3UE6A

The dark structure of the blue-light photoreceptor aureochrome1 lov
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
135
structure length
135
Chain Sequence
EDPDYSLVKALQMAQQNFVITDASLPDNPIVYASRGFLTLTGYSLDQILGRNCRFLQGPETDPRAVDKIRNAITKGVDTSVCLLNYRQDGTTFWNLFFVAGLRDSKGNIVNYVGVQSKVSEDYAKLLVNEQNIEY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structures of Aureochrome1 LOV suggest new design strategies for optogenetics.
pubmed doi rcsb
source organism Vaucheria frigida
molecule tags Signaling protein
molecule keywords Aureochrome1
total genus 39
structure length 135
sequence length 135
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2011-10-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13426 PAS_9 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3ue6A00
3MJQA 1T1AA 3MFXA 4L9EA 5J3WA 5HDCA 3LI8A 4E04A 2CMNA 2BASA 4NXFA 4PKYA 5HWWA 3E4OA 5TBMA 1UWNX 5TBMB 3VE3A 1VB6A 3P7NA 1OJGA 1WA9A 4WF0A 5F6AA 5HD3A 1LSVA 3LYXA 4KQDA 3EWKA 3LIDA 4F3LA 1XFNA 2B02A 1F9IA 3MQOA 4EW7A 1N9LA 1OTEA 2L0WA 4M4XA 1P0ZA 2I9VA 1D06A 5HWTA 3RTYA 3E4PA 4HP9A 3F1PB 3E4QA 2WKRA 1S66L 1EW0A 2OWJA 3PYPA 4GHIB 4HH2A 1OTDA 2V1BA 1BYWA 1GSVA 2PR5A 3NOTC 2V9AA 4KUKA 4PKYG 2D02A 2Z6CA 4LPZA 5F69A 5IS1A 3RH8B 4HJ3A 4EEUA 4R70A 3G6OA 3IS2A 1G28A 3OLOA 4LRXC 3T50A 4YWZA 4BBTA 3F1PA 5HDDA 4HI4A 3H82A 3A0RA 2INWA 3A0SA 3MR0A 2KX6A 1KOUA 4I5SA 1OT6A 5HDSA 2JN7A 2PHYA 2QKPA 3BY9A 4I3IA 3HJIA 4H6JA 3CWFA 3IS2B 4HJ4A 1S1YA 1DP6A 5HSQA 1OJ5A 5HD5A 4GCZA 2PR6A 1F98A 4HHDA 4I3JA 3UE6A 4DJ2A 5G4YA 2EA9A 4HJ6A 3LICA 2WKPA 5DJTA 4HQAA 5F5YA 2ZOIA 5HZHA 2Z6DA 3C2WA 3GECA 1S4SA 3UB8A 1GSXA 3D72A 5DKKA 2A24B 5G4ZA 2L1MA 5I5LA 2A24A 3BWLA 4NXBA 3ULFA 4KUOA 4WUJA 4K08A 4HNBA 4LLOB 4F3LB 2VV7A 3ICYA 2GJ3A 4R3AA 5J7EA 1Y28A 4WL9A 2QJ7A 4HIAA 3PHYA 5F68A 3F1OA 1UGUA 3IBRA 3LIBA 4EERA 3H7WA 1TS0A 1LT0A 1S67L 2PYPA 4JGOA 3SW1A 1GSWA 3K3DA 3UB9A 2V1AA 1XJ3A 2JHEA 1NWZA 3F1NB 4GS9B 2PD7A 1OTBA 3F1NA 5KIZA 3MXQA 2OOLA 2YKFA 4LRZE 2P7JA 4JGQA 4HOIA 3H7WB 5IU1A 5AVEA 3GDIA 2V0UA 2ZOHA 1T1CA 1TS8A 2ZBBA 1LSWA 3H9WA 1T18A 4GHIA 4WLAA 2WKQA 4LRYC 4XT2B 5J4EA 4GS9A 2PYRA 3FG8A 4H6JB 4NXGA 2QWSA 3MQQA 1LSXA 2QHKA 3LIFA 1OTAA 4BBVA 4HY8A 1OTIA 4RQ9A 2W27A 1P97A 2R78A 3UB6A 2VLGA 3CAXA 3UB7A 3H82B 5A8BA 1XFQA 3KX0X 1V9ZA 1S4RA 4B9OA 4I38A 2VV6A 1DP9A 1N9NA 3LIEA 4HH3A 2QJ5A 5DKLA 4EEPA 1DRMA 4WN5A 4NXEA 3NOPC 1ODVA 2H28A 2HV1A 1X0OA 3NHQA 2VEAA 4EESA 1XJ4A 4R6LA 2VV8A 1TS6A 5DJUA 4EQ1A 1DP8A 1N9OA 1TS7A 1XJ6A 3EEHA 3NJAA 2KDKA 2YKHA 4I39A 4R38A 1MZUA 3K3CA 3ZQ5A 5HWVA 4MN6A 5EFWA 1JNUA 2PD8A 4GW9A 4HP4A 4XT2A 3LI9A 1T1BA 4JGRA 3BY8A 3LIAA 4EETB 3VOLA 3VE4A 1LL8A 2M1CA 4BBUA 1T19A 2D01A 5AVFA 3UMDA 3UMEA 2W0NA 3A0VA 1OT9A 3LUQA 2K7SA 3CLOA 2J80A 4L9GA 4MN5A 1XJ2A 2OWHA 2PDRA 1S1ZA 1V9YA 4L9FA 2V0WA 3HJKA 1UWPX 4I3AA 3B33A 3F1OB 3FC7A 1D7EA 4EXOA 3NOUC 4JGPA 4DJ3A 2L4RA 3C8CA
chains in the Genus database with same CATH superfamily
1JTGA 2V1ZA 3K2NA 3JVUA 4EBLA 3UE1A 4PHTA 2V8FA 2ZM8A 3KSFA 4F3LA 4EW7A 2HJ9C 3N8SA 2Y8HA 2DMWA 4G3KA 1S0WA 5F69A 4DRTA 1FR6A 4D2OA 3RH8B 2DNSA 1G28A 3V67A 5EVLA 3BLMA 5HDDA 3W4PA 2H0YA 1F98A 4KG6A 1SZVA 4E3LA 5DJTA 1QMEA 4HNBA 5MC7A 2E8JA 2KOIA 1TDLA 1LHYA 1UGUA 2A2LA 3O88A 5FQ9A 3SW1A 1E3UD 1HVBA 1SDNA 2OAP1 5KIZA 2ZMAA 4ZJ3A 1ZG4A 2FZ0A 4OP8A 2WKIA 1K38A 3LIFA 3FYZA 3LR5A 3D4FA 1DRMA 2VGJA 3SZTA 2HV1A 3QP4A 2ZL1B 1BSGA 1Y54A 3UPOA 1MWSA 5FQQA 5L07A 3HUOA 5L2FA 3BY8A 1PZPA 2EWWA 3ZDJA 4OH0A 2XQZA 2PT7A 2Y91A 3IHBA 1RGZA 2XFSA 4Y15A 3JPUA 4EUVA 4WYYA 3G32A 1M40A 3ZG9B 1D06A 5HWTA 4R3BA 4PPRA 4JXWA 4PAUA 3CUEC 4BBTA 1K25A 5HAPA 3ZGAB 1W63M 3HJIA 3IS2B 4HJ4A 4MEZA 1H8YA 1ONHA 2O9AA 2V20A 3B3XA 3BW6A 4P87A 3LICA 3QP5A 4RVAA 3UB8A 1S4SA 3OPLA 4KQOA 3SH7A 5J7EA 3PBRA 4WL9A 3LIBA 3H7WA 3HBRA 1YLYA 1GSWA 3UB9A 4K0XA 3GMWA 3NULA 2WKQA 3FG8A 2P08A 2W1TB 2FFFB 5A8BA 2Q9NA 5L8MA 5G18A 4QB8A 1IFQA 3R4KA 3MZEA 5CTMA 5CRFA 2Y2IA 4EUZA 2KDKA 4WZ5C 3LEZA 2QZ6A 3NCKA 2Y2MA 1CI9A 4BBUA 4E6WA 1MBLA 3KYQA 2PBYA 5AQ7A 5EE8A 1VETA 4GOGA 3G34A 4JGPA 1IKGA 4E3MA 1TVFA 2CMNA 2BASA 2VX8A 4PM7A 3CZDA 1LSVA 4JXSA 4Y0UA 5CXWA 2XF3A 2EX9A 1P9RA 1EW0A 3S7NA 5KMWA 2J3TD 1K57C 3OPRA 1IYPA 4S2LA 3DTEA 3T4JA 5CECA 3A3JA 4HBTA 5HDSA 1YMXA 3NDEA 3WS2A 1S1YA 2ZC7A 2K31A 3UPNA 4UQIM 5G4YA 2JCHA 4MNRA 5EVIA 4DDYA 2ZLYA 3IXBA 3KSHA 3ISGA 3NIAA 5EECA 1BLPA 3EEAA 4EWFA 5F68A 3BEBA 3HLWA 3MF0A 3UY6A 4O8GA 3OC2A 1PNEA 2RL3A 3G30A 4KZ5A 1PIOA 2Q0OA 3TG9A 3HLFA 1H5XA 3FZCA 1J3WA 2J8YA 3N4IA 2J9PA 5F82A 3UB6A 4B93A 4GJ4A 3H82B 1BT5A 2QJ5A 2ZM0A 1ERMA 1FQGA 1ODVA 3BRMA 1IYSA 3HLDA 2EFUA 4X6TA 2JKFA 3IH8A 3E2KA 5CEBA 4BQMA 4WEJA 5IHVA 2W0NA 5A93A 2WGIA 5TBMA 1AXBA 3BLSA 5EM1A 3MKFA 5TGFA 4DE0A 3BFFA 4IVKA 4M4XA 3T4OA 4JF5A 2WADA 3E4PA 3HLBA 3OZHA 3CG5A 3PBSA 1PI4A 3M2KA 4LV2A 2GZAA 1FCNA 1XA7A 2EX8A 3EGDC 2HP5A 4U0XA 2VZWA 3A0RA 3H82A 3LCEA 3BFGA 1BUEA 1G6AA 2XA7M 1MC0A 3M2JA 4HQAA 5F5YA 5DKKA 2A24B 5FI2A 3IF6A 3V5MA 4NXBA 4WUJA 4JXVA 2WAFA 3RJUA 5CGSA 4DE1A 1NZUA 4BL2A 4RX3A 4KZ6A 3SOIA 1YLPA 5AVEA 3KSIA 4BBVA 1LSXA 4WZ4A 3W8KA 2W27A 1P97A 1DJAA 1XFQA 1V9ZA 4K0WA 4F94A 1QMFA 2MJ6A 5BOHA 3CI6A 4UHUA 3EEHA 4CLCD 4DF6A 4R38A 4MN7A 2PD8A 1ALQA 2Y2LA 1T19A 3LUQA 5CHMA 5J8XA 2E8IA 1UWPX 3Q7VB 2ZQ7A 4L9EA 1M6KA 4IBXA 3WRZA 1TEMA 5M18A 3O86A 5EVID 3A3DA 3LYXA 4KQDA 1MY8A 4G3WA 4QD4A 2Y55A 4GD8A 1HZOA 1XFNA 2A3UA 2EFXA 3V50A 2L0WA 3N6IA 3C4OA 4JF4A 4PKYG 2PR5A 5HDCA 2V9AA 3ITAA 4HJ3A 3F1PA 2X02A 4E3IA 3BQ8A 3BY9A 4DKIA 3V3RA 2PU2A 2RCXA 2ZC5B 3PBOA 3BM6A 4HJ6A 3ZG7B 1MWRA 5AQBA 2WZXA 1XGIA 2GNXA 3S4XA 5HARA 4XUZA 3CPTA 1YT4A 3MSHA 3UN7A 4E3KA 1YLWA 2G2WA 3EGXC 4OLDA 2OV5A 1VHMA 1NWZA 2PD7A 3MXQA 1W79A 2ZC6B 3H7WB 3BYDA 2V0UA 4I5SA 4XT2B 4Y17A 1SKOA 5DTKA 1O7EA 5FI6A 1DY6A 2ZD8A 1ES4A 1ZKJA 5GLBA 2LB9A 3UB7A 1OPXA 5JYOA 4I38A 4Y3IA 1X0OA 4K91A 5CGXA 1KDSA 1ZTUA 4DE3A 3ZVTA 4BL3A 1MZUA 3K3CA 3KYEA 5EFWA 4HP4A 3N8LA 4OQGA 1WE4A 1ZC2A 3VOLA 4MBKA 2ZQ8A 2D01A 4A5RA 4NK3A 3ITBA 1F5MA 1K56D 3UMEA 4YFMA 3LR4A 4DJ2A 2VK3A 3MMHA 2Y79A 4WZ5A 1YKDA 5CHUA 3MFXA 4E04A 3U4LP 1ERQA 3PBTA 3UNWA 1OMEA 2HDRA 4HBUA 3L9KA 3P09A 1JWZA 3CMZA 4NEED 1K4EA 4GHIB 4HH2A 2ZL1A 4PM9A 2FH5A 4C75A 1U60A 3HLEA 3S1YA 4ZBEA 1XA1A 2VGLM 4HI4A 5CERA 3FKWA 1TF1A 1SHVA 1L0EA 4II7A 2B5RA 4GN2A 1STZA 4OQHA 2Z6DA 4QU3A 3BFEA 3FWLA 2J9OA 3WS4A 2Y2JA 3AGDA 4WEKA 1CEFA 3E2LA 3GSGA 2DRWA 2UWXA 3Q1FA 1FCMA 4KQQA 2QYBA 3CITA 1PWDA 4OLGA 4N92A 5FATA 3VFHA 4OVDA 5DKLA 3LO7A 2XD5A 3DWZA 3HUNA 3Q07A 3TE8A 3Q82A 2BLSA 5FA7A 3UE0A 1HLUP 1L0FA 1E3UA 3EOIA 4MN6A 3LI9A 3LR3A 1XPBA 4LGWA 5F1FA 4MN5A 3E98A 2X01A 5GLCA 2JC7A 1LLBA 2L4RA 3C8CA 4KZAA 4OONA 4D60A 5HL1A 2OLVA 5DFXA 3P7NA 4GKUA 2AVXA 3IXGA 4ESPA 3D9YA 1FIKA 5HW3A 1PFLA 2ZQDA 1DJCA 2JKTI 1ES2A 5DF8A 5HFOA 3KO6A 1GSVA 2IWCA 3IS2A 3OLOA 4R0QA 4YWZA 2M7VA 3SH8A 5A92A 4DN0A 3R7WA 4GDBA 1YPRA 4QPRA 3MZFA 5DF9A 4ZJ2A 2XD1A 4BD1A 3C4PA 3GECA 2GX5A 5I5LA 2Z2MB 4PMAA 3PR6A 1YLJA 3BECA 3LY4A 1Y28A 4S2MA 2X71A 1SKOB 4OKPA 3BFDA 3MKEA 1HTZA 5M1AA 1BULA 1E4DA 5AJGA 4BD0A 5U47A 2EX6A 4S2OA 1XX2A 1DP9A 3LIEA 3IXHA 4WN5A 3IF6C 4ZDXA 2PRFA 5DJUA 4NETA 1N9OA 1GHPA 3VP1A 5FQIA 5IT5A 3LIAA 4U0TA 3NC8A 3LGOA 3R7WB 4Z1WA 2ZMVA 4L9FA 5FAOA 3F1OB 1D7EA 3SH9A 3NOUC 3DTMA 4ETXA 5EOOA 1T1AA 3G4PA 2KLIA 2WK0A 3JVVA 3JYIA 3TSGA 4P6ZS 4Y7PA 1WA9A 4KG2A 4GZBA 4GLQA 2WKHA 5M19A 2O0YA 4OQIA 1GHIA 3TRCA 3T50A 4X69A 3CWFA 2Y59A 4QY6A 3DTKA 1EI5A 3B47A 3UE6A 2WKPA 5FQMA 4BMWA 2XH9A 1YSQA 1GA0A 3V39A 3HL9A 3DTIA 5HAQA 2BTFP 3UE3A 1ES3A 4EU0A 5EV0A 1ACFA 4OPYA 1S67L 4CLCB 1YSPA 4KZ8A 1SDEA 2M7UA 2P7JA 1VETB 4JGQA 4WLAA 4XT2A 2ZBBA 1PRQA 4GD6A 5J4EA 3QP6A 4H6JB 4ETZA 3MQQA 5DTSA 4B4XA 1ESUA 3VP0A 4BJPA 1BLSA 1K0KA 5CGWA 1WYBA 2XFTA 4EESA 1KVLA 4R6LA 5CTNA 4P6BA 1EWZA 5EVIC 2OSUA 5KSCA 2HDSA 3E0YA 4GNUA 3IBJA 2Y2KA 1A0KA 4UQIS 2V0WA 4I3AA 4IUKA 3SS4A 4WMCD 2WGWB 1J9MA 4XXRA 4OPQA 3DW0A 4WMCA 5TBMB 4RYEA 4CLCC 4U3TA 3T4QA 4FD8A 2I9VA 4OPRA 1L2SA 1BYWA 5IS1A 3G35A 5F83A 3MR0A 1FR1A 2KX6A 5EUAA 2JKGA 1H0MA 2VKSA 1KGEA 4BENA 4O0PA 5HSQA 5HD5A 5D3OA 4HHDA 3UDXA 3IT9A 3PAGA 1G5UA 4FH4A 3OPHA 4JLFA 3VOZA 4WELA 4DMZA 1L3LA 3PBQA 3QHYA 4X1LA 3O3VA 4Q8IA 2JE5A 1MXOA 5EVEA 5A91A 3IBRA 3GRJA 1BLCA 5C5KA 3P98A 1XJ3A 2JHEA 1KGGA 5FEGA 1AWIA 4JBFA 5EPHA 3VE4A 4BLMA 3H9WA 2QHKA 1OTIA 4RQ9A 4B4ZA 3IX4A 3OCLA 1IOUA 3G31A 5E2EA 5FSRA 1PI5A 3U2AA 3PAEA 1H8ZA 5I94A 4JPMA 4EQ1A 1HD8A 3VOYA 4ZRRA 3SS3A 2M1CA 3A0VA 4LV1A 1K54A 2K7SA 2G7UA 2XA7S 1W63Q 2Y2GA 4DJ3A 5J3WA 3IHAA 3VE3A 5HD3A 4JKTA 4B88A 2XK1A 3KSGA 1RCJA 5GHZA 3RTYA 4OPZA 2W3GA 4Q0IA 5DVAA 1NJ4A 2WKRA 1S66L 1JWPA 3NOTC 2JBFA 2DCFA 4LPZA 2Z2LB 4OOLA 2GDNA 5E2FA 3RXWA 4X56A 2JN7A 4NG2A 2HF6A 3IX3A 4N1HA 4GCZA 4MCWA 2P74A 2XGNA 4Y13A 3B42A 1W5DA 2JKRI 5HZHA 1GSXA 3NY4A 3NI9A 1PW8A 2OLUA 3T1SA 3WS5A 3W4QA 4K08A 1G6OA 3ZG0A 4F3LB 2ZQAA 3TJZC 3F1OA 4EERA 1TS0A 1LT0A 4C3QA 1XXMA 1IYQA 3F1NA 4QY5A 1NLZA 2NUTC 3GDIA 3S7PA 1TS8A 4GDNA 4NXGA 1KDWA 3RFBA 4ARZA 3ZNYA 2HZ5A 3D3OA 2C6WB 4X25A 1DP8A 3HLCA 3WWXA 4GW9A 2A49A 3WS1A 1TD5A 2XEPA 1OT9A 2J80A 2OWHA 1V9YA 1NYMA 3CHWP 4G3VA 5GHXA 1OJGA 4AFIA 2IA2A 1MPLA 5AQ9A 2HDQA 1P0ZA 1Q2PA 3PYPA 4EEUA 4R70A 4LRXC 3S22A 2P9VB 3O87A 1GHMA 4UEYA 2P04A 4Y0OA 5CHJA 2ZOIA 4FUWA 4RA7A 2CC1A 5AQAA 2L1MA 3MBZA 1I2SA 4LLOB 4YOFA 1ZHHB 5E2GA 3PHYA 5HL6A 3T4SA 1JWVA 1N4OA 4IUHA 5GLDA 4FOFA 2XRNA 5FAPA 4ZJ1A 4GHIA 3ZHHA 4OOMA 3PBNA 4E3OA 2QWSA 3HCYA 1OTAA 4CLCE 2QMIA 1Y4OA 3T1QB 1NRFA 1LI9A 4X1MA 4NXEA 4IEDA 1PYYA 2VEAA 2Q9MA 4OOYA 5L09A 3A3IA 1Z09A 3IWIA 3VV4A 2UV0E 2PU4A 5HWVA 3S7OA 2WUQA 1CF0A 3LEQA 1JVJA 4Z9QA 1IYOA 4ID4A 1S6RA 1GCEA 2O99A 3MJQA 2HP6A 2VA0A 3LI8A 2HJEA 1PWGA 1XP4A 3LIDA 1YLTA 5TJJA 2HP9A 4MLLA 4HP9A 3F1PB 4PM5A 1GA9A 2V1BA 4E3JA 1NY0A 1H8MA 5FDSA 3T4TA 4P6ZM 3A0SA 2QKPA 1H3QA 3C5AA 3IF6B 2ZC4B 4I3JA 5DFYA 2JKRM 4LENA 5FAQA 4KZBA 4EV4A 4Q0JA 2EXAA 3G2ZA 4KZ9A 2VV7A 3LFVA 4O7DA 3WRTA 4NKPA 4MBHA 3ZCZA 3MFDA 3BQAA 2YKFA 2ZOHA 1T1CA 1MKMA 4E3NA 3FKVA 5FL3A 1VM1A 1SKFA 5HAIA 2WAEA 4S2NA 2O9BA 3P01A 5CX7A 4HH3A 2BG1A 4EEPA 4FTXA 3NDGA 1CQAA 1XJ4A 5FDHA 1XJ6A 5TFQA 4S2KA 2HPBA 3CPTB 3GQZA 4JF6A 1KE4A 4FH2A 3UPPA 1F2KA 4MMNA 3A3EA 3S7QA 1S1ZA 3MQ0A 3HLGA 1KVMA 5HWWA 5F6AA 3EWKA 4Y0TA 1N9LA 3VP3A 1OTEA 1XGJA 4PM8A 3UO9A 3DWKA 2K2NA 2J7VA 3G6OA 4YINA 3SS5A 2INWA 1MWUA 3RXXA 1MKIA 3CJMA 3C7UA 1K57A 2Y2PA 4L0LA 5E2HA 5EVIB 2PBDP 2XR0A 2I72A 5DF7A 4DXBA 2WZZA 1W7FA 1K56A 1SCWA 3KYZA 2GJ3A 3QNCA 2ZC3B 3Q7VA 4LFUA 5FQJA 4LCLA 4PM6A 3QP1A 4R4RA 2W3HA 1IELA 2V1AA 4GS9B 3A3FA 3F1NB 3MZDA 4KZ7A 1K55A 5FEFA 3ZFZA 1PWCA 5EOEA 4GS9A 3I7JA 3OBFA 4KZ3A 4HY8A 4KQRA 4UA6A 2R9XA 1W8QA 2VLGA 1N9BA 3PXPA 3M6BA 2P9VA 1N9NA 1G68A 2W3FA 1BZAA 1BTLA 3ZG8B 4DE2A 2EWVA 3GR2A 2IWBA 2YKHA 3IQAA 4H8RA 5HPFA 4IHQA 1JNUA 4EBNA 4JGRA 4EETB 5KSHA 4ZTKA 5AVFA 3UMDA 2W3EA 2H0TA 3CLOA 1XJ2A 2PDRA 5LBRA 3IWOA 5GL9A 3FV7A 3B33A 1L0GA 2WGWA 2LB5A 3LY3A 4IVIA 1L0DA 1YMSA 2XROA 4PKYA 1UWNX 3T1RA 4UA9A 3VP4A 2XLNA 2Y2HA 4QWOA 3ZYTA 2B02A 1FOFA 3MQOA 3DAVA 5A90A 3FPVA 3E4QA 4S2PA 4KUKA 1FSWA 4HEFA 3AGEA 2W3DA 3IWQA 4Y5FA 2ZM2A 2WGVA 3C38A 1KOUA 3Q7ZA 4I3IA 4H6JA 2XSSA 1DP6A 1OJ5A 1YLZA 4KZ4A 1DJBA 1CJFA 2J3TC 3UDFA 4OP5A 5FI7A 1BLHA 4M3KA 3W2ZA 5TR7A 5HX9A 3T1XA 4KUOA 1FCOA 2V2FF 4CQHA 1YQSA 1Q2QA 4HIAA 4R4SA 4HESA 4CLCA 3T12B 4E6XA 2HGVA 3M6HA 1OTBA 3QP2A 1K55C 1NXYA 1VEUB 2ZJ9A 5IU1A 1NRJA 1T18A 2OAQ1 4P85A 2PYRA 5DTTA 3UB5P 3LR0A 2ZMFA 2R78A 3CAXA 3IXDA 3WS0A 2VV6A 3ZG5A 2H28A 3VSKA 1E25A 1RGYA 3W4OA 3VSLA 1NZOA 1TS6A 2VV8A 3EQUA 1TS7A 3NJAA 2WKEA 4I39A 2ACGA 1ONGA 2H5SA 4N1XA 1LL8A 3G2YA 1ZG6A 4R3JA 3AGFA 3Q81A 4L9GA 3VFFA 4EXOA 3MS6A 3TOIA 3E4OA 4QHCA 4WF0A 4RX2A 3C30A 2C5WB 1LL9A 1FSYA 4IJGA 1F9IA 3BJNA 4CJNA 1VQQA 4KG5A 3DBAA 2OWJA 4WBGA 2QPNA 4UA7A 3FPWA 3GVBA 1ESIA 2J3WA 1K6RA 3OOVA 1CEGA 1LL5A 5HPIA 3UDIA 4ZAMA 1KE3A 4MBFA 3N7WA 2PHYA 4CPKA 2JKTM 3BFCA 2PR6A 3HUMA 4WM9A 3HREA 2EA9A 4BWIA 4Q0HA 3D72A 5G4ZA 2A24A 1O07A 3BWLA 4ME4A 2B18A 3ULFA 3VMAA 2ZQ9A 3ICYA 3VP2A 4N9LA 2Y2QA 1PW1A 3CUEA 2V8CA 4JGOA 4X53A 5CEDA 1FILA 4HOIA 3L7HA 3T4KA 1LSWA 3IF5A 2EXBA 4YNRA 2W1TA 1YAXA 1LI0A 1S4RA 4FCFA 4C6YA 2EX2A 4EQIA 4LV3A 3QNBA 1IKIA 3NECA 1XKZA 3GTCA 1I5QA 5KZHA 1K54C 5JYPA 3T4LA 3ZQ5A 1Z6FA 2O9CA 5GLAA 1T1BA 1I2WA 1JTDA 2H10A 4LV0A 1WYCA 2R9WA 3N8RA 2PAVP 1W8YA 4O01A 2Y2NA 3NBLA 4NXFA 4P0MA 3MXRA 5FASA 1VB6A 1K4FA 4LCMA 4R1GA 4DDSA 4UAAA 4X55A 3O5YA 5E43A 4N9KA 1NYYA 2WYXA 2FFYA 1OTDA 1D1JA 2D02A 2Z6CA 4KENB 2W1RA 4OQ0A 1OT6A 4ARZB 3QP8A 2VGKA 1MWTA 4Y2FA 1P9WA 1EROA 1K6SA 4EBPA 2Y2OA 4FSFA 2IWDA 5GHYA 3C2WA 3OCNA 1NLYA 3MXSA 4S2NC 4GB7A 2XDMA 2VGLS 4S2IA 1KGFA 4X68A 4R3AA 4S2JA 3IX8A 2QJ7A 1CI8A 3ZVWA 1KE0A 2NUPC 5K5BA 2PYPA 3K3DA 2ZQCA 5L10A 2OOLA 4LRZE 2Y4AA 1VEUA 5F1GA 2VJWA 3PTEA 3HVFA 4LRYC 2B95A 2G2UA 1CK3A 3GV9A 4IBRA 4DXCA 3EQVA 3IH9A 3KX0X 4B9OA 5EM0A 3ZNTA 2HDUA 4JXGA 3NOPC 5FQKA 3NHQA 3OPPA 1ES5A 3V3SA 4R23A 1PZOA 1TDGA 1YM1A 4QJGA 1RP5A 1C3BA 1IEMA 3C7VA 3HJKA 4XUXA 3FC7A 3TW8A 4MDZA
chains in the Genus database with same CATH topology
4L9EA 5HWWA 3K2NA 3JVUA 5TBMB 5F6AA 4CLCC 4PHTA 3LYXA 4KQDA 4G3WA 3EWKA 3T4QA 3KSFA 4F3LA 1XFNA 4EW7A 1N9LA 1OTEA 2L0WA 2I9VA 2HJ9C 2Y8HA 2DMWA 4G3KA 4PKYG 1BYWA 2PR5A 5HDCA 5IS1A 2V9AA 5F69A 2K2NA 3RH8B 4HJ3A 3G6OA 1G28A 3V67A 3F1PA 5HDDA 3MR0A 2INWA 2KX6A 3BQ8A 3BY9A 2VKSA 4O0PA 5HSQA 5HD5A 1F98A 3PBOA 4HHDA 4L0LA 4HJ6A 5DJTA 4WELA 4DMZA 2GNXA 4HNBA 3PBQA 5MC7A 2KOIA 3KYZA 2GJ3A 1UGUA 2A2LA 3IBRA 5C5KA 3EGXC 3SW1A 2W3HA 2V1AA 1VHMA 1XJ3A 1NWZA 2JHEA 2OAP1 2PD7A 3F1NB 4GS9B 5KIZA 3MXQA 3H7WB 4I5SA 2V0UA 3VE4A 4XT2B 3H9WA 2FZ0A 4GS9A 3OBFA 2QHKA 3LIFA 4HY8A 1OTIA 4RQ9A 3OCLA 1IOUA 3LR5A 2VLGA 2LB9A 3UB7A 3PXPA 1OPXA 3U2AA 4I38A 1N9NA 4Y3IA 1DRMA 2W3FA 2HV1A 1X0OA 1ZTUA 2EWVA 4EQ1A 2YKHA 1MZUA 3K3CA 5HPFA 4IHQA 5EFWA 1JNUA 4HP4A 4ZRRA 4JGRA 3BY8A 4EETB 5KSHA 2EWWA 3VOLA 2M1CA 2D01A 5AVFA 3UMDA 2W3EA 1F5MA 3UMEA 3A0VA 3LR4A 2PT7A 2K7SA 3CLOA 4DJ2A 1XJ2A 2PDRA 5LBRA 2G7UA 2XA7S 1W63Q 3B33A 3MMHA 2LB5A 2Y79A 4EUVA 4DJ3A 1YKDA 3MFXA 5J3WA 4E04A 2XROA 4PKYA 1UWNX 3VE3A 5HD3A 3PBTA 3KSGA 3ZYTA 2B02A 3MQOA 3RTYA 1D06A 5HWTA 2W3GA 3FPVA 4NEED 3E4QA 4Q0IA 2WKRA 1S66L 4GHIB 4HH2A 3NOTC 4KUKA 2FH5A 4LPZA 4OOLA 4PAUA 3CUEC 2W3DA 4BBTA 2VGLM 4Y5FA 4HI4A 3C38A 1KOUA 1W63M 1TF1A 2JN7A 4I3IA 3HJIA 2XSSA 4H6JA 3IS2B 2HF6A 4II7A 4HJ4A 1DP6A 1OJ5A 4GCZA 2J3TC 2O9AA 3BW6A 4MCWA 3B42A 3LICA 1STZA 2JKRI 5HZHA 2Z6DA 3UB8A 1S4SA 1GSXA 3W2ZA 4KQOA 4KUOA 4K08A 1G6OA 4F3LB 4CQHA 5J7EA 3PBRA 4HIAA 4WL9A 3TJZC 3F1OA 4WEKA 3LIBA 4EERA 3H7WA 1TS0A 1LT0A 4CLCA 1GSWA 3UB9A 2HGVA 1OTBA 3F1NA 5IU1A 1NLZA 2NUTC 3GDIA 3S7PA 1TS8A 1NRJA 1T18A 2OAQ1 2WKQA 2PYRA 3FG8A 2QYBA 4NXGA 3LR0A 3CITA 2P08A 2W1TB 2ZMFA 2R78A 3CAXA 5A8BA 3RFBA 5L8MA 4ARZA 2VV6A 1IFQA 5DKLA 3R4KA 2H28A 3D3OA 3TE8A 2VV8A 1TS6A 1DP8A 3EQUA 1TS7A 3NJAA 2KDKA 4I39A 3EOIA 4MN6A 4GW9A 3LI9A 3LR3A 1LL8A 1TD5A 4BBUA 1OT9A 3KYQA 4L9GA 2J80A 4MN5A 2OWHA 1V9YA 3E98A 4EXOA 4JGPA 2L4RA 3C8CA 2CMNA 2BASA 4G3VA 2VX8A 3E4OA 5DFXA 3P7NA 1OJGA 4WF0A 4AFIA 1LSVA 2IA2A 3C30A 4IJGA 1F9IA 3BJNA 1P0ZA 2JKTI 1P9RA 3DBAA 1EW0A 2OWJA 3KO6A 3PYPA 3S7NA 2J3TD 1GSVA 3FPWA 2J3WA 4EEUA 4R70A 3IS2A 4LRXC 3OLOA 3OOVA 4YWZA 2M7VA 3T4JA 5HPIA 4DN0A 5HDSA 2PHYA 2JKTM 3R7WA 1S1YA 4QPRA 4UEYA 2K31A 2PR6A 2P04A 4UQIM 5G4YA 2EA9A 5DF9A 4BWIA 4Q0HA 2ZOIA 3GECA 3D72A 5G4ZA 2GX5A 2L1MA 5I5LA 2A24A 3KSHA 3BWLA 4ME4A 2B18A 3ULFA 3PR6A 4LLOB 4YOFA 1ZHHB 3ICYA 3EEAA 1Y28A 5F68A 3PHYA 5HL6A 3MF0A 3T4SA 3CUEA 4IUHA 4O8GA 4JGOA 3OC2A 4FOFA 2XRNA 4HOIA 3T4KA 4GHIA 4OOMA 1LSWA 3PBNA 5AJGA 2QWSA 3HCYA 1OTAA 4YNRA 4CLCE 2W1TA 3UB6A 4B93A 4GJ4A 3H82B 1YAXA 1S4RA 1DP9A 3LIEA 2QJ5A 4WN5A 4NXEA 1ODVA 2VEAA 5DJUA 1N9OA 3T4LA 3ZQ5A 3VV4A 2O9CA 5HWVA 3S7OA 1T1BA 5IT5A 3LIAA 4WEJA 2W0NA 3R7WB 4Z1WA 2ZMVA 4L9FA 4O01A 3F1OB 1D7EA 3NOUC 2O99A 4ETXA 3MJQA 1T1AA 2VA0A 3LI8A 4NXFA 5TBMA 2KLIA 3JVVA 4P6ZS 1VB6A 1WA9A 2HJEA 3LIDA 3O5YA 5TJJA 4GLQA 4M4XA 3T4OA 3E4PA 4HP9A 3F1PB 3PBSA 2O0YA 1OTDA 2GZAA 2V1BA 2D02A 2Z6CA 1H8MA 2W1RA 3TRCA 3T50A 3T4TA 3EGDC 2VZWA 3A0RA 3A0SA 3H82A 4P6ZM 1OT6A 4ARZB 2QKPA 1H3QA 3CWFA 4Y2FA 1P9WA 3B47A 4I3JA 3UE6A 5DFYA 2XA7M 2JKRM 4FSFA 1MC0A 2WKPA 4HQAA 5F5YA 3C2WA 4BMWA 3OCNA 4Q0JA 5DKKA 1NLYA 2A24B 1YSQA 4NXBA 4WUJA 2VGLS 2VV7A 3LFVA 4R3AA 4NKPA 2QJ7A 3UE3A 4EU0A 2NUPC 1S67L 5K5BA 4CLCB 2PYPA 3K3DA 1YSPA 3BQAA 2M7UA 2OOLA 2YKFA 4LRZE 2P7JA 4JGQA 5AVEA 2ZOHA 3KSIA 2ZBBA 1MKMA 1T1CA 2VJWA 4WLAA 4XT2A 5J4EA 4LRYC 4H6JB 4ETZA 5FL3A 3MQQA 4BBVA 1LSXA 2W27A 4BJPA 1P97A 3EQVA 1XFQA 3KX0X 1V9ZA 2O9BA 3P01A 5CX7A 4B9OA 4HH3A 4EEPA 3NOPC 2MJ6A 3NHQA 4EESA 1XJ4A 4R6LA 3CI6A 1XJ6A 3EEHA 4CLCD 4R38A 4MN7A 2PD8A 1T19A 4MMNA 3E0YA 3LUQA 3IBJA 3S7QA 1S1ZA 4UQIS 2V0WA 3HJKA 1UWPX 4I3AA 3MQ0A 3FC7A 4IUKA 3TW8A 4MDZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MJQ A;  1T1A A;  3MFX A;  4L9E A;  5J3W A;  5HDC A;  3LI8 A;  4E04 A;  2CMN A;  2BAS A;  4NXF A;  4PKY A;  5HWW A;  3E4O A;  5TBM A;  1UWN X;  5TBM B;  3VE3 A;  1VB6 A;  3P7N A;  1OJG A;  1WA9 A;  4WF0 A;  5F6A A;  5HD3 A;  1LSV A;  3LYX A;  4KQD A;  3EWK A;  3LID A;  4F3L A;  1XFN A;  2B02 A;  1F9I A;  3MQO A;  4EW7 A;  1N9L A;  1OTE A;  2L0W A;  4M4X A;  1P0Z A;  2I9V A;  1D06 A;  5HWT A;  3RTY A;  3E4P A;  4HP9 A;  3F1P B;  3E4Q A;  2WKR A;  1S66 L;  1EW0 A;  2OWJ A;  3PYP A;  4GHI B;  4HH2 A;  1OTD A;  2V1B A;  1BYW A;  1GSV A;  2PR5 A;  3NOT C;  2V9A A;  4KUK A;  4PKY G;  2D02 A;  2Z6C A;  4LPZ A;  5F69 A;  5IS1 A;  3RH8 B;  4HJ3 A;  4EEU A;  4R70 A;  3G6O A;  3IS2 A;  1G28 A;  3OLO A;  4LRX C;  3T50 A;  4YWZ A;  4BBT A;  3F1P A;  5HDD A;  4HI4 A;  3H82 A;  3A0R A;  2INW A;  3A0S A;  3MR0 A;  2KX6 A;  1KOU A;  4I5S A;  1OT6 A;  5HDS A;  2JN7 A;  2PHY A;  2QKP A;  3BY9 A;  4I3I A;  3HJI A;  4H6J A;  3CWF A;  3IS2 B;  4HJ4 A;  1S1Y A;  1DP6 A;  5HSQ A;  1OJ5 A;  5HD5 A;  4GCZ A;  2PR6 A;  1F98 A;  4HHD A;  4I3J A;  3UE6 A;  4DJ2 A;  5G4Y A;  2EA9 A;  4HJ6 A;  3LIC A;  2WKP A;  5DJT A;  4HQA A;  5F5Y A;  2ZOI A;  5HZH A;  2Z6D A;  3C2W A;  3GEC A;  1S4S A;  3UB8 A;  1GSX A;  3D72 A;  5DKK A;  2A24 B;  5G4Z A;  2L1M A;  5I5L A;  2A24 A;  3BWL A;  4NXB A;  3ULF A;  4KUO A;  4WUJ A;  4K08 A;  4HNB A;  4LLO B;  4F3L B;  2VV7 A;  3ICY A;  2GJ3 A;  4R3A A;  5J7E A;  1Y28 A;  4WL9 A;  2QJ7 A;  4HIA A;  3PHY A;  5F68 A;  3F1O A;  1UGU A;  3IBR A;  3LIB A;  4EER A;  3H7W A;  1TS0 A;  1LT0 A;  1S67 L;  2PYP A;  4JGO A;  3SW1 A;  1GSW A;  3K3D A;  3UB9 A;  2V1A A;  1XJ3 A;  2JHE A;  1NWZ A;  3F1N B;  4GS9 B;  2PD7 A;  1OTB A;  3F1N A;  5KIZ A;  3MXQ A;  2OOL A;  2YKF A;  4LRZ E;  2P7J A;  4JGQ A;  4HOI A;  3H7W B;  5IU1 A;  5AVE A;  3GDI A;  2V0U A;  2ZOH A;  1T1C A;  1TS8 A;  2ZBB A;  1LSW A;  3H9W A;  1T18 A;  4GHI A;  4WLA A;  2WKQ A;  4LRY C;  4XT2 B;  5J4E A;  4GS9 A;  2PYR A;  3FG8 A;  4H6J B;  4NXG A;  2QWS A;  3MQQ A;  1LSX A;  2QHK A;  3LIF A;  1OTA A;  4BBV A;  4HY8 A;  1OTI A;  4RQ9 A;  2W27 A;  1P97 A;  2R78 A;  3UB6 A;  2VLG A;  3CAX A;  3UB7 A;  3H82 B;  5A8B A;  1XFQ A;  3KX0 X;  1V9Z A;  1S4R A;  4B9O A;  4I38 A;  2VV6 A;  1DP9 A;  1N9N A;  3LIE A;  4HH3 A;  2QJ5 A;  5DKL A;  4EEP A;  1DRM A;  4WN5 A;  4NXE A;  3NOP C;  1ODV A;  2H28 A;  2HV1 A;  1X0O A;  3NHQ A;  2VEA A;  4EES A;  1XJ4 A;  4R6L A;  2VV8 A;  1TS6 A;  5DJU A;  4EQ1 A;  1DP8 A;  1N9O A;  1TS7 A;  1XJ6 A;  3EEH A;  3NJA A;  2KDK A;  2YKH A;  4I39 A;  4R38 A;  1MZU A;  3K3C A;  3ZQ5 A;  5HWV A;  4MN6 A;  5EFW A;  1JNU A;  2PD8 A;  4GW9 A;  4HP4 A;  4XT2 A;  3LI9 A;  1T1B A;  4JGR A;  3BY8 A;  3LIA A;  4EET B;  3VOL A;  3VE4 A;  1LL8 A;  2M1C A;  4BBU A;  1T19 A;  2D01 A;  5AVF A;  3UMD A;  3UME A;  2W0N A;  3A0V A;  1OT9 A;  3LUQ A;  2K7S A;  3CLO A;  2J80 A;  4L9G A;  4MN5 A;  1XJ2 A;  2OWH A;  2PDR A;  1S1Z A;  1V9Y A;  4L9F A;  2V0W A;  3HJK A;  1UWP X;  4I3A A;  3B33 A;  3F1O B;  3FC7 A;  1D7E A;  4EXO A;  3NOU C;  4JGP A;  4DJ3 A;  2L4R A;  3C8C A; 
#chains in the Genus database with same CATH topology
 1JTG A;  2V1Z A;  3K2N A;  3JVU A;  4EBL A;  3UE1 A;  4PHT A;  2V8F A;  2ZM8 A;  3KSF A;  4F3L A;  4EW7 A;  2HJ9 C;  3N8S A;  2Y8H A;  2DMW A;  4G3K A;  1S0W A;  5F69 A;  4DRT A;  1FR6 A;  4D2O A;  3RH8 B;  2DNS A;  1G28 A;  3V67 A;  5EVL A;  3BLM A;  5HDD A;  3W4P A;  2H0Y A;  1F98 A;  4KG6 A;  1SZV A;  4E3L A;  5DJT A;  1QME A;  4HNB A;  5MC7 A;  2E8J A;  2KOI A;  1TDL A;  1LHY A;  1UGU A;  2A2L A;  3O88 A;  5FQ9 A;  3SW1 A;  1E3U D;  1HVB A;  1SDN A;  2OAP 1;  5KIZ A;  2ZMA A;  4ZJ3 A;  1ZG4 A;  2FZ0 A;  4OP8 A;  2WKI A;  1K38 A;  3LIF A;  3FYZ A;  3LR5 A;  3D4F A;  1DRM A;  2VGJ A;  3SZT A;  2HV1 A;  3QP4 A;  2ZL1 B;  1BSG A;  1Y54 A;  3UPO A;  1MWS A;  5FQQ A;  5L07 A;  3HUO A;  5L2F A;  3BY8 A;  1PZP A;  2EWW A;  3ZDJ A;  4OH0 A;  2XQZ A;  2PT7 A;  2Y91 A;  3IHB A;  1RGZ A;  2XFS A;  4Y15 A;  3JPU A;  4EUV A;  4WYY A;  3G32 A;  1M40 A;  3ZG9 B;  1D06 A;  5HWT A;  4R3B A;  4PPR A;  4JXW A;  4PAU A;  3CUE C;  4BBT A;  1K25 A;  5HAP A;  3ZGA B;  1W63 M;  3HJI A;  3IS2 B;  4HJ4 A;  4MEZ A;  1H8Y A;  1ONH A;  2O9A A;  2V20 A;  3B3X A;  3BW6 A;  4P87 A;  3LIC A;  3QP5 A;  4RVA A;  3UB8 A;  1S4S A;  3OPL A;  4KQO A;  3SH7 A;  5J7E A;  3PBR A;  4WL9 A;  3LIB A;  3H7W A;  3HBR A;  1YLY A;  1GSW A;  3UB9 A;  4K0X A;  3GMW A;  3NUL A;  2WKQ A;  3FG8 A;  2P08 A;  2W1T B;  2FFF B;  5A8B A;  2Q9N A;  5L8M A;  5G18 A;  4QB8 A;  1IFQ A;  3R4K A;  3MZE A;  5CTM A;  5CRF A;  2Y2I A;  4EUZ A;  2KDK A;  4WZ5 C;  3LEZ A;  2QZ6 A;  3NCK A;  2Y2M A;  1CI9 A;  4BBU A;  4E6W A;  1MBL A;  3KYQ A;  2PBY A;  5AQ7 A;  5EE8 A;  1VET A;  4GOG A;  3G34 A;  4JGP A;  1IKG A;  4E3M A;  1TVF A;  2CMN A;  2BAS A;  2VX8 A;  4PM7 A;  3CZD A;  1LSV A;  4JXS A;  4Y0U A;  5CXW A;  2XF3 A;  2EX9 A;  1P9R A;  1EW0 A;  3S7N A;  5KMW A;  2J3T D;  1K57 C;  3OPR A;  1IYP A;  4S2L A;  3DTE A;  3T4J A;  5CEC A;  3A3J A;  4HBT A;  5HDS A;  1YMX A;  3NDE A;  3WS2 A;  1S1Y A;  2ZC7 A;  2K31 A;  3UPN A;  4UQI M;  5G4Y A;  2JCH A;  4MNR A;  5EVI A;  4DDY A;  2ZLY A;  3IXB A;  3KSH A;  3ISG A;  3NIA A;  5EEC A;  1BLP A;  3EEA A;  4EWF A;  5F68 A;  3BEB A;  3HLW A;  3MF0 A;  3UY6 A;  4O8G A;  3OC2 A;  1PNE A;  2RL3 A;  3G30 A;  4KZ5 A;  1PIO A;  2Q0O A;  3TG9 A;  3HLF A;  1H5X A;  3FZC A;  1J3W A;  2J8Y A;  3N4I A;  2J9P A;  5F82 A;  3UB6 A;  4B93 A;  4GJ4 A;  3H82 B;  1BT5 A;  2QJ5 A;  2ZM0 A;  1ERM A;  1FQG A;  1ODV A;  3BRM A;  1IYS A;  3HLD A;  2EFU A;  4X6T A;  2JKF A;  3IH8 A;  3E2K A;  5CEB A;  4BQM A;  4WEJ A;  5IHV A;  2W0N A;  5A93 A;  2WGI A;  5TBM A;  1AXB A;  3BLS A;  5EM1 A;  3MKF A;  5TGF A;  4DE0 A;  3BFF A;  4IVK A;  4M4X A;  3T4O A;  4JF5 A;  2WAD A;  3E4P A;  3HLB A;  3OZH A;  3CG5 A;  3PBS A;  1PI4 A;  3M2K A;  4LV2 A;  2GZA A;  1FCN A;  1XA7 A;  2EX8 A;  3EGD C;  2HP5 A;  4U0X A;  2VZW A;  3A0R A;  3H82 A;  3LCE A;  3BFG A;  1BUE A;  1G6A A;  2XA7 M;  1MC0 A;  3M2J A;  4HQA A;  5F5Y A;  5DKK A;  2A24 B;  5FI2 A;  3IF6 A;  3V5M A;  4NXB A;  4WUJ A;  4JXV A;  2WAF A;  3RJU A;  5CGS A;  4DE1 A;  1NZU A;  4BL2 A;  4RX3 A;  4KZ6 A;  3SOI A;  1YLP A;  5AVE A;  3KSI A;  4BBV A;  1LSX A;  4WZ4 A;  3W8K A;  2W27 A;  1P97 A;  1DJA A;  1XFQ A;  1V9Z A;  4K0W A;  4F94 A;  1QMF A;  2MJ6 A;  5BOH A;  3CI6 A;  4UHU A;  3EEH A;  4CLC D;  4DF6 A;  4R38 A;  4MN7 A;  2PD8 A;  1ALQ A;  2Y2L A;  1T19 A;  3LUQ A;  5CHM A;  5J8X A;  2E8I A;  1UWP X;  3Q7V B;  2ZQ7 A;  4L9E A;  1M6K A;  4IBX A;  3WRZ A;  1TEM A;  5M18 A;  3O86 A;  5EVI D;  3A3D A;  3LYX A;  4KQD A;  1MY8 A;  4G3W A;  4QD4 A;  2Y55 A;  4GD8 A;  1HZO A;  1XFN A;  2A3U A;  2EFX A;  3V50 A;  2L0W A;  3N6I A;  3C4O A;  4JF4 A;  4PKY G;  2PR5 A;  5HDC A;  2V9A A;  3ITA A;  4HJ3 A;  3F1P A;  2X02 A;  4E3I A;  3BQ8 A;  3BY9 A;  4DKI A;  3V3R A;  2PU2 A;  2RCX A;  2ZC5 B;  3PBO A;  3BM6 A;  4HJ6 A;  3ZG7 B;  1MWR A;  5AQB A;  2WZX A;  1XGI A;  2GNX A;  3S4X A;  5HAR A;  4XUZ A;  3CPT A;  1YT4 A;  3MSH A;  3UN7 A;  4E3K A;  1YLW A;  2G2W A;  3EGX C;  4OLD A;  2OV5 A;  1VHM A;  1NWZ A;  2PD7 A;  3MXQ A;  1W79 A;  2ZC6 B;  3H7W B;  3BYD A;  2V0U A;  4I5S A;  4XT2 B;  4Y17 A;  1SKO A;  5DTK A;  1O7E A;  5FI6 A;  1DY6 A;  2ZD8 A;  1ES4 A;  1ZKJ A;  5GLB A;  2LB9 A;  3UB7 A;  1OPX A;  5JYO A;  4I38 A;  4Y3I A;  1X0O A;  4K91 A;  5CGX A;  1KDS A;  1ZTU A;  4DE3 A;  3ZVT A;  4BL3 A;  1MZU A;  3K3C A;  3KYE A;  5EFW A;  4HP4 A;  3N8L A;  4OQG A;  1WE4 A;  1ZC2 A;  3VOL A;  4MBK A;  2ZQ8 A;  2D01 A;  4A5R A;  4NK3 A;  3ITB A;  1F5M A;  1K56 D;  3UME A;  4YFM A;  3LR4 A;  4DJ2 A;  2VK3 A;  3MMH A;  2Y79 A;  4WZ5 A;  1YKD A;  5CHU A;  3MFX A;  4E04 A;  3U4L P;  1ERQ A;  3PBT A;  3UNW A;  1OME A;  2HDR A;  4HBU A;  3L9K A;  3P09 A;  1JWZ A;  3CMZ A;  4NEE D;  1K4E A;  4GHI B;  4HH2 A;  2ZL1 A;  4PM9 A;  2FH5 A;  4C75 A;  1U60 A;  3HLE A;  3S1Y A;  4ZBE A;  1XA1 A;  2VGL M;  4HI4 A;  5CER A;  3FKW A;  1TF1 A;  1SHV A;  1L0E A;  4II7 A;  2B5R A;  4GN2 A;  1STZ A;  4OQH A;  2Z6D A;  4QU3 A;  3BFE A;  3FWL A;  2J9O A;  3WS4 A;  2Y2J A;  3AGD A;  4WEK A;  1CEF A;  3E2L A;  3GSG A;  2DRW A;  2UWX A;  3Q1F A;  1FCM A;  4KQQ A;  2QYB A;  3CIT A;  1PWD A;  4OLG A;  4N92 A;  5FAT A;  3VFH A;  4OVD A;  5DKL A;  3LO7 A;  2XD5 A;  3DWZ A;  3HUN A;  3Q07 A;  3TE8 A;  3Q82 A;  2BLS A;  5FA7 A;  3UE0 A;  1HLU P;  1L0F A;  1E3U A;  3EOI A;  4MN6 A;  3LI9 A;  3LR3 A;  1XPB A;  4LGW A;  5F1F A;  4MN5 A;  3E98 A;  2X01 A;  5GLC A;  2JC7 A;  1LLB A;  2L4R A;  3C8C A;  4KZA A;  4OON A;  4D60 A;  5HL1 A;  2OLV A;  5DFX A;  3P7N A;  4GKU A;  2AVX A;  3IXG A;  4ESP A;  3D9Y A;  1FIK A;  5HW3 A;  1PFL A;  2ZQD A;  1DJC A;  2JKT I;  1ES2 A;  5DF8 A;  5HFO A;  3KO6 A;  1GSV A;  2IWC A;  3IS2 A;  3OLO A;  4R0Q A;  4YWZ A;  2M7V A;  3SH8 A;  5A92 A;  4DN0 A;  3R7W A;  4GDB A;  1YPR A;  4QPR A;  3MZF A;  5DF9 A;  4ZJ2 A;  2XD1 A;  4BD1 A;  3C4P A;  3GEC A;  2GX5 A;  5I5L A;  2Z2M B;  4PMA A;  3PR6 A;  1YLJ A;  3BEC A;  3LY4 A;  1Y28 A;  4S2M A;  2X71 A;  1SKO B;  4OKP A;  3BFD A;  3MKE A;  1HTZ A;  5M1A A;  1BUL A;  1E4D A;  5AJG A;  4BD0 A;  5U47 A;  2EX6 A;  4S2O A;  1XX2 A;  1DP9 A;  3LIE A;  3IXH A;  4WN5 A;  3IF6 C;  4ZDX A;  2PRF A;  5DJU A;  4NET A;  1N9O A;  1GHP A;  3VP1 A;  5FQI A;  5IT5 A;  3LIA A;  4U0T A;  3NC8 A;  3LGO A;  3R7W B;  4Z1W A;  2ZMV A;  4L9F A;  5FAO A;  3F1O B;  1D7E A;  3SH9 A;  3NOU C;  3DTM A;  4ETX A;  5EOO A;  1T1A A;  3G4P A;  2KLI A;  2WK0 A;  3JVV A;  3JYI A;  3TSG A;  4P6Z S;  4Y7P A;  1WA9 A;  4KG2 A;  4GZB A;  4GLQ A;  2WKH A;  5M19 A;  2O0Y A;  4OQI A;  1GHI A;  3TRC A;  3T50 A;  4X69 A;  3CWF A;  2Y59 A;  4QY6 A;  3DTK A;  1EI5 A;  3B47 A;  3UE6 A;  2WKP A;  5FQM A;  4BMW A;  2XH9 A;  1YSQ A;  1GA0 A;  3V39 A;  3HL9 A;  3DTI A;  5HAQ A;  2BTF P;  3UE3 A;  1ES3 A;  4EU0 A;  5EV0 A;  1ACF A;  4OPY A;  1S67 L;  4CLC B;  1YSP A;  4KZ8 A;  1SDE A;  2M7U A;  2P7J A;  1VET B;  4JGQ A;  4WLA A;  4XT2 A;  2ZBB A;  1PRQ A;  4GD6 A;  5J4E A;  3QP6 A;  4H6J B;  4ETZ A;  3MQQ A;  5DTS A;  4B4X A;  1ESU A;  3VP0 A;  4BJP A;  1BLS A;  1K0K A;  5CGW A;  1WYB A;  2XFT A;  4EES A;  1KVL A;  4R6L A;  5CTN A;  4P6B A;  1EWZ A;  5EVI C;  2OSU A;  5KSC A;  2HDS A;  3E0Y A;  4GNU A;  3IBJ A;  2Y2K A;  1A0K A;  4UQI S;  2V0W A;  4I3A A;  4IUK A;  3SS4 A;  4WMC D;  2WGW B;  1J9M A;  4XXR A;  4OPQ A;  3DW0 A;  4WMC A;  5TBM B;  4RYE A;  4CLC C;  4U3T A;  3T4Q A;  4FD8 A;  2I9V A;  4OPR A;  1L2S A;  1BYW A;  5IS1 A;  3G35 A;  5F83 A;  3MR0 A;  1FR1 A;  2KX6 A;  5EUA A;  2JKG A;  1H0M A;  2VKS A;  1KGE A;  4BEN A;  4O0P A;  5HSQ A;  5HD5 A;  5D3O A;  4HHD A;  3UDX A;  3IT9 A;  3PAG A;  1G5U A;  4FH4 A;  3OPH A;  4JLF A;  3VOZ A;  4WEL A;  4DMZ A;  1L3L A;  3PBQ A;  3QHY A;  4X1L A;  3O3V A;  4Q8I A;  2JE5 A;  1MXO A;  5EVE A;  5A91 A;  3IBR A;  3GRJ A;  1BLC A;  5C5K A;  3P98 A;  1XJ3 A;  2JHE A;  1KGG A;  5FEG A;  1AWI A;  4JBF A;  5EPH A;  3VE4 A;  4BLM A;  3H9W A;  2QHK A;  1OTI A;  4RQ9 A;  4B4Z A;  3IX4 A;  3OCL A;  1IOU A;  3G31 A;  5E2E A;  5FSR A;  1PI5 A;  3U2A A;  3PAE A;  1H8Z A;  5I94 A;  4JPM A;  4EQ1 A;  1HD8 A;  3VOY A;  4ZRR A;  3SS3 A;  2M1C A;  3A0V A;  4LV1 A;  1K54 A;  2K7S A;  2G7U A;  2XA7 S;  1W63 Q;  2Y2G A;  4DJ3 A;  5J3W A;  3IHA A;  3VE3 A;  5HD3 A;  4JKT A;  4B88 A;  2XK1 A;  3KSG A;  1RCJ A;  5GHZ A;  3RTY A;  4OPZ A;  2W3G A;  4Q0I A;  5DVA A;  1NJ4 A;  2WKR A;  1S66 L;  1JWP A;  3NOT C;  2JBF A;  2DCF A;  4LPZ A;  2Z2L B;  4OOL A;  2GDN A;  5E2F A;  3RXW A;  4X56 A;  2JN7 A;  4NG2 A;  2HF6 A;  3IX3 A;  4N1H A;  4GCZ A;  4MCW A;  2P74 A;  2XGN A;  4Y13 A;  3B42 A;  1W5D A;  2JKR I;  5HZH A;  1GSX A;  3NY4 A;  3NI9 A;  1PW8 A;  2OLU A;  3T1S A;  3WS5 A;  3W4Q A;  4K08 A;  1G6O A;  3ZG0 A;  4F3L B;  2ZQA A;  3TJZ C;  3F1O A;  4EER A;  1TS0 A;  1LT0 A;  4C3Q A;  1XXM A;  1IYQ A;  3F1N A;  4QY5 A;  1NLZ A;  2NUT C;  3GDI A;  3S7P A;  1TS8 A;  4GDN A;  4NXG A;  1KDW A;  3RFB A;  4ARZ A;  3ZNY A;  2HZ5 A;  3D3O A;  2C6W B;  4X25 A;  1DP8 A;  3HLC A;  3WWX A;  4GW9 A;  2A49 A;  3WS1 A;  1TD5 A;  2XEP A;  1OT9 A;  2J80 A;  2OWH A;  1V9Y A;  1NYM A;  3CHW P;  4G3V A;  5GHX A;  1OJG A;  4AFI A;  2IA2 A;  1MPL A;  5AQ9 A;  2HDQ A;  1P0Z A;  1Q2P A;  3PYP A;  4EEU A;  4R70 A;  4LRX C;  3S22 A;  2P9V B;  3O87 A;  1GHM A;  4UEY A;  2P04 A;  4Y0O A;  5CHJ A;  2ZOI A;  4FUW A;  4RA7 A;  2CC1 A;  5AQA A;  2L1M A;  3MBZ A;  1I2S A;  4LLO B;  4YOF A;  1ZHH B;  5E2G A;  3PHY A;  5HL6 A;  3T4S A;  1JWV A;  1N4O A;  4IUH A;  5GLD A;  4FOF A;  2XRN A;  5FAP A;  4ZJ1 A;  4GHI A;  3ZHH A;  4OOM A;  3PBN A;  4E3O A;  2QWS A;  3HCY A;  1OTA A;  4CLC E;  2QMI A;  1Y4O A;  3T1Q B;  1NRF A;  1LI9 A;  4X1M A;  4NXE A;  4IED A;  1PYY A;  2VEA A;  2Q9M A;  4OOY A;  5L09 A;  3A3I A;  1Z09 A;  3IWI A;  3VV4 A;  2UV0 E;  2PU4 A;  5HWV A;  3S7O A;  2WUQ A;  1CF0 A;  3LEQ A;  1JVJ A;  4Z9Q A;  1IYO A;  4ID4 A;  1S6R A;  1GCE A;  2O99 A;  3MJQ A;  2HP6 A;  2VA0 A;  3LI8 A;  2HJE A;  1PWG A;  1XP4 A;  3LID A;  1YLT A;  5TJJ A;  2HP9 A;  4MLL A;  4HP9 A;  3F1P B;  4PM5 A;  1GA9 A;  2V1B A;  4E3J A;  1NY0 A;  1H8M A;  5FDS A;  3T4T A;  4P6Z M;  3A0S A;  2QKP A;  1H3Q A;  3C5A A;  3IF6 B;  2ZC4 B;  4I3J A;  5DFY A;  2JKR M;  4LEN A;  5FAQ A;  4KZB A;  4EV4 A;  4Q0J A;  2EXA A;  3G2Z A;  4KZ9 A;  2VV7 A;  3LFV A;  4O7D A;  3WRT A;  4NKP A;  4MBH A;  3ZCZ A;  3MFD A;  3BQA A;  2YKF A;  2ZOH A;  1T1C A;  1MKM A;  4E3N A;  3FKV A;  5FL3 A;  1VM1 A;  1SKF A;  5HAI A;  2WAE A;  4S2N A;  2O9B A;  3P01 A;  5CX7 A;  4HH3 A;  2BG1 A;  4EEP A;  4FTX A;  3NDG A;  1CQA A;  1XJ4 A;  5FDH A;  1XJ6 A;  5TFQ A;  4S2K A;  2HPB A;  3CPT B;  3GQZ A;  4JF6 A;  1KE4 A;  4FH2 A;  3UPP A;  1F2K A;  4MMN A;  3A3E A;  3S7Q A;  1S1Z A;  3MQ0 A;  3HLG A;  1KVM A;  5HWW A;  5F6A A;  3EWK A;  4Y0T A;  1N9L A;  3VP3 A;  1OTE A;  1XGJ A;  4PM8 A;  3UO9 A;  3DWK A;  2K2N A;  2J7V A;  3G6O A;  4YIN A;  3SS5 A;  2INW A;  1MWU A;  3RXX A;  1MKI A;  3CJM A;  3C7U A;  1K57 A;  2Y2P A;  4L0L A;  5E2H A;  5EVI B;  2PBD P;  2XR0 A;  2I72 A;  5DF7 A;  4DXB A;  2WZZ A;  1W7F A;  1K56 A;  1SCW A;  3KYZ A;  2GJ3 A;  3QNC A;  2ZC3 B;  3Q7V A;  4LFU A;  5FQJ A;  4LCL A;  4PM6 A;  3QP1 A;  4R4R A;  2W3H A;  1IEL A;  2V1A A;  4GS9 B;  3A3F A;  3F1N B;  3MZD A;  4KZ7 A;  1K55 A;  5FEF A;  3ZFZ A;  1PWC A;  5EOE A;  4GS9 A;  3I7J A;  3OBF A;  4KZ3 A;  4HY8 A;  4KQR A;  4UA6 A;  2R9X A;  1W8Q A;  2VLG A;  1N9B A;  3PXP A;  3M6B A;  2P9V A;  1N9N A;  1G68 A;  2W3F A;  1BZA A;  1BTL A;  3ZG8 B;  4DE2 A;  2EWV A;  3GR2 A;  2IWB A;  2YKH A;  3IQA A;  4H8R A;  5HPF A;  4IHQ A;  1JNU A;  4EBN A;  4JGR A;  4EET B;  5KSH A;  4ZTK A;  5AVF A;  3UMD A;  2W3E A;  2H0T A;  3CLO A;  1XJ2 A;  2PDR A;  5LBR A;  3IWO A;  5GL9 A;  3FV7 A;  3B33 A;  1L0G A;  2WGW A;  2LB5 A;  3LY3 A;  4IVI A;  1L0D A;  1YMS A;  2XRO A;  4PKY A;  1UWN X;  3T1R A;  4UA9 A;  3VP4 A;  2XLN A;  2Y2H A;  4QWO A;  3ZYT A;  2B02 A;  1FOF A;  3MQO A;  3DAV A;  5A90 A;  3FPV A;  3E4Q A;  4S2P A;  4KUK A;  1FSW A;  4HEF A;  3AGE A;  2W3D A;  3IWQ A;  4Y5F A;  2ZM2 A;  2WGV A;  3C38 A;  1KOU A;  3Q7Z A;  4I3I A;  4H6J A;  2XSS A;  1DP6 A;  1OJ5 A;  1YLZ A;  4KZ4 A;  1DJB A;  1CJF A;  2J3T C;  3UDF A;  4OP5 A;  5FI7 A;  1BLH A;  4M3K A;  3W2Z A;  5TR7 A;  5HX9 A;  3T1X A;  4KUO A;  1FCO A;  2V2F F;  4CQH A;  1YQS A;  1Q2Q A;  4HIA A;  4R4S A;  4HES A;  4CLC A;  3T12 B;  4E6X A;  2HGV A;  3M6H A;  1OTB A;  3QP2 A;  1K55 C;  1NXY A;  1VEU B;  2ZJ9 A;  5IU1 A;  1NRJ A;  1T18 A;  2OAQ 1;  4P85 A;  2PYR A;  5DTT A;  3UB5 P;  3LR0 A;  2ZMF A;  2R78 A;  3CAX A;  3IXD A;  3WS0 A;  2VV6 A;  3ZG5 A;  2H28 A;  3VSK A;  1E25 A;  1RGY A;  3W4O A;  3VSL A;  1NZO A;  1TS6 A;  2VV8 A;  3EQU A;  1TS7 A;  3NJA A;  2WKE A;  4I39 A;  2ACG A;  1ONG A;  2H5S A;  4N1X A;  1LL8 A;  3G2Y A;  1ZG6 A;  4R3J A;  3AGF A;  3Q81 A;  4L9G A;  3VFF A;  4EXO A;  3MS6 A;  3TOI A;  3E4O A;  4QHC A;  4WF0 A;  4RX2 A;  3C30 A;  2C5W B;  1LL9 A;  1FSY A;  4IJG A;  1F9I A;  3BJN A;  4CJN A;  1VQQ A;  4KG5 A;  3DBA A;  2OWJ A;  4WBG A;  2QPN A;  4UA7 A;  3FPW A;  3GVB A;  1ESI A;  2J3W A;  1K6R A;  3OOV A;  1CEG A;  1LL5 A;  5HPI A;  3UDI A;  4ZAM A;  1KE3 A;  4MBF A;  3N7W A;  2PHY A;  4CPK A;  2JKT M;  3BFC A;  2PR6 A;  3HUM A;  4WM9 A;  3HRE A;  2EA9 A;  4BWI A;  4Q0H A;  3D72 A;  5G4Z A;  2A24 A;  1O07 A;  3BWL A;  4ME4 A;  2B18 A;  3ULF A;  3VMA A;  2ZQ9 A;  3ICY A;  3VP2 A;  4N9L A;  2Y2Q A;  1PW1 A;  3CUE A;  2V8C A;  4JGO A;  4X53 A;  5CED A;  1FIL A;  4HOI A;  3L7H A;  3T4K A;  1LSW A;  3IF5 A;  2EXB A;  4YNR A;  2W1T A;  1YAX A;  1LI0 A;  1S4R A;  4FCF A;  4C6Y A;  2EX2 A;  4EQI A;  4LV3 A;  3QNB A;  1IKI A;  3NEC A;  1XKZ A;  3GTC A;  1I5Q A;  5KZH A;  1K54 C;  5JYP A;  3T4L A;  3ZQ5 A;  1Z6F A;  2O9C A;  5GLA A;  1T1B A;  1I2W A;  1JTD A;  2H10 A;  4LV0 A;  1WYC A;  2R9W A;  3N8R A;  2PAV P;  1W8Y A;  4O01 A;  2Y2N A;  3NBL A;  4NXF A;  4P0M A;  3MXR A;  5FAS A;  1VB6 A;  1K4F A;  4LCM A;  4R1G A;  4DDS A;  4UAA A;  4X55 A;  3O5Y A;  5E43 A;  4N9K A;  1NYY A;  2WYX A;  2FFY A;  1OTD A;  1D1J A;  2D02 A;  2Z6C A;  4KEN B;  2W1R A;  4OQ0 A;  1OT6 A;  4ARZ B;  3QP8 A;  2VGK A;  1MWT A;  4Y2F A;  1P9W A;  1ERO A;  1K6S A;  4EBP A;  2Y2O A;  4FSF A;  2IWD A;  5GHY A;  3C2W A;  3OCN A;  1NLY A;  3MXS A;  4S2N C;  4GB7 A;  2XDM A;  2VGL S;  4S2I A;  1KGF A;  4X68 A;  4R3A A;  4S2J A;  3IX8 A;  2QJ7 A;  1CI8 A;  3ZVW A;  1KE0 A;  2NUP C;  5K5B A;  2PYP A;  3K3D A;  2ZQC A;  5L10 A;  2OOL A;  4LRZ E;  2Y4A A;  1VEU A;  5F1G A;  2VJW A;  3PTE A;  3HVF A;  4LRY C;  2B95 A;  2G2U A;  1CK3 A;  3GV9 A;  4IBR A;  4DXC A;  3EQV A;  3IH9 A;  3KX0 X;  4B9O A;  5EM0 A;  3ZNT A;  2HDU A;  4JXG A;  3NOP C;  5FQK A;  3NHQ A;  3OPP A;  1ES5 A;  3V3S A;  4R23 A;  1PZO A;  1TDG A;  1YM1 A;  4QJG A;  1RP5 A;  1C3B A;  1IEM A;  3C7V A;  3HJK A;  4XUX A;  3FC7 A;  3TW8 A;  4MDZ A; 
#chains in the Genus database with same CATH homology
 4L9E A;  5HWW A;  3K2N A;  3JVU A;  5TBM B;  5F6A A;  4CLC C;  4PHT A;  3LYX A;  4KQD A;  4G3W A;  3EWK A;  3T4Q A;  3KSF A;  4F3L A;  1XFN A;  4EW7 A;  1N9L A;  1OTE A;  2L0W A;  2I9V A;  2HJ9 C;  2Y8H A;  2DMW A;  4G3K A;  4PKY G;  1BYW A;  2PR5 A;  5HDC A;  5IS1 A;  2V9A A;  5F69 A;  2K2N A;  3RH8 B;  4HJ3 A;  3G6O A;  1G28 A;  3V67 A;  3F1P A;  5HDD A;  3MR0 A;  2INW A;  2KX6 A;  3BQ8 A;  3BY9 A;  2VKS A;  4O0P A;  5HSQ A;  5HD5 A;  1F98 A;  3PBO A;  4HHD A;  4L0L A;  4HJ6 A;  5DJT A;  4WEL A;  4DMZ A;  2GNX A;  4HNB A;  3PBQ A;  5MC7 A;  2KOI A;  3KYZ A;  2GJ3 A;  1UGU A;  2A2L A;  3IBR A;  5C5K A;  3EGX C;  3SW1 A;  2W3H A;  2V1A A;  1VHM A;  1XJ3 A;  1NWZ A;  2JHE A;  2OAP 1;  2PD7 A;  3F1N B;  4GS9 B;  5KIZ A;  3MXQ A;  3H7W B;  4I5S A;  2V0U A;  3VE4 A;  4XT2 B;  3H9W A;  2FZ0 A;  4GS9 A;  3OBF A;  2QHK A;  3LIF A;  4HY8 A;  1OTI A;  4RQ9 A;  3OCL A;  1IOU A;  3LR5 A;  2VLG A;  2LB9 A;  3UB7 A;  3PXP A;  1OPX A;  3U2A A;  4I38 A;  1N9N A;  4Y3I A;  1DRM A;  2W3F A;  2HV1 A;  1X0O A;  1ZTU A;  2EWV A;  4EQ1 A;  2YKH A;  1MZU A;  3K3C A;  5HPF A;  4IHQ A;  5EFW A;  1JNU A;  4HP4 A;  4ZRR A;  4JGR A;  3BY8 A;  4EET B;  5KSH A;  2EWW A;  3VOL A;  2M1C A;  2D01 A;  5AVF A;  3UMD A;  2W3E A;  1F5M A;  3UME A;  3A0V A;  3LR4 A;  2PT7 A;  2K7S A;  3CLO A;  4DJ2 A;  1XJ2 A;  2PDR A;  5LBR A;  2G7U A;  2XA7 S;  1W63 Q;  3B33 A;  3MMH A;  2LB5 A;  2Y79 A;  4EUV A;  4DJ3 A;  1YKD A;  3MFX A;  5J3W A;  4E04 A;  2XRO A;  4PKY A;  1UWN X;  3VE3 A;  5HD3 A;  3PBT A;  3KSG A;  3ZYT A;  2B02 A;  3MQO A;  3RTY A;  1D06 A;  5HWT A;  2W3G A;  3FPV A;  4NEE D;  3E4Q A;  4Q0I A;  2WKR A;  1S66 L;  4GHI B;  4HH2 A;  3NOT C;  4KUK A;  2FH5 A;  4LPZ A;  4OOL A;  4PAU A;  3CUE C;  2W3D A;  4BBT A;  2VGL M;  4Y5F A;  4HI4 A;  3C38 A;  1KOU A;  1W63 M;  1TF1 A;  2JN7 A;  4I3I A;  3HJI A;  2XSS A;  4H6J A;  3IS2 B;  2HF6 A;  4II7 A;  4HJ4 A;  1DP6 A;  1OJ5 A;  4GCZ A;  2J3T C;  2O9A A;  3BW6 A;  4MCW A;  3B42 A;  3LIC A;  1STZ A;  2JKR I;  5HZH A;  2Z6D A;  3UB8 A;  1S4S A;  1GSX A;  3W2Z A;  4KQO A;  4KUO A;  4K08 A;  1G6O A;  4F3L B;  4CQH A;  5J7E A;  3PBR A;  4HIA A;  4WL9 A;  3TJZ C;  3F1O A;  4WEK A;  3LIB A;  4EER A;  3H7W A;  1TS0 A;  1LT0 A;  4CLC A;  1GSW A;  3UB9 A;  2HGV A;  1OTB A;  3F1N A;  5IU1 A;  1NLZ A;  2NUT C;  3GDI A;  3S7P A;  1TS8 A;  1NRJ A;  1T18 A;  2OAQ 1;  2WKQ A;  2PYR A;  3FG8 A;  2QYB A;  4NXG A;  3LR0 A;  3CIT A;  2P08 A;  2W1T B;  2ZMF A;  2R78 A;  3CAX A;  5A8B A;  3RFB A;  5L8M A;  4ARZ A;  2VV6 A;  1IFQ A;  5DKL A;  3R4K A;  2H28 A;  3D3O A;  3TE8 A;  2VV8 A;  1TS6 A;  1DP8 A;  3EQU A;  1TS7 A;  3NJA A;  2KDK A;  4I39 A;  3EOI A;  4MN6 A;  4GW9 A;  3LI9 A;  3LR3 A;  1LL8 A;  1TD5 A;  4BBU A;  1OT9 A;  3KYQ A;  4L9G A;  2J80 A;  4MN5 A;  2OWH A;  1V9Y A;  3E98 A;  4EXO A;  4JGP A;  2L4R A;  3C8C A;  2CMN A;  2BAS A;  4G3V A;  2VX8 A;  3E4O A;  5DFX A;  3P7N A;  1OJG A;  4WF0 A;  4AFI A;  1LSV A;  2IA2 A;  3C30 A;  4IJG A;  1F9I A;  3BJN A;  1P0Z A;  2JKT I;  1P9R A;  3DBA A;  1EW0 A;  2OWJ A;  3KO6 A;  3PYP A;  3S7N A;  2J3T D;  1GSV A;  3FPW A;  2J3W A;  4EEU A;  4R70 A;  3IS2 A;  4LRX C;  3OLO A;  3OOV A;  4YWZ A;  2M7V A;  3T4J A;  5HPI A;  4DN0 A;  5HDS A;  2PHY A;  2JKT M;  3R7W A;  1S1Y A;  4QPR A;  4UEY A;  2K31 A;  2PR6 A;  2P04 A;  4UQI M;  5G4Y A;  2EA9 A;  5DF9 A;  4BWI A;  4Q0H A;  2ZOI A;  3GEC A;  3D72 A;  5G4Z A;  2GX5 A;  2L1M A;  5I5L A;  2A24 A;  3KSH A;  3BWL A;  4ME4 A;  2B18 A;  3ULF A;  3PR6 A;  4LLO B;  4YOF A;  1ZHH B;  3ICY A;  3EEA A;  1Y28 A;  5F68 A;  3PHY A;  5HL6 A;  3MF0 A;  3T4S A;  3CUE A;  4IUH A;  4O8G A;  4JGO A;  3OC2 A;  4FOF A;  2XRN A;  4HOI A;  3T4K A;  4GHI A;  4OOM A;  1LSW A;  3PBN A;  5AJG A;  2QWS A;  3HCY A;  1OTA A;  4YNR A;  4CLC E;  2W1T A;  3UB6 A;  4B93 A;  4GJ4 A;  3H82 B;  1YAX A;  1S4R A;  1DP9 A;  3LIE A;  2QJ5 A;  4WN5 A;  4NXE A;  1ODV A;  2VEA A;  5DJU A;  1N9O A;  3T4L A;  3ZQ5 A;  3VV4 A;  2O9C A;  5HWV A;  3S7O A;  1T1B A;  5IT5 A;  3LIA A;  4WEJ A;  2W0N A;  3R7W B;  4Z1W A;  2ZMV A;  4L9F A;  4O01 A;  3F1O B;  1D7E A;  3NOU C;  2O99 A;  4ETX A;  3MJQ A;  1T1A A;  2VA0 A;  3LI8 A;  4NXF A;  5TBM A;  2KLI A;  3JVV A;  4P6Z S;  1VB6 A;  1WA9 A;  2HJE A;  3LID A;  3O5Y A;  5TJJ A;  4GLQ A;  4M4X A;  3T4O A;  3E4P A;  4HP9 A;  3F1P B;  3PBS A;  2O0Y A;  1OTD A;  2GZA A;  2V1B A;  2D02 A;  2Z6C A;  1H8M A;  2W1R A;  3TRC A;  3T50 A;  3T4T A;  3EGD C;  2VZW A;  3A0R A;  3A0S A;  3H82 A;  4P6Z M;  1OT6 A;  4ARZ B;  2QKP A;  1H3Q A;  3CWF A;  4Y2F A;  1P9W A;  3B47 A;  4I3J A;  3UE6 A;  5DFY A;  2XA7 M;  2JKR M;  4FSF A;  1MC0 A;  2WKP A;  4HQA A;  5F5Y A;  3C2W A;  4BMW A;  3OCN A;  4Q0J A;  5DKK A;  1NLY A;  2A24 B;  1YSQ A;  4NXB A;  4WUJ A;  2VGL S;  2VV7 A;  3LFV A;  4R3A A;  4NKP A;  2QJ7 A;  3UE3 A;  4EU0 A;  2NUP C;  1S67 L;  5K5B A;  4CLC B;  2PYP A;  3K3D A;  1YSP A;  3BQA A;  2M7U A;  2OOL A;  2YKF A;  4LRZ E;  2P7J A;  4JGQ A;  5AVE A;  2ZOH A;  3KSI A;  2ZBB A;  1MKM A;  1T1C A;  2VJW A;  4WLA A;  4XT2 A;  5J4E A;  4LRY C;  4H6J B;  4ETZ A;  5FL3 A;  3MQQ A;  4BBV A;  1LSX A;  2W27 A;  4BJP A;  1P97 A;  3EQV A;  1XFQ A;  3KX0 X;  1V9Z A;  2O9B A;  3P01 A;  5CX7 A;  4B9O A;  4HH3 A;  4EEP A;  3NOP C;  2MJ6 A;  3NHQ A;  4EES A;  1XJ4 A;  4R6L A;  3CI6 A;  1XJ6 A;  3EEH A;  4CLC D;  4R38 A;  4MN7 A;  2PD8 A;  1T19 A;  4MMN A;  3E0Y A;  3LUQ A;  3IBJ A;  3S7Q A;  1S1Z A;  4UQI S;  2V0W A;  3HJK A;  1UWP X;  4I3A A;  3MQ0 A;  3FC7 A;  4IUK A;  3TW8 A;  4MDZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...