2PD8A

1.8 angstrom crystal structure of the cys71ser mutant of vivid
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
148
structure length
148
Chain Sequence
HTLYAPGGYDIMGYLIQIMNRPNPQVELGPVDTSSALILCDLKQKDTPIVYASEAFLYMTGYSNAEVLGRNCRFLQSPDGMVKPKSTRKYVDSNTINTMRKAIDRNAEVQVEVVNFKKNGQRFVNFLTMIPVRDETGEYRYSMGFQCE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Vivid PAS protein VVD
publication title Conformational switching in the fungal light sensor Vivid
pubmed doi rcsb
source organism Neurospora crassa
molecule tags Circadian clock protein
total genus 37
structure length 148
sequence length 148
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13426 PAS_9 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2pd8A00
4HI4A 4WF0A 3G6OA 3KX0X 2INWA 1LSWA 2PD8A 2B02A 4GS9B 3NOUC 1S1YA 4WN5A 2QKPA 1S4SA 4H6JB 2OWJA 1S1ZA 4HIAA 1LSXA 4XT2A 3LICA 3RTYA 3EEHA 1KOUA 4NXEA 4I39A 4GW9A 3HJIA 2BASA 3IS2B 5J7EA 2K7SA 2PR6A 1OTEA 2V0WA 3C8CA 1P97A 5HD3A 4KUKA 2JHEA 5IU1A 4F3LA 4KUOA 2Z6CA 3CLOA 5TBMB 3H7WB 5F69A 1LL8A 1DP9A 3NJAA 3F1PB 5EFWA 1TS6A 1XJ6A 3MXQA 4WUJA 4EETB 1T1BA 5DKLA 5J3WA 3BY9A 3MQQA 4HP9A 3LI9A 3HJKA 3P7NA 3F1NB 4R6LA 5DKKA 2OWHA 3C2WA 2Z6DA 1DP8A 4I5SA 4B9OA 4I38A 1S66L 4DJ2A 2H28A 3VOLA 2M1CA 5A8BA 2L4RA 2I9VA 2VV6A 3F1OA 4JGQA 2QJ7A 1TS8A 3MR0A 4EESA 1NWZA 1UWPX 3UMEA 3LIAA 2PHYA 1XFNA 3K3DA 2A24A 1Y28A 2V1AA 1DRMA 4LRXC 3LIDA 3MJQA 3BWLA 5HZHA 4NXFA 1T1AA 3UB9A 5HWVA 2WKQA 3UMDA 1XJ3A 3VE3A 3NOPC 5HD5A 1S67L 1D7EA 4HQAA 1ODVA 4HY8A 4HH2A 1LSVA 1OTBA 5KIZA 4XT2B 3GECA 2V1BA 3A0RA 4JGPA 3E4OA 5AVFA 4E04A 1P0ZA 2PD7A 5F68A 2J80A 1XJ2A 3LUQA 3PHYA 2KX6A 1XFQA 3BY8A 2P7JA 1OT6A 4MN5A 3MQOA 1F9IA 2W27A 1V9YA 2PYPA 2L0WA 2ZBBA 4F3LB 4BBVA 2R78A 2HV1A 2ZOHA 2QJ5A 2D01A 4HH3A 4I3AA 1VB6A 3SW1A 2VLGA 5G4YA 3A0SA 4JGOA 5HDDA 2V0UA 1JNUA 1BYWA 4EQ1A 1DP6A 1OT9A 1GSXA 3E4PA 4KQDA 2EA9A 4LRYC 2OOLA 3LYXA 2VEAA 1LT0A 3RH8B 4WL9A 3IBRA 3F1PA 2JN7A 5J4EA 3H82A 1EW0A 1V9ZA 3F1OB 1WA9A 3UB6A 4EEPA 2YKHA 2QWSA 1N9LA 2A24B 1GSVA 2QHKA 3H9WA 2YKFA 2W0NA 4NXBA 4NXGA 5HDCA 3MFXA 4M4XA 1F98A 1X0OA 1OTIA 5DJUA 1T19A 4HNBA 3CAXA 5HDSA 2PYRA 3GDIA 2D02A 2VV8A 5F5YA 2ZOIA 1OJGA 3LIEA 4GHIA 1XJ4A 5HWTA 4BBUA 4EW7A 3NOTC 3D72A 4L9EA 3ZQ5A 4GS9A 1G28A 1OTDA 3UB7A 3UE6A 3CWFA 3LIFA 1T1CA 4H6JA 1S4RA 4DJ3A 4I3JA 4R3AA 4EXOA 4YWZA 3B33A 2PR5A 4PKYA 3ULFA 1UGUA 4RQ9A 1N9OA 4LRZE 3PYPA 3FG8A 3VE4A 4GCZA 4L9FA 3IS2A 5AVEA 2GJ3A 3K3CA 3LIBA 1MZUA 4R38A 3ICYA 1TS7A 5HSQA 4HHDA 1D06A 4JGRA 4LLOB 4LPZA 5TBMA 2WKRA 3H7WA 1OTAA 3T50A 4HJ3A 3H82B 2PDRA 1T18A 3UB8A 2L1MA 4L9GA 2V9AA 2CMNA 3FC7A 4HOIA 3F1NA 4WLAA 5DJTA 3A0VA 2KDKA 2WKPA 5HWWA 1N9NA 4HP4A 2VV7A 4HJ6A 4HJ4A 5I5LA 3E4QA 3EWKA 4PKYG 1UWNX 4MN6A 4R70A 3OLOA 4EERA 1OJ5A 3NHQA 1GSWA 3LI8A 1TS0A 4K08A 4BBTA 4GHIB 4EEUA 5IS1A 4I3IA 5G4ZA 5F6AA
chains in the Genus database with same CATH superfamily
1Q2QA 4HI4A 1LLBA 3G6OA 4U0TA 2WKHA 2INWA 1H5XA 4EBLA 1I2SA 4CQHA 3NOUC 2H10A 4E3NA 3DWZA 3IX8A 3Q82A 2ZC3B 4H6JB 2XGNA 5FQMA 1ESIA 2ZMVA 2XEPA 2XQZA 4MCWA 3OBFA 2P9VA 3RTYA 3LCEA 3K2NA 3UO9A 3LEZA 2HJEA 4KZ5A 1RGZA 2Y2JA 1KOUA 1PNEA 3UNWA 5F1GA 1KE3A 3WS1A 3HJIA 3IS2B 1BULA 2XDMA 4JF6A 4MDZA 1SCWA 1N4OA 4FCFA 5HAPA 2LB5A 1OTEA 3C8CA 3MZEA 5FQJA 2HJ9C 1YLWA 5DTSA 4PM6A 1KVLA 2Y79A 4CLCD 5EOOA 1PFLA 2Z2LB 3IF5A 2J3WA 2C6WB 4ID4A 4P6ZS 4F94A 2FFFB 3G30A 1S6RA 4JXWA 4R4SA 2HP5A 1SDEA 4RA7A 1WYBA 4EETB 4S2NA 3M2KA 1O7EA 1TD5A 3L7HA 3F1NB 3C2WA 1I2WA 2Z6DA 1DP8A 4FD8A 5FL3A 3B3XA 2H28A 2J7VA 2O0YA 5K5BA 1BTLA 3OPPA 3VSKA 3S7PA 1FCOA 4Y5FA 3MF0A 1PWDA 4O01A 2NUPC 3V50A 2O9CA 1K25A 3MR0A 1NWZA 2HDSA 4D2OA 3SS3A 4LFUA 4G3WA 1W63Q 4U3TA 2V1AA 4JXGA 5HFOA 3DTIA 3BRMA 4WM9A 3MJQA 4O0PA 3Q07A 4WYYA 5DFYA 5HZHA 3Q1FA 4X6TA 4OLDA 1ZKJA 5E2EA 5FQKA 1FR1A 2X01A 1GHPA 2K2NA 5KSCA 4ZRRA 4GB7A 5CECA 1IELA 4N92A 1PI4A 4HY8A 1LSVA 3VFHA 5JYPA 4WEKA 5FDSA 4IVKA 1P0ZA 1SKOB 4BL3A 3HL9A 2J80A 2WK0A 4PM5A 1BUEA 3LUQA 2KX6A 1HLUP 3IXDA 3BY8A 5EE8A 2AVXA 2OSUA 4CPKA 2L0WA 2WGIA 4F3LB 4BBVA 2WAFA 5E43A 2HV1A 2Y91A 3ISGA 1ZC2A 2WADA 5CXWA 3JYIA 3MFDA 1VB6A 2PBYA 5CGWA 1ERQA 4OQHA 1XGIA 3IF6B 4E3LA 4KZ6A 4DN0A 1DP6A 5CX7A 3MXSA 4UAAA 2Q9MA 1VEUB 4P6BA 2OOLA 4GD6A 4GKUA 3LYXA 4DRTA 4OOLA 1CF0A 3N8LA 5HX9A 3HLGA 4WL9A 3IBRA 1W8YA 3UE3A 2EWVA 3CPTB 1EW0A 4QPRA 2HDRA 2QYBA 3A3DA 1WA9A 4R23A 1N9LA 1P9RA 1MWTA 3T4OA 3H9WA 3MSHA 4X69A 2FH5A 4HBUA 4DMZA 2W0NA 2W1TB 4NXBA 4NXGA 4BL2A 4OQGA 2IWDA 3HLEA 4IVIA 2J9PA 1CEGA 1H8YA 3MZDA 3NECA 4QY6A 3CITA 3EQVA 3WRTA 4PPRA 4C3QA 2WGVA 2Y2HA 5A90A 3PBSA 4QJGA 2JBFA 5AQBA 1GA9A 5HW3A 4EW7A 3NOTC 3RJUA 4P85A 2J3TC 1ONHA 1G28A 1OTDA 1NZUA 2XA7S 4WELA 3QP2A 1T1CA 4H6JA 5HPFA 5GHYA 1CJFA 1LI0A 4I3JA 4R3AA 4XUZA 3BFFA 3B33A 4WZ5C 3S7NA 1UGUA 5FI2A 1L0EA 4LRZE 2DRWA 3FG8A 4D60A 3OPHA 2Y4AA 3LO7A 4GCZA 4L9FA 3IS2A 3R4KA 5L2FA 1YSQA 1MBLA 1K56A 3BEBA 4MN7A 3SOIA 4R38A 4HHDA 3QP1A 2DMWA 4KQRA 4LLOB 3KYZA 4LPZA 1K4EA 1YQSA 1OTAA 3PBOA 3N6IA 4LENA 4HJ3A 2WKEA 3H82B 3ITBA 3S22A 3T4TA 1E3UD 5M18A 1T18A 1OMEA 4Q8IA 4E3KA 3UB8A 1YLPA 2L1MA 5IT5A 3HLBA 3F1NA 3OZHA 1J9MA 1GA0A 1SDNA 4OKPA 1H8MA 3IHBA 1MY8A 3O86A 3N8RA 3U4LP 4H8RA 4ZJ3A 5I5LA 3E4QA 4O8GA 1IOUA 4PKYG 1UWNX 4IUHA 3B42A 3BQ8A 4R4RA 4GDBA 3OC2A 4DE3A 3BJNA 4EERA 1OJ5A 5BOHA 2A49A 4WZ5A 5DF9A 1YAXA 2HZ5A 5FAOA 1Y4OA 2HP9A 4NG2A 3WS4A 2VX8A 2JKGA 4BBTA 1FQGA 4GHIB 3IF6C 4CJNA 1XKZA 2W1RA 4EEUA 3MXRA 2VGKA 3IH8A 1FOFA 4O7DA 1PIOA 5IS1A 4XXRA 4G3VA 3VP3A 4N9KA 5CTNA 3ITAA 4OP5A 2H0TA 5FATA 4OPQA 3GR2A 1LSWA 4GS9B 1PZPA 2ZC5B 1MKMA 4WN5A 4FOFA 2QKPA 2Q0OA 4IEDA 4LV1A 4B88A 2GDNA 3AGEA 3V67A 1S1ZA 3E0YA 2EXBA 3LICA 5FQ9A 3ZNTA 5CTMA 5HL6A 1SKOA 3UY6A 4GZBA 5E2GA 1HTZA 1Z09A 1L0FA 3BLSA 4GDNA 5J7EA 2K7SA 5D3OA 2EFUA 4Y3IA 5HD3A 3S7QA 4F3LA 2X71A 4NKPA 4N1HA 1NLYA 2HGVA 2Z6CA 3LR3A 3H7WB 3MKFA 1JVJA 5E2FA 3IHAA 3W2ZA 2XK1A 1XJ6A 2G2UA 5I94A 2EX6A 3ZVTA 4FH2A 3IF6A 3T4JA 5DKLA 5J3WA 3BY9A 4G3KA 4Z1WA 3LI9A 4E3JA 3UPPA 3IBJA 1IYOA 5LBRA 4OH0A 2JKRI 2B95A 5AQ7A 2O9BA 3VOLA 3T4SA 2M1CA 1M6KA 5FAPA 1H8ZA 4DDSA 5A8BA 3UDXA 3CMZA 1P9WA 4MMNA 3CUEC 4JGQA 5A91A 1TS8A 1KE4A 4S2KA 4EESA 4OQIA 1UWPX 1IFQA 3FPWA 1NJ4A 3IH9A 3LIAA 5HAIA 2NUTC 2PHYA 3A3FA 3UE0A 4R3BA 1Y28A 4E6WA 3BM6A 4LRXC 2UWXA 4KZ8A 4S2NC 2W1TA 3T12B 4LV3A 4WBGA 3QNBA 3T1RA 2PAVP 5HD5A 3DTKA 3SS5A 4BLMA 1D1JA 5AJGA 4HH2A 1PW8A 2ZQ7A 2W3HA 3WS2A 4NK3A 1OTBA 3LGOA 4XT2B 2V8FA 2Y2QA 4PAUA 4BD1A 3TW8A 5L10A 2BLSA 3G31A 2P7JA 1F9IA 3BFDA 2Q9NA 2JKTM 3VV4A 3NC8A 1V9YA 3N8SA 3ZHHA 2PYPA 3IXBA 2ZBBA 5KMWA 3VP2A 3LR5A 2R78A 2ZL1B 4NETA 4R1GA 3CUEA 3PTEA 5GLCA 3WRZA 5G4YA 3A0SA 4JGOA 3PBQA 5CHMA 3GRJA 4KQQA 2V0UA 2V20A 2EX2A 1SKFA 1FILA 5TFQA 3EEAA 2XD5A 3UE1A 4X55A 1W5DA 1LT0A 4QHCA 1KE0A 1DJBA 3KSIA 3O5YA 4E3OA 1CQAA 2IA2A 3H82A 3MKEA 1V9ZA 3F1OB 4LCLA 5CGXA 5CEDA 2QWSA 1E4DA 4B4ZA 3Q81A 2A24B 1K55C 4OPYA 4CLCB 4DE1A 5HL1A 3B47A 5EVID 1KDWA 5L8MA 1A0KA 1LL5A 2VK3A 1TEMA 5CHJA 3KSFA 2OAQ1 2QPNA 1F98A 5CERA 1X0OA 1OTIA 1NYMA 1FSWA 1MC0A 5HDSA 2OV5A 3P01A 1IKIA 3ZCZA 2G7UA 4UA6A 1RCJA 1RGYA 3LR0A 1E25A 1Z6FA 2E8JA 1OJGA 4GHIA 1XJ4A 3DWKA 1DJAA 4BBUA 3LY4A 1BLCA 2ZQDA 3UPOA 2WAEA 3D72A 3ZQ5A 4GS9A 1M40A 3T4LA 3QP8A 3CWFA 2A3UA 4B93A 3O88A 1ONGA 5A92A 4OOMA 1LI9A 4MBKA 5FDHA 4PKYA 1N9OA 1O07A 2RCXA 3D3OA 3QNCA 3PYPA 1K55A 1HD8A 5AVEA 3C7UA 3IQAA 1XA1A 1MWRA 4S2OA 3SS4A 3LIBA 4KG2A 1ACFA 1HVBA 2O9AA 1D06A 2GZAA 3H7WA 3FYZA 5FA7A 3IWOA 4S2LA 1YPRA 1JTGA 3ZYTA 5FEGA 2PDRA 3C4OA 3GSGA 1IYPA 4YNRA 2B18A 4OQ0A 3BYDA 1MWSA 4WEJA 1ZHHB 4ARZB 4OPRA 2V9AA 2CMNA 4HOIA 3TRCA 4JKTA 2KDKA 1YKDA 2XROA 3A3EA 5HWWA 2J8YA 4HP4A 4HJ6A 4LGWA 1ESUA 2LB9A 4BQMA 4YOFA 4Y0UA 2KLIA 2IWBA 5GHXA 2G2WA 2Y2PA 3QHYA 2R9XA 2PRFA 3DAVA 4R70A 2ZMFA 3JVUA 3NHQA 1STZA 1GSWA 2H5SA 1TS0A 1K57A 4JXVA 4IHQA 4A5RA 3UN7A 1ES5A 1YT4A 3QP5A 3HUMA 2WZZA 1YLYA 5C5KA 1HZOA 4DE2A 3KX0X 1L0DA 3IWIA 4UHUA 1S1YA 4WMCA 3TJZC 2JKFA 4LV0A 5DF7A 1AWIA 2OWJA 3C30A 3JVVA 2KOIA 4HIAA 3T1SA 1LSXA 4XT2A 4JPMA 4C75A 1G6AA 3M6HA 3T4KA 4HEFA 1ZG6A 1Q2PA 2EX8A 2MJ6A 3G4PA 4I39A 4CLCC 2W3FA 3NY4A 4S2JA 3W4QA 2PR6A 4PMAA 2PU4A 5EV0A 3KSGA 2V0WA 3LR4A 3C38A 5M19A 3OCLA 5GL9A 4KUKA 2JHEA 4IBRA 3NULA 2WUQA 2ZL1A 3CLOA 3MZFA 1PRQA 1BLPA 2ZQ9A 2QMIA 1RP5A 4KZBA 2PT7A 3NJAA 1MPLA 3GQZA 4KZ4A 1TS6A 3OPLA 2ZC6B 3MXQA 3DBAA 1K54C 3VOZA 3T1XA 3MQQA 3KYQA 3HJKA 2XFTA 4ZJ1A 4Q0IA 3FWLA 5CRFA 3U2AA 3OOVA 4I5SA 4B9OA 4I38A 4DJ2A 1NZOA 4EWFA 2CC1A 2JKRM 3ZG8B 3TSGA 4X1MA 3G32A 1XXMA 2I9VA 1KGFA 3A3JA 1ALQA 3E98A 3F1OA 3MMHA 3MQ0A 3UMEA 2UV0E 4X53A 3C5AA 2VA0A 3K3DA 2A24A 3SH8A 1TF1A 5EM1A 5HARA 4CLCA 3T4QA 1GCEA 3LIDA 2K31A 1IEMA 1TVFA 2ZM8A 1K0KA 2M7VA 4NXFA 2XH9A 5F83A 3PBTA 1BLSA 3JPUA 4Y2FA 2WKQA 3UMDA 3VE3A 5F82A 2ZM2A 1K38A 1S67L 1D7EA 1ERMA 4HQAA 5AQAA 1TDGA 1ODVA 4DE0A 1AXBA 3HUOA 1ZG4A 3DW0A 4UQIM 2EX9A 3GECA 3A0RA 1K54A 3AGDA 4XUXA 4DXCA 2JC7A 1IYQA 3QP6A 1H0MA 1SZVA 5MC7A 4QWOA 4IBXA 4X1LA 2BG1A 1BZAA 5J8XA 3EGDC 1N9BA 3IXGA 4HESA 2BTFP 2XFSA 4AFIA 3HLWA 2V2FF 2WGWB 3TE8A 2QJ5A 2D01A 1WE4A 4I3AA 4BENA 5HAQA 3FV7A 2M7UA 2WKIA 5GHZA 1NYYA 3FKVA 1ES2A 4Y0TA 4YFMA 1S0WA 1YLJA 2HP6A 4GOGA 2WYXA 3O3VA 1JNUA 1LHYA 4EQ1A 2ZQCA 4DF6A 1W7FA 3OCNA 5CHUA 4ETZA 3SZTA 3E4PA 2EA9A 5HPIA 4ZBEA 3W4OA 1JWVA 1DJCA 3CG5A 2X02A 4UQIS 3F1PA 4UA9A 1PWCA 2Y2MA 1CEFA 1WYCA 4E3MA 4JLFA 3BFEA 5JYOA 3ZFZA 3S4XA 3V3RA 4ARZA 4IUKA 1GSVA 2QHKA 2DNSA 4GJ4A 3WS5A 1KGEA 3GMWA 3HVFA 3ZGAB 3N4IA 2W3EA 3Q7VB 5AQ9A 1QMEA 4KQOA 3ZNYA 4UEYA 2QZ6A 4BMWA 2GX5A 2OLVA 1W63M 5DJUA 4JXSA 3PBNA 1T19A 3VP1A 2PYRA 3GDIA 4P6ZM 3NI9A 3BLMA 1K56D 1ES4A 3AGFA 2VV8A 3BFGA 3VMAA 4RYEA 4Q0JA 2ZOIA 2FFYA 1XP4A 5FSRA 3IWQA 1U60A 3V39A 1OPXA 1NRFA 4K0WA 2V1ZA 1K4FA 3RFBA 4L9EA 4ESPA 5EVEA 2VZWA 1VM1A 2B5RA 4EBNA 1CK3A 3ZDJA 3LFVA 3NIAA 5IHVA 2J3TD 4R3JA 3HLCA 4RX3A 4YWZA 2PR5A 5FI6A 3ULFA 5DTTA 5EM0A 3PR6A 4GD8A 3VE4A 4RX2A 3G34A 4FTXA 4EU0A 3FPVA 2PU2A 5E2HA 3R7WB 4OPZA 1FCNA 1JTDA 3K3CA 3HLDA 3V5MA 3WWXA 2Y59A 4ETXA 2C5WB 1TS7A 5HSQA 4JGRA 3PXPA 1KVMA 5EOEA 2VJWA 4P0MA 5G18A 1FSYA 3T50A 4C6YA 3S1YA 2IWCA 2WZXA 3DTEA 4QY5A 3FC7A 5FAQA 3ZVWA 5KSHA 3VP0A 3VP4A 2XD1A 3A0VA 3G2YA 3N7WA 4BD0A 2EFXA 2JE5A 2VV7A 3CI6A 4OONA 3T1QB 4ME4A 3FZCA 1PWGA 3EWKA 3HUNA 1IYSA 3PAGA 5M1AA 5FQIA 3IX3A 4Y7PA 2OLUA 1CI9A 3LI8A 4MEZA 5DF8A 3NDEA 5EVLA 3CHWP 3D9YA 4S2MA 1PYYA 4K08A 1VQQA 2HDQA 4NEED 3ZG9B 4YINA 3LEQA 3PAEA 2RL3A 2ACGA 5G4ZA 5CEBA 1PI5A 5F6AA 3WS0A 1E3UA 4WF0A 4KZ7A 1JWZA 2PD8A 2B02A 4E3IA 5FQQA 5U47A 1S4SA 2ZM0A 1C3BA 1LL9A 2HDUA 2A2LA 5EVIB 1NLZA 4X68A 4Y13A 5L09A 5EUAA 3GV9A 1L3LA 3EEHA 1MKIA 1NRJA 4JBFA 1K57C 2XRNA 4GN2A 4NXEA 4Q0HA 2Y2NA 2JKTI 2ZMAA 4DDYA 4GW9A 4K91A 5GLBA 2BASA 1H3QA 3ZG7B 2XLNA 3VSLA 4MBHA 1P97A 2R9WA 1BSGA 5IU1A 1KDSA 2WGWA 4PM7A 3BW6A 4KUOA 5TBMB 1MWUA 5F69A 2HPBA 4P87A 1LL8A 1YLZA 1DP9A 1L2SA 3EGXC 3F1PB 5EFWA 3TOIA 4FH4A 3TG9A 1VETB 4WUJA 3RXXA 2H0YA 1T1BA 3NDGA 1TDLA 4HP9A 3P7NA 4R6LA 1JWPA 5DKKA 5FI7A 5GLDA 4DXBA 2OWHA 3QP4A 1L0GA 5DTKA 4U0XA 1S66L 1K6RA 2XA7M 4EQIA 3W4PA 1YSPA 2L4RA 2DCFA 3D4FA 4EBPA 2ZQ8A 3UB5P 4S2PA 4QU3A 2VV6A 4KZAA 2QJ7A 3P98A 3O87A 3SH9A 2E8IA 3BFCA 3EOIA 1EWZA 1XFNA 2EWWA 1XX2A 3MBZA 1DRMA 4Y17A 3BWLA 4Z9QA 3HLFA 1T1AA 2XR0A 4UA7A 3UB9A 5EPHA 3P09A 4WZ4A 1W8QA 3Q7VA 2ZLYA 4KENB 5HWVA 3BECA 1XJ3A 3S7OA 1GHMA 3NOPC 1FIKA 4LCMA 1PW1A 4GLQA 1BLHA 5KZHA 4HBTA 4CLCE 2JCHA 4N9LA 5KIZA 1XGJA 1Y54A 3VFFA 4FUWA 2V1BA 2P9VB 2W3GA 3HBRA 4JGPA 3E4OA 4E04A 2ZD8A 1NY0A 3VOYA 2PD7A 4EV4A 1W79A 5F68A 2GNXA 1J3WA 1XJ2A 1FR6A 4EUZA 4BWIA 3PHYA 2HF6A 1XFQA 1YMXA 1XPBA 1OT6A 4MN5A 3FKWA 3HREA 3MQOA 2Y2KA 2ZQAA 4ZDXA 2W27A 5F1FA 3IX4A 3MS6A 2ZOHA 3ZG5A 4HH3A 4KG5A 1PZOA 3UDFA 3KO6A 3SW1A 2VLGA 4Y0OA 4S2IA 2ZC4B 1ZTUA 5HDDA 4QB8A 2VKSA 3R7WA 2XSSA 1BYWA 3PBRA 1EI5A 1OT9A 1GSXA 4PM8A 4KQDA 4LRYC 2VEAA 3RH8B 4GNUA 3IT9A 5FEFA 2JN7A 1YLTA 1VHMA 5J4EA 3CJMA 5EVIC 3RXWA 2ZC7A 3ZG0A 4IJGA 4N1XA 4EUVA 3UB6A 2VGLM 2YKHA 3HCYA 4EEPA 2J9OA 4QD4A 4L0LA 4FSFA 4R0QA 2YKFA 1DY6A 2Y2OA 5A93A 3I7JA 5HDCA 4OOYA 3UDIA 1ES3A 3MFXA 4M4XA 3C7VA 4MNRA 1YM1A 4HNBA 2P74A 3CAXA 5DVAA 2Y2LA 2VGJA 1KGGA 2D02A 4ZJ2A 4E6XA 3W8KA 5F5YA 3E2KA 5L07A 3LIEA 5CGSA 1CI8A 1IKGA 2O99A 5HWTA 4KZ9A 2P04A 3M2JA 3KYEA 3L9KA 3NBLA 4ZTKA 2OAP1 1FCMA 3UB7A 3G2ZA 4MLLA 2Z2MB 3UE6A 1G6OA 3LIFA 2Y8HA 2Y55A 1S4RA 5EECA 4K0XA 4DJ3A 5EVIA 1MXOA 2VGLS 3CZDA 4EXOA 1F2KA 1G5UA 4OLGA 1NXYA 4DKIA 1QMFA 4RQ9A 5TR7A 4LV2A 4Y15A 5GLAA 4II7A 4KZ3A 3G35A 3E2LA 1XA7A 3V3SA 2GJ3A 4B4XA 1EROA 1I5QA 1G68A 1YMSA 5DFXA 4KG6A 2Y2IA 1MZUA 3NCKA 3ICYA 4JF5A 4M3KA 5TJJA 3LY3A 5TBMA 2WKRA 3GTCA 4JF4A 1GHIA 4X56A 1SHVA 3GVBA 1VETA 3A3IA 3SH7A 4PM9A 3BQAA 4L9GA 3DTMA 4WMCD 4BJPA 2EXAA 3C4PA 4WLAA 5DJTA 1K6SA 4OVDA 2I72A 1VEUA 2WKPA 5TGFA 2XF3A 1N9NA 2ZJ9A 3EQUA 3Q7ZA 2V8CA 4HJ4A 2Y2GA 4PHTA 2PBDP 3KSHA 3CPTA 5FASA 2FZ0A 4MN6A 1F5MA 3M6BA 3OLOA 3OPRA 2P08A 4RVAA 4OP8A 1BT5A 4ZAMA 3UPNA 4X25A 4MBFA 2W3DA 3IXHA 4I3IA 5AVFA
chains in the Genus database with same CATH topology
4HI4A 5C5KA 4WF0A 3G6OA 3KX0X 2INWA 1LSWA 2PD8A 2B02A 4GS9B 4CQHA 1MKMA 1S1YA 3NOUC 4WN5A 4FOFA 2QKPA 3TJZC 1S4SA 4H6JB 2OWJA 3C30A 3V67A 2ZMVA 3JVVA 1S1ZA 2A2LA 2KOIA 3E0YA 4HIAA 1NLZA 4MCWA 1LSXA 3OBFA 4XT2A 3LICA 3RTYA 3K2NA 3EEHA 5HL6A 2HJEA 3T4KA 1NRJA 1KOUA 2XRNA 4NXEA 4Q0HA 2JKTI 2MJ6A 4I39A 4GW9A 4CLCC 3HJIA 2BASA 3IS2B 2W3FA 5J7EA 4MDZA 2K7SA 1H3QA 2PR6A 2LB5A 3KSGA 1OTEA 2V0WA 3C8CA 4Y3IA 3LR4A 2HJ9C 3C38A 1P97A 3OCLA 5HD3A 3S7QA 4KUKA 2JHEA 2Y79A 5IU1A 4F3LA 4NKPA 4CLCD 1NLYA 3BW6A 4KUOA 2HGVA 2Z6CA 3CLOA 3LR3A 5TBMB 3H7WB 5F69A 2J3WA 1LL8A 4P6ZS 1DP9A 2PT7A 3NJAA 3EGXC 3W2ZA 3F1PB 5EFWA 1TS6A 1XJ6A 3MXQA 4WUJA 3DBAA 4EETB 3T4JA 1T1BA 5DKLA 5J3WA 3BY9A 4G3KA 4Z1WA 1TD5A 3MQQA 3KYQA 4HP9A 3LI9A 3HJKA 3P7NA 3F1NB 4R6LA 5DKKA 4Q0IA 3IBJA 2OWHA 3U2AA 3OOVA 3C2WA 5LBRA 2JKRI 2Z6DA 1DP8A 4I5SA 5FL3A 4B9OA 4I38A 1S66L 4DJ2A 2H28A 2O0YA 2O9BA 5K5BA 2JKRM 3VOLA 3T4SA 2M1CA 2XA7M 1YSPA 2L4RA 5A8BA 3S7PA 4Y5FA 3MF0A 1P9WA 4O01A 4MMNA 2I9VA 2VV6A 3CUEC 3E98A 3F1OA 4JGQA 2NUPC 2QJ7A 1TS8A 2O9CA 3MMHA 3MR0A 4EESA 1NWZA 1UWPX 3MQ0A 1IFQA 3FPWA 3LIAA 3UMEA 3EOIA 2NUTC 2PHYA 1XFNA 2VA0A 3K3DA 4G3WA 2EWWA 2A24A 1W63Q 1Y28A 2V1AA 1TF1A 1DRMA 4CLCA 3T4QA 4LRXC 3LIDA 2K31A 3MJQA 4O0PA 3BWLA 2M7VA 5DFYA 5HZHA 4NXFA 1T1AA 3UB9A 2W1TA 3PBTA 5HWVA 4Y2FA 2WKQA 3UMDA 1XJ3A 3S7OA 3VE3A 3NOPC 2K2NA 5HD5A 1S67L 1D7EA 4ZRRA 4HQAA 4GLQA 1ODVA 4HY8A 5AJGA 4HH2A 4CLCE 2W3HA 1LSVA 1OTBA 5KIZA 4UQIM 4XT2B 3GECA 2V1BA 3A0RA 4WEKA 2W3GA 4JGPA 3E4OA 5AVFA 4E04A 1P0ZA 4PAUA 2PD7A 5F68A 2GNXA 2J80A 1XJ2A 3TW8A 4BWIA 3LUQA 3PHYA 2HF6A 1XFQA 2KX6A 5MC7A 3BY8A 2P7JA 1OT6A 4MN5A 3MQOA 1F9IA 2JKTM 3EGDC 3VV4A 2W27A 1V9YA 4AFIA 2PYPA 2L0WA 2ZBBA 4F3LB 4BBVA 3LR5A 2R78A 2HV1A 2ZOHA 3TE8A 2QJ5A 2D01A 4HH3A 3CUEA 4I3AA 1VB6A 3KO6A 3SW1A 2VLGA 2M7UA 5G4YA 3A0SA 4JGOA 3PBQA 1ZTUA 5HDDA 2VKSA 4DN0A 2V0UA 1JNUA 3R7WA 2XSSA 1BYWA 4EQ1A 1DP6A 3PBRA 5CX7A 3OCNA 1OT9A 3EEAA 1GSXA 4ETZA 3E4PA 4KQDA 2EA9A 4LRYC 2OOLA 5HPIA 3LYXA 2VEAA 4OOLA 1LT0A 3RH8B 4WL9A 3IBRA 4UQIS 3F1PA 2JN7A 3KSIA 3O5YA 1VHMA 5J4EA 2IA2A 3UE3A 2EWVA 3H82A 1EW0A 4QPRA 2QYBA 1V9ZA 3F1OB 4IJGA 1WA9A 4EUVA 3UB6A 2VGLM 2YKHA 2QWSA 3HCYA 4ARZA 4EEPA 4IUKA 1N9LA 1P9RA 2A24B 3T4OA 1GSVA 4L0LA 2QHKA 4CLCB 4FSFA 3H9WA 3B47A 4GJ4A 2YKFA 2FH5A 5L8MA 4DMZA 2W0NA 2W1TB 2W3EA 4NXBA 4NXGA 5HDCA 3KSFA 2OAQ1 3MFXA 4KQOA 4M4XA 1F98A 4UEYA 1X0OA 4BMWA 1OTIA 2GX5A 1W63M 5DJUA 3PBNA 1T19A 4HNBA 3CAXA 1MC0A 5HDSA 2PYRA 3GDIA 4P6ZM 3CITA 3P01A 3EQVA 2D02A 2G7UA 2VV8A 5F5YA 4Q0JA 2ZOIA 3LR0A 1OJGA 3LIEA 4GHIA 1XJ4A 2O99A 5HWTA 3PBSA 2P04A 4BBUA 4EW7A 3NOTC 2OAP1 1OPXA 3D72A 2J3TC 3RFBA 4L9EA 3ZQ5A 4GS9A 1G28A 1OTDA 3UB7A 2VZWA 2XA7S 3T4LA 4WELA 3UE6A 1G6OA 3CWFA 3LIFA 1T1CA 2Y8HA 4H6JA 5HPFA 1S4RA 4B93A 4DJ3A 3LFVA 2VGLS 4I3JA 4R3AA 4EXOA 4OOMA 2J3TD 4YWZA 3B33A 2PR5A 4PKYA 3S7NA 3ULFA 1UGUA 4RQ9A 1N9OA 3D3OA 4LRZE 3PR6A 4II7A 3PYPA 3FG8A 3VE4A 4GCZA 4L9FA 3IS2A 5AVEA 3R4KA 4EU0A 3FPVA 3R7WB 2GJ3A 3K3CA 1YSQA 3LIBA 5DFXA 1MZUA 4MN7A 4R38A 3ICYA 4ETXA 1TS7A 5HSQA 4HHDA 2O9AA 5TJJA 1D06A 4JGRA 3PXPA 2GZAA 2DMWA 4LLOB 2VJWA 3KYZA 4LPZA 5TBMA 2WKRA 3H7WA 1OTAA 3PBOA 3T50A 4HJ3A 3ZYTA 3H82B 3T4TA 2PDRA 1T18A 4YNRA 2B18A 3UB8A 4WEJA 1ZHHB 3BQAA 4ARZB 2L1MA 4L9GA 4BJPA 5IT5A 2V9AA 2CMNA 3FC7A 4HOIA 3TRCA 3F1NA 5KSHA 4WLAA 5DJTA 3A0VA 2KDKA 2WKPA 1H8MA 1YKDA 2XROA 5HWWA 1N9NA 4HP4A 2VV7A 4HJ6A 3EQUA 3CI6A 2LB9A 4ME4A 4YOFA 4HJ4A 2KLIA 4PHTA 5I5LA 3E4QA 3EWKA 4O8GA 3KSHA 1IOUA 4PKYG 1UWNX 2FZ0A 4IUHA 4MN6A 3B42A 3BQ8A 1F5MA 3OC2A 4R70A 3BJNA 2ZMFA 3JVUA 3OLOA 4EERA 1OJ5A 1STZA 3NHQA 1GSWA 3LI8A 1TS0A 5DF9A 2P08A 1YAXA 4IHQA 2VX8A 4K08A 4BBTA 4GHIB 2W1RA 4NEED 4EEUA 2W3DA 5IS1A 4G3VA 4I3IA 5G4ZA 5F6AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HI4 A;  4WF0 A;  3G6O A;  3KX0 X;  2INW A;  1LSW A;  2PD8 A;  2B02 A;  4GS9 B;  3NOU C;  1S1Y A;  4WN5 A;  2QKP A;  1S4S A;  4H6J B;  2OWJ A;  1S1Z A;  4HIA A;  1LSX A;  4XT2 A;  3LIC A;  3RTY A;  3EEH A;  1KOU A;  4NXE A;  4I39 A;  4GW9 A;  3HJI A;  2BAS A;  3IS2 B;  5J7E A;  2K7S A;  2PR6 A;  1OTE A;  2V0W A;  3C8C A;  1P97 A;  5HD3 A;  4KUK A;  2JHE A;  5IU1 A;  4F3L A;  4KUO A;  2Z6C A;  3CLO A;  5TBM B;  3H7W B;  5F69 A;  1LL8 A;  1DP9 A;  3NJA A;  3F1P B;  5EFW A;  1TS6 A;  1XJ6 A;  3MXQ A;  4WUJ A;  4EET B;  1T1B A;  5DKL A;  5J3W A;  3BY9 A;  3MQQ A;  4HP9 A;  3LI9 A;  3HJK A;  3P7N A;  3F1N B;  4R6L A;  5DKK A;  2OWH A;  3C2W A;  2Z6D A;  1DP8 A;  4I5S A;  4B9O A;  4I38 A;  1S66 L;  4DJ2 A;  2H28 A;  3VOL A;  2M1C A;  5A8B A;  2L4R A;  2I9V A;  2VV6 A;  3F1O A;  4JGQ A;  2QJ7 A;  1TS8 A;  3MR0 A;  4EES A;  1NWZ A;  1UWP X;  3UME A;  3LIA A;  2PHY A;  1XFN A;  3K3D A;  2A24 A;  1Y28 A;  2V1A A;  1DRM A;  4LRX C;  3LID A;  3MJQ A;  3BWL A;  5HZH A;  4NXF A;  1T1A A;  3UB9 A;  5HWV A;  2WKQ A;  3UMD A;  1XJ3 A;  3VE3 A;  3NOP C;  5HD5 A;  1S67 L;  1D7E A;  4HQA A;  1ODV A;  4HY8 A;  4HH2 A;  1LSV A;  1OTB A;  5KIZ A;  4XT2 B;  3GEC A;  2V1B A;  3A0R A;  4JGP A;  3E4O A;  5AVF A;  4E04 A;  1P0Z A;  2PD7 A;  5F68 A;  2J80 A;  1XJ2 A;  3LUQ A;  3PHY A;  2KX6 A;  1XFQ A;  3BY8 A;  2P7J A;  1OT6 A;  4MN5 A;  3MQO A;  1F9I A;  2W27 A;  1V9Y A;  2PYP A;  2L0W A;  2ZBB A;  4F3L B;  4BBV A;  2R78 A;  2HV1 A;  2ZOH A;  2QJ5 A;  2D01 A;  4HH3 A;  4I3A A;  1VB6 A;  3SW1 A;  2VLG A;  5G4Y A;  3A0S A;  4JGO A;  5HDD A;  2V0U A;  1JNU A;  1BYW A;  4EQ1 A;  1DP6 A;  1OT9 A;  1GSX A;  3E4P A;  4KQD A;  2EA9 A;  4LRY C;  2OOL A;  3LYX A;  2VEA A;  1LT0 A;  3RH8 B;  4WL9 A;  3IBR A;  3F1P A;  2JN7 A;  5J4E A;  3H82 A;  1EW0 A;  1V9Z A;  3F1O B;  1WA9 A;  3UB6 A;  4EEP A;  2YKH A;  2QWS A;  1N9L A;  2A24 B;  1GSV A;  2QHK A;  3H9W A;  2YKF A;  2W0N A;  4NXB A;  4NXG A;  5HDC A;  3MFX A;  4M4X A;  1F98 A;  1X0O A;  1OTI A;  5DJU A;  1T19 A;  4HNB A;  3CAX A;  5HDS A;  2PYR A;  3GDI A;  2D02 A;  2VV8 A;  5F5Y A;  2ZOI A;  1OJG A;  3LIE A;  4GHI A;  1XJ4 A;  5HWT A;  4BBU A;  4EW7 A;  3NOT C;  3D72 A;  4L9E A;  3ZQ5 A;  4GS9 A;  1G28 A;  1OTD A;  3UB7 A;  3UE6 A;  3CWF A;  3LIF A;  1T1C A;  4H6J A;  1S4R A;  4DJ3 A;  4I3J A;  4R3A A;  4EXO A;  4YWZ A;  3B33 A;  2PR5 A;  4PKY A;  3ULF A;  1UGU A;  4RQ9 A;  1N9O A;  4LRZ E;  3PYP A;  3FG8 A;  3VE4 A;  4GCZ A;  4L9F A;  3IS2 A;  5AVE A;  2GJ3 A;  3K3C A;  3LIB A;  1MZU A;  4R38 A;  3ICY A;  1TS7 A;  5HSQ A;  4HHD A;  1D06 A;  4JGR A;  4LLO B;  4LPZ A;  5TBM A;  2WKR A;  3H7W A;  1OTA A;  3T50 A;  4HJ3 A;  3H82 B;  2PDR A;  1T18 A;  3UB8 A;  2L1M A;  4L9G A;  2V9A A;  2CMN A;  3FC7 A;  4HOI A;  3F1N A;  4WLA A;  5DJT A;  3A0V A;  2KDK A;  2WKP A;  5HWW A;  1N9N A;  4HP4 A;  2VV7 A;  4HJ6 A;  4HJ4 A;  5I5L A;  3E4Q A;  3EWK A;  4PKY G;  1UWN X;  4MN6 A;  4R70 A;  3OLO A;  4EER A;  1OJ5 A;  3NHQ A;  1GSW A;  3LI8 A;  1TS0 A;  4K08 A;  4BBT A;  4GHI B;  4EEU A;  5IS1 A;  4I3I A;  5G4Z A;  5F6A A; 
#chains in the Genus database with same CATH topology
 1Q2Q A;  4HI4 A;  1LLB A;  3G6O A;  4U0T A;  2WKH A;  2INW A;  1H5X A;  4EBL A;  1I2S A;  4CQH A;  3NOU C;  2H10 A;  4E3N A;  3DWZ A;  3IX8 A;  3Q82 A;  2ZC3 B;  4H6J B;  2XGN A;  5FQM A;  1ESI A;  2ZMV A;  2XEP A;  2XQZ A;  4MCW A;  3OBF A;  2P9V A;  3RTY A;  3LCE A;  3K2N A;  3UO9 A;  3LEZ A;  2HJE A;  4KZ5 A;  1RGZ A;  2Y2J A;  1KOU A;  1PNE A;  3UNW A;  5F1G A;  1KE3 A;  3WS1 A;  3HJI A;  3IS2 B;  1BUL A;  2XDM A;  4JF6 A;  4MDZ A;  1SCW A;  1N4O A;  4FCF A;  5HAP A;  2LB5 A;  1OTE A;  3C8C A;  3MZE A;  5FQJ A;  2HJ9 C;  1YLW A;  5DTS A;  4PM6 A;  1KVL A;  2Y79 A;  4CLC D;  5EOO A;  1PFL A;  2Z2L B;  3IF5 A;  2J3W A;  2C6W B;  4ID4 A;  4P6Z S;  4F94 A;  2FFF B;  3G30 A;  1S6R A;  4JXW A;  4R4S A;  2HP5 A;  1SDE A;  4RA7 A;  1WYB A;  4EET B;  4S2N A;  3M2K A;  1O7E A;  1TD5 A;  3L7H A;  3F1N B;  3C2W A;  1I2W A;  2Z6D A;  1DP8 A;  4FD8 A;  5FL3 A;  3B3X A;  2H28 A;  2J7V A;  2O0Y A;  5K5B A;  1BTL A;  3OPP A;  3VSK A;  3S7P A;  1FCO A;  4Y5F A;  3MF0 A;  1PWD A;  4O01 A;  2NUP C;  3V50 A;  2O9C A;  1K25 A;  3MR0 A;  1NWZ A;  2HDS A;  4D2O A;  3SS3 A;  4LFU A;  4G3W A;  1W63 Q;  4U3T A;  2V1A A;  4JXG A;  5HFO A;  3DTI A;  3BRM A;  4WM9 A;  3MJQ A;  4O0P A;  3Q07 A;  4WYY A;  5DFY A;  5HZH A;  3Q1F A;  4X6T A;  4OLD A;  1ZKJ A;  5E2E A;  5FQK A;  1FR1 A;  2X01 A;  1GHP A;  2K2N A;  5KSC A;  4ZRR A;  4GB7 A;  5CEC A;  1IEL A;  4N92 A;  1PI4 A;  4HY8 A;  1LSV A;  3VFH A;  5JYP A;  4WEK A;  5FDS A;  4IVK A;  1P0Z A;  1SKO B;  4BL3 A;  3HL9 A;  2J80 A;  2WK0 A;  4PM5 A;  1BUE A;  3LUQ A;  2KX6 A;  1HLU P;  3IXD A;  3BY8 A;  5EE8 A;  2AVX A;  2OSU A;  4CPK A;  2L0W A;  2WGI A;  4F3L B;  4BBV A;  2WAF A;  5E43 A;  2HV1 A;  2Y91 A;  3ISG A;  1ZC2 A;  2WAD A;  5CXW A;  3JYI A;  3MFD A;  1VB6 A;  2PBY A;  5CGW A;  1ERQ A;  4OQH A;  1XGI A;  3IF6 B;  4E3L A;  4KZ6 A;  4DN0 A;  1DP6 A;  5CX7 A;  3MXS A;  4UAA A;  2Q9M A;  1VEU B;  4P6B A;  2OOL A;  4GD6 A;  4GKU A;  3LYX A;  4DRT A;  4OOL A;  1CF0 A;  3N8L A;  5HX9 A;  3HLG A;  4WL9 A;  3IBR A;  1W8Y A;  3UE3 A;  2EWV A;  3CPT B;  1EW0 A;  4QPR A;  2HDR A;  2QYB A;  3A3D A;  1WA9 A;  4R23 A;  1N9L A;  1P9R A;  1MWT A;  3T4O A;  3H9W A;  3MSH A;  4X69 A;  2FH5 A;  4HBU A;  4DMZ A;  2W0N A;  2W1T B;  4NXB A;  4NXG A;  4BL2 A;  4OQG A;  2IWD A;  3HLE A;  4IVI A;  2J9P A;  1CEG A;  1H8Y A;  3MZD A;  3NEC A;  4QY6 A;  3CIT A;  3EQV A;  3WRT A;  4PPR A;  4C3Q A;  2WGV A;  2Y2H A;  5A90 A;  3PBS A;  4QJG A;  2JBF A;  5AQB A;  1GA9 A;  5HW3 A;  4EW7 A;  3NOT C;  3RJU A;  4P85 A;  2J3T C;  1ONH A;  1G28 A;  1OTD A;  1NZU A;  2XA7 S;  4WEL A;  3QP2 A;  1T1C A;  4H6J A;  5HPF A;  5GHY A;  1CJF A;  1LI0 A;  4I3J A;  4R3A A;  4XUZ A;  3BFF A;  3B33 A;  4WZ5 C;  3S7N A;  1UGU A;  5FI2 A;  1L0E A;  4LRZ E;  2DRW A;  3FG8 A;  4D60 A;  3OPH A;  2Y4A A;  3LO7 A;  4GCZ A;  4L9F A;  3IS2 A;  3R4K A;  5L2F A;  1YSQ A;  1MBL A;  1K56 A;  3BEB A;  4MN7 A;  3SOI A;  4R38 A;  4HHD A;  3QP1 A;  2DMW A;  4KQR A;  4LLO B;  3KYZ A;  4LPZ A;  1K4E A;  1YQS A;  1OTA A;  3PBO A;  3N6I A;  4LEN A;  4HJ3 A;  2WKE A;  3H82 B;  3ITB A;  3S22 A;  3T4T A;  1E3U D;  5M18 A;  1T18 A;  1OME A;  4Q8I A;  4E3K A;  3UB8 A;  1YLP A;  2L1M A;  5IT5 A;  3HLB A;  3F1N A;  3OZH A;  1J9M A;  1GA0 A;  1SDN A;  4OKP A;  1H8M A;  3IHB A;  1MY8 A;  3O86 A;  3N8R A;  3U4L P;  4H8R A;  4ZJ3 A;  5I5L A;  3E4Q A;  4O8G A;  1IOU A;  4PKY G;  1UWN X;  4IUH A;  3B42 A;  3BQ8 A;  4R4R A;  4GDB A;  3OC2 A;  4DE3 A;  3BJN A;  4EER A;  1OJ5 A;  5BOH A;  2A49 A;  4WZ5 A;  5DF9 A;  1YAX A;  2HZ5 A;  5FAO A;  1Y4O A;  2HP9 A;  4NG2 A;  3WS4 A;  2VX8 A;  2JKG A;  4BBT A;  1FQG A;  4GHI B;  3IF6 C;  4CJN A;  1XKZ A;  2W1R A;  4EEU A;  3MXR A;  2VGK A;  3IH8 A;  1FOF A;  4O7D A;  1PIO A;  5IS1 A;  4XXR A;  4G3V A;  3VP3 A;  4N9K A;  5CTN A;  3ITA A;  4OP5 A;  2H0T A;  5FAT A;  4OPQ A;  3GR2 A;  1LSW A;  4GS9 B;  1PZP A;  2ZC5 B;  1MKM A;  4WN5 A;  4FOF A;  2QKP A;  2Q0O A;  4IED A;  4LV1 A;  4B88 A;  2GDN A;  3AGE A;  3V67 A;  1S1Z A;  3E0Y A;  2EXB A;  3LIC A;  5FQ9 A;  3ZNT A;  5CTM A;  5HL6 A;  1SKO A;  3UY6 A;  4GZB A;  5E2G A;  1HTZ A;  1Z09 A;  1L0F A;  3BLS A;  4GDN A;  5J7E A;  2K7S A;  5D3O A;  2EFU A;  4Y3I A;  5HD3 A;  3S7Q A;  4F3L A;  2X71 A;  4NKP A;  4N1H A;  1NLY A;  2HGV A;  2Z6C A;  3LR3 A;  3H7W B;  3MKF A;  1JVJ A;  5E2F A;  3IHA A;  3W2Z A;  2XK1 A;  1XJ6 A;  2G2U A;  5I94 A;  2EX6 A;  3ZVT A;  4FH2 A;  3IF6 A;  3T4J A;  5DKL A;  5J3W A;  3BY9 A;  4G3K A;  4Z1W A;  3LI9 A;  4E3J A;  3UPP A;  3IBJ A;  1IYO A;  5LBR A;  4OH0 A;  2JKR I;  2B95 A;  5AQ7 A;  2O9B A;  3VOL A;  3T4S A;  2M1C A;  1M6K A;  5FAP A;  1H8Z A;  4DDS A;  5A8B A;  3UDX A;  3CMZ A;  1P9W A;  4MMN A;  3CUE C;  4JGQ A;  5A91 A;  1TS8 A;  1KE4 A;  4S2K A;  4EES A;  4OQI A;  1UWP X;  1IFQ A;  3FPW A;  1NJ4 A;  3IH9 A;  3LIA A;  5HAI A;  2NUT C;  2PHY A;  3A3F A;  3UE0 A;  4R3B A;  1Y28 A;  4E6W A;  3BM6 A;  4LRX C;  2UWX A;  4KZ8 A;  4S2N C;  2W1T A;  3T12 B;  4LV3 A;  4WBG A;  3QNB A;  3T1R A;  2PAV P;  5HD5 A;  3DTK A;  3SS5 A;  4BLM A;  1D1J A;  5AJG A;  4HH2 A;  1PW8 A;  2ZQ7 A;  2W3H A;  3WS2 A;  4NK3 A;  1OTB A;  3LGO A;  4XT2 B;  2V8F A;  2Y2Q A;  4PAU A;  4BD1 A;  3TW8 A;  5L10 A;  2BLS A;  3G31 A;  2P7J A;  1F9I A;  3BFD A;  2Q9N A;  2JKT M;  3VV4 A;  3NC8 A;  1V9Y A;  3N8S A;  3ZHH A;  2PYP A;  3IXB A;  2ZBB A;  5KMW A;  3VP2 A;  3LR5 A;  2R78 A;  2ZL1 B;  4NET A;  4R1G A;  3CUE A;  3PTE A;  5GLC A;  3WRZ A;  5G4Y A;  3A0S A;  4JGO A;  3PBQ A;  5CHM A;  3GRJ A;  4KQQ A;  2V0U A;  2V20 A;  2EX2 A;  1SKF A;  1FIL A;  5TFQ A;  3EEA A;  2XD5 A;  3UE1 A;  4X55 A;  1W5D A;  1LT0 A;  4QHC A;  1KE0 A;  1DJB A;  3KSI A;  3O5Y A;  4E3O A;  1CQA A;  2IA2 A;  3H82 A;  3MKE A;  1V9Z A;  3F1O B;  4LCL A;  5CGX A;  5CED A;  2QWS A;  1E4D A;  4B4Z A;  3Q81 A;  2A24 B;  1K55 C;  4OPY A;  4CLC B;  4DE1 A;  5HL1 A;  3B47 A;  5EVI D;  1KDW A;  5L8M A;  1A0K A;  1LL5 A;  2VK3 A;  1TEM A;  5CHJ A;  3KSF A;  2OAQ 1;  2QPN A;  1F98 A;  5CER A;  1X0O A;  1OTI A;  1NYM A;  1FSW A;  1MC0 A;  5HDS A;  2OV5 A;  3P01 A;  1IKI A;  3ZCZ A;  2G7U A;  4UA6 A;  1RCJ A;  1RGY A;  3LR0 A;  1E25 A;  1Z6F A;  2E8J A;  1OJG A;  4GHI A;  1XJ4 A;  3DWK A;  1DJA A;  4BBU A;  3LY4 A;  1BLC A;  2ZQD A;  3UPO A;  2WAE A;  3D72 A;  3ZQ5 A;  4GS9 A;  1M40 A;  3T4L A;  3QP8 A;  3CWF A;  2A3U A;  4B93 A;  3O88 A;  1ONG A;  5A92 A;  4OOM A;  1LI9 A;  4MBK A;  5FDH A;  4PKY A;  1N9O A;  1O07 A;  2RCX A;  3D3O A;  3QNC A;  3PYP A;  1K55 A;  1HD8 A;  5AVE A;  3C7U A;  3IQA A;  1XA1 A;  1MWR A;  4S2O A;  3SS4 A;  3LIB A;  4KG2 A;  1ACF A;  1HVB A;  2O9A A;  1D06 A;  2GZA A;  3H7W A;  3FYZ A;  5FA7 A;  3IWO A;  4S2L A;  1YPR A;  1JTG A;  3ZYT A;  5FEG A;  2PDR A;  3C4O A;  3GSG A;  1IYP A;  4YNR A;  2B18 A;  4OQ0 A;  3BYD A;  1MWS A;  4WEJ A;  1ZHH B;  4ARZ B;  4OPR A;  2V9A A;  2CMN A;  4HOI A;  3TRC A;  4JKT A;  2KDK A;  1YKD A;  2XRO A;  3A3E A;  5HWW A;  2J8Y A;  4HP4 A;  4HJ6 A;  4LGW A;  1ESU A;  2LB9 A;  4BQM A;  4YOF A;  4Y0U A;  2KLI A;  2IWB A;  5GHX A;  2G2W A;  2Y2P A;  3QHY A;  2R9X A;  2PRF A;  3DAV A;  4R70 A;  2ZMF A;  3JVU A;  3NHQ A;  1STZ A;  1GSW A;  2H5S A;  1TS0 A;  1K57 A;  4JXV A;  4IHQ A;  4A5R A;  3UN7 A;  1ES5 A;  1YT4 A;  3QP5 A;  3HUM A;  2WZZ A;  1YLY A;  5C5K A;  1HZO A;  4DE2 A;  3KX0 X;  1L0D A;  3IWI A;  4UHU A;  1S1Y A;  4WMC A;  3TJZ C;  2JKF A;  4LV0 A;  5DF7 A;  1AWI A;  2OWJ A;  3C30 A;  3JVV A;  2KOI A;  4HIA A;  3T1S A;  1LSX A;  4XT2 A;  4JPM A;  4C75 A;  1G6A A;  3M6H A;  3T4K A;  4HEF A;  1ZG6 A;  1Q2P A;  2EX8 A;  2MJ6 A;  3G4P A;  4I39 A;  4CLC C;  2W3F A;  3NY4 A;  4S2J A;  3W4Q A;  2PR6 A;  4PMA A;  2PU4 A;  5EV0 A;  3KSG A;  2V0W A;  3LR4 A;  3C38 A;  5M19 A;  3OCL A;  5GL9 A;  4KUK A;  2JHE A;  4IBR A;  3NUL A;  2WUQ A;  2ZL1 A;  3CLO A;  3MZF A;  1PRQ A;  1BLP A;  2ZQ9 A;  2QMI A;  1RP5 A;  4KZB A;  2PT7 A;  3NJA A;  1MPL A;  3GQZ A;  4KZ4 A;  1TS6 A;  3OPL A;  2ZC6 B;  3MXQ A;  3DBA A;  1K54 C;  3VOZ A;  3T1X A;  3MQQ A;  3KYQ A;  3HJK A;  2XFT A;  4ZJ1 A;  4Q0I A;  3FWL A;  5CRF A;  3U2A A;  3OOV A;  4I5S A;  4B9O A;  4I38 A;  4DJ2 A;  1NZO A;  4EWF A;  2CC1 A;  2JKR M;  3ZG8 B;  3TSG A;  4X1M A;  3G32 A;  1XXM A;  2I9V A;  1KGF A;  3A3J A;  1ALQ A;  3E98 A;  3F1O A;  3MMH A;  3MQ0 A;  3UME A;  2UV0 E;  4X53 A;  3C5A A;  2VA0 A;  3K3D A;  2A24 A;  3SH8 A;  1TF1 A;  5EM1 A;  5HAR A;  4CLC A;  3T4Q A;  1GCE A;  3LID A;  2K31 A;  1IEM A;  1TVF A;  2ZM8 A;  1K0K A;  2M7V A;  4NXF A;  2XH9 A;  5F83 A;  3PBT A;  1BLS A;  3JPU A;  4Y2F A;  2WKQ A;  3UMD A;  3VE3 A;  5F82 A;  2ZM2 A;  1K38 A;  1S67 L;  1D7E A;  1ERM A;  4HQA A;  5AQA A;  1TDG A;  1ODV A;  4DE0 A;  1AXB A;  3HUO A;  1ZG4 A;  3DW0 A;  4UQI M;  2EX9 A;  3GEC A;  3A0R A;  1K54 A;  3AGD A;  4XUX A;  4DXC A;  2JC7 A;  1IYQ A;  3QP6 A;  1H0M A;  1SZV A;  5MC7 A;  4QWO A;  4IBX A;  4X1L A;  2BG1 A;  1BZA A;  5J8X A;  3EGD C;  1N9B A;  3IXG A;  4HES A;  2BTF P;  2XFS A;  4AFI A;  3HLW A;  2V2F F;  2WGW B;  3TE8 A;  2QJ5 A;  2D01 A;  1WE4 A;  4I3A A;  4BEN A;  5HAQ A;  3FV7 A;  2M7U A;  2WKI A;  5GHZ A;  1NYY A;  3FKV A;  1ES2 A;  4Y0T A;  4YFM A;  1S0W A;  1YLJ A;  2HP6 A;  4GOG A;  2WYX A;  3O3V A;  1JNU A;  1LHY A;  4EQ1 A;  2ZQC A;  4DF6 A;  1W7F A;  3OCN A;  5CHU A;  4ETZ A;  3SZT A;  3E4P A;  2EA9 A;  5HPI A;  4ZBE A;  3W4O A;  1JWV A;  1DJC A;  3CG5 A;  2X02 A;  4UQI S;  3F1P A;  4UA9 A;  1PWC A;  2Y2M A;  1CEF A;  1WYC A;  4E3M A;  4JLF A;  3BFE A;  5JYO A;  3ZFZ A;  3S4X A;  3V3R A;  4ARZ A;  4IUK A;  1GSV A;  2QHK A;  2DNS A;  4GJ4 A;  3WS5 A;  1KGE A;  3GMW A;  3HVF A;  3ZGA B;  3N4I A;  2W3E A;  3Q7V B;  5AQ9 A;  1QME A;  4KQO A;  3ZNY A;  4UEY A;  2QZ6 A;  4BMW A;  2GX5 A;  2OLV A;  1W63 M;  5DJU A;  4JXS A;  3PBN A;  1T19 A;  3VP1 A;  2PYR A;  3GDI A;  4P6Z M;  3NI9 A;  3BLM A;  1K56 D;  1ES4 A;  3AGF A;  2VV8 A;  3BFG A;  3VMA A;  4RYE A;  4Q0J A;  2ZOI A;  2FFY A;  1XP4 A;  5FSR A;  3IWQ A;  1U60 A;  3V39 A;  1OPX A;  1NRF A;  4K0W A;  2V1Z A;  1K4F A;  3RFB A;  4L9E A;  4ESP A;  5EVE A;  2VZW A;  1VM1 A;  2B5R A;  4EBN A;  1CK3 A;  3ZDJ A;  3LFV A;  3NIA A;  5IHV A;  2J3T D;  4R3J A;  3HLC A;  4RX3 A;  4YWZ A;  2PR5 A;  5FI6 A;  3ULF A;  5DTT A;  5EM0 A;  3PR6 A;  4GD8 A;  3VE4 A;  4RX2 A;  3G34 A;  4FTX A;  4EU0 A;  3FPV A;  2PU2 A;  5E2H A;  3R7W B;  4OPZ A;  1FCN A;  1JTD A;  3K3C A;  3HLD A;  3V5M A;  3WWX A;  2Y59 A;  4ETX A;  2C5W B;  1TS7 A;  5HSQ A;  4JGR A;  3PXP A;  1KVM A;  5EOE A;  2VJW A;  4P0M A;  5G18 A;  1FSY A;  3T50 A;  4C6Y A;  3S1Y A;  2IWC A;  2WZX A;  3DTE A;  4QY5 A;  3FC7 A;  5FAQ A;  3ZVW A;  5KSH A;  3VP0 A;  3VP4 A;  2XD1 A;  3A0V A;  3G2Y A;  3N7W A;  4BD0 A;  2EFX A;  2JE5 A;  2VV7 A;  3CI6 A;  4OON A;  3T1Q B;  4ME4 A;  3FZC A;  1PWG A;  3EWK A;  3HUN A;  1IYS A;  3PAG A;  5M1A A;  5FQI A;  3IX3 A;  4Y7P A;  2OLU A;  1CI9 A;  3LI8 A;  4MEZ A;  5DF8 A;  3NDE A;  5EVL A;  3CHW P;  3D9Y A;  4S2M A;  1PYY A;  4K08 A;  1VQQ A;  2HDQ A;  4NEE D;  3ZG9 B;  4YIN A;  3LEQ A;  3PAE A;  2RL3 A;  2ACG A;  5G4Z A;  5CEB A;  1PI5 A;  5F6A A;  3WS0 A;  1E3U A;  4WF0 A;  4KZ7 A;  1JWZ A;  2PD8 A;  2B02 A;  4E3I A;  5FQQ A;  5U47 A;  1S4S A;  2ZM0 A;  1C3B A;  1LL9 A;  2HDU A;  2A2L A;  5EVI B;  1NLZ A;  4X68 A;  4Y13 A;  5L09 A;  5EUA A;  3GV9 A;  1L3L A;  3EEH A;  1MKI A;  1NRJ A;  4JBF A;  1K57 C;  2XRN A;  4GN2 A;  4NXE A;  4Q0H A;  2Y2N A;  2JKT I;  2ZMA A;  4DDY A;  4GW9 A;  4K91 A;  5GLB A;  2BAS A;  1H3Q A;  3ZG7 B;  2XLN A;  3VSL A;  4MBH A;  1P97 A;  2R9W A;  1BSG A;  5IU1 A;  1KDS A;  2WGW A;  4PM7 A;  3BW6 A;  4KUO A;  5TBM B;  1MWU A;  5F69 A;  2HPB A;  4P87 A;  1LL8 A;  1YLZ A;  1DP9 A;  1L2S A;  3EGX C;  3F1P B;  5EFW A;  3TOI A;  4FH4 A;  3TG9 A;  1VET B;  4WUJ A;  3RXX A;  2H0Y A;  1T1B A;  3NDG A;  1TDL A;  4HP9 A;  3P7N A;  4R6L A;  1JWP A;  5DKK A;  5FI7 A;  5GLD A;  4DXB A;  2OWH A;  3QP4 A;  1L0G A;  5DTK A;  4U0X A;  1S66 L;  1K6R A;  2XA7 M;  4EQI A;  3W4P A;  1YSP A;  2L4R A;  2DCF A;  3D4F A;  4EBP A;  2ZQ8 A;  3UB5 P;  4S2P A;  4QU3 A;  2VV6 A;  4KZA A;  2QJ7 A;  3P98 A;  3O87 A;  3SH9 A;  2E8I A;  3BFC A;  3EOI A;  1EWZ A;  1XFN A;  2EWW A;  1XX2 A;  3MBZ A;  1DRM A;  4Y17 A;  3BWL A;  4Z9Q A;  3HLF A;  1T1A A;  2XR0 A;  4UA7 A;  3UB9 A;  5EPH A;  3P09 A;  4WZ4 A;  1W8Q A;  3Q7V A;  2ZLY A;  4KEN B;  5HWV A;  3BEC A;  1XJ3 A;  3S7O A;  1GHM A;  3NOP C;  1FIK A;  4LCM A;  1PW1 A;  4GLQ A;  1BLH A;  5KZH A;  4HBT A;  4CLC E;  2JCH A;  4N9L A;  5KIZ A;  1XGJ A;  1Y54 A;  3VFF A;  4FUW A;  2V1B A;  2P9V B;  2W3G A;  3HBR A;  4JGP A;  3E4O A;  4E04 A;  2ZD8 A;  1NY0 A;  3VOY A;  2PD7 A;  4EV4 A;  1W79 A;  5F68 A;  2GNX A;  1J3W A;  1XJ2 A;  1FR6 A;  4EUZ A;  4BWI A;  3PHY A;  2HF6 A;  1XFQ A;  1YMX A;  1XPB A;  1OT6 A;  4MN5 A;  3FKW A;  3HRE A;  3MQO A;  2Y2K A;  2ZQA A;  4ZDX A;  2W27 A;  5F1F A;  3IX4 A;  3MS6 A;  2ZOH A;  3ZG5 A;  4HH3 A;  4KG5 A;  1PZO A;  3UDF A;  3KO6 A;  3SW1 A;  2VLG A;  4Y0O A;  4S2I A;  2ZC4 B;  1ZTU A;  5HDD A;  4QB8 A;  2VKS A;  3R7W A;  2XSS A;  1BYW A;  3PBR A;  1EI5 A;  1OT9 A;  1GSX A;  4PM8 A;  4KQD A;  4LRY C;  2VEA A;  3RH8 B;  4GNU A;  3IT9 A;  5FEF A;  2JN7 A;  1YLT A;  1VHM A;  5J4E A;  3CJM A;  5EVI C;  3RXW A;  2ZC7 A;  3ZG0 A;  4IJG A;  4N1X A;  4EUV A;  3UB6 A;  2VGL M;  2YKH A;  3HCY A;  4EEP A;  2J9O A;  4QD4 A;  4L0L A;  4FSF A;  4R0Q A;  2YKF A;  1DY6 A;  2Y2O A;  5A93 A;  3I7J A;  5HDC A;  4OOY A;  3UDI A;  1ES3 A;  3MFX A;  4M4X A;  3C7V A;  4MNR A;  1YM1 A;  4HNB A;  2P74 A;  3CAX A;  5DVA A;  2Y2L A;  2VGJ A;  1KGG A;  2D02 A;  4ZJ2 A;  4E6X A;  3W8K A;  5F5Y A;  3E2K A;  5L07 A;  3LIE A;  5CGS A;  1CI8 A;  1IKG A;  2O99 A;  5HWT A;  4KZ9 A;  2P04 A;  3M2J A;  3KYE A;  3L9K A;  3NBL A;  4ZTK A;  2OAP 1;  1FCM A;  3UB7 A;  3G2Z A;  4MLL A;  2Z2M B;  3UE6 A;  1G6O A;  3LIF A;  2Y8H A;  2Y55 A;  1S4R A;  5EEC A;  4K0X A;  4DJ3 A;  5EVI A;  1MXO A;  2VGL S;  3CZD A;  4EXO A;  1F2K A;  1G5U A;  4OLG A;  1NXY A;  4DKI A;  1QMF A;  4RQ9 A;  5TR7 A;  4LV2 A;  4Y15 A;  5GLA A;  4II7 A;  4KZ3 A;  3G35 A;  3E2L A;  1XA7 A;  3V3S A;  2GJ3 A;  4B4X A;  1ERO A;  1I5Q A;  1G68 A;  1YMS A;  5DFX A;  4KG6 A;  2Y2I A;  1MZU A;  3NCK A;  3ICY A;  4JF5 A;  4M3K A;  5TJJ A;  3LY3 A;  5TBM A;  2WKR A;  3GTC A;  4JF4 A;  1GHI A;  4X56 A;  1SHV A;  3GVB A;  1VET A;  3A3I A;  3SH7 A;  4PM9 A;  3BQA A;  4L9G A;  3DTM A;  4WMC D;  4BJP A;  2EXA A;  3C4P A;  4WLA A;  5DJT A;  1K6S A;  4OVD A;  2I72 A;  1VEU A;  2WKP A;  5TGF A;  2XF3 A;  1N9N A;  2ZJ9 A;  3EQU A;  3Q7Z A;  2V8C A;  4HJ4 A;  2Y2G A;  4PHT A;  2PBD P;  3KSH A;  3CPT A;  5FAS A;  2FZ0 A;  4MN6 A;  1F5M A;  3M6B A;  3OLO A;  3OPR A;  2P08 A;  4RVA A;  4OP8 A;  1BT5 A;  4ZAM A;  3UPN A;  4X25 A;  4MBF A;  2W3D A;  3IXH A;  4I3I A;  5AVF A; 
#chains in the Genus database with same CATH homology
 4HI4 A;  5C5K A;  4WF0 A;  3G6O A;  3KX0 X;  2INW A;  1LSW A;  2PD8 A;  2B02 A;  4GS9 B;  4CQH A;  1MKM A;  1S1Y A;  3NOU C;  4WN5 A;  4FOF A;  2QKP A;  3TJZ C;  1S4S A;  4H6J B;  2OWJ A;  3C30 A;  3V67 A;  2ZMV A;  3JVV A;  1S1Z A;  2A2L A;  2KOI A;  3E0Y A;  4HIA A;  1NLZ A;  4MCW A;  1LSX A;  3OBF A;  4XT2 A;  3LIC A;  3RTY A;  3K2N A;  3EEH A;  5HL6 A;  2HJE A;  3T4K A;  1NRJ A;  1KOU A;  2XRN A;  4NXE A;  4Q0H A;  2JKT I;  2MJ6 A;  4I39 A;  4GW9 A;  4CLC C;  3HJI A;  2BAS A;  3IS2 B;  2W3F A;  5J7E A;  4MDZ A;  2K7S A;  1H3Q A;  2PR6 A;  2LB5 A;  3KSG A;  1OTE A;  2V0W A;  3C8C A;  4Y3I A;  3LR4 A;  2HJ9 C;  3C38 A;  1P97 A;  3OCL A;  5HD3 A;  3S7Q A;  4KUK A;  2JHE A;  2Y79 A;  5IU1 A;  4F3L A;  4NKP A;  4CLC D;  1NLY A;  3BW6 A;  4KUO A;  2HGV A;  2Z6C A;  3CLO A;  3LR3 A;  5TBM B;  3H7W B;  5F69 A;  2J3W A;  1LL8 A;  4P6Z S;  1DP9 A;  2PT7 A;  3NJA A;  3EGX C;  3W2Z A;  3F1P B;  5EFW A;  1TS6 A;  1XJ6 A;  3MXQ A;  4WUJ A;  3DBA A;  4EET B;  3T4J A;  1T1B A;  5DKL A;  5J3W A;  3BY9 A;  4G3K A;  4Z1W A;  1TD5 A;  3MQQ A;  3KYQ A;  4HP9 A;  3LI9 A;  3HJK A;  3P7N A;  3F1N B;  4R6L A;  5DKK A;  4Q0I A;  3IBJ A;  2OWH A;  3U2A A;  3OOV A;  3C2W A;  5LBR A;  2JKR I;  2Z6D A;  1DP8 A;  4I5S A;  5FL3 A;  4B9O A;  4I38 A;  1S66 L;  4DJ2 A;  2H28 A;  2O0Y A;  2O9B A;  5K5B A;  2JKR M;  3VOL A;  3T4S A;  2M1C A;  2XA7 M;  1YSP A;  2L4R A;  5A8B A;  3S7P A;  4Y5F A;  3MF0 A;  1P9W A;  4O01 A;  4MMN A;  2I9V A;  2VV6 A;  3CUE C;  3E98 A;  3F1O A;  4JGQ A;  2NUP C;  2QJ7 A;  1TS8 A;  2O9C A;  3MMH A;  3MR0 A;  4EES A;  1NWZ A;  1UWP X;  3MQ0 A;  1IFQ A;  3FPW A;  3LIA A;  3UME A;  3EOI A;  2NUT C;  2PHY A;  1XFN A;  2VA0 A;  3K3D A;  4G3W A;  2EWW A;  2A24 A;  1W63 Q;  1Y28 A;  2V1A A;  1TF1 A;  1DRM A;  4CLC A;  3T4Q A;  4LRX C;  3LID A;  2K31 A;  3MJQ A;  4O0P A;  3BWL A;  2M7V A;  5DFY A;  5HZH A;  4NXF A;  1T1A A;  3UB9 A;  2W1T A;  3PBT A;  5HWV A;  4Y2F A;  2WKQ A;  3UMD A;  1XJ3 A;  3S7O A;  3VE3 A;  3NOP C;  2K2N A;  5HD5 A;  1S67 L;  1D7E A;  4ZRR A;  4HQA A;  4GLQ A;  1ODV A;  4HY8 A;  5AJG A;  4HH2 A;  4CLC E;  2W3H A;  1LSV A;  1OTB A;  5KIZ A;  4UQI M;  4XT2 B;  3GEC A;  2V1B A;  3A0R A;  4WEK A;  2W3G A;  4JGP A;  3E4O A;  5AVF A;  4E04 A;  1P0Z A;  4PAU A;  2PD7 A;  5F68 A;  2GNX A;  2J80 A;  1XJ2 A;  3TW8 A;  4BWI A;  3LUQ A;  3PHY A;  2HF6 A;  1XFQ A;  2KX6 A;  5MC7 A;  3BY8 A;  2P7J A;  1OT6 A;  4MN5 A;  3MQO A;  1F9I A;  2JKT M;  3EGD C;  3VV4 A;  2W27 A;  1V9Y A;  4AFI A;  2PYP A;  2L0W A;  2ZBB A;  4F3L B;  4BBV A;  3LR5 A;  2R78 A;  2HV1 A;  2ZOH A;  3TE8 A;  2QJ5 A;  2D01 A;  4HH3 A;  3CUE A;  4I3A A;  1VB6 A;  3KO6 A;  3SW1 A;  2VLG A;  2M7U A;  5G4Y A;  3A0S A;  4JGO A;  3PBQ A;  1ZTU A;  5HDD A;  2VKS A;  4DN0 A;  2V0U A;  1JNU A;  3R7W A;  2XSS A;  1BYW A;  4EQ1 A;  1DP6 A;  3PBR A;  5CX7 A;  3OCN A;  1OT9 A;  3EEA A;  1GSX A;  4ETZ A;  3E4P A;  4KQD A;  2EA9 A;  4LRY C;  2OOL A;  5HPI A;  3LYX A;  2VEA A;  4OOL A;  1LT0 A;  3RH8 B;  4WL9 A;  3IBR A;  4UQI S;  3F1P A;  2JN7 A;  3KSI A;  3O5Y A;  1VHM A;  5J4E A;  2IA2 A;  3UE3 A;  2EWV A;  3H82 A;  1EW0 A;  4QPR A;  2QYB A;  1V9Z A;  3F1O B;  4IJG A;  1WA9 A;  4EUV A;  3UB6 A;  2VGL M;  2YKH A;  2QWS A;  3HCY A;  4ARZ A;  4EEP A;  4IUK A;  1N9L A;  1P9R A;  2A24 B;  3T4O A;  1GSV A;  4L0L A;  2QHK A;  4CLC B;  4FSF A;  3H9W A;  3B47 A;  4GJ4 A;  2YKF A;  2FH5 A;  5L8M A;  4DMZ A;  2W0N A;  2W1T B;  2W3E A;  4NXB A;  4NXG A;  5HDC A;  3KSF A;  2OAQ 1;  3MFX A;  4KQO A;  4M4X A;  1F98 A;  4UEY A;  1X0O A;  4BMW A;  1OTI A;  2GX5 A;  1W63 M;  5DJU A;  3PBN A;  1T19 A;  4HNB A;  3CAX A;  1MC0 A;  5HDS A;  2PYR A;  3GDI A;  4P6Z M;  3CIT A;  3P01 A;  3EQV A;  2D02 A;  2G7U A;  2VV8 A;  5F5Y A;  4Q0J A;  2ZOI A;  3LR0 A;  1OJG A;  3LIE A;  4GHI A;  1XJ4 A;  2O99 A;  5HWT A;  3PBS A;  2P04 A;  4BBU A;  4EW7 A;  3NOT C;  2OAP 1;  1OPX A;  3D72 A;  2J3T C;  3RFB A;  4L9E A;  3ZQ5 A;  4GS9 A;  1G28 A;  1OTD A;  3UB7 A;  2VZW A;  2XA7 S;  3T4L A;  4WEL A;  3UE6 A;  1G6O A;  3CWF A;  3LIF A;  1T1C A;  2Y8H A;  4H6J A;  5HPF A;  1S4R A;  4B93 A;  4DJ3 A;  3LFV A;  2VGL S;  4I3J A;  4R3A A;  4EXO A;  4OOM A;  2J3T D;  4YWZ A;  3B33 A;  2PR5 A;  4PKY A;  3S7N A;  3ULF A;  1UGU A;  4RQ9 A;  1N9O A;  3D3O A;  4LRZ E;  3PR6 A;  4II7 A;  3PYP A;  3FG8 A;  3VE4 A;  4GCZ A;  4L9F A;  3IS2 A;  5AVE A;  3R4K A;  4EU0 A;  3FPV A;  3R7W B;  2GJ3 A;  3K3C A;  1YSQ A;  3LIB A;  5DFX A;  1MZU A;  4MN7 A;  4R38 A;  3ICY A;  4ETX A;  1TS7 A;  5HSQ A;  4HHD A;  2O9A A;  5TJJ A;  1D06 A;  4JGR A;  3PXP A;  2GZA A;  2DMW A;  4LLO B;  2VJW A;  3KYZ A;  4LPZ A;  5TBM A;  2WKR A;  3H7W A;  1OTA A;  3PBO A;  3T50 A;  4HJ3 A;  3ZYT A;  3H82 B;  3T4T A;  2PDR A;  1T18 A;  4YNR A;  2B18 A;  3UB8 A;  4WEJ A;  1ZHH B;  3BQA A;  4ARZ B;  2L1M A;  4L9G A;  4BJP A;  5IT5 A;  2V9A A;  2CMN A;  3FC7 A;  4HOI A;  3TRC A;  3F1N A;  5KSH A;  4WLA A;  5DJT A;  3A0V A;  2KDK A;  2WKP A;  1H8M A;  1YKD A;  2XRO A;  5HWW A;  1N9N A;  4HP4 A;  2VV7 A;  4HJ6 A;  3EQU A;  3CI6 A;  2LB9 A;  4ME4 A;  4YOF A;  4HJ4 A;  2KLI A;  4PHT A;  5I5L A;  3E4Q A;  3EWK A;  4O8G A;  3KSH A;  1IOU A;  4PKY G;  1UWN X;  2FZ0 A;  4IUH A;  4MN6 A;  3B42 A;  3BQ8 A;  1F5M A;  3OC2 A;  4R70 A;  3BJN A;  2ZMF A;  3JVU A;  3OLO A;  4EER A;  1OJ5 A;  1STZ A;  3NHQ A;  1GSW A;  3LI8 A;  1TS0 A;  5DF9 A;  2P08 A;  1YAX A;  4IHQ A;  2VX8 A;  4K08 A;  4BBT A;  4GHI B;  2W1R A;  4NEE D;  4EEU A;  2W3D A;  5IS1 A;  4G3V A;  4I3I A;  5G4Z A;  5F6A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...