3UE6A

The dark structure of the blue-light photoreceptor aureochrome1 lov
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
135
structure length
135
Chain Sequence
EDPDYSLVKALQMAQQNFVITDASLPDNPIVYASRGFLTLTGYSLDQILGRNCRFLQGPETDPRAVDKIRNAITKGVDTSVCLLNYRQDGTTFWNLFFVAGLRDSKGNIVNYVGVQSKVSEDYAKLLVNEQNIEY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Signaling protein
molecule keywords Aureochrome1
publication title Crystal structures of Aureochrome1 LOV suggest new design strategies for optogenetics.
pubmed doi rcsb
source organism Vaucheria frigida
total genus 39
structure length 135
sequence length 135
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2011-10-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13426 PAS_9 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3ue6A00
1LT0A 3K3CA 1NWZA 5KIZA 3SW1A 3H7WA 3UB8A 3ICYA 3E4PA 3LIBA 1VB6A 5J7EA 1MZUA 4GW9A 2BASA 5HZHA 2JHEA 1TS6A 3HJKA 4WUJA 1XJ2A 4LLOB 4LRZE 1JNUA 4B9OA 3LIAA 4HJ4A 1T1CA 1XFNA 4I39A 4H6JA 5J3WA 4F3LB 2JN7A 2PDRA 2PHYA 3LUQA 3E4QA 1V9YA 1WA9A 4PKYA 5HDCA 1TS7A 3IS2B 2V0WA 1OJGA 2QWSA 4HP4A 3F1OA 4HI4A 1DRMA 2I9VA 3F1NA 4EEUA 5DJTA 5DKLA 1N9OA 4I3AA 4GS9B 3LIDA 1EW0A 2QJ5A 4HQAA 3G6OA 4LRYC 2VV6A 3A0VA 4BBVA 3T50A 4NXGA 2OWHA 3MQQA 4R6LA 3EWKA 4R38A 3NHQA 4YWZA 3MQOA 3LIFA 2P7JA 3LI8A 2VV8A 1OTEA 4KUOA 4L9FA 3C8CA 4WLAA 5TBMA 3H7WB 3NJAA 4E04A 4DJ3A 3RTYA 3BY8A 3MFXA 1T18A 5HD5A 1T19A 4GCZA 1GSWA 2PYRA 4H6JB 5DJUA 1G28A 1S66L 1LSXA 3F1OB 1DP8A 5HDDA 3UMDA 5HD3A 1D7EA 3F1NB 4NXFA 1LSWA 5IU1A 4KQDA 1N9LA 4EESA 2OWJA 4I5SA 1P0ZA 2D02A 1OTDA 2QJ7A 1XJ3A 1OTIA 2GJ3A 4LPZA 5IS1A 3H82A 1XFQA 3A0SA 3CAXA 2A24A 2V1BA 3UB6A 3UE6A 5F69A 1S1ZA 3F1PA 2W27A 1D06A 1TS0A 1X0OA 2Z6DA 5TBMB 3CWFA 1GSXA 1T1AA 3NOUC 2L1MA 3BY9A 4R3AA 2WKQA 2Z6CA 4MN6A 2EA9A 4EERA 1OJ5A 4JGRA 4WN5A 2QKPA 2HV1A 3H9WA 5F6AA 4I3JA 3VOLA 3E4OA 3FC7A 1F98A 4MN5A 5I5LA 1OTBA 3HJIA 3PHYA 3LIEA 2V1AA 1V9ZA 3MR0A 2PR6A 4I3IA 1UGUA 3EEHA 2D01A 2B02A 3KX0X 2J80A 2CMNA 3K3DA 3UB9A 3H82B 4EW7A 4BBTA 5AVFA 5DKKA 5HWTA 2QHKA 4JGPA 2A24B 5J4EA 3UB7A 3C2WA 2ZOIA 3F1PB 3NOPC 3FG8A 4EETB 4L9EA 2PR5A 2WKPA 2R78A 4HH3A 1S4SA 3ZQ5A 3BWLA 5AVEA 1XJ6A 1BYWA 1S4RA 4JGQA 5HWVA 2H28A 4HH2A 3LICA 4HP9A 1S67L 4KUKA 4RQ9A 1OTAA 1DP6A 4HIAA 5HWWA 2W0NA 4WF0A 4DJ2A 3VE3A 2ZBBA 4NXBA 4JGOA 4EEPA 2INWA 5HDSA 1KOUA 4GHIA 5G4YA 1LL8A 3IBRA 3PYPA 1OT9A 4XT2A 2YKHA 2V9AA 1ODVA 4HJ6A 1XJ4A 3A0RA 2PD7A 3CLOA 2K7SA 3OLOA 4NXEA 5F68A 4R70A 3MXQA 2M1CA 1UWNX 3D72A 5A8BA 2KDKA 3LYXA 4EQ1A 1N9NA 3B33A 4F3LA 2PD8A 1GSVA 2ZOHA 4WL9A 1S1YA 2WKRA 3GECA 4HOIA 4K08A 4PKYG 2VV7A 3IS2A 3VE4A 3NOTC 2VEAA 2V0UA 1LSVA 1T1BA 4BBUA 4HNBA 2KX6A 5EFWA 4HJ3A 5G4ZA 4HHDA 1F9IA 5HSQA 2PYPA 1DP9A 4HY8A 4LRXC 5F5YA 4GS9A 1OT6A 1P97A 2YKFA 3RH8B 4GHIB 1Y28A 2L0WA 4M4XA 3GDIA 3MJQA 2L4RA 1UWPX 3ULFA 2OOLA 3P7NA 4L9GA 3LI9A 2VLGA 3UMEA 4EXOA 4I38A 1TS8A 4XT2B
chains in the Genus database with same CATH superfamily
3UPOA 1FILA 4X56A 3RFBA 4DKIA 1ACFA 4WZ5C 1MZUA 4K0WA 3T4LA 1N4OA 3UE0A 5I94A 2O99A 4P85A 1HVBA 1XJ2A 3HLWA 4ME4A 2NUTC 4B9OA 3LIAA 3AGDA 1XX2A 1T1CA 1XKZA 2OAQ1 3IWQA 3ZVWA 2JN7A 2PDRA 5EUAA 4PM9A 3LUQA 5EVLA 1I2SA 1V9YA 3HBRA 4GD6A 3DWKA 2Y2OA 3S7OA 3F1OA 2P08A 4Y3IA 3F1NA 3HUMA 2HDUA 3KSHA 4DMZA 1C3BA 3HLCA 1JWVA 3UDIA 5HFOA 4I3AA 3QNBA 1KGEA 5FQJA 5FEFA 4IVKA 5LBRA 4NXGA 4XUZA 3MQQA 2W1TA 1LL5A 4R38A 4KZ7A 4YWZA 2W1RA 2VGKA 3VP4A 2XFTA 4P0MA 1GHMA 2P7JA 3OPRA 1J3WA 4G3KA 2WYXA 4MBFA 3SZTA 5CRFA 3ITBA 3C8CA 2JKTM 1PNEA 2HP5A 1MWRA 1IYQA 3VV4A 2EFUA 4DDYA 1CI9A 4DJ3A 3V39A 3BY8A 4UHUA 1STZA 3MFXA 1T18A 3GR2A 1T19A 4OQHA 4GDNA 1L0EA 1GSWA 5DJUA 4S2NA 2W3HA 2OAP1 3MXSA 1W63Q 3LGOA 3UE1A 1D1JA 5DFXA 1N9BA 1KGFA 2IWBA 4KG6A 4WZ4A 3UMDA 1ONHA 1SZVA 3IBJA 2W3DA 4NETA 3JPUA 5L10A 4N1HA 1N9LA 2ZD8A 3HVFA 4A5RA 2V2FF 2WADA 5FATA 3FPVA 4QY6A 5FQKA 4Y15A 2VGJA 2QJ7A 4R3BA 4LPZA 2OLUA 1CQAA 1EI5A 3D3OA 3TJZC 1PI5A 1IKGA 1YT4A 3UE6A 1S1ZA 2W27A 2V20A 1W5DA 3CWFA 1GSXA 3NOUC 3K2NA 4JF6A 2GNXA 3BY9A 4UA9A 4GDBA 3GSGA 5FA7A 1RP5A 2VA0A 2WKEA 1ES4A 3IF6C 4XUXA 4WN5A 5FL3A 1K55C 2HV1A 3IXHA 3T1SA 3BFFA 3O3VA 4KZ9A 3NECA 5F6AA 1MWUA 2Y55A 4LCLA 3R7WB 4FCFA 4OQGA 3KYEA 2XEPA 3BFCA 2O9CA 1U60A 3FC7A 1F98A 2IWDA 5BOHA 1OTBA 3PHYA 5GHXA 2PR6A 1JWPA 4I3IA 4G3VA 4QPRA 2C5WB 1YAXA 3CJMA 3C4PA 1VETA 1XXMA 2CMNA 4H8RA 2PU2A 5L2FA 1GA0A 3K3DA 3QP8A 4GOGA 4WYYA 4OQ0A 4DE1A 4JGPA 2A24B 5J4EA 3C2WA 5HW3A 2ZQ7A 4PM6A 5GL9A 2EWVA 5DFYA 4EETB 4L9EA 2PR5A 4HH3A 3BWLA 5AVEA 1XJ6A 1H5XA 3MZFA 1BYWA 2ZL1B 3Q7VB 2LB5A 5EVEA 4NKPA 4OOMA 5HWVA 4EBPA 1KE0A 3PTEA 1FR1A 1LL9A 1QMEA 4WBGA 3A3DA 4EBLA 1YLJA 2WGWA 4RQ9A 1P9RA 3Q1FA 4KZ6A 3HL9A 5F1GA 5AQBA 4DJ2A 2XSSA 1J9MA 2HDQA 3MKEA 3VE3A 3LFVA 4YFMA 4EEPA 3VP2A 1KOUA 3FKWA 4Y0UA 4PM7A 2PBDP 3ZDJA 1NLZA 3CPTB 1BZAA 2Y91A 1O7EA 3FV7A 4O0PA 4UA7A 4IHQA 1JVJA 5E2GA 4CLCD 5EVIB 4AFIA 4CLCA 1HD8A 3OLOA 4NXEA 1I5QA 2M1CA 2Y2JA 2ZM0A 5KSCA 3BECA 5A8BA 3RJUA 1O07A 1LI0A 4GD8A 1CJFA 5FI7A 2BLSA 1LI9A 5FDSA 2Y4AA 1OMEA 3TOIA 2J9PA 3T4JA 3GECA 2VV7A 2HJ9C 3OBFA 3IS2A 3VE4A 2PU4A 3WWXA 5CTNA 2W3EA 1LSVA 1ZG4A 4HNBA 4OP5A 1IYPA 2ZC6B 3LY4A 2WKIA 1YSQA 3CG5A 1DP9A 1A0KA 1OT6A 1BLHA 1P97A 1MXOA 4WEJA 3GDIA 3MJQA 4R23A 2L4RA 2OOLA 2CC1A 4E6XA 2PBYA 1CEGA 1XA7A 5HAPA 2LB9A 2JKTI 3MMHA 4EXOA 5IT5A 1MC0A 4ZJ3A 3A3JA 1F5MA 3MZEA 1LT0A 3K3CA 2X02A 1NWZA 4Y13A 3PAGA 3T4OA 1BULA 3UB8A 3E4PA 3LIBA 3V5MA 5GLCA 1K38A 2JHEA 4LV3A 4WUJA 3N7WA 1MY8A 3C5AA 2XD1A 3B3XA 1HTZA 3SOIA 3DTIA 2JKGA 1XFNA 4I39A 3DWZA 3EGDC 3E2LA 3KYZA 2PHYA 1ZG6A 4GNUA 3FWLA 3E4QA 1WA9A 3OZHA 2V0WA 1RGZA 4DN0A 3LY3A 2J3WA 1TVFA 4HP4A 4R4SA 2I9VA 2K31A 2JKRM 4UQIS 4MBKA 1IOUA 4X1LA 2XFSA 4F94A 2Y2IA 1Q2PA 2VJWA 2WUQA 3G34A 5TJJA 4EUVA 4OLGA 4GS9B 3HUOA 1EW0A 3G6OA 4LRYC 5TGFA 3TSGA 3A0VA 4BBVA 3T50A 5A92A 1PYYA 4R6LA 3EWKA 4FSFA 2WZZA 4X55A 4OPZA 2I72A 2Y2QA 2FZ0A 4IVIA 1FCNA 3BJNA 5AQ9A 3LI8A 4DXBA 4YINA 1L0FA 2HJEA 3BFEA 4ETZA 1ES2A 3KSGA 2G7UA 3IWIA 4HEFA 1VEUA 3E0YA 1FCOA 3SH8A 3BW6A 1K4EA 1W7FA 5F1FA 1S0WA 1YSPA 5U47A 3VP1A 3EQUA 3FKVA 4PM8A 3VP3A 5CHMA 2PYRA 4B93A 4QHCA 3OC2A 4X6TA 3C30A 4II7A 1G28A 3BLMA 4X69A 3OCLA 4JPMA 4UQIM 1L2SA 3F1OB 1DP8A 5HDDA 4DE3A 1ZHHB 4FUWA 3AGFA 3MF0A 5HD3A 3G35A 1D7EA 3F1NB 4NXFA 1XGJA 1LSWA 1YLPA 4KQDA 3BYDA 2IWCA 4I5SA 2PT7A 2D02A 4KZ8A 3EQVA 2Y2LA 1IFQA 4JXWA 2JKFA 5HL6A 4BJPA 2HDSA 2EXBA 3H82A 1NRJA 1PWCA 4BLMA 2W1TB 2M7VA 3C38A 3PXPA 4WMCD 1K57A 4BENA 3O86A 5AJGA 1MWSA 4FTXA 5F69A 1ALQA 2C6WB 1BLPA 1W8YA 3L9KA 4WMCA 2H0TA 3CITA 1K6SA 3HLDA 1SCWA 1PRQA 4DRTA 3TW8A 1T1AA 2L1MA 2Z6CA 3GTCA 1EWZA 3O5YA 4KG2A 2QKPA 5M18A 2XGNA 2HZ5A 3ITAA 4I3JA 3JYIA 1NRFA 2EX6A 3R4KA 1CK3A 1YLTA 3IHBA 5HX9A 2XD5A 3W4OA 4HBUA 3E4OA 4ETXA 4KZ5A 4MN5A 1NY0A 4JLFA 5I5LA 3PBQA 4UAAA 2H10A 4GJ4A 3MS6A 3TG9A 1M40A 3S1YA 3LIEA 1H8ZA 2P74A 3LR4A 1V9ZA 1EROA 3JVVA 4DE2A 4PPRA 2Y8HA 3QP6A 3ZNYA 5DF8A 2D01A 3ZG7B 3N6IA 2J80A 3UPPA 3CI6A 3CUEA 3UB9A 4MN7A 1SKOA 4O01A 2BG1A 4EW7A 2Y2MA 3NULA 4EUZA 5DKKA 2QHKA 3MSHA 3UB7A 1TDLA 3HCYA 2J7VA 1MKMA 1K54C 3FG8A 4OKPA 2JC7A 3ZQ5A 3RXWA 3NY4A 2OLVA 3ZCZA 2GX5A 1PI4A 4ZJ1A 4RX2A 4BQMA 3IX4A 2Q9MA 4JGQA 3M6BA 1K0KA 2ZQDA 2J3TD 1YLWA 1K56D 4E3OA 4KZAA 1DJAA 4KUKA 1OTAA 4HIAA 5HWWA 2W0NA 1K56A 3NIAA 2DCFA 5CHJA 3ZGAB 5FEGA 2INWA 4FH4A 1JTDA 5HDSA 2OSUA 4DDSA 4GHIA 5HARA 5GHZA 3ZG8B 3WS4A 3N4IA 3ISGA 1VETB 1W8QA 3IXGA 1OT9A 4CJNA 3P09A 4XT2A 4N1XA 4GKUA 3GMWA 3T1RA 3Q82A 3LCEA 4WZ5A 1XA1A 4HJ6A 1SDEA 4NEED 2A2LA 3QP1A 3GRJA 2HP6A 1NZOA 2GZAA 4MBHA 4MNRA 3FZCA 2HPBA 1FCMA 3SS5A 5EVIC 1TDGA 5E43A 1UWNX 4QY5A 1SDNA 3V3SA 1WE4A 4Y2FA 4B4XA 4IUKA 1IYSA 1PFLA 2DMWA 5D3OA 3B33A 4F3LA 1GSVA 4WL9A 1S1YA 4CPKA 2JCHA 4PKYG 4N9KA 2JKRI 5GHYA 4N9LA 5EM0A 3NOTC 2WGWB 1FOFA 2V0UA 5FAPA 5CGSA 4S2JA 2EXAA 4HJ3A 2B18A 3LO7A 1GCEA 3G2ZA 1CF0A 4WELA 4HHDA 4MCWA 4S2MA 2PYPA 1XP4A 4HY8A 4LRXC 1BSGA 3M2JA 2A49A 3RH8B 4Q8IA 1IYOA 1XPBA 4LV1A 1XGIA 2P9VA 4E3LA 4QU3A 3UMEA 3PBSA 4I38A 1YQSA 4NG2A 4HBTA 3M2KA 5EECA 5KIZA 3SW1A 1BTLA 3H7WA 3ICYA 4CLCB 1G6AA 1W79A 4S2KA 1VB6A 5J7EA 1NXYA 2BASA 2O0YA 4U0TA 4Y0OA 3HJKA 3GVBA 4LRZE 5FQ9A 4G3WA 2V8CA 3DBAA 3S22A 1NYYA 2XR0A 3PBTA 3GV9A 2PRFA 1ZKJA 4H6JA 5J3WA 5EOEA 2H5SA 2X01A 1JTGA 2QZ6A 4RYEA 3IS2B 2ZMFA 4P6ZS 4OQIA 5CHUA 3Q7ZA 4LFUA 2B95A 3D9YA 3UO9A 2QWSA 5CXWA 2HF6A 4HI4A 1DRMA 4C75A 3WS1A 2Y59A 3WS2A 4EEUA 3BQ8A 4ZRRA 2XROA 5DJTA 1N9OA 3AGEA 3OOVA 3EGXC 1YLYA 3LIDA 4DXCA 5HPFA 4HQAA 5AQAA 4ZTKA 4S2PA 4KQRA 1IEMA 2VV6A 1F2KA 2OWHA 3ZNTA 1KE3A 5EV0A 3MQOA 2UWXA 3T4QA 1GHIA 4WEKA 3LIFA 1BLCA 2XH9A 1OTEA 3UN7A 1I2WA 4Y5FA 4WLAA 5TBMA 4YNRA 1SKFA 3UDXA 3NJAA 3SH7A 3IF6A 4E04A 4OOLA 3ZG9B 1K55A 3RTYA 4Y7PA 3IH8A 2Y2GA 3ZFZA 2R9WA 4GCZA 3Q07A 3SS4A 1Y54A 4QD4A 3HREA 4P6ZM 4ESPA 3LEQA 1S66L 4ZAMA 1K4FA 1DJCA 3IX3A 4LV0A 4X68A 4RVAA 3NDGA 1NZUA 3LR3A 4P87A 3ZVTA 5FAOA 1DJBA 4JXGA 5GLDA 5IU1A 3S7QA 4EESA 1E4DA 3B42A 4XXRA 3W8KA 1P0ZA 3G31A 4S2IA 2Y79A 5EE8A 3HLBA 2M7UA 1FIKA 4Y0TA 1YLZA 1XJ3A 1OTIA 5IS1A 3N8SA 2ZQ9A 4OPYA 3T12B 3IX8A 1PWGA 5M19A 1JWZA 1XFQA 3A0SA 3DTMA 3CAXA 3VP0A 3ZG0A 4GN2A 2FH5A 3UB6A 3F1PA 3T1QB 1X0OA 3TE8A 1VEUB 3G32A 4JKTA 5MC7A 5C5KA 4R3AA 2WKQA 4PMAA 4MN6A 4GZBA 1S6RA 3OPHA 1OJ5A 1E25A 3IXBA 4JF4A 1IELA 3CMZA 3H9WA 3T4SA 1IKIA 3SH9A 5E2EA 2Y2HA 4LV2A 2AVXA 1YPRA 4IJGA 3Q81A 2JBFA 5G18A 5E2HA 5FI2A 3VFFA 3PBNA 4S2NC 4BL2A 3ZHHA 1PWDA 1NLYA 3WS5A 4Z9QA 2Q0OA 2QPNA 4Z1WA 4LENA 3WS0A 1Q2QA 2B02A 3KX0X 3UDFA 4IEDA 5DTKA 3H82B 3RXXA 1E3UD 1YMSA 1ESIA 3IQAA 3W2ZA 5L09A 3EOIA 4LCMA 2QYBA 5HWTA 1E3UA 1BT5A 5K5BA 2XDMA 1K6RA 5FQIA 3KSFA 3NOPC 1TF1A 1KE4A 2J8YA 3V3RA 4HESA 5FAQA 4MDZA 2VGLM 4OLDA 4K0XA 2ZM8A 2ZLYA 2VKSA 2QMIA 5F82A 3QHYA 1FQGA 4HH2A 3W4QA 5KSHA 1TEMA 1DP6A 3IHAA 2WKHA 3N8RA 4WF0A 5TR7A 3I7JA 3GQZA 5FSRA 1MWTA 3NCKA 3D4FA 2WK0A 3VOZA 3UB5P 5DF9A 2NUPC 4Q0JA 3E2KA 3KYQA 2G2WA 4E6WA 1YKDA 3VSLA 3LEZA 4ARZA 4FH2A 5L8MA 2O9BA 3PYPA 2HP9A 1DY6A 1YMXA 1FSWA 1ODVA 1SKOB 1H8YA 1XJ4A 3A0RA 2PD7A 5EOOA 3CLOA 2K7SA 1NJ4A 1WYCA 3BEBA 3PAEA 5F68A 4KZ4A 4R70A 3MXQA 4MMNA 3MZDA 2DRWA 4ZBEA 5DVAA 3DAVA 3D72A 4Q0HA 3QP5A 4S2LA 2KDKA 2K2NA 1H0MA 5CEDA 2G2UA 1N9NA 1RGYA 2DNSA 2PD8A 4EV4A 2ZOHA 4HOIA 4K08A 3NDEA 5FQMA 4ZDXA 2VEAA 4MEZA 1ERQA 1T1BA 2VX8A 2Z2LB 2ZJ9A 3MQ0A 2KX6A 5EFWA 2ACGA 1SHVA 3UE3A 1KDSA 2VK3A 3UPNA 3L7HA 1AWIA 5F5YA 1HZOA 2YKFA 3QP4A 3BFDA 1NYMA 1PIOA 4GHIB 1Y28A 2L0WA 4M4XA 4O8GA 3P7NA 1UWPX 2R9XA 2XA7S 1L0DA 2VLGA 2E8IA 2HDRA 3V67A 4XT2B 2MJ6A 2FFFB 1AXBA 3HLFA 5GLAA 4R4RA 1MPLA 2WAEA 4BL3A 3UNWA 3JVUA 4BWIA 4QWOA 4GW9A 4BD1A 5HZHA 1TS6A 4EQIA 4KQOA 4LLOB 1JNUA 4CLCC 3PBRA 4HJ4A 1H8MA 3O87A 4GLQA 4F3LB 2P04A 1VQQA 1CEFA 1PZPA 2ZC5B 4PKYA 5HDCA 1TS7A 1G6OA 1OJGA 2GDNA 5JYOA 4PM5A 1ONGA 5A93A 3DW0A 2ZQAA 2A3UA 5DKLA 5FQQA 3NBLA 3VOYA 1FSYA 1Z6FA 5FI6A 2QJ5A 1MKIA 2XA7M 4B88A 1BLSA 2KLIA 3U4LP 4OPRA 2ZMAA 5A90A 3VSKA 2P9VB 4NK3A 1TD5A 4E3MA 2Y2NA 3NHQA 4D2OA 4GB7A 4BMWA 4MLLA 3G30A 2EFXA 1KVMA 2Y2PA 1L0GA 2XF3A 2VV8A 3B47A 4WM9A 4JF5A 5FDHA 3ZG5A 4KUOA 4L9FA 3S4XA 3H7WB 5DTSA 1ERMA 2ZC4B 3WRTA 4PAUA 2V1ZA 5AQ7A 2ZQ8A 4KQQA 1KGGA 4U3TA 5A91A 5HD5A 3VFHA 4IBXA 1PW1A 3HUNA 4H6JB 2UV0E 4OH0A 3C7UA 1KDWA 3BM6A 3R7WA 2Y2KA 3MXRA 1LSXA 4X1MA 3FYZA 4RX3A 5FASA 4PHTA 3O88A 4QJGA 3HLGA 1HLUP 1H3QA 4BD0A 3IT9A 2OWJA 3N8LA 5CX7A 4UA6A 1GHPA 5HAQA 1OTDA 2BTFP 1G68A 2E8JA 5CECA 5GLBA 2GJ3A 1MBLA 3A3FA 3QP2A 4EU0A 2B5RA 3G2YA 5CEBA 1K54A 2A24A 2V1BA 1PZOA 4OVDA 5EM1A 3MKFA 4QB8A 1D06A 1TS0A 2EWWA 2Z6DA 5TBMB 3W4PA 1LLBA 4KG5A 2EX8A 2XQZA 3IF6B 2ZL1A 3KO6A 3Q7VA 4OONA 1L3LA 2EA9A 4EERA 2FFYA 5DTTA 4JGRA 4Q0IA 4CQHA 2WGIA 3IF5A 3QNCA 5E2FA 4R3JA 1QMFA 1KVLA 3SS3A 3EEAA 3T1XA 4M3KA 3VOLA 4ID4A 3S7NA 5DF7A 1ESUA 2W3GA 3HJIA 4C3QA 3M6HA 2V1AA 4O7DA 3MR0A 4E3IA 3VMAA 5HPIA 3C4OA 3CPTA 2KOIA 4R1GA 3S7PA 1GA9A 3A3EA 3CZDA 3BLSA 4P6BA 1UGUA 3A3IA 3EEHA 5EVID 1ZC2A 2X71A 1BUEA 5EVIA 5CTMA 4BBTA 5AVFA 4IUHA 1PW8A 5J8XA 5KMWA 3WRZA 5JYPA 2ZOIA 3P01A 2ZM2A 3F1PB 2RL3A 4JXVA 2XLNA 1K25A 1K57C 4OOYA 2WKPA 2R78A 1S4SA 2WGVA 1S4RA 2IA2A 5CGXA 5HAIA 3NC8A 3NI9A 4S2OA 3U2AA 2W3FA 3PR6A 5CGWA 3IXDA 4JBFA 2EX9A 2JE5A 1FR6A 2H0YA 2H28A 3LICA 3MBZA 2RCXA 4HP9A 1S67L 2HGVA 2WZXA 1ES3A 1VHMA 4JXSA 2V8FA 3UY6A 3C7VA 1OPXA 2XRNA 2ZBBA 3LR5A 1M6KA 3IH9A 4KZ3A 4NXBA 4Y17A 4JGOA 4D60A 3OPLA 2J9OA 4LGWA 3DTEA 3TRCA 2O9AA 3E98A 3MFDA 4OP8A 3HLEA 3CHWP 5G4YA 3T4TA 4C6YA 1LL8A 4X53A 3IBRA 1WYBA 2ZQCA 5KZHA 1G5UA 2YKHA 2VGLS 4UEYA 1LHYA 3PBOA 1CI8A 2V9AA 3KSIA 4ZJ2A 4E3JA 2Z2MB 5HL1A 4IBRA 3CUEC 2EX2A 5M1AA 4KZBA 1YM1A 1W63M 4B4ZA 3OCNA 3OPPA 2Q9NA 4FD8A 4E3KA 4KENB 1VM1A 1ES5A 4R0QA 3LYXA 4RA7A 1ZTUA 4N92A 2VZWA 2ZC7A 4OPQA 4EQ1A 4X25A 1P9WA 4DE0A 2WKRA 4E3NA 4U0XA 4YOFA 4FOFA 3BRMA 1Z09A 2ZC3B 5TFQA 3DTKA 3P98A 4BBUA 1RCJA 3ZYTA 3IWOA 5G4ZA 1Y4OA 5L07A 4DF6A 3BQAA 2ZMVA 2OV5A 1F9IA 2J3TC 5HSQA 2XK1A 4L0LA 3T4KA 4GS9A 3G4PA 3BFGA 4EWFA 3FPWA 4CLCE 3V50A 2PAVP 4K91A 5F83A 4ARZB 4EBNA 5IHVA 3ULFA 4L9GA 3LI9A 2WAFA 3LR0A 1TS8A 5CERA 5EPHA
chains in the Genus database with same CATH topology
1F5MA 1LT0A 3K3CA 1NWZA 5KIZA 3SW1A 3H7WA 3T4OA 3UB8A 3RFBA 3ICYA 3JVUA 4CLCB 3E4PA 4BWIA 3LIBA 1VB6A 5J7EA 1MZUA 4GW9A 2BASA 3T4LA 5HZHA 2O0YA 2JHEA 2O99A 1TS6A 3HJKA 4KQOA 4WUJA 1XJ2A 4LLOB 4LRZE 4ME4A 1JNUA 2NUTC 4CLCC 4B9OA 4G3WA 3LIAA 3DBAA 3PBRA 3PBTA 4HJ4A 1T1CA 1XFNA 1H8MA 4I39A 2OAQ1 3EGDC 4H6JA 4GLQA 3KYZA 5J3WA 2P04A 4F3LB 2JN7A 2PDRA 2PHYA 3LUQA 3E4QA 1V9YA 1WA9A 4PKYA 5HDCA 1TS7A 3IS2B 2ZMFA 4P6ZS 2V0WA 1G6OA 4DN0A 2J3WA 1OJGA 2QWSA 4HP4A 3S7OA 3F1OA 2P08A 2HF6A 4HI4A 1DRMA 2I9VA 2K31A 2JKRM 4Y3IA 4UQIS 3F1NA 4EEUA 3BQ8A 4ZRRA 2XROA 1IOUA 3KSHA 5DJTA 5DKLA 4DMZA 1N9OA 2VJWA 3OOVA 5TJJA 4I3AA 4EUVA 3EGXC 4GS9B 3LIDA 1EW0A 2QJ5A 5HPFA 2XA7M 4HQAA 2KLIA 3G6OA 4LRYC 2VV6A 5LBRA 3A0VA 4BBVA 3T50A 4NXGA 2OWHA 1TD5A 3MQQA 2W1TA 4R6LA 3EWKA 4R38A 4FSFA 3NHQA 4YWZA 2W1RA 3MQOA 4BMWA 3T4QA 4WEKA 3LIFA 2P7JA 4G3KA 2FZ0A 3BJNA 3LI8A 2VV8A 3B47A 1OTEA 2HJEA 4KUOA 4L9FA 4Y5FA 3C8CA 2JKTM 4WLAA 5TBMA 4ETZA 3H7WB 3KSGA 4YNRA 2G7UA 3VV4A 3E0YA 3NJAA 4PAUA 4E04A 3BW6A 4DJ3A 4OOLA 1YSPA 3RTYA 3BY8A 3EQUA 1STZA 3MFXA 1T18A 5HD5A 1T19A 4GCZA 1GSWA 2PYRA 4B93A 4H6JB 4P6ZM 3OC2A 5DJUA 3R7WA 3C30A 4II7A 2W3HA 2OAP1 1W63Q 1G28A 1S66L 1LSXA 5DFXA 4PHTA 3OCLA 4UQIM 3F1OB 1DP8A 5HDDA 1ZHHB 3MF0A 3UMDA 5HD3A 3LR3A 3IBJA 1D7EA 1H3QA 2W3DA 3F1NB 4NXFA 1LSWA 5IU1A 4KQDA 1N9LA 3S7QA 4EESA 2OWJA 5CX7A 3B42A 4I5SA 2PT7A 1P0ZA 2D02A 3FPVA 3EQVA 1OTDA 2Y79A 1IFQA 2M7UA 5HL6A 2QJ7A 1XJ3A 4BJPA 1OTIA 2GJ3A 4LPZA 5IS1A 3H82A 1NRJA 4EU0A 2W1TB 2M7VA 3C38A 3D3OA 3PXPA 1XFQA 3A0SA 3CAXA 2A24A 3TJZC 5AJGA 2V1BA 2FH5A 3UB6A 3UE6A 5F69A 1S1ZA 3F1PA 2W27A 1D06A 3CITA 1TS0A 2EWWA 1X0OA 2Z6DA 5TBMB 3CWFA 3TE8A 1GSXA 3TW8A 1T1AA 3NOUC 2L1MA 5MC7A 3K2NA 3KO6A 2GNXA 3BY9A 5C5KA 4R3AA 2WKQA 2Z6CA 4MN6A 2EA9A 3O5YA 2VA0A 4EERA 1OJ5A 4JGRA 4Q0IA 4CQHA 4WN5A 2QKPA 5FL3A 2HV1A 3H9WA 3T4SA 5F6AA 4I3JA 3EEAA 3R7WB 3R4KA 3VOLA 2O9CA 3E4OA 4IJGA 3S7NA 4ETXA 3FC7A 1F98A 4MN5A 5I5LA 1OTBA 3PBQA 3PBNA 2W3GA 4GJ4A 3HJIA 3PHYA 3LIEA 2V1AA 3LR4A 1V9ZA 3MR0A 2PR6A 3JVVA 1NLYA 4I3IA 4G3VA 5HPIA 4QPRA 2KOIA 2Y8HA 3S7PA 1YAXA 4Z1WA 1UGUA 3EEHA 2D01A 2B02A 3KX0X 2J80A 2CMNA 3K3DA 3CI6A 3CUEA 3UB9A 4MN7A 4O01A 3H82B 4EW7A 4BBTA 5AVFA 3W2ZA 3EOIA 5DKKA 2QHKA 2QYBA 4IUHA 4JGPA 5HWTA 2A24B 5J4EA 3UB7A 3C2WA 3HCYA 2ZOIA 3P01A 5K5BA 3F1PB 2EWVA 1MKMA 3KSFA 3NOPC 5DFYA 1TF1A 3FG8A 4EETB 4L9EA 2PR5A 2WKPA 2R78A 4HH3A 1S4SA 3ZQ5A 3BWLA 5AVEA 1XJ6A 1BYWA 1S4RA 2IA2A 2GX5A 4MDZA 2VGLM 2LB5A 3U2AA 2W3FA 3PR6A 4JGQA 2VKSA 4NKPA 4OOMA 5HWVA 2H28A 2J3TD 4HH2A 5KSHA 3LICA 4HP9A 1S67L 2HGVA 4KUKA 4RQ9A 1OTAA 1DP6A 1P9RA 4HIAA 1VHMA 5HWWA 2W0NA 4WF0A 1OPXA 4DJ2A 2XSSA 2XRNA 3VE3A 2ZBBA 3LFVA 3LR5A 4NXBA 4JGOA 4EEPA 2INWA 5HDSA 5DF9A 1KOUA 2NUPC 3TRCA 4Q0JA 3KYQA 4GHIA 1YKDA 2O9AA 1NLZA 3E98A 4ARZA 5G4YA 3T4TA 1LL8A 4O0PA 5L8MA 3IBRA 2O9BA 3PYPA 1OT9A 4XT2A 4IHQA 2YKHA 2VGLS 4UEYA 3PBOA 2V9AA 3KSIA 1ODVA 4CLCD 4HJ6A 4NEED 2A2LA 1XJ4A 3A0RA 2PD7A 3CLOA 2K7SA 4AFIA 2GZAA 3CUEC 4CLCA 3OLOA 4NXEA 1W63M 5F68A 3OCNA 4R70A 3MXQA 4MMNA 2M1CA 1UWNX 3D72A 4Q0HA 4Y2FA 5A8BA 4IUKA 2KDKA 3LYXA 2K2NA 1ZTUA 2VZWA 2DMWA 4EQ1A 1N9NA 1P9WA 3B33A 4F3LA 2PD8A 1GSVA 3T4JA 2ZOHA 4WL9A 1S1YA 2WKRA 3GECA 4HOIA 4K08A 4YOFA 4PKYG 2VV7A 2JKRI 4FOFA 2HJ9C 3OBFA 3IS2A 3VE4A 3NOTC 2VEAA 2V0UA 2W3EA 1LSVA 1T1BA 2VX8A 4BBUA 4HNBA 3MQ0A 2KX6A 3ZYTA 5EFWA 4HJ3A 2B18A 5G4ZA 3BQAA 3UE3A 2ZMVA 4WELA 4HHDA 4MCWA 1F9IA 1YSQA 2J3TC 5HSQA 2PYPA 4L0LA 1DP9A 4HY8A 4LRXC 5F5YA 3T4KA 4GS9A 1OT6A 1P97A 2YKFA 3RH8B 3FPWA 4GHIB 4CLCE 1Y28A 2L0WA 4M4XA 4WEJA 3GDIA 4O8GA 4ARZB 3MJQA 2L4RA 1UWPX 2OOLA 2XA7S 3P7NA 4L9GA 3ULFA 3LI9A 2VLGA 2LB9A 2JKTI 3MMHA 3UMEA 3PBSA 4EXOA 4I38A 5IT5A 3LR0A 1TS8A 3V67A 4XT2B 1MC0A 2MJ6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LT0 A;  3K3C A;  1NWZ A;  5KIZ A;  3SW1 A;  3H7W A;  3UB8 A;  3ICY A;  3E4P A;  3LIB A;  1VB6 A;  5J7E A;  1MZU A;  4GW9 A;  2BAS A;  5HZH A;  2JHE A;  1TS6 A;  3HJK A;  4WUJ A;  1XJ2 A;  4LLO B;  4LRZ E;  1JNU A;  4B9O A;  3LIA A;  4HJ4 A;  1T1C A;  1XFN A;  4I39 A;  4H6J A;  5J3W A;  4F3L B;  2JN7 A;  2PDR A;  2PHY A;  3LUQ A;  3E4Q A;  1V9Y A;  1WA9 A;  4PKY A;  5HDC A;  1TS7 A;  3IS2 B;  2V0W A;  1OJG A;  2QWS A;  4HP4 A;  3F1O A;  4HI4 A;  1DRM A;  2I9V A;  3F1N A;  4EEU A;  5DJT A;  5DKL A;  1N9O A;  4I3A A;  4GS9 B;  3LID A;  1EW0 A;  2QJ5 A;  4HQA A;  3G6O A;  4LRY C;  2VV6 A;  3A0V A;  4BBV A;  3T50 A;  4NXG A;  2OWH A;  3MQQ A;  4R6L A;  3EWK A;  4R38 A;  3NHQ A;  4YWZ A;  3MQO A;  3LIF A;  2P7J A;  3LI8 A;  2VV8 A;  1OTE A;  4KUO A;  4L9F A;  3C8C A;  4WLA A;  5TBM A;  3H7W B;  3NJA A;  4E04 A;  4DJ3 A;  3RTY A;  3BY8 A;  3MFX A;  1T18 A;  5HD5 A;  1T19 A;  4GCZ A;  1GSW A;  2PYR A;  4H6J B;  5DJU A;  1G28 A;  1S66 L;  1LSX A;  3F1O B;  1DP8 A;  5HDD A;  3UMD A;  5HD3 A;  1D7E A;  3F1N B;  4NXF A;  1LSW A;  5IU1 A;  4KQD A;  1N9L A;  4EES A;  2OWJ A;  4I5S A;  1P0Z A;  2D02 A;  1OTD A;  2QJ7 A;  1XJ3 A;  1OTI A;  2GJ3 A;  4LPZ A;  5IS1 A;  3H82 A;  1XFQ A;  3A0S A;  3CAX A;  2A24 A;  2V1B A;  3UB6 A;  3UE6 A;  5F69 A;  1S1Z A;  3F1P A;  2W27 A;  1D06 A;  1TS0 A;  1X0O A;  2Z6D A;  5TBM B;  3CWF A;  1GSX A;  1T1A A;  3NOU C;  2L1M A;  3BY9 A;  4R3A A;  2WKQ A;  2Z6C A;  4MN6 A;  2EA9 A;  4EER A;  1OJ5 A;  4JGR A;  4WN5 A;  2QKP A;  2HV1 A;  3H9W A;  5F6A A;  4I3J A;  3VOL A;  3E4O A;  3FC7 A;  1F98 A;  4MN5 A;  5I5L A;  1OTB A;  3HJI A;  3PHY A;  3LIE A;  2V1A A;  1V9Z A;  3MR0 A;  2PR6 A;  4I3I A;  1UGU A;  3EEH A;  2D01 A;  2B02 A;  3KX0 X;  2J80 A;  2CMN A;  3K3D A;  3UB9 A;  3H82 B;  4EW7 A;  4BBT A;  5AVF A;  5DKK A;  5HWT A;  2QHK A;  4JGP A;  2A24 B;  5J4E A;  3UB7 A;  3C2W A;  2ZOI A;  3F1P B;  3NOP C;  3FG8 A;  4EET B;  4L9E A;  2PR5 A;  2WKP A;  2R78 A;  4HH3 A;  1S4S A;  3ZQ5 A;  3BWL A;  5AVE A;  1XJ6 A;  1BYW A;  1S4R A;  4JGQ A;  5HWV A;  2H28 A;  4HH2 A;  3LIC A;  4HP9 A;  1S67 L;  4KUK A;  4RQ9 A;  1OTA A;  1DP6 A;  4HIA A;  5HWW A;  2W0N A;  4WF0 A;  4DJ2 A;  3VE3 A;  2ZBB A;  4NXB A;  4JGO A;  4EEP A;  2INW A;  5HDS A;  1KOU A;  4GHI A;  5G4Y A;  1LL8 A;  3IBR A;  3PYP A;  1OT9 A;  4XT2 A;  2YKH A;  2V9A A;  1ODV A;  4HJ6 A;  1XJ4 A;  3A0R A;  2PD7 A;  3CLO A;  2K7S A;  3OLO A;  4NXE A;  5F68 A;  4R70 A;  3MXQ A;  2M1C A;  1UWN X;  3D72 A;  5A8B A;  2KDK A;  3LYX A;  4EQ1 A;  1N9N A;  3B33 A;  4F3L A;  2PD8 A;  1GSV A;  2ZOH A;  4WL9 A;  1S1Y A;  2WKR A;  3GEC A;  4HOI A;  4K08 A;  4PKY G;  2VV7 A;  3IS2 A;  3VE4 A;  3NOT C;  2VEA A;  2V0U A;  1LSV A;  1T1B A;  4BBU A;  4HNB A;  2KX6 A;  5EFW A;  4HJ3 A;  5G4Z A;  4HHD A;  1F9I A;  5HSQ A;  2PYP A;  1DP9 A;  4HY8 A;  4LRX C;  5F5Y A;  4GS9 A;  1OT6 A;  1P97 A;  2YKF A;  3RH8 B;  4GHI B;  1Y28 A;  2L0W A;  4M4X A;  3GDI A;  3MJQ A;  2L4R A;  1UWP X;  3ULF A;  2OOL A;  3P7N A;  4L9G A;  3LI9 A;  2VLG A;  3UME A;  4EXO A;  4I38 A;  1TS8 A;  4XT2 B; 
#chains in the Genus database with same CATH topology
 3UPO A;  1FIL A;  4X56 A;  3RFB A;  4DKI A;  1ACF A;  4WZ5 C;  1MZU A;  4K0W A;  3T4L A;  1N4O A;  3UE0 A;  5I94 A;  2O99 A;  4P85 A;  1HVB A;  1XJ2 A;  3HLW A;  4ME4 A;  2NUT C;  4B9O A;  3LIA A;  3AGD A;  1XX2 A;  1T1C A;  1XKZ A;  2OAQ 1;  3IWQ A;  3ZVW A;  2JN7 A;  2PDR A;  5EUA A;  4PM9 A;  3LUQ A;  5EVL A;  1I2S A;  1V9Y A;  3HBR A;  4GD6 A;  3DWK A;  2Y2O A;  3S7O A;  3F1O A;  2P08 A;  4Y3I A;  3F1N A;  3HUM A;  2HDU A;  3KSH A;  4DMZ A;  1C3B A;  3HLC A;  1JWV A;  3UDI A;  5HFO A;  4I3A A;  3QNB A;  1KGE A;  5FQJ A;  5FEF A;  4IVK A;  5LBR A;  4NXG A;  4XUZ A;  3MQQ A;  2W1T A;  1LL5 A;  4R38 A;  4KZ7 A;  4YWZ A;  2W1R A;  2VGK A;  3VP4 A;  2XFT A;  4P0M A;  1GHM A;  2P7J A;  3OPR A;  1J3W A;  4G3K A;  2WYX A;  4MBF A;  3SZT A;  5CRF A;  3ITB A;  3C8C A;  2JKT M;  1PNE A;  2HP5 A;  1MWR A;  1IYQ A;  3VV4 A;  2EFU A;  4DDY A;  1CI9 A;  4DJ3 A;  3V39 A;  3BY8 A;  4UHU A;  1STZ A;  3MFX A;  1T18 A;  3GR2 A;  1T19 A;  4OQH A;  4GDN A;  1L0E A;  1GSW A;  5DJU A;  4S2N A;  2W3H A;  2OAP 1;  3MXS A;  1W63 Q;  3LGO A;  3UE1 A;  1D1J A;  5DFX A;  1N9B A;  1KGF A;  2IWB A;  4KG6 A;  4WZ4 A;  3UMD A;  1ONH A;  1SZV A;  3IBJ A;  2W3D A;  4NET A;  3JPU A;  5L10 A;  4N1H A;  1N9L A;  2ZD8 A;  3HVF A;  4A5R A;  2V2F F;  2WAD A;  5FAT A;  3FPV A;  4QY6 A;  5FQK A;  4Y15 A;  2VGJ A;  2QJ7 A;  4R3B A;  4LPZ A;  2OLU A;  1CQA A;  1EI5 A;  3D3O A;  3TJZ C;  1PI5 A;  1IKG A;  1YT4 A;  3UE6 A;  1S1Z A;  2W27 A;  2V20 A;  1W5D A;  3CWF A;  1GSX A;  3NOU C;  3K2N A;  4JF6 A;  2GNX A;  3BY9 A;  4UA9 A;  4GDB A;  3GSG A;  5FA7 A;  1RP5 A;  2VA0 A;  2WKE A;  1ES4 A;  3IF6 C;  4XUX A;  4WN5 A;  5FL3 A;  1K55 C;  2HV1 A;  3IXH A;  3T1S A;  3BFF A;  3O3V A;  4KZ9 A;  3NEC A;  5F6A A;  1MWU A;  2Y55 A;  4LCL A;  3R7W B;  4FCF A;  4OQG A;  3KYE A;  2XEP A;  3BFC A;  2O9C A;  1U60 A;  3FC7 A;  1F98 A;  2IWD A;  5BOH A;  1OTB A;  3PHY A;  5GHX A;  2PR6 A;  1JWP A;  4I3I A;  4G3V A;  4QPR A;  2C5W B;  1YAX A;  3CJM A;  3C4P A;  1VET A;  1XXM A;  2CMN A;  4H8R A;  2PU2 A;  5L2F A;  1GA0 A;  3K3D A;  3QP8 A;  4GOG A;  4WYY A;  4OQ0 A;  4DE1 A;  4JGP A;  2A24 B;  5J4E A;  3C2W A;  5HW3 A;  2ZQ7 A;  4PM6 A;  5GL9 A;  2EWV A;  5DFY A;  4EET B;  4L9E A;  2PR5 A;  4HH3 A;  3BWL A;  5AVE A;  1XJ6 A;  1H5X A;  3MZF A;  1BYW A;  2ZL1 B;  3Q7V B;  2LB5 A;  5EVE A;  4NKP A;  4OOM A;  5HWV A;  4EBP A;  1KE0 A;  3PTE A;  1FR1 A;  1LL9 A;  1QME A;  4WBG A;  3A3D A;  4EBL A;  1YLJ A;  2WGW A;  4RQ9 A;  1P9R A;  3Q1F A;  4KZ6 A;  3HL9 A;  5F1G A;  5AQB A;  4DJ2 A;  2XSS A;  1J9M A;  2HDQ A;  3MKE A;  3VE3 A;  3LFV A;  4YFM A;  4EEP A;  3VP2 A;  1KOU A;  3FKW A;  4Y0U A;  4PM7 A;  2PBD P;  3ZDJ A;  1NLZ A;  3CPT B;  1BZA A;  2Y91 A;  1O7E A;  3FV7 A;  4O0P A;  4UA7 A;  4IHQ A;  1JVJ A;  5E2G A;  4CLC D;  5EVI B;  4AFI A;  4CLC A;  1HD8 A;  3OLO A;  4NXE A;  1I5Q A;  2M1C A;  2Y2J A;  2ZM0 A;  5KSC A;  3BEC A;  5A8B A;  3RJU A;  1O07 A;  1LI0 A;  4GD8 A;  1CJF A;  5FI7 A;  2BLS A;  1LI9 A;  5FDS A;  2Y4A A;  1OME A;  3TOI A;  2J9P A;  3T4J A;  3GEC A;  2VV7 A;  2HJ9 C;  3OBF A;  3IS2 A;  3VE4 A;  2PU4 A;  3WWX A;  5CTN A;  2W3E A;  1LSV A;  1ZG4 A;  4HNB A;  4OP5 A;  1IYP A;  2ZC6 B;  3LY4 A;  2WKI A;  1YSQ A;  3CG5 A;  1DP9 A;  1A0K A;  1OT6 A;  1BLH A;  1P97 A;  1MXO A;  4WEJ A;  3GDI A;  3MJQ A;  4R23 A;  2L4R A;  2OOL A;  2CC1 A;  4E6X A;  2PBY A;  1CEG A;  1XA7 A;  5HAP A;  2LB9 A;  2JKT I;  3MMH A;  4EXO A;  5IT5 A;  1MC0 A;  4ZJ3 A;  3A3J A;  1F5M A;  3MZE A;  1LT0 A;  3K3C A;  2X02 A;  1NWZ A;  4Y13 A;  3PAG A;  3T4O A;  1BUL A;  3UB8 A;  3E4P A;  3LIB A;  3V5M A;  5GLC A;  1K38 A;  2JHE A;  4LV3 A;  4WUJ A;  3N7W A;  1MY8 A;  3C5A A;  2XD1 A;  3B3X A;  1HTZ A;  3SOI A;  3DTI A;  2JKG A;  1XFN A;  4I39 A;  3DWZ A;  3EGD C;  3E2L A;  3KYZ A;  2PHY A;  1ZG6 A;  4GNU A;  3FWL A;  3E4Q A;  1WA9 A;  3OZH A;  2V0W A;  1RGZ A;  4DN0 A;  3LY3 A;  2J3W A;  1TVF A;  4HP4 A;  4R4S A;  2I9V A;  2K31 A;  2JKR M;  4UQI S;  4MBK A;  1IOU A;  4X1L A;  2XFS A;  4F94 A;  2Y2I A;  1Q2P A;  2VJW A;  2WUQ A;  3G34 A;  5TJJ A;  4EUV A;  4OLG A;  4GS9 B;  3HUO A;  1EW0 A;  3G6O A;  4LRY C;  5TGF A;  3TSG A;  3A0V A;  4BBV A;  3T50 A;  5A92 A;  1PYY A;  4R6L A;  3EWK A;  4FSF A;  2WZZ A;  4X55 A;  4OPZ A;  2I72 A;  2Y2Q A;  2FZ0 A;  4IVI A;  1FCN A;  3BJN A;  5AQ9 A;  3LI8 A;  4DXB A;  4YIN A;  1L0F A;  2HJE A;  3BFE A;  4ETZ A;  1ES2 A;  3KSG A;  2G7U A;  3IWI A;  4HEF A;  1VEU A;  3E0Y A;  1FCO A;  3SH8 A;  3BW6 A;  1K4E A;  1W7F A;  5F1F A;  1S0W A;  1YSP A;  5U47 A;  3VP1 A;  3EQU A;  3FKV A;  4PM8 A;  3VP3 A;  5CHM A;  2PYR A;  4B93 A;  4QHC A;  3OC2 A;  4X6T A;  3C30 A;  4II7 A;  1G28 A;  3BLM A;  4X69 A;  3OCL A;  4JPM A;  4UQI M;  1L2S A;  3F1O B;  1DP8 A;  5HDD A;  4DE3 A;  1ZHH B;  4FUW A;  3AGF A;  3MF0 A;  5HD3 A;  3G35 A;  1D7E A;  3F1N B;  4NXF A;  1XGJ A;  1LSW A;  1YLP A;  4KQD A;  3BYD A;  2IWC A;  4I5S A;  2PT7 A;  2D02 A;  4KZ8 A;  3EQV A;  2Y2L A;  1IFQ A;  4JXW A;  2JKF A;  5HL6 A;  4BJP A;  2HDS A;  2EXB A;  3H82 A;  1NRJ A;  1PWC A;  4BLM A;  2W1T B;  2M7V A;  3C38 A;  3PXP A;  4WMC D;  1K57 A;  4BEN A;  3O86 A;  5AJG A;  1MWS A;  4FTX A;  5F69 A;  1ALQ A;  2C6W B;  1BLP A;  1W8Y A;  3L9K A;  4WMC A;  2H0T A;  3CIT A;  1K6S A;  3HLD A;  1SCW A;  1PRQ A;  4DRT A;  3TW8 A;  1T1A A;  2L1M A;  2Z6C A;  3GTC A;  1EWZ A;  3O5Y A;  4KG2 A;  2QKP A;  5M18 A;  2XGN A;  2HZ5 A;  3ITA A;  4I3J A;  3JYI A;  1NRF A;  2EX6 A;  3R4K A;  1CK3 A;  1YLT A;  3IHB A;  5HX9 A;  2XD5 A;  3W4O A;  4HBU A;  3E4O A;  4ETX A;  4KZ5 A;  4MN5 A;  1NY0 A;  4JLF A;  5I5L A;  3PBQ A;  4UAA A;  2H10 A;  4GJ4 A;  3MS6 A;  3TG9 A;  1M40 A;  3S1Y A;  3LIE A;  1H8Z A;  2P74 A;  3LR4 A;  1V9Z A;  1ERO A;  3JVV A;  4DE2 A;  4PPR A;  2Y8H A;  3QP6 A;  3ZNY A;  5DF8 A;  2D01 A;  3ZG7 B;  3N6I A;  2J80 A;  3UPP A;  3CI6 A;  3CUE A;  3UB9 A;  4MN7 A;  1SKO A;  4O01 A;  2BG1 A;  4EW7 A;  2Y2M A;  3NUL A;  4EUZ A;  5DKK A;  2QHK A;  3MSH A;  3UB7 A;  1TDL A;  3HCY A;  2J7V A;  1MKM A;  1K54 C;  3FG8 A;  4OKP A;  2JC7 A;  3ZQ5 A;  3RXW A;  3NY4 A;  2OLV A;  3ZCZ A;  2GX5 A;  1PI4 A;  4ZJ1 A;  4RX2 A;  4BQM A;  3IX4 A;  2Q9M A;  4JGQ A;  3M6B A;  1K0K A;  2ZQD A;  2J3T D;  1YLW A;  1K56 D;  4E3O A;  4KZA A;  1DJA A;  4KUK A;  1OTA A;  4HIA A;  5HWW A;  2W0N A;  1K56 A;  3NIA A;  2DCF A;  5CHJ A;  3ZGA B;  5FEG A;  2INW A;  4FH4 A;  1JTD A;  5HDS A;  2OSU A;  4DDS A;  4GHI A;  5HAR A;  5GHZ A;  3ZG8 B;  3WS4 A;  3N4I A;  3ISG A;  1VET B;  1W8Q A;  3IXG A;  1OT9 A;  4CJN A;  3P09 A;  4XT2 A;  4N1X A;  4GKU A;  3GMW A;  3T1R A;  3Q82 A;  3LCE A;  4WZ5 A;  1XA1 A;  4HJ6 A;  1SDE A;  4NEE D;  2A2L A;  3QP1 A;  3GRJ A;  2HP6 A;  1NZO A;  2GZA A;  4MBH A;  4MNR A;  3FZC A;  2HPB A;  1FCM A;  3SS5 A;  5EVI C;  1TDG A;  5E43 A;  1UWN X;  4QY5 A;  1SDN A;  3V3S A;  1WE4 A;  4Y2F A;  4B4X A;  4IUK A;  1IYS A;  1PFL A;  2DMW A;  5D3O A;  3B33 A;  4F3L A;  1GSV A;  4WL9 A;  1S1Y A;  4CPK A;  2JCH A;  4PKY G;  4N9K A;  2JKR I;  5GHY A;  4N9L A;  5EM0 A;  3NOT C;  2WGW B;  1FOF A;  2V0U A;  5FAP A;  5CGS A;  4S2J A;  2EXA A;  4HJ3 A;  2B18 A;  3LO7 A;  1GCE A;  3G2Z A;  1CF0 A;  4WEL A;  4HHD A;  4MCW A;  4S2M A;  2PYP A;  1XP4 A;  4HY8 A;  4LRX C;  1BSG A;  3M2J A;  2A49 A;  3RH8 B;  4Q8I A;  1IYO A;  1XPB A;  4LV1 A;  1XGI A;  2P9V A;  4E3L A;  4QU3 A;  3UME A;  3PBS A;  4I38 A;  1YQS A;  4NG2 A;  4HBT A;  3M2K A;  5EEC A;  5KIZ A;  3SW1 A;  1BTL A;  3H7W A;  3ICY A;  4CLC B;  1G6A A;  1W79 A;  4S2K A;  1VB6 A;  5J7E A;  1NXY A;  2BAS A;  2O0Y A;  4U0T A;  4Y0O A;  3HJK A;  3GVB A;  4LRZ E;  5FQ9 A;  4G3W A;  2V8C A;  3DBA A;  3S22 A;  1NYY A;  2XR0 A;  3PBT A;  3GV9 A;  2PRF A;  1ZKJ A;  4H6J A;  5J3W A;  5EOE A;  2H5S A;  2X01 A;  1JTG A;  2QZ6 A;  4RYE A;  3IS2 B;  2ZMF A;  4P6Z S;  4OQI A;  5CHU A;  3Q7Z A;  4LFU A;  2B95 A;  3D9Y A;  3UO9 A;  2QWS A;  5CXW A;  2HF6 A;  4HI4 A;  1DRM A;  4C75 A;  3WS1 A;  2Y59 A;  3WS2 A;  4EEU A;  3BQ8 A;  4ZRR A;  2XRO A;  5DJT A;  1N9O A;  3AGE A;  3OOV A;  3EGX C;  1YLY A;  3LID A;  4DXC A;  5HPF A;  4HQA A;  5AQA A;  4ZTK A;  4S2P A;  4KQR A;  1IEM A;  2VV6 A;  1F2K A;  2OWH A;  3ZNT A;  1KE3 A;  5EV0 A;  3MQO A;  2UWX A;  3T4Q A;  1GHI A;  4WEK A;  3LIF A;  1BLC A;  2XH9 A;  1OTE A;  3UN7 A;  1I2W A;  4Y5F A;  4WLA A;  5TBM A;  4YNR A;  1SKF A;  3UDX A;  3NJA A;  3SH7 A;  3IF6 A;  4E04 A;  4OOL A;  3ZG9 B;  1K55 A;  3RTY A;  4Y7P A;  3IH8 A;  2Y2G A;  3ZFZ A;  2R9W A;  4GCZ A;  3Q07 A;  3SS4 A;  1Y54 A;  4QD4 A;  3HRE A;  4P6Z M;  4ESP A;  3LEQ A;  1S66 L;  4ZAM A;  1K4F A;  1DJC A;  3IX3 A;  4LV0 A;  4X68 A;  4RVA A;  3NDG A;  1NZU A;  3LR3 A;  4P87 A;  3ZVT A;  5FAO A;  1DJB A;  4JXG A;  5GLD A;  5IU1 A;  3S7Q A;  4EES A;  1E4D A;  3B42 A;  4XXR A;  3W8K A;  1P0Z A;  3G31 A;  4S2I A;  2Y79 A;  5EE8 A;  3HLB A;  2M7U A;  1FIK A;  4Y0T A;  1YLZ A;  1XJ3 A;  1OTI A;  5IS1 A;  3N8S A;  2ZQ9 A;  4OPY A;  3T12 B;  3IX8 A;  1PWG A;  5M19 A;  1JWZ A;  1XFQ A;  3A0S A;  3DTM A;  3CAX A;  3VP0 A;  3ZG0 A;  4GN2 A;  2FH5 A;  3UB6 A;  3F1P A;  3T1Q B;  1X0O A;  3TE8 A;  1VEU B;  3G32 A;  4JKT A;  5MC7 A;  5C5K A;  4R3A A;  2WKQ A;  4PMA A;  4MN6 A;  4GZB A;  1S6R A;  3OPH A;  1OJ5 A;  1E25 A;  3IXB A;  4JF4 A;  1IEL A;  3CMZ A;  3H9W A;  3T4S A;  1IKI A;  3SH9 A;  5E2E A;  2Y2H A;  4LV2 A;  2AVX A;  1YPR A;  4IJG A;  3Q81 A;  2JBF A;  5G18 A;  5E2H A;  5FI2 A;  3VFF A;  3PBN A;  4S2N C;  4BL2 A;  3ZHH A;  1PWD A;  1NLY A;  3WS5 A;  4Z9Q A;  2Q0O A;  2QPN A;  4Z1W A;  4LEN A;  3WS0 A;  1Q2Q A;  2B02 A;  3KX0 X;  3UDF A;  4IED A;  5DTK A;  3H82 B;  3RXX A;  1E3U D;  1YMS A;  1ESI A;  3IQA A;  3W2Z A;  5L09 A;  3EOI A;  4LCM A;  2QYB A;  5HWT A;  1E3U A;  1BT5 A;  5K5B A;  2XDM A;  1K6R A;  5FQI A;  3KSF A;  3NOP C;  1TF1 A;  1KE4 A;  2J8Y A;  3V3R A;  4HES A;  5FAQ A;  4MDZ A;  2VGL M;  4OLD A;  4K0X A;  2ZM8 A;  2ZLY A;  2VKS A;  2QMI A;  5F82 A;  3QHY A;  1FQG A;  4HH2 A;  3W4Q A;  5KSH A;  1TEM A;  1DP6 A;  3IHA A;  2WKH A;  3N8R A;  4WF0 A;  5TR7 A;  3I7J A;  3GQZ A;  5FSR A;  1MWT A;  3NCK A;  3D4F A;  2WK0 A;  3VOZ A;  3UB5 P;  5DF9 A;  2NUP C;  4Q0J A;  3E2K A;  3KYQ A;  2G2W A;  4E6W A;  1YKD A;  3VSL A;  3LEZ A;  4ARZ A;  4FH2 A;  5L8M A;  2O9B A;  3PYP A;  2HP9 A;  1DY6 A;  1YMX A;  1FSW A;  1ODV A;  1SKO B;  1H8Y A;  1XJ4 A;  3A0R A;  2PD7 A;  5EOO A;  3CLO A;  2K7S A;  1NJ4 A;  1WYC A;  3BEB A;  3PAE A;  5F68 A;  4KZ4 A;  4R70 A;  3MXQ A;  4MMN A;  3MZD A;  2DRW A;  4ZBE A;  5DVA A;  3DAV A;  3D72 A;  4Q0H A;  3QP5 A;  4S2L A;  2KDK A;  2K2N A;  1H0M A;  5CED A;  2G2U A;  1N9N A;  1RGY A;  2DNS A;  2PD8 A;  4EV4 A;  2ZOH A;  4HOI A;  4K08 A;  3NDE A;  5FQM A;  4ZDX A;  2VEA A;  4MEZ A;  1ERQ A;  1T1B A;  2VX8 A;  2Z2L B;  2ZJ9 A;  3MQ0 A;  2KX6 A;  5EFW A;  2ACG A;  1SHV A;  3UE3 A;  1KDS A;  2VK3 A;  3UPN A;  3L7H A;  1AWI A;  5F5Y A;  1HZO A;  2YKF A;  3QP4 A;  3BFD A;  1NYM A;  1PIO A;  4GHI B;  1Y28 A;  2L0W A;  4M4X A;  4O8G A;  3P7N A;  1UWP X;  2R9X A;  2XA7 S;  1L0D A;  2VLG A;  2E8I A;  2HDR A;  3V67 A;  4XT2 B;  2MJ6 A;  2FFF B;  1AXB A;  3HLF A;  5GLA A;  4R4R A;  1MPL A;  2WAE A;  4BL3 A;  3UNW A;  3JVU A;  4BWI A;  4QWO A;  4GW9 A;  4BD1 A;  5HZH A;  1TS6 A;  4EQI A;  4KQO A;  4LLO B;  1JNU A;  4CLC C;  3PBR A;  4HJ4 A;  1H8M A;  3O87 A;  4GLQ A;  4F3L B;  2P04 A;  1VQQ A;  1CEF A;  1PZP A;  2ZC5 B;  4PKY A;  5HDC A;  1TS7 A;  1G6O A;  1OJG A;  2GDN A;  5JYO A;  4PM5 A;  1ONG A;  5A93 A;  3DW0 A;  2ZQA A;  2A3U A;  5DKL A;  5FQQ A;  3NBL A;  3VOY A;  1FSY A;  1Z6F A;  5FI6 A;  2QJ5 A;  1MKI A;  2XA7 M;  4B88 A;  1BLS A;  2KLI A;  3U4L P;  4OPR A;  2ZMA A;  5A90 A;  3VSK A;  2P9V B;  4NK3 A;  1TD5 A;  4E3M A;  2Y2N A;  3NHQ A;  4D2O A;  4GB7 A;  4BMW A;  4MLL A;  3G30 A;  2EFX A;  1KVM A;  2Y2P A;  1L0G A;  2XF3 A;  2VV8 A;  3B47 A;  4WM9 A;  4JF5 A;  5FDH A;  3ZG5 A;  4KUO A;  4L9F A;  3S4X A;  3H7W B;  5DTS A;  1ERM A;  2ZC4 B;  3WRT A;  4PAU A;  2V1Z A;  5AQ7 A;  2ZQ8 A;  4KQQ A;  1KGG A;  4U3T A;  5A91 A;  5HD5 A;  3VFH A;  4IBX A;  1PW1 A;  3HUN A;  4H6J B;  2UV0 E;  4OH0 A;  3C7U A;  1KDW A;  3BM6 A;  3R7W A;  2Y2K A;  3MXR A;  1LSX A;  4X1M A;  3FYZ A;  4RX3 A;  5FAS A;  4PHT A;  3O88 A;  4QJG A;  3HLG A;  1HLU P;  1H3Q A;  4BD0 A;  3IT9 A;  2OWJ A;  3N8L A;  5CX7 A;  4UA6 A;  1GHP A;  5HAQ A;  1OTD A;  2BTF P;  1G68 A;  2E8J A;  5CEC A;  5GLB A;  2GJ3 A;  1MBL A;  3A3F A;  3QP2 A;  4EU0 A;  2B5R A;  3G2Y A;  5CEB A;  1K54 A;  2A24 A;  2V1B A;  1PZO A;  4OVD A;  5EM1 A;  3MKF A;  4QB8 A;  1D06 A;  1TS0 A;  2EWW A;  2Z6D A;  5TBM B;  3W4P A;  1LLB A;  4KG5 A;  2EX8 A;  2XQZ A;  3IF6 B;  2ZL1 A;  3KO6 A;  3Q7V A;  4OON A;  1L3L A;  2EA9 A;  4EER A;  2FFY A;  5DTT A;  4JGR A;  4Q0I A;  4CQH A;  2WGI A;  3IF5 A;  3QNC A;  5E2F A;  4R3J A;  1QMF A;  1KVL A;  3SS3 A;  3EEA A;  3T1X A;  4M3K A;  3VOL A;  4ID4 A;  3S7N A;  5DF7 A;  1ESU A;  2W3G A;  3HJI A;  4C3Q A;  3M6H A;  2V1A A;  4O7D A;  3MR0 A;  4E3I A;  3VMA A;  5HPI A;  3C4O A;  3CPT A;  2KOI A;  4R1G A;  3S7P A;  1GA9 A;  3A3E A;  3CZD A;  3BLS A;  4P6B A;  1UGU A;  3A3I A;  3EEH A;  5EVI D;  1ZC2 A;  2X71 A;  1BUE A;  5EVI A;  5CTM A;  4BBT A;  5AVF A;  4IUH A;  1PW8 A;  5J8X A;  5KMW A;  3WRZ A;  5JYP A;  2ZOI A;  3P01 A;  2ZM2 A;  3F1P B;  2RL3 A;  4JXV A;  2XLN A;  1K25 A;  1K57 C;  4OOY A;  2WKP A;  2R78 A;  1S4S A;  2WGV A;  1S4R A;  2IA2 A;  5CGX A;  5HAI A;  3NC8 A;  3NI9 A;  4S2O A;  3U2A A;  2W3F A;  3PR6 A;  5CGW A;  3IXD A;  4JBF A;  2EX9 A;  2JE5 A;  1FR6 A;  2H0Y A;  2H28 A;  3LIC A;  3MBZ A;  2RCX A;  4HP9 A;  1S67 L;  2HGV A;  2WZX A;  1ES3 A;  1VHM A;  4JXS A;  2V8F A;  3UY6 A;  3C7V A;  1OPX A;  2XRN A;  2ZBB A;  3LR5 A;  1M6K A;  3IH9 A;  4KZ3 A;  4NXB A;  4Y17 A;  4JGO A;  4D60 A;  3OPL A;  2J9O A;  4LGW A;  3DTE A;  3TRC A;  2O9A A;  3E98 A;  3MFD A;  4OP8 A;  3HLE A;  3CHW P;  5G4Y A;  3T4T A;  4C6Y A;  1LL8 A;  4X53 A;  3IBR A;  1WYB A;  2ZQC A;  5KZH A;  1G5U A;  2YKH A;  2VGL S;  4UEY A;  1LHY A;  3PBO A;  1CI8 A;  2V9A A;  3KSI A;  4ZJ2 A;  4E3J A;  2Z2M B;  5HL1 A;  4IBR A;  3CUE C;  2EX2 A;  5M1A A;  4KZB A;  1YM1 A;  1W63 M;  4B4Z A;  3OCN A;  3OPP A;  2Q9N A;  4FD8 A;  4E3K A;  4KEN B;  1VM1 A;  1ES5 A;  4R0Q A;  3LYX A;  4RA7 A;  1ZTU A;  4N92 A;  2VZW A;  2ZC7 A;  4OPQ A;  4EQ1 A;  4X25 A;  1P9W A;  4DE0 A;  2WKR A;  4E3N A;  4U0X A;  4YOF A;  4FOF A;  3BRM A;  1Z09 A;  2ZC3 B;  5TFQ A;  3DTK A;  3P98 A;  4BBU A;  1RCJ A;  3ZYT A;  3IWO A;  5G4Z A;  1Y4O A;  5L07 A;  4DF6 A;  3BQA A;  2ZMV A;  2OV5 A;  1F9I A;  2J3T C;  5HSQ A;  2XK1 A;  4L0L A;  3T4K A;  4GS9 A;  3G4P A;  3BFG A;  4EWF A;  3FPW A;  4CLC E;  3V50 A;  2PAV P;  4K91 A;  5F83 A;  4ARZ B;  4EBN A;  5IHV A;  3ULF A;  4L9G A;  3LI9 A;  2WAF A;  3LR0 A;  1TS8 A;  5CER A;  5EPH A; 
#chains in the Genus database with same CATH homology
 1F5M A;  1LT0 A;  3K3C A;  1NWZ A;  5KIZ A;  3SW1 A;  3H7W A;  3T4O A;  3UB8 A;  3RFB A;  3ICY A;  3JVU A;  4CLC B;  3E4P A;  4BWI A;  3LIB A;  1VB6 A;  5J7E A;  1MZU A;  4GW9 A;  2BAS A;  3T4L A;  5HZH A;  2O0Y A;  2JHE A;  2O99 A;  1TS6 A;  3HJK A;  4KQO A;  4WUJ A;  1XJ2 A;  4LLO B;  4LRZ E;  4ME4 A;  1JNU A;  2NUT C;  4CLC C;  4B9O A;  4G3W A;  3LIA A;  3DBA A;  3PBR A;  3PBT A;  4HJ4 A;  1T1C A;  1XFN A;  1H8M A;  4I39 A;  2OAQ 1;  3EGD C;  4H6J A;  4GLQ A;  3KYZ A;  5J3W A;  2P04 A;  4F3L B;  2JN7 A;  2PDR A;  2PHY A;  3LUQ A;  3E4Q A;  1V9Y A;  1WA9 A;  4PKY A;  5HDC A;  1TS7 A;  3IS2 B;  2ZMF A;  4P6Z S;  2V0W A;  1G6O A;  4DN0 A;  2J3W A;  1OJG A;  2QWS A;  4HP4 A;  3S7O A;  3F1O A;  2P08 A;  2HF6 A;  4HI4 A;  1DRM A;  2I9V A;  2K31 A;  2JKR M;  4Y3I A;  4UQI S;  3F1N A;  4EEU A;  3BQ8 A;  4ZRR A;  2XRO A;  1IOU A;  3KSH A;  5DJT A;  5DKL A;  4DMZ A;  1N9O A;  2VJW A;  3OOV A;  5TJJ A;  4I3A A;  4EUV A;  3EGX C;  4GS9 B;  3LID A;  1EW0 A;  2QJ5 A;  5HPF A;  2XA7 M;  4HQA A;  2KLI A;  3G6O A;  4LRY C;  2VV6 A;  5LBR A;  3A0V A;  4BBV A;  3T50 A;  4NXG A;  2OWH A;  1TD5 A;  3MQQ A;  2W1T A;  4R6L A;  3EWK A;  4R38 A;  4FSF A;  3NHQ A;  4YWZ A;  2W1R A;  3MQO A;  4BMW A;  3T4Q A;  4WEK A;  3LIF A;  2P7J A;  4G3K A;  2FZ0 A;  3BJN A;  3LI8 A;  2VV8 A;  3B47 A;  1OTE A;  2HJE A;  4KUO A;  4L9F A;  4Y5F A;  3C8C A;  2JKT M;  4WLA A;  5TBM A;  4ETZ A;  3H7W B;  3KSG A;  4YNR A;  2G7U A;  3VV4 A;  3E0Y A;  3NJA A;  4PAU A;  4E04 A;  3BW6 A;  4DJ3 A;  4OOL A;  1YSP A;  3RTY A;  3BY8 A;  3EQU A;  1STZ A;  3MFX A;  1T18 A;  5HD5 A;  1T19 A;  4GCZ A;  1GSW A;  2PYR A;  4B93 A;  4H6J B;  4P6Z M;  3OC2 A;  5DJU A;  3R7W A;  3C30 A;  4II7 A;  2W3H A;  2OAP 1;  1W63 Q;  1G28 A;  1S66 L;  1LSX A;  5DFX A;  4PHT A;  3OCL A;  4UQI M;  3F1O B;  1DP8 A;  5HDD A;  1ZHH B;  3MF0 A;  3UMD A;  5HD3 A;  3LR3 A;  3IBJ A;  1D7E A;  1H3Q A;  2W3D A;  3F1N B;  4NXF A;  1LSW A;  5IU1 A;  4KQD A;  1N9L A;  3S7Q A;  4EES A;  2OWJ A;  5CX7 A;  3B42 A;  4I5S A;  2PT7 A;  1P0Z A;  2D02 A;  3FPV A;  3EQV A;  1OTD A;  2Y79 A;  1IFQ A;  2M7U A;  5HL6 A;  2QJ7 A;  1XJ3 A;  4BJP A;  1OTI A;  2GJ3 A;  4LPZ A;  5IS1 A;  3H82 A;  1NRJ A;  4EU0 A;  2W1T B;  2M7V A;  3C38 A;  3D3O A;  3PXP A;  1XFQ A;  3A0S A;  3CAX A;  2A24 A;  3TJZ C;  5AJG A;  2V1B A;  2FH5 A;  3UB6 A;  3UE6 A;  5F69 A;  1S1Z A;  3F1P A;  2W27 A;  1D06 A;  3CIT A;  1TS0 A;  2EWW A;  1X0O A;  2Z6D A;  5TBM B;  3CWF A;  3TE8 A;  1GSX A;  3TW8 A;  1T1A A;  3NOU C;  2L1M A;  5MC7 A;  3K2N A;  3KO6 A;  2GNX A;  3BY9 A;  5C5K A;  4R3A A;  2WKQ A;  2Z6C A;  4MN6 A;  2EA9 A;  3O5Y A;  2VA0 A;  4EER A;  1OJ5 A;  4JGR A;  4Q0I A;  4CQH A;  4WN5 A;  2QKP A;  5FL3 A;  2HV1 A;  3H9W A;  3T4S A;  5F6A A;  4I3J A;  3EEA A;  3R7W B;  3R4K A;  3VOL A;  2O9C A;  3E4O A;  4IJG A;  3S7N A;  4ETX A;  3FC7 A;  1F98 A;  4MN5 A;  5I5L A;  1OTB A;  3PBQ A;  3PBN A;  2W3G A;  4GJ4 A;  3HJI A;  3PHY A;  3LIE A;  2V1A A;  3LR4 A;  1V9Z A;  3MR0 A;  2PR6 A;  3JVV A;  1NLY A;  4I3I A;  4G3V A;  5HPI A;  4QPR A;  2KOI A;  2Y8H A;  3S7P A;  1YAX A;  4Z1W A;  1UGU A;  3EEH A;  2D01 A;  2B02 A;  3KX0 X;  2J80 A;  2CMN A;  3K3D A;  3CI6 A;  3CUE A;  3UB9 A;  4MN7 A;  4O01 A;  3H82 B;  4EW7 A;  4BBT A;  5AVF A;  3W2Z A;  3EOI A;  5DKK A;  2QHK A;  2QYB A;  4IUH A;  4JGP A;  5HWT A;  2A24 B;  5J4E A;  3UB7 A;  3C2W A;  3HCY A;  2ZOI A;  3P01 A;  5K5B A;  3F1P B;  2EWV A;  1MKM A;  3KSF A;  3NOP C;  5DFY A;  1TF1 A;  3FG8 A;  4EET B;  4L9E A;  2PR5 A;  2WKP A;  2R78 A;  4HH3 A;  1S4S A;  3ZQ5 A;  3BWL A;  5AVE A;  1XJ6 A;  1BYW A;  1S4R A;  2IA2 A;  2GX5 A;  4MDZ A;  2VGL M;  2LB5 A;  3U2A A;  2W3F A;  3PR6 A;  4JGQ A;  2VKS A;  4NKP A;  4OOM A;  5HWV A;  2H28 A;  2J3T D;  4HH2 A;  5KSH A;  3LIC A;  4HP9 A;  1S67 L;  2HGV A;  4KUK A;  4RQ9 A;  1OTA A;  1DP6 A;  1P9R A;  4HIA A;  1VHM A;  5HWW A;  2W0N A;  4WF0 A;  1OPX A;  4DJ2 A;  2XSS A;  2XRN A;  3VE3 A;  2ZBB A;  3LFV A;  3LR5 A;  4NXB A;  4JGO A;  4EEP A;  2INW A;  5HDS A;  5DF9 A;  1KOU A;  2NUP C;  3TRC A;  4Q0J A;  3KYQ A;  4GHI A;  1YKD A;  2O9A A;  1NLZ A;  3E98 A;  4ARZ A;  5G4Y A;  3T4T A;  1LL8 A;  4O0P A;  5L8M A;  3IBR A;  2O9B A;  3PYP A;  1OT9 A;  4XT2 A;  4IHQ A;  2YKH A;  2VGL S;  4UEY A;  3PBO A;  2V9A A;  3KSI A;  1ODV A;  4CLC D;  4HJ6 A;  4NEE D;  2A2L A;  1XJ4 A;  3A0R A;  2PD7 A;  3CLO A;  2K7S A;  4AFI A;  2GZA A;  3CUE C;  4CLC A;  3OLO A;  4NXE A;  1W63 M;  5F68 A;  3OCN A;  4R70 A;  3MXQ A;  4MMN A;  2M1C A;  1UWN X;  3D72 A;  4Q0H A;  4Y2F A;  5A8B A;  4IUK A;  2KDK A;  3LYX A;  2K2N A;  1ZTU A;  2VZW A;  2DMW A;  4EQ1 A;  1N9N A;  1P9W A;  3B33 A;  4F3L A;  2PD8 A;  1GSV A;  3T4J A;  2ZOH A;  4WL9 A;  1S1Y A;  2WKR A;  3GEC A;  4HOI A;  4K08 A;  4YOF A;  4PKY G;  2VV7 A;  2JKR I;  4FOF A;  2HJ9 C;  3OBF A;  3IS2 A;  3VE4 A;  3NOT C;  2VEA A;  2V0U A;  2W3E A;  1LSV A;  1T1B A;  2VX8 A;  4BBU A;  4HNB A;  3MQ0 A;  2KX6 A;  3ZYT A;  5EFW A;  4HJ3 A;  2B18 A;  5G4Z A;  3BQA A;  3UE3 A;  2ZMV A;  4WEL A;  4HHD A;  4MCW A;  1F9I A;  1YSQ A;  2J3T C;  5HSQ A;  2PYP A;  4L0L A;  1DP9 A;  4HY8 A;  4LRX C;  5F5Y A;  3T4K A;  4GS9 A;  1OT6 A;  1P97 A;  2YKF A;  3RH8 B;  3FPW A;  4GHI B;  4CLC E;  1Y28 A;  2L0W A;  4M4X A;  4WEJ A;  3GDI A;  4O8G A;  4ARZ B;  3MJQ A;  2L4R A;  1UWP X;  2OOL A;  2XA7 S;  3P7N A;  4L9G A;  3ULF A;  3LI9 A;  2VLG A;  2LB9 A;  2JKT I;  3MMH A;  3UME A;  3PBS A;  4EXO A;  4I38 A;  5IT5 A;  3LR0 A;  1TS8 A;  3V67 A;  4XT2 B;  1MC0 A;  2MJ6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...