4PKYG

Arnt/hif transcription factor/coactivator complex
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
106
structure length
100
Chain Sequence
LDSKTFLSEHSMDMKFTYCDDRITELIGYHPEELLGRSAYEFYHALDSENMTKSHQNLCTKGQVVSGQYRMLAKHGGYVWLETQGTVIYNQCIMCVNYVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Coiled-coil Coactivators Play a Structural Role Mediating Interactions in Hypoxia-inducible Factor Heterodimerization.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/cell cycle
molecule keywords Aryl hydrocarbon receptor nuclear translocator
total genus 26
structure length 100
sequence length 106
ec nomenclature
pdb deposition date 2014-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF08447 PAS_3 PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4pkyG00
3D72A 3E4OA 3UE6A 1LSXA 4HJ6A 2EA9A 2W0NA 2PHYA 1N9OA 5IU1A 5HZHA 5J3WA 2A24A 2PDRA 4GHIA 1OT6A 4F3LA 2I9VA 5G4ZA 3H7WB 2V0UA 3CWFA 4H6JB 4L9GA 4R3AA 3VE3A 1V9ZA 2OWJA 3MXQA 4I5SA 5TBMA 3ICYA 1S67L 1DP6A 1OTDA 1UGUA 2L0WA 2OWHA 1TS8A 3BY8A 1OTAA 2ZOIA 2VV8A 4GS9B 2QJ5A 2Z6DA 4LRYC 1XJ4A 3LI9A 3F1PB 3F1NB 4EEPA 4EXOA 3BWLA 4WLAA 1X0OA 2J80A 3PHYA 5F69A 4HIAA 3RTYA 3CLOA 1NWZA 1T18A 2GJ3A 2B02A 4PKYA 4EEUA 3H9WA 3A0VA 3G6OA 1P97A 4JGQA 4PKYG 1OT9A 3ULFA 4B9OA 3LIEA 1WA9A 4JGOA 3IBRA 1G28A 4KUOA 5HWVA 5A8BA 1S4RA 2VV6A 4NXGA 1EW0A 3MFXA 4EESA 4BBUA 3F1NA 3LIBA 5HWWA 1OTEA 1T1AA 3LIDA 3LI8A 3LUQA 4GS9A 1F9IA 2WKPA 2OOLA 1GSVA 5G4YA 2PYRA 2QKPA 2YKFA 1UWNX 1T1CA 2INWA 3EEHA 5DKKA 1OTBA 2PD8A 1OTIA 4HI4A 4WUJA 3UB6A 4EETB 2CMNA 4K08A 1S66L 2QWSA 4HJ4A 5AVEA 4GCZA 4I38A 3C8CA 5AVFA 1LSVA 2PYPA 4NXBA 5DKLA 3VE4A 1D7EA 2V9AA 5HSQA 4F3LB 3E4PA 4I3AA 1Y28A 4GHIB 2A24B 2D01A 2HV1A 3A0SA 4JGRA 2VV7A 3MR0A 4LPZA 4WN5A 1XJ6A 1T1BA 2ZOHA 2H28A 4LLOB 3H82B 3MQOA 4HQAA 2ZBBA 2WKQA 4WL9A 3B33A 1XJ2A 2QJ7A 5I5LA 5J7EA 4I3IA 3HJIA 4HHDA 3LIAA 1LSWA 3FC7A 3BY9A 3E4QA 3IS2A 3A0RA 4R38A 5HDSA 1KOUA 4R70A 4GW9A 2L4RA 1DRMA 3RH8B 3UMDA 3CAXA 4EQ1A 3MJQA 1XFQA 1OJ5A 2KDKA 2PR5A 2JHEA 3GECA 3NOUC 3OLOA 4I3JA 2KX6A 4DJ2A 1XFNA 5HD3A 3HJKA 4DJ3A 2VEAA 2D02A 1XJ3A 4XT2A 5IS1A 4NXEA 5HDCA 1S1ZA 1MZUA 3EWKA 5EFWA 5F68A 4BBVA 2V0WA 3P7NA 4E04A 3F1PA 1ODVA 5KIZA 3NOTC 3F1OB 3NHQA 1P0ZA 2Z6CA 2WKRA 5HD5A 3FG8A 4LRXC 4KUKA 2W27A 5HWTA 3C2WA 3LYXA 1T19A 1VB6A 3F1OA 4HH2A 2L1MA 4NXFA 3K3CA 1OJGA 1GSWA 4HJ3A 5DJTA 5TBMB 1DP8A 1LL8A 2R78A 3GDIA 3NOPC 4HP9A 4M4XA 3H7WA 3K3DA 4H6JA 3UB7A 3T50A 4RQ9A 4I39A 1D06A 2BASA 5F6AA 1V9YA 4XT2B 2V1AA 5DJUA 4HNBA 1DP9A 1S1YA 2YKHA 4MN5A 4WF0A 4BBTA 3PYPA 1LT0A 1S4SA 3LIFA 4L9EA 4LRZE 5F5YA 4HY8A 1F98A 2VLGA 4JGPA 1UWPX 1BYWA 1TS7A 3MQQA 1N9LA 3NJAA 2V1BA 4HP4A 4R6LA 2M1CA 3ZQ5A 3IS2B 5J4EA 4YWZA 2QHKA 4HH3A 3VOLA 3SW1A 1TS0A 1JNUA 4KQDA 3UB9A 4L9FA 4EERA 2P7JA 2K7SA 3LICA 4MN6A 4EW7A 2PD7A 4HOIA 2PR6A 5HDDA 1N9NA 3UB8A 3H82A 1TS6A 3UMEA 2JN7A 3KX0X 1GSXA
chains in the Genus database with same CATH superfamily
3D72A 4G3WA 3OBFA 4FUWA 4ID4A 2VGJA 3Q82A 4RYEA 4R1GA 5BOHA 4GKUA 3KSGA 1SDNA 1RCJA 4BLMA 2XLNA 3UPNA 2PRFA 2QPNA 4OKPA 3MQ0A 1NWZA 3G32A 2WGIA 3EGXC 4MN7A 5K5BA 2ZC5B 4UQIM 3JYIA 3V5MA 2WKPA 1YMSA 3C4OA 2R9WA 3CZDA 1YSQA 2JKTI 5DKLA 4Y0OA 4NXBA 3UPPA 1HZOA 2A2LA 1Y28A 3N6IA 3HVFA 4WN5A 1T1BA 2ZBBA 1P9WA 2K2NA 1L0EA 4KQRA 2ZM0A 4Y15A 1QMFA 4LCLA 3IX3A 1Q2QA 1XFQA 4DJ3A 2ZMAA 1JWPA 5TGFA 4UQIS 4E04A 4Y0UA 4PHTA 4JXSA 2Y2IA 5CTNA 3O3VA 5DJTA 4QY5A 4UA9A 5F6AA 4XT2B 5MC7A 1DP9A 4L9EA 1JWZA 3IF6A 3VOLA 2XK1A 5FQIA 5EVIB 2JN7A 5GLDA 2P04A 3PBRA 4HESA 2A24A 3U2AA 3TJZC 1OT6A 4BL2A 1DJAA 1XP4A 3CG5A 4C75A 1RP5A 3BYDA 1J3WA 3C5AA 4E6XA 4ARZB 1OTAA 4FH4A 1SZVA 1FOFA 5U47A 1MWUA 2BG1A 1T18A 2ACGA 2J3TC 4PPRA 1FCMA 4E3JA 1BZAA 5HARA 5E2EA 3C30A 2ZQ9A 3LIEA 3GMWA 2XROA 5EOOA 3W4QA 4ETXA 2YKFA 2FFYA 3E98A 4B88A 1S66L 5FEFA 3BQAA 1P9RA 2P08A 4JF6A 4OQHA 2XFSA 2GZAA 3IH8A 4OQGA 4BENA 3E2KA 5DTTA 3UN7A 3MJQA 2VGLM 2VJWA 5D3OA 1YLWA 2A3UA 5CGXA 2KX6A 5FQ9A 1JTGA 4JPMA 2O0YA 3IXGA 1K0KA 4KZ7A 4PM6A 5HWTA 4NXFA 4GN2A 1PZOA 3H7WA 4QU3A 1MC0A 1PW8A 3PBTA 4LV2A 3NCKA 3UNWA 2Y2GA 4LGWA 4EUVA 3SW1A 2P7JA 3PBOA 1K38A 1K56A 4S2IA 5EVID 1MPLA 2EA9A 4QD4A 2ZMVA 3FZCA 1VEUB 2OWJA 1G5UA 2I72A 4IBRA 2OLVA 1UGUA 3A3FA 3BFFA 1YM1A 4D60A 5JYPA 3RTYA 5FQMA 1PI4A 4L0LA 3Q7VA 1P97A 3IBRA 3VP0A 2J3TD 3LY4A 4YFMA 4QJGA 2QKPA 3TE8A 3V50A 1OTIA 1VM1A 3CI6A 3DWZA 2HF6A 3GSGA 1ES5A 4N1XA 3ZVWA 1K6SA 2A24B 4MMNA 4S2MA 3ZNTA 1M40A 2ZOHA 4DMZA 1YKDA 2UWXA 1XJ2A 5HL6A 2H5SA 3R7WB 3MFDA 3E4QA 3A0RA 3NULA 4EQ1A 3LEZA 3OPLA 4DJ2A 4YNRA 4XT2A 5AQ7A 3P7NA 1MY8A 4R23A 1ODVA 1P0ZA 3FG8A 3C2WA 1OMEA 3T4LA 3MKEA 3NOPC 2W1TA 3GDIA 5E43A 3VSLA 4LFUA 4Q0JA 4HNBA 4X53A 3VOZA 1TS7A 1KDSA 5J4EA 3WWXA 4CPKA 1BTLA 3MZEA 1FCNA 5IT5A 5A92A 1K56D 1W8QA 2PHYA 3OCLA 5HZHA 5CX7A 3BLMA 4EBPA 2I9VA 4DE1A 4X56A 4ZAMA 2K31A 1NRFA 4PMAA 4D2OA 4FCFA 4EEPA 1FILA 1OPXA 4R3BA 3T1XA 4HBUA 3HUOA 2EFXA 1OT9A 3P09A 2VZWA 4DDYA 1KE4A 2HPBA 4KQQA 1K6RA 3T1RA 2PT7A 3LIDA 2JE5A 3NIAA 1G68A 2XD5A 2PBYA 1PWGA 5EPHA 2PYPA 3QP4A 2HJEA 3VP1A 3BFEA 5J7EA 3FKWA 1DRMA 2WUQA 3PTEA 4DE3A 3GECA 5KIZA 3JPUA 2C5WB 5A91A 2XA7M 4NXEA 1KE0A 5EFWA 5I94A 2W1TB 3VSKA 1LHYA 2XGNA 4PM8A 3LYXA 3HL9A 4NKPA 2L1MA 1H8YA 2W3HA 1W5DA 3Q07A 3CITA 4H6JA 5CGWA 4KZBA 1S4SA 3LIFA 5AQ9A 1S6RA 1O07A 4UA7A 2XA7S 4B4ZA 5EVEA 4EERA 3LICA 3Q7ZA 1MWSA 4S2PA 1GSXA 3E4OA 1YPRA 2W0NA 3O87A 4DXBA 3T1QB 5J3WA 4IVIA 2Y79A 4OP5A 3IXHA 1GHPA 1RGZA 2Y2JA 3WS1A 2X02A 3ZG5A 2VV8A 5FATA 3WS5A 5C5KA 3MSHA 4UEYA 3NI9A 1YAXA 4X6TA 2XFTA 1YT4A 4PKYA 2J7VA 3H9WA 3G6OA 4XXRA 3G30A 5CHMA 3O88A 1OTEA 4GDBA 3LI8A 3BFCA 4WZ4A 5HAQA 3IXBA 4Z9QA 3ZQ5A 5HAIA 5E2HA 4HI4A 3FPVA 2CMNA 4K08A 4R3JA 3W4PA 4I38A 1MKIA 1SKFA 3DAVA 4JXVA 5CERA 1NYMA 3DBAA 3W8KA 3M6BA 3V3SA 2J9OA 2ZM2A 2QJ7A 3W2ZA 3ZGAB 2OSUA 4DE2A 5GLAA 3LR5A 5EVLA 1DY6A 3V67A 2V0WA 2JKRM 3T4SA 2PAVP 2WKHA 3F1OB 5GLCA 1K54A 4HH2A 3G31A 2Y91A 3K3CA 3E2LA 4HEFA 1G6OA 2JKFA 1YMXA 2BASA 1YLZA 2EX2A 1S1YA 1HD8A 2FFFB 1ONHA 1FCOA 4P6BA 3BW6A 2M1CA 4DF6A 2Q9MA 4FH2A 4PM9A 1ESUA 5M1AA 4ZRRA 2JKTM 2Z2LB 5G4ZA 2LB9A 4JXGA 4EQIA 3CWFA 4FD8A 3N8SA 3M2KA 2V20A 4CLCC 4R0QA 4LRYC 1XX2A 4O0PA 3GTCA 4GB7A 4KG6A 1K55C 2GJ3A 3N8LA 4EBLA 1G28A 2J8YA 3E0YA 2HP9A 4JLFA 1BLSA 1ES2A 4NEED 5HAPA 3S1YA 4BBUA 5EVIC 3SS3A 3G34A 4LV1A 2P9VA 2ZC7A 5G4YA 4ARZA 2Y59A 1TVFA 4HJ4A 2DMWA 2XRNA 5DF7A 2HV1A 3BEBA 4FSFA 4JGRA 2WGWB 3MQOA 3VMAA 2OV5A 3B33A 3N4IA 2EX6A 3M2JA 3D4FA 1EROA 5I5LA 3BQ8A 4U0XA 3LO7A 4HHDA 3IF6B 3IS2A 4E3MA 4R70A 1LL9A 1I5QA 1AWIA 2KDKA 4ME4A 4X1LA 1CI8A 3FYZA 4WYYA 2ZC3B 5F68A 4NK3A 2O9BA 2GDNA 2BLSA 1MBLA 5HD5A 5KSHA 4KUKA 2V1AA 3UE3A 3CPTA 3IF5A 3UE0A 3ZG0A 4Z1WA 2VLGA 4P0MA 2H0YA 2QHKA 1ACFA 1PNEA 3KYQA 4Y7PA 2X71A 2L0WA 2PBDP 5TR7A 2WZXA 1W79A 1FQGA 3S4XA 2V0UA 4L9GA 1K25A 3PAEA 3ZHHA 4MDZA 4ETZA 1IYQA 2X01A 3LR3A 1YLPA 1TS8A 2XD1A 5FI6A 2QYBA 1BSGA 4B4XA 2ZQ8A 5M18A 1PRQA 1VETA 3LIBA 5GHZA 4IHQA 2Y2QA 5EOEA 3JVVA 3EEHA 4EETB 1H8MA 3BLSA 1K4EA 4FTXA 4S2KA 1D7EA 4F3LB 2VA0A 2VV7A 4LPZA 4Y2FA 4OQ0A 5DVAA 3ZYTA 3B42A 3RJUA 4N92A 4WZ5C 2HP5A 3LIAA 3DTMA 5GHXA 2L4RA 1CK3A 1YQSA 2V2FF 4S2OA 4JF4A 1IKGA 3HLFA 3IWIA 2HDRA 4K0XA 3EWKA 1ZKJA 1PYYA 3NHQA 4JKTA 2Z6CA 3LCEA 1NLZA 1OJGA 2HDUA 1F2KA 3LY3A 3UY6A 1PIOA 3WS0A 2HP6A 5IHVA 3VOYA 4KQOA 5CGSA 4OVDA 1DJCA 5HPIA 1XPBA 2CC1A 3N7WA 3TSGA 4E3OA 4OPRA 2Y2KA 3S7QA 3EQUA 2WYXA 2XQZA 1L0FA 1L0DA 1JVJA 5FI7A 1VQQA 5HPFA 3FV7A 1DP6A 1BT5A 3LI9A 3BWLA 2ZM8A 4MNRA 3MZFA 5J8XA 4S2LA 5FAQA 2IWDA 3BFGA 4PKYG 4KG2A 3I7JA 4NXGA 1NYYA 1EW0A 1BLCA 3MXSA 2ZC6B 4OONA 2NUTC 2HDSA 1E4DA 1ONGA 5A93A 1PW1A 2C6WB 3C8CA 4E3LA 4EBNA 2G7UA 1N9BA 3KO6A 4LLOB 4HQAA 4WL9A 3QP8A 5IU1A 1VHMA 1M6KA 4OOYA 4G3VA 1CEGA 1PFLA 4Q8IA 3A3JA 1OJ5A 2PR5A 3QP5A 5HW3A 3NECA 3P98A 1XJ3A 1MWRA 4N9LA 4CLCA 5HDCA 3DWKA 2ZMFA 3NOTC 4LRXC 2W27A 5FQKA 5DTKA 4BMWA 1CI9A 1ZTUA 4GLQA 3MQQA 1ALQA 1H3QA 4HP4A 4YWZA 4HH3A 4KQDA 4EW7A 4EWFA 3WRZA 1GHIA 3PAGA 3CLOA 2HGVA 5JYOA 2WKIA 4GHIA 3HLEA 5TBMA 5EM0A 3UE6A 1CEFA 5F69A 5CEBA 3IBJA 1E3UA 5E2GA 1WA9A 4WMCA 5AQAA 5G18A 3F1NA 3LUQA 1T1AA 4PM5A 4O01A 4MCWA 4S2NA 4CLCE 2KLIA 2QMIA 4ZBEA 3EOIA 1WYBA 3PBQA 2V1ZA 4JXWA 2J9PA 3S7PA 4R38A 1KOUA 1TDLA 5EV0A 3U4LP 1Z09A 3UMDA 4EU0A 4RX3A 4IUKA 1KGGA 2G2UA 1MZUA 4BBVA 4KG5A 3HREA 1BLPA 2ZD8A 3F1PA 4IUHA 1GCEA 3IHBA 3IX8A 5FL3A 4WEJA 3AGEA 5HFOA 4X1MA 4I39A 2EWVA 2FZ0A 4WF0A 2DCFA 1G6AA 1K55A 1BYWA 1JTDA 2HDQA 3T4TA 3UB5P 4S2NC 3A3IA 3V3RA 1C3BA 4ZTKA 3UB9A 3B3XA 2OAP1 2PD7A 4GDNA 3UMEA 1TS6A 5GHYA 3R4KA 1LSXA 4R4SA 3NDEA 2Y2LA 3SH7A 3HLCA 4Y0TA 3TRCA 2ZQAA 1H0MA 3T4OA 1SKOB 3IQAA 3Q1FA 4QY6A 3ZVTA 1OTDA 1K4FA 3F1PB 1K57A 2B18A 2Y2MA 3ISGA 3TW8A 2QZ6A 5M19A 1ZG6A 4O7DA 2ZL1B 3B47A 4KUOA 5CEDA 3PBNA 2EWWA 1NXYA 5HX9A 4GCZA 5FAOA 3QNBA 2V9AA 4OPZA 4DN0A 1FR1A 2AVXA 3HUNA 3OOVA 2UV0E 1I2SA 2HZ5A 4KZ4A 3VV4A 4LV3A 1CF0A 4X25A 3MBZA 1RGYA 3FC7A 2V8CA 4LV0A 4QWOA 4Q0HA 3AGDA 4E3IA 3IXDA 3S7OA 2OLUA 3C7UA 3HJKA 3LR0A 4OLDA 5IS1A 1LI9A 5GL9A 3SOIA 3QP6A 1F5MA 4XUZA 1T19A 4LENA 3TG9A 5TBMB 1SHVA 3D3OA 3N8RA 2VGKA 4RQ9A 1TF1A 3A3EA 4LRZE 2W1RA 2Y4AA 4JGPA 1UWPX 4R6LA 1KGEA 4GZBA 3ZFZA 4L9FA 5HDDA 1Z6FA 3NDGA 2XEPA 3H82A 4OH0A 3HBRA 1Y4OA 4DXCA 1TD5A 1N9OA 4QB8A 2ZQ7A 1STZA 3P01A 4IVKA 3W4OA 3HLWA 5KSCA 5FDSA 4BWIA 1BLHA 2OWHA 1Q2PA 2QJ5A 1XA1A 3Q81A 3LR4A 1X0OA 3OCNA 3PHYA 2PU2A 5L8MA 2B02A 4WEKA 1J9MA 4EEUA 4ZDXA 5FASA 2ZL1A 1XKZA 4E3NA 4B9OA 3VFHA 2Y2HA 4GS9A 1FSWA 1XGJA 5E2FA 2Y8HA 3UB6A 2J3WA 1ES3A 2W3GA 1CQAA 3VE4A 1XGIA 4OLGA 2MJ6A 1K57C 3CJMA 4U3TA 1L3LA 3IX4A 3PBSA 4C3QA 1W7FA 3RH8B 2WK0A 5L07A 1IKIA 2ZQCA 3NOUC 3S7NA 4A5RA 2V8FA 2VKSA 3OPRA 3GV9A 2Q0OA 3BJNA 5AQBA 5DF8A 1W63Q 4GD8A 3EGDC 1VB6A 3WS4A 4HJ3A 4DKIA 1DP8A 2GNXA 5CXWA 4Y5FA 3T50A 3OPHA 3QP2A 1ERMA 3K2NA 4O8GA 2XH9A 1LT0A 3HLGA 5F5YA 4KZ8A 5CTMA 3L9KA 3MKFA 3DW0A 3SS4A 2DRWA 2Y2NA 1K54C 4MN6A 1GA0A 2PR6A 5L10A 1GA9A 1YLYA 5CHJA 2IWBA 4MBHA 5DF9A 3KYEA 4LCMA 4H6JB 1PWDA 1ZHHB 4RVAA 3BM6A 4E3KA 1S67L 2IA2A 1FSYA 2J80A 2B95A 1WYCA 3MS6A 3G2ZA 4ESPA 3A3DA 4JGOA 5HWVA 2Q9NA 3L7HA 3MFXA 3CUEA 3M6HA 1NZUA 2XF3A 4GOGA 1GSVA 2M7UA 1FR6A 1NZOA 2PD8A 3FKVA 4MEZA 3ZG9B 3WS2A 4GD6A 5HSQA 4N1HA 4GHIB 4CLCD 2D01A 1L0GA 3MR0A 4P6ZS 2XDMA 1U60A 2WKQA 3BRMA 4UA6A 3O86A 3BY9A 4NG2A 5HDSA 2NUPC 3QHYA 1XFNA 3PR6A 4ZJ1A 4IJGA 2XSSA 3O5YA 5EE8A 3UDXA 4PM7A 4OP8A 2VGLS 2R78A 1YSPA 1D06A 1V9YA 4CLCB 4UHUA 1IFQA 3OPPA 4DDSA 4CQHA 3LEQA 4R4RA 3IT9A 4QPRA 2K7SA 4HOIA 2PU4A 4AFIA 3ITBA 5CHUA 2Y55A 4CJNA 4HJ6A 4DRTA 4OPYA 5L09A 2E8IA 3GVBA 1W63M 2B5RA 1HLUP 4YINA 3MXQA 4I5SA 3ICYA 1NRJA 1NLYA 2RCXA 2EX9A 3BY8A 4GS9B 1WE4A 1FIKA 5EUAA 3S22A 3SH9A 1BUEA 1KE3A 4H8RA 4S2JA 5FA7A 3ULFA 3JVUA 5DTSA 1N4OA 2G2WA 2Y2PA 5DKKA 1UWNX 2INWA 2ZQDA 4QHCA 1OTBA 4WUJA 4WBGA 2JKGA 2WGWA 3ZNYA 3SZTA 1IYSA 3HLDA 3GR2A 3T4QA 3FWLA 2WAEA 4WMCD 1E3UD 1S0WA 3GQZA 4U0TA 3H82B 2P9VB 4I3IA 3HJIA 2VK3A 1H8ZA 1KVLA 4IBXA 1ZG4A 2JHEA 5HD3A 2WKEA 3T4JA 2D02A 3HCYA 3VP3A 4P6ZM 5FDHA 4GJ4A 5FI2A 4WZ5A 2O9CA 5FAPA 1IOUA 2GX5A 1SCWA 4ZJ3A 2VX8A 4HP9A 1VEUA 1TEMA 2WGVA 5F82A 3SH8A 1IELA 4HY8A 2JCHA 5AVEA 4Y17A 3NJAA 3HLBA 3IWOA 1IEMA 4KZAA 3EEAA 4BQMA 3ZDJA 4F3LA 4M3KA 3H7WB 4RA7A 5KMWA 3UDFA 3T4KA 3LFVA 4KZ3A 4OPQA 2LB5A 2ZOIA 1XJ4A 4EXOA 3KYZA 3OZHA 3DTEA 2W3DA 4HIAA 1VETB 1KGFA 4OOMA 3RFBA 1YLJA 4BJPA 2EFUA 4HBTA 4Y13A 5HWWA 1CJFA 2PYRA 1SKOA 2WZZA 4KZ6A 5LBRA 3AGFA 4I3AA 1A0KA 1PI5A 4WM9A 4GNUA 3MMHA 4KZ5A 2EXBA 1NY0A 1DJBA 2EXAA 3VFFA 2IWCA 5F1GA 4KENB 3G35A 3GRJA 3V39A 5L2FA 3CPTB 4MBFA 5DFXA 1S1ZA 1ZC2A 2RL3A 2BTFP 3G2YA 3IH9A 3D9YA 2ZJ9A 3VP4A 2JC7A 4OQIA 4X55A 4EUZA 4BBTA 3SS5A 1Y54A 4YOFA 5EVIA 1F98A 5AVFA 1W8YA 3BFDA 3IS2B 3ITAA 2KOIA 1TS0A 1ERQA 2R9XA 3UB8A 2PDRA 3IWQA 3VE3A 3UO9A 1V9ZA 3DTKA 3C38A 3KSIA 4FOFA 4JBFA 4C6YA 1HVBA 4X68A 3F1NB 4BL3A 2WADA 4WLAA 2XR0A 5CRFA 2O9AA 5FSRA 2Z2MB 5HL1A 3C7VA 3A0VA 4KZ9A 4JGQA 4UAAA 5FQQA 4WELA 5A8BA 2VV6A 3CMZA 4DE0A 4K0WA 1MKMA 4ZJ2A 2OOLA 2H0TA 1YLTA 1T1CA 2JBFA 1ESIA 3NC8A 2QWSA 3IF6C 1LLBA 2EX8A 1BULA 3QNCA 5AJGA 4EV4A 5DFYA 1XA7A 2O99A 4OOLA 1LSWA 1MWTA 3QP1A 4X69A 4GW9A 1I2WA 3BECA 4IEDA 3FPWA 4I3JA 2VEAA 5FQJA 1SDEA 4N9KA 3C4PA 3ZG8B 1LI0A 3UPOA 3RXWA 5A90A 3OC2A 2OAQ1 3MZDA 2WKRA 1EI5A 4Y3IA 1IYOA 4MBKA 3NBLA 4P87A 3F1OA 1NJ4A 2Y2OA 1GSWA 2JKRI 3UB7A 1HTZA 4RX2A 3CHWP 1TDGA 2YKHA 2WAFA 3HUMA 1QMEA 2HJ9C 3CUEC 1EWZA 1N9LA 3EQVA 3TOIA 3MXRA 2E8JA 3ZG7B 2W3EA 3KX0X 2M7VA 2W3FA 3KSFA 4R3AA 4G3KA 3T12B 2DNSA 2Z6DA 4F94A 5TFQA 3IHAA 1E25A 1LL5A 1KVMA 3KSHA 3WRTA 1PZPA 1AXBA 2ZLYA 3VP2A 3NY4A 1S4RA 5FEGA 1MXOA 1O7EA 4EESA 3R7WA 1KDWA 1F9IA 2ZC4B 5KZHA 4K91A 5EM1A 1LSVA 4JF5A 3ZCZA 3E4PA 3A0SA 1XXMA 4P85A 1XJ6A 1GHMA 2H28A 4E6WA 2H10A 4BD1A 2P74A 4MLLA 1PWCA 4B93A 3CAXA 3G4PA 1IYPA 3OLOA 3Q7VB 5EECA 2FH5A 5CECA 3LGOA 4PAUA 3DTIA 3PXPA 5GLBA 1LL8A 4M4XA 3K3DA 2A49A 5DJUA 1JWVA 4MN5A 3UDIA 3PYPA 3UE1A 4XUXA 3T1SA 2V1BA 1L2SA 3MF0A 1ES4A 4BD0A 1H5XA 5F83A 1JNUA 4II7A 5TJJA 4NETA 3RXXA 5F1FA 1N9NA 1D1JA 4Q0IA
chains in the Genus database with same CATH topology
3D72A 3E4OA 4G3WA 4HJ6A 2W0NA 3OBFA 5J3WA 4GHIA 2Y79A 1W63M 5TBMA 3MXQA 4I5SA 3ICYA 1NRJA 3KSGA 1NLYA 3BY8A 3UE6A 2VV8A 4GS9B 3MQ0A 5F69A 5C5KA 4UEYA 1YAXA 1NWZA 4PKYA 3H9WA 3G6OA 3EGXC 3IBJA 3ULFA 4MN7A 1WA9A 3JVUA 5K5BA 3F1NA 4UQIM 1OTEA 1T1AA 3LI8A 3LUQA 2WKPA 4O01A 5DKKA 1UWNX 4MCWA 1YSQA 2INWA 3ZQ5A 1OTBA 4HI4A 2JKTI 4WUJA 2KLIA 3FPVA 4CLCE 2CMNA 4K08A 4I38A 5DKLA 3EOIA 4NXBA 3T4QA 2A2LA 1Y28A 3DBAA 4WN5A 3PBQA 1T1BA 3H82B 2ZBBA 1P9WA 2QJ7A 2K2NA 4I3IA 3HJIA 3S7PA 4R38A 3W2ZA 1KOUA 3UMDA 4EU0A 4IUKA 1XFQA 2JHEA 5HD3A 3LR5A 3T4JA 4DJ3A 2D02A 1MZUA 3HCYA 4BBVA 3V67A 2V0WA 2JKRM 4UQIS 4P6ZM 4E04A 3F1PA 4GJ4A 4IUHA 3T4SA 3F1OB 4PHTA 5FL3A 2O9CA 4WEJA 1IOUA 2GX5A 4HH2A 3K3CA 5DJTA 2VX8A 4HP9A 1G6OA 4I39A 2EWVA 2BASA 5F6AA 4XT2B 2FZ0A 5MC7A 1DP9A 1S1YA 4WF0A 4L9EA 4HY8A 5AVEA 1BYWA 3NJAA 3T4TA 3BW6A 2M1CA 3VOLA 3UB9A 2OAP1 2PD7A 3UMEA 1TS6A 2JN7A 3R4KA 4ZRRA 2P04A 1LSXA 3PBRA 3EEAA 2A24A 3U2AA 3TJZC 1OT6A 2JKTM 4F3LA 5G4ZA 2LB9A 3TRCA 3H7WB 3CWFA 3T4OA 1GSXA 3T4KA 3LFVA 1OTDA 4CLCC 2LB5A 4ARZB 1OTAA 2ZOIA 4LRYC 1XJ4A 3F1PB 4EXOA 3KYZA 2B18A 3TW8A 4O0PA 2W3DA 4HIAA 1T18A 2GJ3A 2J3TC 4OOMA 3RFBA 3B47A 3C30A 3LIEA 1G28A 4BJPA 4KUOA 3E0YA 2XROA 4NEED 3PBNA 4BBUA 5HWWA 2EWWA 5G4YA 4ARZA 4ETXA 2PYRA 2YKFA 3E98A 1S66L 4HJ4A 2DMWA 3BQAA 4GCZA 1P9RA 2XRNA 2P08A 2V9AA 5LBRA 4DN0A 4I3AA 2GZAA 2HV1A 4FSFA 4JGRA 3OOVA 3MMHA 4Q0IA 3VV4A 3MQOA 3B33A 5I5LA 3BQ8A 4HHDA 3FC7A 3IS2A 4R70A 4Q0HA 3MJQA 2VGLM 2VJWA 2KDKA 4ME4A 2KX6A 3S7OA 3HJKA 3LR0A 5DFXA 5IS1A 1S1ZA 5F68A 2O0YA 2O9BA 1F5MA 5HD5A 5KSHA 4KUKA 5HWTA 1T19A 4NXFA 5TBMB 3D3OA 3H7WA 1MC0A 4RQ9A 3PBTA 2V1AA 3UE3A 1TF1A 4BBTA 4LRZE 2W1RA 4YOFA 4Z1WA 1F98A 2VLGA 4JGPA 1UWPX 5AVFA 4R6LA 3IS2B 2QHKA 4EUVA 3SW1A 2KOIA 1TS0A 3KYQA 4L9FA 2P7JA 3PBOA 5HDDA 3UB8A 3H82A 2L0WA 1TD5A 2EA9A 1N9OA 2PDRA 1STZA 2ZMVA 3P01A 2V0UA 4L9GA 3VE3A 1V9ZA 2OWJA 4MDZA 3C38A 4ETZA 3KSIA 4FOFA 4BWIA 3LR3A 1UGUA 2OWHA 1TS8A 2QYBA 2QJ5A 3F1NB 4WLAA 3LR4A 1X0OA 3OCNA 3PHYA 5L8MA 3RTYA 2O9AA 2B02A 4L0LA 4WEKA 4EEUA 3A0VA 1P97A 4JGQA 4B9OA 3IBRA 4WELA 5A8BA 2VV6A 2J3TD 1MKMA 3LIBA 4IHQA 4GS9A 2OOLA 2QKPA 3TE8A 3JVVA 1T1CA 2Y8HA 3EEHA 3UB6A 1OTIA 4EETB 3CI6A 2J3WA 1H8MA 2HF6A 2QWSA 2W3GA 3VE4A 1D7EA 4F3LB 2VA0A 2A24B 5AJGA 4MMNA 2MJ6A 2VV7A 4LPZA 4Y2FA 2ZOHA 4DMZA 1YKDA 3ZYTA 3B42A 5DFYA 1XJ2A 5HL6A 2O99A 4OOLA 3LIAA 1LSWA 3PBSA 3R7WB 3E4QA 3A0RA 4GW9A 2L4RA 3RH8B 4EQ1A 3FPWA 3NOUC 3S7NA 4I3JA 4DJ2A 4YNRA 2VEAA 2VKSA 4XT2A 3EWKA 3P7NA 3OC2A 1ODVA 2OAQ1 3BJNA 3NHQA 1P0ZA 2Z6CA 2WKRA 4Y3IA 1W63Q 3FG8A 3C2WA 3EGDC 1NLZA 1VB6A 3T4LA 3F1OA 1OJGA 1GSWA 4HJ3A 2JKRI 1DP8A 3NOPC 2GNXA 2W1TA 3GDIA 3UB7A 4Y5FA 3T50A 4Q0JA 3K2NA 4HNBA 2YKHA 4O8GA 1LT0A 5F5YA 4KQOA 1TS7A 2HJ9C 3CUEC 1N9LA 5J4EA 3EQVA 5HPIA 4MN6A 2W3EA 2PR6A 5IT5A 3S7QA 3KX0X 3EQUA 2M7VA 2PHYA 2W3FA 3OCLA 5HZHA 5DF9A 5CX7A 3KSFA 2I9VA 4H6JB 4R3AA 1ZHHB 5HPFA 4G3KA 1S67L 2K31A 1DP6A 2IA2A 2Z6DA 3LI9A 4EEPA 3BWLA 2J80A 1OPXA 3KSHA 4PKYG 1OT9A 2VZWA 4JGOA 5HWVA 1S4RA 4NXGA 1EW0A 3MFXA 3CUEA 2PT7A 4EESA 3R7WA 3LIDA 1F9IA 1GSVA 2NUTC 2M7UA 2PD8A 3C8CA 1LSVA 2PYPA 2HJEA 5HSQA 2G7UA 3E4PA 4CLCD 4GHIB 2D01A 3A0SA 3MR0A 4P6ZS 3KO6A 1XJ6A 2H28A 4LLOB 4HQAA 2WKQA 4WL9A 5J7EA 5IU1A 3BY9A 1VHMA 5HDSA 2NUPC 4B93A 1DRMA 4G3VA 3CAXA 1OJ5A 2PR5A 3GECA 5KIZA 3OLOA 1XFNA 2FH5A 1XJ3A 2XA7M 4CLCA 3PR6A 4NXEA 5HDCA 5EFWA 2W1TB 4IJGA 4PAUA 2ZMFA 2XSSA 3O5YA 3NOTC 3PXPA 4LRXC 2W27A 3LYXA 4NKPA 2L1MA 2VGLS 4BMWA 2W3HA 1LL8A 2R78A 4M4XA 1YSPA 3CITA 3K3DA 4H6JA 1D06A 1V9YA 4CLCB 1ZTUA 5DJUA 1IFQA 4MN5A 3PYPA 1S4SA 3LIFA 4GLQA 4CQHA 3MQQA 1H3QA 2V1BA 4HP4A 2XA7S 4YWZA 3MF0A 4HH3A 1JNUA 4II7A 4KQDA 4QPRA 5TJJA 3LICA 2K7SA 4EERA 4EW7A 4HOIA 1N9NA 3CLOA 2HGVA 4AFIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3D72 A;  3E4O A;  3UE6 A;  1LSX A;  4HJ6 A;  2EA9 A;  2W0N A;  2PHY A;  1N9O A;  5IU1 A;  5HZH A;  5J3W A;  2A24 A;  2PDR A;  4GHI A;  1OT6 A;  4F3L A;  2I9V A;  5G4Z A;  3H7W B;  2V0U A;  3CWF A;  4H6J B;  4L9G A;  4R3A A;  3VE3 A;  1V9Z A;  2OWJ A;  3MXQ A;  4I5S A;  5TBM A;  3ICY A;  1S67 L;  1DP6 A;  1OTD A;  1UGU A;  2L0W A;  2OWH A;  1TS8 A;  3BY8 A;  1OTA A;  2ZOI A;  2VV8 A;  4GS9 B;  2QJ5 A;  2Z6D A;  4LRY C;  1XJ4 A;  3LI9 A;  3F1P B;  3F1N B;  4EEP A;  4EXO A;  3BWL A;  4WLA A;  1X0O A;  2J80 A;  3PHY A;  5F69 A;  4HIA A;  3RTY A;  3CLO A;  1NWZ A;  1T18 A;  2GJ3 A;  2B02 A;  4PKY A;  4EEU A;  3H9W A;  3A0V A;  3G6O A;  1P97 A;  4JGQ A;  4PKY G;  1OT9 A;  3ULF A;  4B9O A;  3LIE A;  1WA9 A;  4JGO A;  3IBR A;  1G28 A;  4KUO A;  5HWV A;  5A8B A;  1S4R A;  2VV6 A;  4NXG A;  1EW0 A;  3MFX A;  4EES A;  4BBU A;  3F1N A;  3LIB A;  5HWW A;  1OTE A;  1T1A A;  3LID A;  3LI8 A;  3LUQ A;  4GS9 A;  1F9I A;  2WKP A;  2OOL A;  1GSV A;  5G4Y A;  2PYR A;  2QKP A;  2YKF A;  1UWN X;  1T1C A;  2INW A;  3EEH A;  5DKK A;  1OTB A;  2PD8 A;  1OTI A;  4HI4 A;  4WUJ A;  3UB6 A;  4EET B;  2CMN A;  4K08 A;  1S66 L;  2QWS A;  4HJ4 A;  5AVE A;  4GCZ A;  4I38 A;  3C8C A;  5AVF A;  1LSV A;  2PYP A;  4NXB A;  5DKL A;  3VE4 A;  1D7E A;  2V9A A;  5HSQ A;  4F3L B;  3E4P A;  4I3A A;  1Y28 A;  4GHI B;  2A24 B;  2D01 A;  2HV1 A;  3A0S A;  4JGR A;  2VV7 A;  3MR0 A;  4LPZ A;  4WN5 A;  1XJ6 A;  1T1B A;  2ZOH A;  2H28 A;  4LLO B;  3H82 B;  3MQO A;  4HQA A;  2ZBB A;  2WKQ A;  4WL9 A;  3B33 A;  1XJ2 A;  2QJ7 A;  5I5L A;  5J7E A;  4I3I A;  3HJI A;  4HHD A;  3LIA A;  1LSW A;  3FC7 A;  3BY9 A;  3E4Q A;  3IS2 A;  3A0R A;  4R38 A;  5HDS A;  1KOU A;  4R70 A;  4GW9 A;  2L4R A;  1DRM A;  3RH8 B;  3UMD A;  3CAX A;  4EQ1 A;  3MJQ A;  1XFQ A;  1OJ5 A;  2KDK A;  2PR5 A;  2JHE A;  3GEC A;  3NOU C;  3OLO A;  4I3J A;  2KX6 A;  4DJ2 A;  1XFN A;  5HD3 A;  3HJK A;  4DJ3 A;  2VEA A;  2D02 A;  1XJ3 A;  4XT2 A;  5IS1 A;  4NXE A;  5HDC A;  1S1Z A;  1MZU A;  3EWK A;  5EFW A;  5F68 A;  4BBV A;  2V0W A;  3P7N A;  4E04 A;  3F1P A;  1ODV A;  5KIZ A;  3NOT C;  3F1O B;  3NHQ A;  1P0Z A;  2Z6C A;  2WKR A;  5HD5 A;  3FG8 A;  4LRX C;  4KUK A;  2W27 A;  5HWT A;  3C2W A;  3LYX A;  1T19 A;  1VB6 A;  3F1O A;  4HH2 A;  2L1M A;  4NXF A;  3K3C A;  1OJG A;  1GSW A;  4HJ3 A;  5DJT A;  5TBM B;  1DP8 A;  1LL8 A;  2R78 A;  3GDI A;  3NOP C;  4HP9 A;  4M4X A;  3H7W A;  3K3D A;  4H6J A;  3UB7 A;  3T50 A;  4RQ9 A;  4I39 A;  1D06 A;  2BAS A;  5F6A A;  1V9Y A;  4XT2 B;  2V1A A;  5DJU A;  4HNB A;  1DP9 A;  1S1Y A;  2YKH A;  4MN5 A;  4WF0 A;  4BBT A;  3PYP A;  1LT0 A;  1S4S A;  3LIF A;  4L9E A;  4LRZ E;  5F5Y A;  4HY8 A;  1F98 A;  2VLG A;  4JGP A;  1UWP X;  1BYW A;  1TS7 A;  3MQQ A;  1N9L A;  3NJA A;  2V1B A;  4HP4 A;  4R6L A;  2M1C A;  3ZQ5 A;  3IS2 B;  5J4E A;  4YWZ A;  2QHK A;  4HH3 A;  3VOL A;  3SW1 A;  1TS0 A;  1JNU A;  4KQD A;  3UB9 A;  4L9F A;  4EER A;  2P7J A;  2K7S A;  3LIC A;  4MN6 A;  4EW7 A;  2PD7 A;  4HOI A;  2PR6 A;  5HDD A;  1N9N A;  3UB8 A;  3H82 A;  1TS6 A;  3UME A;  2JN7 A;  3KX0 X;  1GSX A; 
#chains in the Genus database with same CATH topology
 3D72 A;  4G3W A;  3OBF A;  4FUW A;  4ID4 A;  2VGJ A;  3Q82 A;  4RYE A;  4R1G A;  5BOH A;  4GKU A;  3KSG A;  1SDN A;  1RCJ A;  4BLM A;  2XLN A;  3UPN A;  2PRF A;  2QPN A;  4OKP A;  3MQ0 A;  1NWZ A;  3G32 A;  2WGI A;  3EGX C;  4MN7 A;  5K5B A;  2ZC5 B;  4UQI M;  3JYI A;  3V5M A;  2WKP A;  1YMS A;  3C4O A;  2R9W A;  3CZD A;  1YSQ A;  2JKT I;  5DKL A;  4Y0O A;  4NXB A;  3UPP A;  1HZO A;  2A2L A;  1Y28 A;  3N6I A;  3HVF A;  4WN5 A;  1T1B A;  2ZBB A;  1P9W A;  2K2N A;  1L0E A;  4KQR A;  2ZM0 A;  4Y15 A;  1QMF A;  4LCL A;  3IX3 A;  1Q2Q A;  1XFQ A;  4DJ3 A;  2ZMA A;  1JWP A;  5TGF A;  4UQI S;  4E04 A;  4Y0U A;  4PHT A;  4JXS A;  2Y2I A;  5CTN A;  3O3V A;  5DJT A;  4QY5 A;  4UA9 A;  5F6A A;  4XT2 B;  5MC7 A;  1DP9 A;  4L9E A;  1JWZ A;  3IF6 A;  3VOL A;  2XK1 A;  5FQI A;  5EVI B;  2JN7 A;  5GLD A;  2P04 A;  3PBR A;  4HES A;  2A24 A;  3U2A A;  3TJZ C;  1OT6 A;  4BL2 A;  1DJA A;  1XP4 A;  3CG5 A;  4C75 A;  1RP5 A;  3BYD A;  1J3W A;  3C5A A;  4E6X A;  4ARZ B;  1OTA A;  4FH4 A;  1SZV A;  1FOF A;  5U47 A;  1MWU A;  2BG1 A;  1T18 A;  2ACG A;  2J3T C;  4PPR A;  1FCM A;  4E3J A;  1BZA A;  5HAR A;  5E2E A;  3C30 A;  2ZQ9 A;  3LIE A;  3GMW A;  2XRO A;  5EOO A;  3W4Q A;  4ETX A;  2YKF A;  2FFY A;  3E98 A;  4B88 A;  1S66 L;  5FEF A;  3BQA A;  1P9R A;  2P08 A;  4JF6 A;  4OQH A;  2XFS A;  2GZA A;  3IH8 A;  4OQG A;  4BEN A;  3E2K A;  5DTT A;  3UN7 A;  3MJQ A;  2VGL M;  2VJW A;  5D3O A;  1YLW A;  2A3U A;  5CGX A;  2KX6 A;  5FQ9 A;  1JTG A;  4JPM A;  2O0Y A;  3IXG A;  1K0K A;  4KZ7 A;  4PM6 A;  5HWT A;  4NXF A;  4GN2 A;  1PZO A;  3H7W A;  4QU3 A;  1MC0 A;  1PW8 A;  3PBT A;  4LV2 A;  3NCK A;  3UNW A;  2Y2G A;  4LGW A;  4EUV A;  3SW1 A;  2P7J A;  3PBO A;  1K38 A;  1K56 A;  4S2I A;  5EVI D;  1MPL A;  2EA9 A;  4QD4 A;  2ZMV A;  3FZC A;  1VEU B;  2OWJ A;  1G5U A;  2I72 A;  4IBR A;  2OLV A;  1UGU A;  3A3F A;  3BFF A;  1YM1 A;  4D60 A;  5JYP A;  3RTY A;  5FQM A;  1PI4 A;  4L0L A;  3Q7V A;  1P97 A;  3IBR A;  3VP0 A;  2J3T D;  3LY4 A;  4YFM A;  4QJG A;  2QKP A;  3TE8 A;  3V50 A;  1OTI A;  1VM1 A;  3CI6 A;  3DWZ A;  2HF6 A;  3GSG A;  1ES5 A;  4N1X A;  3ZVW A;  1K6S A;  2A24 B;  4MMN A;  4S2M A;  3ZNT A;  1M40 A;  2ZOH A;  4DMZ A;  1YKD A;  2UWX A;  1XJ2 A;  5HL6 A;  2H5S A;  3R7W B;  3MFD A;  3E4Q A;  3A0R A;  3NUL A;  4EQ1 A;  3LEZ A;  3OPL A;  4DJ2 A;  4YNR A;  4XT2 A;  5AQ7 A;  3P7N A;  1MY8 A;  4R23 A;  1ODV A;  1P0Z A;  3FG8 A;  3C2W A;  1OME A;  3T4L A;  3MKE A;  3NOP C;  2W1T A;  3GDI A;  5E43 A;  3VSL A;  4LFU A;  4Q0J A;  4HNB A;  4X53 A;  3VOZ A;  1TS7 A;  1KDS A;  5J4E A;  3WWX A;  4CPK A;  1BTL A;  3MZE A;  1FCN A;  5IT5 A;  5A92 A;  1K56 D;  1W8Q A;  2PHY A;  3OCL A;  5HZH A;  5CX7 A;  3BLM A;  4EBP A;  2I9V A;  4DE1 A;  4X56 A;  4ZAM A;  2K31 A;  1NRF A;  4PMA A;  4D2O A;  4FCF A;  4EEP A;  1FIL A;  1OPX A;  4R3B A;  3T1X A;  4HBU A;  3HUO A;  2EFX A;  1OT9 A;  3P09 A;  2VZW A;  4DDY A;  1KE4 A;  2HPB A;  4KQQ A;  1K6R A;  3T1R A;  2PT7 A;  3LID A;  2JE5 A;  3NIA A;  1G68 A;  2XD5 A;  2PBY A;  1PWG A;  5EPH A;  2PYP A;  3QP4 A;  2HJE A;  3VP1 A;  3BFE A;  5J7E A;  3FKW A;  1DRM A;  2WUQ A;  3PTE A;  4DE3 A;  3GEC A;  5KIZ A;  3JPU A;  2C5W B;  5A91 A;  2XA7 M;  4NXE A;  1KE0 A;  5EFW A;  5I94 A;  2W1T B;  3VSK A;  1LHY A;  2XGN A;  4PM8 A;  3LYX A;  3HL9 A;  4NKP A;  2L1M A;  1H8Y A;  2W3H A;  1W5D A;  3Q07 A;  3CIT A;  4H6J A;  5CGW A;  4KZB A;  1S4S A;  3LIF A;  5AQ9 A;  1S6R A;  1O07 A;  4UA7 A;  2XA7 S;  4B4Z A;  5EVE A;  4EER A;  3LIC A;  3Q7Z A;  1MWS A;  4S2P A;  1GSX A;  3E4O A;  1YPR A;  2W0N A;  3O87 A;  4DXB A;  3T1Q B;  5J3W A;  4IVI A;  2Y79 A;  4OP5 A;  3IXH A;  1GHP A;  1RGZ A;  2Y2J A;  3WS1 A;  2X02 A;  3ZG5 A;  2VV8 A;  5FAT A;  3WS5 A;  5C5K A;  3MSH A;  4UEY A;  3NI9 A;  1YAX A;  4X6T A;  2XFT A;  1YT4 A;  4PKY A;  2J7V A;  3H9W A;  3G6O A;  4XXR A;  3G30 A;  5CHM A;  3O88 A;  1OTE A;  4GDB A;  3LI8 A;  3BFC A;  4WZ4 A;  5HAQ A;  3IXB A;  4Z9Q A;  3ZQ5 A;  5HAI A;  5E2H A;  4HI4 A;  3FPV A;  2CMN A;  4K08 A;  4R3J A;  3W4P A;  4I38 A;  1MKI A;  1SKF A;  3DAV A;  4JXV A;  5CER A;  1NYM A;  3DBA A;  3W8K A;  3M6B A;  3V3S A;  2J9O A;  2ZM2 A;  2QJ7 A;  3W2Z A;  3ZGA B;  2OSU A;  4DE2 A;  5GLA A;  3LR5 A;  5EVL A;  1DY6 A;  3V67 A;  2V0W A;  2JKR M;  3T4S A;  2PAV P;  2WKH A;  3F1O B;  5GLC A;  1K54 A;  4HH2 A;  3G31 A;  2Y91 A;  3K3C A;  3E2L A;  4HEF A;  1G6O A;  2JKF A;  1YMX A;  2BAS A;  1YLZ A;  2EX2 A;  1S1Y A;  1HD8 A;  2FFF B;  1ONH A;  1FCO A;  4P6B A;  3BW6 A;  2M1C A;  4DF6 A;  2Q9M A;  4FH2 A;  4PM9 A;  1ESU A;  5M1A A;  4ZRR A;  2JKT M;  2Z2L B;  5G4Z A;  2LB9 A;  4JXG A;  4EQI A;  3CWF A;  4FD8 A;  3N8S A;  3M2K A;  2V20 A;  4CLC C;  4R0Q A;  4LRY C;  1XX2 A;  4O0P A;  3GTC A;  4GB7 A;  4KG6 A;  1K55 C;  2GJ3 A;  3N8L A;  4EBL A;  1G28 A;  2J8Y A;  3E0Y A;  2HP9 A;  4JLF A;  1BLS A;  1ES2 A;  4NEE D;  5HAP A;  3S1Y A;  4BBU A;  5EVI C;  3SS3 A;  3G34 A;  4LV1 A;  2P9V A;  2ZC7 A;  5G4Y A;  4ARZ A;  2Y59 A;  1TVF A;  4HJ4 A;  2DMW A;  2XRN A;  5DF7 A;  2HV1 A;  3BEB A;  4FSF A;  4JGR A;  2WGW B;  3MQO A;  3VMA A;  2OV5 A;  3B33 A;  3N4I A;  2EX6 A;  3M2J A;  3D4F A;  1ERO A;  5I5L A;  3BQ8 A;  4U0X A;  3LO7 A;  4HHD A;  3IF6 B;  3IS2 A;  4E3M A;  4R70 A;  1LL9 A;  1I5Q A;  1AWI A;  2KDK A;  4ME4 A;  4X1L A;  1CI8 A;  3FYZ A;  4WYY A;  2ZC3 B;  5F68 A;  4NK3 A;  2O9B A;  2GDN A;  2BLS A;  1MBL A;  5HD5 A;  5KSH A;  4KUK A;  2V1A A;  3UE3 A;  3CPT A;  3IF5 A;  3UE0 A;  3ZG0 A;  4Z1W A;  2VLG A;  4P0M A;  2H0Y A;  2QHK A;  1ACF A;  1PNE A;  3KYQ A;  4Y7P A;  2X71 A;  2L0W A;  2PBD P;  5TR7 A;  2WZX A;  1W79 A;  1FQG A;  3S4X A;  2V0U A;  4L9G A;  1K25 A;  3PAE A;  3ZHH A;  4MDZ A;  4ETZ A;  1IYQ A;  2X01 A;  3LR3 A;  1YLP A;  1TS8 A;  2XD1 A;  5FI6 A;  2QYB A;  1BSG A;  4B4X A;  2ZQ8 A;  5M18 A;  1PRQ A;  1VET A;  3LIB A;  5GHZ A;  4IHQ A;  2Y2Q A;  5EOE A;  3JVV A;  3EEH A;  4EET B;  1H8M A;  3BLS A;  1K4E A;  4FTX A;  4S2K A;  1D7E A;  4F3L B;  2VA0 A;  2VV7 A;  4LPZ A;  4Y2F A;  4OQ0 A;  5DVA A;  3ZYT A;  3B42 A;  3RJU A;  4N92 A;  4WZ5 C;  2HP5 A;  3LIA A;  3DTM A;  5GHX A;  2L4R A;  1CK3 A;  1YQS A;  2V2F F;  4S2O A;  4JF4 A;  1IKG A;  3HLF A;  3IWI A;  2HDR A;  4K0X A;  3EWK A;  1ZKJ A;  1PYY A;  3NHQ A;  4JKT A;  2Z6C A;  3LCE A;  1NLZ A;  1OJG A;  2HDU A;  1F2K A;  3LY3 A;  3UY6 A;  1PIO A;  3WS0 A;  2HP6 A;  5IHV A;  3VOY A;  4KQO A;  5CGS A;  4OVD A;  1DJC A;  5HPI A;  1XPB A;  2CC1 A;  3N7W A;  3TSG A;  4E3O A;  4OPR A;  2Y2K A;  3S7Q A;  3EQU A;  2WYX A;  2XQZ A;  1L0F A;  1L0D A;  1JVJ A;  5FI7 A;  1VQQ A;  5HPF A;  3FV7 A;  1DP6 A;  1BT5 A;  3LI9 A;  3BWL A;  2ZM8 A;  4MNR A;  3MZF A;  5J8X A;  4S2L A;  5FAQ A;  2IWD A;  3BFG A;  4PKY G;  4KG2 A;  3I7J A;  4NXG A;  1NYY A;  1EW0 A;  1BLC A;  3MXS A;  2ZC6 B;  4OON A;  2NUT C;  2HDS A;  1E4D A;  1ONG A;  5A93 A;  1PW1 A;  2C6W B;  3C8C A;  4E3L A;  4EBN A;  2G7U A;  1N9B A;  3KO6 A;  4LLO B;  4HQA A;  4WL9 A;  3QP8 A;  5IU1 A;  1VHM A;  1M6K A;  4OOY A;  4G3V A;  1CEG A;  1PFL A;  4Q8I A;  3A3J A;  1OJ5 A;  2PR5 A;  3QP5 A;  5HW3 A;  3NEC A;  3P98 A;  1XJ3 A;  1MWR A;  4N9L A;  4CLC A;  5HDC A;  3DWK A;  2ZMF A;  3NOT C;  4LRX C;  2W27 A;  5FQK A;  5DTK A;  4BMW A;  1CI9 A;  1ZTU A;  4GLQ A;  3MQQ A;  1ALQ A;  1H3Q A;  4HP4 A;  4YWZ A;  4HH3 A;  4KQD A;  4EW7 A;  4EWF A;  3WRZ A;  1GHI A;  3PAG A;  3CLO A;  2HGV A;  5JYO A;  2WKI A;  4GHI A;  3HLE A;  5TBM A;  5EM0 A;  3UE6 A;  1CEF A;  5F69 A;  5CEB A;  3IBJ A;  1E3U A;  5E2G A;  1WA9 A;  4WMC A;  5AQA A;  5G18 A;  3F1N A;  3LUQ A;  1T1A A;  4PM5 A;  4O01 A;  4MCW A;  4S2N A;  4CLC E;  2KLI A;  2QMI A;  4ZBE A;  3EOI A;  1WYB A;  3PBQ A;  2V1Z A;  4JXW A;  2J9P A;  3S7P A;  4R38 A;  1KOU A;  1TDL A;  5EV0 A;  3U4L P;  1Z09 A;  3UMD A;  4EU0 A;  4RX3 A;  4IUK A;  1KGG A;  2G2U A;  1MZU A;  4BBV A;  4KG5 A;  3HRE A;  1BLP A;  2ZD8 A;  3F1P A;  4IUH A;  1GCE A;  3IHB A;  3IX8 A;  5FL3 A;  4WEJ A;  3AGE A;  5HFO A;  4X1M A;  4I39 A;  2EWV A;  2FZ0 A;  4WF0 A;  2DCF A;  1G6A A;  1K55 A;  1BYW A;  1JTD A;  2HDQ A;  3T4T A;  3UB5 P;  4S2N C;  3A3I A;  3V3R A;  1C3B A;  4ZTK A;  3UB9 A;  3B3X A;  2OAP 1;  2PD7 A;  4GDN A;  3UME A;  1TS6 A;  5GHY A;  3R4K A;  1LSX A;  4R4S A;  3NDE A;  2Y2L A;  3SH7 A;  3HLC A;  4Y0T A;  3TRC A;  2ZQA A;  1H0M A;  3T4O A;  1SKO B;  3IQA A;  3Q1F A;  4QY6 A;  3ZVT A;  1OTD A;  1K4F A;  3F1P B;  1K57 A;  2B18 A;  2Y2M A;  3ISG A;  3TW8 A;  2QZ6 A;  5M19 A;  1ZG6 A;  4O7D A;  2ZL1 B;  3B47 A;  4KUO A;  5CED A;  3PBN A;  2EWW A;  1NXY A;  5HX9 A;  4GCZ A;  5FAO A;  3QNB A;  2V9A A;  4OPZ A;  4DN0 A;  1FR1 A;  2AVX A;  3HUN A;  3OOV A;  2UV0 E;  1I2S A;  2HZ5 A;  4KZ4 A;  3VV4 A;  4LV3 A;  1CF0 A;  4X25 A;  3MBZ A;  1RGY A;  3FC7 A;  2V8C A;  4LV0 A;  4QWO A;  4Q0H A;  3AGD A;  4E3I A;  3IXD A;  3S7O A;  2OLU A;  3C7U A;  3HJK A;  3LR0 A;  4OLD A;  5IS1 A;  1LI9 A;  5GL9 A;  3SOI A;  3QP6 A;  1F5M A;  4XUZ A;  1T19 A;  4LEN A;  3TG9 A;  5TBM B;  1SHV A;  3D3O A;  3N8R A;  2VGK A;  4RQ9 A;  1TF1 A;  3A3E A;  4LRZ E;  2W1R A;  2Y4A A;  4JGP A;  1UWP X;  4R6L A;  1KGE A;  4GZB A;  3ZFZ A;  4L9F A;  5HDD A;  1Z6F A;  3NDG A;  2XEP A;  3H82 A;  4OH0 A;  3HBR A;  1Y4O A;  4DXC A;  1TD5 A;  1N9O A;  4QB8 A;  2ZQ7 A;  1STZ A;  3P01 A;  4IVK A;  3W4O A;  3HLW A;  5KSC A;  5FDS A;  4BWI A;  1BLH A;  2OWH A;  1Q2P A;  2QJ5 A;  1XA1 A;  3Q81 A;  3LR4 A;  1X0O A;  3OCN A;  3PHY A;  2PU2 A;  5L8M A;  2B02 A;  4WEK A;  1J9M A;  4EEU A;  4ZDX A;  5FAS A;  2ZL1 A;  1XKZ A;  4E3N A;  4B9O A;  3VFH A;  2Y2H A;  4GS9 A;  1FSW A;  1XGJ A;  5E2F A;  2Y8H A;  3UB6 A;  2J3W A;  1ES3 A;  2W3G A;  1CQA A;  3VE4 A;  1XGI A;  4OLG A;  2MJ6 A;  1K57 C;  3CJM A;  4U3T A;  1L3L A;  3IX4 A;  3PBS A;  4C3Q A;  1W7F A;  3RH8 B;  2WK0 A;  5L07 A;  1IKI A;  2ZQC A;  3NOU C;  3S7N A;  4A5R A;  2V8F A;  2VKS A;  3OPR A;  3GV9 A;  2Q0O A;  3BJN A;  5AQB A;  5DF8 A;  1W63 Q;  4GD8 A;  3EGD C;  1VB6 A;  3WS4 A;  4HJ3 A;  4DKI A;  1DP8 A;  2GNX A;  5CXW A;  4Y5F A;  3T50 A;  3OPH A;  3QP2 A;  1ERM A;  3K2N A;  4O8G A;  2XH9 A;  1LT0 A;  3HLG A;  5F5Y A;  4KZ8 A;  5CTM A;  3L9K A;  3MKF A;  3DW0 A;  3SS4 A;  2DRW A;  2Y2N A;  1K54 C;  4MN6 A;  1GA0 A;  2PR6 A;  5L10 A;  1GA9 A;  1YLY A;  5CHJ A;  2IWB A;  4MBH A;  5DF9 A;  3KYE A;  4LCM A;  4H6J B;  1PWD A;  1ZHH B;  4RVA A;  3BM6 A;  4E3K A;  1S67 L;  2IA2 A;  1FSY A;  2J80 A;  2B95 A;  1WYC A;  3MS6 A;  3G2Z A;  4ESP A;  3A3D A;  4JGO A;  5HWV A;  2Q9N A;  3L7H A;  3MFX A;  3CUE A;  3M6H A;  1NZU A;  2XF3 A;  4GOG A;  1GSV A;  2M7U A;  1FR6 A;  1NZO A;  2PD8 A;  3FKV A;  4MEZ A;  3ZG9 B;  3WS2 A;  4GD6 A;  5HSQ A;  4N1H A;  4GHI B;  4CLC D;  2D01 A;  1L0G A;  3MR0 A;  4P6Z S;  2XDM A;  1U60 A;  2WKQ A;  3BRM A;  4UA6 A;  3O86 A;  3BY9 A;  4NG2 A;  5HDS A;  2NUP C;  3QHY A;  1XFN A;  3PR6 A;  4ZJ1 A;  4IJG A;  2XSS A;  3O5Y A;  5EE8 A;  3UDX A;  4PM7 A;  4OP8 A;  2VGL S;  2R78 A;  1YSP A;  1D06 A;  1V9Y A;  4CLC B;  4UHU A;  1IFQ A;  3OPP A;  4DDS A;  4CQH A;  3LEQ A;  4R4R A;  3IT9 A;  4QPR A;  2K7S A;  4HOI A;  2PU4 A;  4AFI A;  3ITB A;  5CHU A;  2Y55 A;  4CJN A;  4HJ6 A;  4DRT A;  4OPY A;  5L09 A;  2E8I A;  3GVB A;  1W63 M;  2B5R A;  1HLU P;  4YIN A;  3MXQ A;  4I5S A;  3ICY A;  1NRJ A;  1NLY A;  2RCX A;  2EX9 A;  3BY8 A;  4GS9 B;  1WE4 A;  1FIK A;  5EUA A;  3S22 A;  3SH9 A;  1BUE A;  1KE3 A;  4H8R A;  4S2J A;  5FA7 A;  3ULF A;  3JVU A;  5DTS A;  1N4O A;  2G2W A;  2Y2P A;  5DKK A;  1UWN X;  2INW A;  2ZQD A;  4QHC A;  1OTB A;  4WUJ A;  4WBG A;  2JKG A;  2WGW A;  3ZNY A;  3SZT A;  1IYS A;  3HLD A;  3GR2 A;  3T4Q A;  3FWL A;  2WAE A;  4WMC D;  1E3U D;  1S0W A;  3GQZ A;  4U0T A;  3H82 B;  2P9V B;  4I3I A;  3HJI A;  2VK3 A;  1H8Z A;  1KVL A;  4IBX A;  1ZG4 A;  2JHE A;  5HD3 A;  2WKE A;  3T4J A;  2D02 A;  3HCY A;  3VP3 A;  4P6Z M;  5FDH A;  4GJ4 A;  5FI2 A;  4WZ5 A;  2O9C A;  5FAP A;  1IOU A;  2GX5 A;  1SCW A;  4ZJ3 A;  2VX8 A;  4HP9 A;  1VEU A;  1TEM A;  2WGV A;  5F82 A;  3SH8 A;  1IEL A;  4HY8 A;  2JCH A;  5AVE A;  4Y17 A;  3NJA A;  3HLB A;  3IWO A;  1IEM A;  4KZA A;  3EEA A;  4BQM A;  3ZDJ A;  4F3L A;  4M3K A;  3H7W B;  4RA7 A;  5KMW A;  3UDF A;  3T4K A;  3LFV A;  4KZ3 A;  4OPQ A;  2LB5 A;  2ZOI A;  1XJ4 A;  4EXO A;  3KYZ A;  3OZH A;  3DTE A;  2W3D A;  4HIA A;  1VET B;  1KGF A;  4OOM A;  3RFB A;  1YLJ A;  4BJP A;  2EFU A;  4HBT A;  4Y13 A;  5HWW A;  1CJF A;  2PYR A;  1SKO A;  2WZZ A;  4KZ6 A;  5LBR A;  3AGF A;  4I3A A;  1A0K A;  1PI5 A;  4WM9 A;  4GNU A;  3MMH A;  4KZ5 A;  2EXB A;  1NY0 A;  1DJB A;  2EXA A;  3VFF A;  2IWC A;  5F1G A;  4KEN B;  3G35 A;  3GRJ A;  3V39 A;  5L2F A;  3CPT B;  4MBF A;  5DFX A;  1S1Z A;  1ZC2 A;  2RL3 A;  2BTF P;  3G2Y A;  3IH9 A;  3D9Y A;  2ZJ9 A;  3VP4 A;  2JC7 A;  4OQI A;  4X55 A;  4EUZ A;  4BBT A;  3SS5 A;  1Y54 A;  4YOF A;  5EVI A;  1F98 A;  5AVF A;  1W8Y A;  3BFD A;  3IS2 B;  3ITA A;  2KOI A;  1TS0 A;  1ERQ A;  2R9X A;  3UB8 A;  2PDR A;  3IWQ A;  3VE3 A;  3UO9 A;  1V9Z A;  3DTK A;  3C38 A;  3KSI A;  4FOF A;  4JBF A;  4C6Y A;  1HVB A;  4X68 A;  3F1N B;  4BL3 A;  2WAD A;  4WLA A;  2XR0 A;  5CRF A;  2O9A A;  5FSR A;  2Z2M B;  5HL1 A;  3C7V A;  3A0V A;  4KZ9 A;  4JGQ A;  4UAA A;  5FQQ A;  4WEL A;  5A8B A;  2VV6 A;  3CMZ A;  4DE0 A;  4K0W A;  1MKM A;  4ZJ2 A;  2OOL A;  2H0T A;  1YLT A;  1T1C A;  2JBF A;  1ESI A;  3NC8 A;  2QWS A;  3IF6 C;  1LLB A;  2EX8 A;  1BUL A;  3QNC A;  5AJG A;  4EV4 A;  5DFY A;  1XA7 A;  2O99 A;  4OOL A;  1LSW A;  1MWT A;  3QP1 A;  4X69 A;  4GW9 A;  1I2W A;  3BEC A;  4IED A;  3FPW A;  4I3J A;  2VEA A;  5FQJ A;  1SDE A;  4N9K A;  3C4P A;  3ZG8 B;  1LI0 A;  3UPO A;  3RXW A;  5A90 A;  3OC2 A;  2OAQ 1;  3MZD A;  2WKR A;  1EI5 A;  4Y3I A;  1IYO A;  4MBK A;  3NBL A;  4P87 A;  3F1O A;  1NJ4 A;  2Y2O A;  1GSW A;  2JKR I;  3UB7 A;  1HTZ A;  4RX2 A;  3CHW P;  1TDG A;  2YKH A;  2WAF A;  3HUM A;  1QME A;  2HJ9 C;  3CUE C;  1EWZ A;  1N9L A;  3EQV A;  3TOI A;  3MXR A;  2E8J A;  3ZG7 B;  2W3E A;  3KX0 X;  2M7V A;  2W3F A;  3KSF A;  4R3A A;  4G3K A;  3T12 B;  2DNS A;  2Z6D A;  4F94 A;  5TFQ A;  3IHA A;  1E25 A;  1LL5 A;  1KVM A;  3KSH A;  3WRT A;  1PZP A;  1AXB A;  2ZLY A;  3VP2 A;  3NY4 A;  1S4R A;  5FEG A;  1MXO A;  1O7E A;  4EES A;  3R7W A;  1KDW A;  1F9I A;  2ZC4 B;  5KZH A;  4K91 A;  5EM1 A;  1LSV A;  4JF5 A;  3ZCZ A;  3E4P A;  3A0S A;  1XXM A;  4P85 A;  1XJ6 A;  1GHM A;  2H28 A;  4E6W A;  2H10 A;  4BD1 A;  2P74 A;  4MLL A;  1PWC A;  4B93 A;  3CAX A;  3G4P A;  1IYP A;  3OLO A;  3Q7V B;  5EEC A;  2FH5 A;  5CEC A;  3LGO A;  4PAU A;  3DTI A;  3PXP A;  5GLB A;  1LL8 A;  4M4X A;  3K3D A;  2A49 A;  5DJU A;  1JWV A;  4MN5 A;  3UDI A;  3PYP A;  3UE1 A;  4XUX A;  3T1S A;  2V1B A;  1L2S A;  3MF0 A;  1ES4 A;  4BD0 A;  1H5X A;  5F83 A;  1JNU A;  4II7 A;  5TJJ A;  4NET A;  3RXX A;  5F1F A;  1N9N A;  1D1J A;  4Q0I A; 
#chains in the Genus database with same CATH homology
 3D72 A;  3E4O A;  4G3W A;  4HJ6 A;  2W0N A;  3OBF A;  5J3W A;  4GHI A;  2Y79 A;  1W63 M;  5TBM A;  3MXQ A;  4I5S A;  3ICY A;  1NRJ A;  3KSG A;  1NLY A;  3BY8 A;  3UE6 A;  2VV8 A;  4GS9 B;  3MQ0 A;  5F69 A;  5C5K A;  4UEY A;  1YAX A;  1NWZ A;  4PKY A;  3H9W A;  3G6O A;  3EGX C;  3IBJ A;  3ULF A;  4MN7 A;  1WA9 A;  3JVU A;  5K5B A;  3F1N A;  4UQI M;  1OTE A;  1T1A A;  3LI8 A;  3LUQ A;  2WKP A;  4O01 A;  5DKK A;  1UWN X;  4MCW A;  1YSQ A;  2INW A;  3ZQ5 A;  1OTB A;  4HI4 A;  2JKT I;  4WUJ A;  2KLI A;  3FPV A;  4CLC E;  2CMN A;  4K08 A;  4I38 A;  5DKL A;  3EOI A;  4NXB A;  3T4Q A;  2A2L A;  1Y28 A;  3DBA A;  4WN5 A;  3PBQ A;  1T1B A;  3H82 B;  2ZBB A;  1P9W A;  2QJ7 A;  2K2N A;  4I3I A;  3HJI A;  3S7P A;  4R38 A;  3W2Z A;  1KOU A;  3UMD A;  4EU0 A;  4IUK A;  1XFQ A;  2JHE A;  5HD3 A;  3LR5 A;  3T4J A;  4DJ3 A;  2D02 A;  1MZU A;  3HCY A;  4BBV A;  3V67 A;  2V0W A;  2JKR M;  4UQI S;  4P6Z M;  4E04 A;  3F1P A;  4GJ4 A;  4IUH A;  3T4S A;  3F1O B;  4PHT A;  5FL3 A;  2O9C A;  4WEJ A;  1IOU A;  2GX5 A;  4HH2 A;  3K3C A;  5DJT A;  2VX8 A;  4HP9 A;  1G6O A;  4I39 A;  2EWV A;  2BAS A;  5F6A A;  4XT2 B;  2FZ0 A;  5MC7 A;  1DP9 A;  1S1Y A;  4WF0 A;  4L9E A;  4HY8 A;  5AVE A;  1BYW A;  3NJA A;  3T4T A;  3BW6 A;  2M1C A;  3VOL A;  3UB9 A;  2OAP 1;  2PD7 A;  3UME A;  1TS6 A;  2JN7 A;  3R4K A;  4ZRR A;  2P04 A;  1LSX A;  3PBR A;  3EEA A;  2A24 A;  3U2A A;  3TJZ C;  1OT6 A;  2JKT M;  4F3L A;  5G4Z A;  2LB9 A;  3TRC A;  3H7W B;  3CWF A;  3T4O A;  1GSX A;  3T4K A;  3LFV A;  1OTD A;  4CLC C;  2LB5 A;  4ARZ B;  1OTA A;  2ZOI A;  4LRY C;  1XJ4 A;  3F1P B;  4EXO A;  3KYZ A;  2B18 A;  3TW8 A;  4O0P A;  2W3D A;  4HIA A;  1T18 A;  2GJ3 A;  2J3T C;  4OOM A;  3RFB A;  3B47 A;  3C30 A;  3LIE A;  1G28 A;  4BJP A;  4KUO A;  3E0Y A;  2XRO A;  4NEE D;  3PBN A;  4BBU A;  5HWW A;  2EWW A;  5G4Y A;  4ARZ A;  4ETX A;  2PYR A;  2YKF A;  3E98 A;  1S66 L;  4HJ4 A;  2DMW A;  3BQA A;  4GCZ A;  1P9R A;  2XRN A;  2P08 A;  2V9A A;  5LBR A;  4DN0 A;  4I3A A;  2GZA A;  2HV1 A;  4FSF A;  4JGR A;  3OOV A;  3MMH A;  4Q0I A;  3VV4 A;  3MQO A;  3B33 A;  5I5L A;  3BQ8 A;  4HHD A;  3FC7 A;  3IS2 A;  4R70 A;  4Q0H A;  3MJQ A;  2VGL M;  2VJW A;  2KDK A;  4ME4 A;  2KX6 A;  3S7O A;  3HJK A;  3LR0 A;  5DFX A;  5IS1 A;  1S1Z A;  5F68 A;  2O0Y A;  2O9B A;  1F5M A;  5HD5 A;  5KSH A;  4KUK A;  5HWT A;  1T19 A;  4NXF A;  5TBM B;  3D3O A;  3H7W A;  1MC0 A;  4RQ9 A;  3PBT A;  2V1A A;  3UE3 A;  1TF1 A;  4BBT A;  4LRZ E;  2W1R A;  4YOF A;  4Z1W A;  1F98 A;  2VLG A;  4JGP A;  1UWP X;  5AVF A;  4R6L A;  3IS2 B;  2QHK A;  4EUV A;  3SW1 A;  2KOI A;  1TS0 A;  3KYQ A;  4L9F A;  2P7J A;  3PBO A;  5HDD A;  3UB8 A;  3H82 A;  2L0W A;  1TD5 A;  2EA9 A;  1N9O A;  2PDR A;  1STZ A;  2ZMV A;  3P01 A;  2V0U A;  4L9G A;  3VE3 A;  1V9Z A;  2OWJ A;  4MDZ A;  3C38 A;  4ETZ A;  3KSI A;  4FOF A;  4BWI A;  3LR3 A;  1UGU A;  2OWH A;  1TS8 A;  2QYB A;  2QJ5 A;  3F1N B;  4WLA A;  3LR4 A;  1X0O A;  3OCN A;  3PHY A;  5L8M A;  3RTY A;  2O9A A;  2B02 A;  4L0L A;  4WEK A;  4EEU A;  3A0V A;  1P97 A;  4JGQ A;  4B9O A;  3IBR A;  4WEL A;  5A8B A;  2VV6 A;  2J3T D;  1MKM A;  3LIB A;  4IHQ A;  4GS9 A;  2OOL A;  2QKP A;  3TE8 A;  3JVV A;  1T1C A;  2Y8H A;  3EEH A;  3UB6 A;  1OTI A;  4EET B;  3CI6 A;  2J3W A;  1H8M A;  2HF6 A;  2QWS A;  2W3G A;  3VE4 A;  1D7E A;  4F3L B;  2VA0 A;  2A24 B;  5AJG A;  4MMN A;  2MJ6 A;  2VV7 A;  4LPZ A;  4Y2F A;  2ZOH A;  4DMZ A;  1YKD A;  3ZYT A;  3B42 A;  5DFY A;  1XJ2 A;  5HL6 A;  2O99 A;  4OOL A;  3LIA A;  1LSW A;  3PBS A;  3R7W B;  3E4Q A;  3A0R A;  4GW9 A;  2L4R A;  3RH8 B;  4EQ1 A;  3FPW A;  3NOU C;  3S7N A;  4I3J A;  4DJ2 A;  4YNR A;  2VEA A;  2VKS A;  4XT2 A;  3EWK A;  3P7N A;  3OC2 A;  1ODV A;  2OAQ 1;  3BJN A;  3NHQ A;  1P0Z A;  2Z6C A;  2WKR A;  4Y3I A;  1W63 Q;  3FG8 A;  3C2W A;  3EGD C;  1NLZ A;  1VB6 A;  3T4L A;  3F1O A;  1OJG A;  1GSW A;  4HJ3 A;  2JKR I;  1DP8 A;  3NOP C;  2GNX A;  2W1T A;  3GDI A;  3UB7 A;  4Y5F A;  3T50 A;  4Q0J A;  3K2N A;  4HNB A;  2YKH A;  4O8G A;  1LT0 A;  5F5Y A;  4KQO A;  1TS7 A;  2HJ9 C;  3CUE C;  1N9L A;  5J4E A;  3EQV A;  5HPI A;  4MN6 A;  2W3E A;  2PR6 A;  5IT5 A;  3S7Q A;  3KX0 X;  3EQU A;  2M7V A;  2PHY A;  2W3F A;  3OCL A;  5HZH A;  5DF9 A;  5CX7 A;  3KSF A;  2I9V A;  4H6J B;  4R3A A;  1ZHH B;  5HPF A;  4G3K A;  1S67 L;  2K31 A;  1DP6 A;  2IA2 A;  2Z6D A;  3LI9 A;  4EEP A;  3BWL A;  2J80 A;  1OPX A;  3KSH A;  4PKY G;  1OT9 A;  2VZW A;  4JGO A;  5HWV A;  1S4R A;  4NXG A;  1EW0 A;  3MFX A;  3CUE A;  2PT7 A;  4EES A;  3R7W A;  3LID A;  1F9I A;  1GSV A;  2NUT C;  2M7U A;  2PD8 A;  3C8C A;  1LSV A;  2PYP A;  2HJE A;  5HSQ A;  2G7U A;  3E4P A;  4CLC D;  4GHI B;  2D01 A;  3A0S A;  3MR0 A;  4P6Z S;  3KO6 A;  1XJ6 A;  2H28 A;  4LLO B;  4HQA A;  2WKQ A;  4WL9 A;  5J7E A;  5IU1 A;  3BY9 A;  1VHM A;  5HDS A;  2NUP C;  4B93 A;  1DRM A;  4G3V A;  3CAX A;  1OJ5 A;  2PR5 A;  3GEC A;  5KIZ A;  3OLO A;  1XFN A;  2FH5 A;  1XJ3 A;  2XA7 M;  4CLC A;  3PR6 A;  4NXE A;  5HDC A;  5EFW A;  2W1T B;  4IJG A;  4PAU A;  2ZMF A;  2XSS A;  3O5Y A;  3NOT C;  3PXP A;  4LRX C;  2W27 A;  3LYX A;  4NKP A;  2L1M A;  2VGL S;  4BMW A;  2W3H A;  1LL8 A;  2R78 A;  4M4X A;  1YSP A;  3CIT A;  3K3D A;  4H6J A;  1D06 A;  1V9Y A;  4CLC B;  1ZTU A;  5DJU A;  1IFQ A;  4MN5 A;  3PYP A;  1S4S A;  3LIF A;  4GLQ A;  4CQH A;  3MQQ A;  1H3Q A;  2V1B A;  4HP4 A;  2XA7 S;  4YWZ A;  3MF0 A;  4HH3 A;  1JNU A;  4II7 A;  4KQD A;  4QPR A;  5TJJ A;  3LIC A;  2K7S A;  4EER A;  4EW7 A;  4HOI A;  1N9N A;  3CLO A;  2HGV A;  4AFI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...