4PKYG

Arnt/hif transcription factor/coactivator complex
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
106
structure length
100
Chain Sequence
b'LDSKTFLSEHSMDMKFTYCDDRITELIGYHPEELLGRSAYEFYHALDSENMTKSHQNLCTKGQVVSGQYRMLAKHGGYVWLETQGTVIYNQCIMCVNYVL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Aryl hydrocarbon receptor nuclear translocator
publication title Coiled-coil Coactivators Play a Structural Role Mediating Interactions in Hypoxia-inducible Factor Heterodimerization.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/cell cycle
total genus 26
structure length 100
sequence length 106
ec nomenclature
pdb deposition date 2014-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF08447 PAS_3 PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4pkyG00
3LIEA 2CMNA 2PYPA 4LRXC 3KX0X 4JGQA 2V9AA 3BWLA 3F1OA 2PDRA 5F69A 4BBTA 5F68A 3MR0A 1WA9A 3FC7A 5HDDA 4R6LA 2PD8A 1LT0A 4WF0A 2OOLA 4JGOA 3NJAA 1G28A 5HZHA 4WL9A 2I9VA 1P97A 5DJUA 5A8BA 5KIZA 4HH2A 2D01A 2J80A 2K7SA 3LI9A 4EW7A 5HD3A 4I38A 3ZQ5A 4GS9B 5I5LA 4EETB 3A0VA 1XJ2A 3H82A 4EXOA 4WLAA 3UB6A 2VV8A 2ZOIA 5HWWA 4EQ1A 1BYWA 4I3IA 3C8CA 1LSXA 3NOUC 4GHIB 5F5YA 2QJ7A 4LRYC 1T1BA 2A24B 3C2WA 5J4EA 3A0RA 4MN6A 2Z6DA 2Z6CA 1OJ5A 4HI4A 4BBVA 1D7EA 3VE4A 4GCZA 2V0UA 1EW0A 5EFWA 1T18A 4MN5A 4DJ3A 4PKYG 2QWSA 2D02A 3BY9A 3B33A 5IS1A 1OT9A 2INWA 3GDIA 3PHYA 3T50A 1S67L 4BBUA 2B02A 3IS2A 1S1YA 4GW9A 2ZOHA 2L1MA 3LIBA 4XT2B 5AVFA 5DJTA 1LL8A 5TBMB 3F1PB 3E4OA 5HSQA 1DP8A 4EEUA 2YKFA 3H7WA 4HP4A 3LIFA 3PYPA 3RTYA 1GSXA 1TS0A 3EEHA 4I3JA 4HJ3A 4M4XA 3BY8A 3UE6A 3LIDA 2KX6A 1LSVA 3F1NB 2R78A 4LPZA 5DKLA 1Y28A 4NXGA 1UWNX 5AVEA 2EA9A 4EERA 1NWZA 4WUJA 4LRZE 4KUKA 4NXBA 5J3WA 2OWJA 1DP6A 1TS7A 2P7JA 4HNBA 3E4QA 3EWKA 2VV6A 3HJKA 2JN7A 2QJ5A 1XFNA 3LIAA 4EEPA 4E04A 3UMEA 4K08A 2L0WA 2QHKA 1OTEA 4F3LB 5G4ZA 1UWPX 3LUQA 4GHIA 2HV1A 4L9GA 2A24A 4HQAA 1OTAA 4NXEA 3K3CA 1XJ4A 1TS6A 2WKPA 3H9WA 1T1CA 2WKRA 4YWZA 3NHQA 1DRMA 3NOTC 3SW1A 3UB9A 4HJ4A 3VE3A 5J7EA 2BASA 1GSVA 1GSWA 3UB8A 2JHEA 1D06A 1S4SA 4JGRA 3D72A 2GJ3A 4L9EA 2PR5A 3HJIA 4XT2A 3UB7A 5HDSA 5TBMA 3ICYA 4HP9A 4H6JB 3F1PA 3E4PA 1N9OA 2OWHA 4RQ9A 3IBRA 3ULFA 1OTBA 4R3AA 2YKHA 3K3DA 3F1OB 3CWFA 3LYXA 2V1AA 4R70A 3GECA 1V9YA 5G4YA 3CLOA 4HIAA 3F1NA 4PKYA 5F6AA 1T1AA 1XJ3A 4I39A 2H28A 1OTDA 4JGPA 2VV7A 3MJQA 1P0ZA 3P7NA 5HWVA 1V9ZA 4HOIA 1XFQA 2WKQA 4GS9A 4HH3A 1S66L 2ZBBA 1OTIA 3MFXA 3H82B 1N9NA 3MQOA 2PR6A 4HHDA 4HY8A 1LSWA 5HWTA 5IU1A 2W0NA 2PHYA 1JNUA 3MXQA 2QKPA 2M1CA 4F3LA 5DKKA 1ODVA 1S1ZA 4I5SA 3RH8B 5HDCA 3LICA 3A0SA 4LLOB 1F9IA 1OT6A 1DP9A 4WN5A 1F98A 1MZUA 3NOPC 5HD5A 2KDKA 4NXFA 4KQDA 3CAXA 1T19A 1XJ6A 3UMDA 4KUOA 2PYRA 1VB6A 1KOUA 2V1BA 1X0OA 2V0WA 3MQQA 1N9LA 3IS2B 4I3AA 2W27A 2PD7A 2L4RA 1TS8A 3VOLA 4R38A 4L9FA 2VEAA 1S4RA 3OLOA 4DJ2A 3LI8A 3FG8A 2VLGA 1UGUA 4HJ6A 4B9OA 4EESA 3H7WB 4H6JA 3G6OA 1OJGA
chains in the Genus database with same CATH superfamily
2CMNA 3SOIA 2V9AA 1TEMA 2EX2A 3F1OA 4S2PA 3MR0A 1MKMA 4KZ7A 3UPPA 4A5RA 3FC7A 2PBDP 5FI6A 1YLWA 1HD8A 3UPOA 4LENA 1LT0A 4WF0A 5EE8A 4KZAA 1G28A 1W8YA 4N1XA 3G2YA 1P97A 5KIZA 5HPFA 4EWFA 3VV4A 4PPRA 4DE0A 3NDEA 1CQAA 4GS9B 2P04A 3ZG8B 3UB6A 3HL9A 4MDZA 1MWRA 3MBZA 3HBRA 1WYBA 4ZAMA 4ARZA 4IBXA 3DW0A 1W7FA 4LV1A 5GHYA 4Z1WA 3P09A 4NG2A 4LRYC 1T1BA 3VP1A 1H8ZA 2Z6DA 1PYYA 2ZMVA 4HI4A 3UDXA 3T1SA 2Y2HA 4D60A 2J3TD 3HLWA 3VOYA 5DFYA 2V0UA 5KSCA 2B5RA 2P74A 4DJ3A 3C4PA 4MN7A 4IUKA 4E3LA 2EXAA 2OLVA 1ONHA 3BECA 4X53A 1ONGA 1KGFA 2ZL1A 4R1GA 5DF8A 5HAIA 1OT9A 2INWA 1SDNA 2ZQ9A 3GDIA 1E4DA 1C3BA 3IF6B 2FH5A 3EGXC 1KVLA 4P6ZM 2B02A 2XSSA 3KO6A 4GW9A 2L1MA 4GN2A 5AVFA 5DJTA 2PAVP 2XRNA 5TBMB 2M7UA 4Q8IA 3B3XA 1K57A 2NUTC 1ALQA 3RXWA 2VX8A 1IKGA 4CLCD 4UQIM 4F94A 3O5YA 4HP4A 1IYQA 3LIFA 1LLBA 4JLFA 3NC8A 3QHYA 1M40A 4FUWA 3D3OA 2ZQ7A 5KMWA 3LFVA 1IOUA 4Q0IA 5DKLA 4P6ZS 3SZTA 2X71A 5AVEA 2HDQA 1NWZA 4X6TA 2G2UA 3CI6A 3IX3A 2R9XA 2O99A 1QMEA 1DP6A 3V5MA 2XK1A 4QPRA 1Q2QA 1XX2A 1H3QA 1PW1A 2W3DA 3NCKA 3G34A 5EVIC 5CX7A 4EQIA 4FTXA 2WK0A 4CLCA 1JTGA 4PMAA 1FOFA 4EEPA 3NDGA 2X02A 3TSGA 2HDRA 2IA2A 3CG5A 1NJ4A 4K08A 2V8CA 3NIAA 3WS2A 4Q0HA 1MWTA 3G31A 1RGZA 3P01A 1Z6FA 2VGJA 4GHIA 5A92A 2A24A 2GX5A 4HQAA 5FATA 4NXEA 4K91A 3AGEA 1H0MA 1YSQA 3CMZA 1OPXA 1T1CA 2EWWA 4ZJ1A 1H8YA 3VSLA 3NHQA 2J8YA 3S7OA 3NOTC 5GL9A 3S22A 3RJUA 2ZM0A 3V3RA 2BASA 1GSVA 1SKOA 2AVXA 3AGFA 1S4SA 3K2NA 4LV3A 5FI2A 3IWOA 2GJ3A 5AQAA 3S4XA 3HJIA 3UB7A 1LI0A 3C30A 4YFMA 3IXHA 4HP9A 1MKIA 3LEQA 3E4PA 2WYXA 4E6XA 1N9OA 1KGGA 4OQIA 1WE4A 1I2SA 5IT5A 5M1AA 3DWKA 2XEPA 2DRWA 5F82A 3BLSA 1ZKJA 5KZHA 1U60A 5TJJA 3CUEC 1V9YA 5G4YA 1TDLA 3CLOA 4HIAA 2VA0A 3BQ8A 4KZ9A 5F6AA 2Y2LA 4UHUA 2V2FF 4P6BA 5EUAA 5BOHA 1QMFA 4X55A 2XA7M 5EVIA 2EFXA 5CGWA 4R3JA 3DBAA 4GDBA 1P0ZA 1VM1A 2Y8HA 3TG9A 4YOFA 2W1RA 2ZBBA 1PWGA 4KG6A 3H82B 4EU0A 4P85A 3R7WA 3MQOA 1FQGA 3E2KA 1LSWA 1M6KA 3PBSA 4U0XA 5CHUA 1PW8A 2QKPA 3SS3A 2M1CA 4Y7PA 4C3QA 2Q9NA 4S2OA 2XA7S 3ISGA 3M6BA 3C7UA 3NI9A 1D1JA 5F1GA 3MXSA 3LR4A 3OPRA 2JKGA 2PT7A 2H10A 1KVMA 5HDCA 2C5WB 3BFGA 4X69A 1DP9A 4PM9A 1Q2PA 3E2LA 3MF0A 5CRFA 3NOPC 3N6IA 5FQJA 1BLSA 1PI4A 4DDSA 3ZVTA 3N8SA 3VMAA 5MC7A 1N4OA 3VP3A 2JC7A 3OOVA 4JBFA 3PAGA 3TOIA 1K0KA 1X0OA 3RXXA 2V0WA 3ITBA 4O7DA 4G3KA 4LCMA 4C6YA 1FCOA 4PM6A 2L4RA 4RVAA 2WZXA 4X68A 3M2KA 1ES3A 4OKPA 4Y0UA 1MC0A 3GMWA 4OOYA 3CUEA 3H7WB 4H6JA 1V9ZA 3G6OA 2IWDA 3LIEA 3KX0X 4GD6A 5EPHA 2XFSA 4JGQA 4DKIA 5AQ9A 4QY5A 2W3HA 3BWLA 2WGIA 4BBTA 5CERA 1GHMA 1EWZA 4FH2A 3BRMA 4BD0A 1J3WA 1FR1A 3WS0A 5FQMA 4KG5A 4NETA 1VETA 2I9VA 5GLBA 4OQ0A 5A8BA 1YPRA 2JKRM 2Y2OA 2WGWB 2K7SA 3CHWP 1JVJA 4DDYA 4EW7A 3UNWA 1GA9A 3A3EA 4I38A 2XDMA 3HLCA 5I5LA 3T1RA 5FI7A 1CF0A 3PBRA 4WLAA 2ZC4B 3QNBA 3PTEA 3Q7VA 4HESA 5CEDA 3JVUA 4EQ1A 3IF5A 4JKTA 2H5SA 1CJFA 1BYWA 3T4OA 4MEZA 1XXMA 1LSXA 3A3DA 3IXGA 3MQ0A 5J4EA 3A0RA 4MN6A 4N92A 2JKRI 4JPMA 4CJNA 5GLDA 4LCLA 2VGKA 1KE0A 4DF6A 5CGSA 4G3VA 1PI5A 2VZWA 1EW0A 4K0WA 2PBYA 4E3JA 1VEUB 4M3KA 4G3WA 4PHTA 2ZQDA 1SZVA 5FAQA 1ES2A 5CHMA 3U2AA 1L0FA 3T50A 4KZ3A 3ZG0A 2RL3A 1Z09A 3T4KA 1S67L 4ZJ3A 2Y2QA 3C7VA 4OOMA 3IS2A 1AWIA 3LIBA 3GQZA 4R23A 3SH8A 3F1PB 4WEJA 3UB5P 1MXOA 3BJNA 3IF6C 1O7EA 5EM1A 4EEUA 1ZHHB 4KZ8A 3PYPA 4E3IA 1K57C 4WYYA 4IBRA 4ZRRA 2Y2PA 1TS0A 3EEHA 4EV4A 2C6WB 4M4XA 2Y4AA 4BQMA 3C38A 3S7QA 5FA7A 2J3TC 2KX6A 2R78A 3MSHA 2M7VA 4LPZA 1GA0A 1UWNX 2Q0OA 4EERA 4NXBA 1KDWA 2WZZA 1CK3A 3G35A 1XA7A 5E43A 1I2WA 4WMCD 3MS6A 4IJGA 5L10A 4IVKA 3EWKA 5HL6A 4QD4A 4BD1A 1YT4A 4BWIA 1BULA 3LIAA 3W4OA 3G4PA 4DRTA 5L2FA 1KE3A 3UMEA 5CHJA 4CLCC 2L0WA 4D2OA 1OTEA 1W79A 2QZ6A 3IT9A 3MXRA 5DF9A 1S6RA 4OPYA 2FFFB 1UWPX 1YQSA 4BL3A 1FSWA 1YLJA 1O07A 1BLHA 1XJ4A 1J9MA 2Y2JA 4RA7A 2WKPA 1PWDA 1K6SA 2BTFP 3H9WA 1EROA 4O01A 4R4RA 1RGYA 3SS4A 3SW1A 1GHIA 4U0TA 1GSWA 2UWXA 2JHEA 3CJMA 3IF6A 4X25A 1D06A 1YM1A 3QP8A 1DY6A 3BLMA 3LY3A 4LV2A 1BT5A 4Y0TA 2OLUA 1ERMA 4O0PA 2PU2A 2XR0A 5TBMA 4KQOA 3KSFA 3OZHA 1OTBA 3UN7A 4Z9QA 3EQUA 4IVIA 3K3DA 4IHQA 3ZNTA 4DE3A 3OBFA 1IYSA 1E3UD 4OPZA 3WRZA 1K38A 1SKFA 3HUOA 1TD5A 1G6OA 1WYCA 3ZVWA 1T1AA 3ZDJA 4KZBA 1XJ3A 4NEED 3MZDA 1XA1A 3ZYTA 1OTDA 3QP2A 3IHBA 2VV7A 4S2NC 5DFXA 2V1ZA 1XFQA 4FOFA 3BYDA 2Y91A 4QB8A 4BL2A 2XQZA 4QHCA 3BFCA 5FAPA 1K55A 5GLCA 2E8IA 1YAXA 1P9RA 1W8QA 2J9OA 1ZG4A 2P08A 5JYPA 2A2LA 2WGVA 2P9VB 4PM8A 1ESUA 2Y2NA 1S1ZA 1S0WA 3RH8B 4OLGA 4E3NA 5A90A 1K4EA 3T4JA 2ZLYA 3A0SA 4LLOB 3IQAA 1OT6A 4H8RA 4UEYA 4WN5A 5A91A 2Y55A 1MZUA 4Y3IA 2O9CA 3EQVA 4MCWA 2KDKA 1YKDA 1PZPA 2FFYA 5DTKA 2ZD8A 3CAXA 4PM7A 3GSGA 4MMNA 3UE3A 3UMDA 3WRTA 4KUOA 2PYRA 1KOUA 3NULA 3LR3A 3IH9A 2JE5A 4I3AA 4XXRA 3VOLA 1JWVA 1NLZA 4N9LA 2JKTM 3LI8A 3FG8A 2VLGA 4FD8A 2Y2IA 4B9OA 4E6WA 1K4FA 3UY6A 5CEBA 1NZUA 4Y0OA 1TVFA 2RCXA 2XH9A 1XGJA 4IEDA 2PYPA 4LRXC 1PNEA 1KE4A 4E3KA 3W8KA 4XUZA 2ZMFA 1FCMA 4B93A 1YMSA 1Y4OA 2PU4A 5F69A 3LR0A 4LV0A 4S2NA 2PD8A 2HZ5A 1FIKA 2Z2LB 3IHAA 2JKTI 2GDNA 3O88A 2XGNA 3N8RA 5HZHA 5EECA 5TGFA 4OVDA 5DJUA 3ZHHA 4HH2A 1MWSA 5CTNA 4KZ4A 2PRFA 3LCEA 3LI9A 4HBTA 1JWZA 5HD3A 3FZCA 1NRJA 3LR5A 3A0VA 3H82A 3HREA 5AQ7A 3T4LA 4EXOA 2VV8A 3CPTA 2ZOIA 1ES4A 1BZAA 5HPIA 1HTZA 4E3MA 4I3IA 1ESIA 3SS5A 3NECA 3NOUC 1LI9A 2QJ7A 2A49A 1CEFA 3FPWA 4CQHA 2O9AA 4WEKA 4BBVA 1F5MA 1YLYA 1D7EA 3I7JA 3ZCZA 4B4ZA 3OC2A 2DCFA 3VE4A 1W63M 1P9WA 4ETXA 5EFWA 4MN5A 1CEGA 3UE1A 3VSKA 4FCFA 4PKYG 3GV9A 2J3WA 3HUNA 2WUQA 2EXBA 3BY9A 5FDSA 5IS1A 4EUVA 3PHYA 3HLDA 4BBUA 4XT2B 3ITAA 5D3OA 5AJGA 4WM9A 3A3FA 3E4OA 4GD8A 1RP5A 2EX6A 1F2KA 2YKFA 3H7WA 3BW6A 3RTYA 4JXVA 2OAQ1 1TDGA 1G68A 3V3SA 4HJ3A 3PR6A 3UE6A 1MBLA 3LIDA 3F1NB 3DTMA 4OH0A 2ZC3B 4JF6A 3FWLA 1Y28A 3FV7A 3VP2A 4NXGA 3LO7A 2ZM8A 2KOIA 3MZFA 5GHZA 4LRZE 3D4FA 3HLBA 5HAQA 5CECA 2WAEA 4UA6A 1IKIA 2OWJA 4O8GA 2W1TB 1TS7A 3OCLA 4RX2A 4EBNA 3VOZA 2GNXA 3E4QA 2E8JA 3ZGAB 3Q7ZA 2WGWA 2Y59A 5E2FA 4KQQA 3KSGA 2G2WA 4JXWA 2JN7A 2QJ5A 1XFNA 4UA9A 4WELA 2CC1A 3HLFA 1YLZA 1IYOA 3ZG5A 3MMHA 4IUHA 2QHKA 4F3LB 4GDNA 3IX4A 3TW8A 1NZOA 2HF6A 2H0YA 4PAUA 1DJCA 1G6AA 5TR7A 4S2LA 3W2ZA 3B42A 3TJZC 1L0DA 3ZG7B 3FKVA 3JPUA 4NK3A 3IX8A 2O0YA 5CGXA 5FEFA 5C5KA 4QY6A 2WKRA 4OQGA 1IEMA 4YWZA 3VP4A 1N9BA 2K31A 1MWUA 4AFIA 1XGIA 3VE3A 1VHMA 1KDSA 4MBKA 5J7EA 3WWXA 4ETZA 3IH8A 4MLLA 1TF1A 2XLNA 2XF3A 2HJEA 2IWBA 4QU3A 3E0YA 4WBGA 2Y79A 3KYEA 4BJPA 2PR5A 3T4SA 4BENA 1JTDA 3ICYA 2EWVA 3F1PA 4ZBEA 2HDSA 3ULFA 3G2ZA 1LHYA 3T1QB 4R3AA 1FILA 3F1OB 2HP9A 3CWFA 4N1HA 4R70A 4CPKA 3GECA 2JKFA 5AQBA 4OQHA 5F83A 2MJ6A 4GLQA 3ZFZA 4PM5A 1MPLA 3BFEA 5DF7A 4DXBA 3P7NA 2VJWA 1FCNA 4JF5A 3VP0A 3NY4A 1PFLA 2WKEA 3GTCA 4GS9A 4HH3A 5GLAA 3MFXA 1IYPA 2EX9A 5U47A 4OOLA 1N9NA 1GHPA 2JCHA 4JXGA 4LGWA 1PZOA 2ZC5B 4N9KA 2PR6A 2V20A 3A3JA 4HY8A 5HWTA 1SDEA 2W0NA 2Z2MB 1NYYA 3KYZA 1MY8A 4II7A 2PHYA 3HVFA 4ARZB 3MXQA 4WZ5C 4U3TA 5DKKA 3S7NA 3QP6A 1K55C 4KG2A 4GKUA 3WS1A 5FQIA 1LL5A 4Y13A 4CLCE 4OP5A 3QP1A 4X1LA 4I5SA 3LICA 4GNUA 3QP5A 4S2JA 3LGOA 4WMCA 4HEFA 1F9IA 3PBNA 2ZMAA 5FL3A 1L0EA 4X56A 3OCNA 2LB9A 5HD5A 4L0LA 5HL1A 4NXFA 4KQDA 2W3EA 4UA7A 2ZL1B 4EBPA 3T4TA 2DNSA 2WAFA 3O87A 3WS4A 1HLUP 3SH9A 5I94A 3MQQA 1N9LA 4KQRA 4OONA 1BLPA 2JBFA 3FPVA 4DE2A 1TS8A 5HX9A 1XKZA 4L9FA 4JF4A 2QYBA 2VEAA 1W63Q 4DJ2A 3E98A 4HJ6A 3VFFA 1STZA 4DN0A 2G7UA 3BM6A 3KSHA 4EESA 3B47A 1OJGA 3Q07A 3C4OA 5DTTA 2EFUA 2Q9MA 4OPQA 3HLGA 4BLMA 2PDRA 5F68A 1AXBA 1WA9A 5CXWA 5F1FA 5HDDA 4R6LA 4EUZA 3DWZA 1XPBA 2A3UA 2OOLA 4JGOA 3NJAA 4WL9A 5IHVA 3DAVA 1CI8A 4OLDA 5HW3A 5M19A 2D01A 4OPRA 3T4QA 1L0GA 2J80A 4ME4A 3OPLA 3FYZA 4WZ5A 4CLCB 4UQIS 3ZQ5A 5EOOA 1VQQA 3V67A 5E2EA 4EETB 1XJ2A 1H8MA 1ZTUA 1EI5A 3MZEA 3S1YA 5HWWA 1NLYA 3L9KA 1E3UA 5L09A 2DMWA 4RYEA 3C8CA 1K54C 2VK3A 4GHIB 4GOGA 3O86A 5F5YA 2P9VA 3PBQA 2A24B 3C2WA 3CITA 1CI9A 2Z6CA 1OJ5A 3M2JA 1BTLA 1DJBA 5FQQA 3UPNA 5EV0A 4GCZA 4KZ5A 3DTKA 1T18A 3S7PA 5E2HA 5DVAA 1NXYA 2QWSA 2WADA 2J9PA 2IWCA 1IFQA 3VFHA 2ZC7A 2BLSA 3N4IA 4KENB 2D02A 2KLIA 3B33A 4FH4A 3KSIA 1SKOB 4ZTKA 4P0MA 4DE1A 4GB7A 4S2IA 3LEZA 4UAAA 4Y15A 4GJ4A 3T1XA 5EVID 1W5DA 3QNCA 1Y54A 4R0QA 4YINA 4B88A 1S1YA 2ZOHA 5FASA 5FAOA 5HAPA 4R3BA 1GCEA 2VGLM 2NUPC 1ERQA 4MNRA 1LL8A 2GZAA 2W3FA 2J7VA 5HSQA 2WKHA 1FSYA 3HCYA 3OPHA 1DP8A 3IXBA 3DTEA 1I5QA 3W4PA 4S2KA 5LBRA 4E3OA 1GSXA 3N8LA 4I3JA 5FEGA 3BY8A 3MKEA 5EVEA 1K56D 3V39A 4ZDXA 3TE8A 1LSVA 2ZC6B 2ZQAA 3MFDA 2QMIA 5EVIB 2EA9A 1K25A 1YSPA 4WUJA 2V8FA 4KUKA 5J3WA 4BMWA 2HDUA 2VGLS 3AGDA 2ZJ9A 4R4SA 4S2MA 5KSHA 5FDHA 3PBOA 2P7JA 3W4QA 4HNBA 4QWOA 2B95A 4FSFA 2VV6A 3JYIA 3HJKA 3UDFA 1PIOA 2FZ0A 5FQKA 3R7WB 2ZQCA 2XFTA 4YNRA 1K54A 4WZ4A 4NKPA 2X01A 4E04A 1XP4A 1L2SA 3CPTB 5G4ZA 1K56A 3RFBA 3O3VA 1YLTA 4B4XA 2HP5A 2K2NA 3R4KA 3LUQA 4MBFA 1NYMA 2HV1A 4L9GA 2O9BA 1OTAA 3K3CA 1SCWA 1IELA 5K5BA 1TS6A 1KGEA 3ZNYA 3HUMA 1JWPA 3P98A 3JVVA 1DRMA 3IBJA 5EOEA 4MBHA 3NBLA 3UB9A 3DTIA 4HJ4A 1NY0A 3BFDA 3LY4A 5HARA 3GR2A 3WS5A 3UB8A 1HZOA 1OMEA 3Q1FA 4JGRA 3D72A 4L9EA 3A3IA 2WKIA 4C75A 4XT2A 3T12B 5HDSA 1BLCA 2QPNA 4H6JB 3Q82A 3UE0A 5JYOA 2H0TA 2OWHA 4RQ9A 3IBRA 2XD1A 3QP4A 4ID4A 2OV5A 5FQ9A 4RX3A 3UO9A 2YKHA 1DJAA 3N7WA 3LYXA 2V1AA 3KYQA 4DXCA 5DTSA 3GVBA 3L7HA 4P87A 3MKFA 3F1NA 5M18A 4PKYA 2I72A 2ZQ8A 4KZ6A 4I39A 2H28A 3SH7A 4JGPA 1VETB 1ZC2A 2W3GA 3PAEA 3U4LP 3BFFA 2R9WA 3EEAA 3MJQA 4Q0JA 5E2GA 1PRQA 5EVLA 5HWVA 4GZBA 2W1TA 2HGVA 5CTMA 1A0KA 2HPBA 4HOIA 5GHXA 2WKQA 4Y2FA 1S66L 1YLPA 1OTIA 1SHVA 2BG1A 1K6RA 3D9YA 3ZG9B 3BQAA 3HLEA 2UV0E 1LL9A 3Q7VB 4HHDA 3Q81A 1RCJA 4EBLA 5IU1A 3G32A 4Y5FA 4DMZA 1JNUA 2OAP1 4XUXA 4K0XA 4F3LA 4X1MA 3GRJA 2ACGA 2Y2GA 1HVBA 2EX8A 3IWIA 4ZJ2A 1ODVA 3PXPA 3C5AA 1ZG6A 2Y2MA 5TFQA 2XROA 2HP6A 1L3LA 3CZDA 1F98A 2ZM2A 4JXSA 2XD5A 5L8MA 1VEUA 3TRCA 1G5UA 1PWCA 1NRFA 2OSUA 3EGDC 1T19A 1XJ6A 2Y2KA 2B18A 4QJGA 5FSRA 5HFOA 1VB6A 5J8XA 2V1BA 1ACFA 5G18A 4Y17A 3OPPA 4HBUA 5A93A 2HJ9C 1FR6A 1ES5A 5L07A 2LB5A 4OP8A 3IS2B 4ESPA 3IWQA 2W27A 2PD7A 5EM0A 1BUEA 3PBTA 1BSGA 1YMXA 4R38A 3FKWA 3IXDA 1H5XA 1S4RA 1E25A 3OLOA 2VKSA 3UDIA 1UGUA 3BEBA 4LFUA 3G30A 3EOIA 3V50A 3M6HA
chains in the Genus database with same CATH topology
3LIEA 2CMNA 2PYPA 4LRXC 3KX0X 4JGQA 2V9AA 2W3HA 3BWLA 2ZMFA 3F1OA 2PDRA 4B93A 5F69A 4BBTA 5F68A 3MR0A 1MKMA 3LR0A 1WA9A 3FC7A 5HDDA 4R6LA 2PD8A 1LT0A 2JKTI 4WF0A 2OOLA 4JGOA 3NJAA 1G28A 5HZHA 4WL9A 2I9VA 1P97A 5DJUA 5A8BA 5KIZA 4HH2A 5HPFA 2D01A 2JKRM 3VV4A 3T4QA 2J80A 2K7SA 4ME4A 3LI9A 4EW7A 5HD3A 4CLCB 4UQIS 4I38A 3ZQ5A 4GS9B 5I5LA 3V67A 1NRJA 4EETB 3LR5A 2P04A 3A0VA 1XJ2A 3H82A 3T4LA 1H8MA 4EXOA 3PBRA 4WLAA 1ZTUA 3UB6A 2VV8A 2ZOIA 4MDZA 5HWWA 1NLYA 5HPIA 3JVUA 4EQ1A 2DMWA 4ARZA 1BYWA 4I3IA 3T4OA 3C8CA 1LSXA 4Z1WA 3NOUC 4GHIB 5F5YA 2QJ7A 3MQ0A 3PBQA 4LRYC 1T1BA 2A24B 3C2WA 5J4EA 3A0RA 3CITA 4MN6A 3FPWA 2Z6DA 2JKRI 2Z6CA 4CQHA 2O9AA 4WEKA 1OJ5A 2ZMVA 4HI4A 4BBVA 1F5MA 1D7EA 3OC2A 2J3TD 4G3VA 3VE4A 4GCZA 1W63M 5DFYA 2VZWA 2V0UA 1P9WA 1EW0A 4ETXA 5EFWA 1T18A 3S7PA 4MN5A 4DJ3A 4MN7A 4IUKA 2QWSA 4PKYG 4G3WA 2J3WA 1IFQA 4PHTA 2D02A 2KLIA 3BY9A 3B33A 3KSIA 5IS1A 1OT9A 2INWA 4EUVA 3U2AA 3GDIA 3PHYA 3T50A 2FH5A 3EGXC 3T4KA 1S67L 4BBUA 4GJ4A 4P6ZM 2B02A 4OOMA 2XSSA 3IS2A 3KO6A 1S1YA 4GW9A 2ZOHA 2L1MA 3LIBA 4XT2B 5AVFA 5DJTA 2VGLM 2XRNA 2NUPC 5AJGA 1LL8A 5TBMB 2M7UA 3F1PB 3E4OA 4WEJA 2NUTC 2VX8A 2GZAA 2W3FA 5HSQA 4CLCD 3BJNA 3HCYA 4UQIM 1DP8A 4EEUA 2YKFA 3O5YA 1ZHHB 3BW6A 3H7WA 3LIFA 3PYPA 4HP4A 5LBRA 2OAQ1 3RTYA 4ZRRA 1GSXA 1TS0A 3EEHA 4I3JA 4HJ3A 4M4XA 3BY8A 3PR6A 3C38A 3S7QA 3UE6A 2J3TC 3D3OA 3LIDA 2KX6A 3TE8A 1LSVA 3F1NB 2R78A 3LFVA 2M7VA 4LPZA 1IOUA 4Q0IA 5DKLA 1Y28A 4P6ZS 4NXGA 1UWNX 5AVEA 2EA9A 4EERA 2KOIA 1YSPA 1NWZA 4WUJA 4LRZE 3CI6A 4KUKA 4NXBA 5J3WA 4BMWA 2VGLS 2OWJA 4O8GA 2O99A 5KSHA 1DP6A 2W1TB 1TS7A 3OCLA 3PBOA 2P7JA 4QPRA 4HNBA 2GNXA 3E4QA 4IJGA 5HL6A 1H3QA 3EWKA 4FSFA 2VV6A 3HJKA 2W3DA 4BWIA 5CX7A 2FZ0A 3KSGA 3R7WB 2JN7A 2QJ5A 4CLCA 1XFNA 4YNRA 3LIAA 4WELA 4NKPA 4EEPA 4E04A 2IA2A 3UMEA 4K08A 3MMHA 2L0WA 4IUHA 4CLCC 2QHKA 1OTEA 4F3LB 4Q0HA 5G4ZA 3RFBA 5DF9A 3TW8A 2K2NA 2HF6A 3R4KA 1UWPX 3LUQA 3P01A 4GHIA 2HV1A 4PAUA 4L9GA 2O9BA 2A24A 2GX5A 4HQAA 3B42A 3TJZC 3W2ZA 1OTAA 4NXEA 3K3CA 1XJ4A 1YSQA 5K5BA 1TS6A 2O0YA 2WKPA 3H9WA 5C5KA 4O01A 1OPXA 1T1CA 2EWWA 3JVVA 2WKRA 4YWZA 3NHQA 1DRMA 3IBJA 3S7OA 3NOTC 2K31A 3SW1A 3UB9A 1OJGA 4HJ4A 4AFIA 3VE3A 1VHMA 5J7EA 2BASA 4ETZA 1GSVA 1GSWA 1TF1A 3UB8A 2JHEA 1D06A 1S4SA 2HJEA 3K2NA 4JGRA 3D72A 2GJ3A 4L9EA 3E0YA 2Y79A 4BJPA 2PR5A 4H6JA 3T4SA 3HJIA 4XT2A 3UB7A 5HDSA 4O0PA 3C30A 5TBMA 3ICYA 4HP9A 4H6JB 2EWVA 3F1PA 4KQOA 3E4PA 1N9OA 2OWHA 4RQ9A 3IBRA 3KSFA 3ULFA 1OTBA 5IT5A 4R3AA 3EQUA 2YKHA 3K3DA 4IHQA 3F1OB 3CWFA 3OBFA 3LYXA 2V1AA 4R70A 3KYQA 5TJJA 3GECA 1V9YA 3CUEC 5G4YA 1TD5A 3CLOA 1G6OA 4HIAA 3F1NA 4PKYA 2VA0A 3BQ8A 5F6AA 2MJ6A 1T1AA 2XA7M 1XJ3A 4I39A 4GLQA 2H28A 4NEED 3ZYTA 1OTDA 4JGPA 3DBAA 2W3GA 2VV7A 3EEAA 3MJQA 4Q0JA 1P0ZA 3P7NA 2VJWA 5HWVA 2Y8HA 1V9ZA 2W1TA 2HGVA 4YOFA 5DFXA 2W1RA 4HOIA 1XFQA 4FOFA 2WKQA 4GS9A 4HH3A 4Y2FA 1S66L 2ZBBA 1OTIA 3MFXA 3BQAA 3H82B 4OOLA 1N9NA 4EU0A 3R7WA 3MQOA 2PR6A 4HHDA 4HY8A 1LSWA 5HWTA 5IU1A 2W0NA 3KYZA 4II7A 4Y5FA 4DMZA 2PHYA 3PBSA 1JNUA 4ARZB 2OAP1 3MXQA 1YAXA 2QKPA 2M1CA 1P9RA 4F3LA 5DKKA 3S7NA 2P08A 2A2LA 2XA7S 1ODVA 3PXPA 4CLCE 1S1ZA 3LR4A 2PT7A 4I5SA 2XROA 3RH8B 5HDCA 3LICA 3T4JA 3A0SA 4LLOB 1F9IA 1OT6A 1DP9A 3PBNA 4UEYA 4WN5A 1F98A 5FL3A 1MZUA 3MF0A 4Y3IA 2O9CA 3NOPC 3EQVA 3OCNA 2LB9A 5HD5A 4MCWA 5L8MA 4L0LA 2KDKA 3TRCA 1YKDA 4NXFA 5MC7A 4KQDA 3CAXA 4MMNA 3UE3A 2W3EA 3EGDC 1T19A 1XJ6A 3UMDA 4KUOA 3OOVA 2PYRA 2B18A 3T4TA 1VB6A 1KOUA 2V1BA 1X0OA 3LR3A 2HJ9C 2V0WA 3MQQA 1N9LA 2LB5A 4G3KA 3IS2B 4I3AA 3FPVA 2W27A 2PD7A 2L4RA 1TS8A 3PBTA 3VOLA 4R38A 4L9FA 1NLZA 2QYBA 2VEAA 1W63Q 1S4RA 2JKTM 3OLOA 4DJ2A 3LI8A 3E98A 2VLGA 3FG8A 2VKSA 1UGUA 4HJ6A 4B9OA 1STZA 1MC0A 4DN0A 2G7UA 3KSHA 4EESA 3CUEA 3H7WB 3EOIA 3G6OA 3B47A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LIE A;  2CMN A;  2PYP A;  4LRX C;  3KX0 X;  4JGQ A;  2V9A A;  3BWL A;  3F1O A;  2PDR A;  5F69 A;  4BBT A;  5F68 A;  3MR0 A;  1WA9 A;  3FC7 A;  5HDD A;  4R6L A;  2PD8 A;  1LT0 A;  4WF0 A;  2OOL A;  4JGO A;  3NJA A;  1G28 A;  5HZH A;  4WL9 A;  2I9V A;  1P97 A;  5DJU A;  5A8B A;  5KIZ A;  4HH2 A;  2D01 A;  2J80 A;  2K7S A;  3LI9 A;  4EW7 A;  5HD3 A;  4I38 A;  3ZQ5 A;  4GS9 B;  5I5L A;  4EET B;  3A0V A;  1XJ2 A;  3H82 A;  4EXO A;  4WLA A;  3UB6 A;  2VV8 A;  2ZOI A;  5HWW A;  4EQ1 A;  1BYW A;  4I3I A;  3C8C A;  1LSX A;  3NOU C;  4GHI B;  5F5Y A;  2QJ7 A;  4LRY C;  1T1B A;  2A24 B;  3C2W A;  5J4E A;  3A0R A;  4MN6 A;  2Z6D A;  2Z6C A;  1OJ5 A;  4HI4 A;  4BBV A;  1D7E A;  3VE4 A;  4GCZ A;  2V0U A;  1EW0 A;  5EFW A;  1T18 A;  4MN5 A;  4DJ3 A;  4PKY G;  2QWS A;  2D02 A;  3BY9 A;  3B33 A;  5IS1 A;  1OT9 A;  2INW A;  3GDI A;  3PHY A;  3T50 A;  1S67 L;  4BBU A;  2B02 A;  3IS2 A;  1S1Y A;  4GW9 A;  2ZOH A;  2L1M A;  3LIB A;  4XT2 B;  5AVF A;  5DJT A;  1LL8 A;  5TBM B;  3F1P B;  3E4O A;  5HSQ A;  1DP8 A;  4EEU A;  2YKF A;  3H7W A;  4HP4 A;  3LIF A;  3PYP A;  3RTY A;  1GSX A;  1TS0 A;  3EEH A;  4I3J A;  4HJ3 A;  4M4X A;  3BY8 A;  3UE6 A;  3LID A;  2KX6 A;  1LSV A;  3F1N B;  2R78 A;  4LPZ A;  5DKL A;  1Y28 A;  4NXG A;  1UWN X;  5AVE A;  2EA9 A;  4EER A;  1NWZ A;  4WUJ A;  4LRZ E;  4KUK A;  4NXB A;  5J3W A;  2OWJ A;  1DP6 A;  1TS7 A;  2P7J A;  4HNB A;  3E4Q A;  3EWK A;  2VV6 A;  3HJK A;  2JN7 A;  2QJ5 A;  1XFN A;  3LIA A;  4EEP A;  4E04 A;  3UME A;  4K08 A;  2L0W A;  2QHK A;  1OTE A;  4F3L B;  5G4Z A;  1UWP X;  3LUQ A;  4GHI A;  2HV1 A;  4L9G A;  2A24 A;  4HQA A;  1OTA A;  4NXE A;  3K3C A;  1XJ4 A;  1TS6 A;  2WKP A;  3H9W A;  1T1C A;  2WKR A;  4YWZ A;  3NHQ A;  1DRM A;  3NOT C;  3SW1 A;  3UB9 A;  4HJ4 A;  3VE3 A;  5J7E A;  2BAS A;  1GSV A;  1GSW A;  3UB8 A;  2JHE A;  1D06 A;  1S4S A;  4JGR A;  3D72 A;  2GJ3 A;  4L9E A;  2PR5 A;  3HJI A;  4XT2 A;  3UB7 A;  5HDS A;  5TBM A;  3ICY A;  4HP9 A;  4H6J B;  3F1P A;  3E4P A;  1N9O A;  2OWH A;  4RQ9 A;  3IBR A;  3ULF A;  1OTB A;  4R3A A;  2YKH A;  3K3D A;  3F1O B;  3CWF A;  3LYX A;  2V1A A;  4R70 A;  3GEC A;  1V9Y A;  5G4Y A;  3CLO A;  4HIA A;  3F1N A;  4PKY A;  5F6A A;  1T1A A;  1XJ3 A;  4I39 A;  2H28 A;  1OTD A;  4JGP A;  2VV7 A;  3MJQ A;  1P0Z A;  3P7N A;  5HWV A;  1V9Z A;  4HOI A;  1XFQ A;  2WKQ A;  4GS9 A;  4HH3 A;  1S66 L;  2ZBB A;  1OTI A;  3MFX A;  3H82 B;  1N9N A;  3MQO A;  2PR6 A;  4HHD A;  4HY8 A;  1LSW A;  5HWT A;  5IU1 A;  2W0N A;  2PHY A;  1JNU A;  3MXQ A;  2QKP A;  2M1C A;  4F3L A;  5DKK A;  1ODV A;  1S1Z A;  4I5S A;  3RH8 B;  5HDC A;  3LIC A;  3A0S A;  4LLO B;  1F9I A;  1OT6 A;  1DP9 A;  4WN5 A;  1F98 A;  1MZU A;  3NOP C;  5HD5 A;  2KDK A;  4NXF A;  4KQD A;  3CAX A;  1T19 A;  1XJ6 A;  3UMD A;  4KUO A;  2PYR A;  1VB6 A;  1KOU A;  2V1B A;  1X0O A;  2V0W A;  3MQQ A;  1N9L A;  3IS2 B;  4I3A A;  2W27 A;  2PD7 A;  2L4R A;  1TS8 A;  3VOL A;  4R38 A;  4L9F A;  2VEA A;  1S4R A;  3OLO A;  4DJ2 A;  3LI8 A;  3FG8 A;  2VLG A;  1UGU A;  4HJ6 A;  4B9O A;  4EES A;  3H7W B;  4H6J A;  3G6O A;  1OJG A; 
#chains in the Genus database with same CATH topology
 2CMN A;  3SOI A;  2V9A A;  1TEM A;  2EX2 A;  3F1O A;  4S2P A;  3MR0 A;  1MKM A;  4KZ7 A;  3UPP A;  4A5R A;  3FC7 A;  2PBD P;  5FI6 A;  1YLW A;  1HD8 A;  3UPO A;  4LEN A;  1LT0 A;  4WF0 A;  5EE8 A;  4KZA A;  1G28 A;  1W8Y A;  4N1X A;  3G2Y A;  1P97 A;  5KIZ A;  5HPF A;  4EWF A;  3VV4 A;  4PPR A;  4DE0 A;  3NDE A;  1CQA A;  4GS9 B;  2P04 A;  3ZG8 B;  3UB6 A;  3HL9 A;  4MDZ A;  1MWR A;  3MBZ A;  3HBR A;  1WYB A;  4ZAM A;  4ARZ A;  4IBX A;  3DW0 A;  1W7F A;  4LV1 A;  5GHY A;  4Z1W A;  3P09 A;  4NG2 A;  4LRY C;  1T1B A;  3VP1 A;  1H8Z A;  2Z6D A;  1PYY A;  2ZMV A;  4HI4 A;  3UDX A;  3T1S A;  2Y2H A;  4D60 A;  2J3T D;  3HLW A;  3VOY A;  5DFY A;  2V0U A;  5KSC A;  2B5R A;  2P74 A;  4DJ3 A;  3C4P A;  4MN7 A;  4IUK A;  4E3L A;  2EXA A;  2OLV A;  1ONH A;  3BEC A;  4X53 A;  1ONG A;  1KGF A;  2ZL1 A;  4R1G A;  5DF8 A;  5HAI A;  1OT9 A;  2INW A;  1SDN A;  2ZQ9 A;  3GDI A;  1E4D A;  1C3B A;  3IF6 B;  2FH5 A;  3EGX C;  1KVL A;  4P6Z M;  2B02 A;  2XSS A;  3KO6 A;  4GW9 A;  2L1M A;  4GN2 A;  5AVF A;  5DJT A;  2PAV P;  2XRN A;  5TBM B;  2M7U A;  4Q8I A;  3B3X A;  1K57 A;  2NUT C;  1ALQ A;  3RXW A;  2VX8 A;  1IKG A;  4CLC D;  4UQI M;  4F94 A;  3O5Y A;  4HP4 A;  1IYQ A;  3LIF A;  1LLB A;  4JLF A;  3NC8 A;  3QHY A;  1M40 A;  4FUW A;  3D3O A;  2ZQ7 A;  5KMW A;  3LFV A;  1IOU A;  4Q0I A;  5DKL A;  4P6Z S;  3SZT A;  2X71 A;  5AVE A;  2HDQ A;  1NWZ A;  4X6T A;  2G2U A;  3CI6 A;  3IX3 A;  2R9X A;  2O99 A;  1QME A;  1DP6 A;  3V5M A;  2XK1 A;  4QPR A;  1Q2Q A;  1XX2 A;  1H3Q A;  1PW1 A;  2W3D A;  3NCK A;  3G34 A;  5EVI C;  5CX7 A;  4EQI A;  4FTX A;  2WK0 A;  4CLC A;  1JTG A;  4PMA A;  1FOF A;  4EEP A;  3NDG A;  2X02 A;  3TSG A;  2HDR A;  2IA2 A;  3CG5 A;  1NJ4 A;  4K08 A;  2V8C A;  3NIA A;  3WS2 A;  4Q0H A;  1MWT A;  3G31 A;  1RGZ A;  3P01 A;  1Z6F A;  2VGJ A;  4GHI A;  5A92 A;  2A24 A;  2GX5 A;  4HQA A;  5FAT A;  4NXE A;  4K91 A;  3AGE A;  1H0M A;  1YSQ A;  3CMZ A;  1OPX A;  1T1C A;  2EWW A;  4ZJ1 A;  1H8Y A;  3VSL A;  3NHQ A;  2J8Y A;  3S7O A;  3NOT C;  5GL9 A;  3S22 A;  3RJU A;  2ZM0 A;  3V3R A;  2BAS A;  1GSV A;  1SKO A;  2AVX A;  3AGF A;  1S4S A;  3K2N A;  4LV3 A;  5FI2 A;  3IWO A;  2GJ3 A;  5AQA A;  3S4X A;  3HJI A;  3UB7 A;  1LI0 A;  3C30 A;  4YFM A;  3IXH A;  4HP9 A;  1MKI A;  3LEQ A;  3E4P A;  2WYX A;  4E6X A;  1N9O A;  1KGG A;  4OQI A;  1WE4 A;  1I2S A;  5IT5 A;  5M1A A;  3DWK A;  2XEP A;  2DRW A;  5F82 A;  3BLS A;  1ZKJ A;  5KZH A;  1U60 A;  5TJJ A;  3CUE C;  1V9Y A;  5G4Y A;  1TDL A;  3CLO A;  4HIA A;  2VA0 A;  3BQ8 A;  4KZ9 A;  5F6A A;  2Y2L A;  4UHU A;  2V2F F;  4P6B A;  5EUA A;  5BOH A;  1QMF A;  4X55 A;  2XA7 M;  5EVI A;  2EFX A;  5CGW A;  4R3J A;  3DBA A;  4GDB A;  1P0Z A;  1VM1 A;  2Y8H A;  3TG9 A;  4YOF A;  2W1R A;  2ZBB A;  1PWG A;  4KG6 A;  3H82 B;  4EU0 A;  4P85 A;  3R7W A;  3MQO A;  1FQG A;  3E2K A;  1LSW A;  1M6K A;  3PBS A;  4U0X A;  5CHU A;  1PW8 A;  2QKP A;  3SS3 A;  2M1C A;  4Y7P A;  4C3Q A;  2Q9N A;  4S2O A;  2XA7 S;  3ISG A;  3M6B A;  3C7U A;  3NI9 A;  1D1J A;  5F1G A;  3MXS A;  3LR4 A;  3OPR A;  2JKG A;  2PT7 A;  2H10 A;  1KVM A;  5HDC A;  2C5W B;  3BFG A;  4X69 A;  1DP9 A;  4PM9 A;  1Q2P A;  3E2L A;  3MF0 A;  5CRF A;  3NOP C;  3N6I A;  5FQJ A;  1BLS A;  1PI4 A;  4DDS A;  3ZVT A;  3N8S A;  3VMA A;  5MC7 A;  1N4O A;  3VP3 A;  2JC7 A;  3OOV A;  4JBF A;  3PAG A;  3TOI A;  1K0K A;  1X0O A;  3RXX A;  2V0W A;  3ITB A;  4O7D A;  4G3K A;  4LCM A;  4C6Y A;  1FCO A;  4PM6 A;  2L4R A;  4RVA A;  2WZX A;  4X68 A;  3M2K A;  1ES3 A;  4OKP A;  4Y0U A;  1MC0 A;  3GMW A;  4OOY A;  3CUE A;  3H7W B;  4H6J A;  1V9Z A;  3G6O A;  2IWD A;  3LIE A;  3KX0 X;  4GD6 A;  5EPH A;  2XFS A;  4JGQ A;  4DKI A;  5AQ9 A;  4QY5 A;  2W3H A;  3BWL A;  2WGI A;  4BBT A;  5CER A;  1GHM A;  1EWZ A;  4FH2 A;  3BRM A;  4BD0 A;  1J3W A;  1FR1 A;  3WS0 A;  5FQM A;  4KG5 A;  4NET A;  1VET A;  2I9V A;  5GLB A;  4OQ0 A;  5A8B A;  1YPR A;  2JKR M;  2Y2O A;  2WGW B;  2K7S A;  3CHW P;  1JVJ A;  4DDY A;  4EW7 A;  3UNW A;  1GA9 A;  3A3E A;  4I38 A;  2XDM A;  3HLC A;  5I5L A;  3T1R A;  5FI7 A;  1CF0 A;  3PBR A;  4WLA A;  2ZC4 B;  3QNB A;  3PTE A;  3Q7V A;  4HES A;  5CED A;  3JVU A;  4EQ1 A;  3IF5 A;  4JKT A;  2H5S A;  1CJF A;  1BYW A;  3T4O A;  4MEZ A;  1XXM A;  1LSX A;  3A3D A;  3IXG A;  3MQ0 A;  5J4E A;  3A0R A;  4MN6 A;  4N92 A;  2JKR I;  4JPM A;  4CJN A;  5GLD A;  4LCL A;  2VGK A;  1KE0 A;  4DF6 A;  5CGS A;  4G3V A;  1PI5 A;  2VZW A;  1EW0 A;  4K0W A;  2PBY A;  4E3J A;  1VEU B;  4M3K A;  4G3W A;  4PHT A;  2ZQD A;  1SZV A;  5FAQ A;  1ES2 A;  5CHM A;  3U2A A;  1L0F A;  3T50 A;  4KZ3 A;  3ZG0 A;  2RL3 A;  1Z09 A;  3T4K A;  1S67 L;  4ZJ3 A;  2Y2Q A;  3C7V A;  4OOM A;  3IS2 A;  1AWI A;  3LIB A;  3GQZ A;  4R23 A;  3SH8 A;  3F1P B;  4WEJ A;  3UB5 P;  1MXO A;  3BJN A;  3IF6 C;  1O7E A;  5EM1 A;  4EEU A;  1ZHH B;  4KZ8 A;  3PYP A;  4E3I A;  1K57 C;  4WYY A;  4IBR A;  4ZRR A;  2Y2P A;  1TS0 A;  3EEH A;  4EV4 A;  2C6W B;  4M4X A;  2Y4A A;  4BQM A;  3C38 A;  3S7Q A;  5FA7 A;  2J3T C;  2KX6 A;  2R78 A;  3MSH A;  2M7V A;  4LPZ A;  1GA0 A;  1UWN X;  2Q0O A;  4EER A;  4NXB A;  1KDW A;  2WZZ A;  1CK3 A;  3G35 A;  1XA7 A;  5E43 A;  1I2W A;  4WMC D;  3MS6 A;  4IJG A;  5L10 A;  4IVK A;  3EWK A;  5HL6 A;  4QD4 A;  4BD1 A;  1YT4 A;  4BWI A;  1BUL A;  3LIA A;  3W4O A;  3G4P A;  4DRT A;  5L2F A;  1KE3 A;  3UME A;  5CHJ A;  4CLC C;  2L0W A;  4D2O A;  1OTE A;  1W79 A;  2QZ6 A;  3IT9 A;  3MXR A;  5DF9 A;  1S6R A;  4OPY A;  2FFF B;  1UWP X;  1YQS A;  4BL3 A;  1FSW A;  1YLJ A;  1O07 A;  1BLH A;  1XJ4 A;  1J9M A;  2Y2J A;  4RA7 A;  2WKP A;  1PWD A;  1K6S A;  2BTF P;  3H9W A;  1ERO A;  4O01 A;  4R4R A;  1RGY A;  3SS4 A;  3SW1 A;  1GHI A;  4U0T A;  1GSW A;  2UWX A;  2JHE A;  3CJM A;  3IF6 A;  4X25 A;  1D06 A;  1YM1 A;  3QP8 A;  1DY6 A;  3BLM A;  3LY3 A;  4LV2 A;  1BT5 A;  4Y0T A;  2OLU A;  1ERM A;  4O0P A;  2PU2 A;  2XR0 A;  5TBM A;  4KQO A;  3KSF A;  3OZH A;  1OTB A;  3UN7 A;  4Z9Q A;  3EQU A;  4IVI A;  3K3D A;  4IHQ A;  3ZNT A;  4DE3 A;  3OBF A;  1IYS A;  1E3U D;  4OPZ A;  3WRZ A;  1K38 A;  1SKF A;  3HUO A;  1TD5 A;  1G6O A;  1WYC A;  3ZVW A;  1T1A A;  3ZDJ A;  4KZB A;  1XJ3 A;  4NEE D;  3MZD A;  1XA1 A;  3ZYT A;  1OTD A;  3QP2 A;  3IHB A;  2VV7 A;  4S2N C;  5DFX A;  2V1Z A;  1XFQ A;  4FOF A;  3BYD A;  2Y91 A;  4QB8 A;  4BL2 A;  2XQZ A;  4QHC A;  3BFC A;  5FAP A;  1K55 A;  5GLC A;  2E8I A;  1YAX A;  1P9R A;  1W8Q A;  2J9O A;  1ZG4 A;  2P08 A;  5JYP A;  2A2L A;  2WGV A;  2P9V B;  4PM8 A;  1ESU A;  2Y2N A;  1S1Z A;  1S0W A;  3RH8 B;  4OLG A;  4E3N A;  5A90 A;  1K4E A;  3T4J A;  2ZLY A;  3A0S A;  4LLO B;  3IQA A;  1OT6 A;  4H8R A;  4UEY A;  4WN5 A;  5A91 A;  2Y55 A;  1MZU A;  4Y3I A;  2O9C A;  3EQV A;  4MCW A;  2KDK A;  1YKD A;  1PZP A;  2FFY A;  5DTK A;  2ZD8 A;  3CAX A;  4PM7 A;  3GSG A;  4MMN A;  3UE3 A;  3UMD A;  3WRT A;  4KUO A;  2PYR A;  1KOU A;  3NUL A;  3LR3 A;  3IH9 A;  2JE5 A;  4I3A A;  4XXR A;  3VOL A;  1JWV A;  1NLZ A;  4N9L A;  2JKT M;  3LI8 A;  3FG8 A;  2VLG A;  4FD8 A;  2Y2I A;  4B9O A;  4E6W A;  1K4F A;  3UY6 A;  5CEB A;  1NZU A;  4Y0O A;  1TVF A;  2RCX A;  2XH9 A;  1XGJ A;  4IED A;  2PYP A;  4LRX C;  1PNE A;  1KE4 A;  4E3K A;  3W8K A;  4XUZ A;  2ZMF A;  1FCM A;  4B93 A;  1YMS A;  1Y4O A;  2PU4 A;  5F69 A;  3LR0 A;  4LV0 A;  4S2N A;  2PD8 A;  2HZ5 A;  1FIK A;  2Z2L B;  3IHA A;  2JKT I;  2GDN A;  3O88 A;  2XGN A;  3N8R A;  5HZH A;  5EEC A;  5TGF A;  4OVD A;  5DJU A;  3ZHH A;  4HH2 A;  1MWS A;  5CTN A;  4KZ4 A;  2PRF A;  3LCE A;  3LI9 A;  4HBT A;  1JWZ A;  5HD3 A;  3FZC A;  1NRJ A;  3LR5 A;  3A0V A;  3H82 A;  3HRE A;  5AQ7 A;  3T4L A;  4EXO A;  2VV8 A;  3CPT A;  2ZOI A;  1ES4 A;  1BZA A;  5HPI A;  1HTZ A;  4E3M A;  4I3I A;  1ESI A;  3SS5 A;  3NEC A;  3NOU C;  1LI9 A;  2QJ7 A;  2A49 A;  1CEF A;  3FPW A;  4CQH A;  2O9A A;  4WEK A;  4BBV A;  1F5M A;  1YLY A;  1D7E A;  3I7J A;  3ZCZ A;  4B4Z A;  3OC2 A;  2DCF A;  3VE4 A;  1W63 M;  1P9W A;  4ETX A;  5EFW A;  4MN5 A;  1CEG A;  3UE1 A;  3VSK A;  4FCF A;  4PKY G;  3GV9 A;  2J3W A;  3HUN A;  2WUQ A;  2EXB A;  3BY9 A;  5FDS A;  5IS1 A;  4EUV A;  3PHY A;  3HLD A;  4BBU A;  4XT2 B;  3ITA A;  5D3O A;  5AJG A;  4WM9 A;  3A3F A;  3E4O A;  4GD8 A;  1RP5 A;  2EX6 A;  1F2K A;  2YKF A;  3H7W A;  3BW6 A;  3RTY A;  4JXV A;  2OAQ 1;  1TDG A;  1G68 A;  3V3S A;  4HJ3 A;  3PR6 A;  3UE6 A;  1MBL A;  3LID A;  3F1N B;  3DTM A;  4OH0 A;  2ZC3 B;  4JF6 A;  3FWL A;  1Y28 A;  3FV7 A;  3VP2 A;  4NXG A;  3LO7 A;  2ZM8 A;  2KOI A;  3MZF A;  5GHZ A;  4LRZ E;  3D4F A;  3HLB A;  5HAQ A;  5CEC A;  2WAE A;  4UA6 A;  1IKI A;  2OWJ A;  4O8G A;  2W1T B;  1TS7 A;  3OCL A;  4RX2 A;  4EBN A;  3VOZ A;  2GNX A;  3E4Q A;  2E8J A;  3ZGA B;  3Q7Z A;  2WGW A;  2Y59 A;  5E2F A;  4KQQ A;  3KSG A;  2G2W A;  4JXW A;  2JN7 A;  2QJ5 A;  1XFN A;  4UA9 A;  4WEL A;  2CC1 A;  3HLF A;  1YLZ A;  1IYO A;  3ZG5 A;  3MMH A;  4IUH A;  2QHK A;  4F3L B;  4GDN A;  3IX4 A;  3TW8 A;  1NZO A;  2HF6 A;  2H0Y A;  4PAU A;  1DJC A;  1G6A A;  5TR7 A;  4S2L A;  3W2Z A;  3B42 A;  3TJZ C;  1L0D A;  3ZG7 B;  3FKV A;  3JPU A;  4NK3 A;  3IX8 A;  2O0Y A;  5CGX A;  5FEF A;  5C5K A;  4QY6 A;  2WKR A;  4OQG A;  1IEM A;  4YWZ A;  3VP4 A;  1N9B A;  2K31 A;  1MWU A;  4AFI A;  1XGI A;  3VE3 A;  1VHM A;  1KDS A;  4MBK A;  5J7E A;  3WWX A;  4ETZ A;  3IH8 A;  4MLL A;  1TF1 A;  2XLN A;  2XF3 A;  2HJE A;  2IWB A;  4QU3 A;  3E0Y A;  4WBG A;  2Y79 A;  3KYE A;  4BJP A;  2PR5 A;  3T4S A;  4BEN A;  1JTD A;  3ICY A;  2EWV A;  3F1P A;  4ZBE A;  2HDS A;  3ULF A;  3G2Z A;  1LHY A;  3T1Q B;  4R3A A;  1FIL A;  3F1O B;  2HP9 A;  3CWF A;  4N1H A;  4R70 A;  4CPK A;  3GEC A;  2JKF A;  5AQB A;  4OQH A;  5F83 A;  2MJ6 A;  4GLQ A;  3ZFZ A;  4PM5 A;  1MPL A;  3BFE A;  5DF7 A;  4DXB A;  3P7N A;  2VJW A;  1FCN A;  4JF5 A;  3VP0 A;  3NY4 A;  1PFL A;  2WKE A;  3GTC A;  4GS9 A;  4HH3 A;  5GLA A;  3MFX A;  1IYP A;  2EX9 A;  5U47 A;  4OOL A;  1N9N A;  1GHP A;  2JCH A;  4JXG A;  4LGW A;  1PZO A;  2ZC5 B;  4N9K A;  2PR6 A;  2V20 A;  3A3J A;  4HY8 A;  5HWT A;  1SDE A;  2W0N A;  2Z2M B;  1NYY A;  3KYZ A;  1MY8 A;  4II7 A;  2PHY A;  3HVF A;  4ARZ B;  3MXQ A;  4WZ5 C;  4U3T A;  5DKK A;  3S7N A;  3QP6 A;  1K55 C;  4KG2 A;  4GKU A;  3WS1 A;  5FQI A;  1LL5 A;  4Y13 A;  4CLC E;  4OP5 A;  3QP1 A;  4X1L A;  4I5S A;  3LIC A;  4GNU A;  3QP5 A;  4S2J A;  3LGO A;  4WMC A;  4HEF A;  1F9I A;  3PBN A;  2ZMA A;  5FL3 A;  1L0E A;  4X56 A;  3OCN A;  2LB9 A;  5HD5 A;  4L0L A;  5HL1 A;  4NXF A;  4KQD A;  2W3E A;  4UA7 A;  2ZL1 B;  4EBP A;  3T4T A;  2DNS A;  2WAF A;  3O87 A;  3WS4 A;  1HLU P;  3SH9 A;  5I94 A;  3MQQ A;  1N9L A;  4KQR A;  4OON A;  1BLP A;  2JBF A;  3FPV A;  4DE2 A;  1TS8 A;  5HX9 A;  1XKZ A;  4L9F A;  4JF4 A;  2QYB A;  2VEA A;  1W63 Q;  4DJ2 A;  3E98 A;  4HJ6 A;  3VFF A;  1STZ A;  4DN0 A;  2G7U A;  3BM6 A;  3KSH A;  4EES A;  3B47 A;  1OJG A;  3Q07 A;  3C4O A;  5DTT A;  2EFU A;  2Q9M A;  4OPQ A;  3HLG A;  4BLM A;  2PDR A;  5F68 A;  1AXB A;  1WA9 A;  5CXW A;  5F1F A;  5HDD A;  4R6L A;  4EUZ A;  3DWZ A;  1XPB A;  2A3U A;  2OOL A;  4JGO A;  3NJA A;  4WL9 A;  5IHV A;  3DAV A;  1CI8 A;  4OLD A;  5HW3 A;  5M19 A;  2D01 A;  4OPR A;  3T4Q A;  1L0G A;  2J80 A;  4ME4 A;  3OPL A;  3FYZ A;  4WZ5 A;  4CLC B;  4UQI S;  3ZQ5 A;  5EOO A;  1VQQ A;  3V67 A;  5E2E A;  4EET B;  1XJ2 A;  1H8M A;  1ZTU A;  1EI5 A;  3MZE A;  3S1Y A;  5HWW A;  1NLY A;  3L9K A;  1E3U A;  5L09 A;  2DMW A;  4RYE A;  3C8C A;  1K54 C;  2VK3 A;  4GHI B;  4GOG A;  3O86 A;  5F5Y A;  2P9V A;  3PBQ A;  2A24 B;  3C2W A;  3CIT A;  1CI9 A;  2Z6C A;  1OJ5 A;  3M2J A;  1BTL A;  1DJB A;  5FQQ A;  3UPN A;  5EV0 A;  4GCZ A;  4KZ5 A;  3DTK A;  1T18 A;  3S7P A;  5E2H A;  5DVA A;  1NXY A;  2QWS A;  2WAD A;  2J9P A;  2IWC A;  1IFQ A;  3VFH A;  2ZC7 A;  2BLS A;  3N4I A;  4KEN B;  2D02 A;  2KLI A;  3B33 A;  4FH4 A;  3KSI A;  1SKO B;  4ZTK A;  4P0M A;  4DE1 A;  4GB7 A;  4S2I A;  3LEZ A;  4UAA A;  4Y15 A;  4GJ4 A;  3T1X A;  5EVI D;  1W5D A;  3QNC A;  1Y54 A;  4R0Q A;  4YIN A;  4B88 A;  1S1Y A;  2ZOH A;  5FAS A;  5FAO A;  5HAP A;  4R3B A;  1GCE A;  2VGL M;  2NUP C;  1ERQ A;  4MNR A;  1LL8 A;  2GZA A;  2W3F A;  2J7V A;  5HSQ A;  2WKH A;  1FSY A;  3HCY A;  3OPH A;  1DP8 A;  3IXB A;  3DTE A;  1I5Q A;  3W4P A;  4S2K A;  5LBR A;  4E3O A;  1GSX A;  3N8L A;  4I3J A;  5FEG A;  3BY8 A;  3MKE A;  5EVE A;  1K56 D;  3V39 A;  4ZDX A;  3TE8 A;  1LSV A;  2ZC6 B;  2ZQA A;  3MFD A;  2QMI A;  5EVI B;  2EA9 A;  1K25 A;  1YSP A;  4WUJ A;  2V8F A;  4KUK A;  5J3W A;  4BMW A;  2HDU A;  2VGL S;  3AGD A;  2ZJ9 A;  4R4S A;  4S2M A;  5KSH A;  5FDH A;  3PBO A;  2P7J A;  3W4Q A;  4HNB A;  4QWO A;  2B95 A;  4FSF A;  2VV6 A;  3JYI A;  3HJK A;  3UDF A;  1PIO A;  2FZ0 A;  5FQK A;  3R7W B;  2ZQC A;  2XFT A;  4YNR A;  1K54 A;  4WZ4 A;  4NKP A;  2X01 A;  4E04 A;  1XP4 A;  1L2S A;  3CPT B;  5G4Z A;  1K56 A;  3RFB A;  3O3V A;  1YLT A;  4B4X A;  2HP5 A;  2K2N A;  3R4K A;  3LUQ A;  4MBF A;  1NYM A;  2HV1 A;  4L9G A;  2O9B A;  1OTA A;  3K3C A;  1SCW A;  1IEL A;  5K5B A;  1TS6 A;  1KGE A;  3ZNY A;  3HUM A;  1JWP A;  3P98 A;  3JVV A;  1DRM A;  3IBJ A;  5EOE A;  4MBH A;  3NBL A;  3UB9 A;  3DTI A;  4HJ4 A;  1NY0 A;  3BFD A;  3LY4 A;  5HAR A;  3GR2 A;  3WS5 A;  3UB8 A;  1HZO A;  1OME A;  3Q1F A;  4JGR A;  3D72 A;  4L9E A;  3A3I A;  2WKI A;  4C75 A;  4XT2 A;  3T12 B;  5HDS A;  1BLC A;  2QPN A;  4H6J B;  3Q82 A;  3UE0 A;  5JYO A;  2H0T A;  2OWH A;  4RQ9 A;  3IBR A;  2XD1 A;  3QP4 A;  4ID4 A;  2OV5 A;  5FQ9 A;  4RX3 A;  3UO9 A;  2YKH A;  1DJA A;  3N7W A;  3LYX A;  2V1A A;  3KYQ A;  4DXC A;  5DTS A;  3GVB A;  3L7H A;  4P87 A;  3MKF A;  3F1N A;  5M18 A;  4PKY A;  2I72 A;  2ZQ8 A;  4KZ6 A;  4I39 A;  2H28 A;  3SH7 A;  4JGP A;  1VET B;  1ZC2 A;  2W3G A;  3PAE A;  3U4L P;  3BFF A;  2R9W A;  3EEA A;  3MJQ A;  4Q0J A;  5E2G A;  1PRQ A;  5EVL A;  5HWV A;  4GZB A;  2W1T A;  2HGV A;  5CTM A;  1A0K A;  2HPB A;  4HOI A;  5GHX A;  2WKQ A;  4Y2F A;  1S66 L;  1YLP A;  1OTI A;  1SHV A;  2BG1 A;  1K6R A;  3D9Y A;  3ZG9 B;  3BQA A;  3HLE A;  2UV0 E;  1LL9 A;  3Q7V B;  4HHD A;  3Q81 A;  1RCJ A;  4EBL A;  5IU1 A;  3G32 A;  4Y5F A;  4DMZ A;  1JNU A;  2OAP 1;  4XUX A;  4K0X A;  4F3L A;  4X1M A;  3GRJ A;  2ACG A;  2Y2G A;  1HVB A;  2EX8 A;  3IWI A;  4ZJ2 A;  1ODV A;  3PXP A;  3C5A A;  1ZG6 A;  2Y2M A;  5TFQ A;  2XRO A;  2HP6 A;  1L3L A;  3CZD A;  1F98 A;  2ZM2 A;  4JXS A;  2XD5 A;  5L8M A;  1VEU A;  3TRC A;  1G5U A;  1PWC A;  1NRF A;  2OSU A;  3EGD C;  1T19 A;  1XJ6 A;  2Y2K A;  2B18 A;  4QJG A;  5FSR A;  5HFO A;  1VB6 A;  5J8X A;  2V1B A;  1ACF A;  5G18 A;  4Y17 A;  3OPP A;  4HBU A;  5A93 A;  2HJ9 C;  1FR6 A;  1ES5 A;  5L07 A;  2LB5 A;  4OP8 A;  3IS2 B;  4ESP A;  3IWQ A;  2W27 A;  2PD7 A;  5EM0 A;  1BUE A;  3PBT A;  1BSG A;  1YMX A;  4R38 A;  3FKW A;  3IXD A;  1H5X A;  1S4R A;  1E25 A;  3OLO A;  2VKS A;  3UDI A;  1UGU A;  3BEB A;  4LFU A;  3G30 A;  3EOI A;  3V50 A;  3M6H A; 
#chains in the Genus database with same CATH homology
 3LIE A;  2CMN A;  2PYP A;  4LRX C;  3KX0 X;  4JGQ A;  2V9A A;  2W3H A;  3BWL A;  2ZMF A;  3F1O A;  2PDR A;  4B93 A;  5F69 A;  4BBT A;  5F68 A;  3MR0 A;  1MKM A;  3LR0 A;  1WA9 A;  3FC7 A;  5HDD A;  4R6L A;  2PD8 A;  1LT0 A;  2JKT I;  4WF0 A;  2OOL A;  4JGO A;  3NJA A;  1G28 A;  5HZH A;  4WL9 A;  2I9V A;  1P97 A;  5DJU A;  5A8B A;  5KIZ A;  4HH2 A;  5HPF A;  2D01 A;  2JKR M;  3VV4 A;  3T4Q A;  2J80 A;  2K7S A;  4ME4 A;  3LI9 A;  4EW7 A;  5HD3 A;  4CLC B;  4UQI S;  4I38 A;  3ZQ5 A;  4GS9 B;  5I5L A;  3V67 A;  1NRJ A;  4EET B;  3LR5 A;  2P04 A;  3A0V A;  1XJ2 A;  3H82 A;  3T4L A;  1H8M A;  4EXO A;  3PBR A;  4WLA A;  1ZTU A;  3UB6 A;  2VV8 A;  2ZOI A;  4MDZ A;  5HWW A;  1NLY A;  5HPI A;  3JVU A;  4EQ1 A;  2DMW A;  4ARZ A;  1BYW A;  4I3I A;  3T4O A;  3C8C A;  1LSX A;  4Z1W A;  3NOU C;  4GHI B;  5F5Y A;  2QJ7 A;  3MQ0 A;  3PBQ A;  4LRY C;  1T1B A;  2A24 B;  3C2W A;  5J4E A;  3A0R A;  3CIT A;  4MN6 A;  3FPW A;  2Z6D A;  2JKR I;  2Z6C A;  4CQH A;  2O9A A;  4WEK A;  1OJ5 A;  2ZMV A;  4HI4 A;  4BBV A;  1F5M A;  1D7E A;  3OC2 A;  2J3T D;  4G3V A;  3VE4 A;  4GCZ A;  1W63 M;  5DFY A;  2VZW A;  2V0U A;  1P9W A;  1EW0 A;  4ETX A;  5EFW A;  1T18 A;  3S7P A;  4MN5 A;  4DJ3 A;  4MN7 A;  4IUK A;  2QWS A;  4PKY G;  4G3W A;  2J3W A;  1IFQ A;  4PHT A;  2D02 A;  2KLI A;  3BY9 A;  3B33 A;  3KSI A;  5IS1 A;  1OT9 A;  2INW A;  4EUV A;  3U2A A;  3GDI A;  3PHY A;  3T50 A;  2FH5 A;  3EGX C;  3T4K A;  1S67 L;  4BBU A;  4GJ4 A;  4P6Z M;  2B02 A;  4OOM A;  2XSS A;  3IS2 A;  3KO6 A;  1S1Y A;  4GW9 A;  2ZOH A;  2L1M A;  3LIB A;  4XT2 B;  5AVF A;  5DJT A;  2VGL M;  2XRN A;  2NUP C;  5AJG A;  1LL8 A;  5TBM B;  2M7U A;  3F1P B;  3E4O A;  4WEJ A;  2NUT C;  2VX8 A;  2GZA A;  2W3F A;  5HSQ A;  4CLC D;  3BJN A;  3HCY A;  4UQI M;  1DP8 A;  4EEU A;  2YKF A;  3O5Y A;  1ZHH B;  3BW6 A;  3H7W A;  3LIF A;  3PYP A;  4HP4 A;  5LBR A;  2OAQ 1;  3RTY A;  4ZRR A;  1GSX A;  1TS0 A;  3EEH A;  4I3J A;  4HJ3 A;  4M4X A;  3BY8 A;  3PR6 A;  3C38 A;  3S7Q A;  3UE6 A;  2J3T C;  3D3O A;  3LID A;  2KX6 A;  3TE8 A;  1LSV A;  3F1N B;  2R78 A;  3LFV A;  2M7V A;  4LPZ A;  1IOU A;  4Q0I A;  5DKL A;  1Y28 A;  4P6Z S;  4NXG A;  1UWN X;  5AVE A;  2EA9 A;  4EER A;  2KOI A;  1YSP A;  1NWZ A;  4WUJ A;  4LRZ E;  3CI6 A;  4KUK A;  4NXB A;  5J3W A;  4BMW A;  2VGL S;  2OWJ A;  4O8G A;  2O99 A;  5KSH A;  1DP6 A;  2W1T B;  1TS7 A;  3OCL A;  3PBO A;  2P7J A;  4QPR A;  4HNB A;  2GNX A;  3E4Q A;  4IJG A;  5HL6 A;  1H3Q A;  3EWK A;  4FSF A;  2VV6 A;  3HJK A;  2W3D A;  4BWI A;  5CX7 A;  2FZ0 A;  3KSG A;  3R7W B;  2JN7 A;  2QJ5 A;  4CLC A;  1XFN A;  4YNR A;  3LIA A;  4WEL A;  4NKP A;  4EEP A;  4E04 A;  2IA2 A;  3UME A;  4K08 A;  3MMH A;  2L0W A;  4IUH A;  4CLC C;  2QHK A;  1OTE A;  4F3L B;  4Q0H A;  5G4Z A;  3RFB A;  5DF9 A;  3TW8 A;  2K2N A;  2HF6 A;  3R4K A;  1UWP X;  3LUQ A;  3P01 A;  4GHI A;  2HV1 A;  4PAU A;  4L9G A;  2O9B A;  2A24 A;  2GX5 A;  4HQA A;  3B42 A;  3TJZ C;  3W2Z A;  1OTA A;  4NXE A;  3K3C A;  1XJ4 A;  1YSQ A;  5K5B A;  1TS6 A;  2O0Y A;  2WKP A;  3H9W A;  5C5K A;  4O01 A;  1OPX A;  1T1C A;  2EWW A;  3JVV A;  2WKR A;  4YWZ A;  3NHQ A;  1DRM A;  3IBJ A;  3S7O A;  3NOT C;  2K31 A;  3SW1 A;  3UB9 A;  1OJG A;  4HJ4 A;  4AFI A;  3VE3 A;  1VHM A;  5J7E A;  2BAS A;  4ETZ A;  1GSV A;  1GSW A;  1TF1 A;  3UB8 A;  2JHE A;  1D06 A;  1S4S A;  2HJE A;  3K2N A;  4JGR A;  3D72 A;  2GJ3 A;  4L9E A;  3E0Y A;  2Y79 A;  4BJP A;  2PR5 A;  4H6J A;  3T4S A;  3HJI A;  4XT2 A;  3UB7 A;  5HDS A;  4O0P A;  3C30 A;  5TBM A;  3ICY A;  4HP9 A;  4H6J B;  2EWV A;  3F1P A;  4KQO A;  3E4P A;  1N9O A;  2OWH A;  4RQ9 A;  3IBR A;  3KSF A;  3ULF A;  1OTB A;  5IT5 A;  4R3A A;  3EQU A;  2YKH A;  3K3D A;  4IHQ A;  3F1O B;  3CWF A;  3OBF A;  3LYX A;  2V1A A;  4R70 A;  3KYQ A;  5TJJ A;  3GEC A;  1V9Y A;  3CUE C;  5G4Y A;  1TD5 A;  3CLO A;  1G6O A;  4HIA A;  3F1N A;  4PKY A;  2VA0 A;  3BQ8 A;  5F6A A;  2MJ6 A;  1T1A A;  2XA7 M;  1XJ3 A;  4I39 A;  4GLQ A;  2H28 A;  4NEE D;  3ZYT A;  1OTD A;  4JGP A;  3DBA A;  2W3G A;  2VV7 A;  3EEA A;  3MJQ A;  4Q0J A;  1P0Z A;  3P7N A;  2VJW A;  5HWV A;  2Y8H A;  1V9Z A;  2W1T A;  2HGV A;  4YOF A;  5DFX A;  2W1R A;  4HOI A;  1XFQ A;  4FOF A;  2WKQ A;  4GS9 A;  4HH3 A;  4Y2F A;  1S66 L;  2ZBB A;  1OTI A;  3MFX A;  3BQA A;  3H82 B;  4OOL A;  1N9N A;  4EU0 A;  3R7W A;  3MQO A;  2PR6 A;  4HHD A;  4HY8 A;  1LSW A;  5HWT A;  5IU1 A;  2W0N A;  3KYZ A;  4II7 A;  4Y5F A;  4DMZ A;  2PHY A;  3PBS A;  1JNU A;  4ARZ B;  2OAP 1;  3MXQ A;  1YAX A;  2QKP A;  2M1C A;  1P9R A;  4F3L A;  5DKK A;  3S7N A;  2P08 A;  2A2L A;  2XA7 S;  1ODV A;  3PXP A;  4CLC E;  1S1Z A;  3LR4 A;  2PT7 A;  4I5S A;  2XRO A;  3RH8 B;  5HDC A;  3LIC A;  3T4J A;  3A0S A;  4LLO B;  1F9I A;  1OT6 A;  1DP9 A;  3PBN A;  4UEY A;  4WN5 A;  1F98 A;  5FL3 A;  1MZU A;  3MF0 A;  4Y3I A;  2O9C A;  3NOP C;  3EQV A;  3OCN A;  2LB9 A;  5HD5 A;  4MCW A;  5L8M A;  4L0L A;  2KDK A;  3TRC A;  1YKD A;  4NXF A;  5MC7 A;  4KQD A;  3CAX A;  4MMN A;  3UE3 A;  2W3E A;  3EGD C;  1T19 A;  1XJ6 A;  3UMD A;  4KUO A;  3OOV A;  2PYR A;  2B18 A;  3T4T A;  1VB6 A;  1KOU A;  2V1B A;  1X0O A;  3LR3 A;  2HJ9 C;  2V0W A;  3MQQ A;  1N9L A;  2LB5 A;  4G3K A;  3IS2 B;  4I3A A;  3FPV A;  2W27 A;  2PD7 A;  2L4R A;  1TS8 A;  3PBT A;  3VOL A;  4R38 A;  4L9F A;  1NLZ A;  2QYB A;  2VEA A;  1W63 Q;  1S4R A;  2JKT M;  3OLO A;  4DJ2 A;  3LI8 A;  3E98 A;  2VLG A;  3FG8 A;  2VKS A;  1UGU A;  4HJ6 A;  4B9O A;  1STZ A;  1MC0 A;  4DN0 A;  2G7U A;  3KSH A;  4EES A;  3CUE A;  3H7W B;  3EOI A;  3G6O A;  3B47 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...