4PKYG

Arnt/hif transcription factor/coactivator complex
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
106
structure length
100
Chain Sequence
LDSKTFLSEHSMDMKFTYCDDRITELIGYHPEELLGRSAYEFYHALDSENMTKSHQNLCTKGQVVSGQYRMLAKHGGYVWLETQGTVIYNQCIMCVNYVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Aryl hydrocarbon receptor nuclear translocator
publication title Coiled-coil Coactivators Play a Structural Role Mediating Interactions in Hypoxia-inducible Factor Heterodimerization.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/cell cycle
total genus 26
structure length 100
sequence length 106
ec nomenclature
pdb deposition date 2014-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF08447 PAS_3 PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4pkyG00
1XJ6A 1OTDA 2QWSA 4KQDA 3E4OA 5AVFA 5HD5A 5A8BA 3FG8A 5TBMA 3IS2B 4K08A 4BBVA 4E04A 5I5LA 4WUJA 1GSWA 3LIAA 3ZQ5A 3CAXA 2L4RA 2V9AA 3NOUC 1TS8A 4GHIA 3NOPC 5F6AA 5HZHA 1GSVA 2VV8A 2PR5A 3K3DA 4JGPA 4I38A 2WKRA 1KOUA 4EEPA 4WN5A 1NWZA 4I3JA 1XJ3A 4XT2B 5G4ZA 1OTAA 4WF0A 2KX6A 4R38A 5AVEA 3UMDA 1TS0A 3H82A 2YKHA 4H6JB 1XJ2A 1OTIA 1P97A 2R78A 2QJ5A 3EEHA 1OT9A 2JN7A 3GDIA 1DP9A 3NHQA 4KUKA 3VOLA 5IU1A 1XJ4A 3PHYA 4GCZA 2QHKA 1BYWA 4MN5A 4NXFA 4M4XA 1UGUA 4EERA 5F69A 3B33A 1TS7A 1V9ZA 5EFWA 3LIDA 1D7EA 5KIZA 1T1AA 4EEUA 2Z6DA 3NOTC 3P7NA 4PKYA 1T19A 2GJ3A 3MR0A 1T18A 5DKKA 5HDCA 5HDDA 1F9IA 3E4PA 3VE3A 4HOIA 4KUOA 2ZOHA 3GECA 4GW9A 1T1CA 3F1PA 3RTYA 4BBTA 4R3AA 2W0NA 4BBUA 1MZUA 2HV1A 3LIEA 3A0SA 4HJ6A 5HWWA 4HI4A 4HQAA 4EESA 2PYPA 4HNBA 3UB9A 1OTEA 4HY8A 3H7WA 1VB6A 2V1AA 2A24A 3H9WA 4GS9A 5J7EA 3LUQA 3LI8A 3F1OA 3E4QA 3BWLA 5IS1A 1N9NA 4LLOB 2P7JA 3LI9A 2V1BA 4MN6A 3RH8B 5TBMB 1OT6A 1XFNA 4HP4A 2OWHA 4EXOA 3MFXA 2YKFA 2ZOIA 2VV6A 1TS6A 1ODVA 3VE4A 2QJ7A 3KX0X 5G4YA 3UMEA 1DP8A 1V9YA 2D01A 4GHIB 2J80A 5DJTA 3BY9A 5HSQA 1LL8A 1JNUA 4R70A 2VLGA 1X0OA 4JGQA 3CLOA 2PD8A 4F3LA 1S4RA 1UWNX 4DJ2A 2WKPA 4HHDA 4HJ4A 2VV7A 4LRYC 3K3CA 3C2WA 2PDRA 2OWJA 4L9GA 3D72A 3LIBA 1S1YA 4NXBA 4L9EA 4EQ1A 3H82B 3OLOA 5J3WA 2B02A 4L9FA 1DRMA 3IS2A 2V0UA 3LICA 3IBRA 2M1CA 5DKLA 3PYPA 4WL9A 2EA9A 2PHYA 1P0ZA 5J4EA 1S4SA 4YWZA 3EWKA 4LPZA 4NXEA 4LRZE 2QKPA 3ULFA 5HWVA 4I3AA 5HWTA 2L0WA 3T50A 4NXGA 2Z6CA 3MJQA 3LYXA 1DP6A 3UB7A 4XT2A 2PD7A 3MQOA 4WLAA 3BY8A 2BASA 3F1NA 1D06A 4PKYG 4H6JA 2W27A 3G6OA 3FC7A 3F1PB 2WKQA 1T1BA 4EETB 2KDKA 3CWFA 4R6LA 4HH2A 2K7SA 1Y28A 1S1ZA 1LT0A 3A0RA 2VEAA 4LRXC 1G28A 4RQ9A 1LSWA 3MXQA 3H7WB 1S67L 3SW1A 4I3IA 2PR6A 2A24B 4GS9B 4HH3A 4EW7A 3F1OB 4I39A 1LSVA 3F1NB 5DJUA 1F98A 1EW0A 1OTBA 1XFQA 4JGOA 4HJ3A 1N9LA 2INWA 3ICYA 4DJ3A 2JHEA 1UWPX 4B9OA 2H28A 3A0VA 4HP9A 2D02A 4HIAA 5F5YA 5HDSA 4JGRA 1OJGA 1GSXA 3HJIA 5F68A 2ZBBA 3UB6A 1S66L 3UB8A 1N9OA 3MQQA 2I9VA 2PYRA 3C8CA 1WA9A 1OJ5A 3NJAA 4I5SA 3LIFA 1LSXA 2L1MA 3HJKA 2CMNA 2V0WA 4F3LB 2OOLA 3UE6A 5HD3A
chains in the Genus database with same CATH superfamily
4QHCA 1OTDA 2MJ6A 3LCEA 1G6OA 4KQDA 2V2FF 3HUNA 5FATA 5A8BA 3FZCA 2G2UA 4KQOA 4CLCD 3QHYA 1H8MA 3VOYA 4II7A 5I5LA 5DF8A 4EBNA 3DW0A 3MS6A 3HLFA 1GSWA 3LIAA 2ZMAA 3T4OA 4YOFA 2WAEA 2NUPC 4KG2A 2ZL1B 5EV0A 2ZQDA 5KZHA 5HZHA 1NRFA 1SKOB 1HTZA 2PR5A 3K3DA 1SDNA 3BLMA 4DKIA 4JGPA 4Q0HA 3SH9A 1NLZA 5FAPA 4OKPA 4EEPA 1I2SA 1PRQA 5GL9A 5G4ZA 1FCNA 2KX6A 4R38A 1XXMA 4OOYA 4UHUA 4NETA 3CZDA 3Q7VB 3BJNA 1OTIA 3KYQA 3P01A 3PBQA 5FQKA 3DBAA 3ZHHA 1CJFA 3IXHA 4MBFA 2JN7A 4FH2A 3ZNTA 5FQJA 3G4PA 2HZ5A 3PHYA 2Y2PA 3EQUA 1NZUA 3LEZA 4MN5A 5CTNA 5KMWA 4EERA 4Y13A 1PWCA 2PBDP 3C30A 5A92A 5GLAA 4UAAA 1F2KA 3MXRA 4OQHA 1ONGA 5KIZA 3W8KA 1T1AA 1S0WA 2Z6DA 3NOTC 3KSHA 2HJEA 3UE3A 1SHVA 2GJ3A 3E98A 4OP5A 2FZ0A 2J8YA 4O01A 1IYOA 3E4PA 1T1CA 3F1PA 4ZJ2A 4GN2A 4U0TA 4Y0UA 2W0NA 4X53A 4KENB 4D2OA 5CEDA 1VEUB 2GZAA 1XA1A 5HWWA 4HEFA 1YQSA 4EESA 2PYPA 4HNBA 3UB9A 3C7UA 4B88A 3T1XA 4WELA 1ZTUA 2XDMA 2V8CA 3NULA 4JXGA 4EBLA 3H9WA 4JF4A 3LI8A 4FOFA 1OMEA 4MDZA 3T4QA 2FH5A 1A0KA 4XUZA 1N9NA 3W4PA 5TR7A 2WKEA 4QU3A 4P0MA 3RH8B 3S4XA 4WEJA 3E2LA 3IX4A 5FQIA 5F82A 1KDSA 4UA9A 2YKFA 2ZOIA 2NUTC 4IBXA 2A49A 1K57A 1TS6A 1BLHA 3G2YA 3VE4A 1BTLA 2QJ7A 1PNEA 3IT9A 3BLSA 2WUQA 5HPIA 4WZ5C 4N92A 1DP8A 2Y4AA 4IUHA 4KZBA 2WGIA 2V8FA 4S2LA 3ZGAB 3IHBA 4GHIB 1BSGA 4K0WA 4R70A 2I72A 4OPZA 2ZQ7A 3S1YA 3OPRA 1H8ZA 3ZNYA 3CLOA 2PD8A 1FSYA 5AQAA 3LEQA 1PFLA 3B42A 1MWUA 4HJ4A 4ZJ3A 2VV7A 4DN0A 3C2WA 3AGEA 4MCWA 4L9GA 3PBOA 5HFOA 3LIBA 4ID4A 4GKUA 4L9EA 1RGYA 1CI8A 3EGDC 1JWZA 1KGFA 1FR6A 3IBRA 2O99A 5HW3A 1YLPA 1MWTA 2HP6A 4WL9A 3SS3A 3PBTA 3L7HA 1I5QA 5J4EA 1PZOA 3T4TA 4YWZA 3EWKA 4LPZA 3B3XA 3EGXC 5HAPA 4DXCA 1ZG6A 4NXEA 2W1RA 2HP5A 3ULFA 1IKIA 4I3AA 2WAFA 4O7DA 3VOZA 5HWTA 3C4OA 3DTEA 5DF7A 2Y2MA 4H8RA 1HLUP 1KE0A 1MPLA 4OOMA 3MQOA 3Q81A 5EM1A 2RL3A 3FKVA 1U60A 2ZQAA 4PKYG 3TG9A 3A3FA 4KZ9A 3PBSA 1CK3A 2R9WA 3G6OA 3FC7A 4P85A 1AXBA 2WKQA 1W63Q 4E6WA 2K7SA 3IWOA 1S1ZA 2VEAA 4KG5A 5CTMA 3MZEA 1YKDA 1LSWA 1CEFA 2DCFA 1S67L 4PM5A 2EWVA 4I3IA 4CQHA 4GS9B 3LY3A 4HH3A 4RVAA 1W63M 4N9KA 4I39A 3F1NB 1EW0A 1PI5A 5J8XA 2XSSA 4S2NC 2J9PA 2Y2KA 1TVFA 2INWA 3ICYA 1FQGA 2JHEA 2GNXA 2H28A 3BQAA 3KSIA 3NECA 2HP9A 3GSGA 3NY4A 2PBYA 3Q82A 5F5YA 3UPOA 4JBFA 3D3OA 4ZJ1A 3TRCA 2ZBBA 3UB8A 3DTIA 5FQMA 1EROA 2XD1A 5CX7A 1YSQA 3CJMA 2WZXA 1ESUA 1L0DA 5AQBA 3CITA 5DFXA 3JPUA 4S2MA 1FCMA 2W3GA 5D3OA 2V0WA 5JYPA 3UE6A 2WGVA 1ES4A 4ZDXA 1CQAA 4YINA 2QWSA 2CC1A 2VZWA 1XGIA 4OP8A 3BRMA 4GD8A 5AVFA 3JVVA 2ZM0A 1YLTA 5TBMA 2X01A 2Z2LB 3HUMA 1O07A 2P74A 3V5MA 2H0TA 3IS2B 4S2IA 5FI6A 1L0GA 4BBVA 4NEED 4MEZA 4F94A 3CPTA 2Q9NA 3QP4A 3WS5A 1TDLA 4Z1WA 3IXGA 2V9AA 1MKIA 4KQRA 4QB8A 3OC2A 1P9RA 4G3VA 1PWGA 1ACFA 1BLPA 3NOPC 5M18A 5F6AA 4N1XA 4PPRA 3QP1A 3N8RA 3ZFZA 4I38A 3HBRA 1KOUA 3KYZA 3TSGA 2WYXA 1EWZA 4XT2B 3T1RA 1OTAA 1CF0A 2EX6A 2Y2QA 2OLVA 1K0KA 5E2EA 1MKMA 3H82A 2Q9MA 1ZHHB 3UPPA 1P9WA 4HBUA 2YKHA 3U2AA 2ZC3B 4IHQA 1PW8A 2QJ5A 1K4EA 2GX5A 2AVXA 1OT9A 5C5KA 1ALQA 1VETA 4Q0JA 3NHQA 1AWIA 3VSLA 3VSKA 1HD8A 5L09A 4EQIA 5L8MA 4LCMA 1BYWA 4IEDA 4M4XA 1UGUA 2Z2MB 3BFDA 5F69A 4IJGA 2FFFB 1TS7A 1K56D 1V9ZA 1D7EA 2JE5A 1ZC2A 3QNBA 1XP4A 5HDCA 5FASA 1F9IA 3C38A 3WS2A 4CLCA 4WMCD 5LBRA 4KZ7A 2XLNA 3BYDA 3NI9A 3GECA 4BWIA 4OVDA 4OOLA 3RTYA 4R3AA 1YSPA 1NJ4A 1ZKJA 5K5BA 5CERA 2HV1A 5GLDA 2VX8A 3A0SA 4HJ6A 1L3LA 1YMSA 1LL5A 3M2KA 4LV0A 1BLCA 1K6RA 3R7WA 4JF6A 5EUAA 3T12B 5HAQA 1BULA 4LV3A 3PBNA 5CHJA 3G31A 3H7WA 1VB6A 3G35A 1IYQA 5A93A 3E2KA 3FV7A 3MF0A 3F1OA 5EVIC 3E4QA 2Y2IA 5EVIB 4OPYA 3BWLA 1YLYA 4UQIM 4LLOB 3ZG8B 3LI9A 2P08A 1KE4A 1NZOA 1K55C 4LCLA 1K54A 1OT6A 3IH9A 1XFNA 2WKIA 3EOIA 1NRJA 4P6ZM 2Y2JA 3UY6A 4DE0A 2VV6A 5KSHA 2W3FA 3KX0X 5EVLA 3MBZA 2UWXA 2WK0A 4GNUA 4MNRA 3TJZC 4Q0IA 3EQVA 3BY9A 2Y59A 3HLEA 1F5MA 5F1FA 3O88A 2ZQCA 3GV9A 2XGNA 2LB5A 4DXBA 3A3EA 4OH0A 4FCFA 4F3LA 2WADA 1LI0A 1Z6FA 2ZQ9A 3WS4A 2WKPA 1J3WA 4Q8IA 5CRFA 3IF6C 4HESA 3IHAA 3IF6B 2OWJA 4ZRRA 2JBFA 3W4OA 1SZVA 4NXBA 1FCOA 4EQ1A 5GHZA 1BZAA 1KGGA 1NYYA 2WZZA 2JKFA 4QY5A 2OSUA 2B02A 3MSHA 4L9FA 1KE3A 1DRMA 2V0UA 3LICA 5DF9A 2H10A 2IWCA 3PAGA 5EPHA 2M1CA 5I94A 4M3KA 5DKLA 1TDGA 2QMIA 2DNSA 5GLCA 3K2NA 4IBRA 1P0ZA 2ZL1A 1RGZA 4BJPA 1S4SA 4R3JA 3O5YA 3ITBA 1SKOA 3N4IA 3D9YA 3BFEA 3NC8A 3RFBA 4ARZB 2L0WA 4OQGA 2P9VB 1ESIA 4NXGA 3UB5P 1DP6A 2IWDA 4MLLA 2PD7A 3DWKA 4R0QA 3UDXA 2EX2A 3Q7VA 4EUZA 4DE1A 2W27A 4S2JA 3SZTA 4K0XA 4WM9A 5AQ9A 1T1BA 4UQIS 1ERQA 1PYYA 4CJNA 3S7OA 2WGWB 1OPXA 3W4QA 1H5XA 1ERMA 2ZMFA 2JKTI 3GMWA 3SW1A 1IKGA 2PR6A 2A24B 3GRJA 1ES2A 4B93A 3DAVA 1NXYA 4EW7A 4BL2A 5CECA 1PIOA 1LL9A 2XA7M 5DJUA 2XEPA 2Y2NA 4JGOA 3QP5A 2XF3A 4BENA 4OPQA 3CMZA 1BUEA 1WYBA 2VKSA 5CEBA 1K25A 4D60A 3FWLA 4X56A 1SDEA 4JXWA 3A3IA 2PU2A 4HIAA 5HDSA 2ZD8A 4JGRA 1GSXA 3HJIA 4X25A 5F68A 3UB6A 1S66L 1N9OA 1VEUA 3UE0A 3C8CA 3ISGA 1L2SA 1YT4A 4E3OA 1XA7A 4EWFA 1LI9A 3HLBA 5FEFA 3VV4A 1LSXA 1MWSA 2CMNA 2P04A 4E3MA 3MMHA 3SH7A 1W8QA 3OCNA 1Y54A 2BG1A 4R3BA 2J3WA 3E4OA 2QYBA 1Q2QA 5HD5A 3FYZA 2V20A 4QY6A 1JTDA 1H8YA 4Y0OA 4OLDA 5FDSA 2OAP1 4XXRA 4MN7A 3VFFA 5DFYA 4OPRA 1JTGA 1YLJA 3D4FA 3WRTA 2L4RA 3BM6A 3UE1A 3Q7ZA 4WZ5A 3S7QA 4GHIA 2PT7A 3UDFA 5L10A 5DVAA 3Q07A 3S22A 1H0MA 2B5RA 3GTCA 4BQMA 1GSVA 3V3SA 3N8SA 4E3LA 3BFGA 3DTMA 1YMXA 3GVBA 4O0PA 5EOEA 4ZBEA 1NWZA 3QNCA 3MZFA 1XJ3A 2W3EA 4WF0A 1HZOA 3UMDA 1W8YA 2HF6A 1O7EA 3NDEA 1TS0A 4BMWA 2ZLYA 5DTKA 3LR4A 4H6JB 1P97A 1XKZA 4FD8A 1LLBA 2XA7S 3KYEA 1MY8A 2R78A 5L07A 1ZG4A 4GDNA 4EV4A 3GDIA 3VP2A 3RJUA 1DP9A 5MC7A 2EX9A 3UDIA 3CHWP 3LFVA 3CI6A 4GOGA 4PM7A 2Y2GA 1M40A 4GCZA 2ZMVA 2QHKA 2VJWA 5FA7A 4N9LA 3UN7A 3IWIA 1Q2PA 2C5WB 5G18A 4O8GA 3B33A 5GHYA 1NLYA 2W1TB 3MQ0A 3UNWA 2ZC7A 3Q1FA 5DTSA 3NIAA 4EEUA 2PU4A 4PKYA 3MKEA 1T19A 3MR0A 1T18A 5DKKA 4QPRA 5HDDA 3OOVA 2IA2A 4WYYA 4P6BA 3G32A 3VE3A 4KUOA 1IEMA 4PM9A 3ZG5A 4BBTA 4DMZA 5IT5A 1MZUA 3LIEA 4DF6A 2DMWA 3ITAA 3ZG7B 2FFYA 5FSRA 4HQAA 4X1LA 3PR6A 4GZBA 3V50A 2JKGA 1IELA 1GA0A 3TW8A 2EXAA 4GS9A 4PHTA 3CUEC 3LUQA 2ACGA 1S6RA 4Y17A 4R4SA 2HJ9C 3LO7A 1K6SA 4IVKA 5IS1A 4S2NA 2V1BA 4MN6A 1YLWA 2G7UA 5A91A 2R9XA 1C3BA 4X1MA 2J3TC 4RA7A 1EI5A 2OWHA 3MFXA 3C4PA 3S7NA 2ZC6B 3FPWA 1CI9A 3PXPA 2ZC4B 2QZ6A 3KO6A 4RX3A 4GD6A 4U3TA 1G6AA 3UMEA 2D01A 4XUXA 4GB7A 3HLDA 3N7WA 4S2KA 2OLUA 1YLZA 3OZHA 4HBTA 5HSQA 1Y4OA 1LL8A 3A3DA 1JNUA 3OBFA 3LGOA 5CHUA 3ZVWA 1X0OA 5TFQA 2HDQA 3WS1A 4E3KA 1L0EA 3W2ZA 4DJ2A 4HHDA 1KVMA 3BQ8A 1K56A 4LRYC 3UPNA 3K3CA 2OV5A 2PDRA 2LB9A 3HLWA 3D72A 1H3QA 4DDYA 1GA9A 1KVLA 5IHVA 3OLOA 4LFUA 4JLFA 4JKTA 4GJ4A 4WMCA 3IS2A 3RXWA 3V67A 2XQZA 1VM1A 2XD5A 5FQQA 5HARA 5U47A 1JVJA 4GLQA 3OPPA 3L9KA 5GLBA 3IXDA 4E6XA 4MMNA 3VP1A 2Y91A 5CHMA 3PYPA 5FAOA 1HVBA 4BLMA 2JKTM 4FH4A 2EWWA 2DRWA 5L2FA 4X69A 4LRZE 1MBLA 3HREA 1IYSA 3BECA 2Y2HA 5EE8A 4P87A 1CEGA 4S2OA 1VHMA 1RP5A 3MJQA 1GCEA 3T1SA 1YPRA 1E25A 4XT2A 4BL3A 3WS0A 3VP3A 3BY8A 2GDNA 3A3JA 2VGJA 2K2NA 5AQ7A 3GQZA 4E3JA 1Z09A 4X68A 2EXBA 1N4OA 2J3TD 3WWXA 4E3NA 3F1PB 2XFTA 1TF1A 3VP4A 1MWRA 3IH8A 4EETB 1VQQA 5F83A 3CWFA 2K31A 2XROA 3O3VA 4KZ8A 4QD4A 1GHIA 1Y28A 4OQIA 2UV0E 1D1JA 2Y2OA 3IXBA 3MZDA 4N1HA 2G2WA 2Y55A 4S2PA 1W5DA 4RQ9A 4IVIA 1W79A 4KZ5A 4JXSA 3MXQA 1STZA 4AFIA 2HDRA 2H0YA 3MFDA 2JC7A 3IF5A 1LSVA 4KG6A 5FL3A 1XFQA 1SCWA 3V3RA 3G2ZA 3HLCA 2B95A 3HCYA 4RYEA 3SS4A 4DDSA 3P98A 4NG2A 2J9OA 4R23A 4ESPA 1MC0A 4WBGA 4ETXA 1K57C 2D02A 1PI4A 1N9BA 2JKRI 5FI2A 3BFCA 3UO9A 3IX8A 4LV2A 1XX2A 2OAQ1 1WA9A 1YAXA 1OJ5A 2PRFA 4OLGA 2H5SA 3LIFA 1GHMA 2L1MA 3LR0A 3U4LP 3HJKA 4X6TA 4U0XA 1JWVA 5HX9A 3MKFA 5FI7A 1PWDA 3OPHA 2M7VA 1W7FA 3MXSA 1DJCA 4C3QA 5HD3A 1IYPA 5EVIA 1XJ6A 1E4DA 3BFFA 3N8LA 1NY0A 1YM1A 2C6WB 2PAVP 3FG8A 1JWPA 5EVID 3WRZA 2O9AA 3RXXA 2KOIA 5CGWA 5HL1A 1K55A 5HAIA 4K08A 2O9BA 4E04A 4UA6A 4WUJA 4GDBA 5F1GA 5E2FA 1FR1A 3ZQ5A 5GHXA 3CAXA 4PM6A 3ZG9B 2ZQ8A 1G68A 3NOUC 4UEYA 2XRNA 1TS8A 1DY6A 3T4LA 4QWOA 4BD0A 2Y2LA 3QP8A 3LR5A 3ZVTA 4DE2A 3LR3A 3FKWA 2VV8A 3ZCZA 4KQQA 1IFQA 2WKRA 5EM0A 3TOIA 4P6ZS 4LV1A 4WN5A 3VP0A 4G3KA 4B4XA 1WE4A 4I3JA 2B18A 1TEMA 3IF6A 5FAQA 1LHYA 5AVEA 3T4JA 2O0YA 1E3UA 4FSFA 1L0FA 4FUWA 4UA7A 1XJ2A 3HL9A 3NBLA 4Z9QA 4DRTA 2XR0A 3ZDJA 1M6KA 1E3UD 3EEHA 4PAUA 3N6IA 4QJGA 3DTKA 3G30A 3SOIA 4KZ6A 4KUKA 3IQAA 3VOLA 5HL6A 1XJ4A 5CGXA 5IU1A 3HLGA 4K91A 4NXFA 3R4KA 4BD1A 3S7PA 3T4KA 2ZM8A 4ARZA 2P9VA 5EFWA 3LIDA 3SS5A 5TGFA 2RCXA 3P7NA 3SH8A 4PMAA 2M7UA 3FPVA 4KZAA 3M6BA 4A5RA 1K38A 3G34A 2XH9A 4HOIA 2ZOHA 4GW9A 3LY4A 3NCKA 5A90A 2E8JA 1QMFA 3C5AA 4BBUA 3QP6A 5AJGA 3BEBA 2WKHA 2WGWA 4HI4A 5FQ9A 4E3IA 4FTXA 1OTEA 4HY8A 1QMEA 4LGWA 4ZAMA 2V1AA 2A24A 5J7EA 2ZM2A 1ES5A 5EOOA 3VMAA 2VGLM 3IWQA 1NYMA 2P7JA 4PM8A 2A3UA 4EU0A 4C75A 4IUKA 2HPBA 3EEAA 5JYOA 4Y7PA 5KSCA 4OQ0A 5TBMB 3IX3A 3CG5A 1RCJA 4HP4A 4EXOA 5HPFA 3CPTB 1FIKA 3JYIA 4Y3IA 1ODVA 5G4YA 4NKPA 1PZPA 4CLCE 1V9YA 1XPBA 1K4FA 2J80A 4Y15A 5DJTA 2XFSA 2A2LA 5CXWA 2VLGA 4WEKA 3AGDA 1KDWA 4JGQA 5FEGA 3KSGA 1S4RA 1UWNX 2EX8A 2XK1A 3BW6A 1SKFA 1TD5A 1IOUA 4MBKA 5FDHA 3PAEA 1FILA 5M1AA 1J9MA 2O9CA 1BLSA 1S1YA 2ZJ9A 3O87A 3P09A 5EVEA 3H82B 1DJAA 5CGSA 2HDUA 5J3WA 2KLIA 2HGVA 1G5UA 3PBRA 3TE8A 1MXOA 4MBHA 2VGKA 4X55A 1VETB 2W3DA 5E2GA 4G3WA 4ME4A 3PTEA 2EA9A 2PHYA 2V1ZA 3M6HA 5DTTA 3JVUA 5BOHA 1KGEA 4JXVA 4LENA 2VK3A 4YNRA 4CPKA 2QKPA 3B47A 2EFXA 3KSFA 3E0YA 5HWVA 3DWZA 1DJBA 3T50A 2QPNA 2Y79A 2Z6CA 3LYXA 3UB7A 2W3HA 5E43A 3T4SA 4WLAA 4EBPA 4C6YA 4EUVA 3T1QB 2BASA 2J7VA 3F1NA 4CLCC 3ZG0A 1D06A 4CLCB 1XGJA 4H6JA 4KZ4A 2JKRM 2VGLS 4Y0TA 3AGFA 4B4ZA 2KDKA 3M2JA 4R6LA 3IBJA 1FSWA 2HDSA 4ZTKA 4JPMA 4HH2A 4NK3A 5TJJA 2ZC5B 1LT0A 3A0RA 3R7WB 4LRXC 1G28A 1GHPA 4Y5FA 3QP2A 4OONA 3H7WB 3ZYTA 4WZ4A 1ONHA 2JCHA 2W1TA 4JF5A 3F1OB 3HVFA 1WYCA 1ES3A 1PW1A 2Q0OA 1F98A 1OTBA 5E2HA 2VA0A 2X71A 4HJ3A 4RX2A 1N9LA 4DJ3A 1K54C 1UWPX 3C7VA 4B9OA 2IWBA 2EFUA 3NDGA 4KZ3A 3A0VA 3OPLA 4HP9A 2E8IA 3O86A 4R4RA 1OJGA 5EECA 4YFMA 3V39A 1FOFA 3VFHA 3OCLA 4R1GA 3MQQA 2I9VA 2PYRA 1I2WA 1BT5A 3NJAA 2BTFP 4I5SA 4Y2FA 4L0LA 3I7JA 2Y8HA 2X02A 3HUOA 2BLSA 4F3LB 5M19A 2OOLA 3CUEA 4ETZA 4DE3A 3GR2A
chains in the Genus database with same CATH topology
1XJ6A 1OTDA 2MJ6A 2QWSA 1G6OA 2J3WA 4KQDA 3E4OA 2QYBA 2VZWA 5AVFA 5HD5A 5A8BA 3JVVA 3FG8A 5TBMA 4KQOA 4CLCD 2OAP1 2O9AA 2KOIA 1H8MA 3IS2B 4MN7A 4II7A 4K08A 2O9BA 4BBVA 4E04A 4NEED 5I5LA 4WUJA 5DFYA 1GSWA 3LIAA 3T4OA 4Z1WA 3ZQ5A 4YOFA 3CAXA 2L4RA 2NUPC 2V9AA 3NOUC 4UEYA 3S7QA 2XRNA 1TS8A 3OC2A 4GHIA 1P9RA 2PT7A 3T4LA 4G3VA 3NOPC 3LR5A 5F6AA 5HZHA 1GSVA 3LR3A 2VV8A 2PR5A 3K3DA 4JGPA 4Q0HA 4I38A 1IFQA 2WKRA 1NLZA 1KOUA 3KYZA 4O0PA 4EEPA 4P6ZS 4WN5A 1NWZA 4G3KA 4I3JA 2B18A 1XJ3A 4XT2B 5G4ZA 1OTAA 2W3EA 4WF0A 2KX6A 4R38A 5AVEA 3UMDA 2HF6A 3T4JA 1TS0A 4BMWA 1MKMA 3H82A 2O0YA 1ZHHB 4FSFA 1P9WA 3BJNA 2YKHA 3LR4A 4H6JB 1XJ2A 1OTIA 3U2AA 3KYQA 1P97A 4IHQA 3P01A 2XA7S 3PBQA 2R78A 3DBAA 2QJ5A 3EEHA 2GX5A 4PAUA 1OT9A 2JN7A 3GDIA 5C5KA 1DP9A 5MC7A 4Q0JA 3NHQA 4KUKA 3LFVA 3CI6A 3VOLA 5HL6A 1XJ4A 5IU1A 3PHYA 4GCZA 3EQUA 2ZMVA 5L8MA 2QHKA 1BYWA 2VJWA 4MN5A 4NXFA 4M4XA 1UGUA 3R4KA 4EERA 3C30A 5F69A 3S7PA 3T4KA 4O8GA 3B33A 4ARZA 1NLYA 2W1TB 3MQ0A 4IJGA 1TS7A 1V9ZA 5EFWA 3LIDA 1D7EA 5KIZA 1T1AA 4EEUA 2Z6DA 3NOTC 3KSHA 3P7NA 2HJEA 3UE3A 4PKYA 1T19A 2GJ3A 3MR0A 3FPVA 2M7UA 3E98A 1T18A 5DKKA 5HDCA 4QPRA 5HDDA 1F9IA 2FZ0A 3C38A 4O01A 3OOVA 2IA2A 4CLCA 3E4PA 5LBRA 3VE3A 4HOIA 4KUOA 2ZOHA 3GECA 4GW9A 1T1CA 3F1PA 4BWIA 4OOLA 3RTYA 4BBTA 4DMZA 4R3AA 1YSPA 2W0NA 5K5BA 4BBUA 5IT5A 1MZUA 2HV1A 2VX8A 3LIEA 5AJGA 2GZAA 3A0SA 4HJ6A 2DMWA 5HWWA 4HI4A 3R7WA 4HQAA 4EESA 2PYPA 4HNBA 3UB9A 3PR6A 1OTEA 4HY8A 4WELA 1ZTUA 3PBNA 3TW8A 3H7WA 1VB6A 2V1AA 2A24A 3H9WA 4GS9A 4PHTA 3CUEC 5J7EA 3LUQA 3LI8A 4FOFA 3MF0A 4MDZA 3T4QA 3F1OA 2FH5A 3E4QA 2HJ9C 2VGLM 3BWLA 5IS1A 1N9NA 4UQIM 4LLOB 2P7JA 3LI9A 4EU0A 2V1BA 4MN6A 3RH8B 2P08A 4IUKA 2G7UA 3EEAA 4WEJA 5TBMB 1OT6A 2J3TC 1XFNA 3EOIA 4HP4A 2OWHA 4EXOA 1NRJA 3MFXA 5HPFA 2YKFA 2ZOIA 3S7NA 3FPWA 2NUTC 4P6ZM 3PXPA 2VV6A 1TS6A 5KSHA 4Y3IA 1ODVA 2W3FA 3KO6A 3VE4A 2QJ7A 3KX0X 5G4YA 3UMEA 5HPIA 4NKPA 1DP8A 3TJZC 4CLCE 1V9YA 2D01A 4IUHA 4Q0IA 4GHIB 2J80A 5DJTA 3EQVA 2A2LA 3BY9A 5HSQA 1LL8A 1JNUA 4R70A 1F5MA 3OBFA 2VLGA 4WEKA 1X0OA 2LB5A 4JGQA 3CLOA 2PD8A 3KSGA 4F3LA 3W2ZA 1S4RA 3B42A 1UWNX 4DJ2A 2WKPA 3BW6A 4HHDA 4HJ4A 1TD5A 3BQ8A 1IOUA 2VV7A 4DN0A 4LRYC 3K3CA 3C2WA 2PDRA 2LB9A 2OWJA 4MCWA 4L9GA 4ZRRA 3D72A 3PBOA 1H3QA 2O9CA 3LIBA 1S1YA 4NXBA 4L9EA 4EQ1A 3H82B 3OLOA 3EGDC 4GJ4A 5J3WA 2B02A 2KLIA 2HGVA 4L9FA 1DRMA 3IS2A 3V67A 2V0UA 3PBRA 3LICA 3IBRA 4GLQA 2O99A 5DF9A 3TE8A 2M1CA 4MMNA 5DKLA 3PYPA 2W3DA 4WL9A 2JKTM 4G3WA 4ME4A 2EA9A 2EWWA 2PHYA 3K2NA 3PBTA 1P0ZA 5J4EA 4BJPA 1S4SA 3T4TA 4YWZA 3EWKA 4LPZA 3EGXC 3O5YA 3JVUA 4NXEA 2W1RA 4LRZE 4YNRA 2QKPA 3B47A 3KSFA 3ULFA 3RFBA 3E0YA 4ARZB 4I3AA 5HWVA 5HWTA 2L0WA 3T50A 1VHMA 2Y79A 4NXGA 2Z6CA 3MJQA 3LYXA 1DP6A 3UB7A 4XT2A 2PD7A 4OOMA 2W3HA 3MQOA 3T4SA 4WLAA 4EUVA 3BY8A 2BASA 3F1NA 4CLCC 1D06A 4PKYG 4CLCB 2K2NA 4H6JA 2JKRM 2W27A 3PBSA 2J3TD 3G6OA 3FC7A 2VGLS 3F1PB 2WKQA 1TF1A 1T1BA 4EETB 1W63Q 2KDKA 4UQIS 3CWFA 4R6LA 3IBJA 2K31A 2XROA 4HH2A 2K7SA 5TJJA 1Y28A 3S7OA 1S1ZA 1LT0A 3A0RA 1OPXA 2VEAA 3R7WB 4LRXC 1G28A 4Y5FA 4RQ9A 1YKDA 1LSWA 2ZMFA 3MXQA 2JKTI 1STZA 3H7WB 1S67L 4AFIA 3SW1A 3ZYTA 2EWVA 4I3IA 2PR6A 4CQHA 2A24B 4GS9B 4HH3A 4B93A 4EW7A 2W1TA 1W63M 3F1OB 4I39A 1LSVA 2XA7M 3F1NB 5DJUA 1F98A 1EW0A 1OTBA 5FL3A 1XFQA 4JGOA 2XSSA 3HCYA 2VA0A 4HJ3A 1N9LA 2INWA 3ICYA 4DJ3A 2VKSA 2JHEA 1UWPX 1MC0A 2GNXA 4ETXA 4B9OA 2H28A 3BQAA 3KSIA 3A0VA 4HP9A 2D02A 4HIAA 5F5YA 5HDSA 4JGRA 2JKRI 1OJGA 3D3OA 1GSXA 3HJIA 5F68A 3TRCA 2ZBBA 3UB6A 1S66L 3OCLA 3UB8A 1N9OA 3MQQA 2I9VA 2PYRA 2OAQ1 3C8CA 5CX7A 1WA9A 1YSQA 1YAXA 1OJ5A 3NJAA 4I5SA 3VV4A 3CITA 3LIFA 4Y2FA 4L0LA 1LSXA 5DFXA 2L1MA 3LR0A 2W3GA 3HJKA 2CMNA 2Y8HA 2P04A 2V0WA 4F3LB 2OOLA 3MMHA 3UE6A 3CUEA 3OCNA 4ETZA 2M7VA 5HD3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XJ6 A;  1OTD A;  2QWS A;  4KQD A;  3E4O A;  5AVF A;  5HD5 A;  5A8B A;  3FG8 A;  5TBM A;  3IS2 B;  4K08 A;  4BBV A;  4E04 A;  5I5L A;  4WUJ A;  1GSW A;  3LIA A;  3ZQ5 A;  3CAX A;  2L4R A;  2V9A A;  3NOU C;  1TS8 A;  4GHI A;  3NOP C;  5F6A A;  5HZH A;  1GSV A;  2VV8 A;  2PR5 A;  3K3D A;  4JGP A;  4I38 A;  2WKR A;  1KOU A;  4EEP A;  4WN5 A;  1NWZ A;  4I3J A;  1XJ3 A;  4XT2 B;  5G4Z A;  1OTA A;  4WF0 A;  2KX6 A;  4R38 A;  5AVE A;  3UMD A;  1TS0 A;  3H82 A;  2YKH A;  4H6J B;  1XJ2 A;  1OTI A;  1P97 A;  2R78 A;  2QJ5 A;  3EEH A;  1OT9 A;  2JN7 A;  3GDI A;  1DP9 A;  3NHQ A;  4KUK A;  3VOL A;  5IU1 A;  1XJ4 A;  3PHY A;  4GCZ A;  2QHK A;  1BYW A;  4MN5 A;  4NXF A;  4M4X A;  1UGU A;  4EER A;  5F69 A;  3B33 A;  1TS7 A;  1V9Z A;  5EFW A;  3LID A;  1D7E A;  5KIZ A;  1T1A A;  4EEU A;  2Z6D A;  3NOT C;  3P7N A;  4PKY A;  1T19 A;  2GJ3 A;  3MR0 A;  1T18 A;  5DKK A;  5HDC A;  5HDD A;  1F9I A;  3E4P A;  3VE3 A;  4HOI A;  4KUO A;  2ZOH A;  3GEC A;  4GW9 A;  1T1C A;  3F1P A;  3RTY A;  4BBT A;  4R3A A;  2W0N A;  4BBU A;  1MZU A;  2HV1 A;  3LIE A;  3A0S A;  4HJ6 A;  5HWW A;  4HI4 A;  4HQA A;  4EES A;  2PYP A;  4HNB A;  3UB9 A;  1OTE A;  4HY8 A;  3H7W A;  1VB6 A;  2V1A A;  2A24 A;  3H9W A;  4GS9 A;  5J7E A;  3LUQ A;  3LI8 A;  3F1O A;  3E4Q A;  3BWL A;  5IS1 A;  1N9N A;  4LLO B;  2P7J A;  3LI9 A;  2V1B A;  4MN6 A;  3RH8 B;  5TBM B;  1OT6 A;  1XFN A;  4HP4 A;  2OWH A;  4EXO A;  3MFX A;  2YKF A;  2ZOI A;  2VV6 A;  1TS6 A;  1ODV A;  3VE4 A;  2QJ7 A;  3KX0 X;  5G4Y A;  3UME A;  1DP8 A;  1V9Y A;  2D01 A;  4GHI B;  2J80 A;  5DJT A;  3BY9 A;  5HSQ A;  1LL8 A;  1JNU A;  4R70 A;  2VLG A;  1X0O A;  4JGQ A;  3CLO A;  2PD8 A;  4F3L A;  1S4R A;  1UWN X;  4DJ2 A;  2WKP A;  4HHD A;  4HJ4 A;  2VV7 A;  4LRY C;  3K3C A;  3C2W A;  2PDR A;  2OWJ A;  4L9G A;  3D72 A;  3LIB A;  1S1Y A;  4NXB A;  4L9E A;  4EQ1 A;  3H82 B;  3OLO A;  5J3W A;  2B02 A;  4L9F A;  1DRM A;  3IS2 A;  2V0U A;  3LIC A;  3IBR A;  2M1C A;  5DKL A;  3PYP A;  4WL9 A;  2EA9 A;  2PHY A;  1P0Z A;  5J4E A;  1S4S A;  4YWZ A;  3EWK A;  4LPZ A;  4NXE A;  4LRZ E;  2QKP A;  3ULF A;  5HWV A;  4I3A A;  5HWT A;  2L0W A;  3T50 A;  4NXG A;  2Z6C A;  3MJQ A;  3LYX A;  1DP6 A;  3UB7 A;  4XT2 A;  2PD7 A;  3MQO A;  4WLA A;  3BY8 A;  2BAS A;  3F1N A;  1D06 A;  4PKY G;  4H6J A;  2W27 A;  3G6O A;  3FC7 A;  3F1P B;  2WKQ A;  1T1B A;  4EET B;  2KDK A;  3CWF A;  4R6L A;  4HH2 A;  2K7S A;  1Y28 A;  1S1Z A;  1LT0 A;  3A0R A;  2VEA A;  4LRX C;  1G28 A;  4RQ9 A;  1LSW A;  3MXQ A;  3H7W B;  1S67 L;  3SW1 A;  4I3I A;  2PR6 A;  2A24 B;  4GS9 B;  4HH3 A;  4EW7 A;  3F1O B;  4I39 A;  1LSV A;  3F1N B;  5DJU A;  1F98 A;  1EW0 A;  1OTB A;  1XFQ A;  4JGO A;  4HJ3 A;  1N9L A;  2INW A;  3ICY A;  4DJ3 A;  2JHE A;  1UWP X;  4B9O A;  2H28 A;  3A0V A;  4HP9 A;  2D02 A;  4HIA A;  5F5Y A;  5HDS A;  4JGR A;  1OJG A;  1GSX A;  3HJI A;  5F68 A;  2ZBB A;  3UB6 A;  1S66 L;  3UB8 A;  1N9O A;  3MQQ A;  2I9V A;  2PYR A;  3C8C A;  1WA9 A;  1OJ5 A;  3NJA A;  4I5S A;  3LIF A;  1LSX A;  2L1M A;  3HJK A;  2CMN A;  2V0W A;  4F3L B;  2OOL A;  3UE6 A;  5HD3 A; 
#chains in the Genus database with same CATH topology
 4QHC A;  1OTD A;  2MJ6 A;  3LCE A;  1G6O A;  4KQD A;  2V2F F;  3HUN A;  5FAT A;  5A8B A;  3FZC A;  2G2U A;  4KQO A;  4CLC D;  3QHY A;  1H8M A;  3VOY A;  4II7 A;  5I5L A;  5DF8 A;  4EBN A;  3DW0 A;  3MS6 A;  3HLF A;  1GSW A;  3LIA A;  2ZMA A;  3T4O A;  4YOF A;  2WAE A;  2NUP C;  4KG2 A;  2ZL1 B;  5EV0 A;  2ZQD A;  5KZH A;  5HZH A;  1NRF A;  1SKO B;  1HTZ A;  2PR5 A;  3K3D A;  1SDN A;  3BLM A;  4DKI A;  4JGP A;  4Q0H A;  3SH9 A;  1NLZ A;  5FAP A;  4OKP A;  4EEP A;  1I2S A;  1PRQ A;  5GL9 A;  5G4Z A;  1FCN A;  2KX6 A;  4R38 A;  1XXM A;  4OOY A;  4UHU A;  4NET A;  3CZD A;  3Q7V B;  3BJN A;  1OTI A;  3KYQ A;  3P01 A;  3PBQ A;  5FQK A;  3DBA A;  3ZHH A;  1CJF A;  3IXH A;  4MBF A;  2JN7 A;  4FH2 A;  3ZNT A;  5FQJ A;  3G4P A;  2HZ5 A;  3PHY A;  2Y2P A;  3EQU A;  1NZU A;  3LEZ A;  4MN5 A;  5CTN A;  5KMW A;  4EER A;  4Y13 A;  1PWC A;  2PBD P;  3C30 A;  5A92 A;  5GLA A;  4UAA A;  1F2K A;  3MXR A;  4OQH A;  1ONG A;  5KIZ A;  3W8K A;  1T1A A;  1S0W A;  2Z6D A;  3NOT C;  3KSH A;  2HJE A;  3UE3 A;  1SHV A;  2GJ3 A;  3E98 A;  4OP5 A;  2FZ0 A;  2J8Y A;  4O01 A;  1IYO A;  3E4P A;  1T1C A;  3F1P A;  4ZJ2 A;  4GN2 A;  4U0T A;  4Y0U A;  2W0N A;  4X53 A;  4KEN B;  4D2O A;  5CED A;  1VEU B;  2GZA A;  1XA1 A;  5HWW A;  4HEF A;  1YQS A;  4EES A;  2PYP A;  4HNB A;  3UB9 A;  3C7U A;  4B88 A;  3T1X A;  4WEL A;  1ZTU A;  2XDM A;  2V8C A;  3NUL A;  4JXG A;  4EBL A;  3H9W A;  4JF4 A;  3LI8 A;  4FOF A;  1OME A;  4MDZ A;  3T4Q A;  2FH5 A;  1A0K A;  4XUZ A;  1N9N A;  3W4P A;  5TR7 A;  2WKE A;  4QU3 A;  4P0M A;  3RH8 B;  3S4X A;  4WEJ A;  3E2L A;  3IX4 A;  5FQI A;  5F82 A;  1KDS A;  4UA9 A;  2YKF A;  2ZOI A;  2NUT C;  4IBX A;  2A49 A;  1K57 A;  1TS6 A;  1BLH A;  3G2Y A;  3VE4 A;  1BTL A;  2QJ7 A;  1PNE A;  3IT9 A;  3BLS A;  2WUQ A;  5HPI A;  4WZ5 C;  4N92 A;  1DP8 A;  2Y4A A;  4IUH A;  4KZB A;  2WGI A;  2V8F A;  4S2L A;  3ZGA B;  3IHB A;  4GHI B;  1BSG A;  4K0W A;  4R70 A;  2I72 A;  4OPZ A;  2ZQ7 A;  3S1Y A;  3OPR A;  1H8Z A;  3ZNY A;  3CLO A;  2PD8 A;  1FSY A;  5AQA A;  3LEQ A;  1PFL A;  3B42 A;  1MWU A;  4HJ4 A;  4ZJ3 A;  2VV7 A;  4DN0 A;  3C2W A;  3AGE A;  4MCW A;  4L9G A;  3PBO A;  5HFO A;  3LIB A;  4ID4 A;  4GKU A;  4L9E A;  1RGY A;  1CI8 A;  3EGD C;  1JWZ A;  1KGF A;  1FR6 A;  3IBR A;  2O99 A;  5HW3 A;  1YLP A;  1MWT A;  2HP6 A;  4WL9 A;  3SS3 A;  3PBT A;  3L7H A;  1I5Q A;  5J4E A;  1PZO A;  3T4T A;  4YWZ A;  3EWK A;  4LPZ A;  3B3X A;  3EGX C;  5HAP A;  4DXC A;  1ZG6 A;  4NXE A;  2W1R A;  2HP5 A;  3ULF A;  1IKI A;  4I3A A;  2WAF A;  4O7D A;  3VOZ A;  5HWT A;  3C4O A;  3DTE A;  5DF7 A;  2Y2M A;  4H8R A;  1HLU P;  1KE0 A;  1MPL A;  4OOM A;  3MQO A;  3Q81 A;  5EM1 A;  2RL3 A;  3FKV A;  1U60 A;  2ZQA A;  4PKY G;  3TG9 A;  3A3F A;  4KZ9 A;  3PBS A;  1CK3 A;  2R9W A;  3G6O A;  3FC7 A;  4P85 A;  1AXB A;  2WKQ A;  1W63 Q;  4E6W A;  2K7S A;  3IWO A;  1S1Z A;  2VEA A;  4KG5 A;  5CTM A;  3MZE A;  1YKD A;  1LSW A;  1CEF A;  2DCF A;  1S67 L;  4PM5 A;  2EWV A;  4I3I A;  4CQH A;  4GS9 B;  3LY3 A;  4HH3 A;  4RVA A;  1W63 M;  4N9K A;  4I39 A;  3F1N B;  1EW0 A;  1PI5 A;  5J8X A;  2XSS A;  4S2N C;  2J9P A;  2Y2K A;  1TVF A;  2INW A;  3ICY A;  1FQG A;  2JHE A;  2GNX A;  2H28 A;  3BQA A;  3KSI A;  3NEC A;  2HP9 A;  3GSG A;  3NY4 A;  2PBY A;  3Q82 A;  5F5Y A;  3UPO A;  4JBF A;  3D3O A;  4ZJ1 A;  3TRC A;  2ZBB A;  3UB8 A;  3DTI A;  5FQM A;  1ERO A;  2XD1 A;  5CX7 A;  1YSQ A;  3CJM A;  2WZX A;  1ESU A;  1L0D A;  5AQB A;  3CIT A;  5DFX A;  3JPU A;  4S2M A;  1FCM A;  2W3G A;  5D3O A;  2V0W A;  5JYP A;  3UE6 A;  2WGV A;  1ES4 A;  4ZDX A;  1CQA A;  4YIN A;  2QWS A;  2CC1 A;  2VZW A;  1XGI A;  4OP8 A;  3BRM A;  4GD8 A;  5AVF A;  3JVV A;  2ZM0 A;  1YLT A;  5TBM A;  2X01 A;  2Z2L B;  3HUM A;  1O07 A;  2P74 A;  3V5M A;  2H0T A;  3IS2 B;  4S2I A;  5FI6 A;  1L0G A;  4BBV A;  4NEE D;  4MEZ A;  4F94 A;  3CPT A;  2Q9N A;  3QP4 A;  3WS5 A;  1TDL A;  4Z1W A;  3IXG A;  2V9A A;  1MKI A;  4KQR A;  4QB8 A;  3OC2 A;  1P9R A;  4G3V A;  1PWG A;  1ACF A;  1BLP A;  3NOP C;  5M18 A;  5F6A A;  4N1X A;  4PPR A;  3QP1 A;  3N8R A;  3ZFZ A;  4I38 A;  3HBR A;  1KOU A;  3KYZ A;  3TSG A;  2WYX A;  1EWZ A;  4XT2 B;  3T1R A;  1OTA A;  1CF0 A;  2EX6 A;  2Y2Q A;  2OLV A;  1K0K A;  5E2E A;  1MKM A;  3H82 A;  2Q9M A;  1ZHH B;  3UPP A;  1P9W A;  4HBU A;  2YKH A;  3U2A A;  2ZC3 B;  4IHQ A;  1PW8 A;  2QJ5 A;  1K4E A;  2GX5 A;  2AVX A;  1OT9 A;  5C5K A;  1ALQ A;  1VET A;  4Q0J A;  3NHQ A;  1AWI A;  3VSL A;  3VSK A;  1HD8 A;  5L09 A;  4EQI A;  5L8M A;  4LCM A;  1BYW A;  4IED A;  4M4X A;  1UGU A;  2Z2M B;  3BFD A;  5F69 A;  4IJG A;  2FFF B;  1TS7 A;  1K56 D;  1V9Z A;  1D7E A;  2JE5 A;  1ZC2 A;  3QNB A;  1XP4 A;  5HDC A;  5FAS A;  1F9I A;  3C38 A;  3WS2 A;  4CLC A;  4WMC D;  5LBR A;  4KZ7 A;  2XLN A;  3BYD A;  3NI9 A;  3GEC A;  4BWI A;  4OVD A;  4OOL A;  3RTY A;  4R3A A;  1YSP A;  1NJ4 A;  1ZKJ A;  5K5B A;  5CER A;  2HV1 A;  5GLD A;  2VX8 A;  3A0S A;  4HJ6 A;  1L3L A;  1YMS A;  1LL5 A;  3M2K A;  4LV0 A;  1BLC A;  1K6R A;  3R7W A;  4JF6 A;  5EUA A;  3T12 B;  5HAQ A;  1BUL A;  4LV3 A;  3PBN A;  5CHJ A;  3G31 A;  3H7W A;  1VB6 A;  3G35 A;  1IYQ A;  5A93 A;  3E2K A;  3FV7 A;  3MF0 A;  3F1O A;  5EVI C;  3E4Q A;  2Y2I A;  5EVI B;  4OPY A;  3BWL A;  1YLY A;  4UQI M;  4LLO B;  3ZG8 B;  3LI9 A;  2P08 A;  1KE4 A;  1NZO A;  1K55 C;  4LCL A;  1K54 A;  1OT6 A;  3IH9 A;  1XFN A;  2WKI A;  3EOI A;  1NRJ A;  4P6Z M;  2Y2J A;  3UY6 A;  4DE0 A;  2VV6 A;  5KSH A;  2W3F A;  3KX0 X;  5EVL A;  3MBZ A;  2UWX A;  2WK0 A;  4GNU A;  4MNR A;  3TJZ C;  4Q0I A;  3EQV A;  3BY9 A;  2Y59 A;  3HLE A;  1F5M A;  5F1F A;  3O88 A;  2ZQC A;  3GV9 A;  2XGN A;  2LB5 A;  4DXB A;  3A3E A;  4OH0 A;  4FCF A;  4F3L A;  2WAD A;  1LI0 A;  1Z6F A;  2ZQ9 A;  3WS4 A;  2WKP A;  1J3W A;  4Q8I A;  5CRF A;  3IF6 C;  4HES A;  3IHA A;  3IF6 B;  2OWJ A;  4ZRR A;  2JBF A;  3W4O A;  1SZV A;  4NXB A;  1FCO A;  4EQ1 A;  5GHZ A;  1BZA A;  1KGG A;  1NYY A;  2WZZ A;  2JKF A;  4QY5 A;  2OSU A;  2B02 A;  3MSH A;  4L9F A;  1KE3 A;  1DRM A;  2V0U A;  3LIC A;  5DF9 A;  2H10 A;  2IWC A;  3PAG A;  5EPH A;  2M1C A;  5I94 A;  4M3K A;  5DKL A;  1TDG A;  2QMI A;  2DNS A;  5GLC A;  3K2N A;  4IBR A;  1P0Z A;  2ZL1 A;  1RGZ A;  4BJP A;  1S4S A;  4R3J A;  3O5Y A;  3ITB A;  1SKO A;  3N4I A;  3D9Y A;  3BFE A;  3NC8 A;  3RFB A;  4ARZ B;  2L0W A;  4OQG A;  2P9V B;  1ESI A;  4NXG A;  3UB5 P;  1DP6 A;  2IWD A;  4MLL A;  2PD7 A;  3DWK A;  4R0Q A;  3UDX A;  2EX2 A;  3Q7V A;  4EUZ A;  4DE1 A;  2W27 A;  4S2J A;  3SZT A;  4K0X A;  4WM9 A;  5AQ9 A;  1T1B A;  4UQI S;  1ERQ A;  1PYY A;  4CJN A;  3S7O A;  2WGW B;  1OPX A;  3W4Q A;  1H5X A;  1ERM A;  2ZMF A;  2JKT I;  3GMW A;  3SW1 A;  1IKG A;  2PR6 A;  2A24 B;  3GRJ A;  1ES2 A;  4B93 A;  3DAV A;  1NXY A;  4EW7 A;  4BL2 A;  5CEC A;  1PIO A;  1LL9 A;  2XA7 M;  5DJU A;  2XEP A;  2Y2N A;  4JGO A;  3QP5 A;  2XF3 A;  4BEN A;  4OPQ A;  3CMZ A;  1BUE A;  1WYB A;  2VKS A;  5CEB A;  1K25 A;  4D60 A;  3FWL A;  4X56 A;  1SDE A;  4JXW A;  3A3I A;  2PU2 A;  4HIA A;  5HDS A;  2ZD8 A;  4JGR A;  1GSX A;  3HJI A;  4X25 A;  5F68 A;  3UB6 A;  1S66 L;  1N9O A;  1VEU A;  3UE0 A;  3C8C A;  3ISG A;  1L2S A;  1YT4 A;  4E3O A;  1XA7 A;  4EWF A;  1LI9 A;  3HLB A;  5FEF A;  3VV4 A;  1LSX A;  1MWS A;  2CMN A;  2P04 A;  4E3M A;  3MMH A;  3SH7 A;  1W8Q A;  3OCN A;  1Y54 A;  2BG1 A;  4R3B A;  2J3W A;  3E4O A;  2QYB A;  1Q2Q A;  5HD5 A;  3FYZ A;  2V20 A;  4QY6 A;  1JTD A;  1H8Y A;  4Y0O A;  4OLD A;  5FDS A;  2OAP 1;  4XXR A;  4MN7 A;  3VFF A;  5DFY A;  4OPR A;  1JTG A;  1YLJ A;  3D4F A;  3WRT A;  2L4R A;  3BM6 A;  3UE1 A;  3Q7Z A;  4WZ5 A;  3S7Q A;  4GHI A;  2PT7 A;  3UDF A;  5L10 A;  5DVA A;  3Q07 A;  3S22 A;  1H0M A;  2B5R A;  3GTC A;  4BQM A;  1GSV A;  3V3S A;  3N8S A;  4E3L A;  3BFG A;  3DTM A;  1YMX A;  3GVB A;  4O0P A;  5EOE A;  4ZBE A;  1NWZ A;  3QNC A;  3MZF A;  1XJ3 A;  2W3E A;  4WF0 A;  1HZO A;  3UMD A;  1W8Y A;  2HF6 A;  1O7E A;  3NDE A;  1TS0 A;  4BMW A;  2ZLY A;  5DTK A;  3LR4 A;  4H6J B;  1P97 A;  1XKZ A;  4FD8 A;  1LLB A;  2XA7 S;  3KYE A;  1MY8 A;  2R78 A;  5L07 A;  1ZG4 A;  4GDN A;  4EV4 A;  3GDI A;  3VP2 A;  3RJU A;  1DP9 A;  5MC7 A;  2EX9 A;  3UDI A;  3CHW P;  3LFV A;  3CI6 A;  4GOG A;  4PM7 A;  2Y2G A;  1M40 A;  4GCZ A;  2ZMV A;  2QHK A;  2VJW A;  5FA7 A;  4N9L A;  3UN7 A;  3IWI A;  1Q2P A;  2C5W B;  5G18 A;  4O8G A;  3B33 A;  5GHY A;  1NLY A;  2W1T B;  3MQ0 A;  3UNW A;  2ZC7 A;  3Q1F A;  5DTS A;  3NIA A;  4EEU A;  2PU4 A;  4PKY A;  3MKE A;  1T19 A;  3MR0 A;  1T18 A;  5DKK A;  4QPR A;  5HDD A;  3OOV A;  2IA2 A;  4WYY A;  4P6B A;  3G32 A;  3VE3 A;  4KUO A;  1IEM A;  4PM9 A;  3ZG5 A;  4BBT A;  4DMZ A;  5IT5 A;  1MZU A;  3LIE A;  4DF6 A;  2DMW A;  3ITA A;  3ZG7 B;  2FFY A;  5FSR A;  4HQA A;  4X1L A;  3PR6 A;  4GZB A;  3V50 A;  2JKG A;  1IEL A;  1GA0 A;  3TW8 A;  2EXA A;  4GS9 A;  4PHT A;  3CUE C;  3LUQ A;  2ACG A;  1S6R A;  4Y17 A;  4R4S A;  2HJ9 C;  3LO7 A;  1K6S A;  4IVK A;  5IS1 A;  4S2N A;  2V1B A;  4MN6 A;  1YLW A;  2G7U A;  5A91 A;  2R9X A;  1C3B A;  4X1M A;  2J3T C;  4RA7 A;  1EI5 A;  2OWH A;  3MFX A;  3C4P A;  3S7N A;  2ZC6 B;  3FPW A;  1CI9 A;  3PXP A;  2ZC4 B;  2QZ6 A;  3KO6 A;  4RX3 A;  4GD6 A;  4U3T A;  1G6A A;  3UME A;  2D01 A;  4XUX A;  4GB7 A;  3HLD A;  3N7W A;  4S2K A;  2OLU A;  1YLZ A;  3OZH A;  4HBT A;  5HSQ A;  1Y4O A;  1LL8 A;  3A3D A;  1JNU A;  3OBF A;  3LGO A;  5CHU A;  3ZVW A;  1X0O A;  5TFQ A;  2HDQ A;  3WS1 A;  4E3K A;  1L0E A;  3W2Z A;  4DJ2 A;  4HHD A;  1KVM A;  3BQ8 A;  1K56 A;  4LRY C;  3UPN A;  3K3C A;  2OV5 A;  2PDR A;  2LB9 A;  3HLW A;  3D72 A;  1H3Q A;  4DDY A;  1GA9 A;  1KVL A;  5IHV A;  3OLO A;  4LFU A;  4JLF A;  4JKT A;  4GJ4 A;  4WMC A;  3IS2 A;  3RXW A;  3V67 A;  2XQZ A;  1VM1 A;  2XD5 A;  5FQQ A;  5HAR A;  5U47 A;  1JVJ A;  4GLQ A;  3OPP A;  3L9K A;  5GLB A;  3IXD A;  4E6X A;  4MMN A;  3VP1 A;  2Y91 A;  5CHM A;  3PYP A;  5FAO A;  1HVB A;  4BLM A;  2JKT M;  4FH4 A;  2EWW A;  2DRW A;  5L2F A;  4X69 A;  4LRZ E;  1MBL A;  3HRE A;  1IYS A;  3BEC A;  2Y2H A;  5EE8 A;  4P87 A;  1CEG A;  4S2O A;  1VHM A;  1RP5 A;  3MJQ A;  1GCE A;  3T1S A;  1YPR A;  1E25 A;  4XT2 A;  4BL3 A;  3WS0 A;  3VP3 A;  3BY8 A;  2GDN A;  3A3J A;  2VGJ A;  2K2N A;  5AQ7 A;  3GQZ A;  4E3J A;  1Z09 A;  4X68 A;  2EXB A;  1N4O A;  2J3T D;  3WWX A;  4E3N A;  3F1P B;  2XFT A;  1TF1 A;  3VP4 A;  1MWR A;  3IH8 A;  4EET B;  1VQQ A;  5F83 A;  3CWF A;  2K31 A;  2XRO A;  3O3V A;  4KZ8 A;  4QD4 A;  1GHI A;  1Y28 A;  4OQI A;  2UV0 E;  1D1J A;  2Y2O A;  3IXB A;  3MZD A;  4N1H A;  2G2W A;  2Y55 A;  4S2P A;  1W5D A;  4RQ9 A;  4IVI A;  1W79 A;  4KZ5 A;  4JXS A;  3MXQ A;  1STZ A;  4AFI A;  2HDR A;  2H0Y A;  3MFD A;  2JC7 A;  3IF5 A;  1LSV A;  4KG6 A;  5FL3 A;  1XFQ A;  1SCW A;  3V3R A;  3G2Z A;  3HLC A;  2B95 A;  3HCY A;  4RYE A;  3SS4 A;  4DDS A;  3P98 A;  4NG2 A;  2J9O A;  4R23 A;  4ESP A;  1MC0 A;  4WBG A;  4ETX A;  1K57 C;  2D02 A;  1PI4 A;  1N9B A;  2JKR I;  5FI2 A;  3BFC A;  3UO9 A;  3IX8 A;  4LV2 A;  1XX2 A;  2OAQ 1;  1WA9 A;  1YAX A;  1OJ5 A;  2PRF A;  4OLG A;  2H5S A;  3LIF A;  1GHM A;  2L1M A;  3LR0 A;  3U4L P;  3HJK A;  4X6T A;  4U0X A;  1JWV A;  5HX9 A;  3MKF A;  5FI7 A;  1PWD A;  3OPH A;  2M7V A;  1W7F A;  3MXS A;  1DJC A;  4C3Q A;  5HD3 A;  1IYP A;  5EVI A;  1XJ6 A;  1E4D A;  3BFF A;  3N8L A;  1NY0 A;  1YM1 A;  2C6W B;  2PAV P;  3FG8 A;  1JWP A;  5EVI D;  3WRZ A;  2O9A A;  3RXX A;  2KOI A;  5CGW A;  5HL1 A;  1K55 A;  5HAI A;  4K08 A;  2O9B A;  4E04 A;  4UA6 A;  4WUJ A;  4GDB A;  5F1G A;  5E2F A;  1FR1 A;  3ZQ5 A;  5GHX A;  3CAX A;  4PM6 A;  3ZG9 B;  2ZQ8 A;  1G68 A;  3NOU C;  4UEY A;  2XRN A;  1TS8 A;  1DY6 A;  3T4L A;  4QWO A;  4BD0 A;  2Y2L A;  3QP8 A;  3LR5 A;  3ZVT A;  4DE2 A;  3LR3 A;  3FKW A;  2VV8 A;  3ZCZ A;  4KQQ A;  1IFQ A;  2WKR A;  5EM0 A;  3TOI A;  4P6Z S;  4LV1 A;  4WN5 A;  3VP0 A;  4G3K A;  4B4X A;  1WE4 A;  4I3J A;  2B18 A;  1TEM A;  3IF6 A;  5FAQ A;  1LHY A;  5AVE A;  3T4J A;  2O0Y A;  1E3U A;  4FSF A;  1L0F A;  4FUW A;  4UA7 A;  1XJ2 A;  3HL9 A;  3NBL A;  4Z9Q A;  4DRT A;  2XR0 A;  3ZDJ A;  1M6K A;  1E3U D;  3EEH A;  4PAU A;  3N6I A;  4QJG A;  3DTK A;  3G30 A;  3SOI A;  4KZ6 A;  4KUK A;  3IQA A;  3VOL A;  5HL6 A;  1XJ4 A;  5CGX A;  5IU1 A;  3HLG A;  4K91 A;  4NXF A;  3R4K A;  4BD1 A;  3S7P A;  3T4K A;  2ZM8 A;  4ARZ A;  2P9V A;  5EFW A;  3LID A;  3SS5 A;  5TGF A;  2RCX A;  3P7N A;  3SH8 A;  4PMA A;  2M7U A;  3FPV A;  4KZA A;  3M6B A;  4A5R A;  1K38 A;  3G34 A;  2XH9 A;  4HOI A;  2ZOH A;  4GW9 A;  3LY4 A;  3NCK A;  5A90 A;  2E8J A;  1QMF A;  3C5A A;  4BBU A;  3QP6 A;  5AJG A;  3BEB A;  2WKH A;  2WGW A;  4HI4 A;  5FQ9 A;  4E3I A;  4FTX A;  1OTE A;  4HY8 A;  1QME A;  4LGW A;  4ZAM A;  2V1A A;  2A24 A;  5J7E A;  2ZM2 A;  1ES5 A;  5EOO A;  3VMA A;  2VGL M;  3IWQ A;  1NYM A;  2P7J A;  4PM8 A;  2A3U A;  4EU0 A;  4C75 A;  4IUK A;  2HPB A;  3EEA A;  5JYO A;  4Y7P A;  5KSC A;  4OQ0 A;  5TBM B;  3IX3 A;  3CG5 A;  1RCJ A;  4HP4 A;  4EXO A;  5HPF A;  3CPT B;  1FIK A;  3JYI A;  4Y3I A;  1ODV A;  5G4Y A;  4NKP A;  1PZP A;  4CLC E;  1V9Y A;  1XPB A;  1K4F A;  2J80 A;  4Y15 A;  5DJT A;  2XFS A;  2A2L A;  5CXW A;  2VLG A;  4WEK A;  3AGD A;  1KDW A;  4JGQ A;  5FEG A;  3KSG A;  1S4R A;  1UWN X;  2EX8 A;  2XK1 A;  3BW6 A;  1SKF A;  1TD5 A;  1IOU A;  4MBK A;  5FDH A;  3PAE A;  1FIL A;  5M1A A;  1J9M A;  2O9C A;  1BLS A;  1S1Y A;  2ZJ9 A;  3O87 A;  3P09 A;  5EVE A;  3H82 B;  1DJA A;  5CGS A;  2HDU A;  5J3W A;  2KLI A;  2HGV A;  1G5U A;  3PBR A;  3TE8 A;  1MXO A;  4MBH A;  2VGK A;  4X55 A;  1VET B;  2W3D A;  5E2G A;  4G3W A;  4ME4 A;  3PTE A;  2EA9 A;  2PHY A;  2V1Z A;  3M6H A;  5DTT A;  3JVU A;  5BOH A;  1KGE A;  4JXV A;  4LEN A;  2VK3 A;  4YNR A;  4CPK A;  2QKP A;  3B47 A;  2EFX A;  3KSF A;  3E0Y A;  5HWV A;  3DWZ A;  1DJB A;  3T50 A;  2QPN A;  2Y79 A;  2Z6C A;  3LYX A;  3UB7 A;  2W3H A;  5E43 A;  3T4S A;  4WLA A;  4EBP A;  4C6Y A;  4EUV A;  3T1Q B;  2BAS A;  2J7V A;  3F1N A;  4CLC C;  3ZG0 A;  1D06 A;  4CLC B;  1XGJ A;  4H6J A;  4KZ4 A;  2JKR M;  2VGL S;  4Y0T A;  3AGF A;  4B4Z A;  2KDK A;  3M2J A;  4R6L A;  3IBJ A;  1FSW A;  2HDS A;  4ZTK A;  4JPM A;  4HH2 A;  4NK3 A;  5TJJ A;  2ZC5 B;  1LT0 A;  3A0R A;  3R7W B;  4LRX C;  1G28 A;  1GHP A;  4Y5F A;  3QP2 A;  4OON A;  3H7W B;  3ZYT A;  4WZ4 A;  1ONH A;  2JCH A;  2W1T A;  4JF5 A;  3F1O B;  3HVF A;  1WYC A;  1ES3 A;  1PW1 A;  2Q0O A;  1F98 A;  1OTB A;  5E2H A;  2VA0 A;  2X71 A;  4HJ3 A;  4RX2 A;  1N9L A;  4DJ3 A;  1K54 C;  1UWP X;  3C7V A;  4B9O A;  2IWB A;  2EFU A;  3NDG A;  4KZ3 A;  3A0V A;  3OPL A;  4HP9 A;  2E8I A;  3O86 A;  4R4R A;  1OJG A;  5EEC A;  4YFM A;  3V39 A;  1FOF A;  3VFH A;  3OCL A;  4R1G A;  3MQQ A;  2I9V A;  2PYR A;  1I2W A;  1BT5 A;  3NJA A;  2BTF P;  4I5S A;  4Y2F A;  4L0L A;  3I7J A;  2Y8H A;  2X02 A;  3HUO A;  2BLS A;  4F3L B;  5M19 A;  2OOL A;  3CUE A;  4ETZ A;  4DE3 A;  3GR2 A; 
#chains in the Genus database with same CATH homology
 1XJ6 A;  1OTD A;  2MJ6 A;  2QWS A;  1G6O A;  2J3W A;  4KQD A;  3E4O A;  2QYB A;  2VZW A;  5AVF A;  5HD5 A;  5A8B A;  3JVV A;  3FG8 A;  5TBM A;  4KQO A;  4CLC D;  2OAP 1;  2O9A A;  2KOI A;  1H8M A;  3IS2 B;  4MN7 A;  4II7 A;  4K08 A;  2O9B A;  4BBV A;  4E04 A;  4NEE D;  5I5L A;  4WUJ A;  5DFY A;  1GSW A;  3LIA A;  3T4O A;  4Z1W A;  3ZQ5 A;  4YOF A;  3CAX A;  2L4R A;  2NUP C;  2V9A A;  3NOU C;  4UEY A;  3S7Q A;  2XRN A;  1TS8 A;  3OC2 A;  4GHI A;  1P9R A;  2PT7 A;  3T4L A;  4G3V A;  3NOP C;  3LR5 A;  5F6A A;  5HZH A;  1GSV A;  3LR3 A;  2VV8 A;  2PR5 A;  3K3D A;  4JGP A;  4Q0H A;  4I38 A;  1IFQ A;  2WKR A;  1NLZ A;  1KOU A;  3KYZ A;  4O0P A;  4EEP A;  4P6Z S;  4WN5 A;  1NWZ A;  4G3K A;  4I3J A;  2B18 A;  1XJ3 A;  4XT2 B;  5G4Z A;  1OTA A;  2W3E A;  4WF0 A;  2KX6 A;  4R38 A;  5AVE A;  3UMD A;  2HF6 A;  3T4J A;  1TS0 A;  4BMW A;  1MKM A;  3H82 A;  2O0Y A;  1ZHH B;  4FSF A;  1P9W A;  3BJN A;  2YKH A;  3LR4 A;  4H6J B;  1XJ2 A;  1OTI A;  3U2A A;  3KYQ A;  1P97 A;  4IHQ A;  3P01 A;  2XA7 S;  3PBQ A;  2R78 A;  3DBA A;  2QJ5 A;  3EEH A;  2GX5 A;  4PAU A;  1OT9 A;  2JN7 A;  3GDI A;  5C5K A;  1DP9 A;  5MC7 A;  4Q0J A;  3NHQ A;  4KUK A;  3LFV A;  3CI6 A;  3VOL A;  5HL6 A;  1XJ4 A;  5IU1 A;  3PHY A;  4GCZ A;  3EQU A;  2ZMV A;  5L8M A;  2QHK A;  1BYW A;  2VJW A;  4MN5 A;  4NXF A;  4M4X A;  1UGU A;  3R4K A;  4EER A;  3C30 A;  5F69 A;  3S7P A;  3T4K A;  4O8G A;  3B33 A;  4ARZ A;  1NLY A;  2W1T B;  3MQ0 A;  4IJG A;  1TS7 A;  1V9Z A;  5EFW A;  3LID A;  1D7E A;  5KIZ A;  1T1A A;  4EEU A;  2Z6D A;  3NOT C;  3KSH A;  3P7N A;  2HJE A;  3UE3 A;  4PKY A;  1T19 A;  2GJ3 A;  3MR0 A;  3FPV A;  2M7U A;  3E98 A;  1T18 A;  5DKK A;  5HDC A;  4QPR A;  5HDD A;  1F9I A;  2FZ0 A;  3C38 A;  4O01 A;  3OOV A;  2IA2 A;  4CLC A;  3E4P A;  5LBR A;  3VE3 A;  4HOI A;  4KUO A;  2ZOH A;  3GEC A;  4GW9 A;  1T1C A;  3F1P A;  4BWI A;  4OOL A;  3RTY A;  4BBT A;  4DMZ A;  4R3A A;  1YSP A;  2W0N A;  5K5B A;  4BBU A;  5IT5 A;  1MZU A;  2HV1 A;  2VX8 A;  3LIE A;  5AJG A;  2GZA A;  3A0S A;  4HJ6 A;  2DMW A;  5HWW A;  4HI4 A;  3R7W A;  4HQA A;  4EES A;  2PYP A;  4HNB A;  3UB9 A;  3PR6 A;  1OTE A;  4HY8 A;  4WEL A;  1ZTU A;  3PBN A;  3TW8 A;  3H7W A;  1VB6 A;  2V1A A;  2A24 A;  3H9W A;  4GS9 A;  4PHT A;  3CUE C;  5J7E A;  3LUQ A;  3LI8 A;  4FOF A;  3MF0 A;  4MDZ A;  3T4Q A;  3F1O A;  2FH5 A;  3E4Q A;  2HJ9 C;  2VGL M;  3BWL A;  5IS1 A;  1N9N A;  4UQI M;  4LLO B;  2P7J A;  3LI9 A;  4EU0 A;  2V1B A;  4MN6 A;  3RH8 B;  2P08 A;  4IUK A;  2G7U A;  3EEA A;  4WEJ A;  5TBM B;  1OT6 A;  2J3T C;  1XFN A;  3EOI A;  4HP4 A;  2OWH A;  4EXO A;  1NRJ A;  3MFX A;  5HPF A;  2YKF A;  2ZOI A;  3S7N A;  3FPW A;  2NUT C;  4P6Z M;  3PXP A;  2VV6 A;  1TS6 A;  5KSH A;  4Y3I A;  1ODV A;  2W3F A;  3KO6 A;  3VE4 A;  2QJ7 A;  3KX0 X;  5G4Y A;  3UME A;  5HPI A;  4NKP A;  1DP8 A;  3TJZ C;  4CLC E;  1V9Y A;  2D01 A;  4IUH A;  4Q0I A;  4GHI B;  2J80 A;  5DJT A;  3EQV A;  2A2L A;  3BY9 A;  5HSQ A;  1LL8 A;  1JNU A;  4R70 A;  1F5M A;  3OBF A;  2VLG A;  4WEK A;  1X0O A;  2LB5 A;  4JGQ A;  3CLO A;  2PD8 A;  3KSG A;  4F3L A;  3W2Z A;  1S4R A;  3B42 A;  1UWN X;  4DJ2 A;  2WKP A;  3BW6 A;  4HHD A;  4HJ4 A;  1TD5 A;  3BQ8 A;  1IOU A;  2VV7 A;  4DN0 A;  4LRY C;  3K3C A;  3C2W A;  2PDR A;  2LB9 A;  2OWJ A;  4MCW A;  4L9G A;  4ZRR A;  3D72 A;  3PBO A;  1H3Q A;  2O9C A;  3LIB A;  1S1Y A;  4NXB A;  4L9E A;  4EQ1 A;  3H82 B;  3OLO A;  3EGD C;  4GJ4 A;  5J3W A;  2B02 A;  2KLI A;  2HGV A;  4L9F A;  1DRM A;  3IS2 A;  3V67 A;  2V0U A;  3PBR A;  3LIC A;  3IBR A;  4GLQ A;  2O99 A;  5DF9 A;  3TE8 A;  2M1C A;  4MMN A;  5DKL A;  3PYP A;  2W3D A;  4WL9 A;  2JKT M;  4G3W A;  4ME4 A;  2EA9 A;  2EWW A;  2PHY A;  3K2N A;  3PBT A;  1P0Z A;  5J4E A;  4BJP A;  1S4S A;  3T4T A;  4YWZ A;  3EWK A;  4LPZ A;  3EGX C;  3O5Y A;  3JVU A;  4NXE A;  2W1R A;  4LRZ E;  4YNR A;  2QKP A;  3B47 A;  3KSF A;  3ULF A;  3RFB A;  3E0Y A;  4ARZ B;  4I3A A;  5HWV A;  5HWT A;  2L0W A;  3T50 A;  1VHM A;  2Y79 A;  4NXG A;  2Z6C A;  3MJQ A;  3LYX A;  1DP6 A;  3UB7 A;  4XT2 A;  2PD7 A;  4OOM A;  2W3H A;  3MQO A;  3T4S A;  4WLA A;  4EUV A;  3BY8 A;  2BAS A;  3F1N A;  4CLC C;  1D06 A;  4PKY G;  4CLC B;  2K2N A;  4H6J A;  2JKR M;  2W27 A;  3PBS A;  2J3T D;  3G6O A;  3FC7 A;  2VGL S;  3F1P B;  2WKQ A;  1TF1 A;  1T1B A;  4EET B;  1W63 Q;  2KDK A;  4UQI S;  3CWF A;  4R6L A;  3IBJ A;  2K31 A;  2XRO A;  4HH2 A;  2K7S A;  5TJJ A;  1Y28 A;  3S7O A;  1S1Z A;  1LT0 A;  3A0R A;  1OPX A;  2VEA A;  3R7W B;  4LRX C;  1G28 A;  4Y5F A;  4RQ9 A;  1YKD A;  1LSW A;  2ZMF A;  3MXQ A;  2JKT I;  1STZ A;  3H7W B;  1S67 L;  4AFI A;  3SW1 A;  3ZYT A;  2EWV A;  4I3I A;  2PR6 A;  4CQH A;  2A24 B;  4GS9 B;  4HH3 A;  4B93 A;  4EW7 A;  2W1T A;  1W63 M;  3F1O B;  4I39 A;  1LSV A;  2XA7 M;  3F1N B;  5DJU A;  1F98 A;  1EW0 A;  1OTB A;  5FL3 A;  1XFQ A;  4JGO A;  2XSS A;  3HCY A;  2VA0 A;  4HJ3 A;  1N9L A;  2INW A;  3ICY A;  4DJ3 A;  2VKS A;  2JHE A;  1UWP X;  1MC0 A;  2GNX A;  4ETX A;  4B9O A;  2H28 A;  3BQA A;  3KSI A;  3A0V A;  4HP9 A;  2D02 A;  4HIA A;  5F5Y A;  5HDS A;  4JGR A;  2JKR I;  1OJG A;  3D3O A;  1GSX A;  3HJI A;  5F68 A;  3TRC A;  2ZBB A;  3UB6 A;  1S66 L;  3OCL A;  3UB8 A;  1N9O A;  3MQQ A;  2I9V A;  2PYR A;  2OAQ 1;  3C8C A;  5CX7 A;  1WA9 A;  1YSQ A;  1YAX A;  1OJ5 A;  3NJA A;  4I5S A;  3VV4 A;  3CIT A;  3LIF A;  4Y2F A;  4L0L A;  1LSX A;  5DFX A;  2L1M A;  3LR0 A;  2W3G A;  3HJK A;  2CMN A;  2Y8H A;  2P04 A;  2V0W A;  4F3L B;  2OOL A;  3MMH A;  3UE6 A;  3CUE A;  3OCN A;  4ETZ A;  2M7V A;  5HD3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...