 3MXRA 4HOIA 3TJZC 5TJJA 2QJ7A 4PM5A 5HWTA 1IYPA 2HF6A 4LV3A 1TS0A 5DTTA 3LICA 5G4YA 2PHYA 4MBKA 1FILA 1TF1A 2INWA 2ZL1A 4Y0TA 5FL3A 1SCWA 1ZG6A 4F94A 3IS2A 1F5MA 5MC7A 4FH4A 5EOEA 1CF0A 2WKPA 2QKPA 4EXOA 2C6WB 1J9MA 4E3KA 3ZYTA 1Z6FA 5HDSA 5CTMA 3VE4A 4JPMA 1K56D 1GA9A 3RTYA 2Y2LA 1XJ2A 1P9RA 4QY6A 1CI9A 3E2LA 2M7UA 4DE3A 3Q7ZA 1MPLA 3MZEA 4Y13A 2R9WA 3NI9A 4JGPA 2W0NA 2ZL1B 2RCXA 4JXWA 5FI7A 1P9WA 2VGJA 3JPUA 4BENA 2W3EA 3ZQ5A 3GRJA 1WA9A 3O3VA 1PIOA 4GN2A 3DWZA 1BULA 3HLFA 4WEJA 1W63Q 4JXGA 3LR3A 2M1CA 5HL1A 5CHMA 1NWZA 3HBRA 1ODVA 2WGWA 3S7PA 3BFEA 3N8LA 4DRTA 1L0GA 4JXVA 3P09A 5EUAA 3U2AA 1XKZA 3UB6A 3VSLA 3IWQA 3FKVA 4K0XA 3HLBA 2ZC4B 1HTZA 1IKGA 4I39A 1OMEA 4Z1WA 5CGXA 4X55A 4RQ9A 1OTDA 3HUNA 2VV8A 4MCWA 3HLEA 4B4ZA 4BBVA 4ZBEA 4QY5A 3ZNYA 3PBNA 4P6ZM 3VP0A 4DXCA 3QNBA 1LLBA 2FFYA 1XGJA 3DAVA 1RP5A 2Y2MA 3NDEA 2QJ5A 4K91A 3G35A 4JF4A 4EQ1A 1DY6A 4R4SA 3IF5A 4XUXA 4K0WA 4GZBA 2V1ZA 1CJFA 5GLBA 2BLSA 3A3JA 4U0TA 2QWSA 1WYBA 4HH2A 1NZUA 3P01A 4M3KA 2HZ5A 3IX3A 3NECA 3GQZA 2XK1A 5TGFA 1M40A 1F9IA 2B02A 4YFMA 1H3QA 1Y4OA 1V9ZA 1ACFA 1IYOA 4HJ6A 3LY4A 3S7QA 3G32A 1UGUA 3HUMA 4IVIA 3ITAA 5U47A 5FEGA 2LB9A 2R78A 4HI4A 4DKIA 4EETB 3Q1FA 4EBLA 2FH5A 2VLGA 3FYZA 4FH2A 4CJNA 3Q07A 1SKFA 3FKWA 1BLCA 2JKGA 1VM1A 1H8YA 4ZDXA 3IXHA 3VFHA 2Y2GA 5LBRA 5HD3A 4JGQA 2P9VA 4PHTA 4ZAMA 2EX8A 2CMNA 1I2SA 3WRZA 3MR0A 4UQIS 5L10A 1JWZA 2EWVA 3HLDA 4KENB 2OSUA 1PI5A 3PAEA 2XA7M 4OOYA 4EEPA 4RYEA 2XSSA 5FAOA 2QPNA 1TDGA 1DJAA 1PWGA 3CG5A 3ITBA 2WKEA 4HEFA 4HIAA 3LY3A 1SDNA 4WYYA 3P7NA 2P74A 4HJ3A 4BD0A 4EESA 4CPKA 1LL5A 3VMAA 3NIAA 3IBJA 4BL3A 3HL9A 5G4ZA 3PBRA 2KDKA 3V50A 3NC8A 5DF8A 4GLQA 3BQ8A 3WWXA 2KX6A 4Y0UA 2K7SA 5J4EA 3VOLA 5G18A 2G2UA 1H8MA 5F5YA 3BJNA 1YPRA 3HJIA 4DMZA 4ETZA 4ID4A 2I9VA 2PBYA 2WGIA 3MQ0A 4XXRA 4E3NA 2J8YA 2JKRI 3MZDA 2XFTA 5DVAA 1YMSA 5HD5A 1T1AA 3CPTA 5GLCA 4JXSA 4Y0OA 4RX2A 4OQHA 3OCLA 4ZTKA 1BTLA 3VOZA 5KSCA 3N8SA 2Q9MA 2JCHA 5E2FA 3GR2A 1G5UA 3N4IA 3AGEA 3FPVA 5HL6A 1J3WA 2UV0E 3M2KA 2HPBA 2ZQAA 4PPRA 3T1QB 4PM9A 1T19A 1HD8A 1MBLA 5IS1A 3CPTB 1GA0A 4D2OA 4BD1A 3B33A 1CI8A 4AFIA 3ZNTA 2K2NA 2J9PA 3RFBA 2J80A 3BECA 4JBFA 1JWVA 5E2GA 1PW8A 2EX9A 4Q8IA 1K25A 3MZFA 4GJ4A 4UHUA 2ZC6B 4RA7A 1W8QA 3IX8A 2ACGA 2E8IA 3F1NB 4HP4A 1TVFA 2K31A 1D06A 3NY4A 2X71A 3CHWP 2A49A 2WKIA 2ZOHA 4IEDA 4LRZE 3IF6B 1M6KA 4KZ8A 1XJ4A 3W8KA 3R4KA 4WF0A 3S4XA 2ZQCA 5HAPA 4QB8A 5DJTA 4N92A 1K54A 1XXMA 5D3OA 4MN5A 1G6OA 4S2OA 1N4OA 5EM0A 2KLIA 3BEBA 3UE3A 1Y54A 3FG8A 2WGVA 1E3UD 5I94A 1I2WA 3ZVTA 1YLYA 4CLCD 4GDNA 4RX3A 3VP2A 1Z09A 1DP6A 2GJ3A 3W4PA 3A0RA 2HP5A 4S2IA 3OPPA 5AQAA 4BQMA 3H82A 2Y2HA 1VETB 3WS5A 2OLUA 1ONHA 3ZHHA 1CEGA 2JKTM 5JYOA 2ZQ9A 3C8CA 3KYEA 2J3TC 4R0QA 4PKYG 1XP4A 2W27A 4UA7A 5GL9A 1K54C 1JNUA 2JN7A 3D72A 1K0KA 3T1RA 2ZC5B 3AGDA 1BT5A 4I5SA 5A92A 1EI5A 2XROA 5GHYA 2Y2OA 2V0UA 3RXWA 1KDWA 3CWFA 4DN0A 1IKIA 4OOMA 4NXGA 1MWSA 4OQ0A 4LPZA 2OOLA 4WUJA 2CC1A 1ZG4A 2WKHA 3B42A 2H28A 3H82B 4FD8A 4NETA 4R1GA 5J8XA 4ZJ3A 4Y5FA 2P04A 1YT4A 3NULA 3IWOA 2Y55A 2ZM2A 3G4PA 1N9BA 3KO6A 5L2FA 3RJUA 1KOUA 3E98A 1BLSA 3A3FA 5CGWA 4WZ5C 1KVMA 1ESIA 4FUWA 4I3JA 2OAP1 1WYCA 3U4LP 5EVEA 3SZTA 2E8JA 3WS2A 4OPRA 4K08A 2XH9A 2M7VA 4BWIA 2Z2LB 4P0MA 1W63M 1ZTUA 4MBHA 1FIKA 1CEFA 1S0WA 4Z9QA 2WKRA 2GNXA 5DKLA 4DE2A 5JYPA 2R9XA 2NUPC 1XA7A 1QMEA 3EGDC 4HY8A 1IFQA 3LR5A 2XD5A 5FQ9A 2O99A 1ERMA 2H0TA 3PBSA 3SH8A 3ZG9B 1PNEA 3UB5P 2XDMA 1LT0A 5AQ9A 3G2YA 4C3QA 5M19A 1KDSA 2W3GA 1KVLA 1PRQA 1NYMA 1EROA 4O0PA 2OAQ1 2Y8HA 3DTMA 4IHQA 5I5LA 4S2PA 2ZQDA 3BFFA 3LIFA 3T4QA 4QPRA 4X68A 3D9YA 3NCKA 3FWLA 2AVXA 2DMWA 2QHKA 4DF6A 2IWCA 3FZCA 4KG5A 3HLCA 5HARA 2WZXA 1F98A 5F82A 4BL2A 2HGVA 1YSQA 5DFYA 4X56A 2Q9NA 2P7JA 3S7NA 4B93A 4R4RA 3NDGA 2Y2KA 4X69A 3A3DA 3ZCZA 3SS4A 1KE0A 2VA0A 3QP1A 5DF9A 4EERA 3QHYA 1XGIA 4WL9A 4EQIA 3W4QA 4EWFA 1GCEA 3IS2B 3UDIA 1JVJA 4Y17A 4HHDA 3GMWA 4QU3A 2UWXA 3QP4A 3T1SA 3IH8A 3O86A 1LL8A 1XFNA 1E25A 5E2HA 1BLPA 2HJEA 4PM7A 3BFDA 2V20A 1PZPA 5F1GA 4EW7A 1ONGA 3PBTA 3SH7A 3JVVA 3C38A 2VGLM 2DRWA 4HQAA 1OTAA 2QZ6A 3CAXA 1HZOA 1PWDA 3HLWA 3OC2A 1LSXA 5FASA 5A90A 5F68A 3UE1A 3VP1A 1OJGA 2PRFA 1K56A 2Y4AA 3KYQA 4KZ7A 1G6AA 2VJWA 3W4OA 1K6RA 3H7WA 1YLZA 4MEZA 3LO7A 3IHBA 4HP9A 2WGWB 4F3LA 4HNBA 2EX6A 5IT5A 4E6XA 1AXBA 3FV7A 4UA9A 5AQ7A 2IWDA 3OLOA 5EV0A 1STZA 2OWJA 4P85A 3KSGA 2Q0OA 1LSVA 3TSGA 4GDBA 5A8BA 2JE5A 5HSQA 5M18A 2GDNA 3R7WA 1N9NA 3ZG0A 3GVBA 4DE0A 1QMFA 4ZJ2A 1XA1A 1BUEA 4F3LB 3EEAA 5AVFA 2FFFB 4OOLA 4R6LA 3UY6A 5CEBA 1IYSA 1W8YA 4N9LA 2BTFP 5CERA 1S6RA 3C2WA 4CLCE 5L07A 3EQUA 3AGFA 4I38A 2XF3A 3Q7VA 1HLUP 3CITA 2HP9A 1H0MA 2W3FA 2B5RA 4JGRA 3SS3A 4R70A 5EM1A 5C5KA 3LEZA 4NEED 3R7WB 2ZQ7A 3K3DA 2EX2A 1UWNX 2W1RA 3DTEA 3C5AA 4Q0JA 3LR4A 1W7FA 2HDSA 3E0YA 3I7JA 2XA7S 4OQIA 4C6YA 1SKOA 1Q2QA 3O87A 1Y28A 3MQOA 2XGNA 3Q7VB 2HDQA 1GSXA 4WZ4A 1FCOA 3UDXA 1OT6A 3VP4A 2Y59A 1DP8A 3GTCA 1PZOA 3TG9A 4P6BA 5CHUA 1NXYA 4X1LA 2P9VB 3EOIA 4R3AA 5FI2A 3MXSA 4BLMA 3OZHA 4EBNA 2XEPA 4JGOA 1EWZA 2L1MA 1XFQA 2EA9A 3DWKA 4ARZA 1LI9A 5CECA 4EUVA 1K55A 3E4QA 1NLZA 1MKIA 4HBTA 3G30A 1NZOA 4WMCD 3G34A 3QP5A 5FQQA 3WS1A 1VEUA 3UDFA 1XPBA 5AJGA 4E3IA 5J7EA 1NLYA 1C3BA 1ERQA 5EVID 2XD1A 1YQSA 4QHCA 4L9EA 3OOVA 2C5WB 1KE3A 3C30A 2XLNA 2G7UA 4ARZB 4GKUA 1S1ZA 4Y15A 4B4XA 3MBZA 4OLDA 5TR7A 1ZKJA 5CRFA 3OPRA 2WYXA 3P98A 4II7A 2IWBA 1N9OA 3EGXC 3Q82A 1NJ4A 1AWIA 1K55C 3QP8A 3WRTA 1VEUB 5GLAA 3ICYA 4X1MA 1YLJA 3NJAA 1VQQA 2ZQ8A 3ZFZA 2X02A 2VKSA 4MNRA
chains in the Genus database with same CATH topology
2P04A 4Q0IA 3S7OA 2W3EA 2VV6A 1GSVA 3ZQ5A 3KO6A 2BASA 1WA9A 1KOUA 3E98A 4ME4A 3TE8A 1P97A 1YKDA 2Y79A 3PXPA 4WEJA 2VEAA 3MJQA 1W63Q 1UWPX 3LR3A 4UQIM 3VE3A 2M1CA 1OJ5A 4I3JA 1NWZA 2OAP1 1ODVA 5TBMA 4NXFA 3S7PA 3MFXA 4K08A 2V1AA 2M7VA 3U2AA 3JVUA 4BWIA 2PT7A 5IU1A 3F1OA 3UB6A 1W63M 3NOTC 1ZTUA 3OBFA 2V1BA 2ZMVA 2WKRA 2V9AA 2GNXA 2HJ9C 5DKLA 4I39A 1BYWA 4Z1WA 2NUPC 3EGDC 4HY8A 1IFQA 4IJGA 4RQ9A 3LR5A 1OTDA 4MN7A 4GHIA 2O99A 2VV8A 4MCWA 4BBVA 2O0YA 1D7EA 3PBSA 5HZHA 2FZ0A 4E04A 3PBNA 4P6ZM 1LT0A 4GW9A 3EQVA 4XT2A 2L0WA 2QJ5A 2W3GA 2YKHA 1DP9A 5TBMB 4EQ1A 4LRXC 1V9YA 3K2NA 5DFXA 2LB5A 2PD7A 4O0PA 2OAQ1 2Y8HA 4IHQA 5I5LA 3TRCA 3LIFA 3T4QA 1TS8A 3F1OB 4QPRA 3BWLA 5HDCA 4R38A 4Y2FA 4L9FA 2PYPA 1S4SA 2DMWA 2QWSA 2QHKA 3LFVA 4HH2A 3H9WA 3P01A 1EW0A 1P0ZA 4GHIB 1F98A 2ZMFA 3A0VA 1F9IA 2HGVA 2B02A 1YSQA 5DFYA 2WKQA 2L4RA 1H3QA 1DRMA 3G6OA 1V9ZA 3SW1A 2J3TD 2VV7A 3NOUC 4XT2B 2P7JA 3S7NA 3TW8A 1GSWA 4HJ6A 3K3CA 3S7QA 4B93A 3T4JA 3HCYA 4KUOA 1IOUA 1UGUA 3F1NA 3GECA 3MQQA 4WELA 3MXQA 3W2ZA 3FC7A 2LB9A 2VA0A 2R78A 5DF9A 4YWZA 4HI4A 4EERA 4EETB 4WL9A 5DJUA 2FH5A 2VLGA 4NKPA 3CLOA 3E4OA 3LI8A 4WEKA 3BY8A 2JHEA 3LYXA 1ZHHB 3IS2B 1YAXA 4HHDA 4CLCA 5LBRA 5HD3A 4JGQA 5HWVA 5HPIA 2QYBA 4PHTA 2CMNA 4NXEA 1LL8A 4PKYA 3MR0A 1XFNA 4MMNA 4UQIS 2EWVA 4YNRA 3LI9A 3F1PA 2HJEA 3BY9A 4EU0A 2XA7M 3T4SA 4EEPA 3O5YA 4EW7A 5HDDA 3PBTA 4HH3A 2XSSA 3T50A 3JVVA 4PAUA 3C38A 5AVEA 2VGLM 4MN6A 2VZWA 4HQAA 4ETXA 1OTAA 4HIAA 4BBUA 2A24A 3CAXA 3T4OA 3P7NA 4HJ3A 3CI6A 4EESA 3OC2A 2OWHA 1LSXA 3IBJA 3KX0X 2W1TA 3T4TA 1S66L 5G4ZA 5F68A 4CLCB 3PBRA 4CQHA 1S4RA 2KDKA 2JKRM 1OJGA 4GLQA 3BQ8A 3KYQA 2VJWA 5HWWA 3PYPA 3H7WA 2KX6A 2MJ6A 5F69A 5KIZA 2K7SA 4HP9A 5J4EA 3VOLA 3F1PB 4CLCC 4F3LA 1H8MA 4HNBA 4M4XA 5F5YA 3BJNA 3HJIA 2ZBBA 4DMZA 5IT5A 4ETZA 2I9VA 3MQ0A 4HJ4A 3IBRA 3T4LA 4B9OA 3OLOA 1STZA 3PR6A 2OWJA 2JKRI 3VV4A 2VX8A 3LIDA 4G3KA 4MDZA 2XRNA 3KSGA 5J3WA 1LSVA 5HD5A 3T4KA 1T1AA 3GDIA 3UMDA 3A0SA 3LIEA 3OCLA 3UMEA 1TS7A 3D3OA 5A8BA 2W1TB 5HSQA 1XJ6A 1TD5A 4GCZA 2O9AA 3R7WA 1N9NA 4IUKA 4FOFA 1T1BA 3FPVA 5HL6A 4YOFA 4BJPA 2W3HA 1VHMA 3CUEA 3LUQA 4EEUA 4F3LB 3BQAA 3EEAA 4ZRRA 5AVFA 4OOLA 1OT9A 4Q0HA 4R6LA 4KQOA 1T19A 5EFWA 3C2WA 4CLCE 3KYZA 3PHYA 4O8GA 3EQUA 4KQDA 3OCNA 5IS1A 4I38A 3CITA 3HJKA 4L9GA 3B33A 2W3FA 4JGRA 4AFIA 2V0WA 3FPWA 4R70A 5L8MA 5HPFA 3LIBA 5C5KA 1G28A 3KSIA 4Y3IA 1N9LA 2J3WA 1MZUA 2K2NA 5CX7A 3MF0A 3BW6A 3KSHA 4NEED 3RFBA 2J80A 3R7WB 3ULFA 2A2LA 4H6JA 2ZOIA 5F6AA 3K3DA 4GJ4A 4BBTA 1UWNX 3LIAA 2W1RA 4KUKA 2O9BA 3EEHA 4Q0JA 4WLAA 3LR4A 3E0YA 3F1NB 4HP4A 2PD8A 2XA7S 2K31A 1D06A 4BMWA 3KSFA 3E4PA 4L0LA 4G3VA 2VGLS 3EWKA 2PDRA 3CUEC 1Y28A 4I3AA 1MC0A 3DBAA 3MQOA 2ZOHA 4IUHA 4LRZE 1GSXA 2GX5A 2W3DA 4FSFA 4GS9A 4DJ2A 3MMHA 1VB6A 1OT6A 1XJ4A 1DP8A 3LR0A 1MKMA 3R4KA 4WF0A 5DJTA 4H6JB 4P6ZS 2PR5A 3NHQA 2D01A 4NXBA 3EOIA 4R3AA 2PYRA 1YSPA 2D02A 4MN5A 1G6OA 1LSWA 4I3IA 2KLIA 2L1MA 1XFQA 1X0OA 4JGOA 3UE3A 3B47A 2EA9A 4ARZA 1NRJA 3FG8A 3UE6A 5KSHA 4EUVA 3E4QA 3UB8A 1NLZA 1T1CA 1OTEA 2B18A 2Z6CA 3PBOA 3NOPC 4CLCD 2O9CA 2A24B 2IA2A 2YKFA 4GS9B 1DP6A 2GJ3A 4HOIA 3TJZC 2NUTC 5TJJA 2PR6A 2QJ7A 5HWTA 2HF6A 3A0RA 4LLOB 3RH8B 1TS0A 2HV1A 3LICA 5AJGA 5G4YA 5K5BA 5J7EA 2PHYA 3H82A 1NLYA 1TF1A 2GZAA 5DKKA 2INWA 4WN5A 3H7WB 5FL3A 2JKTM 4DJ3A 3C8CA 2EWWA 1OTBA 4L9EA 2J3TC 3IS2A 3OOVA 1F5MA 4PKYG 2KOIA 5MC7A 1S1YA 2W27A 3C30A 1TS6A 2G7UA 2WKPA 4ARZB 2QKPA 1S1ZA 1XJ3A 1JNUA 4EXOA 2JN7A 3D72A 1T18A 2JKTI 3V67A 4I5SA 3ZYTA 4II7A 1N9OA 1S67L 3EGXC 2XROA 2Z6DA 5HDSA 2V0UA 3VE4A 3CWFA 4DN0A 3RTYA 1XJ2A 4OOMA 4LRYC 1P9RA 4NXGA 3UB7A 4LPZA 2OOLA 4WUJA 3ICYA 2M7UA 2P08A 3B42A 1OTIA 2H28A 1OPXA 3H82B 3PBQA 4O01A 4UEYA 4JGPA 2W0NA 3NJAA 4Y5FA 3UB9A 4G3WA 2VKSA 1P9WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VV6 A;  1GSV A;  3ZQ5 A;  2BAS A;  1WA9 A;  1KOU A;  1P97 A;  2VEA A;  3MJQ A;  1UWP X;  3VE3 A;  2M1C A;  1OJ5 A;  4I3J A;  1NWZ A;  1ODV A;  5TBM A;  4NXF A;  3MFX A;  4K08 A;  2V1A A;  5IU1 A;  3F1O A;  3UB6 A;  3NOT C;  2V1B A;  2WKR A;  2V9A A;  5DKL A;  4I39 A;  1BYW A;  4HY8 A;  4RQ9 A;  1OTD A;  4GHI A;  2VV8 A;  4BBV A;  1D7E A;  5HZH A;  4E04 A;  1LT0 A;  4GW9 A;  4XT2 A;  2L0W A;  2QJ5 A;  2YKH A;  1DP9 A;  5TBM B;  4EQ1 A;  4LRX C;  1V9Y A;  2PD7 A;  5I5L A;  3LIF A;  1TS8 A;  3F1O B;  3BWL A;  5HDC A;  4R38 A;  4L9F A;  2PYP A;  1S4S A;  2QWS A;  2QHK A;  4HH2 A;  3H9W A;  1EW0 A;  1P0Z A;  4GHI B;  1F98 A;  3A0V A;  1F9I A;  2B02 A;  2WKQ A;  2L4R A;  1DRM A;  3G6O A;  1V9Z A;  3SW1 A;  2VV7 A;  3NOU C;  4XT2 B;  2P7J A;  1GSW A;  4HJ6 A;  3K3C A;  4KUO A;  1UGU A;  3F1N A;  3GEC A;  3MQQ A;  3MXQ A;  3FC7 A;  2R78 A;  4YWZ A;  4HI4 A;  4EER A;  4EET B;  4WL9 A;  5DJU A;  2VLG A;  3CLO A;  3E4O A;  3LI8 A;  3BY8 A;  2JHE A;  3LYX A;  3IS2 B;  4HHD A;  5HD3 A;  4JGQ A;  5HWV A;  2CMN A;  4NXE A;  1LL8 A;  4PKY A;  3MR0 A;  1XFN A;  3LI9 A;  3F1P A;  3BY9 A;  4EEP A;  4EW7 A;  5HDD A;  4HH3 A;  3T50 A;  5AVE A;  4MN6 A;  4HQA A;  1OTA A;  4HIA A;  4BBU A;  2A24 A;  3CAX A;  3P7N A;  4HJ3 A;  4EES A;  2OWH A;  1LSX A;  3KX0 X;  1S66 L;  5G4Z A;  5F68 A;  1S4R A;  2KDK A;  1OJG A;  5HWW A;  3PYP A;  3H7W A;  2KX6 A;  5F69 A;  5KIZ A;  2K7S A;  4HP9 A;  5J4E A;  3VOL A;  3F1P B;  4F3L A;  4HNB A;  4M4X A;  5F5Y A;  3HJI A;  2ZBB A;  2I9V A;  4HJ4 A;  3IBR A;  4B9O A;  3OLO A;  2OWJ A;  3LID A;  5J3W A;  1LSV A;  5HD5 A;  1T1A A;  3GDI A;  3UMD A;  3A0S A;  3LIE A;  3UME A;  1TS7 A;  5A8B A;  5HSQ A;  1XJ6 A;  4GCZ A;  1N9N A;  1T1B A;  3LUQ A;  4EEU A;  4F3L B;  5AVF A;  1OT9 A;  4R6L A;  1T19 A;  5EFW A;  3C2W A;  3PHY A;  4KQD A;  5IS1 A;  4I38 A;  3HJK A;  4L9G A;  3B33 A;  4JGR A;  2V0W A;  4R70 A;  3LIB A;  1G28 A;  1N9L A;  1MZU A;  2J80 A;  3ULF A;  4H6J A;  2ZOI A;  5F6A A;  3K3D A;  4BBT A;  1UWN X;  3LIA A;  4KUK A;  3EEH A;  4WLA A;  3F1N B;  4HP4 A;  2PD8 A;  1D06 A;  3E4P A;  3EWK A;  2PDR A;  1Y28 A;  4I3A A;  3MQO A;  2ZOH A;  4LRZ E;  1GSX A;  4DJ2 A;  4GS9 A;  1VB6 A;  1OT6 A;  1XJ4 A;  1DP8 A;  4WF0 A;  5DJT A;  4H6J B;  2PR5 A;  3NHQ A;  2D01 A;  4NXB A;  4R3A A;  2PYR A;  2D02 A;  4MN5 A;  1LSW A;  4I3I A;  2L1M A;  4JGO A;  1XFQ A;  1X0O A;  2EA9 A;  3FG8 A;  3UE6 A;  3E4Q A;  3UB8 A;  1T1C A;  1OTE A;  2Z6C A;  3NOP C;  2A24 B;  2YKF A;  4GS9 B;  1DP6 A;  2GJ3 A;  4HOI A;  2PR6 A;  2QJ7 A;  5HWT A;  3A0R A;  4LLO B;  3RH8 B;  1TS0 A;  2HV1 A;  3LIC A;  5G4Y A;  5J7E A;  2PHY A;  3H82 A;  5DKK A;  2INW A;  4WN5 A;  3H7W B;  4DJ3 A;  3C8C A;  1OTB A;  4L9E A;  3IS2 A;  4PKY G;  1S1Y A;  2W27 A;  1TS6 A;  2WKP A;  2QKP A;  1S1Z A;  1XJ3 A;  1JNU A;  4EXO A;  2JN7 A;  3D72 A;  1T18 A;  4I5S A;  1N9O A;  1S67 L;  2Z6D A;  5HDS A;  2V0U A;  3VE4 A;  3CWF A;  3RTY A;  1XJ2 A;  4LRY C;  4NXG A;  3UB7 A;  4LPZ A;  2OOL A;  4WUJ A;  3ICY A;  1OTI A;  2H28 A;  3H82 B;  4JGP A;  2W0N A;  3NJA A;  3UB9 A; 
#chains in the Genus database with same CATH topology
 2B95 A;  2JBF A;  4Q0I A;  3S7O A;  2VV6 A;  3GV9 A;  1GSV A;  3BFG A;  4X6T A;  2BAS A;  3OPH A;  5BOH A;  3CJM A;  2EFU A;  3ZG5 A;  3TE8 A;  1P97 A;  1YKD A;  2Y79 A;  3PXP A;  4ESP A;  1CQA A;  1FCM A;  3TOI A;  3MJQ A;  1YLT A;  1UWP X;  2Y2Q A;  3VE3 A;  1OJ5 A;  4NXF A;  5TFQ A;  4U0X A;  4LFU A;  3QP2 A;  3NOT C;  5FDH A;  3B3X A;  2ZMV A;  3M6H A;  3DTK A;  4LV0 A;  4IJG A;  4KZ4 A;  3ZVW A;  2Y91 A;  1D7E A;  4E04 A;  4KZ6 A;  3V3R A;  3IT9 A;  4GW9 A;  1ES5 A;  2PAV P;  4E6W A;  4OH0 A;  4LRX C;  1V9Y A;  3K2N A;  2PD7 A;  5FQI A;  4DE1 A;  2V8C A;  4KG6 A;  1FR6 A;  2X01 A;  4Y2F A;  4WZ5 A;  1HVB A;  1S4S A;  5HAQ A;  4KZ3 A;  3L9K A;  4NK3 A;  4UA6 A;  5FI6 A;  1EW0 A;  3HVF A;  2ZMF A;  2OV5 A;  4E3O A;  1Q2P A;  2WKQ A;  2L4R A;  3RXX A;  5FQK A;  1BSG A;  3NOU C;  1LHY A;  3TW8 A;  4EBP A;  2JC7 A;  3HCY A;  4KUO A;  1IOU A;  3GEC A;  5EOO A;  3IWI A;  3W2Z A;  5HX9 A;  2WUQ A;  4QWO A;  3UO9 A;  4YWZ A;  3VFF A;  3LCE A;  4WBG A;  3CMZ A;  3MSH A;  4E3L A;  1MWU A;  5CXW A;  5DJU A;  4NKP A;  1DJB A;  3SS5 A;  4OKP A;  3LI8 A;  3HLG A;  2G2W A;  3BY8 A;  2JHE A;  1E3U A;  1ZHH B;  5M1A A;  4CLC A;  4N1X A;  1IYQ A;  2WZZ A;  4HBU A;  1K57 A;  1CK3 A;  4NXE A;  4MMN A;  3MFD A;  3DW0 A;  4YNR A;  1ES2 A;  4D60 A;  5EEC A;  4E3J A;  2ZJ9 A;  4KG2 A;  3O5Y A;  2XQZ A;  5HDD A;  5EE8 A;  5AVE A;  4MN6 A;  3UPN A;  4BBU A;  2A24 A;  3T4O A;  4DDS A;  2OWH A;  2W1T A;  4CLC B;  4PMA A;  3LGO A;  3G2Z A;  1W79 A;  2JKR M;  3UPO A;  3IX4 A;  5HWW A;  3PYP A;  3C7U A;  3BM6 A;  5KIZ A;  5GHX A;  4CLC C;  2ZC3 B;  2ZBB A;  5FEF A;  5EVL A;  2WK0 A;  4HJ4 A;  1K57 C;  3A3I A;  1L0D A;  2XRN A;  5J3W A;  3T4K A;  3O88 A;  5DF7 A;  5GLD A;  2W1T B;  1XJ6 A;  1TD5 A;  1LI0 A;  4IBR A;  4YOF A;  4BJP A;  1VHM A;  3CUE A;  5F83 A;  4EEU A;  1MXO A;  2RL3 A;  4KQO A;  3UPP A;  5FAT A;  5FAP A;  3KYZ A;  3T1X A;  2Y2J A;  4O8G A;  4KQD A;  2PU4 A;  1GHP A;  3HJK A;  3FPW A;  4S2N A;  5L8M A;  4OVD A;  5HPF A;  3KSI A;  3C4P A;  1H8Z A;  1N9L A;  5FSR A;  5A93 A;  2J3W A;  1MZU A;  5CX7 A;  3MF0 A;  2PBD P;  3BW6 A;  3C7V A;  1L3L A;  2V8F A;  3ULF A;  2ZOI A;  1YLW A;  5F6A A;  3LIA A;  4N1H A;  2O9B A;  3EEH A;  1WE4 A;  1L0F A;  3BYD A;  4BMW A;  3KSF A;  4E3M A;  4LV1 A;  1F2K A;  4L0L A;  4QJG A;  2VGL S;  3EWK A;  2PDR A;  3CUE C;  1MC0 A;  3DBA A;  4OPQ A;  1FCN A;  1MWT A;  2W3D A;  2V2F F;  4DDY A;  4FSF A;  4KQR A;  3MMH A;  1VB6 A;  1G68 A;  2Z2M B;  2ZLY A;  2ZC7 A;  3LR0 A;  4Y7P A;  3ISG A;  4P6Z S;  4S2J A;  3N6I A;  2D01 A;  3NHQ A;  4S2N C;  4NXB A;  1KGG A;  2PYR A;  1YSP A;  1LSW A;  4S2L A;  4I3I A;  4KZ9 A;  3S22 A;  1KGE A;  1NRJ A;  3UE6 A;  1K6S A;  3UB8 A;  3VSK A;  1T1C A;  3VOY A;  3D4F A;  1NY0 A;  1OTE A;  2HP6 A;  3NOP C;  3C4O A;  2O9C A;  1YLP A;  2VK3 A;  2NUT C;  2PR6 A;  4DXB A;  4LLO B;  3RH8 B;  2HV1 A;  5K5B A;  3IXD A;  4IBX A;  2J7V A;  2EFX A;  1XX2 A;  4KZA A;  2GZA A;  3IXB A;  5DKK A;  5FAQ A;  4WN5 A;  3H7W B;  4IVK A;  4DJ3 A;  4JF6 A;  2XR0 A;  2EWW A;  1OTB A;  3OPL A;  4A5R A;  3SOI A;  2KOI A;  2VGK A;  1S1Y A;  1D1J A;  1TS6 A;  2WAD A;  1XJ3 A;  1T18 A;  1JTD A;  2JKT I;  5FQJ A;  3BLS A;  1A0K A;  3JYI A;  3V67 A;  4S2M A;  1S67 L;  1NRF A;  2Z6D A;  3PTE A;  3MKE A;  2DCF A;  4LRY C;  1L2S A;  3UNW A;  3UB7 A;  3ZDJ A;  2P08 A;  1OTI A;  1OPX A;  5EPH A;  4O01 A;  3PBQ A;  3IH9 A;  4UEY A;  3UB9 A;  4G3W A;  1L0E A;  3V39 A;  4MLL A;  3M6B A;  3ZGA B;  2OLV A;  3IQA A;  4ME4 A;  1FSW A;  4OPZ A;  4LV2 A;  2VEA A;  2H10 A;  1YMX A;  4UQI M;  4GB7 A;  4OP8 A;  5TBM A;  1SZV A;  5L09 A;  3MFX A;  1FOF A;  2J9O A;  4GD8 A;  2V1A A;  5FDS A;  4UAA A;  5GHZ A;  1O07 A;  3JVU A;  2Y2I A;  2PT7 A;  5IU1 A;  3F1O A;  3OBF A;  3T12 B;  2V1B A;  1PYY A;  2V9A A;  2HJ9 C;  3LEQ A;  1BYW A;  4PM8 A;  4MN7 A;  4GHI A;  1PFL A;  4MBF A;  2O0Y A;  5FA7 A;  1SKO B;  5HZH A;  2FZ0 A;  3QNC A;  1GHI A;  3GSG A;  4JF5 A;  3IHA A;  3EQV A;  5DTS A;  4XT2 A;  2EXB A;  2L0W A;  1RGY A;  2YKH A;  3UN7 A;  5CED A;  1DP9 A;  5TBM B;  5DFX A;  2LB5 A;  5F1F A;  1FSY A;  1SHV A;  4OQG A;  3TRC A;  4C75 A;  5KMW A;  1TS8 A;  3F1O B;  4XUZ A;  3BWL A;  4GD6 A;  5HDC A;  3V5M A;  1FQG A;  4R38 A;  4L9F A;  2PYP A;  1KE4 A;  1BLH A;  5A91 A;  2WAF A;  1JWP A;  4NG2 A;  3LFV A;  5IHV A;  3H9W A;  1P0Z A;  4GHI B;  3IXG A;  3A0V A;  1ES4 A;  4P87 A;  4FTX A;  1O7E A;  1DRM A;  3G6O A;  3HUO A;  3SW1 A;  1TEM A;  3PAG A;  2J3T D;  2VV7 A;  4XT2 B;  5AQB A;  1GSW A;  3K3C A;  1FR1 A;  3T4J A;  3F1N A;  4FCF A;  3MQQ A;  4WEL A;  4KZ5 A;  3MXQ A;  3FC7 A;  5KZH A;  4B88 A;  5CTN A;  4X53 A;  1I5Q A;  1K4E A;  2HDU A;  4OP5 A;  1JTG A;  2BG1 A;  3CLO A;  3E4O A;  3IF6 A;  2JKF A;  4EV4 A;  4WEK A;  3LYX A;  2H5S A;  1YAX A;  1RCJ A;  4ZJ1 A;  2ZD8 A;  3G31 A;  5HWV A;  5HPI A;  2QYB A;  3NBL A;  3MKF A;  4WMC A;  4PKY A;  3CZD A;  1H5X A;  3LI9 A;  3F1P A;  3BY9 A;  5E2E A;  4EU0 A;  4GNU A;  3T4S A;  4HH3 A;  3T50 A;  4JKT A;  4PAU A;  5EVI A;  2DNS A;  1MY8 A;  4O7D A;  2VZW A;  4ETX A;  4OLG A;  1U60 A;  4R3J A;  3ZG7 B;  4WM9 A;  4S2K A;  2Y2P A;  3CI6 A;  2WAE A;  3KX0 X;  3T4T A;  1S66 L;  1LL9 A;  4X25 A;  1PI4 A;  3IF6 C;  4CQH A;  1S4R A;  3M2J A;  5DTK A;  1VET A;  3HRE A;  3MS6 A;  2MJ6 A;  5F69 A;  5CHJ A;  3Q81 A;  3F1P B;  2XFS A;  4M4X A;  5HW3 A;  1DJC A;  4LCL A;  4RVA A;  3IBR A;  3T4L A;  1YM1 A;  4B9O A;  3PR6 A;  3VV4 A;  2VX8 A;  5EVI B;  3LID A;  4G3K A;  4MDZ A;  4U3T A;  3L7H A;  1MWR A;  3GDI A;  3BFC A;  3UMD A;  1BZA A;  3A0S A;  3LIE A;  3ZG8 B;  3UME A;  4YIN A;  4PM6 A;  1TS7 A;  3D3O A;  5EVI C;  1NYY A;  2EXA A;  3N7W A;  4LEN A;  1TDL A;  4GCZ A;  4N9K A;  2O9A A;  4IUK A;  4FOF A;  1ZC2 A;  1K38 A;  1T1B A;  2H0Y A;  4LGW A;  2W3H A;  3QP6 A;  3LUQ A;  3WS4 A;  3BQA A;  4ZRR A;  1OT9 A;  4Q0H A;  1ESU A;  4QD4 A;  5EFW A;  1PW1 A;  3PHY A;  3S1Y A;  3OCN A;  2PU2 A;  3A3E A;  3BLM A;  4L9G A;  1IEL A;  2V0W A;  3LIB A;  1G28 A;  4KQQ A;  1RGZ A;  4Y3I A;  3UE0 A;  1GHM A;  3KSH A;  4EUZ A;  3VP3 A;  1PWC A;  2ZM8 A;  2A2L A;  4H6J A;  2ZMA A;  4BBT A;  4KUK A;  4WLA A;  1KGF A;  2PD8 A;  1W5D A;  4R23 A;  3E4P A;  4LCM A;  4G3V A;  2I72 A;  4I3A A;  3SH9 A;  4IUH A;  3WS0 A;  4OPY A;  4HES A;  2GX5 A;  4DJ2 A;  4GS9 A;  1K4F A;  1MKM A;  5E43 A;  3V3S A;  3N8R A;  1IEM A;  4H6J B;  5HAI A;  2PR5 A;  2Y2N A;  3BRM A;  1ALQ A;  5FQM A;  2D02 A;  1ES3 A;  1X0O A;  3B47 A;  5HFO A;  4H8R A;  3E2K A;  4KZB A;  4OON A;  4R3B A;  5KSH A;  2HDR A;  1SDE A;  2A3U A;  4JLF A;  2B18 A;  2Z6C A;  3PBO A;  1E4D A;  2QMI A;  3DTI A;  2A24 B;  2IA2 A;  2ZM0 A;  2YKF A;  5CGS A;  4GOG A;  4GS9 B;  3MXR A;  4HOI A;  3TJZ C;  5TJJ A;  2QJ7 A;  4PM5 A;  5HWT A;  1IYP A;  2HF6 A;  4LV3 A;  1TS0 A;  5DTT A;  3LIC A;  5G4Y A;  2PHY A;  4MBK A;  1FIL A;  1TF1 A;  2INW A;  2ZL1 A;  4Y0T A;  5FL3 A;  1SCW A;  1ZG6 A;  4F94 A;  3IS2 A;  1F5M A;  5MC7 A;  4FH4 A;  5EOE A;  1CF0 A;  2WKP A;  2QKP A;  4EXO A;  2C6W B;  1J9M A;  4E3K A;  3ZYT A;  1Z6F A;  5HDS A;  5CTM A;  3VE4 A;  4JPM A;  1K56 D;  1GA9 A;  3RTY A;  2Y2L A;  1XJ2 A;  1P9R A;  4QY6 A;  1CI9 A;  3E2L A;  2M7U A;  4DE3 A;  3Q7Z A;  1MPL A;  3MZE A;  4Y13 A;  2R9W A;  3NI9 A;  4JGP A;  2W0N A;  2ZL1 B;  2RCX A;  4JXW A;  5FI7 A;  1P9W A;  2VGJ A;  3JPU A;  4BEN A;  2W3E A;  3ZQ5 A;  3GRJ A;  1WA9 A;  3O3V A;  1PIO A;  4GN2 A;  3DWZ A;  1BUL A;  3HLF A;  4WEJ A;  1W63 Q;  4JXG A;  3LR3 A;  2M1C A;  5HL1 A;  5CHM A;  1NWZ A;  3HBR A;  1ODV A;  2WGW A;  3S7P A;  3BFE A;  3N8L A;  4DRT A;  1L0G A;  4JXV A;  3P09 A;  5EUA A;  3U2A A;  1XKZ A;  3UB6 A;  3VSL A;  3IWQ A;  3FKV A;  4K0X A;  3HLB A;  2ZC4 B;  1HTZ A;  1IKG A;  4I39 A;  1OME A;  4Z1W A;  5CGX A;  4X55 A;  4RQ9 A;  1OTD A;  3HUN A;  2VV8 A;  4MCW A;  3HLE A;  4B4Z A;  4BBV A;  4ZBE A;  4QY5 A;  3ZNY A;  3PBN A;  4P6Z M;  3VP0 A;  4DXC A;  3QNB A;  1LLB A;  2FFY A;  1XGJ A;  3DAV A;  1RP5 A;  2Y2M A;  3NDE A;  2QJ5 A;  4K91 A;  3G35 A;  4JF4 A;  4EQ1 A;  1DY6 A;  4R4S A;  3IF5 A;  4XUX A;  4K0W A;  4GZB A;  2V1Z A;  1CJF A;  5GLB A;  2BLS A;  3A3J A;  4U0T A;  2QWS A;  1WYB A;  4HH2 A;  1NZU A;  3P01 A;  4M3K A;  2HZ5 A;  3IX3 A;  3NEC A;  3GQZ A;  2XK1 A;  5TGF A;  1M40 A;  1F9I A;  2B02 A;  4YFM A;  1H3Q A;  1Y4O A;  1V9Z A;  1ACF A;  1IYO A;  4HJ6 A;  3LY4 A;  3S7Q A;  3G32 A;  1UGU A;  3HUM A;  4IVI A;  3ITA A;  5U47 A;  5FEG A;  2LB9 A;  2R78 A;  4HI4 A;  4DKI A;  4EET B;  3Q1F A;  4EBL A;  2FH5 A;  2VLG A;  3FYZ A;  4FH2 A;  4CJN A;  3Q07 A;  1SKF A;  3FKW A;  1BLC A;  2JKG A;  1VM1 A;  1H8Y A;  4ZDX A;  3IXH A;  3VFH A;  2Y2G A;  5LBR A;  5HD3 A;  4JGQ A;  2P9V A;  4PHT A;  4ZAM A;  2EX8 A;  2CMN A;  1I2S A;  3WRZ A;  3MR0 A;  4UQI S;  5L10 A;  1JWZ A;  2EWV A;  3HLD A;  4KEN B;  2OSU A;  1PI5 A;  3PAE A;  2XA7 M;  4OOY A;  4EEP A;  4RYE A;  2XSS A;  5FAO A;  2QPN A;  1TDG A;  1DJA A;  1PWG A;  3CG5 A;  3ITB A;  2WKE A;  4HEF A;  4HIA A;  3LY3 A;  1SDN A;  4WYY A;  3P7N A;  2P74 A;  4HJ3 A;  4BD0 A;  4EES A;  4CPK A;  1LL5 A;  3VMA A;  3NIA A;  3IBJ A;  4BL3 A;  3HL9 A;  5G4Z A;  3PBR A;  2KDK A;  3V50 A;  3NC8 A;  5DF8 A;  4GLQ A;  3BQ8 A;  3WWX A;  2KX6 A;  4Y0U A;  2K7S A;  5J4E A;  3VOL A;  5G18 A;  2G2U A;  1H8M A;  5F5Y A;  3BJN A;  1YPR A;  3HJI A;  4DMZ A;  4ETZ A;  4ID4 A;  2I9V A;  2PBY A;  2WGI A;  3MQ0 A;  4XXR A;  4E3N A;  2J8Y A;  2JKR I;  3MZD A;  2XFT A;  5DVA A;  1YMS A;  5HD5 A;  1T1A A;  3CPT A;  5GLC A;  4JXS A;  4Y0O A;  4RX2 A;  4OQH A;  3OCL A;  4ZTK A;  1BTL A;  3VOZ A;  5KSC A;  3N8S A;  2Q9M A;  2JCH A;  5E2F A;  3GR2 A;  1G5U A;  3N4I A;  3AGE A;  3FPV A;  5HL6 A;  1J3W A;  2UV0 E;  3M2K A;  2HPB A;  2ZQA A;  4PPR A;  3T1Q B;  4PM9 A;  1T19 A;  1HD8 A;  1MBL A;  5IS1 A;  3CPT B;  1GA0 A;  4D2O A;  4BD1 A;  3B33 A;  1CI8 A;  4AFI A;  3ZNT A;  2K2N A;  2J9P A;  3RFB A;  2J80 A;  3BEC A;  4JBF A;  1JWV A;  5E2G A;  1PW8 A;  2EX9 A;  4Q8I A;  1K25 A;  3MZF A;  4GJ4 A;  4UHU A;  2ZC6 B;  4RA7 A;  1W8Q A;  3IX8 A;  2ACG A;  2E8I A;  3F1N B;  4HP4 A;  1TVF A;  2K31 A;  1D06 A;  3NY4 A;  2X71 A;  3CHW P;  2A49 A;  2WKI A;  2ZOH A;  4IED A;  4LRZ E;  3IF6 B;  1M6K A;  4KZ8 A;  1XJ4 A;  3W8K A;  3R4K A;  4WF0 A;  3S4X A;  2ZQC A;  5HAP A;  4QB8 A;  5DJT A;  4N92 A;  1K54 A;  1XXM A;  5D3O A;  4MN5 A;  1G6O A;  4S2O A;  1N4O A;  5EM0 A;  2KLI A;  3BEB A;  3UE3 A;  1Y54 A;  3FG8 A;  2WGV A;  1E3U D;  5I94 A;  1I2W A;  3ZVT A;  1YLY A;  4CLC D;  4GDN A;  4RX3 A;  3VP2 A;  1Z09 A;  1DP6 A;  2GJ3 A;  3W4P A;  3A0R A;  2HP5 A;  4S2I A;  3OPP A;  5AQA A;  4BQM A;  3H82 A;  2Y2H A;  1VET B;  3WS5 A;  2OLU A;  1ONH A;  3ZHH A;  1CEG A;  2JKT M;  5JYO A;  2ZQ9 A;  3C8C A;  3KYE A;  2J3T C;  4R0Q A;  4PKY G;  1XP4 A;  2W27 A;  4UA7 A;  5GL9 A;  1K54 C;  1JNU A;  2JN7 A;  3D72 A;  1K0K A;  3T1R A;  2ZC5 B;  3AGD A;  1BT5 A;  4I5S A;  5A92 A;  1EI5 A;  2XRO A;  5GHY A;  2Y2O A;  2V0U A;  3RXW A;  1KDW A;  3CWF A;  4DN0 A;  1IKI A;  4OOM A;  4NXG A;  1MWS A;  4OQ0 A;  4LPZ A;  2OOL A;  4WUJ A;  2CC1 A;  1ZG4 A;  2WKH A;  3B42 A;  2H28 A;  3H82 B;  4FD8 A;  4NET A;  4R1G A;  5J8X A;  4ZJ3 A;  4Y5F A;  2P04 A;  1YT4 A;  3NUL A;  3IWO A;  2Y55 A;  2ZM2 A;  3G4P A;  1N9B A;  3KO6 A;  5L2F A;  3RJU A;  1KOU A;  3E98 A;  1BLS A;  3A3F A;  5CGW A;  4WZ5 C;  1KVM A;  1ESI A;  4FUW A;  4I3J A;  2OAP 1;  1WYC A;  3U4L P;  5EVE A;  3SZT A;  2E8J A;  3WS2 A;  4OPR A;  4K08 A;  2XH9 A;  2M7V A;  4BWI A;  2Z2L B;  4P0M A;  1W63 M;  1ZTU A;  4MBH A;  1FIK A;  1CEF A;  1S0W A;  4Z9Q A;  2WKR A;  2GNX A;  5DKL A;  4DE2 A;  5JYP A;  2R9X A;  2NUP C;  1XA7 A;  1QME A;  3EGD C;  4HY8 A;  1IFQ A;  3LR5 A;  2XD5 A;  5FQ9 A;  2O99 A;  1ERM A;  2H0T A;  3PBS A;  3SH8 A;  3ZG9 B;  1PNE A;  3UB5 P;  2XDM A;  1LT0 A;  5AQ9 A;  3G2Y A;  4C3Q A;  5M19 A;  1KDS A;  2W3G A;  1KVL A;  1PRQ A;  1NYM A;  1ERO A;  4O0P A;  2OAQ 1;  2Y8H A;  3DTM A;  4IHQ A;  5I5L A;  4S2P A;  2ZQD A;  3BFF A;  3LIF A;  3T4Q A;  4QPR A;  4X68 A;  3D9Y A;  3NCK A;  3FWL A;  2AVX A;  2DMW A;  2QHK A;  4DF6 A;  2IWC A;  3FZC A;  4KG5 A;  3HLC A;  5HAR A;  2WZX A;  1F98 A;  5F82 A;  4BL2 A;  2HGV A;  1YSQ A;  5DFY A;  4X56 A;  2Q9N A;  2P7J A;  3S7N A;  4B93 A;  4R4R A;  3NDG A;  2Y2K A;  4X69 A;  3A3D A;  3ZCZ A;  3SS4 A;  1KE0 A;  2VA0 A;  3QP1 A;  5DF9 A;  4EER A;  3QHY A;  1XGI A;  4WL9 A;  4EQI A;  3W4Q A;  4EWF A;  1GCE A;  3IS2 B;  3UDI A;  1JVJ A;  4Y17 A;  4HHD A;  3GMW A;  4QU3 A;  2UWX A;  3QP4 A;  3T1S A;  3IH8 A;  3O86 A;  1LL8 A;  1XFN A;  1E25 A;  5E2H A;  1BLP A;  2HJE A;  4PM7 A;  3BFD A;  2V20 A;  1PZP A;  5F1G A;  4EW7 A;  1ONG A;  3PBT A;  3SH7 A;  3JVV A;  3C38 A;  2VGL M;  2DRW A;  4HQA A;  1OTA A;  2QZ6 A;  3CAX A;  1HZO A;  1PWD A;  3HLW A;  3OC2 A;  1LSX A;  5FAS A;  5A90 A;  5F68 A;  3UE1 A;  3VP1 A;  1OJG A;  2PRF A;  1K56 A;  2Y4A A;  3KYQ A;  4KZ7 A;  1G6A A;  2VJW A;  3W4O A;  1K6R A;  3H7W A;  1YLZ A;  4MEZ A;  3LO7 A;  3IHB A;  4HP9 A;  2WGW B;  4F3L A;  4HNB A;  2EX6 A;  5IT5 A;  4E6X A;  1AXB A;  3FV7 A;  4UA9 A;  5AQ7 A;  2IWD A;  3OLO A;  5EV0 A;  1STZ A;  2OWJ A;  4P85 A;  3KSG A;  2Q0O A;  1LSV A;  3TSG A;  4GDB A;  5A8B A;  2JE5 A;  5HSQ A;  5M18 A;  2GDN A;  3R7W A;  1N9N A;  3ZG0 A;  3GVB A;  4DE0 A;  1QMF A;  4ZJ2 A;  1XA1 A;  1BUE A;  4F3L B;  3EEA A;  5AVF A;  2FFF B;  4OOL A;  4R6L A;  3UY6 A;  5CEB A;  1IYS A;  1W8Y A;  4N9L A;  2BTF P;  5CER A;  1S6R A;  3C2W A;  4CLC E;  5L07 A;  3EQU A;  3AGF A;  4I38 A;  2XF3 A;  3Q7V A;  1HLU P;  3CIT A;  2HP9 A;  1H0M A;  2W3F A;  2B5R A;  4JGR A;  3SS3 A;  4R70 A;  5EM1 A;  5C5K A;  3LEZ A;  4NEE D;  3R7W B;  2ZQ7 A;  3K3D A;  2EX2 A;  1UWN X;  2W1R A;  3DTE A;  3C5A A;  4Q0J A;  3LR4 A;  1W7F A;  2HDS A;  3E0Y A;  3I7J A;  2XA7 S;  4OQI A;  4C6Y A;  1SKO A;  1Q2Q A;  3O87 A;  1Y28 A;  3MQO A;  2XGN A;  3Q7V B;  2HDQ A;  1GSX A;  4WZ4 A;  1FCO A;  3UDX A;  1OT6 A;  3VP4 A;  2Y59 A;  1DP8 A;  3GTC A;  1PZO A;  3TG9 A;  4P6B A;  5CHU A;  1NXY A;  4X1L A;  2P9V B;  3EOI A;  4R3A A;  5FI2 A;  3MXS A;  4BLM A;  3OZH A;  4EBN A;  2XEP A;  4JGO A;  1EWZ A;  2L1M A;  1XFQ A;  2EA9 A;  3DWK A;  4ARZ A;  1LI9 A;  5CEC A;  4EUV A;  1K55 A;  3E4Q A;  1NLZ A;  1MKI A;  4HBT A;  3G30 A;  1NZO A;  4WMC D;  3G34 A;  3QP5 A;  5FQQ A;  3WS1 A;  1VEU A;  3UDF A;  1XPB A;  5AJG A;  4E3I A;  5J7E A;  1NLY A;  1C3B A;  1ERQ A;  5EVI D;  2XD1 A;  1YQS A;  4QHC A;  4L9E A;  3OOV A;  2C5W B;  1KE3 A;  3C30 A;  2XLN A;  2G7U A;  4ARZ B;  4GKU A;  1S1Z A;  4Y15 A;  4B4X A;  3MBZ A;  4OLD A;  5TR7 A;  1ZKJ A;  5CRF A;  3OPR A;  2WYX A;  3P98 A;  4II7 A;  2IWB A;  1N9O A;  3EGX C;  3Q82 A;  1NJ4 A;  1AWI A;  1K55 C;  3QP8 A;  3WRT A;  1VEU B;  5GLA A;  3ICY A;  4X1M A;  1YLJ A;  3NJA A;  1VQQ A;  2ZQ8 A;  3ZFZ A;  2X02 A;  2VKS A;  4MNR A; 
#chains in the Genus database with same CATH homology
 2P04 A;  4Q0I A;  3S7O A;  2W3E A;  2VV6 A;  1GSV A;  3ZQ5 A;  3KO6 A;  2BAS A;  1WA9 A;  1KOU A;  3E98 A;  4ME4 A;  3TE8 A;  1P97 A;  1YKD A;  2Y79 A;  3PXP A;  4WEJ A;  2VEA A;  3MJQ A;  1W63 Q;  1UWP X;  3LR3 A;  4UQI M;  3VE3 A;  2M1C A;  1OJ5 A;  4I3J A;  1NWZ A;  2OAP 1;  1ODV A;  5TBM A;  4NXF A;  3S7P A;  3MFX A;  4K08 A;  2V1A A;  2M7V A;  3U2A A;  3JVU A;  4BWI A;  2PT7 A;  5IU1 A;  3F1O A;  3UB6 A;  1W63 M;  3NOT C;  1ZTU A;  3OBF A;  2V1B A;  2ZMV A;  2WKR A;  2V9A A;  2GNX A;  2HJ9 C;  5DKL A;  4I39 A;  1BYW A;  4Z1W A;  2NUP C;  3EGD C;  4HY8 A;  1IFQ A;  4IJG A;  4RQ9 A;  3LR5 A;  1OTD A;  4MN7 A;  4GHI A;  2O99 A;  2VV8 A;  4MCW A;  4BBV A;  2O0Y A;  1D7E A;  3PBS A;  5HZH A;  2FZ0 A;  4E04 A;  3PBN A;  4P6Z M;  1LT0 A;  4GW9 A;  3EQV A;  4XT2 A;  2L0W A;  2QJ5 A;  2W3G A;  2YKH A;  1DP9 A;  5TBM B;  4EQ1 A;  4LRX C;  1V9Y A;  3K2N A;  5DFX A;  2LB5 A;  2PD7 A;  4O0P A;  2OAQ 1;  2Y8H A;  4IHQ A;  5I5L A;  3TRC A;  3LIF A;  3T4Q A;  1TS8 A;  3F1O B;  4QPR A;  3BWL A;  5HDC A;  4R38 A;  4Y2F A;  4L9F A;  2PYP A;  1S4S A;  2DMW A;  2QWS A;  2QHK A;  3LFV A;  4HH2 A;  3H9W A;  3P01 A;  1EW0 A;  1P0Z A;  4GHI B;  1F98 A;  2ZMF A;  3A0V A;  1F9I A;  2HGV A;  2B02 A;  1YSQ A;  5DFY A;  2WKQ A;  2L4R A;  1H3Q A;  1DRM A;  3G6O A;  1V9Z A;  3SW1 A;  2J3T D;  2VV7 A;  3NOU C;  4XT2 B;  2P7J A;  3S7N A;  3TW8 A;  1GSW A;  4HJ6 A;  3K3C A;  3S7Q A;  4B93 A;  3T4J A;  3HCY A;  4KUO A;  1IOU A;  1UGU A;  3F1N A;  3GEC A;  3MQQ A;  4WEL A;  3MXQ A;  3W2Z A;  3FC7 A;  2LB9 A;  2VA0 A;  2R78 A;  5DF9 A;  4YWZ A;  4HI4 A;  4EER A;  4EET B;  4WL9 A;  5DJU A;  2FH5 A;  2VLG A;  4NKP A;  3CLO A;  3E4O A;  3LI8 A;  4WEK A;  3BY8 A;  2JHE A;  3LYX A;  1ZHH B;  3IS2 B;  1YAX A;  4HHD A;  4CLC A;  5LBR A;  5HD3 A;  4JGQ A;  5HWV A;  5HPI A;  2QYB A;  4PHT A;  2CMN A;  4NXE A;  1LL8 A;  4PKY A;  3MR0 A;  1XFN A;  4MMN A;  4UQI S;  2EWV A;  4YNR A;  3LI9 A;  3F1P A;  2HJE A;  3BY9 A;  4EU0 A;  2XA7 M;  3T4S A;  4EEP A;  3O5Y A;  4EW7 A;  5HDD A;  3PBT A;  4HH3 A;  2XSS A;  3T50 A;  3JVV A;  4PAU A;  3C38 A;  5AVE A;  2VGL M;  4MN6 A;  2VZW A;  4HQA A;  4ETX A;  1OTA A;  4HIA A;  4BBU A;  2A24 A;  3CAX A;  3T4O A;  3P7N A;  4HJ3 A;  3CI6 A;  4EES A;  3OC2 A;  2OWH A;  1LSX A;  3IBJ A;  3KX0 X;  2W1T A;  3T4T A;  1S66 L;  5G4Z A;  5F68 A;  4CLC B;  3PBR A;  4CQH A;  1S4R A;  2KDK A;  2JKR M;  1OJG A;  4GLQ A;  3BQ8 A;  3KYQ A;  2VJW A;  5HWW A;  3PYP A;  3H7W A;  2KX6 A;  2MJ6 A;  5F69 A;  5KIZ A;  2K7S A;  4HP9 A;  5J4E A;  3VOL A;  3F1P B;  4CLC C;  4F3L A;  1H8M A;  4HNB A;  4M4X A;  5F5Y A;  3BJN A;  3HJI A;  2ZBB A;  4DMZ A;  5IT5 A;  4ETZ A;  2I9V A;  3MQ0 A;  4HJ4 A;  3IBR A;  3T4L A;  4B9O A;  3OLO A;  1STZ A;  3PR6 A;  2OWJ A;  2JKR I;  3VV4 A;  2VX8 A;  3LID A;  4G3K A;  4MDZ A;  2XRN A;  3KSG A;  5J3W A;  1LSV A;  5HD5 A;  3T4K A;  1T1A A;  3GDI A;  3UMD A;  3A0S A;  3LIE A;  3OCL A;  3UME A;  1TS7 A;  3D3O A;  5A8B A;  2W1T B;  5HSQ A;  1XJ6 A;  1TD5 A;  4GCZ A;  2O9A A;  3R7W A;  1N9N A;  4IUK A;  4FOF A;  1T1B A;  3FPV A;  5HL6 A;  4YOF A;  4BJP A;  2W3H A;  1VHM A;  3CUE A;  3LUQ A;  4EEU A;  4F3L B;  3BQA A;  3EEA A;  4ZRR A;  5AVF A;  4OOL A;  1OT9 A;  4Q0H A;  4R6L A;  4KQO A;  1T19 A;  5EFW A;  3C2W A;  4CLC E;  3KYZ A;  3PHY A;  4O8G A;  3EQU A;  4KQD A;  3OCN A;  5IS1 A;  4I38 A;  3CIT A;  3HJK A;  4L9G A;  3B33 A;  2W3F A;  4JGR A;  4AFI A;  2V0W A;  3FPW A;  4R70 A;  5L8M A;  5HPF A;  3LIB A;  5C5K A;  1G28 A;  3KSI A;  4Y3I A;  1N9L A;  2J3W A;  1MZU A;  2K2N A;  5CX7 A;  3MF0 A;  3BW6 A;  3KSH A;  4NEE D;  3RFB A;  2J80 A;  3R7W B;  3ULF A;  2A2L A;  4H6J A;  2ZOI A;  5F6A A;  3K3D A;  4GJ4 A;  4BBT A;  1UWN X;  3LIA A;  2W1R A;  4KUK A;  2O9B A;  3EEH A;  4Q0J A;  4WLA A;  3LR4 A;  3E0Y A;  3F1N B;  4HP4 A;  2PD8 A;  2XA7 S;  2K31 A;  1D06 A;  4BMW A;  3KSF A;  3E4P A;  4L0L A;  4G3V A;  2VGL S;  3EWK A;  2PDR A;  3CUE C;  1Y28 A;  4I3A A;  1MC0 A;  3DBA A;  3MQO A;  2ZOH A;  4IUH A;  4LRZ E;  1GSX A;  2GX5 A;  2W3D A;  4FSF A;  4GS9 A;  4DJ2 A;  3MMH A;  1VB6 A;  1OT6 A;  1XJ4 A;  1DP8 A;  3LR0 A;  1MKM A;  3R4K A;  4WF0 A;  5DJT A;  4H6J B;  4P6Z S;  2PR5 A;  3NHQ A;  2D01 A;  4NXB A;  3EOI A;  4R3A A;  2PYR A;  1YSP A;  2D02 A;  4MN5 A;  1G6O A;  1LSW A;  4I3I A;  2KLI A;  2L1M A;  1XFQ A;  1X0O A;  4JGO A;  3UE3 A;  3B47 A;  2EA9 A;  4ARZ A;  1NRJ A;  3FG8 A;  3UE6 A;  5KSH A;  4EUV A;  3E4Q A;  3UB8 A;  1NLZ A;  1T1C A;  1OTE A;  2B18 A;  2Z6C A;  3PBO A;  3NOP C;  4CLC D;  2O9C A;  2A24 B;  2IA2 A;  2YKF A;  4GS9 B;  1DP6 A;  2GJ3 A;  4HOI A;  3TJZ C;  2NUT C;  5TJJ A;  2PR6 A;  2QJ7 A;  5HWT A;  2HF6 A;  3A0R A;  4LLO B;  3RH8 B;  1TS0 A;  2HV1 A;  3LIC A;  5AJG A;  5G4Y A;  5K5B A;  5J7E A;  2PHY A;  3H82 A;  1NLY A;  1TF1 A;  2GZA A;  5DKK A;  2INW A;  4WN5 A;  3H7W B;  5FL3 A;  2JKT M;  4DJ3 A;  3C8C A;  2EWW A;  1OTB A;  4L9E A;  2J3T C;  3IS2 A;  3OOV A;  1F5M A;  4PKY G;  2KOI A;  5MC7 A;  1S1Y A;  2W27 A;  3C30 A;  1TS6 A;  2G7U A;  2WKP A;  4ARZ B;  2QKP A;  1S1Z A;  1XJ3 A;  1JNU A;  4EXO A;  2JN7 A;  3D72 A;  1T18 A;  2JKT I;  3V67 A;  4I5S A;  3ZYT A;  4II7 A;  1N9O A;  1S67 L;  3EGX C;  2XRO A;  2Z6D A;  5HDS A;  2V0U A;  3VE4 A;  3CWF A;  4DN0 A;  3RTY A;  1XJ2 A;  4OOM A;  4LRY C;  1P9R A;  4NXG A;  3UB7 A;  4LPZ A;  2OOL A;  4WUJ A;  3ICY A;  2M7U A;  2P08 A;  3B42 A;  1OTI A;  2H28 A;  1OPX A;  3H82 B;  3PBQ A;  4O01 A;  4UEY A;  4JGP A;  2W0N A;  3NJA A;  4Y5F A;  3UB9 A;  4G3W A;  2VKS A;  1P9W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...