4PKYG

Arnt/hif transcription factor/coactivator complex
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
106
structure length
100
Chain Sequence
LDSKTFLSEHSMDMKFTYCDDRITELIGYHPEELLGRSAYEFYHALDSENMTKSHQNLCTKGQVVSGQYRMLAKHGGYVWLETQGTVIYNQCIMCVNYVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Aryl hydrocarbon receptor nuclear translocator
publication title Coiled-coil Coactivators Play a Structural Role Mediating Interactions in Hypoxia-inducible Factor Heterodimerization.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/cell cycle
total genus 26
structure length 100
sequence length 106
ec nomenclature
pdb deposition date 2014-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF08447 PAS_3 PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4pkyG00
4M4XA 1OTIA 5G4ZA 3F1OB 2PHYA 3K3DA 3LIAA 3NOTC 3MFXA 4HP9A 4GCZA 4I3AA 3BWLA 1F9IA 1XJ4A 1S1ZA 2JHEA 1DP6A 3PHYA 4XT2B 5F68A 5IS1A 3E4PA 5I5LA 2L4RA 4EERA 1OTEA 3EEHA 2V1AA 1D06A 2YKHA 1XJ2A 4KQDA 2INWA 2R78A 3PYPA 3LICA 2B02A 5DJUA 2VEAA 5G4YA 5HSQA 2ZOHA 5J7EA 4HJ4A 1DP8A 4RQ9A 5HDDA 4I39A 3SW1A 3A0VA 1T1CA 1TS7A 3C2WA 1TS6A 1LSXA 1N9LA 3CWFA 2V0UA 3F1PB 3RH8B 3HJIA 5DKKA 3UB7A 2PD7A 1KOUA 4MN6A 4F3LB 3MQQA 3MJQA 3MXQA 4K08A 4JGOA 3G6OA 2VV7A 1D7EA 2H28A 2VV6A 1OJGA 1N9OA 1GSVA 2QHKA 5DJTA 1V9ZA 1OTBA 4PKYA 5F6AA 2V1BA 1T1BA 3BY9A 1TS0A 2WKRA 4KUOA 3IBRA 4WLAA 2QWSA 4HY8A 1OTDA 3LIFA 3MR0A 5HD5A 4HJ3A 1UGUA 2A24A 2HV1A 4LRZE 1GSWA 4GS9B 4HNBA 3LIDA 2ZOIA 5TBMB 4R6LA 4GHIA 2W27A 5F69A 3F1NB 3H7WA 4H6JB 5KIZA 4R3AA 4NXGA 3IS2B 3VE4A 2KDKA 3F1OA 1WA9A 3T50A 1V9YA 1T19A 5J4EA 2PYRA 3K3CA 1VB6A 3NHQA 5IU1A 1UWNX 4EEUA 1LSWA 3KX0X 4JGQA 4HH3A 5HD3A 4EETB 4XT2A 3BY8A 4LRXC 2VV8A 1S4SA 4R38A 4R70A 2YKFA 3A0RA 3UE6A 3NJAA 4B9OA 4HP4A 1DP9A 4L9FA 1P97A 2BASA 4I5SA 2JN7A 4I38A 3CLOA 5AVEA 5AVFA 1ODVA 2QJ5A 2QJ7A 5A8BA 1Y28A 3F1PA 4F3LA 1TS8A 2Z6CA 2VLGA 1XFQA 2W0NA 4HJ6A 1G28A 4EEPA 2WKPA 3B33A 3ICYA 3E4QA 2P7JA 5EFWA 3H82B 2WKQA 2OWHA 4YWZA 1OTAA 2EA9A 1F98A 4L9EA 4EQ1A 3VE3A 4HI4A 4HH2A 4E04A 4WF0A 3GECA 4LRYC 2D01A 3RTYA 4I3JA 2V9AA 2OWJA 3FG8A 1UWPX 2PYPA 2M1CA 1LL8A 2I9VA 4EW7A 4NXEA 1MZUA 3UB9A 1S1YA 5HDSA 4JGPA 3E4OA 2CMNA 4GS9A 2KX6A 3HJKA 3VOLA 2PR5A 5TBMA 1OT6A 4HIAA 2V0WA 5J3WA 3C8CA 2GJ3A 5HWTA 3F1NA 3LUQA 4DJ2A 1LT0A 1XJ6A 4H6JA 3GDIA 4MN5A 3NOPC 3IS2A 2Z6DA 2OOLA 4LPZA 4HHDA 4EESA 4I3IA 3D72A 4LLOB 2L1MA 5HDCA 1EW0A 4HQAA 2ZBBA 3OLOA 4L9GA 3UB8A 4NXFA 4WL9A 2QKPA 3P7NA 2D02A 1S4RA 2J80A 2PR6A 1S67L 1GSXA 1DRMA 3EWKA 1NWZA 4JGRA 5HZHA 3A0SA 3LIBA 1LSVA 1OJ5A 2PD8A 4BBVA 4NXBA 4PKYG 3H9WA 4BBUA 3LI9A 1P0ZA 1S66L 1T1AA 3UB6A 1OT9A 1XJ3A 3ULFA 5F5YA 4GW9A 4HOIA 1N9NA 2A24B 2L0WA 3ZQ5A 3CAXA 3LYXA 3LI8A 4BBTA 1T18A 3NOUC 1BYWA 3MQOA 2PDRA 5HWVA 1JNUA 5HWWA 4DJ3A 4KUKA 4EXOA 3UMEA 4GHIB 3H82A 4WN5A 1X0OA 3UMDA 1XFNA 3H7WB 2K7SA 4WUJA 3FC7A 5DKLA 3LIEA
chains in the Genus database with same CATH superfamily
2HF6A 1OTIA 3SH7A 5CTNA 1O07A 1IFQA 5G4ZA 1H0MA 1TDLA 4QU3A 3K3DA 4H8RA 3NOTC 2R9XA 2Y91A 5EPHA 3MFXA 1FSYA 3PR6A 5L09A 3TRCA 2WKIA 2FFFB 3MXSA 2JHEA 3UB5P 4ETZA 2ZM0A 2OLVA 4XT2B 4GKUA 2WKEA 4S2NC 1SHVA 4UA6A 1G6AA 4D2OA 2OV5A 4ARZB 4DE2A 2OSUA 3LICA 4GJ4A 1D1JA 3PBRA 4DE1A 2VEAA 5HSQA 4YINA 2ZOHA 5F1FA 4X6TA 3DW0A 4UEYA 4I39A 1L0DA 3SW1A 3T4QA 3EEAA 1CK3A 4LCMA 4U0XA 5DFYA 1TS7A 1FR1A 4KZAA 1LSXA 3SH8A 4N1HA 2G2UA 1YSQA 3A3JA 4QB8A 2O9AA 5CEBA 3FV7A 3HREA 3HLFA 3HUMA 1L2SA 4MN7A 5KMWA 1K55A 4K08A 2ZQDA 4X1MA 4R4RA 1OPXA 5FQJA 3G32A 2VV6A 1OJGA 5L10A 2XGNA 1SCWA 3M6BA 2V1BA 3UE0A 5F83A 3KYQA 4JXSA 2HDSA 4OQ0A 3BY9A 3BLMA 2W1TA 1KDWA 1TS0A 2ZL1B 1L0FA 1E3UA 2VX8A 5A90A 1MWTA 2QWSA 1JWPA 4Y7PA 1HVBA 3IWOA 1IYQA 4RYEA 3MXRA 3D4FA 4OPZA 3LIFA 3MR0A 1VETB 4Y2FA 2ACGA 3D3OA 2ZQCA 4QHCA 4CLCD 1DJAA 4JF4A 2JKRI 3G30A 4OPYA 1K55C 3KO6A 2M7VA 3HLWA 4LRZE 1DY6A 2Y2IA 2ZJ9A 4XUZA 4WMCD 4S2KA 5L8MA 1G6OA 2OAP1 1GHMA 2JC7A 2DRWA 4PM8A 5EVIB 4OPRA 4DMZA 3VSLA 3HLCA 4BD1A 3C4OA 4NK3A 3F1NB 3W4OA 3OPLA 4R3AA 3DAVA 3FZCA 3IS2B 4EU0A 5FI2A 2KDKA 4IBRA 1V9YA 1RP5A 4OOMA 1XX2A 1VB6A 2H10A 3EGXC 1UWNX 1YPRA 4OLDA 5DFXA 1LSWA 4WEJA 4JGQA 4MNRA 2J7VA 2HJ9C 2DNSA 3P01A 4XT2A 1K6SA 2E8JA 4OKPA 1IYOA 1PZOA 5F1GA 5FQIA 3S7OA 3W8KA 1S4SA 3VOYA 2FZ0A 1CEFA 4ARZA 4ETXA 3EGDC 2YKFA 2QZ6A 2Y2OA 3A0RA 4S2LA 3KYZA 3O87A 1P97A 1XA7A 3DBAA 1BLCA 2Y2JA 4L0LA 3T1XA 1ZC2A 5AVFA 3OCNA 4FH2A 2QJ5A 2RCXA 3Q07A 2V2FF 3RJUA 3WS1A 4FTXA 3G31A 1YLJA 5A92A 2VLGA 1K25A 1VM1A 1XFQA 1W5DA 4S2OA 4E6XA 3PBQA 4EEPA 3PTEA 1Q2QA 3ICYA 2P74A 4XXRA 3E4QA 3VP0A 1HLUP 5EFWA 3G2ZA 1YLWA 1CI9A 1ZG6A 4CPKA 2K31A 2WKQA 1RGYA 5GLBA 5GLCA 1OTAA 3ZVTA 2ZL1A 5CERA 3ITBA 4KZ3A 4X53A 4YFMA 2Y59A 3HCYA 2UV0E 3QHYA 4UAAA 4E04A 4CLCE 1ES4A 3VP4A 1VETA 4IVIA 2V9AA 3OPPA 3FG8A 1XPBA 2PYPA 2M1CA 5FQKA 3IF6C 4EW7A 4NXEA 3W4PA 5KSHA 2GZAA 3EOIA 4DDYA 4G3WA 2ZC4B 2KX6A 3K2NA 3JVUA 4Y15A 1S6RA 2XR0A 3HJKA 4G3VA 3VOLA 2IWBA 1Y54A 2PR5A 1OT6A 3QP2A 4IVKA 5EVIA 4HIAA 1ZKJA 5G18A 2WADA 2A49A 1MWUA 2XA7S 3F1NA 3LUQA 5HX9A 4JF5A 1G68A 3T4JA 3SS5A 3IS2A 3T1QB 2Z6DA 1KGFA 2WGWB 4HHDA 4LLOB 1EW0A 3HVFA 1IEMA 3OLOA 5M18A 3O3VA 1ONGA 3NCKA 4CLCC 2J80A 5EM1A 2PR6A 2WK0A 2A3UA 4P0MA 4OONA 1J9MA 1DRMA 1NWZA 5FI7A 4JGRA 1G5UA 4E3KA 1H8ZA 4HBUA 3LIBA 1LSVA 1OJ5A 5FI6A 3ZYTA 5BOHA 1QMFA 3QP4A 3LCEA 4NXBA 1PIOA 1NLZA 1XP4A 4PKYG 4BBUA 2AVXA 3PAEA 3DTIA 1NYMA 3CUEA 2ZMAA 3ZHHA 3OC2A 3Q81A 4LV3A 4Q0JA 1PW1A 4ZTKA 1T1AA 3UB6A 4PM9A 4B4ZA 4IUHA 3BLSA 5TJJA 1NZOA 3LEZA 5F5YA 1W79A 4HOIA 2L0WA 4RVAA 3JVVA 5EVLA 3TSGA 3WRTA 5D3OA 4PPRA 1BYWA 1JVJA 1ES2A 4LENA 4PMAA 1JNUA 4GD8A 2B18A 1C3BA 4OPQA 2G2WA 1K54A 4GB7A 4II7A 1VHMA 2XK1A 3C7UA 4WN5A 4MCWA 3I7JA 1XFNA 3UMDA 1DJCA 1DJBA 2J9PA 3HUOA 2WAEA 3T4LA 3M2JA 3UDFA 4K0XA 3LIEA 4M4XA 1CQAA 3G4PA 2W3GA 2J3WA 4RX2A 3F1OB 2PHYA 3GTCA 3LIAA 4GOGA 3T4KA 1JTDA 4I3AA 2HP5A 3BWLA 2ZQ7A 3V67A 1DP6A 3PHYA 5CTMA 1NRFA 3IWQA 3C38A 4F94A 3LY4A 1W7FA 3TOIA 5F68A 5IS1A 3IXGA 1FSWA 1L0EA 2PRFA 4R0QA 1K54C 4EERA 3ZG0A 2RL3A 2Q9MA 2V1AA 1VQQA 4KQDA 1W63Q 5E43A 3PYPA 1TVFA 5DJUA 5EOOA 3GVBA 3Q7ZA 4OQHA 2HDRA 4HJ4A 4RQ9A 2WGWA 1IKIA 1T1CA 1YQSA 2EX2A 4BENA 4ZBEA 3HUNA 3C2WA 4WEKA 4NETA 1RGZA 3CWFA 5CHUA 2V0UA 3HJIA 3UB7A 1CEGA 4KZ5A 4F3LB 4FUWA 4PM6A 3IXBA 1ZHHB 4BJPA 1GSVA 2QHKA 5DJTA 5AQAA 1V9ZA 5E2FA 1HD8A 3DTKA 5F6AA 3UE1A 3AGFA 5EUAA 2WKRA 4UA7A 4KZ7A 1STZA 4Y13A 2PAVP 3IHAA 2JKTM 5EECA 1OTDA 3NULA 1YAXA 3PXPA 1UGUA 3MQ0A 3A3FA 3MBZA 4N1XA 1K4EA 1GSWA 2EX9A 2EX8A 3Q1FA 5EV0A 3IH9A 3GQZA 2EWWA 2JKFA 1F2KA 3SOIA 4MBKA 3LIDA 2ZOIA 5E2HA 3LR5A 4R6LA 1PW8A 1SDEA 1HTZA 2ZMFA 3NECA 4GDBA 4E3MA 2IWCA 1PRQA 2C6WB 4H6JB 4OP5A 3AGEA 4NXGA 3VE4A 4CJNA 4X25A 4FOFA 3U4LP 5FQ9A 1BULA 3CMZA 3F1OA 4M3KA 3CPTB 3VSKA 1MWSA 4OQGA 4DN0A 4QWOA 5AQBA 5GLDA 1LI0A 2BG1A 2HJEA 4X56A 5IU1A 1PWDA 1NY0A 1I2SA 3DWZA 3KX0X 3IBJA 2LB9A 2DCFA 2H5SA 3BM6A 4LRXC 2P9VA 2VV8A 1L3LA 2PT7A 1CJFA 4OP8A 3UE6A 3SS4A 4LV0A 2JN7A 5HPIA 2QPNA 5GHZA 4IEDA 1PWGA 2ZC5B 3CLOA 2P04A 4GZBA 3EQVA 3VMAA 4KQQA 2EXAA 3OZHA 5HARA 4O0PA 5A8BA 3CJMA 1O7EA 4ZAMA 3EQUA 1J3WA 5DF9A 4F3LA 1TS8A 3B42A 3PBSA 2Z6CA 2WUQA 1GHIA 1W8QA 4HBTA 1KVLA 3ZG9B 5CECA 1WYBA 4IBXA 3QP1A 1MXOA 4HJ6A 3P09A 3B33A 4BWIA 2WGIA 5HAIA 3TW8A 3KSGA 3BECA 3ZCZA 5EM0A 3ZG5A 4MLLA 4PM5A 2Y2HA 4ZJ1A 4Y0TA 3O5YA 3HLBA 4YWZA 2EA9A 4EQ1A 4P87A 5U47A 3JYIA 3VP3A 4ME4A 4LRYC 2XRNA 3A3EA 4ZJ3A 2A2LA 3MZDA 3CZDA 5EVID 3QP5A 3LR3A 1BLPA 2I9VA 1ES3A 2W1RA 3S7QA 1PWCA 2C5WB 5FAOA 5GHXA 4JGPA 1BLHA 1MWRA 3E4OA 1SKFA 3N7WA 1M6KA 2Y55A 4KZ4A 3UN7A 4DXCA 1MY8A 1PYYA 2XDMA 2QMIA 2W3FA 4Q0IA 3UE3A 1K56D 2GJ3A 3E0YA 3C7VA 4H6JA 5HL6A 4MN5A 5KZHA 4O7DA 3N8RA 4KZ8A 3D72A 3CPTA 4FSFA 2L1MA 4MBFA 2ZBBA 4L9GA 3VV4A 1QMEA 4BLMA 4P6ZS 4S2IA 5LBRA 2W3DA 1KE3A 5HAQA 4JXGA 2PU2A 4N9KA 1S4RA 4KG5A 1IYSA 4DE0A 1S67L 1EI5A 3MSHA 4FD8A 1ERQA 3EWKA 5HW3A 3A0SA 3LFVA 2FFYA 1YKDA 1U60A 5FL3A 2GX5A 3LI9A 1TEMA 1S66L 1KGEA 5HL1A 3S4XA 2VGKA 1XJ3A 3ULFA 1OMEA 1FCOA 4GW9A 1N9NA 2A24B 1E4DA 3ZQ5A 3LI8A 4BBTA 3BEBA 3BRMA 3MQOA 3T4TA 2EXBA 2ZC7A 4DJ3A 4B4XA 3NIAA 4EXOA 3UMEA 3ZFZA 4R3BA 3PBTA 4DF6A 1H8YA 1X0OA 3H7WB 2K7SA 2XLNA 5CHJA 1BUEA 1S0WA 1CF0A 3MKFA 4RA7A 4MBHA 3IF5A 3ITAA 4K91A 1F9IA 1S1ZA 4X55A 1AWIA 3BQ8A 3QP8A 4P6ZM 4R23A 3OBFA 2Z2LB 2ZC6B 2NUPC 4X68A 2G7UA 4E6WA 1EWZA 3KSHA 2L4RA 1TD5A 1W8YA 1ZTUA 1OTEA 3EEHA 1P9WA 2YKHA 1XJ2A 2ZD8A 2INWA 2JCHA 1K56A 2ZM8A 2O9BA 2ZMVA 1DP8A 4QPRA 5HDDA 5GLAA 4WM9A 3SH9A 3A0VA 4Y17A 5DTTA 5EVIC 1GHPA 1NRJA 4O01A 2VZWA 2XEPA 1WYCA 3JPUA 3F1PB 2PD7A 2B95A 5DF8A 3MQQA 4CQHA 2JBFA 4YOFA 4JGOA 2VV7A 2H28A 4EUZA 3PBOA 1FQGA 4R1GA 4PKYA 1JWVA 1ZG4A 3Q82A 1LHYA 3FPWA 2CC1A 3T1SA 3ISGA 4JPMA 1T1BA 3BJNA 3OOVA 1WE4A 5GHYA 3CHWP 4KUOA 3HBRA 3IBRA 4JXVA 3IXDA 3SS3A 4MDZA 1K57A 2ZLYA 3WS2A 5E2EA 1K0KA 3TG9A 4WZ4A 4HJ3A 5FDSA 3T4SA 3R7WB 2A24A 2EWVA 4BL2A 3LR0A 4UQIS 2M7UA 3E98A 4PM7A 1P9RA 5EVEA 3UY6A 3CUEC 3W4QA 4GS9B 2OAQ1 4GD6A 5K5BA 3R4KA 2QYBA 4WZ5A 4BD0A 2ZQAA 1PI4A 1ESIA 3WS4A 2XD5A 3H7WA 3IXHA 5AQ9A 4Y0OA 1MKIA 2BTFP 4KQRA 3OCLA 5EE8A 2P9VB 4YNRA 2PYRA 4DRTA 3K3CA 4JBFA 5CX7A 1H3QA 4OOLA 5FEGA 4EEUA 3FKWA 3HLGA 4EBLA 4HH3A 5HD3A 4D60A 1VEUB 1XGIA 1ERMA 4R38A 1XXMA 4R70A 2JKTI 3HLEA 3NJAA 3ZDJA 4JLFA 4L9FA 4KQOA 3VFFA 1LI9A 1XKZA 4I38A 5IT5A 3VOZA 5AVEA 1ODVA 3IX4A 3S7NA 2VJWA 3T1RA 3F1PA 5F82A 1H5XA 4EBNA 4UQIM 3ZG8B 4K0WA 4BL3A 3RFBA 4EWFA 2Y4AA 3ZNTA 5A91A 1ESUA 2ZQ8A 3QNBA 4OLGA 4GNUA 2W0NA 1L0GA 2EX6A 1KE4A 3MS6A 2WKHA 3CG5A 2P7JA 3HLDA 4NEED 3H82B 3LEQA 2JE5A 3W2ZA 3KSFA 1BTLA 1K4FA 5M1AA 3VE3A 2PBDP 4HI4A 2V1ZA 3FPVA 4HH2A 2PU4A 5CGSA 2W3EA 2XFTA 1SZVA 4S2NA 2D01A 5HFOA 4S2PA 3RTYA 4NG2A 2OWJA 3R7WA 1UWPX 2VGLS 4EUVA 1LL8A 2Y2PA 1S1YA 2X71A 4OVDA 4IHQA 5TFQA 4GS9A 2B5RA 1JWZA 4FCFA 3Q7VB 5J8XA 1HZOA 2ZM2A 1ALQA 4JXWA 3IHBA 5J3WA 3C8CA 5HWTA 4DJ2A 1XJ6A 4G3KA 1W63M 1YMXA 1GA9A 2KLIA 3G34A 4KG2A 5CRFA 3LGOA 4U0TA 1NZUA 1BLSA 3UDIA 4I3IA 2XSSA 3E2LA 1MC0A 4HQAA 3IQAA 1IKGA 3UB8A 3UDXA 4DKIA 4WL9A 3CI6A 2D02A 3V5MA 3A3IA 5FATA 1VEUA 4UA9A 3IX3A 2MJ6A 3V3SA 3NI9A 2V8CA 4Z9QA 4KZBA 5E2GA 1LL5A 1AXBA 3FWLA 1KGGA 3QP6A 3IF6B 2PD8A 4BBVA 1YT4A 5M19A 3H9WA 5EOEA 1P0ZA 2HP9A 3IT9A 1OT9A 3N6IA 4GN2A 3T12B 3U2AA 2VGLM 4A5RA 3NY4A 3UPNA 4QJGA 3BFFA 2H0YA 2VK3A 3WS5A 3OPRA 2PDRA 1H8MA 3NDEA 3M6HA 5HWWA 2V8FA 3BYDA 3AGDA 1NYYA 4GHIB 4P85A 3H82A 1A0KA 1FR6A 4BQMA 1XA1A 3HL9A 4CLCB 1EROA 3FC7A 5DKLA 4JF6A 1ES5A 3PAGA 4OH0A 3VP1A 3LR4A 4GLQA 2BLSA 4HP9A 5DF7A 4GCZA 1XJ4A 5GL9A 1IYPA 3WS0A 4ESPA 4HESA 2GNXA 5L07A 1XGJA 5C5KA 2EFXA 1RCJA 2R9WA 1MKMA 2XD1A 4EBPA 2JKGA 3E4PA 5I5LA 5FAQA 4DXBA 1KDSA 3Q7VA 2JKRM 4C6YA 2XH9A 1YLPA 1D06A 2W3HA 4IUKA 4UHUA 1TDGA 2R78A 5FQQA 4NKPA 2B02A 1FCMA 5G4YA 2HGVA 5J7EA 2ZQ9A 3NC8A 1CI8A 5KSCA 5L2FA 4B88A 2PBYA 3WWXA 3UPPA 1TS6A 4R4SA 3VP2A 1N9LA 4X1LA 3RH8B 5DKKA 5TGFA 3BFCA 4KG6A 3NBLA 3LO7A 1KOUA 3FYZA 4MN6A 3MJQA 2Y2NA 3DWKA 3MXQA 2J3TD 3NDGA 1SKOB 4OQIA 2Y2LA 3G6OA 5FA7A 1KE0A 1D7EA 1N9OA 4LV1A 4C75A 1OTBA 4Y0UA 2X02A 3L9KA 5FEFA 4E3LA 4Q0HA 4S2JA 4Y3IA 3TJZC 1NLYA 3IF6A 1F5MA 5CXWA 1PFLA 4HEFA 1BZAA 4WLAA 2XROA 4HY8A 3GSGA 2Y2QA 4E3NA 2WGVA 1IELA 4PAUA 3S1YA 3L7HA 4P6BA 3ZVWA 3BW6A 5HD5A 3ZG7B 5FDHA 3OPHA 4DE3A 1N9BA 2HV1A 2LB5A 1K6RA 4U3TA 1BSGA 3V3RA 2XF3A 5FQMA 3UPOA 1E25A 1YLYA 4HNBA 5AJGA 5TBMB 5CGWA 5FAPA 4LFUA 4GHIA 4LCLA 2W27A 4E3JA 5F69A 4X69A 4ZDXA 5KIZA 4CLCA 4AFIA 2VKSA 2FH5A 3N8LA 1LLBA 4WMCA 1WA9A 3T50A 1T19A 3BQAA 5CGXA 2ZC3B 3RXXA 5J4EA 2OLUA 1SDNA 3VFHA 3NHQA 5JYPA 4R3JA 3O86A 1GA0A 1I2WA 3MZEA 5AQ7A 4EETB 1YSPA 3MKEA 3BY8A 5FASA 3MFDA 3B47A 1IOUA 2Y2MA 3IH8A 1FIKA 4B9OA 4WYYA 4HP4A 1DP9A 3GV9A 2J8YA 2BASA 4O8GA 4I5SA 3G2YA 3BFEA 3C4PA 4WELA 2Y2KA 1FILA 3GRJA 3DTEA 3V50A 1Z09A 2Q0OA 2O99A 3S22A 1NJ4A 4Z1WA 4MMNA 2QJ7A 3DTMA 4BMWA 1Y28A 4N92A 3BFDA 1I5QA 4Y5FA 5DVAA 5FSRA 1MPLA 1SKOA 3PBNA 3ZGAB 5CHMA 1G28A 4E3IA 3G35A 4GDNA 2WKPA 2WAFA 5IHVA 1YM1A 5CEDA 5DTKA 1BT5A 4XUXA 2OWHA 3P98A 3M2KA 4N9LA 2WYXA 1F98A 2XFSA 2XQZA 4L9EA 4ID4A 2VA0A 3IWIA 1ACFA 1YLZA 3S7PA 3C30A 4WF0A 4QY6A 2Y79A 3GECA 4ZJ2A 1FOFA 3D9YA 4I3JA 5HPFA 2I72A 2Z2MB 3A3DA 4LGWA 3CITA 3MF0A 4KZ6A 3E2KA 2XA7M 3UNWA 1MZUA 3UB9A 4MEZA 1NXYA 5HDSA 4KZ9A 2J3TC 1K57C 2CMNA 5JYOA 3KSIA 2DMWA 3BFGA 4IJGA 4B93A 5TBMA 3WRZA 2V0WA 3GMWA 1Z6FA 1FCNA 5A93A 1TF1A 3IX8A 2HZ5A 1LT0A 2GDNA 1M40A 4S2MA 5I94A 3GDIA 2K2NA 1PZPA 3NOPC 3ZNYA 1K38A 5TR7A 2Y2GA 2OOLA 4LPZA 4PHTA 1YLTA 4EESA 1PI5A 4KENB 5HDCA 4WZ5C 3LY3A 2IWDA 4E3OA 2KOIA 4NXFA 5DTSA 2EFUA 2QKPA 2E8IA 3P7NA 2HP6A 4EQIA 2NUTC 2Y8HA 1MBLA 4JKTA 4WBGA 1N4OA 1GSXA 1Q2PA 4OOYA 3B3XA 1LL9A 5HZHA 3N4IA 3FKVA 4QD4A 1GCEA 2W1TB 1E3UD 1KVMA 2WZXA 2WZZA 3C5AA 2HDQA 2IA2A 3UO9A 5HAPA 3QNCA 4Q8IA 2P08A 3MMHA 5MC7A 1Y4OA 4QY5A 3V39A 4FH4A 4ZRRA 3CAXA 3LYXA 4DDSA 1YMSA 3N8SA 3RXWA 2HPBA 1T18A 2V20A 3O88A 3GR2A 2UWXA 3NOUC 2J9OA 4EV4A 1PNEA 3TE8A 2O0YA 3SZTA 3MZFA 5HWVA 2HDUA 1JTGA 4KUKA 4LV2A 2O9CA 4RX3A 2X01A 4C3QA 3KYEA 1ONHA 2VGJA 3T4OA 2Q9NA 4WUJA 2H0TA
chains in the Genus database with same CATH topology
4M4XA 2HF6A 1OTIA 2W3GA 1IFQA 2J3WA 3F1OB 5G4ZA 2PHYA 3K3DA 3LIAA 3LR4A 3NOTC 4GLQA 3MFXA 4HP9A 3T4KA 4GCZA 4I3AA 3BWLA 3PR6A 3TRCA 3V67A 1F9IA 1XJ4A 1S1ZA 2JHEA 1DP6A 3BQ8A 4P6ZM 3PHYA 4ETZA 3OBFA 3C38A 2GNXA 5C5KA 4XT2B 2NUPC 5F68A 5IS1A 1MKMA 3E4PA 2G7UA 5I5LA 3KSHA 2L4RA 1TD5A 2JKRM 1ZTUA 4EERA 1OTEA 4ARZB 3EEHA 1P9WA 2V1AA 1D06A 2W3HA 2YKHA 4IUKA 1XJ2A 4KQDA 1W63Q 2INWA 2R78A 3PYPA 3LICA 4GJ4A 2O9BA 4NKPA 2B02A 3PBRA 5DJUA 2VEAA 5G4YA 5HSQA 2HGVA 2ZMVA 2ZOHA 5J7EA 4HJ4A 1DP8A 4RQ9A 4QPRA 4UEYA 5HDDA 4I39A 3SW1A 3T4QA 3EEAA 3A0VA 1T1CA 5DFYA 1TS7A 3C2WA 1TS6A 4WEKA 1NRJA 1LSXA 1N9LA 3CWFA 4O01A 2VZWA 2V0UA 3F1PB 3RH8B 1YSQA 3HJIA 5DKKA 3UB7A 2O9AA 2PD7A 1KOUA 4MN6A 4F3LB 3MQQA 3MJQA 3MXQA 4CQHA 2J3TD 4MN7A 4K08A 4JGOA 4YOFA 3G6OA 1OPXA 2VV7A 1D7EA 1ZHHB 2H28A 2VV6A 1OJGA 1N9OA 4BJPA 3PBOA 1GSVA 2QHKA 5DJTA 1V9ZA 1OTBA 4PKYA 5F6AA 2V1BA 3FPWA 3KYQA 4Q0HA 1T1BA 3BJNA 3OOVA 3BY9A 2W1TA 4Y3IA 1TS0A 2WKRA 3TJZC 4KUOA 1NLYA 3IBRA 1F5MA 2VX8A 1STZA 4WLAA 2QWSA 2XROA 4HY8A 4MDZA 2JKTM 4PAUA 1OTDA 3LIFA 3MR0A 3BW6A 5HD5A 4HJ3A 3T4SA 1YAXA 3R7WB 3PXPA 1UGUA 4Y2FA 2A24A 2EWVA 3MQ0A 3LR0A 4UQIS 2M7UA 3D3OA 3E98A 4CLCD 2HV1A 2JKRI 1P9RA 3KO6A 2LB5A 3CUEC 2M7VA 4LRZE 1GSWA 4GS9B 5L8MA 1G6OA 2OAQ1 2EWWA 2OAP1 5K5BA 4HNBA 3LIDA 2ZOIA 5AJGA 5TBMB 3R4KA 3LR5A 4R6LA 4DMZA 2QYBA 4GHIA 2W27A 2ZMFA 5F69A 3F1NB 3H7WA 4H6JB 5KIZA 4R3AA 4CLCA 4NXGA 4AFIA 3IS2B 3VE4A 2VKSA 4FOFA 4EU0A 2FH5A 2KDKA 3F1OA 3OCLA 1WA9A 3T50A 1V9YA 4OOMA 1T19A 3BQAA 5J4EA 4YNRA 4DN0A 2PYRA 3K3CA 5CX7A 1VB6A 3NHQA 2HJEA 1H3QA 3EGXC 4OOLA 5IU1A 1UWNX 4EEUA 5DFXA 1LSWA 3KX0X 4WEJA 4JGQA 4HH3A 3IBJA 5HD3A 2LB9A 4EETB 1YSPA 2HJ9C 3P01A 4XT2A 3BY8A 4LRXC 3B47A 2VV8A 3S7OA 1S4SA 2FZ0A 4R38A 1IOUA 4ARZA 4ETXA 2PT7A 3EGDC 4R70A 2YKFA 3A0RA 3UE6A 2JKTI 3NJAA 4B9OA 3KYZA 4HP4A 1DP9A 4L9FA 4KQOA 1P97A 2BASA 4O8GA 3DBAA 2JN7A 4I5SA 5HPIA 4WELA 4I38A 4L0LA 5IT5A 3CLOA 5AVEA 2P04A 5AVFA 3OCNA 3EQVA 2O99A 1ODVA 2QJ5A 4Z1WA 4MMNA 2QJ7A 3S7NA 5A8BA 2VJWA 4O0PA 4BMWA 1Y28A 3F1PA 3EQUA 4UQIM 5DF9A 4F3LA 1TS8A 3B42A 3PBSA 2Z6CA 4Y5FA 2VLGA 3RFBA 1XFQA 3PBNA 2W0NA 3PBQA 4HJ6A 1G28A 4EEPA 2WKPA 3B33A 3ICYA 4BWIA 3E4QA 3KSGA 3TW8A 2P7JA 5EFWA 4NEED 3H82B 2K31A 2WKQA 3O5YA 2OWHA 4YWZA 1OTAA 2EA9A 3W2ZA 1F98A 4L9EA 4EQ1A 3KSFA 2VA0A 3VE3A 4HI4A 3HCYA 3FPVA 4HH2A 3S7PA 4E04A 4ME4A 3C30A 2W3EA 4WF0A 2Y79A 3GECA 4LRYC 2D01A 2XRNA 4CLCE 2A2LA 3RTYA 4I3JA 5HPFA 2V9AA 2OWJA 3FG8A 3R7WA 3LR3A 1UWPX 2VGLS 2PYPA 2M1CA 3CITA 4EUVA 1LL8A 2I9VA 3MF0A 2XA7M 4EW7A 4NXEA 1MZUA 3UB9A 1S1YA 5HDSA 2W1RA 3S7QA 5KSHA 2GZAA 2J3TC 3EOIA 4IHQA 4JGPA 3E4OA 4G3WA 2CMNA 4GS9A 3KSIA 2DMWA 4IJGA 2KX6A 3K2NA 3JVUA 4B93A 3HJKA 4G3VA 3VOLA 2PR5A 5TBMA 2W3FA 1OT6A 4HIAA 2V0WA 4Q0IA 3UE3A 1TF1A 5J3WA 2XA7S 2GJ3A 3C8CA 3F1NA 3LUQA 5HWTA 4DJ2A 3E0YA 1LT0A 1XJ6A 4G3KA 1W63M 4H6JA 3GDIA 2K2NA 4MN5A 5HL6A 3T4JA 2KLIA 3IS2A 3NOPC 2Z6DA 2OOLA 4LPZA 4HHDA 4PHTA 4EESA 4I3IA 3D72A 4LLOB 4FSFA 2XSSA 2L1MA 5HDCA 1EW0A 1MC0A 4HQAA 2ZBBA 3OLOA 4L9GA 3VV4A 4P6ZS 2KOIA 3UB8A 5LBRA 2W3DA 4NXFA 4WL9A 2QKPA 4CLCC 3CI6A 3P7NA 2NUTC 2D02A 1S4RA 2J80A 2PR6A 2Y8HA 1S67L 2MJ6A 1GSXA 1DRMA 3EWKA 1NWZA 4JGRA 5HZHA 3A0SA 3LIBA 3LFVA 1LSVA 1OJ5A 2W1TB 1YKDA 3ZYTA 2PD8A 4BBVA 4NXBA 1NLZA 5FL3A 4PKYG 2GX5A 3H9WA 4BBUA 2IA2A 3CUEA 3LI9A 1P0ZA 1S66L 3OC2A 2P08A 4Q0JA 3MMHA 1T1AA 3UB6A 5MC7A 4IUHA 1OT9A 5TJJA 1XJ3A 3ULFA 5F5YA 4GW9A 4HOIA 4ZRRA 1N9NA 2A24B 2L0WA 3CAXA 3LYXA 3ZQ5A 3LI8A 4BBTA 3U2AA 3JVVA 2VGLM 1T18A 3NOUC 1BYWA 3MQOA 3TE8A 2O0YA 2PDRA 3T4TA 5HWVA 1H8MA 1JNUA 2B18A 5HWWA 4DJ3A 4KUKA 4EXOA 4II7A 2O9CA 3UMEA 1VHMA 4GHIB 3H82A 3PBTA 4WN5A 4MCWA 1X0OA 3H7WB 1XFNA 3UMDA 2K7SA 3T4OA 4CLCB 4WUJA 3FC7A 5DKLA 3T4LA 3LIEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4M4X A;  1OTI A;  5G4Z A;  3F1O B;  2PHY A;  3K3D A;  3LIA A;  3NOT C;  3MFX A;  4HP9 A;  4GCZ A;  4I3A A;  3BWL A;  1F9I A;  1XJ4 A;  1S1Z A;  2JHE A;  1DP6 A;  3PHY A;  4XT2 B;  5F68 A;  5IS1 A;  3E4P A;  5I5L A;  2L4R A;  4EER A;  1OTE A;  3EEH A;  2V1A A;  1D06 A;  2YKH A;  1XJ2 A;  4KQD A;  2INW A;  2R78 A;  3PYP A;  3LIC A;  2B02 A;  5DJU A;  2VEA A;  5G4Y A;  5HSQ A;  2ZOH A;  5J7E A;  4HJ4 A;  1DP8 A;  4RQ9 A;  5HDD A;  4I39 A;  3SW1 A;  3A0V A;  1T1C A;  1TS7 A;  3C2W A;  1TS6 A;  1LSX A;  1N9L A;  3CWF A;  2V0U A;  3F1P B;  3RH8 B;  3HJI A;  5DKK A;  3UB7 A;  2PD7 A;  1KOU A;  4MN6 A;  4F3L B;  3MQQ A;  3MJQ A;  3MXQ A;  4K08 A;  4JGO A;  3G6O A;  2VV7 A;  1D7E A;  2H28 A;  2VV6 A;  1OJG A;  1N9O A;  1GSV A;  2QHK A;  5DJT A;  1V9Z A;  1OTB A;  4PKY A;  5F6A A;  2V1B A;  1T1B A;  3BY9 A;  1TS0 A;  2WKR A;  4KUO A;  3IBR A;  4WLA A;  2QWS A;  4HY8 A;  1OTD A;  3LIF A;  3MR0 A;  5HD5 A;  4HJ3 A;  1UGU A;  2A24 A;  2HV1 A;  4LRZ E;  1GSW A;  4GS9 B;  4HNB A;  3LID A;  2ZOI A;  5TBM B;  4R6L A;  4GHI A;  2W27 A;  5F69 A;  3F1N B;  3H7W A;  4H6J B;  5KIZ A;  4R3A A;  4NXG A;  3IS2 B;  3VE4 A;  2KDK A;  3F1O A;  1WA9 A;  3T50 A;  1V9Y A;  1T19 A;  5J4E A;  2PYR A;  3K3C A;  1VB6 A;  3NHQ A;  5IU1 A;  1UWN X;  4EEU A;  1LSW A;  3KX0 X;  4JGQ A;  4HH3 A;  5HD3 A;  4EET B;  4XT2 A;  3BY8 A;  4LRX C;  2VV8 A;  1S4S A;  4R38 A;  4R70 A;  2YKF A;  3A0R A;  3UE6 A;  3NJA A;  4B9O A;  4HP4 A;  1DP9 A;  4L9F A;  1P97 A;  2BAS A;  4I5S A;  2JN7 A;  4I38 A;  3CLO A;  5AVE A;  5AVF A;  1ODV A;  2QJ5 A;  2QJ7 A;  5A8B A;  1Y28 A;  3F1P A;  4F3L A;  1TS8 A;  2Z6C A;  2VLG A;  1XFQ A;  2W0N A;  4HJ6 A;  1G28 A;  4EEP A;  2WKP A;  3B33 A;  3ICY A;  3E4Q A;  2P7J A;  5EFW A;  3H82 B;  2WKQ A;  2OWH A;  4YWZ A;  1OTA A;  2EA9 A;  1F98 A;  4L9E A;  4EQ1 A;  3VE3 A;  4HI4 A;  4HH2 A;  4E04 A;  4WF0 A;  3GEC A;  4LRY C;  2D01 A;  3RTY A;  4I3J A;  2V9A A;  2OWJ A;  3FG8 A;  1UWP X;  2PYP A;  2M1C A;  1LL8 A;  2I9V A;  4EW7 A;  4NXE A;  1MZU A;  3UB9 A;  1S1Y A;  5HDS A;  4JGP A;  3E4O A;  2CMN A;  4GS9 A;  2KX6 A;  3HJK A;  3VOL A;  2PR5 A;  5TBM A;  1OT6 A;  4HIA A;  2V0W A;  5J3W A;  3C8C A;  2GJ3 A;  5HWT A;  3F1N A;  3LUQ A;  4DJ2 A;  1LT0 A;  1XJ6 A;  4H6J A;  3GDI A;  4MN5 A;  3NOP C;  3IS2 A;  2Z6D A;  2OOL A;  4LPZ A;  4HHD A;  4EES A;  4I3I A;  3D72 A;  4LLO B;  2L1M A;  5HDC A;  1EW0 A;  4HQA A;  2ZBB A;  3OLO A;  4L9G A;  3UB8 A;  4NXF A;  4WL9 A;  2QKP A;  3P7N A;  2D02 A;  1S4R A;  2J80 A;  2PR6 A;  1S67 L;  1GSX A;  1DRM A;  3EWK A;  1NWZ A;  4JGR A;  5HZH A;  3A0S A;  3LIB A;  1LSV A;  1OJ5 A;  2PD8 A;  4BBV A;  4NXB A;  4PKY G;  3H9W A;  4BBU A;  3LI9 A;  1P0Z A;  1S66 L;  1T1A A;  3UB6 A;  1OT9 A;  1XJ3 A;  3ULF A;  5F5Y A;  4GW9 A;  4HOI A;  1N9N A;  2A24 B;  2L0W A;  3ZQ5 A;  3CAX A;  3LYX A;  3LI8 A;  4BBT A;  1T18 A;  3NOU C;  1BYW A;  3MQO A;  2PDR A;  5HWV A;  1JNU A;  5HWW A;  4DJ3 A;  4KUK A;  4EXO A;  3UME A;  4GHI B;  3H82 A;  4WN5 A;  1X0O A;  3UMD A;  1XFN A;  3H7W B;  2K7S A;  4WUJ A;  3FC7 A;  5DKL A;  3LIE A; 
#chains in the Genus database with same CATH topology
 2HF6 A;  1OTI A;  3SH7 A;  5CTN A;  1O07 A;  1IFQ A;  5G4Z A;  1H0M A;  1TDL A;  4QU3 A;  3K3D A;  4H8R A;  3NOT C;  2R9X A;  2Y91 A;  5EPH A;  3MFX A;  1FSY A;  3PR6 A;  5L09 A;  3TRC A;  2WKI A;  2FFF B;  3MXS A;  2JHE A;  3UB5 P;  4ETZ A;  2ZM0 A;  2OLV A;  4XT2 B;  4GKU A;  2WKE A;  4S2N C;  1SHV A;  4UA6 A;  1G6A A;  4D2O A;  2OV5 A;  4ARZ B;  4DE2 A;  2OSU A;  3LIC A;  4GJ4 A;  1D1J A;  3PBR A;  4DE1 A;  2VEA A;  5HSQ A;  4YIN A;  2ZOH A;  5F1F A;  4X6T A;  3DW0 A;  4UEY A;  4I39 A;  1L0D A;  3SW1 A;  3T4Q A;  3EEA A;  1CK3 A;  4LCM A;  4U0X A;  5DFY A;  1TS7 A;  1FR1 A;  4KZA A;  1LSX A;  3SH8 A;  4N1H A;  2G2U A;  1YSQ A;  3A3J A;  4QB8 A;  2O9A A;  5CEB A;  3FV7 A;  3HRE A;  3HLF A;  3HUM A;  1L2S A;  4MN7 A;  5KMW A;  1K55 A;  4K08 A;  2ZQD A;  4X1M A;  4R4R A;  1OPX A;  5FQJ A;  3G32 A;  2VV6 A;  1OJG A;  5L10 A;  2XGN A;  1SCW A;  3M6B A;  2V1B A;  3UE0 A;  5F83 A;  3KYQ A;  4JXS A;  2HDS A;  4OQ0 A;  3BY9 A;  3BLM A;  2W1T A;  1KDW A;  1TS0 A;  2ZL1 B;  1L0F A;  1E3U A;  2VX8 A;  5A90 A;  1MWT A;  2QWS A;  1JWP A;  4Y7P A;  1HVB A;  3IWO A;  1IYQ A;  4RYE A;  3MXR A;  3D4F A;  4OPZ A;  3LIF A;  3MR0 A;  1VET B;  4Y2F A;  2ACG A;  3D3O A;  2ZQC A;  4QHC A;  4CLC D;  1DJA A;  4JF4 A;  2JKR I;  3G30 A;  4OPY A;  1K55 C;  3KO6 A;  2M7V A;  3HLW A;  4LRZ E;  1DY6 A;  2Y2I A;  2ZJ9 A;  4XUZ A;  4WMC D;  4S2K A;  5L8M A;  1G6O A;  2OAP 1;  1GHM A;  2JC7 A;  2DRW A;  4PM8 A;  5EVI B;  4OPR A;  4DMZ A;  3VSL A;  3HLC A;  4BD1 A;  3C4O A;  4NK3 A;  3F1N B;  3W4O A;  3OPL A;  4R3A A;  3DAV A;  3FZC A;  3IS2 B;  4EU0 A;  5FI2 A;  2KDK A;  4IBR A;  1V9Y A;  1RP5 A;  4OOM A;  1XX2 A;  1VB6 A;  2H10 A;  3EGX C;  1UWN X;  1YPR A;  4OLD A;  5DFX A;  1LSW A;  4WEJ A;  4JGQ A;  4MNR A;  2J7V A;  2HJ9 C;  2DNS A;  3P01 A;  4XT2 A;  1K6S A;  2E8J A;  4OKP A;  1IYO A;  1PZO A;  5F1G A;  5FQI A;  3S7O A;  3W8K A;  1S4S A;  3VOY A;  2FZ0 A;  1CEF A;  4ARZ A;  4ETX A;  3EGD C;  2YKF A;  2QZ6 A;  2Y2O A;  3A0R A;  4S2L A;  3KYZ A;  3O87 A;  1P97 A;  1XA7 A;  3DBA A;  1BLC A;  2Y2J A;  4L0L A;  3T1X A;  1ZC2 A;  5AVF A;  3OCN A;  4FH2 A;  2QJ5 A;  2RCX A;  3Q07 A;  2V2F F;  3RJU A;  3WS1 A;  4FTX A;  3G31 A;  1YLJ A;  5A92 A;  2VLG A;  1K25 A;  1VM1 A;  1XFQ A;  1W5D A;  4S2O A;  4E6X A;  3PBQ A;  4EEP A;  3PTE A;  1Q2Q A;  3ICY A;  2P74 A;  4XXR A;  3E4Q A;  3VP0 A;  1HLU P;  5EFW A;  3G2Z A;  1YLW A;  1CI9 A;  1ZG6 A;  4CPK A;  2K31 A;  2WKQ A;  1RGY A;  5GLB A;  5GLC A;  1OTA A;  3ZVT A;  2ZL1 A;  5CER A;  3ITB A;  4KZ3 A;  4X53 A;  4YFM A;  2Y59 A;  3HCY A;  2UV0 E;  3QHY A;  4UAA A;  4E04 A;  4CLC E;  1ES4 A;  3VP4 A;  1VET A;  4IVI A;  2V9A A;  3OPP A;  3FG8 A;  1XPB A;  2PYP A;  2M1C A;  5FQK A;  3IF6 C;  4EW7 A;  4NXE A;  3W4P A;  5KSH A;  2GZA A;  3EOI A;  4DDY A;  4G3W A;  2ZC4 B;  2KX6 A;  3K2N A;  3JVU A;  4Y15 A;  1S6R A;  2XR0 A;  3HJK A;  4G3V A;  3VOL A;  2IWB A;  1Y54 A;  2PR5 A;  1OT6 A;  3QP2 A;  4IVK A;  5EVI A;  4HIA A;  1ZKJ A;  5G18 A;  2WAD A;  2A49 A;  1MWU A;  2XA7 S;  3F1N A;  3LUQ A;  5HX9 A;  4JF5 A;  1G68 A;  3T4J A;  3SS5 A;  3IS2 A;  3T1Q B;  2Z6D A;  1KGF A;  2WGW B;  4HHD A;  4LLO B;  1EW0 A;  3HVF A;  1IEM A;  3OLO A;  5M18 A;  3O3V A;  1ONG A;  3NCK A;  4CLC C;  2J80 A;  5EM1 A;  2PR6 A;  2WK0 A;  2A3U A;  4P0M A;  4OON A;  1J9M A;  1DRM A;  1NWZ A;  5FI7 A;  4JGR A;  1G5U A;  4E3K A;  1H8Z A;  4HBU A;  3LIB A;  1LSV A;  1OJ5 A;  5FI6 A;  3ZYT A;  5BOH A;  1QMF A;  3QP4 A;  3LCE A;  4NXB A;  1PIO A;  1NLZ A;  1XP4 A;  4PKY G;  4BBU A;  2AVX A;  3PAE A;  3DTI A;  1NYM A;  3CUE A;  2ZMA A;  3ZHH A;  3OC2 A;  3Q81 A;  4LV3 A;  4Q0J A;  1PW1 A;  4ZTK A;  1T1A A;  3UB6 A;  4PM9 A;  4B4Z A;  4IUH A;  3BLS A;  5TJJ A;  1NZO A;  3LEZ A;  5F5Y A;  1W79 A;  4HOI A;  2L0W A;  4RVA A;  3JVV A;  5EVL A;  3TSG A;  3WRT A;  5D3O A;  4PPR A;  1BYW A;  1JVJ A;  1ES2 A;  4LEN A;  4PMA A;  1JNU A;  4GD8 A;  2B18 A;  1C3B A;  4OPQ A;  2G2W A;  1K54 A;  4GB7 A;  4II7 A;  1VHM A;  2XK1 A;  3C7U A;  4WN5 A;  4MCW A;  3I7J A;  1XFN A;  3UMD A;  1DJC A;  1DJB A;  2J9P A;  3HUO A;  2WAE A;  3T4L A;  3M2J A;  3UDF A;  4K0X A;  3LIE A;  4M4X A;  1CQA A;  3G4P A;  2W3G A;  2J3W A;  4RX2 A;  3F1O B;  2PHY A;  3GTC A;  3LIA A;  4GOG A;  3T4K A;  1JTD A;  4I3A A;  2HP5 A;  3BWL A;  2ZQ7 A;  3V67 A;  1DP6 A;  3PHY A;  5CTM A;  1NRF A;  3IWQ A;  3C38 A;  4F94 A;  3LY4 A;  1W7F A;  3TOI A;  5F68 A;  5IS1 A;  3IXG A;  1FSW A;  1L0E A;  2PRF A;  4R0Q A;  1K54 C;  4EER A;  3ZG0 A;  2RL3 A;  2Q9M A;  2V1A A;  1VQQ A;  4KQD A;  1W63 Q;  5E43 A;  3PYP A;  1TVF A;  5DJU A;  5EOO A;  3GVB A;  3Q7Z A;  4OQH A;  2HDR A;  4HJ4 A;  4RQ9 A;  2WGW A;  1IKI A;  1T1C A;  1YQS A;  2EX2 A;  4BEN A;  4ZBE A;  3HUN A;  3C2W A;  4WEK A;  4NET A;  1RGZ A;  3CWF A;  5CHU A;  2V0U A;  3HJI A;  3UB7 A;  1CEG A;  4KZ5 A;  4F3L B;  4FUW A;  4PM6 A;  3IXB A;  1ZHH B;  4BJP A;  1GSV A;  2QHK A;  5DJT A;  5AQA A;  1V9Z A;  5E2F A;  1HD8 A;  3DTK A;  5F6A A;  3UE1 A;  3AGF A;  5EUA A;  2WKR A;  4UA7 A;  4KZ7 A;  1STZ A;  4Y13 A;  2PAV P;  3IHA A;  2JKT M;  5EEC A;  1OTD A;  3NUL A;  1YAX A;  3PXP A;  1UGU A;  3MQ0 A;  3A3F A;  3MBZ A;  4N1X A;  1K4E A;  1GSW A;  2EX9 A;  2EX8 A;  3Q1F A;  5EV0 A;  3IH9 A;  3GQZ A;  2EWW A;  2JKF A;  1F2K A;  3SOI A;  4MBK A;  3LID A;  2ZOI A;  5E2H A;  3LR5 A;  4R6L A;  1PW8 A;  1SDE A;  1HTZ A;  2ZMF A;  3NEC A;  4GDB A;  4E3M A;  2IWC A;  1PRQ A;  2C6W B;  4H6J B;  4OP5 A;  3AGE A;  4NXG A;  3VE4 A;  4CJN A;  4X25 A;  4FOF A;  3U4L P;  5FQ9 A;  1BUL A;  3CMZ A;  3F1O A;  4M3K A;  3CPT B;  3VSK A;  1MWS A;  4OQG A;  4DN0 A;  4QWO A;  5AQB A;  5GLD A;  1LI0 A;  2BG1 A;  2HJE A;  4X56 A;  5IU1 A;  1PWD A;  1NY0 A;  1I2S A;  3DWZ A;  3KX0 X;  3IBJ A;  2LB9 A;  2DCF A;  2H5S A;  3BM6 A;  4LRX C;  2P9V A;  2VV8 A;  1L3L A;  2PT7 A;  1CJF A;  4OP8 A;  3UE6 A;  3SS4 A;  4LV0 A;  2JN7 A;  5HPI A;  2QPN A;  5GHZ A;  4IED A;  1PWG A;  2ZC5 B;  3CLO A;  2P04 A;  4GZB A;  3EQV A;  3VMA A;  4KQQ A;  2EXA A;  3OZH A;  5HAR A;  4O0P A;  5A8B A;  3CJM A;  1O7E A;  4ZAM A;  3EQU A;  1J3W A;  5DF9 A;  4F3L A;  1TS8 A;  3B42 A;  3PBS A;  2Z6C A;  2WUQ A;  1GHI A;  1W8Q A;  4HBT A;  1KVL A;  3ZG9 B;  5CEC A;  1WYB A;  4IBX A;  3QP1 A;  1MXO A;  4HJ6 A;  3P09 A;  3B33 A;  4BWI A;  2WGI A;  5HAI A;  3TW8 A;  3KSG A;  3BEC A;  3ZCZ A;  5EM0 A;  3ZG5 A;  4MLL A;  4PM5 A;  2Y2H A;  4ZJ1 A;  4Y0T A;  3O5Y A;  3HLB A;  4YWZ A;  2EA9 A;  4EQ1 A;  4P87 A;  5U47 A;  3JYI A;  3VP3 A;  4ME4 A;  4LRY C;  2XRN A;  3A3E A;  4ZJ3 A;  2A2L A;  3MZD A;  3CZD A;  5EVI D;  3QP5 A;  3LR3 A;  1BLP A;  2I9V A;  1ES3 A;  2W1R A;  3S7Q A;  1PWC A;  2C5W B;  5FAO A;  5GHX A;  4JGP A;  1BLH A;  1MWR A;  3E4O A;  1SKF A;  3N7W A;  1M6K A;  2Y55 A;  4KZ4 A;  3UN7 A;  4DXC A;  1MY8 A;  1PYY A;  2XDM A;  2QMI A;  2W3F A;  4Q0I A;  3UE3 A;  1K56 D;  2GJ3 A;  3E0Y A;  3C7V A;  4H6J A;  5HL6 A;  4MN5 A;  5KZH A;  4O7D A;  3N8R A;  4KZ8 A;  3D72 A;  3CPT A;  4FSF A;  2L1M A;  4MBF A;  2ZBB A;  4L9G A;  3VV4 A;  1QME A;  4BLM A;  4P6Z S;  4S2I A;  5LBR A;  2W3D A;  1KE3 A;  5HAQ A;  4JXG A;  2PU2 A;  4N9K A;  1S4R A;  4KG5 A;  1IYS A;  4DE0 A;  1S67 L;  1EI5 A;  3MSH A;  4FD8 A;  1ERQ A;  3EWK A;  5HW3 A;  3A0S A;  3LFV A;  2FFY A;  1YKD A;  1U60 A;  5FL3 A;  2GX5 A;  3LI9 A;  1TEM A;  1S66 L;  1KGE A;  5HL1 A;  3S4X A;  2VGK A;  1XJ3 A;  3ULF A;  1OME A;  1FCO A;  4GW9 A;  1N9N A;  2A24 B;  1E4D A;  3ZQ5 A;  3LI8 A;  4BBT A;  3BEB A;  3BRM A;  3MQO A;  3T4T A;  2EXB A;  2ZC7 A;  4DJ3 A;  4B4X A;  3NIA A;  4EXO A;  3UME A;  3ZFZ A;  4R3B A;  3PBT A;  4DF6 A;  1H8Y A;  1X0O A;  3H7W B;  2K7S A;  2XLN A;  5CHJ A;  1BUE A;  1S0W A;  1CF0 A;  3MKF A;  4RA7 A;  4MBH A;  3IF5 A;  3ITA A;  4K91 A;  1F9I A;  1S1Z A;  4X55 A;  1AWI A;  3BQ8 A;  3QP8 A;  4P6Z M;  4R23 A;  3OBF A;  2Z2L B;  2ZC6 B;  2NUP C;  4X68 A;  2G7U A;  4E6W A;  1EWZ A;  3KSH A;  2L4R A;  1TD5 A;  1W8Y A;  1ZTU A;  1OTE A;  3EEH A;  1P9W A;  2YKH A;  1XJ2 A;  2ZD8 A;  2INW A;  2JCH A;  1K56 A;  2ZM8 A;  2O9B A;  2ZMV A;  1DP8 A;  4QPR A;  5HDD A;  5GLA A;  4WM9 A;  3SH9 A;  3A0V A;  4Y17 A;  5DTT A;  5EVI C;  1GHP A;  1NRJ A;  4O01 A;  2VZW A;  2XEP A;  1WYC A;  3JPU A;  3F1P B;  2PD7 A;  2B95 A;  5DF8 A;  3MQQ A;  4CQH A;  2JBF A;  4YOF A;  4JGO A;  2VV7 A;  2H28 A;  4EUZ A;  3PBO A;  1FQG A;  4R1G A;  4PKY A;  1JWV A;  1ZG4 A;  3Q82 A;  1LHY A;  3FPW A;  2CC1 A;  3T1S A;  3ISG A;  4JPM A;  1T1B A;  3BJN A;  3OOV A;  1WE4 A;  5GHY A;  3CHW P;  4KUO A;  3HBR A;  3IBR A;  4JXV A;  3IXD A;  3SS3 A;  4MDZ A;  1K57 A;  2ZLY A;  3WS2 A;  5E2E A;  1K0K A;  3TG9 A;  4WZ4 A;  4HJ3 A;  5FDS A;  3T4S A;  3R7W B;  2A24 A;  2EWV A;  4BL2 A;  3LR0 A;  4UQI S;  2M7U A;  3E98 A;  4PM7 A;  1P9R A;  5EVE A;  3UY6 A;  3CUE C;  3W4Q A;  4GS9 B;  2OAQ 1;  4GD6 A;  5K5B A;  3R4K A;  2QYB A;  4WZ5 A;  4BD0 A;  2ZQA A;  1PI4 A;  1ESI A;  3WS4 A;  2XD5 A;  3H7W A;  3IXH A;  5AQ9 A;  4Y0O A;  1MKI A;  2BTF P;  4KQR A;  3OCL A;  5EE8 A;  2P9V B;  4YNR A;  2PYR A;  4DRT A;  3K3C A;  4JBF A;  5CX7 A;  1H3Q A;  4OOL A;  5FEG A;  4EEU A;  3FKW A;  3HLG A;  4EBL A;  4HH3 A;  5HD3 A;  4D60 A;  1VEU B;  1XGI A;  1ERM A;  4R38 A;  1XXM A;  4R70 A;  2JKT I;  3HLE A;  3NJA A;  3ZDJ A;  4JLF A;  4L9F A;  4KQO A;  3VFF A;  1LI9 A;  1XKZ A;  4I38 A;  5IT5 A;  3VOZ A;  5AVE A;  1ODV A;  3IX4 A;  3S7N A;  2VJW A;  3T1R A;  3F1P A;  5F82 A;  1H5X A;  4EBN A;  4UQI M;  3ZG8 B;  4K0W A;  4BL3 A;  3RFB A;  4EWF A;  2Y4A A;  3ZNT A;  5A91 A;  1ESU A;  2ZQ8 A;  3QNB A;  4OLG A;  4GNU A;  2W0N A;  1L0G A;  2EX6 A;  1KE4 A;  3MS6 A;  2WKH A;  3CG5 A;  2P7J A;  3HLD A;  4NEE D;  3H82 B;  3LEQ A;  2JE5 A;  3W2Z A;  3KSF A;  1BTL A;  1K4F A;  5M1A A;  3VE3 A;  2PBD P;  4HI4 A;  2V1Z A;  3FPV A;  4HH2 A;  2PU4 A;  5CGS A;  2W3E A;  2XFT A;  1SZV A;  4S2N A;  2D01 A;  5HFO A;  4S2P A;  3RTY A;  4NG2 A;  2OWJ A;  3R7W A;  1UWP X;  2VGL S;  4EUV A;  1LL8 A;  2Y2P A;  1S1Y A;  2X71 A;  4OVD A;  4IHQ A;  5TFQ A;  4GS9 A;  2B5R A;  1JWZ A;  4FCF A;  3Q7V B;  5J8X A;  1HZO A;  2ZM2 A;  1ALQ A;  4JXW A;  3IHB A;  5J3W A;  3C8C A;  5HWT A;  4DJ2 A;  1XJ6 A;  4G3K A;  1W63 M;  1YMX A;  1GA9 A;  2KLI A;  3G34 A;  4KG2 A;  5CRF A;  3LGO A;  4U0T A;  1NZU A;  1BLS A;  3UDI A;  4I3I A;  2XSS A;  3E2L A;  1MC0 A;  4HQA A;  3IQA A;  1IKG A;  3UB8 A;  3UDX A;  4DKI A;  4WL9 A;  3CI6 A;  2D02 A;  3V5M A;  3A3I A;  5FAT A;  1VEU A;  4UA9 A;  3IX3 A;  2MJ6 A;  3V3S A;  3NI9 A;  2V8C A;  4Z9Q A;  4KZB A;  5E2G A;  1LL5 A;  1AXB A;  3FWL A;  1KGG A;  3QP6 A;  3IF6 B;  2PD8 A;  4BBV A;  1YT4 A;  5M19 A;  3H9W A;  5EOE A;  1P0Z A;  2HP9 A;  3IT9 A;  1OT9 A;  3N6I A;  4GN2 A;  3T12 B;  3U2A A;  2VGL M;  4A5R A;  3NY4 A;  3UPN A;  4QJG A;  3BFF A;  2H0Y A;  2VK3 A;  3WS5 A;  3OPR A;  2PDR A;  1H8M A;  3NDE A;  3M6H A;  5HWW A;  2V8F A;  3BYD A;  3AGD A;  1NYY A;  4GHI B;  4P85 A;  3H82 A;  1A0K A;  1FR6 A;  4BQM A;  1XA1 A;  3HL9 A;  4CLC B;  1ERO A;  3FC7 A;  5DKL A;  4JF6 A;  1ES5 A;  3PAG A;  4OH0 A;  3VP1 A;  3LR4 A;  4GLQ A;  2BLS A;  4HP9 A;  5DF7 A;  4GCZ A;  1XJ4 A;  5GL9 A;  1IYP A;  3WS0 A;  4ESP A;  4HES A;  2GNX A;  5L07 A;  1XGJ A;  5C5K A;  2EFX A;  1RCJ A;  2R9W A;  1MKM A;  2XD1 A;  4EBP A;  2JKG A;  3E4P A;  5I5L A;  5FAQ A;  4DXB A;  1KDS A;  3Q7V A;  2JKR M;  4C6Y A;  2XH9 A;  1YLP A;  1D06 A;  2W3H A;  4IUK A;  4UHU A;  1TDG A;  2R78 A;  5FQQ A;  4NKP A;  2B02 A;  1FCM A;  5G4Y A;  2HGV A;  5J7E A;  2ZQ9 A;  3NC8 A;  1CI8 A;  5KSC A;  5L2F A;  4B88 A;  2PBY A;  3WWX A;  3UPP A;  1TS6 A;  4R4S A;  3VP2 A;  1N9L A;  4X1L A;  3RH8 B;  5DKK A;  5TGF A;  3BFC A;  4KG6 A;  3NBL A;  3LO7 A;  1KOU A;  3FYZ A;  4MN6 A;  3MJQ A;  2Y2N A;  3DWK A;  3MXQ A;  2J3T D;  3NDG A;  1SKO B;  4OQI A;  2Y2L A;  3G6O A;  5FA7 A;  1KE0 A;  1D7E A;  1N9O A;  4LV1 A;  4C75 A;  1OTB A;  4Y0U A;  2X02 A;  3L9K A;  5FEF A;  4E3L A;  4Q0H A;  4S2J A;  4Y3I A;  3TJZ C;  1NLY A;  3IF6 A;  1F5M A;  5CXW A;  1PFL A;  4HEF A;  1BZA A;  4WLA A;  2XRO A;  4HY8 A;  3GSG A;  2Y2Q A;  4E3N A;  2WGV A;  1IEL A;  4PAU A;  3S1Y A;  3L7H A;  4P6B A;  3ZVW A;  3BW6 A;  5HD5 A;  3ZG7 B;  5FDH A;  3OPH A;  4DE3 A;  1N9B A;  2HV1 A;  2LB5 A;  1K6R A;  4U3T A;  1BSG A;  3V3R A;  2XF3 A;  5FQM A;  3UPO A;  1E25 A;  1YLY A;  4HNB A;  5AJG A;  5TBM B;  5CGW A;  5FAP A;  4LFU A;  4GHI A;  4LCL A;  2W27 A;  4E3J A;  5F69 A;  4X69 A;  4ZDX A;  5KIZ A;  4CLC A;  4AFI A;  2VKS A;  2FH5 A;  3N8L A;  1LLB A;  4WMC A;  1WA9 A;  3T50 A;  1T19 A;  3BQA A;  5CGX A;  2ZC3 B;  3RXX A;  5J4E A;  2OLU A;  1SDN A;  3VFH A;  3NHQ A;  5JYP A;  4R3J A;  3O86 A;  1GA0 A;  1I2W A;  3MZE A;  5AQ7 A;  4EET B;  1YSP A;  3MKE A;  3BY8 A;  5FAS A;  3MFD A;  3B47 A;  1IOU A;  2Y2M A;  3IH8 A;  1FIK A;  4B9O A;  4WYY A;  4HP4 A;  1DP9 A;  3GV9 A;  2J8Y A;  2BAS A;  4O8G A;  4I5S A;  3G2Y A;  3BFE A;  3C4P A;  4WEL A;  2Y2K A;  1FIL A;  3GRJ A;  3DTE A;  3V50 A;  1Z09 A;  2Q0O A;  2O99 A;  3S22 A;  1NJ4 A;  4Z1W A;  4MMN A;  2QJ7 A;  3DTM A;  4BMW A;  1Y28 A;  4N92 A;  3BFD A;  1I5Q A;  4Y5F A;  5DVA A;  5FSR A;  1MPL A;  1SKO A;  3PBN A;  3ZGA B;  5CHM A;  1G28 A;  4E3I A;  3G35 A;  4GDN A;  2WKP A;  2WAF A;  5IHV A;  1YM1 A;  5CED A;  5DTK A;  1BT5 A;  4XUX A;  2OWH A;  3P98 A;  3M2K A;  4N9L A;  2WYX A;  1F98 A;  2XFS A;  2XQZ A;  4L9E A;  4ID4 A;  2VA0 A;  3IWI A;  1ACF A;  1YLZ A;  3S7P A;  3C30 A;  4WF0 A;  4QY6 A;  2Y79 A;  3GEC A;  4ZJ2 A;  1FOF A;  3D9Y A;  4I3J A;  5HPF A;  2I72 A;  2Z2M B;  3A3D A;  4LGW A;  3CIT A;  3MF0 A;  4KZ6 A;  3E2K A;  2XA7 M;  3UNW A;  1MZU A;  3UB9 A;  4MEZ A;  1NXY A;  5HDS A;  4KZ9 A;  2J3T C;  1K57 C;  2CMN A;  5JYO A;  3KSI A;  2DMW A;  3BFG A;  4IJG A;  4B93 A;  5TBM A;  3WRZ A;  2V0W A;  3GMW A;  1Z6F A;  1FCN A;  5A93 A;  1TF1 A;  3IX8 A;  2HZ5 A;  1LT0 A;  2GDN A;  1M40 A;  4S2M A;  5I94 A;  3GDI A;  2K2N A;  1PZP A;  3NOP C;  3ZNY A;  1K38 A;  5TR7 A;  2Y2G A;  2OOL A;  4LPZ A;  4PHT A;  1YLT A;  4EES A;  1PI5 A;  4KEN B;  5HDC A;  4WZ5 C;  3LY3 A;  2IWD A;  4E3O A;  2KOI A;  4NXF A;  5DTS A;  2EFU A;  2QKP A;  2E8I A;  3P7N A;  2HP6 A;  4EQI A;  2NUT C;  2Y8H A;  1MBL A;  4JKT A;  4WBG A;  1N4O A;  1GSX A;  1Q2P A;  4OOY A;  3B3X A;  1LL9 A;  5HZH A;  3N4I A;  3FKV A;  4QD4 A;  1GCE A;  2W1T B;  1E3U D;  1KVM A;  2WZX A;  2WZZ A;  3C5A A;  2HDQ A;  2IA2 A;  3UO9 A;  5HAP A;  3QNC A;  4Q8I A;  2P08 A;  3MMH A;  5MC7 A;  1Y4O A;  4QY5 A;  3V39 A;  4FH4 A;  4ZRR A;  3CAX A;  3LYX A;  4DDS A;  1YMS A;  3N8S A;  3RXW A;  2HPB A;  1T18 A;  2V20 A;  3O88 A;  3GR2 A;  2UWX A;  3NOU C;  2J9O A;  4EV4 A;  1PNE A;  3TE8 A;  2O0Y A;  3SZT A;  3MZF A;  5HWV A;  2HDU A;  1JTG A;  4KUK A;  4LV2 A;  2O9C A;  4RX3 A;  2X01 A;  4C3Q A;  3KYE A;  1ONH A;  2VGJ A;  3T4O A;  2Q9N A;  4WUJ A;  2H0T A; 
#chains in the Genus database with same CATH homology
 4M4X A;  2HF6 A;  1OTI A;  2W3G A;  1IFQ A;  2J3W A;  3F1O B;  5G4Z A;  2PHY A;  3K3D A;  3LIA A;  3LR4 A;  3NOT C;  4GLQ A;  3MFX A;  4HP9 A;  3T4K A;  4GCZ A;  4I3A A;  3BWL A;  3PR6 A;  3TRC A;  3V67 A;  1F9I A;  1XJ4 A;  1S1Z A;  2JHE A;  1DP6 A;  3BQ8 A;  4P6Z M;  3PHY A;  4ETZ A;  3OBF A;  3C38 A;  2GNX A;  5C5K A;  4XT2 B;  2NUP C;  5F68 A;  5IS1 A;  1MKM A;  3E4P A;  2G7U A;  5I5L A;  3KSH A;  2L4R A;  1TD5 A;  2JKR M;  1ZTU A;  4EER A;  1OTE A;  4ARZ B;  3EEH A;  1P9W A;  2V1A A;  1D06 A;  2W3H A;  2YKH A;  4IUK A;  1XJ2 A;  4KQD A;  1W63 Q;  2INW A;  2R78 A;  3PYP A;  3LIC A;  4GJ4 A;  2O9B A;  4NKP A;  2B02 A;  3PBR A;  5DJU A;  2VEA A;  5G4Y A;  5HSQ A;  2HGV A;  2ZMV A;  2ZOH A;  5J7E A;  4HJ4 A;  1DP8 A;  4RQ9 A;  4QPR A;  4UEY A;  5HDD A;  4I39 A;  3SW1 A;  3T4Q A;  3EEA A;  3A0V A;  1T1C A;  5DFY A;  1TS7 A;  3C2W A;  1TS6 A;  4WEK A;  1NRJ A;  1LSX A;  1N9L A;  3CWF A;  4O01 A;  2VZW A;  2V0U A;  3F1P B;  3RH8 B;  1YSQ A;  3HJI A;  5DKK A;  3UB7 A;  2O9A A;  2PD7 A;  1KOU A;  4MN6 A;  4F3L B;  3MQQ A;  3MJQ A;  3MXQ A;  4CQH A;  2J3T D;  4MN7 A;  4K08 A;  4JGO A;  4YOF A;  3G6O A;  1OPX A;  2VV7 A;  1D7E A;  1ZHH B;  2H28 A;  2VV6 A;  1OJG A;  1N9O A;  4BJP A;  3PBO A;  1GSV A;  2QHK A;  5DJT A;  1V9Z A;  1OTB A;  4PKY A;  5F6A A;  2V1B A;  3FPW A;  3KYQ A;  4Q0H A;  1T1B A;  3BJN A;  3OOV A;  3BY9 A;  2W1T A;  4Y3I A;  1TS0 A;  2WKR A;  3TJZ C;  4KUO A;  1NLY A;  3IBR A;  1F5M A;  2VX8 A;  1STZ A;  4WLA A;  2QWS A;  2XRO A;  4HY8 A;  4MDZ A;  2JKT M;  4PAU A;  1OTD A;  3LIF A;  3MR0 A;  3BW6 A;  5HD5 A;  4HJ3 A;  3T4S A;  1YAX A;  3R7W B;  3PXP A;  1UGU A;  4Y2F A;  2A24 A;  2EWV A;  3MQ0 A;  3LR0 A;  4UQI S;  2M7U A;  3D3O A;  3E98 A;  4CLC D;  2HV1 A;  2JKR I;  1P9R A;  3KO6 A;  2LB5 A;  3CUE C;  2M7V A;  4LRZ E;  1GSW A;  4GS9 B;  5L8M A;  1G6O A;  2OAQ 1;  2EWW A;  2OAP 1;  5K5B A;  4HNB A;  3LID A;  2ZOI A;  5AJG A;  5TBM B;  3R4K A;  3LR5 A;  4R6L A;  4DMZ A;  2QYB A;  4GHI A;  2W27 A;  2ZMF A;  5F69 A;  3F1N B;  3H7W A;  4H6J B;  5KIZ A;  4R3A A;  4CLC A;  4NXG A;  4AFI A;  3IS2 B;  3VE4 A;  2VKS A;  4FOF A;  4EU0 A;  2FH5 A;  2KDK A;  3F1O A;  3OCL A;  1WA9 A;  3T50 A;  1V9Y A;  4OOM A;  1T19 A;  3BQA A;  5J4E A;  4YNR A;  4DN0 A;  2PYR A;  3K3C A;  5CX7 A;  1VB6 A;  3NHQ A;  2HJE A;  1H3Q A;  3EGX C;  4OOL A;  5IU1 A;  1UWN X;  4EEU A;  5DFX A;  1LSW A;  3KX0 X;  4WEJ A;  4JGQ A;  4HH3 A;  3IBJ A;  5HD3 A;  2LB9 A;  4EET B;  1YSP A;  2HJ9 C;  3P01 A;  4XT2 A;  3BY8 A;  4LRX C;  3B47 A;  2VV8 A;  3S7O A;  1S4S A;  2FZ0 A;  4R38 A;  1IOU A;  4ARZ A;  4ETX A;  2PT7 A;  3EGD C;  4R70 A;  2YKF A;  3A0R A;  3UE6 A;  2JKT I;  3NJA A;  4B9O A;  3KYZ A;  4HP4 A;  1DP9 A;  4L9F A;  4KQO A;  1P97 A;  2BAS A;  4O8G A;  3DBA A;  2JN7 A;  4I5S A;  5HPI A;  4WEL A;  4I38 A;  4L0L A;  5IT5 A;  3CLO A;  5AVE A;  2P04 A;  5AVF A;  3OCN A;  3EQV A;  2O99 A;  1ODV A;  2QJ5 A;  4Z1W A;  4MMN A;  2QJ7 A;  3S7N A;  5A8B A;  2VJW A;  4O0P A;  4BMW A;  1Y28 A;  3F1P A;  3EQU A;  4UQI M;  5DF9 A;  4F3L A;  1TS8 A;  3B42 A;  3PBS A;  2Z6C A;  4Y5F A;  2VLG A;  3RFB A;  1XFQ A;  3PBN A;  2W0N A;  3PBQ A;  4HJ6 A;  1G28 A;  4EEP A;  2WKP A;  3B33 A;  3ICY A;  4BWI A;  3E4Q A;  3KSG A;  3TW8 A;  2P7J A;  5EFW A;  4NEE D;  3H82 B;  2K31 A;  2WKQ A;  3O5Y A;  2OWH A;  4YWZ A;  1OTA A;  2EA9 A;  3W2Z A;  1F98 A;  4L9E A;  4EQ1 A;  3KSF A;  2VA0 A;  3VE3 A;  4HI4 A;  3HCY A;  3FPV A;  4HH2 A;  3S7P A;  4E04 A;  4ME4 A;  3C30 A;  2W3E A;  4WF0 A;  2Y79 A;  3GEC A;  4LRY C;  2D01 A;  2XRN A;  4CLC E;  2A2L A;  3RTY A;  4I3J A;  5HPF A;  2V9A A;  2OWJ A;  3FG8 A;  3R7W A;  3LR3 A;  1UWP X;  2VGL S;  2PYP A;  2M1C A;  3CIT A;  4EUV A;  1LL8 A;  2I9V A;  3MF0 A;  2XA7 M;  4EW7 A;  4NXE A;  1MZU A;  3UB9 A;  1S1Y A;  5HDS A;  2W1R A;  3S7Q A;  5KSH A;  2GZA A;  2J3T C;  3EOI A;  4IHQ A;  4JGP A;  3E4O A;  4G3W A;  2CMN A;  4GS9 A;  3KSI A;  2DMW A;  4IJG A;  2KX6 A;  3K2N A;  3JVU A;  4B93 A;  3HJK A;  4G3V A;  3VOL A;  2PR5 A;  5TBM A;  2W3F A;  1OT6 A;  4HIA A;  2V0W A;  4Q0I A;  3UE3 A;  1TF1 A;  5J3W A;  2XA7 S;  2GJ3 A;  3C8C A;  3F1N A;  3LUQ A;  5HWT A;  4DJ2 A;  3E0Y A;  1LT0 A;  1XJ6 A;  4G3K A;  1W63 M;  4H6J A;  3GDI A;  2K2N A;  4MN5 A;  5HL6 A;  3T4J A;  2KLI A;  3IS2 A;  3NOP C;  2Z6D A;  2OOL A;  4LPZ A;  4HHD A;  4PHT A;  4EES A;  4I3I A;  3D72 A;  4LLO B;  4FSF A;  2XSS A;  2L1M A;  5HDC A;  1EW0 A;  1MC0 A;  4HQA A;  2ZBB A;  3OLO A;  4L9G A;  3VV4 A;  4P6Z S;  2KOI A;  3UB8 A;  5LBR A;  2W3D A;  4NXF A;  4WL9 A;  2QKP A;  4CLC C;  3CI6 A;  3P7N A;  2NUT C;  2D02 A;  1S4R A;  2J80 A;  2PR6 A;  2Y8H A;  1S67 L;  2MJ6 A;  1GSX A;  1DRM A;  3EWK A;  1NWZ A;  4JGR A;  5HZH A;  3A0S A;  3LIB A;  3LFV A;  1LSV A;  1OJ5 A;  2W1T B;  1YKD A;  3ZYT A;  2PD8 A;  4BBV A;  4NXB A;  1NLZ A;  5FL3 A;  4PKY G;  2GX5 A;  3H9W A;  4BBU A;  2IA2 A;  3CUE A;  3LI9 A;  1P0Z A;  1S66 L;  3OC2 A;  2P08 A;  4Q0J A;  3MMH A;  1T1A A;  3UB6 A;  5MC7 A;  4IUH A;  1OT9 A;  5TJJ A;  1XJ3 A;  3ULF A;  5F5Y A;  4GW9 A;  4HOI A;  4ZRR A;  1N9N A;  2A24 B;  2L0W A;  3CAX A;  3LYX A;  3ZQ5 A;  3LI8 A;  4BBT A;  3U2A A;  3JVV A;  2VGL M;  1T18 A;  3NOU C;  1BYW A;  3MQO A;  3TE8 A;  2O0Y A;  2PDR A;  3T4T A;  5HWV A;  1H8M A;  1JNU A;  2B18 A;  5HWW A;  4DJ3 A;  4KUK A;  4EXO A;  4II7 A;  2O9C A;  3UME A;  1VHM A;  4GHI B;  3H82 A;  3PBT A;  4WN5 A;  4MCW A;  1X0O A;  3H7W B;  1XFN A;  3UMD A;  2K7S A;  3T4O A;  4CLC B;  4WUJ A;  3FC7 A;  5DKL A;  3T4L A;  3LIE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...