5IU1A

N-terminal pas domain homodimer of ppanr map3k from physcomitrella patens.
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
106
structure length
106
Chain Sequence
FESQPCVSIDLRGNITSWNRAAEQLYQFKEGEVMGRNLVDLIVPPNAKTAALDTIMRVGQGEVWIGQFSCVRRDNAILNTVVTQKPILDDDQKISGISVCTEPYSM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CTR1-like protein
publication title Genetic Analysis of Physcomitrella patens Identifies ABSCISIC ACID NON-RESPONSIVE, a Regulator of ABA Responses Unique to Basal Land Plants and Required for Desiccation Tolerance.
pubmed doi rcsb
source organism Physcomitrella patens subsp. patens
molecule tags Plant protein
total genus 33
structure length 106
sequence length 106
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-03-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 5iu1A00
3E4PA 1XJ2A 2QJ7A 3NOPC 1DP6A 3UB8A 3P7NA 2HV1A 1OTEA 2V9AA 4M4XA 1OT6A 5J7EA 3H9WA 2D02A 2H28A 4EQ1A 4HJ6A 2Z6DA 2ZOIA 3IS2B 2D01A 1LL8A 4JGPA 3UE6A 3NHQA 4WN5A 3NOTC 3LIAA 3LUQA 3H82A 4YWZA 4HY8A 4HH2A 1EW0A 5HD5A 2QWSA 3T50A 1KOUA 4LRZE 1OTAA 2W0NA 3VOLA 2V1BA 2ZBBA 3H82B 1TS7A 1UWPX 2WKRA 2L1MA 5HDSA 4HJ4A 2R78A 5HWWA 5IU1A 2VEAA 4I3IA 1XJ3A 3B33A 1F98A 4KQDA 4HH3A 3LIBA 3A0VA 2V0UA 3MR0A 3PYPA 1MZUA 1Y28A 2WKQA 3NOUC 4EETB 3F1PA 1LT0A 5J3WA 3MQOA 5HSQA 3LYXA 3ULFA 1T1BA 1D7EA 1D06A 1N9LA 5TBMA 3F1PB 3K3DA 1S67L 3E4OA 4R70A 4HJ3A 5G4ZA 1OJ5A 1LSWA 3F1OA 2PD7A 4L9GA 1OTBA 2BASA 5AVEA 1T1CA 3C2WA 1S4SA 3FC7A 2KDKA 1T18A 2PDRA 5TBMB 3CAXA 5DKKA 2VV8A 1OTDA 4HP4A 4WUJA 1OT9A 2V0WA 4WL9A 1VB6A 3F1OB 1T1AA 3A0RA 5AVFA 2L4RA 2OWJA 3BY8A 3NJAA 1G28A 1DP8A 5F68A 2VV7A 3UB7A 5HDCA 3LIDA 3BY9A 4LRXC 3LI9A 4HOIA 4R38A 1V9YA 3G6OA 1XJ4A 4L9FA 2J80A 2OOLA 2I9VA 4LPZA 1UWNX 3UMEA 4HIAA 1NWZA 4I38A 2GJ3A 4XT2A 4I3JA 2INWA 1F9IA 2YKFA 2PYPA 1N9NA 5HD3A 1BYWA 4XT2B 4BBTA 5G4YA 3CWFA 4LRYC 5HWTA 3GECA 2QJ5A 4EXOA 2JN7A 4NXEA 4NXBA 4EESA 5HZHA 2PHYA 4R6LA 1LSXA 2PR5A 5DKLA 3CLOA 4RQ9A 1GSVA 3VE3A 5A8BA 4BBVA 4E04A 4HHDA 4I39A 5EFWA 1JNUA 4JGQA 4WF0A 4NXGA 1GSWA 4H6JA 5I5LA 4BBUA 3RH8B 1P97A 4HNBA 4HQAA 2ZOHA 4JGRA 3HJKA 2KX6A 3EWKA 1S1YA 4PKYA 1UGUA 4H6JB 2B02A 4L9EA 2PR6A 3ZQ5A 4F3LA 2PD8A 2V1AA 4MN6A 1WA9A 2Z6CA 4B9OA 5HWVA 2A24A 4HP9A 2M1CA 3MXQA 1GSXA 2WKPA 4WLAA 3K3CA 4EEPA 5F5YA 3IBRA 4F3LB 4HI4A 2JHEA 3IS2A 1DP9A 2OWHA 4DJ3A 2A24B 3H7WA 3MFXA 2QKPA 3LI8A 3HJIA 1TS8A 4EEUA 1XFNA 3SW1A 3LIFA 3MQQA 1S1ZA 1XJ6A 2CMNA 2P7JA 4KUOA 4PKYG 3RTYA 4EW7A 2K7SA 5J4EA 3H7WB 3ICYA 5HDDA 4KUKA 2QHKA 3LICA 2L0WA 1N9OA 4GS9A 4GW9A 1TS0A 5IS1A 1DRMA 4LLOB 2W27A 1ODVA 3EEHA 3FG8A 1P0ZA 4JGOA 2PYRA 3GDIA 1XFQA 3F1NA 4I3AA 1OTIA 3UMDA 1OJGA 4GCZA 4GS9B 1LSVA 5DJUA 3MJQA 2YKHA 4MN5A 3VE4A 4NXFA 3UB9A 3F1NB 3OLOA 4GHIA 3BWLA 4DJ2A 1T19A 3A0SA 2VV6A 5F6AA 1S66L 1TS6A 3D72A 2EA9A 1V9ZA 3E4QA 4GHIB 4EERA 3PHYA 3C8CA 4K08A 5F69A 5KIZA 4R3AA 1S4RA 1X0OA 3LIEA 5DJTA 3UB6A 3KX0X 4I5SA 2VLGA
chains in the Genus database with same CATH superfamily
3E4PA 3HUOA 2JC7A 3TOIA 1W7FA 1NRJA 2OAQ1 1E3UA 3UB8A 1E25A 3P7NA 3VFFA 4Y0UA 1PFLA 4A5RA 1CI8A 2NUPC 3BFFA 4ME4A 1PIOA 5E43A 2Y2MA 3H9WA 2ZQCA 2H28A 4EQ1A 4WELA 2ZOIA 5HFOA 5A91A 2WKHA 3LGOA 2HDQA 2JKRM 2B95A 1LL8A 4JGPA 3EQUA 3UE6A 1BTLA 2RCXA 3BW6A 1VM1A 2ZC3B 4G3KA 5CXWA 4HY8A 1C3BA 3IHAA 1FCMA 5EOOA 2QZ6A 4DXBA 1OTAA 2OAP1 4C6YA 3OCNA 4B93A 5L07A 2ZC7A 2ZBBA 2ZC4B 1ONHA 4EU0A 3P09A 3ZG5A 3PBSA 3ZVWA 1YM1A 2OLVA 1H8ZA 1JTDA 4HJ4A 2WGWA 1ONGA 2R78A 4ETZA 3M6BA 4P6ZM 2VGJA 2VEAA 5IU1A 3UNWA 4I3IA 1YSQA 2VGLS 4GB7A 3B33A 4HEFA 1F98A 1CEGA 4JF4A 4KQDA 3EOIA 1KE4A 3S4XA 5C5KA 3LIBA 3CPTA 3A0VA 2J8YA 1K56A 2Y55A 3LEQA 1TD5A 3PAGA 2M7VA 3PYPA 5FATA 3NOUC 3F1PA 4GKUA 5F1FA 3HLCA 3IF6B 5FAQA 2PU2A 2C5WB 3MQOA 5HSQA 3PTEA 3ULFA 1FSYA 3IX4A 3UPNA 5M1AA 4EQIA 1MWRA 2Y4AA 3R4KA 1S67L 3E4OA 5LBRA 3PBTA 4DN0A 3JYIA 3DTMA 1OJ5A 1LSWA 3F1OA 1LLBA 2PAVP 4NETA 4L9GA 1OTBA 1T1CA 3C5AA 3LFVA 4II7A 4EUZA 4Q0IA 4ZJ3A 5GHZA 1DJAA 2ZQ8A 4R4SA 2LB9A 2EFXA 4JXVA 4WL9A 4U0XA 2HDUA 2KOIA 1Q2PA 4H8RA 5E2FA 1ES5A 1T1AA 4X55A 1K4FA 2EWVA 2OWJA 4QHCA 3NBLA 2VV7A 4R3JA 2HP5A 4R4RA 4LRXC 4O0PA 1K57C 3LI9A 3S7QA 3WWXA 4X1LA 3MXRA 3SH8A 3G6OA 1XJ4A 1DJCA 3PBOA 2OOLA 1NWZA 2GJ3A 3S7NA 3V39A 2FFFB 4X69A 4I3JA 5A93A 3P98A 4K0WA 2WUQA 2Y59A 2Y2HA 4WBGA 3QP2A 1F9IA 2J7VA 3FKVA 3B47A 3VSKA 2Z2MB 1VQQA 2YKFA 5DFYA 4JF6A 4OLGA 4BBTA 5G4YA 4LRYC 2Q0OA 2QJ5A 2JN7A 1W8QA 3C4PA 1BSGA 4OOYA 4RYEA 4EESA 4JF5A 4K0XA 1STZA 4GOGA 4E3OA 3GVBA 4Y13A 2Y2OA 3AGFA 1FILA 5HZHA 3Q7ZA 3G34A 4S2NA 2PHYA 4ZAMA 1LSXA 2PT7A 3CLOA 3QNBA 1GSVA 5FQ9A 5A8BA 3W2ZA 4CLCB 5EVIA 1S6RA 1E4DA 4HHDA 1HD8A 4JGQA 4WF0A 2HJ9C 4EUVA 3O87A 4OLDA 1YLWA 4U3TA 4B88A 3RH8B 5TFQA 1P97A 4HNBA 4MBFA 2ZOHA 3ZCZA 3A3FA 4IBXA 2KX6A 1ACFA 3K2NA 3QHYA 4H6JB 4ETXA 3S1YA 4QJGA 4F3LA 1W5DA 2PD8A 2V1AA 1XXMA 3KSGA 2W3EA 2Z6CA 4B9OA 3JVVA 3OOVA 1KGFA 5IT5A 4WLAA 3SS4A 1CEFA 2XR0A 1MBLA 4HI4A 4FSFA 1YAXA 2JBFA 2JHEA 3C4OA 3PR6A 3V3RA 3VP0A 3PBQA 5DF8A 2EXAA 5CECA 2G7UA 5L8MA 3BEBA 5CRFA 2O9BA 3H7WA 2VZWA 3QP1A 5I94A 1MWSA 4EEUA 5HPIA 4PAUA 1IYQA 3ZVTA 4KZ3A 2ZM2A 3NULA 1XGJA 5DF7A 2QPNA 2CMNA 3LO7A 3HLWA 5FQIA 1FCOA 3AGEA 4Q0JA 4KQQA 2A3UA 1DRMA 1KVMA 4LLOB 2XF3A 2ZQDA 4BD1A 2JE5A 2Z2LB 3FG8A 4CLCE 2ACGA 4I3AA 1OTIA 3UMDA 2P74A 1OJGA 2IWBA 1VETB 1SDNA 4JXGA 1K6SA 4KG6A 3MJQA 4L0LA 1ESUA 3OLOA 1MC0A 1T19A 4IHQA 2GNXA 5JYOA 5U47A 1S66L 1TS6A 3G30A 3G32A 4ARZA 1S0WA 2LB5A 1WE4A 4OQHA 4QWOA 4GJ4A 5EVIC 5E2EA 1QMEA 3IWQA 3PHYA 5CHMA 4XUXA 3C8CA 2H0YA 3GTCA 2PRFA 4R3AA 4IVKA 4DDYA 2JKTM 4QY6A 3OCLA 3LIEA 1U60A 3BM6A 3UPPA 1KE3A 4I5SA 2H0TA 2WADA 5EVEA 5AJGA 5GLDA 2QJ7A 5GHXA 4S2LA 2XFSA 3IQAA 3GMWA 4ZRRA 2HV1A 2WAEA 4JXWA 3SS5A 1OTEA 4CQHA 3BRMA 3D3OA 1OT6A 2D02A 1SCWA 3UB5P 3WS2A 3TJZC 1P9WA 3A3EA 4HJ6A 4OQIA 2D01A 4BLMA 1ERMA 1A0KA 1NLYA 3R7WA 3BFDA 3N8SA 1HTZA 4BL2A 1F2KA 3NOTC 3H82A 3A3DA 1BLPA 1MWTA 1MWUA 2FH5A 2QWSA 1XA7A 3O3VA 4Q0HA 4LRZE 4KG2A 3BFCA 3ZG7B 2KLIA 1GHIA 3DTEA 3QP5A 4O8GA 3VOLA 3JVUA 3OPPA 1XGIA 1LL9A 2R9XA 1TS7A 3P01A 1UWPX 3N8RA 5HDSA 1JVJA 3GQZA 3A3JA 2ZL1A 5FDHA 3QP4A 1XJ3A 1BT5A 3U2AA 5DVAA 1SHVA 2EXBA 5DTTA 4HH3A 2XLNA 3QP8A 2V0UA 4P85A 3NECA 2WKEA 3S22A 2O99A 1DJBA 2V8FA 3VP2A 1G6OA 2Y2GA 4Y17A 5HAIA 2XD5A 4BJPA 4O01A 5FI6A 4BD0A 2VA0A 3CJMA 5TBMA 4MEZA 4GDBA 2W1RA 1AWIA 4RX3A 4M3KA 2ZQ7A 4HJ3A 3UO9A 1I2WA 5G4ZA 2XH9A 3UE3A 4WEKA 1WYCA 4OPRA 2BASA 4WM9A 5GLCA 3CITA 3VP4A 4OP8A 2ZMVA 4E3JA 2PDRA 3CAXA 5DKKA 2VV8A 4LENA 2Y2KA 2ZJ9A 4YOFA 1K57A 3LEZA 4E3LA 2WGIA 4Y0TA 2HP6A 1KGEA 5F68A 4BWIA 1NYYA 3HCYA 3VOZA 4OOMA 3NC8A 3ZG9B 3RXXA 4DRTA 3C30A 3WRZA 5HAQA 4E3IA 1XKZA 5JYPA 2ZMFA 3MZFA 4ID4A 2J80A 1N9BA 2I9VA 3JPUA 3UMEA 4HIAA 4EBPA 4I38A 4Y7PA 2DNSA 1W63Q 4X53A 3V50A 3EQVA 1JWVA 2HGVA 4C75A 2INWA 4ZBEA 3V67A 3BQ8A 1TVFA 1YPRA 4DE0A 5TR7A 1N9NA 5BOHA 1YLZA 3IBJA 1G5UA 4XT2B 3NDGA 5FSRA 2X02A 2XRNA 5HWTA 1VEUB 1ES3A 4X68A 2OV5A 3IF5A 2V20A 4KZ5A 5A92A 1PW1A 3I7JA 2PR5A 5DKLA 3ZDJA 3HLDA 4LV0A 4RQ9A 2V2FF 3QP6A 5CX7A 5F83A 1IYOA 2JCHA 4OH0A 4CLCC 5KMWA 2HP9A 4OQ0A 4BBVA 3LY4A 2HJEA 3OBFA 4NXGA 3VFHA 1ZG6A 2VX8A 5EECA 1KE0A 1IELA 5FAPA 5J8XA 4WZ5C 2H10A 3DTKA 1BLSA 2GDNA 2EX9A 4Y2FA 3M2KA 4HQAA 4JGRA 1IYSA 1PZPA 3HJKA 3LR3A 5TGFA 4DXCA 1W8YA 4PKYA 2B02A 4PPRA 4UHUA 3FYZA 2BTFP 3ZNYA 4MN6A 4PMAA 2EX8A 3M6HA 5HWVA 2A24A 4YINA 3KYZA 1LI0A 3T4QA 5F5YA 3IBRA 1L3LA 5CEBA 3D4FA 3BQAA 3ISGA 1DP9A 2FFYA 2ZMAA 3FZCA 2OWHA 4DJ3A 1MY8A 4OKPA 1K25A 5IHVA 2VJWA 3MFXA 3M2JA 3BFEA 5CEDA 2B18A 3LI8A 1YSPA 1TS8A 3UY6A 3HVFA 4R23A 2VGKA 1S1ZA 1XJ6A 2P7JA 4EW7A 4HBTA 5J4EA 2RL3A 4DE3A 2W3DA 3MQ0A 4KUKA 3GSGA 2L0WA 3SOIA 3T4TA 4GW9A 3Q7VB 4GD8A 4UEYA 4N9KA 2HPBA 1H0MA 2HDRA 2WYXA 2XGNA 1BZAA 2PYRA 3GDIA 3NCKA 3T4OA 2K31A 4WEJA 1ZG4A 2PBDP 4GS9B 2ZC5B 3IXDA 1NZOA 3HL9A 2J3TC 2Q9MA 5EV0A 2XA7S 2W3HA 4DE1A 4NXFA 4KG5A 1NRFA 3F1NB 4GHIA 4F94A 2ZM0A 3GR2A 4DJ2A 4GZBA 2Y2IA 3A0SA 4S2PA 5EVLA 4D2OA 1M40A 2HF6A 1SKOB 2W1TB 3WS5A 2X71A 4LV2A 1L0GA 4EERA 3IXHA 1M6KA 5KSHA 3SH7A 5GL9A 3EGDC 4GDNA 5CHUA 4G3VA 2J9PA 3VP3A 3RJUA 5F69A 5KIZA 1I5QA 3HBRA 3CI6A 4QPRA 1HZOA 1S4RA 2IWDA 2WKIA 5FQQA 2K2NA 3T1RA 1OPXA 1J9MA 1NY0A 2P9VB 2VLGA 3DW0A 2H5SA 3PBNA 4KENB 3GRJA 3LY3A 2G2WA 2Y2PA 1DP6A 1H3QA 5EE8A 4KQRA 1IOUA 2V9AA 5CERA 3BECA 3DBAA 4OOLA 4GLQA 4MNRA 5J7EA 3IWIA 2V8CA 2Z6DA 1ERQA 4YNRA 4NK3A 1GCEA 1PW8A 1N4OA 4GNUA 4RX2A 4GD6A 3NHQA 1XX2A 1NXYA 3BLSA 3T4JA 3LUQA 4YWZA 4E3NA 3EEAA 5DFXA 4S2MA 1RGYA 3EGXC 2CC1A 1CJFA 4C3QA 1K6RA 2V1BA 4KZBA 3HUNA 5EOEA 3B3XA 1BULA 2WZXA 2Y79A 3ZHHA 2R9WA 3CMZA 5A90A 3V3SA 3IXGA 1PI5A 4KZ9A 3UN7A 3O86A 2ZD8A 3CHWP 3KSHA 4DE2A 2E8JA 4PHTA 2WGWB 3MZEA 3L9KA 4PM7A 3UDFA 3IF6A 2O0YA 3C7UA 5CGSA 4DDSA 1G68A 1TEMA 2A49A 3T4KA 4LCMA 4KZ4A 5F82A 1DY6A 1MZUA 3CPTB 4EETB 1F5MA 4KZ7A 4P6BA 4X25A 1H8YA 2ZQAA 4S2IA 3T12B 5FI7A 1T1BA 1D7EA 1KDSA 1ES4A 1N9LA 4JKTA 3G4PA 3F1PB 4R70A 2BG1A 4KZAA 3W4QA 2PD7A 5FEFA 3VV4A 5AVEA 3C2WA 3G35A 1S4SA 4N1XA 3FC7A 2KDKA 4NKPA 4Q8IA 4R1GA 1OTDA 3LR5A 5GLAA 2XK1A 2O9CA 1PYYA 4LGWA 3KSIA 1ESIA 1VB6A 2XEPA 5L10A 3F1OB 3HLFA 3LR0A 2W3FA 1HLUP 3A0RA 2L4RA 3G2ZA 3BY8A 1DP8A 4HBUA 5HDCA 4XUZA 4R38A 4ZTKA 2UV0E 4L9FA 4LPZA 4LCLA 2XA7M 1UWNX 5FEGA 1H5XA 3OZHA 1IEMA 1FCNA 3OPLA 3WS4A 3TE8A 2PYPA 4Y15A 5G18A 1E3UD 1YLYA 4MMNA 4PM5A 1BYWA 4FTXA 1IKIA 1NYMA 1MKMA 1BLCA 3E2LA 1PWGA 3GECA 3VP1A 4WMCA 1PWDA 3KO6A 4CLCA 3C38A 3UDXA 4OPYA 3ZG8B 2JKGA 2FZ0A 1YMSA 4BL3A 4WZ5A 3IH9A 1PNEA 2C6WB 3V5MA 3UE0A 4E04A 4X1MA 4PM8A 2Y91A 3IF6C 1JNUA 3FPVA 3UE1A 1FR6A 4FH4A 3W4OA 4E6XA 1GSWA 3DWKA 4RA7A 5MC7A 4H6JA 4ZDXA 1D1JA 3O88A 2AVXA 3NI9A 4N9LA 5EVIB 4BBUA 1L0DA 2ZC6B 3T1XA 4MBHA 1MPLA 4ZJ1A 3MKEA 3MKFA 5CTNA 1S1YA 1UGUA 2XDMA 3S7PA 2PR6A 3WS1A 5DF9A 2EX6A 3KYQA 3C7VA 4X6TA 1LI9A 5FDSA 3MMHA 4HP9A 1GA9A 1GSXA 2V1ZA 4QD4A 4EEPA 4F3LB 1K56D 5HL6A 1GHMA 4R3BA 2J3WA 5HPFA 4U0TA 1PZOA 4FD8A 5CTMA 3CG5A 2QKPA 5EPHA 3HJIA 3N8LA 1KVLA 3ZFZA 3SW1A 3MQQA 4N92A 4KZ6A 3RTYA 2W3GA 3H7WB 3ICYA 3IWOA 5EM0A 4IBRA 2QHKA 3LICA 5L09A 3DWZA 5AQBA 2Y2QA 1VETA 4PM9A 3VSLA 2IA2A 2OLUA 1J3WA 2B5RA 1P0ZA 4JGOA 3PXPA 3CUEC 1EROA 4GCZA 3HLBA 3N7WA 5EUAA 5AQ7A 2QMIA 4FCFA 1BUEA 4MN5A 3T1SA 3VE4A 2VK3A 1FIKA 5FL3A 1NJ4A 4UA7A 1IYPA 3UB9A 5KZHA 3G2YA 2WZZA 1NLZA 1OMEA 4S2JA 1NZUA 3BWLA 1PI4A 3ZG0A 1L0EA 1CI9A 1W79A 4RVAA 2I72A 5M18A 2XROA 2VV6A 4EWFA 5F6AA 5TJJA 1FR1A 2EA9A 1MXOA 3DTIA 2VKSA 3GV9A 3E4QA 1SZVA 3MBZA 4IUHA 5CGXA 1JWPA 1P9RA 1K55A 4ARZB 3TRCA 3UB6A 3AGDA 4BQMA 3SH9A 1JWZA 3IX3A 3KX0X 4UA6A 2Q9NA 4CJNA 1ZHHB 1XJ2A 1LL5A 4OPZA 3PBRA 1RP5A 1Y54A 3B42A 3WS0A 3NOPC 3CZDA 4QY5A 4Y3IA 3E0YA 1QMFA 2P08A 4DF6A 5CHJA 1VHMA 3T4SA 5EVID 4M4XA 4IJGA 4BENA 1K4EA 4N1HA 3LCEA 3HUMA 4ESPA 3T4LA 3IS2B 2NUTC 3QNCA 3KYEA 4WN5A 5AQAA 2DCFA 3LIAA 2GX5A 2Y2NA 2Y2JA 4HH2A 1EW0A 1XPBA 5HD5A 3T50A 5EM1A 1KOUA 1CK3A 5AQ9A 3NIAA 3R7WB 2W0NA 4MLLA 3ZGAB 1ES2A 4OVDA 1KGGA 4WYYA 3H82B 4UQIS 5HL1A 3Q1FA 3ZYTA 2ZM8A 2WKRA 2L1MA 5HWWA 2ZQ9A 1YLTA 4QB8A 3Q07A 4KQOA 3TG9A 1IKGA 2HZ5A 2J9OA 4E3KA 4EBNA 1K54A 5DTSA 1O7EA 1CQAA 3RFBA 4MN7A 1YKDA 1PWCA 3BYDA 5E2GA 2ZL1B 4G3WA 3L7HA 4OP5A 4MCWA 3O5YA 4JLFA 3MR0A 4MBKA 1FOFA 1YQSA 1Y28A 2Y2LA 2WKQA 1G6AA 2EX2A 4JPMA 3S7OA 1YT4A 4FH2A 1LT0A 5GLBA 2XD1A 5J3WA 3LYXA 3VMAA 3ITBA 1MKIA 1D06A 4Y5FA 1K55C 2IWCA 5FQKA 1Q2QA 3K3DA 2PU4A 1GA0A 4IVIA 1HVBA 1GHPA 3FKWA 5HX9A 4ZJ2A 1T18A 1ZTUA 5TBMB 4HP4A 4WUJA 1OT9A 3D9YA 4GN2A 2V0WA 3KSFA 3W8KA 1L2SA 3UPOA 3HLGA 5FI2A 4S2OA 5AVFA 4XXRA 5HAPA 3NJAA 3IHBA 1G28A 4B4ZA 3FV7A 1YLJA 3SS3A 3UB7A 4EV4A 2O9AA 3LIDA 4D60A 3BY9A 4E6WA 4HOIA 1SDEA 4OPQA 1V9YA 4OONA 3BFGA 2JKTI 1SKFA 3BJNA 3HREA 4HESA 2VGLM 5D3OA 4JXSA 1Z6FA 4XT2A 4IEDA 4LFUA 2JKFA 4AFIA 3MXSA 4IUKA 2XQZA 4O7DA 1VEUA 2G2UA 1EWZA 5FA7A 1JTGA 3VOYA 5HD3A 2M7UA 2GZAA 3MSHA 3CWFA 4EXOA 2E8IA 1IFQA 5DTKA 4NXEA 4NXBA 1FSWA 1PRQA 1XP4A 2XSSA 5KSCA 3IT9A 4CPKA 4FOFA 2WAFA 4R6LA 1O07A 4LV1A 5FAOA 3VE3A 3A3IA 1K54C 1ZKJA 3DAVA 5GHYA 2DMWA 4I39A 5EFWA 4S2NC 1WYBA 4Z1WA 3MS6A 3LR4A 1LHYA 5I5LA 4P6ZS 2QYBA 4P0MA 5K5BA 5FASA 4YFMA 3Q81A 1YLPA 1TDLA 3EWKA 1ALQA 3SZTA 3MF0A 4L9EA 3W4PA 4WZ4A 3ZQ5A 3WRTA 3G31A 3IX8A 2ZLYA 1RCJA 1WA9A 4WMCD 1FQGA 2BLSA 2M1CA 3FWLA 4S2KA 3MXQA 2EFUA 4CLCD 2WKPA 3T1QB 3K3CA 5L2FA 3RXWA 4B4XA 5M19A 2WK0A 3IS2A 4EBLA 1W63M 3OPHA 2P04A 2A24B 3TW8A 4UQIM 5E2HA 1YMXA 2XFTA 4NEED 3E98A 3NDEA 3OC2A 1EI5A 2HDSA 4Z9QA 1I2SA 4R0QA 4Y0OA 1XFNA 3PAEA 1XA1A 4K91A 3Q7VA 3UDIA 3ZNTA 4MDZA 3LIFA 5FQJA 4PM6A 4PKYG 1K38A 3IH8A 4KUOA 4UA9A 2K7SA 4DKIA 4KZ8A 5HDDA 2Y8HA 3CUEA 1RGZA 4P87A 1N9OA 4GS9A 3N6IA 1KDWA 1TS0A 4UAAA 5IS1A 3MZDA 2X01A 2OSUA 2W27A 2A2LA 3HLEA 1ODVA 3EEHA 5HARA 1XFQA 2PBYA 1TF1A 3F1NA 3IXBA 3U4LP 4E3MA 2EWWA 3N4IA 1LSVA 4OQGA 5DJUA 1Z09A 4LV3A 4QU3A 1L0FA 1Y4OA 2YKHA 2JKRI 1SKOA 2W1TA 2WGVA 2MJ6A 3E2KA 1TDGA 5F1GA 4NG2A 3D72A 4X56A 4BMWA 5CGWA 1V9ZA 4GHIB 3Q82A 4DMZA 3TSGA 1H8MA 1BLHA 1ZC2A 3NY4A 5HW3A 2P9VA 4FUWA 4K08A 3ITAA 1CF0A 1K0KA 3BLMA 3OPRA 2UWXA 1X0OA 5DJTA 3FPWA 1AXBA 2J3TD 3MFDA 4JBFA 5FQMA 2DRWA
chains in the Genus database with same CATH topology
3E4PA 1XJ2A 3PBNA 5AJGA 3PBRA 2QJ7A 3B42A 3NOPC 1NRJA 2OAQ1 1DP6A 4Y3IA 3UB8A 3E0YA 3P7NA 1H3QA 4ZRRA 2HV1A 2P08A 1IOUA 1OTEA 2V9AA 1VHMA 4CQHA 2NUPC 4ME4A 3T4SA 4M4XA 3DBAA 4IJGA 4OOLA 3D3OA 1OT6A 4GLQA 5J7EA 3H9WA 2D02A 2H28A 4EQ1A 3TJZC 1P9WA 4HJ6A 4WELA 3T4LA 2Z6DA 2ZOIA 3IS2B 2D01A 4YNRA 2NUTC 2JKRM 1NLYA 1LL8A 4JGPA 3EQUA 3R7WA 3UE6A 3NHQA 4WN5A 3BW6A 4G3KA 3T4JA 3NOTC 3LIAA 3LUQA 3H82A 4YWZA 4HY8A 2GX5A 3EEAA 5DFXA 2FH5A 4HH2A 1EW0A 5HD5A 2QWSA 3T50A 1KOUA 4Q0HA 4LRZE 3EGXC 1OTAA 3R7WB 2OAP1 3OCNA 2KLIA 2W0NA 4B93A 4O8GA 3VOLA 2V1BA 2ZBBA 3JVUA 3H82B 4UQIS 4EU0A 1TS7A 3PBSA 3ZYTA 3P01A 1UWPX 2WKRA 2L1MA 2Y79A 5HDSA 4HJ4A 2R78A 4ETZA 5HWWA 4KQOA 4P6ZM 5IU1A 2VEAA 4I3IA 1YSQA 1XJ3A 2VGLS 3B33A 1F98A 3U2AA 3KSHA 4KQDA 3EOIA 4HH3A 3RFBA 4MN7A 5C5KA 4PHTA 3LIBA 1YKDA 3A0VA 2O0YA 2V0UA 4G3WA 4MCWA 1TD5A 3O5YA 3MR0A 2M7VA 3T4KA 3PYPA 2O99A 1MZUA 1Y28A 2WKQA 3NOUC 4EETB 1F5MA 3F1PA 3S7OA 1G6OA 1LT0A 5J3WA 4BJPA 3MQOA 5HSQA 4O01A 3LYXA 3ULFA 1T1BA 1D7EA 1D06A 4Y5FA 1N9LA 2VA0A 5TBMA 3F1PB 3R4KA 2W1RA 1S67L 3E4OA 3K3DA 4R70A 5LBRA 3PBTA 4HJ3A 4DN0A 5G4ZA 1OJ5A 1LSWA 3F1OA 3UE3A 2PD7A 4WEKA 4L9GA 1OTBA 2BASA 3VV4A 5AVEA 1T1CA 3C2WA 3LFVA 1S4SA 3FC7A 2KDKA 3CITA 4II7A 4NKPA 4Q0IA 2ZMVA 1T18A 1ZTUA 2PDRA 5TBMB 3CAXA 5DKKA 2VV8A 1OTDA 4HP4A 2LB9A 4WUJA 3LR5A 1OT9A 2O9CA 3KSIA 2V0WA 4YOFA 4WL9A 1VB6A 3KSFA 2KOIA 3F1OB 3LR0A 2W3FA 1T1AA 3A0RA 5AVFA 2L4RA 2EWVA 2OWJA 3BY8A 3NJAA 1G28A 1DP8A 5F68A 4BWIA 2VV7A 3HCYA 3UB7A 4OOMA 2O9AA 3LIDA 5HDCA 3BY9A 4LRXC 4O0PA 3LI9A 4HOIA 3S7QA 4R38A 1V9YA 3C30A 2JKTI 3G6OA 2ZMFA 3BJNA 1XJ4A 3PBOA 4L9FA 2J80A 2OOLA 2I9VA 2XA7M 1UWNX 4LPZA 3UMEA 4HIAA 1NWZA 2VGLM 4I38A 2GJ3A 1W63Q 3S7NA 3EQVA 4XT2A 4I3JA 4AFIA 2HGVA 2INWA 1F9IA 4IUKA 3V67A 3BQ8A 3B47A 3TE8A 2YKFA 2PYPA 1N9NA 5DFYA 3IBJA 5HD3A 4MMNA 2M7UA 1BYWA 2GZAA 4XT2B 1MKMA 4BBTA 5G4YA 3CWFA 4LRYC 2XRNA 5HWTA 3GECA 2QJ5A 4EXOA 1IFQA 2JN7A 4NXEA 4NXBA 4EESA 1STZA 3KO6A 4CLCA 3C38A 2XSSA 5HZHA 2FZ0A 4FOFA 2PHYA 4R6LA 1LSXA 2PR5A 2PT7A 5DKLA 3CLOA 4RQ9A 1GSVA 5CX7A 3VE3A 5A8BA 3W2ZA 4CLCB 4CLCC 4BBVA 4E04A 2DMWA 4HHDA 4I39A 5EFWA 1JNUA 4JGQA 4WF0A 2HJEA 3OBFA 4NXGA 3FPVA 2HJ9C 4EUVA 4Z1WA 2VX8A 1GSWA 3LR4A 5MC7A 4H6JA 5I5LA 4P6ZS 2QYBA 5K5BA 4BBUA 3RH8B 1P97A 4Y2FA 4HNBA 4HQAA 2ZOHA 4JGRA 3LR3A 3HJKA 2KX6A 3EWKA 3K2NA 1S1YA 4PKYA 1UGUA 4H6JB 4ETXA 2B02A 3MF0A 4L9EA 3S7PA 2PR6A 3ZQ5A 5DF9A 3KYQA 4F3LA 2PD8A 2V1AA 4MN6A 3KSGA 1WA9A 2W3EA 2Z6CA 4B9OA 5HWVA 2A24A 3JVVA 3MMHA 4HP9A 2M1CA 3OOVA 3MXQA 1GSXA 4CLCD 5IT5A 2WKPA 4WLAA 3KYZA 3K3CA 4EEPA 3T4QA 5F5YA 3IBRA 4F3LB 4HI4A 4FSFA 5HL6A 1YAXA 2JHEA 3BQAA 3IS2A 1W63M 3PR6A 2J3WA 1DP9A 2OWHA 3PBQA 2P04A 4DJ3A 5HPFA 2A24B 3TW8A 4UQIM 2G7UA 5L8MA 2O9BA 3H7WA 2VJWA 4NEED 3E98A 2VZWA 3MFXA 2QKPA 2B18A 3LI8A 1YSPA 3OC2A 3HJIA 1TS8A 4EEUA 1XFNA 5HPIA 4PAUA 3SW1A 4MDZA 3LIFA 3MQQA 1S1ZA 1XJ6A 2CMNA 2P7JA 4KUOA 4PKYG 3RTYA 2W3GA 4EW7A 2K7SA 5J4EA 3H7WB 3ICYA 5HDDA 2W3DA 3MQ0A 4KUKA 2QHKA 2Y8HA 3LICA 3CUEA 2L0WA 1N9OA 4GS9A 4Q0JA 3T4TA 4GW9A 1TS0A 5IS1A 4UEYA 1DRMA 2IA2A 4LLOB 2W27A 2A2LA 1ODVA 3EEHA 3FG8A 1P0ZA 4JGOA 2PYRA 3GDIA 1XFQA 3T4OA 3PXPA 4CLCE 1TF1A 2K31A 3F1NA 4I3AA 4WEJA 1OTIA 3CUEC 3UMDA 1OJGA 4GCZA 2EWWA 4GS9B 1LSVA 5DJUA 3MJQA 2YKHA 2J3TC 2JKRI 2W1TA 2XA7S 2W3HA 4MN5A 3VE4A 4NXFA 5FL3A 3UB9A 2MJ6A 3F1NB 4L0LA 3OLOA 4GHIA 1NLZA 3BWLA 1MC0A 4DJ2A 1T19A 3A0SA 4IHQA 2GNXA 2XROA 2VV6A 5F6AA 5TJJA 1S66L 1TS6A 3D72A 2EA9A 2HF6A 4BMWA 4ARZA 2VKSA 2W1TB 2LB5A 1V9ZA 3E4QA 4GHIB 4EERA 4GJ4A 4DMZA 4IUHA 5KSHA 1H8MA 3PHYA 3EGDC 4G3VA 1P9RA 3C8CA 4K08A 5F69A 5KIZA 4ARZB 4R3AA 3CI6A 4QPRA 2JKTM 3TRCA 1S4RA 1X0OA 3OCLA 3LIEA 5DJTA 3UB6A 3FPWA 2J3TD 2K2NA 3KX0X 1OPXA 4I5SA 1ZHHB 2VLGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3E4P A;  1XJ2 A;  2QJ7 A;  3NOP C;  1DP6 A;  3UB8 A;  3P7N A;  2HV1 A;  1OTE A;  2V9A A;  4M4X A;  1OT6 A;  5J7E A;  3H9W A;  2D02 A;  2H28 A;  4EQ1 A;  4HJ6 A;  2Z6D A;  2ZOI A;  3IS2 B;  2D01 A;  1LL8 A;  4JGP A;  3UE6 A;  3NHQ A;  4WN5 A;  3NOT C;  3LIA A;  3LUQ A;  3H82 A;  4YWZ A;  4HY8 A;  4HH2 A;  1EW0 A;  5HD5 A;  2QWS A;  3T50 A;  1KOU A;  4LRZ E;  1OTA A;  2W0N A;  3VOL A;  2V1B A;  2ZBB A;  3H82 B;  1TS7 A;  1UWP X;  2WKR A;  2L1M A;  5HDS A;  4HJ4 A;  2R78 A;  5HWW A;  5IU1 A;  2VEA A;  4I3I A;  1XJ3 A;  3B33 A;  1F98 A;  4KQD A;  4HH3 A;  3LIB A;  3A0V A;  2V0U A;  3MR0 A;  3PYP A;  1MZU A;  1Y28 A;  2WKQ A;  3NOU C;  4EET B;  3F1P A;  1LT0 A;  5J3W A;  3MQO A;  5HSQ A;  3LYX A;  3ULF A;  1T1B A;  1D7E A;  1D06 A;  1N9L A;  5TBM A;  3F1P B;  3K3D A;  1S67 L;  3E4O A;  4R70 A;  4HJ3 A;  5G4Z A;  1OJ5 A;  1LSW A;  3F1O A;  2PD7 A;  4L9G A;  1OTB A;  2BAS A;  5AVE A;  1T1C A;  3C2W A;  1S4S A;  3FC7 A;  2KDK A;  1T18 A;  2PDR A;  5TBM B;  3CAX A;  5DKK A;  2VV8 A;  1OTD A;  4HP4 A;  4WUJ A;  1OT9 A;  2V0W A;  4WL9 A;  1VB6 A;  3F1O B;  1T1A A;  3A0R A;  5AVF A;  2L4R A;  2OWJ A;  3BY8 A;  3NJA A;  1G28 A;  1DP8 A;  5F68 A;  2VV7 A;  3UB7 A;  5HDC A;  3LID A;  3BY9 A;  4LRX C;  3LI9 A;  4HOI A;  4R38 A;  1V9Y A;  3G6O A;  1XJ4 A;  4L9F A;  2J80 A;  2OOL A;  2I9V A;  4LPZ A;  1UWN X;  3UME A;  4HIA A;  1NWZ A;  4I38 A;  2GJ3 A;  4XT2 A;  4I3J A;  2INW A;  1F9I A;  2YKF A;  2PYP A;  1N9N A;  5HD3 A;  1BYW A;  4XT2 B;  4BBT A;  5G4Y A;  3CWF A;  4LRY C;  5HWT A;  3GEC A;  2QJ5 A;  4EXO A;  2JN7 A;  4NXE A;  4NXB A;  4EES A;  5HZH A;  2PHY A;  4R6L A;  1LSX A;  2PR5 A;  5DKL A;  3CLO A;  4RQ9 A;  1GSV A;  3VE3 A;  5A8B A;  4BBV A;  4E04 A;  4HHD A;  4I39 A;  5EFW A;  1JNU A;  4JGQ A;  4WF0 A;  4NXG A;  1GSW A;  4H6J A;  5I5L A;  4BBU A;  3RH8 B;  1P97 A;  4HNB A;  4HQA A;  2ZOH A;  4JGR A;  3HJK A;  2KX6 A;  3EWK A;  1S1Y A;  4PKY A;  1UGU A;  4H6J B;  2B02 A;  4L9E A;  2PR6 A;  3ZQ5 A;  4F3L A;  2PD8 A;  2V1A A;  4MN6 A;  1WA9 A;  2Z6C A;  4B9O A;  5HWV A;  2A24 A;  4HP9 A;  2M1C A;  3MXQ A;  1GSX A;  2WKP A;  4WLA A;  3K3C A;  4EEP A;  5F5Y A;  3IBR A;  4F3L B;  4HI4 A;  2JHE A;  3IS2 A;  1DP9 A;  2OWH A;  4DJ3 A;  2A24 B;  3H7W A;  3MFX A;  2QKP A;  3LI8 A;  3HJI A;  1TS8 A;  4EEU A;  1XFN A;  3SW1 A;  3LIF A;  3MQQ A;  1S1Z A;  1XJ6 A;  2CMN A;  2P7J A;  4KUO A;  4PKY G;  3RTY A;  4EW7 A;  2K7S A;  5J4E A;  3H7W B;  3ICY A;  5HDD A;  4KUK A;  2QHK A;  3LIC A;  2L0W A;  1N9O A;  4GS9 A;  4GW9 A;  1TS0 A;  5IS1 A;  1DRM A;  4LLO B;  2W27 A;  1ODV A;  3EEH A;  3FG8 A;  1P0Z A;  4JGO A;  2PYR A;  3GDI A;  1XFQ A;  3F1N A;  4I3A A;  1OTI A;  3UMD A;  1OJG A;  4GCZ A;  4GS9 B;  1LSV A;  5DJU A;  3MJQ A;  2YKH A;  4MN5 A;  3VE4 A;  4NXF A;  3UB9 A;  3F1N B;  3OLO A;  4GHI A;  3BWL A;  4DJ2 A;  1T19 A;  3A0S A;  2VV6 A;  5F6A A;  1S66 L;  1TS6 A;  3D72 A;  2EA9 A;  1V9Z A;  3E4Q A;  4GHI B;  4EER A;  3PHY A;  3C8C A;  4K08 A;  5F69 A;  5KIZ A;  4R3A A;  1S4R A;  1X0O A;  3LIE A;  5DJT A;  3UB6 A;  3KX0 X;  4I5S A;  2VLG A; 
#chains in the Genus database with same CATH topology
 3E4P A;  3HUO A;  2JC7 A;  3TOI A;  1W7F A;  1NRJ A;  2OAQ 1;  1E3U A;  3UB8 A;  1E25 A;  3P7N A;  3VFF A;  4Y0U A;  1PFL A;  4A5R A;  1CI8 A;  2NUP C;  3BFF A;  4ME4 A;  1PIO A;  5E43 A;  2Y2M A;  3H9W A;  2ZQC A;  2H28 A;  4EQ1 A;  4WEL A;  2ZOI A;  5HFO A;  5A91 A;  2WKH A;  3LGO A;  2HDQ A;  2JKR M;  2B95 A;  1LL8 A;  4JGP A;  3EQU A;  3UE6 A;  1BTL A;  2RCX A;  3BW6 A;  1VM1 A;  2ZC3 B;  4G3K A;  5CXW A;  4HY8 A;  1C3B A;  3IHA A;  1FCM A;  5EOO A;  2QZ6 A;  4DXB A;  1OTA A;  2OAP 1;  4C6Y A;  3OCN A;  4B93 A;  5L07 A;  2ZC7 A;  2ZBB A;  2ZC4 B;  1ONH A;  4EU0 A;  3P09 A;  3ZG5 A;  3PBS A;  3ZVW A;  1YM1 A;  2OLV A;  1H8Z A;  1JTD A;  4HJ4 A;  2WGW A;  1ONG A;  2R78 A;  4ETZ A;  3M6B A;  4P6Z M;  2VGJ A;  2VEA A;  5IU1 A;  3UNW A;  4I3I A;  1YSQ A;  2VGL S;  4GB7 A;  3B33 A;  4HEF A;  1F98 A;  1CEG A;  4JF4 A;  4KQD A;  3EOI A;  1KE4 A;  3S4X A;  5C5K A;  3LIB A;  3CPT A;  3A0V A;  2J8Y A;  1K56 A;  2Y55 A;  3LEQ A;  1TD5 A;  3PAG A;  2M7V A;  3PYP A;  5FAT A;  3NOU C;  3F1P A;  4GKU A;  5F1F A;  3HLC A;  3IF6 B;  5FAQ A;  2PU2 A;  2C5W B;  3MQO A;  5HSQ A;  3PTE A;  3ULF A;  1FSY A;  3IX4 A;  3UPN A;  5M1A A;  4EQI A;  1MWR A;  2Y4A A;  3R4K A;  1S67 L;  3E4O A;  5LBR A;  3PBT A;  4DN0 A;  3JYI A;  3DTM A;  1OJ5 A;  1LSW A;  3F1O A;  1LLB A;  2PAV P;  4NET A;  4L9G A;  1OTB A;  1T1C A;  3C5A A;  3LFV A;  4II7 A;  4EUZ A;  4Q0I A;  4ZJ3 A;  5GHZ A;  1DJA A;  2ZQ8 A;  4R4S A;  2LB9 A;  2EFX A;  4JXV A;  4WL9 A;  4U0X A;  2HDU A;  2KOI A;  1Q2P A;  4H8R A;  5E2F A;  1ES5 A;  1T1A A;  4X55 A;  1K4F A;  2EWV A;  2OWJ A;  4QHC A;  3NBL A;  2VV7 A;  4R3J A;  2HP5 A;  4R4R A;  4LRX C;  4O0P A;  1K57 C;  3LI9 A;  3S7Q A;  3WWX A;  4X1L A;  3MXR A;  3SH8 A;  3G6O A;  1XJ4 A;  1DJC A;  3PBO A;  2OOL A;  1NWZ A;  2GJ3 A;  3S7N A;  3V39 A;  2FFF B;  4X69 A;  4I3J A;  5A93 A;  3P98 A;  4K0W A;  2WUQ A;  2Y59 A;  2Y2H A;  4WBG A;  3QP2 A;  1F9I A;  2J7V A;  3FKV A;  3B47 A;  3VSK A;  2Z2M B;  1VQQ A;  2YKF A;  5DFY A;  4JF6 A;  4OLG A;  4BBT A;  5G4Y A;  4LRY C;  2Q0O A;  2QJ5 A;  2JN7 A;  1W8Q A;  3C4P A;  1BSG A;  4OOY A;  4RYE A;  4EES A;  4JF5 A;  4K0X A;  1STZ A;  4GOG A;  4E3O A;  3GVB A;  4Y13 A;  2Y2O A;  3AGF A;  1FIL A;  5HZH A;  3Q7Z A;  3G34 A;  4S2N A;  2PHY A;  4ZAM A;  1LSX A;  2PT7 A;  3CLO A;  3QNB A;  1GSV A;  5FQ9 A;  5A8B A;  3W2Z A;  4CLC B;  5EVI A;  1S6R A;  1E4D A;  4HHD A;  1HD8 A;  4JGQ A;  4WF0 A;  2HJ9 C;  4EUV A;  3O87 A;  4OLD A;  1YLW A;  4U3T A;  4B88 A;  3RH8 B;  5TFQ A;  1P97 A;  4HNB A;  4MBF A;  2ZOH A;  3ZCZ A;  3A3F A;  4IBX A;  2KX6 A;  1ACF A;  3K2N A;  3QHY A;  4H6J B;  4ETX A;  3S1Y A;  4QJG A;  4F3L A;  1W5D A;  2PD8 A;  2V1A A;  1XXM A;  3KSG A;  2W3E A;  2Z6C A;  4B9O A;  3JVV A;  3OOV A;  1KGF A;  5IT5 A;  4WLA A;  3SS4 A;  1CEF A;  2XR0 A;  1MBL A;  4HI4 A;  4FSF A;  1YAX A;  2JBF A;  2JHE A;  3C4O A;  3PR6 A;  3V3R A;  3VP0 A;  3PBQ A;  5DF8 A;  2EXA A;  5CEC A;  2G7U A;  5L8M A;  3BEB A;  5CRF A;  2O9B A;  3H7W A;  2VZW A;  3QP1 A;  5I94 A;  1MWS A;  4EEU A;  5HPI A;  4PAU A;  1IYQ A;  3ZVT A;  4KZ3 A;  2ZM2 A;  3NUL A;  1XGJ A;  5DF7 A;  2QPN A;  2CMN A;  3LO7 A;  3HLW A;  5FQI A;  1FCO A;  3AGE A;  4Q0J A;  4KQQ A;  2A3U A;  1DRM A;  1KVM A;  4LLO B;  2XF3 A;  2ZQD A;  4BD1 A;  2JE5 A;  2Z2L B;  3FG8 A;  4CLC E;  2ACG A;  4I3A A;  1OTI A;  3UMD A;  2P74 A;  1OJG A;  2IWB A;  1VET B;  1SDN A;  4JXG A;  1K6S A;  4KG6 A;  3MJQ A;  4L0L A;  1ESU A;  3OLO A;  1MC0 A;  1T19 A;  4IHQ A;  2GNX A;  5JYO A;  5U47 A;  1S66 L;  1TS6 A;  3G30 A;  3G32 A;  4ARZ A;  1S0W A;  2LB5 A;  1WE4 A;  4OQH A;  4QWO A;  4GJ4 A;  5EVI C;  5E2E A;  1QME A;  3IWQ A;  3PHY A;  5CHM A;  4XUX A;  3C8C A;  2H0Y A;  3GTC A;  2PRF A;  4R3A A;  4IVK A;  4DDY A;  2JKT M;  4QY6 A;  3OCL A;  3LIE A;  1U60 A;  3BM6 A;  3UPP A;  1KE3 A;  4I5S A;  2H0T A;  2WAD A;  5EVE A;  5AJG A;  5GLD A;  2QJ7 A;  5GHX A;  4S2L A;  2XFS A;  3IQA A;  3GMW A;  4ZRR A;  2HV1 A;  2WAE A;  4JXW A;  3SS5 A;  1OTE A;  4CQH A;  3BRM A;  3D3O A;  1OT6 A;  2D02 A;  1SCW A;  3UB5 P;  3WS2 A;  3TJZ C;  1P9W A;  3A3E A;  4HJ6 A;  4OQI A;  2D01 A;  4BLM A;  1ERM A;  1A0K A;  1NLY A;  3R7W A;  3BFD A;  3N8S A;  1HTZ A;  4BL2 A;  1F2K A;  3NOT C;  3H82 A;  3A3D A;  1BLP A;  1MWT A;  1MWU A;  2FH5 A;  2QWS A;  1XA7 A;  3O3V A;  4Q0H A;  4LRZ E;  4KG2 A;  3BFC A;  3ZG7 B;  2KLI A;  1GHI A;  3DTE A;  3QP5 A;  4O8G A;  3VOL A;  3JVU A;  3OPP A;  1XGI A;  1LL9 A;  2R9X A;  1TS7 A;  3P01 A;  1UWP X;  3N8R A;  5HDS A;  1JVJ A;  3GQZ A;  3A3J A;  2ZL1 A;  5FDH A;  3QP4 A;  1XJ3 A;  1BT5 A;  3U2A A;  5DVA A;  1SHV A;  2EXB A;  5DTT A;  4HH3 A;  2XLN A;  3QP8 A;  2V0U A;  4P85 A;  3NEC A;  2WKE A;  3S22 A;  2O99 A;  1DJB A;  2V8F A;  3VP2 A;  1G6O A;  2Y2G A;  4Y17 A;  5HAI A;  2XD5 A;  4BJP A;  4O01 A;  5FI6 A;  4BD0 A;  2VA0 A;  3CJM A;  5TBM A;  4MEZ A;  4GDB A;  2W1R A;  1AWI A;  4RX3 A;  4M3K A;  2ZQ7 A;  4HJ3 A;  3UO9 A;  1I2W A;  5G4Z A;  2XH9 A;  3UE3 A;  4WEK A;  1WYC A;  4OPR A;  2BAS A;  4WM9 A;  5GLC A;  3CIT A;  3VP4 A;  4OP8 A;  2ZMV A;  4E3J A;  2PDR A;  3CAX A;  5DKK A;  2VV8 A;  4LEN A;  2Y2K A;  2ZJ9 A;  4YOF A;  1K57 A;  3LEZ A;  4E3L A;  2WGI A;  4Y0T A;  2HP6 A;  1KGE A;  5F68 A;  4BWI A;  1NYY A;  3HCY A;  3VOZ A;  4OOM A;  3NC8 A;  3ZG9 B;  3RXX A;  4DRT A;  3C30 A;  3WRZ A;  5HAQ A;  4E3I A;  1XKZ A;  5JYP A;  2ZMF A;  3MZF A;  4ID4 A;  2J80 A;  1N9B A;  2I9V A;  3JPU A;  3UME A;  4HIA A;  4EBP A;  4I38 A;  4Y7P A;  2DNS A;  1W63 Q;  4X53 A;  3V50 A;  3EQV A;  1JWV A;  2HGV A;  4C75 A;  2INW A;  4ZBE A;  3V67 A;  3BQ8 A;  1TVF A;  1YPR A;  4DE0 A;  5TR7 A;  1N9N A;  5BOH A;  1YLZ A;  3IBJ A;  1G5U A;  4XT2 B;  3NDG A;  5FSR A;  2X02 A;  2XRN A;  5HWT A;  1VEU B;  1ES3 A;  4X68 A;  2OV5 A;  3IF5 A;  2V20 A;  4KZ5 A;  5A92 A;  1PW1 A;  3I7J A;  2PR5 A;  5DKL A;  3ZDJ A;  3HLD A;  4LV0 A;  4RQ9 A;  2V2F F;  3QP6 A;  5CX7 A;  5F83 A;  1IYO A;  2JCH A;  4OH0 A;  4CLC C;  5KMW A;  2HP9 A;  4OQ0 A;  4BBV A;  3LY4 A;  2HJE A;  3OBF A;  4NXG A;  3VFH A;  1ZG6 A;  2VX8 A;  5EEC A;  1KE0 A;  1IEL A;  5FAP A;  5J8X A;  4WZ5 C;  2H10 A;  3DTK A;  1BLS A;  2GDN A;  2EX9 A;  4Y2F A;  3M2K A;  4HQA A;  4JGR A;  1IYS A;  1PZP A;  3HJK A;  3LR3 A;  5TGF A;  4DXC A;  1W8Y A;  4PKY A;  2B02 A;  4PPR A;  4UHU A;  3FYZ A;  2BTF P;  3ZNY A;  4MN6 A;  4PMA A;  2EX8 A;  3M6H A;  5HWV A;  2A24 A;  4YIN A;  3KYZ A;  1LI0 A;  3T4Q A;  5F5Y A;  3IBR A;  1L3L A;  5CEB A;  3D4F A;  3BQA A;  3ISG A;  1DP9 A;  2FFY A;  2ZMA A;  3FZC A;  2OWH A;  4DJ3 A;  1MY8 A;  4OKP A;  1K25 A;  5IHV A;  2VJW A;  3MFX A;  3M2J A;  3BFE A;  5CED A;  2B18 A;  3LI8 A;  1YSP A;  1TS8 A;  3UY6 A;  3HVF A;  4R23 A;  2VGK A;  1S1Z A;  1XJ6 A;  2P7J A;  4EW7 A;  4HBT A;  5J4E A;  2RL3 A;  4DE3 A;  2W3D A;  3MQ0 A;  4KUK A;  3GSG A;  2L0W A;  3SOI A;  3T4T A;  4GW9 A;  3Q7V B;  4GD8 A;  4UEY A;  4N9K A;  2HPB A;  1H0M A;  2HDR A;  2WYX A;  2XGN A;  1BZA A;  2PYR A;  3GDI A;  3NCK A;  3T4O A;  2K31 A;  4WEJ A;  1ZG4 A;  2PBD P;  4GS9 B;  2ZC5 B;  3IXD A;  1NZO A;  3HL9 A;  2J3T C;  2Q9M A;  5EV0 A;  2XA7 S;  2W3H A;  4DE1 A;  4NXF A;  4KG5 A;  1NRF A;  3F1N B;  4GHI A;  4F94 A;  2ZM0 A;  3GR2 A;  4DJ2 A;  4GZB A;  2Y2I A;  3A0S A;  4S2P A;  5EVL A;  4D2O A;  1M40 A;  2HF6 A;  1SKO B;  2W1T B;  3WS5 A;  2X71 A;  4LV2 A;  1L0G A;  4EER A;  3IXH A;  1M6K A;  5KSH A;  3SH7 A;  5GL9 A;  3EGD C;  4GDN A;  5CHU A;  4G3V A;  2J9P A;  3VP3 A;  3RJU A;  5F69 A;  5KIZ A;  1I5Q A;  3HBR A;  3CI6 A;  4QPR A;  1HZO A;  1S4R A;  2IWD A;  2WKI A;  5FQQ A;  2K2N A;  3T1R A;  1OPX A;  1J9M A;  1NY0 A;  2P9V B;  2VLG A;  3DW0 A;  2H5S A;  3PBN A;  4KEN B;  3GRJ A;  3LY3 A;  2G2W A;  2Y2P A;  1DP6 A;  1H3Q A;  5EE8 A;  4KQR A;  1IOU A;  2V9A A;  5CER A;  3BEC A;  3DBA A;  4OOL A;  4GLQ A;  4MNR A;  5J7E A;  3IWI A;  2V8C A;  2Z6D A;  1ERQ A;  4YNR A;  4NK3 A;  1GCE A;  1PW8 A;  1N4O A;  4GNU A;  4RX2 A;  4GD6 A;  3NHQ A;  1XX2 A;  1NXY A;  3BLS A;  3T4J A;  3LUQ A;  4YWZ A;  4E3N A;  3EEA A;  5DFX A;  4S2M A;  1RGY A;  3EGX C;  2CC1 A;  1CJF A;  4C3Q A;  1K6R A;  2V1B A;  4KZB A;  3HUN A;  5EOE A;  3B3X A;  1BUL A;  2WZX A;  2Y79 A;  3ZHH A;  2R9W A;  3CMZ A;  5A90 A;  3V3S A;  3IXG A;  1PI5 A;  4KZ9 A;  3UN7 A;  3O86 A;  2ZD8 A;  3CHW P;  3KSH A;  4DE2 A;  2E8J A;  4PHT A;  2WGW B;  3MZE A;  3L9K A;  4PM7 A;  3UDF A;  3IF6 A;  2O0Y A;  3C7U A;  5CGS A;  4DDS A;  1G68 A;  1TEM A;  2A49 A;  3T4K A;  4LCM A;  4KZ4 A;  5F82 A;  1DY6 A;  1MZU A;  3CPT B;  4EET B;  1F5M A;  4KZ7 A;  4P6B A;  4X25 A;  1H8Y A;  2ZQA A;  4S2I A;  3T12 B;  5FI7 A;  1T1B A;  1D7E A;  1KDS A;  1ES4 A;  1N9L A;  4JKT A;  3G4P A;  3F1P B;  4R70 A;  2BG1 A;  4KZA A;  3W4Q A;  2PD7 A;  5FEF A;  3VV4 A;  5AVE A;  3C2W A;  3G35 A;  1S4S A;  4N1X A;  3FC7 A;  2KDK A;  4NKP A;  4Q8I A;  4R1G A;  1OTD A;  3LR5 A;  5GLA A;  2XK1 A;  2O9C A;  1PYY A;  4LGW A;  3KSI A;  1ESI A;  1VB6 A;  2XEP A;  5L10 A;  3F1O B;  3HLF A;  3LR0 A;  2W3F A;  1HLU P;  3A0R A;  2L4R A;  3G2Z A;  3BY8 A;  1DP8 A;  4HBU A;  5HDC A;  4XUZ A;  4R38 A;  4ZTK A;  2UV0 E;  4L9F A;  4LPZ A;  4LCL A;  2XA7 M;  1UWN X;  5FEG A;  1H5X A;  3OZH A;  1IEM A;  1FCN A;  3OPL A;  3WS4 A;  3TE8 A;  2PYP A;  4Y15 A;  5G18 A;  1E3U D;  1YLY A;  4MMN A;  4PM5 A;  1BYW A;  4FTX A;  1IKI A;  1NYM A;  1MKM A;  1BLC A;  3E2L A;  1PWG A;  3GEC A;  3VP1 A;  4WMC A;  1PWD A;  3KO6 A;  4CLC A;  3C38 A;  3UDX A;  4OPY A;  3ZG8 B;  2JKG A;  2FZ0 A;  1YMS A;  4BL3 A;  4WZ5 A;  3IH9 A;  1PNE A;  2C6W B;  3V5M A;  3UE0 A;  4E04 A;  4X1M A;  4PM8 A;  2Y91 A;  3IF6 C;  1JNU A;  3FPV A;  3UE1 A;  1FR6 A;  4FH4 A;  3W4O A;  4E6X A;  1GSW A;  3DWK A;  4RA7 A;  5MC7 A;  4H6J A;  4ZDX A;  1D1J A;  3O88 A;  2AVX A;  3NI9 A;  4N9L A;  5EVI B;  4BBU A;  1L0D A;  2ZC6 B;  3T1X A;  4MBH A;  1MPL A;  4ZJ1 A;  3MKE A;  3MKF A;  5CTN A;  1S1Y A;  1UGU A;  2XDM A;  3S7P A;  2PR6 A;  3WS1 A;  5DF9 A;  2EX6 A;  3KYQ A;  3C7V A;  4X6T A;  1LI9 A;  5FDS A;  3MMH A;  4HP9 A;  1GA9 A;  1GSX A;  2V1Z A;  4QD4 A;  4EEP A;  4F3L B;  1K56 D;  5HL6 A;  1GHM A;  4R3B A;  2J3W A;  5HPF A;  4U0T A;  1PZO A;  4FD8 A;  5CTM A;  3CG5 A;  2QKP A;  5EPH A;  3HJI A;  3N8L A;  1KVL A;  3ZFZ A;  3SW1 A;  3MQQ A;  4N92 A;  4KZ6 A;  3RTY A;  2W3G A;  3H7W B;  3ICY A;  3IWO A;  5EM0 A;  4IBR A;  2QHK A;  3LIC A;  5L09 A;  3DWZ A;  5AQB A;  2Y2Q A;  1VET A;  4PM9 A;  3VSL A;  2IA2 A;  2OLU A;  1J3W A;  2B5R A;  1P0Z A;  4JGO A;  3PXP A;  3CUE C;  1ERO A;  4GCZ A;  3HLB A;  3N7W A;  5EUA A;  5AQ7 A;  2QMI A;  4FCF A;  1BUE A;  4MN5 A;  3T1S A;  3VE4 A;  2VK3 A;  1FIK A;  5FL3 A;  1NJ4 A;  4UA7 A;  1IYP A;  3UB9 A;  5KZH A;  3G2Y A;  2WZZ A;  1NLZ A;  1OME A;  4S2J A;  1NZU A;  3BWL A;  1PI4 A;  3ZG0 A;  1L0E A;  1CI9 A;  1W79 A;  4RVA A;  2I72 A;  5M18 A;  2XRO A;  2VV6 A;  4EWF A;  5F6A A;  5TJJ A;  1FR1 A;  2EA9 A;  1MXO A;  3DTI A;  2VKS A;  3GV9 A;  3E4Q A;  1SZV A;  3MBZ A;  4IUH A;  5CGX A;  1JWP A;  1P9R A;  1K55 A;  4ARZ B;  3TRC A;  3UB6 A;  3AGD A;  4BQM A;  3SH9 A;  1JWZ A;  3IX3 A;  3KX0 X;  4UA6 A;  2Q9N A;  4CJN A;  1ZHH B;  1XJ2 A;  1LL5 A;  4OPZ A;  3PBR A;  1RP5 A;  1Y54 A;  3B42 A;  3WS0 A;  3NOP C;  3CZD A;  4QY5 A;  4Y3I A;  3E0Y A;  1QMF A;  2P08 A;  4DF6 A;  5CHJ A;  1VHM A;  3T4S A;  5EVI D;  4M4X A;  4IJG A;  4BEN A;  1K4E A;  4N1H A;  3LCE A;  3HUM A;  4ESP A;  3T4L A;  3IS2 B;  2NUT C;  3QNC A;  3KYE A;  4WN5 A;  5AQA A;  2DCF A;  3LIA A;  2GX5 A;  2Y2N A;  2Y2J A;  4HH2 A;  1EW0 A;  1XPB A;  5HD5 A;  3T50 A;  5EM1 A;  1KOU A;  1CK3 A;  5AQ9 A;  3NIA A;  3R7W B;  2W0N A;  4MLL A;  3ZGA B;  1ES2 A;  4OVD A;  1KGG A;  4WYY A;  3H82 B;  4UQI S;  5HL1 A;  3Q1F A;  3ZYT A;  2ZM8 A;  2WKR A;  2L1M A;  5HWW A;  2ZQ9 A;  1YLT A;  4QB8 A;  3Q07 A;  4KQO A;  3TG9 A;  1IKG A;  2HZ5 A;  2J9O A;  4E3K A;  4EBN A;  1K54 A;  5DTS A;  1O7E A;  1CQA A;  3RFB A;  4MN7 A;  1YKD A;  1PWC A;  3BYD A;  5E2G A;  2ZL1 B;  4G3W A;  3L7H A;  4OP5 A;  4MCW A;  3O5Y A;  4JLF A;  3MR0 A;  4MBK A;  1FOF A;  1YQS A;  1Y28 A;  2Y2L A;  2WKQ A;  1G6A A;  2EX2 A;  4JPM A;  3S7O A;  1YT4 A;  4FH2 A;  1LT0 A;  5GLB A;  2XD1 A;  5J3W A;  3LYX A;  3VMA A;  3ITB A;  1MKI A;  1D06 A;  4Y5F A;  1K55 C;  2IWC A;  5FQK A;  1Q2Q A;  3K3D A;  2PU4 A;  1GA0 A;  4IVI A;  1HVB A;  1GHP A;  3FKW A;  5HX9 A;  4ZJ2 A;  1T18 A;  1ZTU A;  5TBM B;  4HP4 A;  4WUJ A;  1OT9 A;  3D9Y A;  4GN2 A;  2V0W A;  3KSF A;  3W8K A;  1L2S A;  3UPO A;  3HLG A;  5FI2 A;  4S2O A;  5AVF A;  4XXR A;  5HAP A;  3NJA A;  3IHB A;  1G28 A;  4B4Z A;  3FV7 A;  1YLJ A;  3SS3 A;  3UB7 A;  4EV4 A;  2O9A A;  3LID A;  4D60 A;  3BY9 A;  4E6W A;  4HOI A;  1SDE A;  4OPQ A;  1V9Y A;  4OON A;  3BFG A;  2JKT I;  1SKF A;  3BJN A;  3HRE A;  4HES A;  2VGL M;  5D3O A;  4JXS A;  1Z6F A;  4XT2 A;  4IED A;  4LFU A;  2JKF A;  4AFI A;  3MXS A;  4IUK A;  2XQZ A;  4O7D A;  1VEU A;  2G2U A;  1EWZ A;  5FA7 A;  1JTG A;  3VOY A;  5HD3 A;  2M7U A;  2GZA A;  3MSH A;  3CWF A;  4EXO A;  2E8I A;  1IFQ A;  5DTK A;  4NXE A;  4NXB A;  1FSW A;  1PRQ A;  1XP4 A;  2XSS A;  5KSC A;  3IT9 A;  4CPK A;  4FOF A;  2WAF A;  4R6L A;  1O07 A;  4LV1 A;  5FAO A;  3VE3 A;  3A3I A;  1K54 C;  1ZKJ A;  3DAV A;  5GHY A;  2DMW A;  4I39 A;  5EFW A;  4S2N C;  1WYB A;  4Z1W A;  3MS6 A;  3LR4 A;  1LHY A;  5I5L A;  4P6Z S;  2QYB A;  4P0M A;  5K5B A;  5FAS A;  4YFM A;  3Q81 A;  1YLP A;  1TDL A;  3EWK A;  1ALQ A;  3SZT A;  3MF0 A;  4L9E A;  3W4P A;  4WZ4 A;  3ZQ5 A;  3WRT A;  3G31 A;  3IX8 A;  2ZLY A;  1RCJ A;  1WA9 A;  4WMC D;  1FQG A;  2BLS A;  2M1C A;  3FWL A;  4S2K A;  3MXQ A;  2EFU A;  4CLC D;  2WKP A;  3T1Q B;  3K3C A;  5L2F A;  3RXW A;  4B4X A;  5M19 A;  2WK0 A;  3IS2 A;  4EBL A;  1W63 M;  3OPH A;  2P04 A;  2A24 B;  3TW8 A;  4UQI M;  5E2H A;  1YMX A;  2XFT A;  4NEE D;  3E98 A;  3NDE A;  3OC2 A;  1EI5 A;  2HDS A;  4Z9Q A;  1I2S A;  4R0Q A;  4Y0O A;  1XFN A;  3PAE A;  1XA1 A;  4K91 A;  3Q7V A;  3UDI A;  3ZNT A;  4MDZ A;  3LIF A;  5FQJ A;  4PM6 A;  4PKY G;  1K38 A;  3IH8 A;  4KUO A;  4UA9 A;  2K7S A;  4DKI A;  4KZ8 A;  5HDD A;  2Y8H A;  3CUE A;  1RGZ A;  4P87 A;  1N9O A;  4GS9 A;  3N6I A;  1KDW A;  1TS0 A;  4UAA A;  5IS1 A;  3MZD A;  2X01 A;  2OSU A;  2W27 A;  2A2L A;  3HLE A;  1ODV A;  3EEH A;  5HAR A;  1XFQ A;  2PBY A;  1TF1 A;  3F1N A;  3IXB A;  3U4L P;  4E3M A;  2EWW A;  3N4I A;  1LSV A;  4OQG A;  5DJU A;  1Z09 A;  4LV3 A;  4QU3 A;  1L0F A;  1Y4O A;  2YKH A;  2JKR I;  1SKO A;  2W1T A;  2WGV A;  2MJ6 A;  3E2K A;  1TDG A;  5F1G A;  4NG2 A;  3D72 A;  4X56 A;  4BMW A;  5CGW A;  1V9Z A;  4GHI B;  3Q82 A;  4DMZ A;  3TSG A;  1H8M A;  1BLH A;  1ZC2 A;  3NY4 A;  5HW3 A;  2P9V A;  4FUW A;  4K08 A;  3ITA A;  1CF0 A;  1K0K A;  3BLM A;  3OPR A;  2UWX A;  1X0O A;  5DJT A;  3FPW A;  1AXB A;  2J3T D;  3MFD A;  4JBF A;  5FQM A;  2DRW A; 
#chains in the Genus database with same CATH homology
 3E4P A;  1XJ2 A;  3PBN A;  5AJG A;  3PBR A;  2QJ7 A;  3B42 A;  3NOP C;  1NRJ A;  2OAQ 1;  1DP6 A;  4Y3I A;  3UB8 A;  3E0Y A;  3P7N A;  1H3Q A;  4ZRR A;  2HV1 A;  2P08 A;  1IOU A;  1OTE A;  2V9A A;  1VHM A;  4CQH A;  2NUP C;  4ME4 A;  3T4S A;  4M4X A;  3DBA A;  4IJG A;  4OOL A;  3D3O A;  1OT6 A;  4GLQ A;  5J7E A;  3H9W A;  2D02 A;  2H28 A;  4EQ1 A;  3TJZ C;  1P9W A;  4HJ6 A;  4WEL A;  3T4L A;  2Z6D A;  2ZOI A;  3IS2 B;  2D01 A;  4YNR A;  2NUT C;  2JKR M;  1NLY A;  1LL8 A;  4JGP A;  3EQU A;  3R7W A;  3UE6 A;  3NHQ A;  4WN5 A;  3BW6 A;  4G3K A;  3T4J A;  3NOT C;  3LIA A;  3LUQ A;  3H82 A;  4YWZ A;  4HY8 A;  2GX5 A;  3EEA A;  5DFX A;  2FH5 A;  4HH2 A;  1EW0 A;  5HD5 A;  2QWS A;  3T50 A;  1KOU A;  4Q0H A;  4LRZ E;  3EGX C;  1OTA A;  3R7W B;  2OAP 1;  3OCN A;  2KLI A;  2W0N A;  4B93 A;  4O8G A;  3VOL A;  2V1B A;  2ZBB A;  3JVU A;  3H82 B;  4UQI S;  4EU0 A;  1TS7 A;  3PBS A;  3ZYT A;  3P01 A;  1UWP X;  2WKR A;  2L1M A;  2Y79 A;  5HDS A;  4HJ4 A;  2R78 A;  4ETZ A;  5HWW A;  4KQO A;  4P6Z M;  5IU1 A;  2VEA A;  4I3I A;  1YSQ A;  1XJ3 A;  2VGL S;  3B33 A;  1F98 A;  3U2A A;  3KSH A;  4KQD A;  3EOI A;  4HH3 A;  3RFB A;  4MN7 A;  5C5K A;  4PHT A;  3LIB A;  1YKD A;  3A0V A;  2O0Y A;  2V0U A;  4G3W A;  4MCW A;  1TD5 A;  3O5Y A;  3MR0 A;  2M7V A;  3T4K A;  3PYP A;  2O99 A;  1MZU A;  1Y28 A;  2WKQ A;  3NOU C;  4EET B;  1F5M A;  3F1P A;  3S7O A;  1G6O A;  1LT0 A;  5J3W A;  4BJP A;  3MQO A;  5HSQ A;  4O01 A;  3LYX A;  3ULF A;  1T1B A;  1D7E A;  1D06 A;  4Y5F A;  1N9L A;  2VA0 A;  5TBM A;  3F1P B;  3R4K A;  2W1R A;  1S67 L;  3E4O A;  3K3D A;  4R70 A;  5LBR A;  3PBT A;  4HJ3 A;  4DN0 A;  5G4Z A;  1OJ5 A;  1LSW A;  3F1O A;  3UE3 A;  2PD7 A;  4WEK A;  4L9G A;  1OTB A;  2BAS A;  3VV4 A;  5AVE A;  1T1C A;  3C2W A;  3LFV A;  1S4S A;  3FC7 A;  2KDK A;  3CIT A;  4II7 A;  4NKP A;  4Q0I A;  2ZMV A;  1T18 A;  1ZTU A;  2PDR A;  5TBM B;  3CAX A;  5DKK A;  2VV8 A;  1OTD A;  4HP4 A;  2LB9 A;  4WUJ A;  3LR5 A;  1OT9 A;  2O9C A;  3KSI A;  2V0W A;  4YOF A;  4WL9 A;  1VB6 A;  3KSF A;  2KOI A;  3F1O B;  3LR0 A;  2W3F A;  1T1A A;  3A0R A;  5AVF A;  2L4R A;  2EWV A;  2OWJ A;  3BY8 A;  3NJA A;  1G28 A;  1DP8 A;  5F68 A;  4BWI A;  2VV7 A;  3HCY A;  3UB7 A;  4OOM A;  2O9A A;  3LID A;  5HDC A;  3BY9 A;  4LRX C;  4O0P A;  3LI9 A;  4HOI A;  3S7Q A;  4R38 A;  1V9Y A;  3C30 A;  2JKT I;  3G6O A;  2ZMF A;  3BJN A;  1XJ4 A;  3PBO A;  4L9F A;  2J80 A;  2OOL A;  2I9V A;  2XA7 M;  1UWN X;  4LPZ A;  3UME A;  4HIA A;  1NWZ A;  2VGL M;  4I38 A;  2GJ3 A;  1W63 Q;  3S7N A;  3EQV A;  4XT2 A;  4I3J A;  4AFI A;  2HGV A;  2INW A;  1F9I A;  4IUK A;  3V67 A;  3BQ8 A;  3B47 A;  3TE8 A;  2YKF A;  2PYP A;  1N9N A;  5DFY A;  3IBJ A;  5HD3 A;  4MMN A;  2M7U A;  1BYW A;  2GZA A;  4XT2 B;  1MKM A;  4BBT A;  5G4Y A;  3CWF A;  4LRY C;  2XRN A;  5HWT A;  3GEC A;  2QJ5 A;  4EXO A;  1IFQ A;  2JN7 A;  4NXE A;  4NXB A;  4EES A;  1STZ A;  3KO6 A;  4CLC A;  3C38 A;  2XSS A;  5HZH A;  2FZ0 A;  4FOF A;  2PHY A;  4R6L A;  1LSX A;  2PR5 A;  2PT7 A;  5DKL A;  3CLO A;  4RQ9 A;  1GSV A;  5CX7 A;  3VE3 A;  5A8B A;  3W2Z A;  4CLC B;  4CLC C;  4BBV A;  4E04 A;  2DMW A;  4HHD A;  4I39 A;  5EFW A;  1JNU A;  4JGQ A;  4WF0 A;  2HJE A;  3OBF A;  4NXG A;  3FPV A;  2HJ9 C;  4EUV A;  4Z1W A;  2VX8 A;  1GSW A;  3LR4 A;  5MC7 A;  4H6J A;  5I5L A;  4P6Z S;  2QYB A;  5K5B A;  4BBU A;  3RH8 B;  1P97 A;  4Y2F A;  4HNB A;  4HQA A;  2ZOH A;  4JGR A;  3LR3 A;  3HJK A;  2KX6 A;  3EWK A;  3K2N A;  1S1Y A;  4PKY A;  1UGU A;  4H6J B;  4ETX A;  2B02 A;  3MF0 A;  4L9E A;  3S7P A;  2PR6 A;  3ZQ5 A;  5DF9 A;  3KYQ A;  4F3L A;  2PD8 A;  2V1A A;  4MN6 A;  3KSG A;  1WA9 A;  2W3E A;  2Z6C A;  4B9O A;  5HWV A;  2A24 A;  3JVV A;  3MMH A;  4HP9 A;  2M1C A;  3OOV A;  3MXQ A;  1GSX A;  4CLC D;  5IT5 A;  2WKP A;  4WLA A;  3KYZ A;  3K3C A;  4EEP A;  3T4Q A;  5F5Y A;  3IBR A;  4F3L B;  4HI4 A;  4FSF A;  5HL6 A;  1YAX A;  2JHE A;  3BQA A;  3IS2 A;  1W63 M;  3PR6 A;  2J3W A;  1DP9 A;  2OWH A;  3PBQ A;  2P04 A;  4DJ3 A;  5HPF A;  2A24 B;  3TW8 A;  4UQI M;  2G7U A;  5L8M A;  2O9B A;  3H7W A;  2VJW A;  4NEE D;  3E98 A;  2VZW A;  3MFX A;  2QKP A;  2B18 A;  3LI8 A;  1YSP A;  3OC2 A;  3HJI A;  1TS8 A;  4EEU A;  1XFN A;  5HPI A;  4PAU A;  3SW1 A;  4MDZ A;  3LIF A;  3MQQ A;  1S1Z A;  1XJ6 A;  2CMN A;  2P7J A;  4KUO A;  4PKY G;  3RTY A;  2W3G A;  4EW7 A;  2K7S A;  5J4E A;  3H7W B;  3ICY A;  5HDD A;  2W3D A;  3MQ0 A;  4KUK A;  2QHK A;  2Y8H A;  3LIC A;  3CUE A;  2L0W A;  1N9O A;  4GS9 A;  4Q0J A;  3T4T A;  4GW9 A;  1TS0 A;  5IS1 A;  4UEY A;  1DRM A;  2IA2 A;  4LLO B;  2W27 A;  2A2L A;  1ODV A;  3EEH A;  3FG8 A;  1P0Z A;  4JGO A;  2PYR A;  3GDI A;  1XFQ A;  3T4O A;  3PXP A;  4CLC E;  1TF1 A;  2K31 A;  3F1N A;  4I3A A;  4WEJ A;  1OTI A;  3CUE C;  3UMD A;  1OJG A;  4GCZ A;  2EWW A;  4GS9 B;  1LSV A;  5DJU A;  3MJQ A;  2YKH A;  2J3T C;  2JKR I;  2W1T A;  2XA7 S;  2W3H A;  4MN5 A;  3VE4 A;  4NXF A;  5FL3 A;  3UB9 A;  2MJ6 A;  3F1N B;  4L0L A;  3OLO A;  4GHI A;  1NLZ A;  3BWL A;  1MC0 A;  4DJ2 A;  1T19 A;  3A0S A;  4IHQ A;  2GNX A;  2XRO A;  2VV6 A;  5F6A A;  5TJJ A;  1S66 L;  1TS6 A;  3D72 A;  2EA9 A;  2HF6 A;  4BMW A;  4ARZ A;  2VKS A;  2W1T B;  2LB5 A;  1V9Z A;  3E4Q A;  4GHI B;  4EER A;  4GJ4 A;  4DMZ A;  4IUH A;  5KSH A;  1H8M A;  3PHY A;  3EGD C;  4G3V A;  1P9R A;  3C8C A;  4K08 A;  5F69 A;  5KIZ A;  4ARZ B;  4R3A A;  3CI6 A;  4QPR A;  2JKT M;  3TRC A;  1S4R A;  1X0O A;  3OCL A;  3LIE A;  5DJT A;  3UB6 A;  3FPW A;  2J3T D;  2K2N A;  3KX0 X;  1OPX A;  4I5S A;  1ZHH B;  2VLG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...