5IU1A

N-terminal pas domain homodimer of ppanr map3k from physcomitrella patens.
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
106
structure length
106
Chain Sequence
b'FESQPCVSIDLRGNITSWNRAAEQLYQFKEGEVMGRNLVDLIVPPNAKTAALDTIMRVGQGEVWIGQFSCVRRDNAILNTVVTQKPILDDDQKISGISVCTEPYSM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CTR1-like protein
publication title Genetic Analysis of Physcomitrella patens Identifies ABSCISIC ACID NON-RESPONSIVE, a Regulator of ABA Responses Unique to Basal Land Plants and Required for Desiccation Tolerance.
pubmed doi rcsb
source organism Physcomitrella patens subsp. patens
molecule tags Plant protein
total genus 33
structure length 106
sequence length 106
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-03-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 5iu1A00
4EESA 3LI8A 4HQAA 1G28A 1XJ2A 4NXGA 2QHKA 4GW9A 4JGRA 5HD3A 3A0SA 5HD5A 4XT2A 3UMDA 1EW0A 3K3CA 4GS9B 4WUJA 5F6AA 4R38A 3UB6A 1T18A 2YKHA 1OJ5A 2L0WA 2D02A 3A0VA 4I38A 3LUQA 3ULFA 4HH3A 2JN7A 1TS6A 2VV7A 3H7WB 4EEUA 3MQQA 3VE4A 4HP4A 4LRYC 2CMNA 1JNUA 2H28A 3P7NA 3SW1A 1OJGA 2Z6DA 3CLOA 2PR5A 3RH8B 2PD7A 4LLOB 4GHIB 5J3WA 4DJ2A 3OLOA 4HI4A 3RTYA 1LL8A 4WF0A 1S1YA 4PKYA 4HJ4A 2V9AA 4DJ3A 2P7JA 3VOLA 1V9YA 3FC7A 5HDDA 3LIAA 1T19A 4KUKA 1V9ZA 5KIZA 4GCZA 2W27A 1UGUA 2A24A 3ICYA 1LSXA 1OT9A 3BY8A 2PHYA 2BASA 1UWNX 1DP8A 1GSWA 3IS2B 1OTAA 1OTIA 5A8BA 4BBTA 3H9WA 2V0WA 3F1PB 1OTDA 4H6JA 1BYWA 1LT0A 2OOLA 3LIBA 3LIDA 3EWKA 1N9OA 3PHYA 5J4EA 2QWSA 3PYPA 4GS9A 3MJQA 1VB6A 3MFXA 3F1OA 1UWPX 4MN5A 2HV1A 1WA9A 3E4OA 3LIEA 2K7SA 3H7WA 2JHEA 3NHQA 3F1NB 3BWLA 1XJ4A 4RQ9A 5HWWA 5F5YA 1S1ZA 4YWZA 4EQ1A 3MQOA 4R70A 2W0NA 4JGPA 4L9EA 1TS7A 5DJUA 4HY8A 2Z6CA 2B02A 4EERA 3H82A 4EW7A 5I5LA 4EEPA 1D06A 4XT2B 1P0ZA 4LRXC 2R78A 2V0UA 1N9NA 3GDIA 1ODVA 2WKPA 1DRMA 5J7EA 3IS2A 3EEHA 2VLGA 4HNBA 3VE3A 3E4QA 4KQDA 3F1PA 3K3DA 2V1BA 4L9GA 2YKFA 5HSQA 2I9VA 4I5SA 4HJ3A 5IS1A 5EFWA 4WLAA 4EETB 3IBRA 3E4PA 1LSVA 1XFQA 1OT6A 2OWHA 1S67L 4PKYG 2PYRA 3FG8A 4LRZE 2EA9A 5TBMB 3KX0X 4HOIA 3HJKA 4NXEA 3MR0A 3F1NA 4L9FA 4F3LB 2VEAA 4I39A 1D7EA 1P97A 1TS8A 2PYPA 4B9OA 2D01A 4LPZA 2OWJA 1GSVA 3NJAA 1S4RA 5HDCA 2KX6A 1DP9A 2QJ5A 5AVEA 2ZBBA 3UMEA 5DKLA 5DJTA 4GHIA 1OTBA 4BBVA 2VV8A 1S66L 5HZHA 3LI9A 3NOUC 3C8CA 3GECA 4BBUA 3F1OB 2GJ3A 2QKPA 2KDKA 3UB8A 4I3JA 2L1MA 5DKKA 1OTEA 4E04A 4R6LA 1Y28A 3UB7A 4EXOA 4NXFA 3LICA 5HWVA 4JGOA 2L4RA 3CWFA 4I3AA 2ZOHA 2J80A 5HWTA 4HHDA 5HDSA 3NOTC 1KOUA 4K08A 1F9IA 3ZQ5A 4WN5A 3H82B 3BY9A 4MN6A 2M1CA 1NWZA 3G6OA 2PD8A 1MZUA 1F98A 1N9LA 1TS0A 4M4XA 5TBMA 1DP6A 3CAXA 5F69A 1X0OA 4JGQA 2V1AA 4F3LA 4I3IA 3D72A 3HJIA 3UE6A 5G4ZA 2VV6A 1XJ6A 4HH2A 3T50A 4NXBA 3NOPC 4WL9A 3B33A 3C2WA 3A0RA 1XJ3A 4HIAA 1XFNA 1LSWA 2PDRA 2A24B 5F68A 1T1AA 2WKRA 5G4YA 2ZOIA 3LIFA 1T1BA 1S4SA 2QJ7A 3MXQA 3UB9A 4HJ6A 5AVFA 4KUOA 4R3AA 3LYXA 2WKQA 5IU1A 2INWA 1GSXA 4HP9A 2PR6A 4H6JB 1T1CA
chains in the Genus database with same CATH superfamily
3PBTA 5CGXA 1K57A 4NXGA 4OP8A 2QHKA 4GW9A 5KMWA 3N8LA 5HD3A 1MY8A 1FSYA 2OV5A 3V5MA 4PM7A 3E2LA 4QPRA 4WUJA 4WELA 5EECA 1T18A 1NJ4A 4GZBA 3T4JA 1BSGA 2FFFB 2L0WA 1KDSA 3LCEA 3A0VA 3LUQA 4S2MA 4OONA 2GNXA 4EEUA 1IYSA 4ZAMA 3MQQA 4HP4A 4D60A 2CMNA 1JNUA 2H28A 2KLIA 4OP5A 2Y2PA 4BJPA 1IKGA 1LL9A 1ACFA 3T1XA 3LEZA 3FZCA 5C5KA 1G5UA 3VV4A 4Z9QA 4WBGA 4S2JA 1S1YA 5GHXA 2P9VB 3BM6A 1E4DA 1V9YA 3ISGA 4QY5A 1T19A 1PI5A 3ZNYA 3GQZA 2XLNA 2IWDA 4S2LA 1MKMA 4WYYA 5CEDA 3M2JA 2EXAA 3SZTA 2I72A 2B5RA 1UGUA 2JKGA 2XD1A 3ICYA 3FYZA 3L7HA 2Y2MA 3BY8A 5FQIA 3G2YA 1WYCA 3HLCA 2ZC7A 2PHYA 4DDSA 1JWZA 1DP8A 3IS2B 3FKVA 5CRFA 2ZQ9A 4CLCA 3LR3A 1NRFA 1BLCA 1OTDA 3B3XA 4H6JA 3N7WA 5EPHA 3WRZA 2OOLA 3DAVA 3MXRA 3NIAA 5J4EA 3LR4A 3IXDA 2W1TB 5DF9A 5FQKA 3F1OA 4JBFA 1UWPX 1H5XA 2A3UA 3UPOA 2FZ0A 3R7WA 1K56D 2K7SA 2XFTA 5FL3A 2IA2A 3QP4A 3NHQA 3BWLA 2Y2IA 1STZA 3OPLA 3RXWA 1YKDA 3MQOA 3T12B 1TDGA 4ARZB 2R9XA 4Y15A 3VOZA 1M6KA 2XRNA 1ZC2A 4PM6A 1TS7A 1LI0A 3T4SA 1PYYA 2Z6CA 4R4RA 5HW3A 3H82A 3QNCA 1ALQA 3BFEA 4EEPA 1SKOA 1XGIA 3D3OA 4LRXC 4WZ5C 4WEJA 4E3JA 4E3MA 3MZEA 1HVBA 4JPMA 4JKTA 1IFQA 3GDIA 5E43A 2E8IA 2WKPA 3Q1FA 3RJUA 2WZXA 2JC7A 1O7EA 4KZ3A 4EQIA 4GD6A 1BLHA 2EX6A 3SS3A 5M1AA 4KZ9A 3CJMA 4PMAA 3TE8A 2QPNA 4L9GA 5HSQA 4MBFA 2VGLS 5KSHA 3FPWA 3Q82A 2RL3A 4HJ3A 5LBRA 3BEBA 2XDMA 3IH8A 3E4PA 4NETA 3DW0A 2OWHA 2WGIA 3BRMA 1HLUP 2OLVA 3G31A 1Q2PA 3DTMA 2WUQA 4IEDA 3CG5A 4NXEA 3MR0A 4QD4A 5TJJA 3C30A 3P01A 4I39A 2H0YA 4MBKA 1P97A 4KQQA 2WAFA 1W79A 5EM0A 3G35A 2OWJA 3IQAA 1K6SA 1HZOA 4KZBA 3S7OA 3T1RA 4O01A 3JYIA 4OOMA 5DKLA 3NY4A 4KG6A 4PPRA 3UDXA 2HJ9C 1RCJA 5GHZA 3UDIA 1CQAA 1S66L 4MLLA 2HDRA 2WKHA 3UN7A 3T1SA 1BULA 3T4KA 3C8CA 5CGSA 2KDKA 2IWBA 1YLTA 1WYBA 3T4QA 5FI2A 3LY4A 2GDNA 5EVEA 4UA9A 1L0EA 1MWSA 2P08A 3VOYA 3Q7VB 1E3UA 4QB8A 4R6LA 4B88A 4X1LA 5DTTA 1W63Q 1K4EA 3T4LA 4ESPA 5HWVA 3G30A 5EVIB 3GTCA 1FQGA 2EWVA 4P6ZS 2JKTM 3MMHA 2ZOHA 4FH4A 3PTEA 2J80A 2JKFA 1G6AA 4OLDA 4K08A 1F9IA 1YSQA 4MEZA 3ZQ5A 2W3FA 4Y17A 3Q81A 5CECA 1YQSA 3MZDA 1J3WA 3MZFA 1N9LA 3NBLA 4M4XA 2Y2QA 5CXWA 5TBMA 1VETA 3NI9A 1DP6A 3CAXA 2PT7A 1DJBA 4KQOA 5GLBA 5EUAA 1X0OA 4JGQA 2V1AA 3D72A 4P6BA 1D1JA 3CPTB 2VV6A 4XUXA 5L07A 5DTKA 5AJGA 4IJGA 1XA7A 3A0RA 1XFNA 3JPUA 3ITAA 3DWKA 2LB9A 3B42A 4RX3A 3MSHA 4WZ5A 1KE0A 2C5WB 1IYPA 3IX8A 5FQQA 3TOIA 3UB9A 1LLBA 4DRTA 2ZC3B 4HJ6A 4JXGA 4R3AA 1MWUA 5A93A 1I2SA 2INWA 2WKQA 5DF7A 3OPRA 4O7DA 2O0YA 1ESUA 3HLGA 3U4LP 1W8QA 3A0SA 1VEUB 2BTFP 4OPRA 4RX2A 4XT2A 1AWIA 3T4OA 3R4KA 4GS9B 4R38A 3SS5A 3UB6A 3BW6A 1L0FA 2YKHA 2WZZA 3C38A 3ZFZA 4GLQA 2D02A 4YFMA 4X53A 4UAAA 4LV3A 3H7WB 3CZDA 2W3GA 4FUWA 4QHCA 3LY3A 4R23A 4BL2A 1GHIA 3P7NA 1MPLA 1O07A 1WE4A 3CLOA 2PD7A 4OKPA 4GHIB 3VP2A 2P74A 1YT4A 4KZ6A 1SZVA 4C3QA 5CERA 1IEMA 1TD5A 2RCXA 1LL8A 2EXBA 4WF0A 5IHVA 4JLFA 3C7VA 1BT5A 1C3BA 2J9PA 1L0DA 1KE3A 1XPBA 5L09A 3U2AA 2ZQ8A 4R0QA 1ONGA 4ZJ1A 3FC7A 5HDDA 1JTGA 2ZJ9A 4QU3A 4OLGA 5E2HA 4KUKA 4Y0TA 3EOIA 5HL1A 5A91A 2G2UA 1VM1A 5F1FA 4EWFA 3CUEC 1NXYA 2WKIA 3EQVA 1L3LA 4BBTA 5KZHA 1BLPA 1F2KA 2V1ZA 3GR2A 1VQQA 2V0WA 4LGWA 5CX7A 4N9LA 3O5YA 1MBLA 4BD0A 4JXVA 1BYWA 2ZM2A 4OQIA 3LIBA 4HEFA 3LIDA 2VGJA 3ZCZA 2ZC4B 1N9OA 4D2OA 2VGLM 1K25A 3PHYA 2XQZA 2QWSA 3KYEA 3PYPA 4B4ZA 1Z6FA 1ZTUA 3KSIA 4G3WA 4RYEA 1SHVA 3WS4A 4F94A 3S1YA 1XGJA 5EVLA 4NEED 5HPFA 4Y0OA 3MQ0A 4DDYA 2QMIA 1Z09A 4S2PA 4Y13A 2JHEA 1TDLA 3F1NB 3HUOA 4QJGA 5CHJA 5HWWA 1OPXA 4YWZA 3W4QA 3M6HA 4GDNA 3IF6B 5L2FA 3Q07A 3CHWP 1TEMA 1PZOA 4L9EA 5G18A 5DJUA 2ZD8A 3W4OA 4KQRA 1FR1A 5EM1A 2ZC6B 3MF0A 1W7FA 3MKEA 1LHYA 1GA9A 4IHQA 4ZJ2A 2DNSA 4EW7A 3OC2A 2V20A 1PWDA 2HGVA 1P0ZA 2Q0OA 1IOUA 3MFDA 2R78A 3WS0A 5GLAA 2Y59A 3LR0A 5HX9A 2J3TD 5HAQA 4UEYA 1KDWA 2B95A 2G2WA 3IS2A 2EX8A 3EEHA 2MJ6A 4KG2A 2VLGA 3VE3A 2WGVA 4KQDA 2EX2A 3OPPA 1QMEA 2GZAA 1W5DA 3VP3A 3LEQA 1ZKJA 4RA7A 5FDSA 3NULA 4BD1A 2W3DA 1IYQA 5FATA 4P6ZM 2JKRM 3ZG9B 2GX5A 5EFWA 3VP0A 4H8RA 3IBRA 2W1TA 3DTKA 4KZ8A 1OMEA 2HF6A 2Z2LB 1OT6A 5FQ9A 1S67L 4PKYG 3TRCA 2PYRA 3FG8A 1CEGA 2G7UA 4P0MA 3TG9A 4XUZA 1L0GA 2Y2KA 4NK3A 4ZRRA 2EA9A 4WEKA 4C6YA 4E6XA 4U3TA 5EV0A 3PBOA 4CQHA 4JXSA 3A3EA 4L9FA 4F3LB 2VEAA 1SCWA 3HREA 3N8RA 2XROA 2O99A 3E2KA 3LGOA 5FQMA 3UPNA 2K2NA 4Y2FA 1GSVA 5FI6A 2KX6A 1DP9A 4K0WA 4QWOA 1H8YA 3JVVA 4KZ4A 2AVXA 4M3KA 4ETZA 2XK1A 5FI7A 5M19A 4YNRA 2DMWA 3PBQA 4LCLA 1YAXA 3LI9A 1GA0A 3CUEA 4JXWA 4BBUA 3F1OB 3M2KA 3VSKA 4DMZA 3R7WB 2Y2GA 4L0LA 3NCKA 1OTEA 1ESIA 3UB7A 2XA7S 3QP2A 4FSFA 3WS5A 1G68A 2BG1A 3LICA 4ZTKA 5A92A 4JGOA 5TR7A 4EU0A 3CWFA 5GLCA 3M6BA 3PR6A 5EVID 4AFIA 2WKEA 4GOGA 2FFYA 2ZC5B 3A3FA 4G3VA 3KYQA 3H82B 4MN6A 1K54C 2PD8A 5DF8A 5E2EA 2OAQ1 3W4PA 1L2SA 1LL5A 1EI5A 5FAPA 4I3IA 5GL9A 4OPQA 5KSCA 5I94A 3WRTA 3HJIA 1K56A 5JYPA 2Y2HA 1TF1A 4U0XA 3V3SA 1BLSA 1K55C 1XA1A 1YSPA 3KSHA 4N92A 1FCNA 2A24B 5K5BA 2WKRA 4S2IA 4EUVA 1PWCA 2ZOIA 3LIFA 4MNRA 1GHPA 5AVFA 3I7JA 2XF3A 1PZPA 4KUOA 5IU1A 5BOHA 5HL6A 2W3HA 4FD8A 2PR6A 3LI8A 1A0KA 4GN2A 4HQAA 2XD5A 1CK3A 4UQIS 1EW0A 4ZBEA 5F6AA 3IF5A 4II7A 2A49A 3AGEA 2Y2NA 2J8YA 4N1HA 4I38A 2Y2OA 4LENA 3ULFA 2JN7A 2WGWB 5CTNA 1NYYA 3VE4A 4IUHA 1ERQA 3ITBA 2E8JA 1ES3A 3MKFA 2EX9A 4R3JA 3V39A 5FA7A 2Z6DA 3HLWA 1K38A 3RH8B 1PFLA 4LLOB 3HUNA 3FWLA 5IT5A 2ZQAA 3V3RA 4Q0JA 3T1QB 4DJ2A 3OLOA 4HI4A 3RTYA 4WMCD 3ZG7B 3IBJA 3O87A 2ZL1A 4N1XA 3CPTA 5GLDA 4HJ4A 2V9AA 3IXGA 2HZ5A 2KOIA 2P7JA 4E3NA 2H10A 5HFOA 3PBNA 2O9AA 3BQ8A 3HLFA 2NUPC 3GV9A 1V9ZA 1DJCA 5KIZA 4GCZA 2W27A 3IWQA 3UPPA 2Y4AA 4X1MA 4MCWA 1H0MA 3S7QA 1EWZA 2HP5A 2OLUA 1ERMA 1MWTA 2ZMAA 1YMSA 4Q8IA 2BASA 1GSWA 3P98A 1OTAA 1OTIA 4PHTA 3OPHA 5F1GA 1W63M 4E3LA 3F1PB 1FCOA 1CF0A 3V67A 5CTMA 2ZMVA 4BLMA 1LT0A 3UE0A 4N9KA 4PM8A 3EWKA 1VETB 2DCFA 2EFXA 4GS9A 3ZHHA 2OSUA 1VB6A 2HDSA 3MFXA 1ONHA 1NYMA 4MN5A 1WA9A 3OCNA 3LIEA 4KZ7A 4LV0A 3H7WA 1K54A 1FIKA 1FCMA 2H0TA 2WK0A 3MBZA 1XJ4A 4RQ9A 5JYOA 1K4FA 2O9CA 5CGWA 1SKFA 3O88A 3VP4A 4FH2A 5AQ9A 1I5QA 4UA7A 2PAVP 4Y3IA 2Q9MA 2W0NA 1S0WA 4JGPA 3PBRA 3VP1A 3NDEA 1DJAA 4OVDA 3EGXC 4Z1WA 1K55A 2CC1A 4EERA 4ID4A 4BQMA 4OH0A 4OPZA 4XT2B 3C7UA 3FKWA 4DN0A 3BECA 4B93A 3HLBA 3UY6A 2Y8HA 3ZVWA 3QP6A 1KE4A 1N9NA 2P04A 1ODVA 3QNBA 3IX4A 1DRMA 3TSGA 5J7EA 4MDZA 1JTDA 3CI6A 3UO9A 3D9YA 4CLCE 4BMWA 1EROA 1K0KA 3E0YA 4HNBA 3SH8A 3E4QA 5HPIA 2QZ6A 2X71A 1BUEA 5DFYA 3K3DA 3AGFA 4LV2A 2V1BA 3VSLA 2XA7M 2YKFA 3PAEA 2B18A 2BLSA 2I9VA 3HUMA 3LR5A 1YM1A 3VFHA 2VKSA 2JBFA 3MXSA 2O9BA 1BZAA 2J3TC 3ZGAB 5FAQA 4EETB 1IKIA 4ETXA 2HP9A 5J8XA 3UE1A 3UNWA 2PRFA 5DTSA 1LSVA 2R9WA 1H8MA 5DFXA 5AQ7A 1XP4A 4GKUA 3BLSA 4HOIA 2Y79A 5D3OA 3HJKA 2JKTI 2QYBA 3F1NA 1N9BA 4JF5A 4S2NC 4E3IA 1XX2A 4B9OA 2D01A 4K0XA 3NJAA 2WAEA 5CHMA 2PBDP 1S4RA 3BYDA 1NZOA 1E25A 2EWWA 2QJ5A 1PRQA 4CLCD 4E3KA 4E6WA 4WZ4A 5DJTA 4UA6A 3SH9A 4BBVA 2VV8A 5HZHA 3NOUC 5EOOA 3QP5A 1IYOA 2P9VA 4IVIA 4HBTA 2L1MA 3ZG8B 4K91A 5DKKA 3O3VA 4E3OA 4E04A 1MC0A 3A3IA 2DRWA 3W2ZA 4UQIM 1PW8A 4NKPA 5AQBA 3S4XA 3VFFA 1CJFA 1XKZA 4NXFA 5FSRA 3BFDA 3W8KA 2L4RA 3HLEA 1G6OA 1KGFA 1YLWA 2WADA 4WM9A 2XGNA 3NOTC 5HDSA 1PIOA 2C6WB 4MMNA 4X25A 4B4XA 2J9OA 3BY9A 3CMZA 1K6RA 2M1CA 1ES2A 3QP1A 4DF6A 1NWZA 3P09A 3C4OA 1KVLA 1F98A 1MZUA 4OOYA 3SS4A 4UHUA 3IX3A 4GB7A 4MBHA 3EEAA 5F69A 5EVIC 4F3LA 4HESA 3IXHA 4GDBA 4ME4A 4U0TA 3UB5P 3UDFA 3UE6A 2Y55A 1YLPA 3KSGA 4R4SA 4Y0UA 4IBXA 1XJ6A 4NXBA 3K2NA 2A2LA 3NOPC 4WL9A 2X02A 2NUTC 1PWGA 3B33A 4R1GA 1LSWA 3C5AA 2V8FA 3Q7ZA 4KZ5A 4ARZA 1T1BA 1S4SA 2QJ7A 3MXQA 2EFUA 3G4PA 3QHYA 2Z2MB 3BLMA 1XXMA 4DE0A 2J3WA 2K31A 5E2GA 3LYXA 4CLCB 2ZQ7A 1NRJA 2W3EA 1KGEA 4P85A 4H6JB 3N8SA 4EESA 3SH7A 1G28A 1XJ2A 4IVKA 4JGRA 2ZQCA 5HD5A 4ZJ3A 2FH5A 2XSSA 3UMDA 3K3CA 1M40A 4DXCA 1OJ5A 3EQUA 1BTLA 4BL3A 5CHUA 3CITA 3BFGA 1W8YA 4HH3A 2UWXA 1TS6A 2VV7A 1HD8A 5L10A 4OPYA 4EBLA 4IBRA 4LRYC 4RVAA 3S7NA 2LB5A 5EOEA 3SW1A 2M7UA 1OJGA 2PR5A 4LV1A 3IXBA 2HJEA 4MN7A 3G32A 5J3WA 4S2NA 4DE1A 1RGZA 3BJNA 4C75A 5L8MA 4PKYA 5FAOA 4DJ3A 5AQAA 3VOLA 4ZDXA 4FCFA 3HLDA 3LIAA 2XH9A 1SKOB 3ZVTA 3BFCA 3RFBA 1CI9A 2VA0A 1E3UD 4S2KA 4CJNA 1VHMA 4PAUA 2A24A 2UV0E 2IWCA 3JVUA 1LSXA 1OT9A 4OQ0A 1JWPA 3WWXA 4KZAA 3D4FA 3FV7A 1UWNX 5U47A 1JVJA 5A8BA 2ZM8A 3H9WA 5TGFA 2H5SA 1GHMA 1YLJA 2PU2A 5E2FA 5FASA 3C4PA 3MS6A 3ZG0A 3AGDA 4DE3A 1I2WA 2XR0A 3MJQA 4Y7PA 3V50A 3G2ZA 4LFUA 1NLZA 2HV1A 3DTIA 3E4OA 3Q7VA 2WGWA 4PM9A 5GHYA 5CEBA 4HBUA 4DE2A 2JKRI 5F5YA 1S1ZA 3BFFA 5F82A 4EQ1A 1PW1A 4R70A 4JF4A 5EVIA 5HAIA 3HBRA 1P9WA 1YLYA 3LFVA 1H8ZA 3A3JA 5EE8A 4JF6A 4HY8A 1TVFA 4X56A 2B02A 2V2FF 1KVMA 4LCMA 1RP5A 2ACGA 3HL9A 3NC8A 4Q0HA 5I5LA 1D06A 4IUKA 3RXXA 4EBPA 4EBNA 5HAPA 1F5MA 1RGYA 3VMAA 3KSFA 2XFSA 3IWOA 1Q2QA 4Y5FA 1SDEA 3IF6C 2V0UA 3WS1A 4QY6A 1Y54A 1IELA 5FEGA 1SDNA 1DY6A 3PBSA 1MWRA 3IT9A 3IWIA 1AXBA 3GRJA 1K57C 1YMXA 4R3BA 3F1PA 3IH9A 1Y4OA 1ES4A 4EUZA 1CI8A 4YOFA 3ZG5A 2V8CA 4I5SA 1NLYA 4KENB 2PU4A 1YLZA 3ZNTA 3GVBA 2Q9NA 5IS1A 4XXRA 4WLAA 3SOIA 3N4IA 2ZL1B 4BWIA 2OAP1 1XFQA 5MC7A 4Q0IA 1H3QA 3GSGA 4FTXA 5A90A 4LRZE 5TBMB 1LI9A 3NECA 1VEUA 3KX0X 4NG2A 4EV4A 4DKIA 3TJZC 3ZDJA 1D7EA 1TS8A 2PYPA 4X68A 1J9MA 1PNEA 1ZG4A 4LPZA 3HCYA 3ZYTA 1FSWA 2PBYA 2Y91A 4G3KA 1KGGA 2ZMFA 5HDCA 2J7VA 2ZM0A 5AVEA 4KG5A 1PI4A 2ZBBA 4X6TA 3UMEA 5FEFA 1ZHHB 4GHIA 3A3DA 1OTBA 1CEFA 3IHAA 4WMCA 4O8GA 4PM5A 3UE3A 3KO6A 4BENA 3KYZA 1JWVA 1FOFA 4S2OA 3B47A 2JE5A 3GECA 2GJ3A 3L9KA 2QKPA 3UB8A 4I3JA 4A5RA 2JCHA 4CLCC 1MKIA 1N4OA 3HVFA 1NY0A 5FQJA 2Y2LA 1Y28A 3IHBA 2WYXA 2ZLYA 3FPVA 4EXOA 2VGKA 3N6IA 3TW8A 3WS2A 2VJWA 5DVAA 2HP6A 4YINA 4DXBA 4X55A 4OQGA 2HPBA 5M18A 3G34A 3DTEA 4I3AA 4O0PA 1U60A 5HWTA 4HHDA 2VK3A 4GNUA 1KOUA 4OQHA 2VX8A 4WN5A 1FILA 3G6OA 1QMFA 5F83A 4X69A 1TS0A 2Y2JA 1FR6A 4FOFA 2ZQDA 5FDHA 3EGDC 2M7VA 3O86A 3S22A 3BQAA 3S7PA 1ZG6A 2HDUA 5HARA 5TFQA 5G4ZA 1S6RA 4HH2A 2X01A 1YPRA 2HDQA 3T50A 1ES5A 4P87A 3GMWA 3QP8A 3E98A 3PAGA 3C2WA 1NZUA 1XJ3A 3T4TA 4HIAA 2PDRA 3DWZA 4OOLA 3OCLA 4GJ4A 5F68A 1T1AA 2VZWA 5G4YA 4CPKA 3OOVA 3PXPA 1P9RA 3LO7A 3OBFA 3IF6A 2XEPA 3OZHA 1HTZA 2W1RA 3NDGA 3DBAA 4GD8A 1GCEA 1GSXA 4HP9A 1MXOA 1T1CA
chains in the Genus database with same CATH topology
3PBTA 4EESA 3LI8A 4HQAA 1G28A 1XJ2A 4NXGA 2QHKA 4GW9A 4JGRA 5HD3A 3A0SA 4UQIS 5HD5A 2FH5A 4XT2A 2XSSA 3UMDA 3T4OA 1EW0A 3K3CA 3R4KA 4GS9B 4QPRA 4II7A 4WELA 4R38A 4WUJA 5F6AA 3UB6A 1T18A 3BW6A 2YKHA 3T4JA 1OJ5A 3C38A 2L0WA 3EQUA 4GLQA 2D02A 3CITA 3A0VA 4I38A 3LUQA 3ULFA 4HH3A 2JN7A 1TS6A 2GNXA 2VV7A 3H7WB 4EEUA 3MQQA 3VE4A 2W3GA 4IUHA 4HP4A 4LRYC 2CMNA 3S7NA 1JNUA 2H28A 2LB5A 2KLIA 3P7NA 4BJPA 3SW1A 2M7UA 1OJGA 2Z6DA 3CLOA 2PR5A 3RH8B 2PD7A 4LLOB 4GHIB 2HJEA 4MN7A 5IT5A 5J3WA 4Q0JA 5C5KA 4DJ2A 3OLOA 4HI4A 1TD5A 3VV4A 3RTYA 1LL8A 3BJNA 4WF0A 3IBJA 1S1YA 5L8MA 4PKYA 4HJ4A 2V9AA 3U2AA 4DJ3A 2KOIA 2P7JA 3VOLA 1V9YA 3FC7A 5HDDA 3LIAA 3PBNA 2O9AA 3BQ8A 1T19A 2NUPC 4KUKA 1V9ZA 5KIZA 3RFBA 1MKMA 4GCZA 2VA0A 2W27A 3EOIA 1VHMA 1UGUA 4MCWA 4PAUA 2A24A 3S7QA 3ICYA 3JVUA 1LSXA 1OT9A 3CUEC 3BY8A 2PHYA 2BASA 1UWNX 3EQVA 1DP8A 1GSWA 3IS2B 1OTAA 1OTIA 5A8BA 4BBTA 3H9WA 4PHTA 2V0WA 4CLCA 1W63M 5CX7A 3LR3A 3F1PB 1OTDA 3O5YA 3V67A 4H6JA 2ZMVA 1BYWA 1LT0A 2OOLA 3LIBA 3LIDA 3EWKA 1N9OA 2VGLM 3PHYA 5J4EA 2QWSA 3LR4A 3PYPA 4GS9A 3MJQA 2W1TB 1ZTUA 1VB6A 5DF9A 3KSIA 4G3WA 3MFXA 3F1OA 1UWPX 4NEED 5HPFA 4MN5A 2FZ0A 1NLZA 2HV1A 3R7WA 1WA9A 3OCNA 3MQ0A 3E4OA 3LIEA 2K7SA 5FL3A 2IA2A 3H7WA 2JHEA 3NHQA 3F1NB 3BWLA 1STZA 1XJ4A 4RQ9A 2O9CA 5HWWA 2JKRI 5F5YA 1OPXA 1YKDA 1S1ZA 4YWZA 4EQ1A 3MQOA 4R70A 4Y3IA 4ARZB 1P9WA 2W0NA 4JGPA 3PBRA 2XRNA 3LFVA 4L9EA 1TS7A 5DJUA 4HY8A 3T4SA 3EGXC 3MF0A 4Z1WA 2Z6CA 2B02A 4EERA 3H82A 4IHQA 4EW7A 3OC2A 4Q0HA 5I5LA 4EEPA 1D06A 4IUKA 4XT2B 2HGVA 4DN0A 1P0ZA 1F5MA 3D3OA 4LRXC 3KSFA 1IOUA 4WEJA 4B93A 4Y5FA 2Y8HA 2R78A 2V0UA 1IFQA 1N9NA 3GDIA 2P04A 1ODVA 3LR0A 2WKPA 1DRMA 2J3TD 4UEYA 5J7EA 4MDZA 3PBSA 3CI6A 3IS2A 4CLCE 3EEHA 4BMWA 2MJ6A 3E0YA 2VLGA 4HNBA 3TE8A 3VE3A 3E4QA 5HPIA 4KQDA 5DFYA 3F1PA 3K3DA 2V1BA 2XA7M 2YKFA 4L9GA 5HSQA 2GZAA 2B18A 2VGLS 2I9VA 4YOFA 3LR5A 5KSHA 4I5SA 3FPWA 2VKSA 2W3DA 2O9BA 1NLYA 2J3TC 4P6ZM 2JKRM 4HJ3A 5LBRA 5IS1A 2GX5A 4WLAA 5EFWA 4EETB 4ETXA 3IBRA 3E4PA 2W1TA 4BWIA 2OAP1 1LSVA 1XFQA 2HF6A 1OT6A 2OWHA 5MC7A 1S67L 4PKYG 4Q0IA 2PYRA 3FG8A 3TRCA 1H8MA 5DFXA 2G7UA 1H3QA 4LRZE 4ZRRA 2EA9A 4WEKA 5TBMB 3KX0X 4HOIA 2Y79A 3HJKA 4NXEA 3PBOA 2JKTI 2QYBA 3MR0A 4CQHA 3F1NA 4L9FA 5TJJA 4F3LB 2VEAA 3TJZC 3C30A 3P01A 4I39A 2XROA 2O99A 1D7EA 1P97A 1TS8A 2PYPA 4B9OA 2D01A 2K2NA 4LPZA 3HCYA 4Y2FA 3ZYTA 2OWJA 1GSVA 3NJAA 4G3KA 2ZMFA 1S4RA 5HDCA 2KX6A 3S7OA 1DP9A 2EWWA 2QJ5A 5AVEA 4O01A 2ZBBA 3UMEA 4CLCD 4OOMA 3JVVA 5DKLA 4ETZA 5DJTA 1ZHHB 4GHIA 2HJ9C 1OTBA 4BBVA 2VV8A 4YNRA 2DMWA 4O8GA 1S66L 5HZHA 3PBQA 3UE3A 3KO6A 1YAXA 3LI9A 3CUEA 3KYZA 3NOUC 3T4KA 3C8CA 3B47A 3GECA 4BBUA 3F1OB 2GJ3A 2QKPA 2KDKA 3UB8A 3T4QA 4DMZA 4I3JA 3R7WB 4CLCC 2L1MA 4L0LA 5DKKA 1OTEA 2P08A 4E04A 4R6LA 1MC0A 1Y28A 3UB7A 3FPVA 3W2ZA 4EXOA 2XA7S 4UQIM 4FSFA 4NKPA 3TW8A 1W63Q 3T4LA 4NXFA 2VJWA 3LICA 5HWVA 4JGOA 2L4RA 4EU0A 2EWVA 4P6ZS 3CWFA 1G6OA 2JKTM 3MMHA 4I3AA 2ZOHA 3PR6A 4O0PA 4AFIA 2J80A 5HWTA 4HHDA 3NOTC 5HDSA 1KOUA 4K08A 1F9IA 1YSQA 4MMNA 3ZQ5A 2VX8A 2W3FA 4WN5A 4G3VA 3KYQA 3H82B 3BY9A 4MN6A 2M1CA 1NWZA 3G6OA 2PD8A 1MZUA 1F98A 1N9LA 1TS0A 4M4XA 5TBMA 2OAQ1 4FOFA 1DP6A 3CAXA 2PT7A 3EEAA 4KQOA 5F69A 1X0OA 3EGDC 2M7VA 4JGQA 3BQAA 3S7PA 2V1AA 4F3LA 4I3IA 3D72A 4ME4A 3HJIA 3UE6A 5G4ZA 1TF1A 2VV6A 3KSGA 1XJ6A 4HH2A 3T50A 4NXBA 3K2NA 2A2LA 3NOPC 4WL9A 5AJGA 2NUTC 4IJGA 1YSPA 3B33A 3E98A 3C2WA 3KSHA 3A0RA 1XJ3A 3T4TA 4HIAA 1XFNA 1LSWA 2PDRA 4OOLA 2A24B 3OCLA 5K5BA 2LB9A 4GJ4A 5F68A 1T1AA 2WKRA 2VZWA 5G4YA 3B42A 4EUVA 3OOVA 2ZOIA 4H6JB 3PXPA 3LIFA 4ARZA 1P9RA 1T1BA 3OBFA 1S4SA 2QJ7A 3MXQA 3UB9A 4HJ6A 5AVFA 4KUOA 2J3WA 2W1RA 2K31A 3DBAA 4R3AA 3LYXA 4CLCB 2WKQA 2INWA 5IU1A 5HL6A 1NRJA 2W3HA 2W3EA 1GSXA 4HP9A 2PR6A 2O0YA 1T1CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EES A;  3LI8 A;  4HQA A;  1G28 A;  1XJ2 A;  4NXG A;  2QHK A;  4GW9 A;  4JGR A;  5HD3 A;  3A0S A;  5HD5 A;  4XT2 A;  3UMD A;  1EW0 A;  3K3C A;  4GS9 B;  4WUJ A;  5F6A A;  4R38 A;  3UB6 A;  1T18 A;  2YKH A;  1OJ5 A;  2L0W A;  2D02 A;  3A0V A;  4I38 A;  3LUQ A;  3ULF A;  4HH3 A;  2JN7 A;  1TS6 A;  2VV7 A;  3H7W B;  4EEU A;  3MQQ A;  3VE4 A;  4HP4 A;  4LRY C;  2CMN A;  1JNU A;  2H28 A;  3P7N A;  3SW1 A;  1OJG A;  2Z6D A;  3CLO A;  2PR5 A;  3RH8 B;  2PD7 A;  4LLO B;  4GHI B;  5J3W A;  4DJ2 A;  3OLO A;  4HI4 A;  3RTY A;  1LL8 A;  4WF0 A;  1S1Y A;  4PKY A;  4HJ4 A;  2V9A A;  4DJ3 A;  2P7J A;  3VOL A;  1V9Y A;  3FC7 A;  5HDD A;  3LIA A;  1T19 A;  4KUK A;  1V9Z A;  5KIZ A;  4GCZ A;  2W27 A;  1UGU A;  2A24 A;  3ICY A;  1LSX A;  1OT9 A;  3BY8 A;  2PHY A;  2BAS A;  1UWN X;  1DP8 A;  1GSW A;  3IS2 B;  1OTA A;  1OTI A;  5A8B A;  4BBT A;  3H9W A;  2V0W A;  3F1P B;  1OTD A;  4H6J A;  1BYW A;  1LT0 A;  2OOL A;  3LIB A;  3LID A;  3EWK A;  1N9O A;  3PHY A;  5J4E A;  2QWS A;  3PYP A;  4GS9 A;  3MJQ A;  1VB6 A;  3MFX A;  3F1O A;  1UWP X;  4MN5 A;  2HV1 A;  1WA9 A;  3E4O A;  3LIE A;  2K7S A;  3H7W A;  2JHE A;  3NHQ A;  3F1N B;  3BWL A;  1XJ4 A;  4RQ9 A;  5HWW A;  5F5Y A;  1S1Z A;  4YWZ A;  4EQ1 A;  3MQO A;  4R70 A;  2W0N A;  4JGP A;  4L9E A;  1TS7 A;  5DJU A;  4HY8 A;  2Z6C A;  2B02 A;  4EER A;  3H82 A;  4EW7 A;  5I5L A;  4EEP A;  1D06 A;  4XT2 B;  1P0Z A;  4LRX C;  2R78 A;  2V0U A;  1N9N A;  3GDI A;  1ODV A;  2WKP A;  1DRM A;  5J7E A;  3IS2 A;  3EEH A;  2VLG A;  4HNB A;  3VE3 A;  3E4Q A;  4KQD A;  3F1P A;  3K3D A;  2V1B A;  4L9G A;  2YKF A;  5HSQ A;  2I9V A;  4I5S A;  4HJ3 A;  5IS1 A;  5EFW A;  4WLA A;  4EET B;  3IBR A;  3E4P A;  1LSV A;  1XFQ A;  1OT6 A;  2OWH A;  1S67 L;  4PKY G;  2PYR A;  3FG8 A;  4LRZ E;  2EA9 A;  5TBM B;  3KX0 X;  4HOI A;  3HJK A;  4NXE A;  3MR0 A;  3F1N A;  4L9F A;  4F3L B;  2VEA A;  4I39 A;  1D7E A;  1P97 A;  1TS8 A;  2PYP A;  4B9O A;  2D01 A;  4LPZ A;  2OWJ A;  1GSV A;  3NJA A;  1S4R A;  5HDC A;  2KX6 A;  1DP9 A;  2QJ5 A;  5AVE A;  2ZBB A;  3UME A;  5DKL A;  5DJT A;  4GHI A;  1OTB A;  4BBV A;  2VV8 A;  1S66 L;  5HZH A;  3LI9 A;  3NOU C;  3C8C A;  3GEC A;  4BBU A;  3F1O B;  2GJ3 A;  2QKP A;  2KDK A;  3UB8 A;  4I3J A;  2L1M A;  5DKK A;  1OTE A;  4E04 A;  4R6L A;  1Y28 A;  3UB7 A;  4EXO A;  4NXF A;  3LIC A;  5HWV A;  4JGO A;  2L4R A;  3CWF A;  4I3A A;  2ZOH A;  2J80 A;  5HWT A;  4HHD A;  5HDS A;  3NOT C;  1KOU A;  4K08 A;  1F9I A;  3ZQ5 A;  4WN5 A;  3H82 B;  3BY9 A;  4MN6 A;  2M1C A;  1NWZ A;  3G6O A;  2PD8 A;  1MZU A;  1F98 A;  1N9L A;  1TS0 A;  4M4X A;  5TBM A;  1DP6 A;  3CAX A;  5F69 A;  1X0O A;  4JGQ A;  2V1A A;  4F3L A;  4I3I A;  3D72 A;  3HJI A;  3UE6 A;  5G4Z A;  2VV6 A;  1XJ6 A;  4HH2 A;  3T50 A;  4NXB A;  3NOP C;  4WL9 A;  3B33 A;  3C2W A;  3A0R A;  1XJ3 A;  4HIA A;  1XFN A;  1LSW A;  2PDR A;  2A24 B;  5F68 A;  1T1A A;  2WKR A;  5G4Y A;  2ZOI A;  3LIF A;  1T1B A;  1S4S A;  2QJ7 A;  3MXQ A;  3UB9 A;  4HJ6 A;  5AVF A;  4KUO A;  4R3A A;  3LYX A;  2WKQ A;  5IU1 A;  2INW A;  1GSX A;  4HP9 A;  2PR6 A;  4H6J B;  1T1C A; 
#chains in the Genus database with same CATH topology
 3PBT A;  5CGX A;  1K57 A;  4NXG A;  4OP8 A;  2QHK A;  4GW9 A;  5KMW A;  3N8L A;  5HD3 A;  1MY8 A;  1FSY A;  2OV5 A;  3V5M A;  4PM7 A;  3E2L A;  4QPR A;  4WUJ A;  4WEL A;  5EEC A;  1T18 A;  1NJ4 A;  4GZB A;  3T4J A;  1BSG A;  2FFF B;  2L0W A;  1KDS A;  3LCE A;  3A0V A;  3LUQ A;  4S2M A;  4OON A;  2GNX A;  4EEU A;  1IYS A;  4ZAM A;  3MQQ A;  4HP4 A;  4D60 A;  2CMN A;  1JNU A;  2H28 A;  2KLI A;  4OP5 A;  2Y2P A;  4BJP A;  1IKG A;  1LL9 A;  1ACF A;  3T1X A;  3LEZ A;  3FZC A;  5C5K A;  1G5U A;  3VV4 A;  4Z9Q A;  4WBG A;  4S2J A;  1S1Y A;  5GHX A;  2P9V B;  3BM6 A;  1E4D A;  1V9Y A;  3ISG A;  4QY5 A;  1T19 A;  1PI5 A;  3ZNY A;  3GQZ A;  2XLN A;  2IWD A;  4S2L A;  1MKM A;  4WYY A;  5CED A;  3M2J A;  2EXA A;  3SZT A;  2I72 A;  2B5R A;  1UGU A;  2JKG A;  2XD1 A;  3ICY A;  3FYZ A;  3L7H A;  2Y2M A;  3BY8 A;  5FQI A;  3G2Y A;  1WYC A;  3HLC A;  2ZC7 A;  2PHY A;  4DDS A;  1JWZ A;  1DP8 A;  3IS2 B;  3FKV A;  5CRF A;  2ZQ9 A;  4CLC A;  3LR3 A;  1NRF A;  1BLC A;  1OTD A;  3B3X A;  4H6J A;  3N7W A;  5EPH A;  3WRZ A;  2OOL A;  3DAV A;  3MXR A;  3NIA A;  5J4E A;  3LR4 A;  3IXD A;  2W1T B;  5DF9 A;  5FQK A;  3F1O A;  4JBF A;  1UWP X;  1H5X A;  2A3U A;  3UPO A;  2FZ0 A;  3R7W A;  1K56 D;  2K7S A;  2XFT A;  5FL3 A;  2IA2 A;  3QP4 A;  3NHQ A;  3BWL A;  2Y2I A;  1STZ A;  3OPL A;  3RXW A;  1YKD A;  3MQO A;  3T12 B;  1TDG A;  4ARZ B;  2R9X A;  4Y15 A;  3VOZ A;  1M6K A;  2XRN A;  1ZC2 A;  4PM6 A;  1TS7 A;  1LI0 A;  3T4S A;  1PYY A;  2Z6C A;  4R4R A;  5HW3 A;  3H82 A;  3QNC A;  1ALQ A;  3BFE A;  4EEP A;  1SKO A;  1XGI A;  3D3O A;  4LRX C;  4WZ5 C;  4WEJ A;  4E3J A;  4E3M A;  3MZE A;  1HVB A;  4JPM A;  4JKT A;  1IFQ A;  3GDI A;  5E43 A;  2E8I A;  2WKP A;  3Q1F A;  3RJU A;  2WZX A;  2JC7 A;  1O7E A;  4KZ3 A;  4EQI A;  4GD6 A;  1BLH A;  2EX6 A;  3SS3 A;  5M1A A;  4KZ9 A;  3CJM A;  4PMA A;  3TE8 A;  2QPN A;  4L9G A;  5HSQ A;  4MBF A;  2VGL S;  5KSH A;  3FPW A;  3Q82 A;  2RL3 A;  4HJ3 A;  5LBR A;  3BEB A;  2XDM A;  3IH8 A;  3E4P A;  4NET A;  3DW0 A;  2OWH A;  2WGI A;  3BRM A;  1HLU P;  2OLV A;  3G31 A;  1Q2P A;  3DTM A;  2WUQ A;  4IED A;  3CG5 A;  4NXE A;  3MR0 A;  4QD4 A;  5TJJ A;  3C30 A;  3P01 A;  4I39 A;  2H0Y A;  4MBK A;  1P97 A;  4KQQ A;  2WAF A;  1W79 A;  5EM0 A;  3G35 A;  2OWJ A;  3IQA A;  1K6S A;  1HZO A;  4KZB A;  3S7O A;  3T1R A;  4O01 A;  3JYI A;  4OOM A;  5DKL A;  3NY4 A;  4KG6 A;  4PPR A;  3UDX A;  2HJ9 C;  1RCJ A;  5GHZ A;  3UDI A;  1CQA A;  1S66 L;  4MLL A;  2HDR A;  2WKH A;  3UN7 A;  3T1S A;  1BUL A;  3T4K A;  3C8C A;  5CGS A;  2KDK A;  2IWB A;  1YLT A;  1WYB A;  3T4Q A;  5FI2 A;  3LY4 A;  2GDN A;  5EVE A;  4UA9 A;  1L0E A;  1MWS A;  2P08 A;  3VOY A;  3Q7V B;  1E3U A;  4QB8 A;  4R6L A;  4B88 A;  4X1L A;  5DTT A;  1W63 Q;  1K4E A;  3T4L A;  4ESP A;  5HWV A;  3G30 A;  5EVI B;  3GTC A;  1FQG A;  2EWV A;  4P6Z S;  2JKT M;  3MMH A;  2ZOH A;  4FH4 A;  3PTE A;  2J80 A;  2JKF A;  1G6A A;  4OLD A;  4K08 A;  1F9I A;  1YSQ A;  4MEZ A;  3ZQ5 A;  2W3F A;  4Y17 A;  3Q81 A;  5CEC A;  1YQS A;  3MZD A;  1J3W A;  3MZF A;  1N9L A;  3NBL A;  4M4X A;  2Y2Q A;  5CXW A;  5TBM A;  1VET A;  3NI9 A;  1DP6 A;  3CAX A;  2PT7 A;  1DJB A;  4KQO A;  5GLB A;  5EUA A;  1X0O A;  4JGQ A;  2V1A A;  3D72 A;  4P6B A;  1D1J A;  3CPT B;  2VV6 A;  4XUX A;  5L07 A;  5DTK A;  5AJG A;  4IJG A;  1XA7 A;  3A0R A;  1XFN A;  3JPU A;  3ITA A;  3DWK A;  2LB9 A;  3B42 A;  4RX3 A;  3MSH A;  4WZ5 A;  1KE0 A;  2C5W B;  1IYP A;  3IX8 A;  5FQQ A;  3TOI A;  3UB9 A;  1LLB A;  4DRT A;  2ZC3 B;  4HJ6 A;  4JXG A;  4R3A A;  1MWU A;  5A93 A;  1I2S A;  2INW A;  2WKQ A;  5DF7 A;  3OPR A;  4O7D A;  2O0Y A;  1ESU A;  3HLG A;  3U4L P;  1W8Q A;  3A0S A;  1VEU B;  2BTF P;  4OPR A;  4RX2 A;  4XT2 A;  1AWI A;  3T4O A;  3R4K A;  4GS9 B;  4R38 A;  3SS5 A;  3UB6 A;  3BW6 A;  1L0F A;  2YKH A;  2WZZ A;  3C38 A;  3ZFZ A;  4GLQ A;  2D02 A;  4YFM A;  4X53 A;  4UAA A;  4LV3 A;  3H7W B;  3CZD A;  2W3G A;  4FUW A;  4QHC A;  3LY3 A;  4R23 A;  4BL2 A;  1GHI A;  3P7N A;  1MPL A;  1O07 A;  1WE4 A;  3CLO A;  2PD7 A;  4OKP A;  4GHI B;  3VP2 A;  2P74 A;  1YT4 A;  4KZ6 A;  1SZV A;  4C3Q A;  5CER A;  1IEM A;  1TD5 A;  2RCX A;  1LL8 A;  2EXB A;  4WF0 A;  5IHV A;  4JLF A;  3C7V A;  1BT5 A;  1C3B A;  2J9P A;  1L0D A;  1KE3 A;  1XPB A;  5L09 A;  3U2A A;  2ZQ8 A;  4R0Q A;  1ONG A;  4ZJ1 A;  3FC7 A;  5HDD A;  1JTG A;  2ZJ9 A;  4QU3 A;  4OLG A;  5E2H A;  4KUK A;  4Y0T A;  3EOI A;  5HL1 A;  5A91 A;  2G2U A;  1VM1 A;  5F1F A;  4EWF A;  3CUE C;  1NXY A;  2WKI A;  3EQV A;  1L3L A;  4BBT A;  5KZH A;  1BLP A;  1F2K A;  2V1Z A;  3GR2 A;  1VQQ A;  2V0W A;  4LGW A;  5CX7 A;  4N9L A;  3O5Y A;  1MBL A;  4BD0 A;  4JXV A;  1BYW A;  2ZM2 A;  4OQI A;  3LIB A;  4HEF A;  3LID A;  2VGJ A;  3ZCZ A;  2ZC4 B;  1N9O A;  4D2O A;  2VGL M;  1K25 A;  3PHY A;  2XQZ A;  2QWS A;  3KYE A;  3PYP A;  4B4Z A;  1Z6F A;  1ZTU A;  3KSI A;  4G3W A;  4RYE A;  1SHV A;  3WS4 A;  4F94 A;  3S1Y A;  1XGJ A;  5EVL A;  4NEE D;  5HPF A;  4Y0O A;  3MQ0 A;  4DDY A;  2QMI A;  1Z09 A;  4S2P A;  4Y13 A;  2JHE A;  1TDL A;  3F1N B;  3HUO A;  4QJG A;  5CHJ A;  5HWW A;  1OPX A;  4YWZ A;  3W4Q A;  3M6H A;  4GDN A;  3IF6 B;  5L2F A;  3Q07 A;  3CHW P;  1TEM A;  1PZO A;  4L9E A;  5G18 A;  5DJU A;  2ZD8 A;  3W4O A;  4KQR A;  1FR1 A;  5EM1 A;  2ZC6 B;  3MF0 A;  1W7F A;  3MKE A;  1LHY A;  1GA9 A;  4IHQ A;  4ZJ2 A;  2DNS A;  4EW7 A;  3OC2 A;  2V20 A;  1PWD A;  2HGV A;  1P0Z A;  2Q0O A;  1IOU A;  3MFD A;  2R78 A;  3WS0 A;  5GLA A;  2Y59 A;  3LR0 A;  5HX9 A;  2J3T D;  5HAQ A;  4UEY A;  1KDW A;  2B95 A;  2G2W A;  3IS2 A;  2EX8 A;  3EEH A;  2MJ6 A;  4KG2 A;  2VLG A;  3VE3 A;  2WGV A;  4KQD A;  2EX2 A;  3OPP A;  1QME A;  2GZA A;  1W5D A;  3VP3 A;  3LEQ A;  1ZKJ A;  4RA7 A;  5FDS A;  3NUL A;  4BD1 A;  2W3D A;  1IYQ A;  5FAT A;  4P6Z M;  2JKR M;  3ZG9 B;  2GX5 A;  5EFW A;  3VP0 A;  4H8R A;  3IBR A;  2W1T A;  3DTK A;  4KZ8 A;  1OME A;  2HF6 A;  2Z2L B;  1OT6 A;  5FQ9 A;  1S67 L;  4PKY G;  3TRC A;  2PYR A;  3FG8 A;  1CEG A;  2G7U A;  4P0M A;  3TG9 A;  4XUZ A;  1L0G A;  2Y2K A;  4NK3 A;  4ZRR A;  2EA9 A;  4WEK A;  4C6Y A;  4E6X A;  4U3T A;  5EV0 A;  3PBO A;  4CQH A;  4JXS A;  3A3E A;  4L9F A;  4F3L B;  2VEA A;  1SCW A;  3HRE A;  3N8R A;  2XRO A;  2O99 A;  3E2K A;  3LGO A;  5FQM A;  3UPN A;  2K2N A;  4Y2F A;  1GSV A;  5FI6 A;  2KX6 A;  1DP9 A;  4K0W A;  4QWO A;  1H8Y A;  3JVV A;  4KZ4 A;  2AVX A;  4M3K A;  4ETZ A;  2XK1 A;  5FI7 A;  5M19 A;  4YNR A;  2DMW A;  3PBQ A;  4LCL A;  1YAX A;  3LI9 A;  1GA0 A;  3CUE A;  4JXW A;  4BBU A;  3F1O B;  3M2K A;  3VSK A;  4DMZ A;  3R7W B;  2Y2G A;  4L0L A;  3NCK A;  1OTE A;  1ESI A;  3UB7 A;  2XA7 S;  3QP2 A;  4FSF A;  3WS5 A;  1G68 A;  2BG1 A;  3LIC A;  4ZTK A;  5A92 A;  4JGO A;  5TR7 A;  4EU0 A;  3CWF A;  5GLC A;  3M6B A;  3PR6 A;  5EVI D;  4AFI A;  2WKE A;  4GOG A;  2FFY A;  2ZC5 B;  3A3F A;  4G3V A;  3KYQ A;  3H82 B;  4MN6 A;  1K54 C;  2PD8 A;  5DF8 A;  5E2E A;  2OAQ 1;  3W4P A;  1L2S A;  1LL5 A;  1EI5 A;  5FAP A;  4I3I A;  5GL9 A;  4OPQ A;  5KSC A;  5I94 A;  3WRT A;  3HJI A;  1K56 A;  5JYP A;  2Y2H A;  1TF1 A;  4U0X A;  3V3S A;  1BLS A;  1K55 C;  1XA1 A;  1YSP A;  3KSH A;  4N92 A;  1FCN A;  2A24 B;  5K5B A;  2WKR A;  4S2I A;  4EUV A;  1PWC A;  2ZOI A;  3LIF A;  4MNR A;  1GHP A;  5AVF A;  3I7J A;  2XF3 A;  1PZP A;  4KUO A;  5IU1 A;  5BOH A;  5HL6 A;  2W3H A;  4FD8 A;  2PR6 A;  3LI8 A;  1A0K A;  4GN2 A;  4HQA A;  2XD5 A;  1CK3 A;  4UQI S;  1EW0 A;  4ZBE A;  5F6A A;  3IF5 A;  4II7 A;  2A49 A;  3AGE A;  2Y2N A;  2J8Y A;  4N1H A;  4I38 A;  2Y2O A;  4LEN A;  3ULF A;  2JN7 A;  2WGW B;  5CTN A;  1NYY A;  3VE4 A;  4IUH A;  1ERQ A;  3ITB A;  2E8J A;  1ES3 A;  3MKF A;  2EX9 A;  4R3J A;  3V39 A;  5FA7 A;  2Z6D A;  3HLW A;  1K38 A;  3RH8 B;  1PFL A;  4LLO B;  3HUN A;  3FWL A;  5IT5 A;  2ZQA A;  3V3R A;  4Q0J A;  3T1Q B;  4DJ2 A;  3OLO A;  4HI4 A;  3RTY A;  4WMC D;  3ZG7 B;  3IBJ A;  3O87 A;  2ZL1 A;  4N1X A;  3CPT A;  5GLD A;  4HJ4 A;  2V9A A;  3IXG A;  2HZ5 A;  2KOI A;  2P7J A;  4E3N A;  2H10 A;  5HFO A;  3PBN A;  2O9A A;  3BQ8 A;  3HLF A;  2NUP C;  3GV9 A;  1V9Z A;  1DJC A;  5KIZ A;  4GCZ A;  2W27 A;  3IWQ A;  3UPP A;  2Y4A A;  4X1M A;  4MCW A;  1H0M A;  3S7Q A;  1EWZ A;  2HP5 A;  2OLU A;  1ERM A;  1MWT A;  2ZMA A;  1YMS A;  4Q8I A;  2BAS A;  1GSW A;  3P98 A;  1OTA A;  1OTI A;  4PHT A;  3OPH A;  5F1G A;  1W63 M;  4E3L A;  3F1P B;  1FCO A;  1CF0 A;  3V67 A;  5CTM A;  2ZMV A;  4BLM A;  1LT0 A;  3UE0 A;  4N9K A;  4PM8 A;  3EWK A;  1VET B;  2DCF A;  2EFX A;  4GS9 A;  3ZHH A;  2OSU A;  1VB6 A;  2HDS A;  3MFX A;  1ONH A;  1NYM A;  4MN5 A;  1WA9 A;  3OCN A;  3LIE A;  4KZ7 A;  4LV0 A;  3H7W A;  1K54 A;  1FIK A;  1FCM A;  2H0T A;  2WK0 A;  3MBZ A;  1XJ4 A;  4RQ9 A;  5JYO A;  1K4F A;  2O9C A;  5CGW A;  1SKF A;  3O88 A;  3VP4 A;  4FH2 A;  5AQ9 A;  1I5Q A;  4UA7 A;  2PAV P;  4Y3I A;  2Q9M A;  2W0N A;  1S0W A;  4JGP A;  3PBR A;  3VP1 A;  3NDE A;  1DJA A;  4OVD A;  3EGX C;  4Z1W A;  1K55 A;  2CC1 A;  4EER A;  4ID4 A;  4BQM A;  4OH0 A;  4OPZ A;  4XT2 B;  3C7U A;  3FKW A;  4DN0 A;  3BEC A;  4B93 A;  3HLB A;  3UY6 A;  2Y8H A;  3ZVW A;  3QP6 A;  1KE4 A;  1N9N A;  2P04 A;  1ODV A;  3QNB A;  3IX4 A;  1DRM A;  3TSG A;  5J7E A;  4MDZ A;  1JTD A;  3CI6 A;  3UO9 A;  3D9Y A;  4CLC E;  4BMW A;  1ERO A;  1K0K A;  3E0Y A;  4HNB A;  3SH8 A;  3E4Q A;  5HPI A;  2QZ6 A;  2X71 A;  1BUE A;  5DFY A;  3K3D A;  3AGF A;  4LV2 A;  2V1B A;  3VSL A;  2XA7 M;  2YKF A;  3PAE A;  2B18 A;  2BLS A;  2I9V A;  3HUM A;  3LR5 A;  1YM1 A;  3VFH A;  2VKS A;  2JBF A;  3MXS A;  2O9B A;  1BZA A;  2J3T C;  3ZGA B;  5FAQ A;  4EET B;  1IKI A;  4ETX A;  2HP9 A;  5J8X A;  3UE1 A;  3UNW A;  2PRF A;  5DTS A;  1LSV A;  2R9W A;  1H8M A;  5DFX A;  5AQ7 A;  1XP4 A;  4GKU A;  3BLS A;  4HOI A;  2Y79 A;  5D3O A;  3HJK A;  2JKT I;  2QYB A;  3F1N A;  1N9B A;  4JF5 A;  4S2N C;  4E3I A;  1XX2 A;  4B9O A;  2D01 A;  4K0X A;  3NJA A;  2WAE A;  5CHM A;  2PBD P;  1S4R A;  3BYD A;  1NZO A;  1E25 A;  2EWW A;  2QJ5 A;  1PRQ A;  4CLC D;  4E3K A;  4E6W A;  4WZ4 A;  5DJT A;  4UA6 A;  3SH9 A;  4BBV A;  2VV8 A;  5HZH A;  3NOU C;  5EOO A;  3QP5 A;  1IYO A;  2P9V A;  4IVI A;  4HBT A;  2L1M A;  3ZG8 B;  4K91 A;  5DKK A;  3O3V A;  4E3O A;  4E04 A;  1MC0 A;  3A3I A;  2DRW A;  3W2Z A;  4UQI M;  1PW8 A;  4NKP A;  5AQB A;  3S4X A;  3VFF A;  1CJF A;  1XKZ A;  4NXF A;  5FSR A;  3BFD A;  3W8K A;  2L4R A;  3HLE A;  1G6O A;  1KGF A;  1YLW A;  2WAD A;  4WM9 A;  2XGN A;  3NOT C;  5HDS A;  1PIO A;  2C6W B;  4MMN A;  4X25 A;  4B4X A;  2J9O A;  3BY9 A;  3CMZ A;  1K6R A;  2M1C A;  1ES2 A;  3QP1 A;  4DF6 A;  1NWZ A;  3P09 A;  3C4O A;  1KVL A;  1F98 A;  1MZU A;  4OOY A;  3SS4 A;  4UHU A;  3IX3 A;  4GB7 A;  4MBH A;  3EEA A;  5F69 A;  5EVI C;  4F3L A;  4HES A;  3IXH A;  4GDB A;  4ME4 A;  4U0T A;  3UB5 P;  3UDF A;  3UE6 A;  2Y55 A;  1YLP A;  3KSG A;  4R4S A;  4Y0U A;  4IBX A;  1XJ6 A;  4NXB A;  3K2N A;  2A2L A;  3NOP C;  4WL9 A;  2X02 A;  2NUT C;  1PWG A;  3B33 A;  4R1G A;  1LSW A;  3C5A A;  2V8F A;  3Q7Z A;  4KZ5 A;  4ARZ A;  1T1B A;  1S4S A;  2QJ7 A;  3MXQ A;  2EFU A;  3G4P A;  3QHY A;  2Z2M B;  3BLM A;  1XXM A;  4DE0 A;  2J3W A;  2K31 A;  5E2G A;  3LYX A;  4CLC B;  2ZQ7 A;  1NRJ A;  2W3E A;  1KGE A;  4P85 A;  4H6J B;  3N8S A;  4EES A;  3SH7 A;  1G28 A;  1XJ2 A;  4IVK A;  4JGR A;  2ZQC A;  5HD5 A;  4ZJ3 A;  2FH5 A;  2XSS A;  3UMD A;  3K3C A;  1M40 A;  4DXC A;  1OJ5 A;  3EQU A;  1BTL A;  4BL3 A;  5CHU A;  3CIT A;  3BFG A;  1W8Y A;  4HH3 A;  2UWX A;  1TS6 A;  2VV7 A;  1HD8 A;  5L10 A;  4OPY A;  4EBL A;  4IBR A;  4LRY C;  4RVA A;  3S7N A;  2LB5 A;  5EOE A;  3SW1 A;  2M7U A;  1OJG A;  2PR5 A;  4LV1 A;  3IXB A;  2HJE A;  4MN7 A;  3G32 A;  5J3W A;  4S2N A;  4DE1 A;  1RGZ A;  3BJN A;  4C75 A;  5L8M A;  4PKY A;  5FAO A;  4DJ3 A;  5AQA A;  3VOL A;  4ZDX A;  4FCF A;  3HLD A;  3LIA A;  2XH9 A;  1SKO B;  3ZVT A;  3BFC A;  3RFB A;  1CI9 A;  2VA0 A;  1E3U D;  4S2K A;  4CJN A;  1VHM A;  4PAU A;  2A24 A;  2UV0 E;  2IWC A;  3JVU A;  1LSX A;  1OT9 A;  4OQ0 A;  1JWP A;  3WWX A;  4KZA A;  3D4F A;  3FV7 A;  1UWN X;  5U47 A;  1JVJ A;  5A8B A;  2ZM8 A;  3H9W A;  5TGF A;  2H5S A;  1GHM A;  1YLJ A;  2PU2 A;  5E2F A;  5FAS A;  3C4P A;  3MS6 A;  3ZG0 A;  3AGD A;  4DE3 A;  1I2W A;  2XR0 A;  3MJQ A;  4Y7P A;  3V50 A;  3G2Z A;  4LFU A;  1NLZ A;  2HV1 A;  3DTI A;  3E4O A;  3Q7V A;  2WGW A;  4PM9 A;  5GHY A;  5CEB A;  4HBU A;  4DE2 A;  2JKR I;  5F5Y A;  1S1Z A;  3BFF A;  5F82 A;  4EQ1 A;  1PW1 A;  4R70 A;  4JF4 A;  5EVI A;  5HAI A;  3HBR A;  1P9W A;  1YLY A;  3LFV A;  1H8Z A;  3A3J A;  5EE8 A;  4JF6 A;  4HY8 A;  1TVF A;  4X56 A;  2B02 A;  2V2F F;  1KVM A;  4LCM A;  1RP5 A;  2ACG A;  3HL9 A;  3NC8 A;  4Q0H A;  5I5L A;  1D06 A;  4IUK A;  3RXX A;  4EBP A;  4EBN A;  5HAP A;  1F5M A;  1RGY A;  3VMA A;  3KSF A;  2XFS A;  3IWO A;  1Q2Q A;  4Y5F A;  1SDE A;  3IF6 C;  2V0U A;  3WS1 A;  4QY6 A;  1Y54 A;  1IEL A;  5FEG A;  1SDN A;  1DY6 A;  3PBS A;  1MWR A;  3IT9 A;  3IWI A;  1AXB A;  3GRJ A;  1K57 C;  1YMX A;  4R3B A;  3F1P A;  3IH9 A;  1Y4O A;  1ES4 A;  4EUZ A;  1CI8 A;  4YOF A;  3ZG5 A;  2V8C A;  4I5S A;  1NLY A;  4KEN B;  2PU4 A;  1YLZ A;  3ZNT A;  3GVB A;  2Q9N A;  5IS1 A;  4XXR A;  4WLA A;  3SOI A;  3N4I A;  2ZL1 B;  4BWI A;  2OAP 1;  1XFQ A;  5MC7 A;  4Q0I A;  1H3Q A;  3GSG A;  4FTX A;  5A90 A;  4LRZ E;  5TBM B;  1LI9 A;  3NEC A;  1VEU A;  3KX0 X;  4NG2 A;  4EV4 A;  4DKI A;  3TJZ C;  3ZDJ A;  1D7E A;  1TS8 A;  2PYP A;  4X68 A;  1J9M A;  1PNE A;  1ZG4 A;  4LPZ A;  3HCY A;  3ZYT A;  1FSW A;  2PBY A;  2Y91 A;  4G3K A;  1KGG A;  2ZMF A;  5HDC A;  2J7V A;  2ZM0 A;  5AVE A;  4KG5 A;  1PI4 A;  2ZBB A;  4X6T A;  3UME A;  5FEF A;  1ZHH B;  4GHI A;  3A3D A;  1OTB A;  1CEF A;  3IHA A;  4WMC A;  4O8G A;  4PM5 A;  3UE3 A;  3KO6 A;  4BEN A;  3KYZ A;  1JWV A;  1FOF A;  4S2O A;  3B47 A;  2JE5 A;  3GEC A;  2GJ3 A;  3L9K A;  2QKP A;  3UB8 A;  4I3J A;  4A5R A;  2JCH A;  4CLC C;  1MKI A;  1N4O A;  3HVF A;  1NY0 A;  5FQJ A;  2Y2L A;  1Y28 A;  3IHB A;  2WYX A;  2ZLY A;  3FPV A;  4EXO A;  2VGK A;  3N6I A;  3TW8 A;  3WS2 A;  2VJW A;  5DVA A;  2HP6 A;  4YIN A;  4DXB A;  4X55 A;  4OQG A;  2HPB A;  5M18 A;  3G34 A;  3DTE A;  4I3A A;  4O0P A;  1U60 A;  5HWT A;  4HHD A;  2VK3 A;  4GNU A;  1KOU A;  4OQH A;  2VX8 A;  4WN5 A;  1FIL A;  3G6O A;  1QMF A;  5F83 A;  4X69 A;  1TS0 A;  2Y2J A;  1FR6 A;  4FOF A;  2ZQD A;  5FDH A;  3EGD C;  2M7V A;  3O86 A;  3S22 A;  3BQA A;  3S7P A;  1ZG6 A;  2HDU A;  5HAR A;  5TFQ A;  5G4Z A;  1S6R A;  4HH2 A;  2X01 A;  1YPR A;  2HDQ A;  3T50 A;  1ES5 A;  4P87 A;  3GMW A;  3QP8 A;  3E98 A;  3PAG A;  3C2W A;  1NZU A;  1XJ3 A;  3T4T A;  4HIA A;  2PDR A;  3DWZ A;  4OOL A;  3OCL A;  4GJ4 A;  5F68 A;  1T1A A;  2VZW A;  5G4Y A;  4CPK A;  3OOV A;  3PXP A;  1P9R A;  3LO7 A;  3OBF A;  3IF6 A;  2XEP A;  3OZH A;  1HTZ A;  2W1R A;  3NDG A;  3DBA A;  4GD8 A;  1GCE A;  1GSX A;  4HP9 A;  1MXO A;  1T1C A; 
#chains in the Genus database with same CATH homology
 3PBT A;  4EES A;  3LI8 A;  4HQA A;  1G28 A;  1XJ2 A;  4NXG A;  2QHK A;  4GW9 A;  4JGR A;  5HD3 A;  3A0S A;  4UQI S;  5HD5 A;  2FH5 A;  4XT2 A;  2XSS A;  3UMD A;  3T4O A;  1EW0 A;  3K3C A;  3R4K A;  4GS9 B;  4QPR A;  4II7 A;  4WEL A;  4R38 A;  4WUJ A;  5F6A A;  3UB6 A;  1T18 A;  3BW6 A;  2YKH A;  3T4J A;  1OJ5 A;  3C38 A;  2L0W A;  3EQU A;  4GLQ A;  2D02 A;  3CIT A;  3A0V A;  4I38 A;  3LUQ A;  3ULF A;  4HH3 A;  2JN7 A;  1TS6 A;  2GNX A;  2VV7 A;  3H7W B;  4EEU A;  3MQQ A;  3VE4 A;  2W3G A;  4IUH A;  4HP4 A;  4LRY C;  2CMN A;  3S7N A;  1JNU A;  2H28 A;  2LB5 A;  2KLI A;  3P7N A;  4BJP A;  3SW1 A;  2M7U A;  1OJG A;  2Z6D A;  3CLO A;  2PR5 A;  3RH8 B;  2PD7 A;  4LLO B;  4GHI B;  2HJE A;  4MN7 A;  5IT5 A;  5J3W A;  4Q0J A;  5C5K A;  4DJ2 A;  3OLO A;  4HI4 A;  1TD5 A;  3VV4 A;  3RTY A;  1LL8 A;  3BJN A;  4WF0 A;  3IBJ A;  1S1Y A;  5L8M A;  4PKY A;  4HJ4 A;  2V9A A;  3U2A A;  4DJ3 A;  2KOI A;  2P7J A;  3VOL A;  1V9Y A;  3FC7 A;  5HDD A;  3LIA A;  3PBN A;  2O9A A;  3BQ8 A;  1T19 A;  2NUP C;  4KUK A;  1V9Z A;  5KIZ A;  3RFB A;  1MKM A;  4GCZ A;  2VA0 A;  2W27 A;  3EOI A;  1VHM A;  1UGU A;  4MCW A;  4PAU A;  2A24 A;  3S7Q A;  3ICY A;  3JVU A;  1LSX A;  1OT9 A;  3CUE C;  3BY8 A;  2PHY A;  2BAS A;  1UWN X;  3EQV A;  1DP8 A;  1GSW A;  3IS2 B;  1OTA A;  1OTI A;  5A8B A;  4BBT A;  3H9W A;  4PHT A;  2V0W A;  4CLC A;  1W63 M;  5CX7 A;  3LR3 A;  3F1P B;  1OTD A;  3O5Y A;  3V67 A;  4H6J A;  2ZMV A;  1BYW A;  1LT0 A;  2OOL A;  3LIB A;  3LID A;  3EWK A;  1N9O A;  2VGL M;  3PHY A;  5J4E A;  2QWS A;  3LR4 A;  3PYP A;  4GS9 A;  3MJQ A;  2W1T B;  1ZTU A;  1VB6 A;  5DF9 A;  3KSI A;  4G3W A;  3MFX A;  3F1O A;  1UWP X;  4NEE D;  5HPF A;  4MN5 A;  2FZ0 A;  1NLZ A;  2HV1 A;  3R7W A;  1WA9 A;  3OCN A;  3MQ0 A;  3E4O A;  3LIE A;  2K7S A;  5FL3 A;  2IA2 A;  3H7W A;  2JHE A;  3NHQ A;  3F1N B;  3BWL A;  1STZ A;  1XJ4 A;  4RQ9 A;  2O9C A;  5HWW A;  2JKR I;  5F5Y A;  1OPX A;  1YKD A;  1S1Z A;  4YWZ A;  4EQ1 A;  3MQO A;  4R70 A;  4Y3I A;  4ARZ B;  1P9W A;  2W0N A;  4JGP A;  3PBR A;  2XRN A;  3LFV A;  4L9E A;  1TS7 A;  5DJU A;  4HY8 A;  3T4S A;  3EGX C;  3MF0 A;  4Z1W A;  2Z6C A;  2B02 A;  4EER A;  3H82 A;  4IHQ A;  4EW7 A;  3OC2 A;  4Q0H A;  5I5L A;  4EEP A;  1D06 A;  4IUK A;  4XT2 B;  2HGV A;  4DN0 A;  1P0Z A;  1F5M A;  3D3O A;  4LRX C;  3KSF A;  1IOU A;  4WEJ A;  4B93 A;  4Y5F A;  2Y8H A;  2R78 A;  2V0U A;  1IFQ A;  1N9N A;  3GDI A;  2P04 A;  1ODV A;  3LR0 A;  2WKP A;  1DRM A;  2J3T D;  4UEY A;  5J7E A;  4MDZ A;  3PBS A;  3CI6 A;  3IS2 A;  4CLC E;  3EEH A;  4BMW A;  2MJ6 A;  3E0Y A;  2VLG A;  4HNB A;  3TE8 A;  3VE3 A;  3E4Q A;  5HPI A;  4KQD A;  5DFY A;  3F1P A;  3K3D A;  2V1B A;  2XA7 M;  2YKF A;  4L9G A;  5HSQ A;  2GZA A;  2B18 A;  2VGL S;  2I9V A;  4YOF A;  3LR5 A;  5KSH A;  4I5S A;  3FPW A;  2VKS A;  2W3D A;  2O9B A;  1NLY A;  2J3T C;  4P6Z M;  2JKR M;  4HJ3 A;  5LBR A;  5IS1 A;  2GX5 A;  4WLA A;  5EFW A;  4EET B;  4ETX A;  3IBR A;  3E4P A;  2W1T A;  4BWI A;  2OAP 1;  1LSV A;  1XFQ A;  2HF6 A;  1OT6 A;  2OWH A;  5MC7 A;  1S67 L;  4PKY G;  4Q0I A;  2PYR A;  3FG8 A;  3TRC A;  1H8M A;  5DFX A;  2G7U A;  1H3Q A;  4LRZ E;  4ZRR A;  2EA9 A;  4WEK A;  5TBM B;  3KX0 X;  4HOI A;  2Y79 A;  3HJK A;  4NXE A;  3PBO A;  2JKT I;  2QYB A;  3MR0 A;  4CQH A;  3F1N A;  4L9F A;  5TJJ A;  4F3L B;  2VEA A;  3TJZ C;  3C30 A;  3P01 A;  4I39 A;  2XRO A;  2O99 A;  1D7E A;  1P97 A;  1TS8 A;  2PYP A;  4B9O A;  2D01 A;  2K2N A;  4LPZ A;  3HCY A;  4Y2F A;  3ZYT A;  2OWJ A;  1GSV A;  3NJA A;  4G3K A;  2ZMF A;  1S4R A;  5HDC A;  2KX6 A;  3S7O A;  1DP9 A;  2EWW A;  2QJ5 A;  5AVE A;  4O01 A;  2ZBB A;  3UME A;  4CLC D;  4OOM A;  3JVV A;  5DKL A;  4ETZ A;  5DJT A;  1ZHH B;  4GHI A;  2HJ9 C;  1OTB A;  4BBV A;  2VV8 A;  4YNR A;  2DMW A;  4O8G A;  1S66 L;  5HZH A;  3PBQ A;  3UE3 A;  3KO6 A;  1YAX A;  3LI9 A;  3CUE A;  3KYZ A;  3NOU C;  3T4K A;  3C8C A;  3B47 A;  3GEC A;  4BBU A;  3F1O B;  2GJ3 A;  2QKP A;  2KDK A;  3UB8 A;  3T4Q A;  4DMZ A;  4I3J A;  3R7W B;  4CLC C;  2L1M A;  4L0L A;  5DKK A;  1OTE A;  2P08 A;  4E04 A;  4R6L A;  1MC0 A;  1Y28 A;  3UB7 A;  3FPV A;  3W2Z A;  4EXO A;  2XA7 S;  4UQI M;  4FSF A;  4NKP A;  3TW8 A;  1W63 Q;  3T4L A;  4NXF A;  2VJW A;  3LIC A;  5HWV A;  4JGO A;  2L4R A;  4EU0 A;  2EWV A;  4P6Z S;  3CWF A;  1G6O A;  2JKT M;  3MMH A;  4I3A A;  2ZOH A;  3PR6 A;  4O0P A;  4AFI A;  2J80 A;  5HWT A;  4HHD A;  3NOT C;  5HDS A;  1KOU A;  4K08 A;  1F9I A;  1YSQ A;  4MMN A;  3ZQ5 A;  2VX8 A;  2W3F A;  4WN5 A;  4G3V A;  3KYQ A;  3H82 B;  3BY9 A;  4MN6 A;  2M1C A;  1NWZ A;  3G6O A;  2PD8 A;  1MZU A;  1F98 A;  1N9L A;  1TS0 A;  4M4X A;  5TBM A;  2OAQ 1;  4FOF A;  1DP6 A;  3CAX A;  2PT7 A;  3EEA A;  4KQO A;  5F69 A;  1X0O A;  3EGD C;  2M7V A;  4JGQ A;  3BQA A;  3S7P A;  2V1A A;  4F3L A;  4I3I A;  3D72 A;  4ME4 A;  3HJI A;  3UE6 A;  5G4Z A;  1TF1 A;  2VV6 A;  3KSG A;  1XJ6 A;  4HH2 A;  3T50 A;  4NXB A;  3K2N A;  2A2L A;  3NOP C;  4WL9 A;  5AJG A;  2NUT C;  4IJG A;  1YSP A;  3B33 A;  3E98 A;  3C2W A;  3KSH A;  3A0R A;  1XJ3 A;  3T4T A;  4HIA A;  1XFN A;  1LSW A;  2PDR A;  4OOL A;  2A24 B;  3OCL A;  5K5B A;  2LB9 A;  4GJ4 A;  5F68 A;  1T1A A;  2WKR A;  2VZW A;  5G4Y A;  3B42 A;  4EUV A;  3OOV A;  2ZOI A;  4H6J B;  3PXP A;  3LIF A;  4ARZ A;  1P9R A;  1T1B A;  3OBF A;  1S4S A;  2QJ7 A;  3MXQ A;  3UB9 A;  4HJ6 A;  5AVF A;  4KUO A;  2J3W A;  2W1R A;  2K31 A;  3DBA A;  4R3A A;  3LYX A;  4CLC B;  2WKQ A;  2INW A;  5IU1 A;  5HL6 A;  1NRJ A;  2W3H A;  2W3E A;  1GSX A;  4HP9 A;  2PR6 A;  2O0Y A;  1T1C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...