5IU1A

N-terminal pas domain homodimer of ppanr map3k from physcomitrella patens.
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
106
structure length
106
Chain Sequence
FESQPCVSIDLRGNITSWNRAAEQLYQFKEGEVMGRNLVDLIVPPNAKTAALDTIMRVGQGEVWIGQFSCVRRDNAILNTVVTQKPILDDDQKISGISVCTEPYSM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Plant protein
molecule keywords CTR1-like protein
publication title Genetic Analysis of Physcomitrella patens Identifies ABSCISIC ACID NON-RESPONSIVE, a Regulator of ABA Responses Unique to Basal Land Plants and Required for Desiccation Tolerance.
pubmed doi rcsb
source organism Physcomitrella patens subsp. patens
total genus 33
structure length 106
sequence length 106
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-03-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 5iu1A00
4JGRA 1OTDA 3MQOA 1D06A 1T1BA 1DRMA 4LRXC 5HWVA 2PDRA 4RQ9A 4I38A 3ULFA 3LI9A 4WLAA 5F68A 4B9OA 4BBVA 3UB6A 3NHQA 3BWLA 3LICA 1S1YA 3ICYA 5HSQA 4NXBA 4EESA 5HD3A 4WF0A 5I5LA 2PYRA 3E4OA 2PD8A 4MN5A 5EFWA 1ODVA 1V9YA 1S4SA 3A0VA 1N9LA 3CAXA 3MQQA 4GHIB 2J80A 3UB9A 1BYWA 3LIBA 3VE4A 5HDSA 3F1OB 2V0UA 4R3AA 1LSVA 1DP8A 2M1CA 3A0RA 4H6JB 1LT0A 3GDIA 1Y28A 1P97A 4XT2B 1MZUA 3LUQA 3NJAA 4M4XA 1LSWA 4EETB 2PHYA 1KOUA 2VV8A 2WKRA 4HHDA 4DJ3A 3F1NA 1TS8A 3PHYA 2ZOIA 3CLOA 3BY9A 1GSVA 3A0SA 3T50A 1GSWA 1WA9A 3HJKA 4PKYA 4NXGA 2JN7A 3P7NA 4YWZA 2ZOHA 3UB7A 4NXEA 2L0WA 5KIZA 2B02A 3UE6A 4HP9A 3VOLA 3IBRA 2QJ5A 3NOPC 4LLOB 3FG8A 4KUKA 4WN5A 3NOUC 3SW1A 5HDDA 3GECA 2A24A 3C2WA 5DJTA 1TS7A 1XJ4A 2K7SA 4GW9A 1DP9A 2D02A 3HJIA 4EERA 1X0OA 1S66L 1F98A 1XFNA 4BBTA 2V9AA 5HWTA 3H7WB 4I39A 2PR6A 2JHEA 2HV1A 1G28A 3KX0X 4GS9B 4WUJA 2Z6CA 4F3LA 3F1PB 3EEHA 4R38A 2R78A 4HY8A 4JGPA 3UMDA 5DKKA 3LI8A 4K08A 1UGUA 2KDKA 3IS2B 5G4ZA 4HJ6A 1JNUA 2YKHA 5TBMB 2BASA 4I3IA 4BBUA 4R70A 1S67L 5F6AA 3E4PA 2GJ3A 5IU1A 3NOTC 1N9NA 3RH8B 5HZHA 4KUOA 2I9VA 2W0NA 4JGOA 1F9IA 1XJ2A 3LIDA 4HJ3A 5J7EA 3LYXA 1XJ6A 3RTYA 4PKYG 2VLGA 3H82B 5DKLA 3K3DA 2VV6A 4HP4A 3K3CA 4DJ2A 1OTBA 4GHIA 3F1OA 3VE3A 3IS2A 1V9ZA 4LPZA 3LIAA 4H6JA 2Z6DA 1VB6A 4XT2A 4JGQA 1OT9A 2QKPA 3E4QA 4L9EA 4E04A 3LIFA 1XJ3A 3MFXA 1OTAA 5F5YA 4HI4A 1T1AA 1OTIA 2OWHA 2WKPA 4LRZE 3H82A 1OTEA 1T19A 2H28A 1DP6A 4L9GA 3LIEA 2INWA 2PYPA 3BY8A 2V1BA 4HH2A 3MXQA 1UWPX 4KQDA 3F1NB 3D72A 5IS1A 2PR5A 4HQAA 3EWKA 2QWSA 3FC7A 4I3AA 5HD5A 4EW7A 3B33A 2V0WA 1T18A 5A8BA 3UB8A 2YKFA 2VEAA 5HWWA 5J3WA 1EW0A 4HJ4A 1S4RA 3CWFA 2W27A 3PYPA 2OWJA 4GCZA 4I3JA 3C8CA 1LL8A 1N9OA 3ZQ5A 4EQ1A 5F69A 4HOIA 1TS0A 3H7WA 2EA9A 3H9WA 1GSXA 4L9FA 4NXFA 4I5SA 2A24B 4GS9A 1OJ5A 3F1PA 1D7EA 2OOLA 4WL9A 5AVFA 4HH3A 4MN6A 5J4EA 4HNBA 4EEUA 4EXOA 1TS6A 2KX6A 1XFQA 2WKQA 2D01A 2L4RA 5TBMA 4R6LA 3G6OA 4EEPA 1OJGA 3MR0A 1P0ZA 3OLOA 2P7JA 1T1CA 2V1AA 3MJQA 3UMEA 1NWZA 2L1MA 5HDCA 2ZBBA 4F3LB 1UWNX 4HIAA 4LRYC 5G4YA 1OT6A 2CMNA 5AVEA 2QJ7A 1LSXA 1S1ZA 2PD7A 2QHKA 2VV7A 5DJUA
chains in the Genus database with same CATH superfamily
1RP5A 1FR6A 4E6XA 2ZMAA 3QHYA 2QZ6A 1VEUA 2ZLYA 3LY4A 1T1BA 1RGYA 4S2OA 4UEYA 3N4IA 1ALQA 1MKMA 3HLGA 3G2ZA 3ZG5A 5BOHA 3WS1A 3CPTB 5FQQA 3NHQA 3BWLA 5L10A 1S1YA 3FV7A 1JVJA 4GD6A 3TE8A 2ZQAA 5HD3A 4OQGA 3CHWP 4C3QA 2PD8A 3O3VA 3A0VA 3TJZC 2ZC6B 1N9LA 1IOUA 5I94A 4GHIB 2J80A 3ZG8B 1BYWA 5E2EA 3F1OB 1K55C 2PU2A 4B93A 4IVIA 4PPRA 1KDWA 1DP8A 2CC1A 4H6JB 2W1TB 1Y28A 2E8JA 4UA9A 3LUQA 1YLYA 4EETB 1H3QA 1KOUA 3PXPA 2KOIA 5EVIB 2VV8A 2VK3A 3DTMA 4HHDA 3OOVA 1TS8A 4MNRA 2HJEA 1ES4A 1YPRA 5A91A 5EVEA 4S2JA 3BYDA 1CK3A 1WA9A 3E2KA 4NXGA 3BLSA 3QP1A 2JN7A 1NJ4A 3V67A 4D2OA 2Y2LA 4YWZA 3P01A 5E43A 2HP9A 2J8YA 4MBFA 5EECA 3QNCA 2L0WA 1YSQA 2B02A 2Y2PA 2WGIA 4P6ZS 4KZBA 4DXCA 1GCEA 2M7VA 3PBSA 3JPUA 3R4KA 3FG8A 4KUKA 2JC7A 2GDNA 4YOFA 3WRZA 5HDDA 1YLJA 4HBTA 1W8QA 2PBYA 3KYZA 5DJTA 4Z9QA 2VGJA 1Q2PA 4E3MA 3HJIA 4AFIA 1MWUA 5EOEA 1F2KA 1CJFA 4QD4A 1F98A 3MBZA 4PM7A 5HX9A 3A3FA 3C4PA 3WWXA 1MC0A 4BD0A 3HVFA 4E6WA 3HUMA 4U0TA 2P9VA 2JHEA 3KX0X 5MC7A 2XF3A 2XLNA 2J3WA 3EEHA 2R78A 5DTSA 1ONHA 3OBFA 3E0YA 1ZC2A 3LI8A 1UGUA 2JKTI 2Q9NA 3T4LA 2GZAA 1H8MA 4ESPA 1ESUA 4KG2A 1RCJA 1BLPA 4E3JA 1N9BA 5DVAA 1S67L 1TDGA 3LR5A 5F6AA 3E4PA 4XUXA 2Y59A 3DBAA 3PBNA 1ES5A 3IHBA 2ZL1B 3CUEA 3T4JA 2H0YA 2XA7S 1EI5A 4B88A 4KUOA 3QP4A 3LIDA 1G6OA 4E3NA 5CRFA 2ZQCA 3RTYA 4QWOA 3C7UA 4Q0JA 2Y2GA 1K4FA 4Y2FA 1SZVA 2XH9A 1P9WA 2I72A 4WM9A 3P98A 3AGFA 2K2NA 1V9ZA 5M1AA 4KZ4A 4G3KA 3WS4A 1HD8A 5G18A 4XT2A 1DJAA 1BTLA 4JGQA 2V8FA 2X71A 3E4QA 4L9EA 1LLBA 4E04A 1SCWA 3DWKA 3T4OA 1DJBA 1XJ3A 2V8CA 1IEMA 3NDEA 2Q0OA 1EROA 4GN2A 3A3JA 4HI4A 3B47A 4CLCA 1XKZA 2B18A 2WKPA 4WZ4A 3H82A 4KG6A 1OTEA 3N8RA 4EUVA 1FR1A 2ZMFA 4NEED 5FDSA 4OVDA 2PYPA 2V1BA 3DAVA 4HH2A 3S7OA 3G32A 3G34A 5IS1A 3SH9A 4LENA 1FCMA 4EBPA 4WEJA 3BFGA 5HD5A 2JCHA 4Y0OA 4Y7PA 3VP4A 2YKFA 2P08A 1SKOB 1LI9A 1KDSA 2V2FF 3ITAA 3IT9A 4HJ4A 3CMZA 1C3BA 3UPNA 2RL3A 2ZM2A 1WYCA 2VKSA 4GCZA 4II7A 1W63M 1LL9A 2OV5A 3IH9A 2XFTA 4R3JA 4OOMA 2Y2HA 3FKWA 5TJJA 2V20A 2Y8HA 1PI5A 1TS0A 1IELA 5IHVA 4BL3A 5FAOA 3N6IA 1MWRA 4M3KA 1GA0A 3LO7A 2A24B 3T4TA 4ZJ2A 3V50A 4S2PA 5F1GA 4WL9A 2WKHA 5AVFA 2Y2QA 5EVLA 4MN6A 4Y0TA 5J4EA 2XD5A 4EEUA 3W2ZA 4DMZA 4U0XA 4L0LA 1TS6A 4E3IA 1Y4OA 1JWPA 2D01A 3RFBA 3HBRA 4N9LA 5TBMA 3G4PA 3S4XA 4G3VA 2XFSA 1ES3A 3CUEC 4Q0IA 4EEPA 3SS3A 3OLOA 2P7JA 3CG5A 1PI4A 4OPZA 2JBFA 4QPRA 2QPNA 5EE8A 3SS4A 4F3LB 2XGNA 4DE3A 3DTEA 2ZD8A 1G5UA 4HIAA 3V3RA 1VQQA 3BQAA 4GOGA 1BUEA 1YAXA 5AVEA 2BLSA 4LV0A 1AWIA 3VOYA 5CERA 3PBTA 3E98A 2PD7A 4KQRA 1TF1A 4MBHA 3Q7VB 4IEDA 3LEZA 5DJUA 3DTKA 4MBKA 2WZXA 2ZQ9A 1TEMA 3SH8A 1OTDA 3MQOA 3ZHHA 4K91A 1VETA 4O0PA 4S2NA 5CTNA 2EFUA 3FKVA 4PHTA 5FEFA 2WYXA 3LI9A 2FFYA 4LFUA 3CITA 1NXYA 1LL5A 3BFDA 3NY4A 4RX3A 2IWBA 1K54A 2Y2JA 4NXBA 1FILA 1YT4A 4OLDA 4B4XA 2VGLS 3M6BA 5I5LA 3E4OA 1JTGA 1BLHA 1ODVA 2G7UA 1S4SA 1KE4A 2J3TC 4CLCC 3UB9A 5K5BA 3VE4A 2O9AA 2VGKA 4KG5A 4PAUA 2WZZA 2LB9A 4XUZA 2HJ9C 3VP3A 3ZGAB 1P97A 1MZUA 2OAP1 4KZ8A 3NCKA 3VP1A 2XD1A 4YINA 3KO6A 4DJ3A 3F1NA 3T12B 2XK1A 2HPBA 4R3BA 3EOIA 2WAFA 4DXBA 3U2AA 4OKPA 1IYOA 5E2FA 5IT5A 3A0SA 5CX7A 3UO9A 2PT7A 4IUHA 3SOIA 1BSGA 3MZDA 4JXWA 3K2NA 2EXBA 2O9BA 3P7NA 3ZDJA 4OQIA 3N8SA 3T1SA 3GTCA 1FQGA 4P6BA 4HP9A 3MKFA 2JKRI 1DJCA 3B42A 4LLOB 1I2SA 3GECA 1CEFA 3IF6A 3V3SA 3W4PA 2R9WA 2EX9A 1TS7A 2PU4A 4GDBA 4GW9A 4LV3A 2EWVA 1LHYA 3S7NA 4GB7A 3JYIA 4BBTA 1XPBA 3R7WA 2W3DA 4X6TA 5L09A 5HWTA 3ZVWA 3H7WB 4ZAMA 4X55A 4Y5FA 3HLDA 3C30A 4GDNA 1G28A 2XROA 3UB5P 1ZG6A 4WUJA 3LR0A 2H0TA 4D60A 3EQUA 1IYPA 4R38A 4KQQA 1GHIA 3L9KA 3BECA 3W8KA 3UMDA 2O99A 2LB5A 5DKKA 5F1FA 4K08A 3IS2B 2WGWB 4HJ6A 3HL9A 3LCEA 1SDNA 1MXOA 3IH8A 1JTDA 5EVID 4R70A 4S2NC 5CEBA 3UE1A 5IU1A 4ME4A 1CF0A 5GL9A 3HLWA 3KSHA 3BM6A 2OLVA 4S2MA 5HZHA 2I9VA 1ACFA 1K54C 2W0NA 1F9IA 2DRWA 1XJ2A 4HJ3A 5FQJA 4PKYG 2Y2NA 2IWDA 4ZBEA 3QP8A 5CGSA 5HAIA 3K3DA 4OLGA 2VV6A 4BMWA 1VEUB 4XXRA 2BG1A 2A49A 3LFVA 3M2JA 3Q07A 1BZAA 1PWGA 4EBLA 5HAPA 4P85A 4HESA 1M6KA 1HZOA 1OPXA 3LY3A 4DKIA 2HGVA 2WAEA 1OT9A 3HLCA 4RYEA 4KENB 4N92A 3OCNA 4A5RA 1KVMA 5E2HA 3TG9A 5F5YA 3UPPA 4LRZE 3S7QA 4JF6A 5CHUA 4MEZA 4O01A 1NLZA 3OC2A 4L9GA 4Y13A 4YFMA 1KGFA 5FI6A 2JKFA 4X69A 3IWOA 3BRMA 4MN7A 4JKTA 4WZ5A 1E3UD 1ONGA 1L3LA 2Q9MA 2PR5A 3KSFA 4HQAA 3EWKA 4BJPA 5M19A 3TRCA 3FC7A 3GQZA 4FH2A 4EW7A 5TR7A 4KZ5A 4BQMA 1L2SA 5A8BA 3IF6C 3MMHA 4QHCA 1U60A 4S2LA 2PBDP 1ES2A 3BQ8A 3ZG0A 1XGIA 5GHZA 4I3JA 3C8CA 2P74A 1KVLA 3GRJA 2OAQ1 3UDXA 1I5QA 2EA9A 3FWLA 1SHVA 2ZJ9A 1GSXA 1I2WA 4NXFA 4GS9A 4ZTKA 3MZEA 4GJ4A 3IXHA 2MJ6A 4HEFA 4Y3IA 3F1PA 4OH0A 3ZG7B 3HLEA 1O07A 4PMAA 2XR0A 1XFQA 2HP5A 2WKQA 2ZC3B 3WS5A 4X1MA 2P9VB 2VA0A 2G2WA 1N4OA 1PZPA 1P0ZA 4DN0A 2V1AA 2HF6A 3MJQA 3UMEA 1ESIA 5HDCA 3FZCA 4ETZA 5EV0A 1MWSA 1W63Q 5KSHA 5FA7A 2Y2OA 4F94A 3OPHA 2QJ7A 2XDMA 1S1ZA 4ARZA 3G31A 1QMEA 4IJGA 1HVBA 1KE0A 4KZAA 5FATA 3G2YA 5L8MA 1PFLA 2FFFB 1D1JA 4C6YA 4LRXC 4QB8A 1K25A 4OP8A 4R1GA 3MKEA 3GV9A 2Y4AA 4PM6A 3ULFA 4KZ9A 3PAGA 4WLAA 5F68A 3O88A 4BBVA 3UB6A 2G2UA 1PZOA 3A3IA 3GSGA 2DMWA 3M6HA 4NG2A 5GLAA 4EESA 4CLCE 4P0MA 4MN5A 4UHUA 4BENA 2HZ5A 2XSSA 5EFWA 1V9YA 1VHMA 5FAQA 3IXGA 3CAXA 3MQQA 3IF5A 3LIBA 4FH4A 5HDSA 4EV4A 1GHMA 2V0UA 4R3AA 1L0EA 1LSVA 1F5MA 2M1CA 5FAPA 3A0RA 4ETXA 1LT0A 2Z2MB 3DW0A 4K0XA 4XT2B 3NJAA 3BEBA 1LSWA 4WZ5C 3NULA 4GD8A 2PHYA 3UN7A 1G68A 1NZUA 3PHYA 2ZM0A 1PWDA 1FIKA 3HREA 5CHMA 1RGZA 3BY9A 2EWWA 1GSVA 4EUZA 3SS5A 1NLYA 4R0QA 4UA6A 1YLTA 3NIAA 4CLCB 4E3OA 5FL3A 1K57A 2B5RA 3HJKA 3KYEA 4PKYA 1YLWA 2Y55A 3LGOA 5DFXA 5EUAA 2ZC5B 2NUTC 3ZVTA 1PW8A 1ZKJA 2IWCA 2ZOHA 5TFQA 3UB7A 2WGVA 4EWFA 5C5KA 1ERQA 4GLQA 5KIZA 2FH5A 2VGLM 2W3GA 4IUKA 3NDGA 5KSCA 5M18A 1QMFA 4DE1A 4B4ZA 3IBRA 3C7VA 4X25A 5EOOA 2QJ5A 1HLUP 3NOPC 4Y15A 1SKFA 4R4SA 2GNXA 4WN5A 2J9PA 2R9XA 5KMWA 3HUOA 3C38A 1PWCA 1ZG4A 3IXDA 5FASA 3CZDA 4S2KA 1W79A 3T4SA 1DP9A 1DY6A 4EERA 4N9KA 1X0OA 1S66L 1P9RA 1K55A 1XFNA 3KYQA 5HL6A 2V9AA 3VSLA 3MXSA 3CI6A 3FPWA 1S0WA 4MDZA 4DDYA 3V5MA 4QY5A 4WBGA 1FSWA 2Z6CA 5CGXA 1PYYA 4UA7A 3W4QA 4JGPA 3HUNA 2ZQ7A 3BFCA 3E2LA 4FSFA 4BL2A 1BLSA 4U3TA 3OZHA 5TBMB 2BASA 4CQHA 5HL1A 4S2IA 4BBUA 5CGWA 3NOTC 4MCWA 3DWZA 3G35A 5L2FA 4X56A 1XX2A 2AVXA 5EM0A 2VX8A 2K31A 3PTEA 2FZ0A 1W8YA 4BWIA 1HTZA 3T1RA 3CPTA 3HLFA 5J7EA 3VSKA 1K56D 3GMWA 2VLGA 5GHXA 3AGEA 4JF5A 2C5WB 3GR2A 4OQ0A 2EX2A 3S22A 5FQMA 5GLDA 1TD5A 4UQIS 1VETB 1OTBA 4JF4A 4WMCD 4OPRA 4GHIA 1ZHHB 3C5AA 3L7HA 5E2GA 3RJUA 4KZ3A 3F1OA 3LEQA 3VE3A 4FUWA 3IS2A 1KGGA 1XA1A 4E3KA 4LPZA 4H6JA 1W7FA 3UE0A 2W1TA 1VB6A 3T4QA 4WEKA 3HLBA 3UY6A 5DTTA 2ZQDA 4ZDXA 5EVIA 3UDFA 4NKPA 5A92A 3MFXA 2C6WB 4MMNA 1OTAA 3OCLA 2BTFP 2Y79A 1K57C 5CEDA 3MSHA 2EX8A 1OTIA 3EQVA 4FD8A 2OWHA 2HDQA 5FDHA 2RCXA 4Z1WA 1PRQA 2X02A 1H8ZA 1TVFA 2H28A 3QP2A 3SZTA 2EFXA 5LBRA 3LIEA 3BY8A 3LR4A 5F82A 3U4LP 1IYQA 1UWPX 4KQDA 2NUPC 3F1NB 2A3UA 1STZA 4E3LA 3MZFA 2QWSA 2PAVP 3B33A 3NC8A 3KSIA 3GVBA 4LGWA 4JXGA 2VEAA 2W3HA 3QP6A 5HWWA 4P6ZM 2OLUA 2O9CA 4WYYA 4DRTA 4LCLA 1S4RA 4IBXA 5FQIA 4WELA 1J3WA 1GA9A 4DE2A 1MWTA 2OWJA 3B3XA 5DTKA 4ID4A 1XXMA 2WUQA 2ZC4B 3ZQ5A 1XGJA 1YM1A 5GLCA 4KZ6A 4HOIA 5AQ7A 3S1YA 3VP0A 5FI7A 3H9WA 3ZCZA 2ACGA 2Y2IA 3IF6B 3IWIA 4UAAA 1XA7A 1OJ5A 1D7EA 5CTMA 2OOLA 4NETA 3ZFZA 2ZM8A 3TSGA 4HH3A 3G30A 4H8RA 3ITBA 1E3UA 3QP5A 3WS2A 1Q2QA 2XQZA 3IHAA 1H0MA 2J7VA 2W3EA 3R7WB 4OPYA 4FTXA 4R6LA 4PM8A 3ISGA 1L0GA 3MR0A 3BW6A 4KQOA 3UPOA 2XEPA 5JYOA 1YMXA 3T4KA 1NY0A 1BT5A 1NWZA 2ZL1A 3EGDC 3BLMA 4Q8IA 4X1LA 2H5SA 4ZRRA 1NZOA 2CMNA 3T1QB 4FCFA 1AXBA 4JLFA 4DDSA 2IA2A 2HDSA 1XP4A 5FEGA 3O86A 4IHQA 1J9MA 3DTIA 4LCMA 2XA7M 2VV7A 4BLMA 2JE5A 4JGRA 1IKGA 3IXBA 1D06A 4P87A 1CI8A 5AQAA 5FSRA 3OPLA 1DRMA 3D9YA 1E25A 1JWVA 5HWVA 2PDRA 4RQ9A 4I38A 5HW3A 4CPKA 3OPPA 4QU3A 3Q7ZA 3A3EA 3LR3A 1H5XA 4OOYA 4B9OA 1BLCA 3LICA 4EU0A 1A0KA 3JVVA 2KLIA 3ICYA 5HSQA 2JKTM 2VZWA 3A3DA 3RXWA 5EVIC 5L07A 1BULA 5GLBA 4WF0A 2PYRA 3RXXA 1Y54A 4IBRA 4OPQA 1ERMA 5CXWA 1NRFA 1NYYA 3AGDA 2P04A 1FOFA 2Z2LB 3P09A 3VFHA 1NRJA 3GDIA 4M4XA 5EM1A 1YQSA 5GHYA 5AQBA 5HAQA 2WKRA 4R23A 4RVAA 5DF9A 2ZOIA 2JKGA 1WYBA 3CLOA 1KGEA 3T50A 1GSWA 1H8YA 5U47A 2M7UA 3NECA 1YLPA 3IX4A 1IFQA 1SKOA 2B95A 3MXRA 1K0KA 2XRNA 4GZBA 4NXEA 3NI9A 1O7EA 3UE6A 3BFFA 3VOLA 1LI0A 3I7JA 5HFOA 1MY8A 1YSPA 2V1ZA 4N1XA 4OONA 4MLLA 3NOUC 4DE0A 3SW1A 3MFDA 2A24A 3C2WA 4G3WA 3VOZA 2EXAA 2HP6A 1XJ4A 2K7SA 1L0DA 2PRFA 1JWZA 2D02A 4KZ7A 3OPRA 2EX6A 4RX2A 3SH7A 3VP2A 4JPMA 4I39A 2PR6A 2HV1A 3T1XA 2QYBA 2HDRA 2E8IA 4GS9B 2O0YA 1CEGA 4F3LA 2HDUA 3F1PB 2GX5A 5DF7A 2ZQ8A 4HY8A 4PM9A 1TDLA 1Z6FA 4X53A 3IX8A 2KDKA 5A90A 5G4ZA 2WADA 3VV4A 3ZG9B 1JNUA 5HARA 2YKHA 2WK0A 3Q7VA 4I3IA 3PAEA 5AQ9A 4Q0HA 3UNWA 5HPFA 1Z09A 2GJ3A 3O5YA 2UWXA 3BJNA 2WKEA 2UV0E 1N9NA 2J3TD 4EQIA 3RH8B 4CLCD 3MS6A 3QNBA 5CECA 1M40A 3FYZA 5TGFA 3FPVA 5CHJA 4JGOA 4ARZB 4JXSA 3LYXA 5FI2A 1XJ6A 3PBOA 3IWQA 3MF0A 3WRTA 3H82B 3KSGA 1MBLA 3N7WA 1ZTUA 5DKLA 3W4OA 3Q1FA 2H10A 5AJGA 4HP4A 3K3CA 1CQAA 2ZC7A 5DF8A 4X68A 1PNEA 4DJ2A 1VM1A 1W5DA 3UE3A 1OMEA 1PIOA 4Y0UA 1K6SA 3IBJA 4N1HA 3LIAA 3S7PA 2Z6DA 1FSYA 4NK3A 4OOLA 2X01A 2QKPA 2QMIA 4EBNA 4K0WA 2WKIA 4OP5A 5D3OA 3LIFA 3IQAA 1K6RA 4GNUA 4QY6A 3ZNYA 5JYPA 1EWZA 1T1AA 2J9OA 1WE4A 3IX3A 3Q82A 3N8LA 3C4OA 2OSUA 1T19A 1DP6A 4QJGA 4IVKA 1K56A 4Y17A 1K4EA 3M2KA 1FCOA 2INWA 5J8XA 3MXQA 3TW8A 5DFYA 2W3FA 3D72A 2Y2KA 1YMSA 3Q81A 4WMCA 4I3AA 5HPIA 3VMAA 4UQIM 2V0WA 3ZNTA 1T18A 3UB8A 1CI9A 4PM5A 4GKUA 3WS0A 1GHPA 3PR6A 4R4RA 5J3WA 1EW0A 3CWFA 2Y2MA 3TOIA 2VJWA 4HBUA 2W27A 4RA7A 3PYPA 1SDEA 2A2LA 5A93A 1MPLA 4OQHA 1LL8A 1N9OA 4EQ1A 4CJNA 3EGXC 1MKIA 3PBQA 3D4FA 5F69A 1E4DA 3H7WA 1FCNA 2Y91A 1YLZA 3D3OA 5F83A 4L9FA 3JVUA 5EPHA 4I5SA 1IKIA 2W1RA 3HCYA 4JXVA 3ZYTA 3MQ0A 5FQ9A 4YNRA 1KE3A 2ZMVA 4HNBA 4O7DA 4EXOA 2KX6A 4LV1A 1S6RA 2WGWA 3EEAA 4ZJ1A 2L4RA 1IYSA 4ZJ3A 1PW1A 2JKRM 5FQKA 3G6OA 3NBLA 1OJGA 4LV2A 1K38A 1T1CA 1YKDA 2L1MA 4BD1A 2ZBBA 1L0FA 1UWNX 4O8GA 1G6AA 4LRYC 5G4YA 1OT6A 5KZHA 2DCFA 4JBFA 1LSXA 3PBRA 4DF6A 3BFEA 3UDIA 3VFFA 3O87A 3V39A 2QHKA 1NYMA 4C75A 4FOFA 2DNSA 3CJMA
chains in the Genus database with same CATH topology
4JGRA 1OTDA 5L8MA 3MQOA 1D06A 1T1BA 4UEYA 1DRMA 4LRXC 4O0PA 5HWVA 1MKMA 2PDRA 4RQ9A 4I38A 4PHTA 3ULFA 3LR3A 3LI9A 4WLAA 5F68A 4B9OA 4BBVA 3UB6A 3NHQA 3BWLA 3CITA 1S1YA 3LICA 4EU0A 3JVVA 2KLIA 3ICYA 2DMWA 5HSQA 2JKTM 4NXBA 2VZWA 4EESA 3TE8A 5HD3A 4WF0A 2VGLS 5I5LA 4CLCE 2PYRA 3E4OA 2PD8A 4MN5A 2XSSA 5EFWA 1ODVA 2G7UA 1V9YA 1S4SA 1VHMA 3A0VA 3TJZC 1N9LA 2J3TC 3CAXA 3MQQA 1IOUA 4CLCC 4GHIB 2J80A 3UB9A 1BYWA 3LIBA 5K5BA 3VE4A 5HDSA 3F1OB 2O9AA 4PAUA 4B93A 2V0UA 2LB9A 4R3AA 2P04A 1LSVA 1DP8A 1NRJA 1F5MA 2HJ9C 2M1CA 3A0RA 4H6JB 4ETXA 1LT0A 2W1TB 3GDIA 1Y28A 1P97A 4XT2B 1MZUA 2OAP1 3LUQA 3NJAA 4M4XA 1LSWA 4EETB 1H3QA 2PHYA 1KOUA 3PXPA 2KOIA 2VV8A 2WKRA 3KO6A 4HHDA 4DJ3A 3OOVA 3F1NA 1TS8A 3PHYA 5DF9A 2ZOIA 2HJEA 3CLOA 3EOIA 3BY9A 2EWWA 1GSVA 1NLYA 2VV7A 3U2AA 4CLCB 5IT5A 3A0SA 5CX7A 3T50A 2PT7A 1GSWA 5FL3A 4IUHA 1WA9A 3HJKA 2M7UA 4PKYA 5DFXA 1IFQA 4NXGA 2JN7A 3K2NA 3V67A 2O9BA 2NUTC 3P7NA 4YWZA 2ZOHA 3P01A 3UB7A 5C5KA 2XRNA 4GLQA 4NXEA 2L0WA 5KIZA 1YSQA 2B02A 2FH5A 2VGLM 2W3GA 4IUKA 3UE6A 4P6ZS 4HP9A 3VOLA 3IBRA 2M7VA 1YSPA 2JKRI 2QJ5A 3B42A 3NOPC 3PBSA 4LLOB 3R4KA 2GNXA 3FG8A 4KUKA 4WN5A 3NOUC 4YOFA 3SW1A 5HDDA 3GECA 3C38A 2A24A 3C2WA 4G3WA 3KYZA 5DJTA 1TS7A 1XJ4A 2K7SA 4GW9A 3T4SA 1DP9A 2D02A 2EWVA 3HJIA 4EERA 4AFIA 1X0OA 1S66L 1P9RA 1F98A 3S7NA 1XFNA 5HL6A 3KYQA 4BBTA 2V9AA 3R7WA 2W3DA 1MC0A 5HWTA 3CI6A 3FPWA 3H7WB 4MDZA 4I39A 2PR6A 2JHEA 4Y5FA 2HV1A 3C30A 2QYBA 1G28A 3KX0X 5MC7A 2XROA 4GS9B 2O0YA 4WUJA 2Z6CA 3LR0A 3F1PB 4F3LA 2GX5A 3EQUA 2J3WA 3EEHA 4R38A 2R78A 4HY8A 4JGPA 3UMDA 2O99A 2LB5A 3OBFA 5DKKA 3E0YA 3LI8A 4K08A 1UGUA 2JKTI 2KDKA 3IS2B 5G4ZA 3T4LA 2GZAA 4FSFA 3VV4A 1H8MA 4HJ6A 1JNUA 2YKHA 5TBMB 2BASA 4I3IA 4CQHA 4Q0HA 4BBUA 4R70A 1S67L 5HPFA 3LR5A 5F6AA 3E4PA 2GJ3A 3O5YA 5IU1A 4ME4A 3BJNA 3DBAA 3PBNA 3NOTC 4MCWA 3T4JA 3CUEA 3KSHA 1N9NA 2J3TD 2XA7S 3RH8B 4CLCD 5HZHA 2VX8A 2K31A 4KUOA 2I9VA 2FZ0A 3FPVA 2W0NA 4JGOA 4BWIA 1F9IA 4ARZB 1XJ2A 3LIDA 4HJ3A 1G6OA 3LYXA 5J7EA 1XJ6A 3PBOA 3RTYA 4PKYG 3MF0A 4Q0JA 2VLGA 3H82B 3KSGA 4Y2FA 1ZTUA 5DKLA 3K3DA 2VV6A 5AJGA 4BMWA 4HP4A 3K3CA 1P9WA 1TD5A 4UQIS 4DJ2A 1OTBA 2K2NA 4GHIA 1ZHHB 3LFVA 3F1OA 3VE3A 3IS2A 1V9ZA 3UE3A 4G3KA 4LPZA 1OPXA 3IBJA 3LIAA 4H6JA 3S7PA 2Z6DA 2W1TA 1VB6A 4XT2A 2HGVA 4OOLA 4JGQA 1OT9A 3T4QA 4WEKA 2QKPA 3E4QA 4L9EA 4E04A 3T4OA 3OCNA 3LIFA 1XJ3A 4NKPA 3MFXA 4MMNA 1OTAA 3OCLA 2Y79A 5F5YA 4HI4A 1T1AA 3B47A 4CLCA 2B18A 1OTIA 3EQVA 2OWHA 2WKPA 4LRZE 3S7QA 3H82A 4Z1WA 4O01A 1NLZA 1OTEA 1T19A 2H28A 3OC2A 1DP6A 4EUVA 4L9GA 5LBRA 2ZMFA 4NEED 3LIEA 2INWA 2PYPA 3BY8A 3LR4A 2V1BA 4HH2A 3MXQA 1UWPX 3TW8A 3S7OA 4MN7A 4KQDA 2NUPC 3F1NB 5DFYA 2W3FA 3D72A 5IS1A 2PR5A 3KSFA 4HQAA 3EWKA 4BJPA 4WEJA 1STZA 3TRCA 2QWSA 3FC7A 4I3AA 5HD5A 4EW7A 3B33A 5HPIA 4UQIM 2V0WA 1T18A 3KSIA 5A8BA 3MMHA 3UB8A 2YKFA 2P08A 2VEAA 2W3HA 3PR6A 5HWWA 5J3WA 4P6ZM 2O9CA 1EW0A 3BQ8A 4HJ4A 1S4RA 3CWFA 4WELA 2VJWA 2W27A 3PYPA 2VKSA 2OWJA 4GCZA 4II7A 2A2LA 4I3JA 1W63M 3C8CA 1LL8A 1N9OA 4OOMA 3ZQ5A 4EQ1A 5TJJA 2OAQ1 3EGXC 3PBQA 2Y8HA 5F69A 4HOIA 1TS0A 3H7WA 2EA9A 3D3OA 3H9WA 1GSXA 4L9FA 3JVUA 4NXFA 4I5SA 3HCYA 2W1RA 2A24B 4GS9A 3T4TA 4GJ4A 2MJ6A 4Y3IA 3ZYTA 1OJ5A 3F1PA 1D7EA 2OOLA 4WL9A 3MQ0A 5AVFA 4HH3A 4YNRA 4MN6A 2ZMVA 5J4EA 4HNBA 4EEUA 3W2ZA 4DMZA 4L0LA 4EXOA 1TS6A 2KX6A 1XFQA 2WKQA 2W3EA 2D01A 3EEAA 3R7WB 3RFBA 2L4RA 5TBMA 4R6LA 4G3VA 2JKRM 2VA0A 3G6OA 3CUEC 4Q0IA 4EEPA 1OJGA 3MR0A 3BW6A 4KQOA 1P0ZA 3OLOA 4DN0A 2P7JA 1T1CA 2V1AA 2HF6A 3MJQA 3T4KA 1YKDA 3UMEA 1NWZA 4QPRA 2L1MA 5HDCA 4ETZA 2ZBBA 4F3LB 3EGDC 1W63Q 5KSHA 1UWNX 4O8GA 4HIAA 4LRYC 3BQAA 5G4YA 1OT6A 4ZRRA 1YAXA 2CMNA 5AVEA 2QJ7A 1LSXA 1S1ZA 3PBRA 4ARZA 2IA2A 3PBTA 3E98A 2PD7A 2QHKA 4IHQA 1TF1A 4IJGA 4FOFA 2XA7M 5DJUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JGR A;  1OTD A;  3MQO A;  1D06 A;  1T1B A;  1DRM A;  4LRX C;  5HWV A;  2PDR A;  4RQ9 A;  4I38 A;  3ULF A;  3LI9 A;  4WLA A;  5F68 A;  4B9O A;  4BBV A;  3UB6 A;  3NHQ A;  3BWL A;  3LIC A;  1S1Y A;  3ICY A;  5HSQ A;  4NXB A;  4EES A;  5HD3 A;  4WF0 A;  5I5L A;  2PYR A;  3E4O A;  2PD8 A;  4MN5 A;  5EFW A;  1ODV A;  1V9Y A;  1S4S A;  3A0V A;  1N9L A;  3CAX A;  3MQQ A;  4GHI B;  2J80 A;  3UB9 A;  1BYW A;  3LIB A;  3VE4 A;  5HDS A;  3F1O B;  2V0U A;  4R3A A;  1LSV A;  1DP8 A;  2M1C A;  3A0R A;  4H6J B;  1LT0 A;  3GDI A;  1Y28 A;  1P97 A;  4XT2 B;  1MZU A;  3LUQ A;  3NJA A;  4M4X A;  1LSW A;  4EET B;  2PHY A;  1KOU A;  2VV8 A;  2WKR A;  4HHD A;  4DJ3 A;  3F1N A;  1TS8 A;  3PHY A;  2ZOI A;  3CLO A;  3BY9 A;  1GSV A;  3A0S A;  3T50 A;  1GSW A;  1WA9 A;  3HJK A;  4PKY A;  4NXG A;  2JN7 A;  3P7N A;  4YWZ A;  2ZOH A;  3UB7 A;  4NXE A;  2L0W A;  5KIZ A;  2B02 A;  3UE6 A;  4HP9 A;  3VOL A;  3IBR A;  2QJ5 A;  3NOP C;  4LLO B;  3FG8 A;  4KUK A;  4WN5 A;  3NOU C;  3SW1 A;  5HDD A;  3GEC A;  2A24 A;  3C2W A;  5DJT A;  1TS7 A;  1XJ4 A;  2K7S A;  4GW9 A;  1DP9 A;  2D02 A;  3HJI A;  4EER A;  1X0O A;  1S66 L;  1F98 A;  1XFN A;  4BBT A;  2V9A A;  5HWT A;  3H7W B;  4I39 A;  2PR6 A;  2JHE A;  2HV1 A;  1G28 A;  3KX0 X;  4GS9 B;  4WUJ A;  2Z6C A;  4F3L A;  3F1P B;  3EEH A;  4R38 A;  2R78 A;  4HY8 A;  4JGP A;  3UMD A;  5DKK A;  3LI8 A;  4K08 A;  1UGU A;  2KDK A;  3IS2 B;  5G4Z A;  4HJ6 A;  1JNU A;  2YKH A;  5TBM B;  2BAS A;  4I3I A;  4BBU A;  4R70 A;  1S67 L;  5F6A A;  3E4P A;  2GJ3 A;  5IU1 A;  3NOT C;  1N9N A;  3RH8 B;  5HZH A;  4KUO A;  2I9V A;  2W0N A;  4JGO A;  1F9I A;  1XJ2 A;  3LID A;  4HJ3 A;  5J7E A;  3LYX A;  1XJ6 A;  3RTY A;  4PKY G;  2VLG A;  3H82 B;  5DKL A;  3K3D A;  2VV6 A;  4HP4 A;  3K3C A;  4DJ2 A;  1OTB A;  4GHI A;  3F1O A;  3VE3 A;  3IS2 A;  1V9Z A;  4LPZ A;  3LIA A;  4H6J A;  2Z6D A;  1VB6 A;  4XT2 A;  4JGQ A;  1OT9 A;  2QKP A;  3E4Q A;  4L9E A;  4E04 A;  3LIF A;  1XJ3 A;  3MFX A;  1OTA A;  5F5Y A;  4HI4 A;  1T1A A;  1OTI A;  2OWH A;  2WKP A;  4LRZ E;  3H82 A;  1OTE A;  1T19 A;  2H28 A;  1DP6 A;  4L9G A;  3LIE A;  2INW A;  2PYP A;  3BY8 A;  2V1B A;  4HH2 A;  3MXQ A;  1UWP X;  4KQD A;  3F1N B;  3D72 A;  5IS1 A;  2PR5 A;  4HQA A;  3EWK A;  2QWS A;  3FC7 A;  4I3A A;  5HD5 A;  4EW7 A;  3B33 A;  2V0W A;  1T18 A;  5A8B A;  3UB8 A;  2YKF A;  2VEA A;  5HWW A;  5J3W A;  1EW0 A;  4HJ4 A;  1S4R A;  3CWF A;  2W27 A;  3PYP A;  2OWJ A;  4GCZ A;  4I3J A;  3C8C A;  1LL8 A;  1N9O A;  3ZQ5 A;  4EQ1 A;  5F69 A;  4HOI A;  1TS0 A;  3H7W A;  2EA9 A;  3H9W A;  1GSX A;  4L9F A;  4NXF A;  4I5S A;  2A24 B;  4GS9 A;  1OJ5 A;  3F1P A;  1D7E A;  2OOL A;  4WL9 A;  5AVF A;  4HH3 A;  4MN6 A;  5J4E A;  4HNB A;  4EEU A;  4EXO A;  1TS6 A;  2KX6 A;  1XFQ A;  2WKQ A;  2D01 A;  2L4R A;  5TBM A;  4R6L A;  3G6O A;  4EEP A;  1OJG A;  3MR0 A;  1P0Z A;  3OLO A;  2P7J A;  1T1C A;  2V1A A;  3MJQ A;  3UME A;  1NWZ A;  2L1M A;  5HDC A;  2ZBB A;  4F3L B;  1UWN X;  4HIA A;  4LRY C;  5G4Y A;  1OT6 A;  2CMN A;  5AVE A;  2QJ7 A;  1LSX A;  1S1Z A;  2PD7 A;  2QHK A;  2VV7 A;  5DJU A; 
#chains in the Genus database with same CATH topology
 1RP5 A;  1FR6 A;  4E6X A;  2ZMA A;  3QHY A;  2QZ6 A;  1VEU A;  2ZLY A;  3LY4 A;  1T1B A;  1RGY A;  4S2O A;  4UEY A;  3N4I A;  1ALQ A;  1MKM A;  3HLG A;  3G2Z A;  3ZG5 A;  5BOH A;  3WS1 A;  3CPT B;  5FQQ A;  3NHQ A;  3BWL A;  5L10 A;  1S1Y A;  3FV7 A;  1JVJ A;  4GD6 A;  3TE8 A;  2ZQA A;  5HD3 A;  4OQG A;  3CHW P;  4C3Q A;  2PD8 A;  3O3V A;  3A0V A;  3TJZ C;  2ZC6 B;  1N9L A;  1IOU A;  5I94 A;  4GHI B;  2J80 A;  3ZG8 B;  1BYW A;  5E2E A;  3F1O B;  1K55 C;  2PU2 A;  4B93 A;  4IVI A;  4PPR A;  1KDW A;  1DP8 A;  2CC1 A;  4H6J B;  2W1T B;  1Y28 A;  2E8J A;  4UA9 A;  3LUQ A;  1YLY A;  4EET B;  1H3Q A;  1KOU A;  3PXP A;  2KOI A;  5EVI B;  2VV8 A;  2VK3 A;  3DTM A;  4HHD A;  3OOV A;  1TS8 A;  4MNR A;  2HJE A;  1ES4 A;  1YPR A;  5A91 A;  5EVE A;  4S2J A;  3BYD A;  1CK3 A;  1WA9 A;  3E2K A;  4NXG A;  3BLS A;  3QP1 A;  2JN7 A;  1NJ4 A;  3V67 A;  4D2O A;  2Y2L A;  4YWZ A;  3P01 A;  5E43 A;  2HP9 A;  2J8Y A;  4MBF A;  5EEC A;  3QNC A;  2L0W A;  1YSQ A;  2B02 A;  2Y2P A;  2WGI A;  4P6Z S;  4KZB A;  4DXC A;  1GCE A;  2M7V A;  3PBS A;  3JPU A;  3R4K A;  3FG8 A;  4KUK A;  2JC7 A;  2GDN A;  4YOF A;  3WRZ A;  5HDD A;  1YLJ A;  4HBT A;  1W8Q A;  2PBY A;  3KYZ A;  5DJT A;  4Z9Q A;  2VGJ A;  1Q2P A;  4E3M A;  3HJI A;  4AFI A;  1MWU A;  5EOE A;  1F2K A;  1CJF A;  4QD4 A;  1F98 A;  3MBZ A;  4PM7 A;  5HX9 A;  3A3F A;  3C4P A;  3WWX A;  1MC0 A;  4BD0 A;  3HVF A;  4E6W A;  3HUM A;  4U0T A;  2P9V A;  2JHE A;  3KX0 X;  5MC7 A;  2XF3 A;  2XLN A;  2J3W A;  3EEH A;  2R78 A;  5DTS A;  1ONH A;  3OBF A;  3E0Y A;  1ZC2 A;  3LI8 A;  1UGU A;  2JKT I;  2Q9N A;  3T4L A;  2GZA A;  1H8M A;  4ESP A;  1ESU A;  4KG2 A;  1RCJ A;  1BLP A;  4E3J A;  1N9B A;  5DVA A;  1S67 L;  1TDG A;  3LR5 A;  5F6A A;  3E4P A;  4XUX A;  2Y59 A;  3DBA A;  3PBN A;  1ES5 A;  3IHB A;  2ZL1 B;  3CUE A;  3T4J A;  2H0Y A;  2XA7 S;  1EI5 A;  4B88 A;  4KUO A;  3QP4 A;  3LID A;  1G6O A;  4E3N A;  5CRF A;  2ZQC A;  3RTY A;  4QWO A;  3C7U A;  4Q0J A;  2Y2G A;  1K4F A;  4Y2F A;  1SZV A;  2XH9 A;  1P9W A;  2I72 A;  4WM9 A;  3P98 A;  3AGF A;  2K2N A;  1V9Z A;  5M1A A;  4KZ4 A;  4G3K A;  3WS4 A;  1HD8 A;  5G18 A;  4XT2 A;  1DJA A;  1BTL A;  4JGQ A;  2V8F A;  2X71 A;  3E4Q A;  4L9E A;  1LLB A;  4E04 A;  1SCW A;  3DWK A;  3T4O A;  1DJB A;  1XJ3 A;  2V8C A;  1IEM A;  3NDE A;  2Q0O A;  1ERO A;  4GN2 A;  3A3J A;  4HI4 A;  3B47 A;  4CLC A;  1XKZ A;  2B18 A;  2WKP A;  4WZ4 A;  3H82 A;  4KG6 A;  1OTE A;  3N8R A;  4EUV A;  1FR1 A;  2ZMF A;  4NEE D;  5FDS A;  4OVD A;  2PYP A;  2V1B A;  3DAV A;  4HH2 A;  3S7O A;  3G32 A;  3G34 A;  5IS1 A;  3SH9 A;  4LEN A;  1FCM A;  4EBP A;  4WEJ A;  3BFG A;  5HD5 A;  2JCH A;  4Y0O A;  4Y7P A;  3VP4 A;  2YKF A;  2P08 A;  1SKO B;  1LI9 A;  1KDS A;  2V2F F;  3ITA A;  3IT9 A;  4HJ4 A;  3CMZ A;  1C3B A;  3UPN A;  2RL3 A;  2ZM2 A;  1WYC A;  2VKS A;  4GCZ A;  4II7 A;  1W63 M;  1LL9 A;  2OV5 A;  3IH9 A;  2XFT A;  4R3J A;  4OOM A;  2Y2H A;  3FKW A;  5TJJ A;  2V20 A;  2Y8H A;  1PI5 A;  1TS0 A;  1IEL A;  5IHV A;  4BL3 A;  5FAO A;  3N6I A;  1MWR A;  4M3K A;  1GA0 A;  3LO7 A;  2A24 B;  3T4T A;  4ZJ2 A;  3V50 A;  4S2P A;  5F1G A;  4WL9 A;  2WKH A;  5AVF A;  2Y2Q A;  5EVL A;  4MN6 A;  4Y0T A;  5J4E A;  2XD5 A;  4EEU A;  3W2Z A;  4DMZ A;  4U0X A;  4L0L A;  1TS6 A;  4E3I A;  1Y4O A;  1JWP A;  2D01 A;  3RFB A;  3HBR A;  4N9L A;  5TBM A;  3G4P A;  3S4X A;  4G3V A;  2XFS A;  1ES3 A;  3CUE C;  4Q0I A;  4EEP A;  3SS3 A;  3OLO A;  2P7J A;  3CG5 A;  1PI4 A;  4OPZ A;  2JBF A;  4QPR A;  2QPN A;  5EE8 A;  3SS4 A;  4F3L B;  2XGN A;  4DE3 A;  3DTE A;  2ZD8 A;  1G5U A;  4HIA A;  3V3R A;  1VQQ A;  3BQA A;  4GOG A;  1BUE A;  1YAX A;  5AVE A;  2BLS A;  4LV0 A;  1AWI A;  3VOY A;  5CER A;  3PBT A;  3E98 A;  2PD7 A;  4KQR A;  1TF1 A;  4MBH A;  3Q7V B;  4IED A;  3LEZ A;  5DJU A;  3DTK A;  4MBK A;  2WZX A;  2ZQ9 A;  1TEM A;  3SH8 A;  1OTD A;  3MQO A;  3ZHH A;  4K91 A;  1VET A;  4O0P A;  4S2N A;  5CTN A;  2EFU A;  3FKV A;  4PHT A;  5FEF A;  2WYX A;  3LI9 A;  2FFY A;  4LFU A;  3CIT A;  1NXY A;  1LL5 A;  3BFD A;  3NY4 A;  4RX3 A;  2IWB A;  1K54 A;  2Y2J A;  4NXB A;  1FIL A;  1YT4 A;  4OLD A;  4B4X A;  2VGL S;  3M6B A;  5I5L A;  3E4O A;  1JTG A;  1BLH A;  1ODV A;  2G7U A;  1S4S A;  1KE4 A;  2J3T C;  4CLC C;  3UB9 A;  5K5B A;  3VE4 A;  2O9A A;  2VGK A;  4KG5 A;  4PAU A;  2WZZ A;  2LB9 A;  4XUZ A;  2HJ9 C;  3VP3 A;  3ZGA B;  1P97 A;  1MZU A;  2OAP 1;  4KZ8 A;  3NCK A;  3VP1 A;  2XD1 A;  4YIN A;  3KO6 A;  4DJ3 A;  3F1N A;  3T12 B;  2XK1 A;  2HPB A;  4R3B A;  3EOI A;  2WAF A;  4DXB A;  3U2A A;  4OKP A;  1IYO A;  5E2F A;  5IT5 A;  3A0S A;  5CX7 A;  3UO9 A;  2PT7 A;  4IUH A;  3SOI A;  1BSG A;  3MZD A;  4JXW A;  3K2N A;  2EXB A;  2O9B A;  3P7N A;  3ZDJ A;  4OQI A;  3N8S A;  3T1S A;  3GTC A;  1FQG A;  4P6B A;  4HP9 A;  3MKF A;  2JKR I;  1DJC A;  3B42 A;  4LLO B;  1I2S A;  3GEC A;  1CEF A;  3IF6 A;  3V3S A;  3W4P A;  2R9W A;  2EX9 A;  1TS7 A;  2PU4 A;  4GDB A;  4GW9 A;  4LV3 A;  2EWV A;  1LHY A;  3S7N A;  4GB7 A;  3JYI A;  4BBT A;  1XPB A;  3R7W A;  2W3D A;  4X6T A;  5L09 A;  5HWT A;  3ZVW A;  3H7W B;  4ZAM A;  4X55 A;  4Y5F A;  3HLD A;  3C30 A;  4GDN A;  1G28 A;  2XRO A;  3UB5 P;  1ZG6 A;  4WUJ A;  3LR0 A;  2H0T A;  4D60 A;  3EQU A;  1IYP A;  4R38 A;  4KQQ A;  1GHI A;  3L9K A;  3BEC A;  3W8K A;  3UMD A;  2O99 A;  2LB5 A;  5DKK A;  5F1F A;  4K08 A;  3IS2 B;  2WGW B;  4HJ6 A;  3HL9 A;  3LCE A;  1SDN A;  1MXO A;  3IH8 A;  1JTD A;  5EVI D;  4R70 A;  4S2N C;  5CEB A;  3UE1 A;  5IU1 A;  4ME4 A;  1CF0 A;  5GL9 A;  3HLW A;  3KSH A;  3BM6 A;  2OLV A;  4S2M A;  5HZH A;  2I9V A;  1ACF A;  1K54 C;  2W0N A;  1F9I A;  2DRW A;  1XJ2 A;  4HJ3 A;  5FQJ A;  4PKY G;  2Y2N A;  2IWD A;  4ZBE A;  3QP8 A;  5CGS A;  5HAI A;  3K3D A;  4OLG A;  2VV6 A;  4BMW A;  1VEU B;  4XXR A;  2BG1 A;  2A49 A;  3LFV A;  3M2J A;  3Q07 A;  1BZA A;  1PWG A;  4EBL A;  5HAP A;  4P85 A;  4HES A;  1M6K A;  1HZO A;  1OPX A;  3LY3 A;  4DKI A;  2HGV A;  2WAE A;  1OT9 A;  3HLC A;  4RYE A;  4KEN B;  4N92 A;  3OCN A;  4A5R A;  1KVM A;  5E2H A;  3TG9 A;  5F5Y A;  3UPP A;  4LRZ E;  3S7Q A;  4JF6 A;  5CHU A;  4MEZ A;  4O01 A;  1NLZ A;  3OC2 A;  4L9G A;  4Y13 A;  4YFM A;  1KGF A;  5FI6 A;  2JKF A;  4X69 A;  3IWO A;  3BRM A;  4MN7 A;  4JKT A;  4WZ5 A;  1E3U D;  1ONG A;  1L3L A;  2Q9M A;  2PR5 A;  3KSF A;  4HQA A;  3EWK A;  4BJP A;  5M19 A;  3TRC A;  3FC7 A;  3GQZ A;  4FH2 A;  4EW7 A;  5TR7 A;  4KZ5 A;  4BQM A;  1L2S A;  5A8B A;  3IF6 C;  3MMH A;  4QHC A;  1U60 A;  4S2L A;  2PBD P;  1ES2 A;  3BQ8 A;  3ZG0 A;  1XGI A;  5GHZ A;  4I3J A;  3C8C A;  2P74 A;  1KVL A;  3GRJ A;  2OAQ 1;  3UDX A;  1I5Q A;  2EA9 A;  3FWL A;  1SHV A;  2ZJ9 A;  1GSX A;  1I2W A;  4NXF A;  4GS9 A;  4ZTK A;  3MZE A;  4GJ4 A;  3IXH A;  2MJ6 A;  4HEF A;  4Y3I A;  3F1P A;  4OH0 A;  3ZG7 B;  3HLE A;  1O07 A;  4PMA A;  2XR0 A;  1XFQ A;  2HP5 A;  2WKQ A;  2ZC3 B;  3WS5 A;  4X1M A;  2P9V B;  2VA0 A;  2G2W A;  1N4O A;  1PZP A;  1P0Z A;  4DN0 A;  2V1A A;  2HF6 A;  3MJQ A;  3UME A;  1ESI A;  5HDC A;  3FZC A;  4ETZ A;  5EV0 A;  1MWS A;  1W63 Q;  5KSH A;  5FA7 A;  2Y2O A;  4F94 A;  3OPH A;  2QJ7 A;  2XDM A;  1S1Z A;  4ARZ A;  3G31 A;  1QME A;  4IJG A;  1HVB A;  1KE0 A;  4KZA A;  5FAT A;  3G2Y A;  5L8M A;  1PFL A;  2FFF B;  1D1J A;  4C6Y A;  4LRX C;  4QB8 A;  1K25 A;  4OP8 A;  4R1G A;  3MKE A;  3GV9 A;  2Y4A A;  4PM6 A;  3ULF A;  4KZ9 A;  3PAG A;  4WLA A;  5F68 A;  3O88 A;  4BBV A;  3UB6 A;  2G2U A;  1PZO A;  3A3I A;  3GSG A;  2DMW A;  3M6H A;  4NG2 A;  5GLA A;  4EES A;  4CLC E;  4P0M A;  4MN5 A;  4UHU A;  4BEN A;  2HZ5 A;  2XSS A;  5EFW A;  1V9Y A;  1VHM A;  5FAQ A;  3IXG A;  3CAX A;  3MQQ A;  3IF5 A;  3LIB A;  4FH4 A;  5HDS A;  4EV4 A;  1GHM A;  2V0U A;  4R3A A;  1L0E A;  1LSV A;  1F5M A;  2M1C A;  5FAP A;  3A0R A;  4ETX A;  1LT0 A;  2Z2M B;  3DW0 A;  4K0X A;  4XT2 B;  3NJA A;  3BEB A;  1LSW A;  4WZ5 C;  3NUL A;  4GD8 A;  2PHY A;  3UN7 A;  1G68 A;  1NZU A;  3PHY A;  2ZM0 A;  1PWD A;  1FIK A;  3HRE A;  5CHM A;  1RGZ A;  3BY9 A;  2EWW A;  1GSV A;  4EUZ A;  3SS5 A;  1NLY A;  4R0Q A;  4UA6 A;  1YLT A;  3NIA A;  4CLC B;  4E3O A;  5FL3 A;  1K57 A;  2B5R A;  3HJK A;  3KYE A;  4PKY A;  1YLW A;  2Y55 A;  3LGO A;  5DFX A;  5EUA A;  2ZC5 B;  2NUT C;  3ZVT A;  1PW8 A;  1ZKJ A;  2IWC A;  2ZOH A;  5TFQ A;  3UB7 A;  2WGV A;  4EWF A;  5C5K A;  1ERQ A;  4GLQ A;  5KIZ A;  2FH5 A;  2VGL M;  2W3G A;  4IUK A;  3NDG A;  5KSC A;  5M18 A;  1QMF A;  4DE1 A;  4B4Z A;  3IBR A;  3C7V A;  4X25 A;  5EOO A;  2QJ5 A;  1HLU P;  3NOP C;  4Y15 A;  1SKF A;  4R4S A;  2GNX A;  4WN5 A;  2J9P A;  2R9X A;  5KMW A;  3HUO A;  3C38 A;  1PWC A;  1ZG4 A;  3IXD A;  5FAS A;  3CZD A;  4S2K A;  1W79 A;  3T4S A;  1DP9 A;  1DY6 A;  4EER A;  4N9K A;  1X0O A;  1S66 L;  1P9R A;  1K55 A;  1XFN A;  3KYQ A;  5HL6 A;  2V9A A;  3VSL A;  3MXS A;  3CI6 A;  3FPW A;  1S0W A;  4MDZ A;  4DDY A;  3V5M A;  4QY5 A;  4WBG A;  1FSW A;  2Z6C A;  5CGX A;  1PYY A;  4UA7 A;  3W4Q A;  4JGP A;  3HUN A;  2ZQ7 A;  3BFC A;  3E2L A;  4FSF A;  4BL2 A;  1BLS A;  4U3T A;  3OZH A;  5TBM B;  2BAS A;  4CQH A;  5HL1 A;  4S2I A;  4BBU A;  5CGW A;  3NOT C;  4MCW A;  3DWZ A;  3G35 A;  5L2F A;  4X56 A;  1XX2 A;  2AVX A;  5EM0 A;  2VX8 A;  2K31 A;  3PTE A;  2FZ0 A;  1W8Y A;  4BWI A;  1HTZ A;  3T1R A;  3CPT A;  3HLF A;  5J7E A;  3VSK A;  1K56 D;  3GMW A;  2VLG A;  5GHX A;  3AGE A;  4JF5 A;  2C5W B;  3GR2 A;  4OQ0 A;  2EX2 A;  3S22 A;  5FQM A;  5GLD A;  1TD5 A;  4UQI S;  1VET B;  1OTB A;  4JF4 A;  4WMC D;  4OPR A;  4GHI A;  1ZHH B;  3C5A A;  3L7H A;  5E2G A;  3RJU A;  4KZ3 A;  3F1O A;  3LEQ A;  3VE3 A;  4FUW A;  3IS2 A;  1KGG A;  1XA1 A;  4E3K A;  4LPZ A;  4H6J A;  1W7F A;  3UE0 A;  2W1T A;  1VB6 A;  3T4Q A;  4WEK A;  3HLB A;  3UY6 A;  5DTT A;  2ZQD A;  4ZDX A;  5EVI A;  3UDF A;  4NKP A;  5A92 A;  3MFX A;  2C6W B;  4MMN A;  1OTA A;  3OCL A;  2BTF P;  2Y79 A;  1K57 C;  5CED A;  3MSH A;  2EX8 A;  1OTI A;  3EQV A;  4FD8 A;  2OWH A;  2HDQ A;  5FDH A;  2RCX A;  4Z1W A;  1PRQ A;  2X02 A;  1H8Z A;  1TVF A;  2H28 A;  3QP2 A;  3SZT A;  2EFX A;  5LBR A;  3LIE A;  3BY8 A;  3LR4 A;  5F82 A;  3U4L P;  1IYQ A;  1UWP X;  4KQD A;  2NUP C;  3F1N B;  2A3U A;  1STZ A;  4E3L A;  3MZF A;  2QWS A;  2PAV P;  3B33 A;  3NC8 A;  3KSI A;  3GVB A;  4LGW A;  4JXG A;  2VEA A;  2W3H A;  3QP6 A;  5HWW A;  4P6Z M;  2OLU A;  2O9C A;  4WYY A;  4DRT A;  4LCL A;  1S4R A;  4IBX A;  5FQI A;  4WEL A;  1J3W A;  1GA9 A;  4DE2 A;  1MWT A;  2OWJ A;  3B3X A;  5DTK A;  4ID4 A;  1XXM A;  2WUQ A;  2ZC4 B;  3ZQ5 A;  1XGJ A;  1YM1 A;  5GLC A;  4KZ6 A;  4HOI A;  5AQ7 A;  3S1Y A;  3VP0 A;  5FI7 A;  3H9W A;  3ZCZ A;  2ACG A;  2Y2I A;  3IF6 B;  3IWI A;  4UAA A;  1XA7 A;  1OJ5 A;  1D7E A;  5CTM A;  2OOL A;  4NET A;  3ZFZ A;  2ZM8 A;  3TSG A;  4HH3 A;  3G30 A;  4H8R A;  3ITB A;  1E3U A;  3QP5 A;  3WS2 A;  1Q2Q A;  2XQZ A;  3IHA A;  1H0M A;  2J7V A;  2W3E A;  3R7W B;  4OPY A;  4FTX A;  4R6L A;  4PM8 A;  3ISG A;  1L0G A;  3MR0 A;  3BW6 A;  4KQO A;  3UPO A;  2XEP A;  5JYO A;  1YMX A;  3T4K A;  1NY0 A;  1BT5 A;  1NWZ A;  2ZL1 A;  3EGD C;  3BLM A;  4Q8I A;  4X1L A;  2H5S A;  4ZRR A;  1NZO A;  2CMN A;  3T1Q B;  4FCF A;  1AXB A;  4JLF A;  4DDS A;  2IA2 A;  2HDS A;  1XP4 A;  5FEG A;  3O86 A;  4IHQ A;  1J9M A;  3DTI A;  4LCM A;  2XA7 M;  2VV7 A;  4BLM A;  2JE5 A;  4JGR A;  1IKG A;  3IXB A;  1D06 A;  4P87 A;  1CI8 A;  5AQA A;  5FSR A;  3OPL A;  1DRM A;  3D9Y A;  1E25 A;  1JWV A;  5HWV A;  2PDR A;  4RQ9 A;  4I38 A;  5HW3 A;  4CPK A;  3OPP A;  4QU3 A;  3Q7Z A;  3A3E A;  3LR3 A;  1H5X A;  4OOY A;  4B9O A;  1BLC A;  3LIC A;  4EU0 A;  1A0K A;  3JVV A;  2KLI A;  3ICY A;  5HSQ A;  2JKT M;  2VZW A;  3A3D A;  3RXW A;  5EVI C;  5L07 A;  1BUL A;  5GLB A;  4WF0 A;  2PYR A;  3RXX A;  1Y54 A;  4IBR A;  4OPQ A;  1ERM A;  5CXW A;  1NRF A;  1NYY A;  3AGD A;  2P04 A;  1FOF A;  2Z2L B;  3P09 A;  3VFH A;  1NRJ A;  3GDI A;  4M4X A;  5EM1 A;  1YQS A;  5GHY A;  5AQB A;  5HAQ A;  2WKR A;  4R23 A;  4RVA A;  5DF9 A;  2ZOI A;  2JKG A;  1WYB A;  3CLO A;  1KGE A;  3T50 A;  1GSW A;  1H8Y A;  5U47 A;  2M7U A;  3NEC A;  1YLP A;  3IX4 A;  1IFQ A;  1SKO A;  2B95 A;  3MXR A;  1K0K A;  2XRN A;  4GZB A;  4NXE A;  3NI9 A;  1O7E A;  3UE6 A;  3BFF A;  3VOL A;  1LI0 A;  3I7J A;  5HFO A;  1MY8 A;  1YSP A;  2V1Z A;  4N1X A;  4OON A;  4MLL A;  3NOU C;  4DE0 A;  3SW1 A;  3MFD A;  2A24 A;  3C2W A;  4G3W A;  3VOZ A;  2EXA A;  2HP6 A;  1XJ4 A;  2K7S A;  1L0D A;  2PRF A;  1JWZ A;  2D02 A;  4KZ7 A;  3OPR A;  2EX6 A;  4RX2 A;  3SH7 A;  3VP2 A;  4JPM A;  4I39 A;  2PR6 A;  2HV1 A;  3T1X A;  2QYB A;  2HDR A;  2E8I A;  4GS9 B;  2O0Y A;  1CEG A;  4F3L A;  2HDU A;  3F1P B;  2GX5 A;  5DF7 A;  2ZQ8 A;  4HY8 A;  4PM9 A;  1TDL A;  1Z6F A;  4X53 A;  3IX8 A;  2KDK A;  5A90 A;  5G4Z A;  2WAD A;  3VV4 A;  3ZG9 B;  1JNU A;  5HAR A;  2YKH A;  2WK0 A;  3Q7V A;  4I3I A;  3PAE A;  5AQ9 A;  4Q0H A;  3UNW A;  5HPF A;  1Z09 A;  2GJ3 A;  3O5Y A;  2UWX A;  3BJN A;  2WKE A;  2UV0 E;  1N9N A;  2J3T D;  4EQI A;  3RH8 B;  4CLC D;  3MS6 A;  3QNB A;  5CEC A;  1M40 A;  3FYZ A;  5TGF A;  3FPV A;  5CHJ A;  4JGO A;  4ARZ B;  4JXS A;  3LYX A;  5FI2 A;  1XJ6 A;  3PBO A;  3IWQ A;  3MF0 A;  3WRT A;  3H82 B;  3KSG A;  1MBL A;  3N7W A;  1ZTU A;  5DKL A;  3W4O A;  3Q1F A;  2H10 A;  5AJG A;  4HP4 A;  3K3C A;  1CQA A;  2ZC7 A;  5DF8 A;  4X68 A;  1PNE A;  4DJ2 A;  1VM1 A;  1W5D A;  3UE3 A;  1OME A;  1PIO A;  4Y0U A;  1K6S A;  3IBJ A;  4N1H A;  3LIA A;  3S7P A;  2Z6D A;  1FSY A;  4NK3 A;  4OOL A;  2X01 A;  2QKP A;  2QMI A;  4EBN A;  4K0W A;  2WKI A;  4OP5 A;  5D3O A;  3LIF A;  3IQA A;  1K6R A;  4GNU A;  4QY6 A;  3ZNY A;  5JYP A;  1EWZ A;  1T1A A;  2J9O A;  1WE4 A;  3IX3 A;  3Q82 A;  3N8L A;  3C4O A;  2OSU A;  1T19 A;  1DP6 A;  4QJG A;  4IVK A;  1K56 A;  4Y17 A;  1K4E A;  3M2K A;  1FCO A;  2INW A;  5J8X A;  3MXQ A;  3TW8 A;  5DFY A;  2W3F A;  3D72 A;  2Y2K A;  1YMS A;  3Q81 A;  4WMC A;  4I3A A;  5HPI A;  3VMA A;  4UQI M;  2V0W A;  3ZNT A;  1T18 A;  3UB8 A;  1CI9 A;  4PM5 A;  4GKU A;  3WS0 A;  1GHP A;  3PR6 A;  4R4R A;  5J3W A;  1EW0 A;  3CWF A;  2Y2M A;  3TOI A;  2VJW A;  4HBU A;  2W27 A;  4RA7 A;  3PYP A;  1SDE A;  2A2L A;  5A93 A;  1MPL A;  4OQH A;  1LL8 A;  1N9O A;  4EQ1 A;  4CJN A;  3EGX C;  1MKI A;  3PBQ A;  3D4F A;  5F69 A;  1E4D A;  3H7W A;  1FCN A;  2Y91 A;  1YLZ A;  3D3O A;  5F83 A;  4L9F A;  3JVU A;  5EPH A;  4I5S A;  1IKI A;  2W1R A;  3HCY A;  4JXV A;  3ZYT A;  3MQ0 A;  5FQ9 A;  4YNR A;  1KE3 A;  2ZMV A;  4HNB A;  4O7D A;  4EXO A;  2KX6 A;  4LV1 A;  1S6R A;  2WGW A;  3EEA A;  4ZJ1 A;  2L4R A;  1IYS A;  4ZJ3 A;  1PW1 A;  2JKR M;  5FQK A;  3G6O A;  3NBL A;  1OJG A;  4LV2 A;  1K38 A;  1T1C A;  1YKD A;  2L1M A;  4BD1 A;  2ZBB A;  1L0F A;  1UWN X;  4O8G A;  1G6A A;  4LRY C;  5G4Y A;  1OT6 A;  5KZH A;  2DCF A;  4JBF A;  1LSX A;  3PBR A;  4DF6 A;  3BFE A;  3UDI A;  3VFF A;  3O87 A;  3V39 A;  2QHK A;  1NYM A;  4C75 A;  4FOF A;  2DNS A;  3CJM A; 
#chains in the Genus database with same CATH homology
 4JGR A;  1OTD A;  5L8M A;  3MQO A;  1D06 A;  1T1B A;  4UEY A;  1DRM A;  4LRX C;  4O0P A;  5HWV A;  1MKM A;  2PDR A;  4RQ9 A;  4I38 A;  4PHT A;  3ULF A;  3LR3 A;  3LI9 A;  4WLA A;  5F68 A;  4B9O A;  4BBV A;  3UB6 A;  3NHQ A;  3BWL A;  3CIT A;  1S1Y A;  3LIC A;  4EU0 A;  3JVV A;  2KLI A;  3ICY A;  2DMW A;  5HSQ A;  2JKT M;  4NXB A;  2VZW A;  4EES A;  3TE8 A;  5HD3 A;  4WF0 A;  2VGL S;  5I5L A;  4CLC E;  2PYR A;  3E4O A;  2PD8 A;  4MN5 A;  2XSS A;  5EFW A;  1ODV A;  2G7U A;  1V9Y A;  1S4S A;  1VHM A;  3A0V A;  3TJZ C;  1N9L A;  2J3T C;  3CAX A;  3MQQ A;  1IOU A;  4CLC C;  4GHI B;  2J80 A;  3UB9 A;  1BYW A;  3LIB A;  5K5B A;  3VE4 A;  5HDS A;  3F1O B;  2O9A A;  4PAU A;  4B93 A;  2V0U A;  2LB9 A;  4R3A A;  2P04 A;  1LSV A;  1DP8 A;  1NRJ A;  1F5M A;  2HJ9 C;  2M1C A;  3A0R A;  4H6J B;  4ETX A;  1LT0 A;  2W1T B;  3GDI A;  1Y28 A;  1P97 A;  4XT2 B;  1MZU A;  2OAP 1;  3LUQ A;  3NJA A;  4M4X A;  1LSW A;  4EET B;  1H3Q A;  2PHY A;  1KOU A;  3PXP A;  2KOI A;  2VV8 A;  2WKR A;  3KO6 A;  4HHD A;  4DJ3 A;  3OOV A;  3F1N A;  1TS8 A;  3PHY A;  5DF9 A;  2ZOI A;  2HJE A;  3CLO A;  3EOI A;  3BY9 A;  2EWW A;  1GSV A;  1NLY A;  2VV7 A;  3U2A A;  4CLC B;  5IT5 A;  3A0S A;  5CX7 A;  3T50 A;  2PT7 A;  1GSW A;  5FL3 A;  4IUH A;  1WA9 A;  3HJK A;  2M7U A;  4PKY A;  5DFX A;  1IFQ A;  4NXG A;  2JN7 A;  3K2N A;  3V67 A;  2O9B A;  2NUT C;  3P7N A;  4YWZ A;  2ZOH A;  3P01 A;  3UB7 A;  5C5K A;  2XRN A;  4GLQ A;  4NXE A;  2L0W A;  5KIZ A;  1YSQ A;  2B02 A;  2FH5 A;  2VGL M;  2W3G A;  4IUK A;  3UE6 A;  4P6Z S;  4HP9 A;  3VOL A;  3IBR A;  2M7V A;  1YSP A;  2JKR I;  2QJ5 A;  3B42 A;  3NOP C;  3PBS A;  4LLO B;  3R4K A;  2GNX A;  3FG8 A;  4KUK A;  4WN5 A;  3NOU C;  4YOF A;  3SW1 A;  5HDD A;  3GEC A;  3C38 A;  2A24 A;  3C2W A;  4G3W A;  3KYZ A;  5DJT A;  1TS7 A;  1XJ4 A;  2K7S A;  4GW9 A;  3T4S A;  1DP9 A;  2D02 A;  2EWV A;  3HJI A;  4EER A;  4AFI A;  1X0O A;  1S66 L;  1P9R A;  1F98 A;  3S7N A;  1XFN A;  5HL6 A;  3KYQ A;  4BBT A;  2V9A A;  3R7W A;  2W3D A;  1MC0 A;  5HWT A;  3CI6 A;  3FPW A;  3H7W B;  4MDZ A;  4I39 A;  2PR6 A;  2JHE A;  4Y5F A;  2HV1 A;  3C30 A;  2QYB A;  1G28 A;  3KX0 X;  5MC7 A;  2XRO A;  4GS9 B;  2O0Y A;  4WUJ A;  2Z6C A;  3LR0 A;  3F1P B;  4F3L A;  2GX5 A;  3EQU A;  2J3W A;  3EEH A;  4R38 A;  2R78 A;  4HY8 A;  4JGP A;  3UMD A;  2O99 A;  2LB5 A;  3OBF A;  5DKK A;  3E0Y A;  3LI8 A;  4K08 A;  1UGU A;  2JKT I;  2KDK A;  3IS2 B;  5G4Z A;  3T4L A;  2GZA A;  4FSF A;  3VV4 A;  1H8M A;  4HJ6 A;  1JNU A;  2YKH A;  5TBM B;  2BAS A;  4I3I A;  4CQH A;  4Q0H A;  4BBU A;  4R70 A;  1S67 L;  5HPF A;  3LR5 A;  5F6A A;  3E4P A;  2GJ3 A;  3O5Y A;  5IU1 A;  4ME4 A;  3BJN A;  3DBA A;  3PBN A;  3NOT C;  4MCW A;  3T4J A;  3CUE A;  3KSH A;  1N9N A;  2J3T D;  2XA7 S;  3RH8 B;  4CLC D;  5HZH A;  2VX8 A;  2K31 A;  4KUO A;  2I9V A;  2FZ0 A;  3FPV A;  2W0N A;  4JGO A;  4BWI A;  1F9I A;  4ARZ B;  1XJ2 A;  3LID A;  4HJ3 A;  1G6O A;  3LYX A;  5J7E A;  1XJ6 A;  3PBO A;  3RTY A;  4PKY G;  3MF0 A;  4Q0J A;  2VLG A;  3H82 B;  3KSG A;  4Y2F A;  1ZTU A;  5DKL A;  3K3D A;  2VV6 A;  5AJG A;  4BMW A;  4HP4 A;  3K3C A;  1P9W A;  1TD5 A;  4UQI S;  4DJ2 A;  1OTB A;  2K2N A;  4GHI A;  1ZHH B;  3LFV A;  3F1O A;  3VE3 A;  3IS2 A;  1V9Z A;  3UE3 A;  4G3K A;  4LPZ A;  1OPX A;  3IBJ A;  3LIA A;  4H6J A;  3S7P A;  2Z6D A;  2W1T A;  1VB6 A;  4XT2 A;  2HGV A;  4OOL A;  4JGQ A;  1OT9 A;  3T4Q A;  4WEK A;  2QKP A;  3E4Q A;  4L9E A;  4E04 A;  3T4O A;  3OCN A;  3LIF A;  1XJ3 A;  4NKP A;  3MFX A;  4MMN A;  1OTA A;  3OCL A;  2Y79 A;  5F5Y A;  4HI4 A;  1T1A A;  3B47 A;  4CLC A;  2B18 A;  1OTI A;  3EQV A;  2OWH A;  2WKP A;  4LRZ E;  3S7Q A;  3H82 A;  4Z1W A;  4O01 A;  1NLZ A;  1OTE A;  1T19 A;  2H28 A;  3OC2 A;  1DP6 A;  4EUV A;  4L9G A;  5LBR A;  2ZMF A;  4NEE D;  3LIE A;  2INW A;  2PYP A;  3BY8 A;  3LR4 A;  2V1B A;  4HH2 A;  3MXQ A;  1UWP X;  3TW8 A;  3S7O A;  4MN7 A;  4KQD A;  2NUP C;  3F1N B;  5DFY A;  2W3F A;  3D72 A;  5IS1 A;  2PR5 A;  3KSF A;  4HQA A;  3EWK A;  4BJP A;  4WEJ A;  1STZ A;  3TRC A;  2QWS A;  3FC7 A;  4I3A A;  5HD5 A;  4EW7 A;  3B33 A;  5HPI A;  4UQI M;  2V0W A;  1T18 A;  3KSI A;  5A8B A;  3MMH A;  3UB8 A;  2YKF A;  2P08 A;  2VEA A;  2W3H A;  3PR6 A;  5HWW A;  5J3W A;  4P6Z M;  2O9C A;  1EW0 A;  3BQ8 A;  4HJ4 A;  1S4R A;  3CWF A;  4WEL A;  2VJW A;  2W27 A;  3PYP A;  2VKS A;  2OWJ A;  4GCZ A;  4II7 A;  2A2L A;  4I3J A;  1W63 M;  3C8C A;  1LL8 A;  1N9O A;  4OOM A;  3ZQ5 A;  4EQ1 A;  5TJJ A;  2OAQ 1;  3EGX C;  3PBQ A;  2Y8H A;  5F69 A;  4HOI A;  1TS0 A;  3H7W A;  2EA9 A;  3D3O A;  3H9W A;  1GSX A;  4L9F A;  3JVU A;  4NXF A;  4I5S A;  3HCY A;  2W1R A;  2A24 B;  4GS9 A;  3T4T A;  4GJ4 A;  2MJ6 A;  4Y3I A;  3ZYT A;  1OJ5 A;  3F1P A;  1D7E A;  2OOL A;  4WL9 A;  3MQ0 A;  5AVF A;  4HH3 A;  4YNR A;  4MN6 A;  2ZMV A;  5J4E A;  4HNB A;  4EEU A;  3W2Z A;  4DMZ A;  4L0L A;  4EXO A;  1TS6 A;  2KX6 A;  1XFQ A;  2WKQ A;  2W3E A;  2D01 A;  3EEA A;  3R7W B;  3RFB A;  2L4R A;  5TBM A;  4R6L A;  4G3V A;  2JKR M;  2VA0 A;  3G6O A;  3CUE C;  4Q0I A;  4EEP A;  1OJG A;  3MR0 A;  3BW6 A;  4KQO A;  1P0Z A;  3OLO A;  4DN0 A;  2P7J A;  1T1C A;  2V1A A;  2HF6 A;  3MJQ A;  3T4K A;  1YKD A;  3UME A;  1NWZ A;  4QPR A;  2L1M A;  5HDC A;  4ETZ A;  2ZBB A;  4F3L B;  3EGD C;  1W63 Q;  5KSH A;  1UWN X;  4O8G A;  4HIA A;  4LRY C;  3BQA A;  5G4Y A;  1OT6 A;  4ZRR A;  1YAX A;  2CMN A;  5AVE A;  2QJ7 A;  1LSX A;  1S1Z A;  3PBR A;  4ARZ A;  2IA2 A;  3PBT A;  3E98 A;  2PD7 A;  2QHK A;  4IHQ A;  1TF1 A;  4IJG A;  4FOF A;  2XA7 M;  5DJU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...