3UE6A

The dark structure of the blue-light photoreceptor aureochrome1 lov
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
135
structure length
135
Chain Sequence
b'EDPDYSLVKALQMAQQNFVITDASLPDNPIVYASRGFLTLTGYSLDQILGRNCRFLQGPETDPRAVDKIRNAITKGVDTSVCLLNYRQDGTTFWNLFFVAGLRDSKGNIVNYVGVQSKVSEDYAKLLVNEQNIEY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Aureochrome1
molecule tags Signaling protein
source organism Vaucheria frigida
publication title Crystal structures of Aureochrome1 LOV suggest new design strategies for optogenetics.
pubmed doi rcsb
total genus 39
structure length 135
sequence length 135
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2011-10-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13426 PAS_9 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3ue6A00
3IBRA 2QKPA 3MJQA 5TBMB 4EXOA 5F68A 2WKPA 3F1OA 5IU1A 3VE4A 4GW9A 4HOIA 5HWWA 3NJAA 4BBTA 3UB9A 1T19A 3LIFA 3VOLA 2OWHA 2PR5A 2OOLA 3HJKA 1OJ5A 4XT2A 4KQDA 4F3LB 1P97A 1UGUA 4I5SA 4KUOA 1S67L 1MZUA 3UMDA 5IS1A 3NHQA 1P0ZA 2D01A 3H7WA 1XJ6A 5DJTA 1XFNA 2VV7A 3CAXA 1Y28A 5G4YA 4R38A 1LSVA 2W27A 5DKLA 1D06A 3LUQA 3FG8A 4WL9A 5HDDA 3ZQ5A 4E04A 2JN7A 5HSQA 2H28A 1LT0A 1S4SA 2I9VA 2QJ7A 2VLGA 1TS6A 3LIEA 4GS9A 4HP9A 1XFQA 4JGRA 5HD5A 2GJ3A 4BBVA 5A8BA 1S4RA 1OTDA 3LIBA 1T1AA 3OLOA 2V0UA 3BWLA 4HH3A 5HDSA 5TBMA 4EW7A 1G28A 1UWPX 2OWJA 4WLAA 3LI9A 4MN5A 3T50A 2M1CA 2V1BA 4EEPA 3NOTC 4HHDA 3CWFA 3LIAA 3RH8B 1S66L 4HJ4A 1N9LA 3A0RA 4HQAA 4I38A 3IS2B 2YKFA 1ODVA 2BASA 4WN5A 1OTAA 2VV6A 3K3CA 4I3IA 1LSXA 1GSVA 3KX0X 4LRYC 4F3LA 1BYWA 5J3WA 5J7EA 3H7WB 1JNUA 1UWNX 4JGQA 2K7SA 3H9WA 4HIAA 1OTEA 3P7NA 3H82B 4HH2A 4LPZA 5HWVA 5KIZA 4I3AA 2Z6DA 1LSWA 1DP8A 1S1ZA 3ICYA 4M4XA 1T18A 3HJIA 4R6LA 3RTYA 1GSXA 3B33A 3CLOA 3NOUC 4GS9B 1TS7A 5HDCA 3GECA 3UB8A 1S1YA 3F1PA 4JGOA 2PR6A 3MXQA 5DJUA 1LL8A 3MR0A 2ZOIA 4WF0A 1V9ZA 2PD8A 2R78A 3LICA 5EFWA 2INWA 1OT9A 5F5YA 2A24B 3MFXA 4H6JA 5HZHA 1TS0A 1OTBA 1D7EA 5DKKA 4BBUA 1OTIA 1GSWA 3IS2A 2B02A 2YKHA 2PYRA 4R3AA 4WUJA 3EEHA 2CMNA 4L9EA 3UE6A 3FC7A 3D72A 1T1BA 2ZBBA 2QWSA 3LIDA 3LYXA 4K08A 5F69A 5G4ZA 2PYPA 4L9GA 5HWTA 1TS8A 4HI4A 4EEUA 4EQ1A 2V9AA 5AVEA 1DRMA 3H82A 4EETB 3E4PA 2PDRA 3LI8A 3ULFA 2KX6A 4HNBA 1KOUA 4PKYG 4EESA 4GHIA 3UB6A 1X0OA 3C2WA 3NOPC 4HJ3A 1OJGA 3F1NA 4GCZA 3A0SA 4HY8A 5HD3A 4PKYA 2P7JA 4HJ6A 3C8CA 3G6OA 3E4OA 4LRZE 3F1PB 3F1OB 4LLOB 2VEAA 2HV1A 3UB7A 2QHKA 2W0NA 2V1AA 2WKRA 3BY9A 3PHYA 1XJ3A 1OT6A 2VV8A 1VB6A 3MQQA 5I5LA 4EERA 4RQ9A 2A24A 4NXGA 1NWZA 4H6JB 1N9NA 4I3JA 3EWKA 2EA9A 3PYPA 2V0WA 4DJ2A 3BY8A 3E4QA 2J80A 2L4RA 4LRXC 4XT2B 1XJ2A 4JGPA 5F6AA 3VE3A 2JHEA 4NXBA 4L9FA 1DP6A 2D02A 2QJ5A 5AVFA 2PHYA 1EW0A 1N9OA 2ZOHA 4I39A 2PD7A 2KDKA 4HP4A 1F98A 2L0WA 1F9IA 3A0VA 4R70A 4YWZA 4B9OA 1V9YA 4KUKA 4NXEA 3SW1A 3UMEA 2L1MA 2Z6CA 3GDIA 4NXFA 1DP9A 4MN6A 1T1CA 1WA9A 4GHIB 1XJ4A 4DJ3A 5J4EA 3F1NB 3MQOA 3K3DA 2WKQA
chains in the Genus database with same CATH superfamily
5AQAA 2QKPA 4DRTA 3F1OA 1L0EA 4R23A 5HWWA 4ETXA 2PBDP 2VJWA 3KYQA 4KQDA 4KUOA 4Y0UA 1BSGA 4GJ4A 4XUXA 3S7PA 3OLOA 5DF9A 4FD8A 3SS5A 2OWJA 5FQJA 3FV7A 3UE0A 4GDBA 3WRZA 4BMWA 3RFBA 4MBHA 4Y3IA 3N8LA 2WGVA 2X02A 4Y5FA 2PT7A 4Z9QA 1ONGA 1K54C 3GECA 2BG1A 5DJUA 4PM5A 5EFWA 1K57C 3QHYA 3S7NA 3DAVA 1OMEA 3HLEA 5FAPA 2B95A 2PYRA 4OP5A 3OPPA 1CF0A 1H0MA 3BFFA 5CTMA 1BZAA 1PIOA 2NUTC 3ULFA 1ES5A 2OSUA 1IELA 1AXBA 1HLUP 3C8CA 3G6OA 3CHWP 4DE1A 2V1AA 3BY9A 4OOLA 4JXWA 1TDLA 3Q07A 4G3VA 3Q7ZA 1YT4A 3S4XA 3LEZA 3ZG7B 1FIKA 1W7FA 1HZOA 3A3IA 2OV5A 4L0LA 1F5MA 2R9XA 5JYPA 4GW9A 3BEBA 1W5DA 4F3LB 3GSGA 3E2LA 4OONA 2ZMVA 3JYIA 3ITAA 1K56A 4P6BA 2W27A 3ZQ5A 2ZC3B 4X56A 1ZKJA 4NK3A 1Y4OA 2Q9NA 4UA6A 4UAAA 2FZ0A 4KZ9A 2FH5A 5HARA 2JKRI 3R7WB 3K3CA 1LSXA 2AVXA 3MZFA 4CLCD 5EECA 1E25A 4P85A 1WE4A 1YMXA 4S2NC 4P0MA 2ZMAA 3MBZA 5DF8A 2R78A 1U60A 2CC1A 3HVFA 1OTIA 4WUJA 3QP4A 2C5WB 4GLQA 5TFQA 1LI9A 2EFXA 1YQSA 5CGSA 2EXBA 3D9YA 4EETB 4BD1A 3KSIA 5MC7A 5FQ9A 5GLCA 2RCXA 2G2WA 3A3DA 2ZD8A 4KZ4A 3WRTA 4DJ2A 4LRXC 5F6AA 4JGPA 5GHXA 4Y17A 5E2HA 3O86A 3VFFA 2O99A 3UMEA 1FCMA 4X1MA 5FDHA 3IBRA 4OOYA 3HUOA 4OPYA 5CHJA 2ZQDA 2P08A 3BYDA 4O8GA 3OPHA 2PU2A 1YKDA 1MKMA 1XJ6A 2XLNA 3GRJA 4OP8A 5FI6A 3CAXA 3VP4A 3IQAA 2W1TB 5EM0A 1JTDA 5EVIC 4X25A 3T4JA 3IF6A 1TS6A 4GS9A 1PW1A 2EFUA 2R9WA 2EX8A 2H0TA 1OTAA 4GD6A 4ID4A 2WZZA 4KENB 3WS0A 4OQHA 4EBNA 4LCMA 2W1TA 5AQBA 3HJIA 3CUEA 4EUVA 2Q0OA 4QWOA 4ESPA 3WS4A 1Y54A 1OT9A 2HDRA 1TS0A 3UNWA 3HLDA 4KQRA 4R3AA 1YAXA 2VA0A 3BFGA 5G4ZA 4IVIA 1JWZA 4KZ7A 4WZ5C 5L10A 4ZJ3A 5DTKA 1X0OA 4HJ3A 2XA7S 4JPMA 2WUQA 1IYPA 4R1GA 3PBOA 3LEQA 2HDQA 1MXOA 1DP6A 5AVFA 5C5KA 4OPRA 1N9OA 1KGGA 3BFDA 4R70A 1NLZA 4UHUA 4NXFA 1KE0A 4O7DA 2Y4AA 2JKFA 5EE8A 4WZ4A 2OAQ1 3LGOA 1L3LA 4LV1A 1K55A 2DMWA 1VHMA 4II7A 3MS6A 2Y2LA 2O0YA 3H7WA 4S2OA 2VV7A 1MWRA 3TOIA 1ES3A 4GN2A 3W4OA 5HSQA 1LT0A 2Y2PA 4BBVA 1KE3A 5FI7A 4DE3A 1EROA 5E43A 4C3QA 4DXCA 3MZDA 3IS2B 3MQ0A 5FA7A 4S2NA 1ZTUA 1VETA 4OH0A 3MXSA 4X53A 3BLSA 4K0WA 4I3AA 4RA7A 1S1ZA 4R6LA 1ACFA 3RTYA 1K6SA 2BTFP 5DF7A 3HL9A 3QP2A 1LL8A 2V8CA 4WF0A 3PTEA 4WBGA 2W3FA 3MFXA 5FAOA 1OTBA 2JKRM 1YLTA 1GSWA 4UA7A 1WYBA 5GHZA 4C75A 3KO6A 2HP5A 5A93A 3FPVA 2PDRA 2QYBA 4EV4A 2H0YA 4GHIA 4O01A 3F1NA 1OPXA 3SH7A 1ZG4A 1N4OA 2W0NA 3P01A 3ZG0A 3C7UA 1S0WA 1VB6A 4M3KA 4MLLA 3NECA 3HREA 4GNUA 4S2LA 1XJ2A 5FQQA 4D2OA 5CERA 3K2NA 1EW0A 2Y2GA 4I39A 5HX9A 3UY6A 5GLAA 1DP9A 1DY6A 3F1NB 1YSPA 2WADA 5IU1A 2J3TD 2WGWA 3LIFA 2QPNA 3M6BA 3G35A 3R7WA 3HJKA 1P97A 3CITA 1S67L 3M2JA 4IBXA 2PAVP 5HPFA 5DKLA 4N9LA 2JN7A 2VLGA 1XFQA 1GA9A 4DKIA 4E3NA 3LI9A 5AQ9A 3GTCA 2V2FF 4P6ZM 3VE3A 1W8QA 3ZYTA 3KX0X 2XFSA 4E3MA 1UWNX 2EWVA 2E8JA 3FKWA 3ICYA 3NY4A 4M4XA 1G6AA 4EQIA 1W63M 3G32A 5FQMA 3TG9A 1LLBA 3FWLA 2PD8A 3AGDA 2EXAA 4BBUA 5HFOA 3IS2A 2B02A 3OPLA 1TEMA 2WAFA 3M2KA 2EWWA 4L9EA 2M7UA 3VP0A 1BLCA 4EQ1A 1VETB 2PRFA 2XDMA 1DRMA 4S2MA 1KOUA 1SDNA 5E2FA 5CHMA 1NRJA 4EERA 5I5LA 4JXGA 4LCLA 4UQIS 3OOVA 4NXBA 4ZAMA 1CI9A 2W3HA 1ZHHB 1E3UD 1CI8A 3GDIA 3ZCZA 4CLCA 1IYQA 4P87A 3G34A 1O7EA 3HLCA 1NY0A 1OJ5A 1ZC2A 5DJTA 5CXWA 3WWXA 2ZJ9A 3DW0A 2QJ7A 1AWIA 4OVDA 4LV3A 4DF6A 1OTDA 3LIBA 5HDSA 2P04A 4DE2A 1XXMA 3DTEA 5EUAA 2WGWB 1YMSA 2ZL1A 3RH8B 1IYSA 3A0RA 2WKIA 1W8YA 2IWBA 1BYWA 4E6XA 1YLJA 1JNUA 2WAEA 3ZG8B 4KG2A 2LB5A 2XR0A 3DWZA 2NUPC 1LSWA 2Y8HA 1FCOA 2XD5A 4OQGA 3CLOA 3FZCA 2H10A 2PR6A 3W4QA 2ZOIA 3BFEA 1V9ZA 4GZBA 5AQ7A 4PHTA 2X71A 3AGFA 1H8ZA 1FQGA 3G30A 5FQKA 5J7EA 2W3EA 5AVEA 4RVAA 3LI8A 3V67A 2UWXA 3UB6A 2Z2LB 3IX3A 4Y0OA 3NC8A 1K54A 5KSHA 3QP8A 5IHVA 1XJ3A 3ZDJA 5M1AA 3BY8A 2J80A 4XT2B 3DTIA 4EBPA 4B88A 2ZQAA 4FH2A 1L0FA 1F98A 4KUKA 4BLMA 4E3JA 2E8IA 4MN6A 5U47A 4EUZA 2WKQA 4MN7A 3MJQA 4PPRA 1RP5A 4DXBA 5EPHA 4WEKA 4CJNA 1NJ4A 3DWKA 2B18A 3VOLA 1SDEA 3QNCA 2HPBA 1F2KA 1JWPA 3TRCA 4JLFA 1PFLA 4D60A 4PM7A 2HZ5A 4CLCC 5A8BA 2GJ3A 5KMWA 3SW1A 2GX5A 2XQZA 3IH9A 4A5RA 3NOTC 3E0YA 2XEPA 4WN5A 4OPZA 2XF3A 5G18A 4LRYC 3SS3A 5I94A 1CQAA 1H3QA 1I2WA 1OTEA 4LPZA 5HWVA 5KIZA 4BWIA 5KSCA 5TGFA 3B33A 1BULA 2XRNA 5BOHA 3T1SA 4B4XA 4G3KA 1PI4A 2P74A 5EM1A 4F94A 4QPRA 4Q0JA 3EEHA 4JBFA 3UE6A 4WEJA 3D72A 4Q0HA 1KDWA 1NYMA 4HI4A 5HAPA 3PXPA 4GCZA 2KOIA 3UPPA 1M6KA 2Z2MB 3DTKA 3UDFA 3Q7VB 1N9NA 2XFTA 3PYPA 3IF6C 1MKIA 3LO7A 1PZPA 3IX8A 3IWIA 2PBYA 4R4RA 1Q2QA 3T4LA 5CECA 3WS5A 4NXEA 2L1MA 4AFIA 3G4PA 1YLWA 2WKPA 1LI0A 4WELA 1Z6FA 2DCFA 3RJUA 1S6RA 4I5SA 5IS1A 1E4DA 2EX9A 2ZQCA 3IXBA 4MMNA 1FCNA 4HP9A 3GVBA 4FUWA 1H5XA 4MNRA 1SKOB 1NZUA 4PMAA 2HJ9C 3T50A 4N1HA 4HHDA 3CWFA 2J8YA 4MDZA 3A3EA 5EOEA 4E3LA 1BT5A 3LR5A 3H7WB 2GZAA 2BLSA 3P7NA 2DNSA 3QP6A 4ZDXA 5EVIA 1TS7A 5A91A 3F1PA 2OAP1 2I72A 2ZM8A 4N92A 2J9OA 3T4OA 3N4IA 5HAQA 4C6YA 1YLYA 2RL3A 1W79A 4OQIA 3D4FA 1M40A 4ETZA 3I7JA 5E2GA 2KX6A 3MFDA 4XUZA 4EESA 5EVIB 4CLCB 1XA1A 2UV0E 4PKYA 3LR4A 3NDEA 4LRZE 1D1JA 4KG5A 4CPKA 3MKFA 1ALQA 2HP9A 4NETA 4RQ9A 3MSHA 5AJGA 3HLGA 1CJFA 2PD7A 2G2UA 3TE8A 4KG6A 2ZQ7A 4N1XA 4GHIB 4R3BA 1GCEA 5HL1A 2J3WA 3Q82A 3UPNA 1N9BA 2ZC6B 4HOIA 4IJGA 2ZL1B 4KZ3A 3D3OA 2OWHA 2J7VA 1HVBA 2A49A 2VK3A 5G4YA 2VKSA 4WL9A 1W63Q 3VP3A 1K6RA 4IVKA 1DJBA 3RXXA 1H8MA 1YLPA 3U2AA 3TJZC 3UB5P 4MN5A 2V1BA 3LIAA 3IBJA 5FSRA 1JTGA 4BJPA 5J3WA 1YPRA 4KQOA 4R4SA 4R3JA 4FCFA 1L0DA 1ZG6A 3CI6A 3BECA 1BLPA 3T4KA 5GL9A 3VP2A 2HF6A 3PAEA 4WZ5A 4PM9A 1XGIA 5IT5A 2ZQ9A 3S7OA 1QMFA 1ES4A 2O9CA 1KDSA 5HWTA 3GR2A 3NULA 3B47A 4YINA 2W3DA 4S2IA 4JF5A 5A92A 1G68A 3FYZA 1YLZA 5D3OA 2VV8A 2Y2NA 3P09A 1FILA 4FSFA 3EWKA 4O0PA 4GOGA 3SH8A 3UPOA 1CK3A 5EOOA 1IYOA 5HL6A 2XSSA 3HBRA 4HP4A 4DE0A 1HTZA 3VSKA 3OC2A 1K56D 1XJ4A 2WZXA 5JYOA 1GHMA 4LV0A 5FASA 1FSWA 4OLGA 3V3RA 5FEGA 5M18A 4X55A 2PR5A 4BL2A 1JVJA 2JCHA 1ONHA 4R38A 2JC7A 1YSQA 2Q9MA 1IFQA 4WM9A 4IEDA 1XX2A 4LGWA 4HBTA 2IA2A 3W2ZA 4OLDA 3H82B 1K0KA 2VGJA 4GDNA 4MCWA 4MEZA 4IUHA 1ERMA 2ZQ8A 3MZEA 2INWA 1NRFA 3C4PA 4H6JA 1PI5A 5TJJA 3N7WA 4OPQA 1FR6A 5LBRA 4CLCE 4Q0IA 4EBLA 2PYPA 5CHUA 3H82A 1K4FA 2H5SA 3KSHA 4BD0A 1TVFA 3C2WA 3P98A 5DTTA 1FSYA 1TF1A 2B5RA 3QP5A 4QY5A 4H6JB 2FFYA 2OLUA 2ZM2A 4QD4A 4RX2A 1P9WA 2Y2KA 2Y2MA 2ZOHA 4YWZA 1V9YA 2Z6CA 4E6WA 4WYYA 5HD3A 2Y91A 4H8RA 2JBFA 4G3WA 4Y0TA 1SKOA 2P9VB 3LFVA 5CGWA 2WKEA 4IBRA 4MBKA 5EVEA 1K4EA 2OOLA 4XT2A 5CTNA 3T1QB 2D01A 3IXHA 1Y28A 5F82A 3QNBA 2O9BA 2V8FA 2H28A 1PWGA 1S4RA 3BW6A 2Y2IA 1BTLA 5L07A 3JVVA 4ZTKA 1S66L 5GLBA 3N8SA 3V39A 2J3TC 4KZ5A 1KE4A 3H9WA 2VGLS 3UE1A 1T18A 3PAGA 3NOUC 3HUMA 4E3KA 4ZRRA 2WK0A 3SOIA 4QB8A 3MR0A 3IHBA 5F5YA 2Y2OA 1GHIA 4FTXA 3O88A 1YM1A 3FC7A 2VGKA 4EEUA 2VX8A 5EVID 4K0XA 4HEFA 1OJGA 5HAIA 4E3IA 3IWQA 3A3FA 1NLYA 3CG5A 1OT6A 3BFCA 1NWZA 3BRMA 3SS4A 4JXSA 2D02A 4BQMA 1G6OA 5DFXA 3S1YA 3GV9A 1K38A 3CPTA 3UN7A 4U0TA 1WA9A 5TBMB 3ZFZA 3C5AA 3C7VA 3Q7VA 1O07A 5CX7A 4HBUA 1QMEA 3BJNA 3HLFA 4LV2A 1GA0A 4JXVA 3JVUA 1P9RA 4QU3A 4DDYA 4E3OA 5DFYA 1TD5A 5HDDA 5F1FA 4PM8A 4B4ZA 3LIEA 4JGRA 3UDXA 4NEED 3MMHA 5TBMA 1E3UA 4Y15A 2HDUA 2P9VA 3HLWA 3B3XA 2IWCA 3KSFA 1K57A 1MC0A 5CEBA 5K5BA 3OPRA 2Y2JA 4BL3A 2W3GA 4QY6A 2HJEA 1PRQA 4WMCA 1KGEA 1KVMA 2J9PA 4HH2A 2VZWA 3ITBA 2XH9A 2VGLM 3NI9A 4B93A 1BLHA 1ESUA 5HW3A 1CEFA 3T4QA 3LICA 2G7UA 3MXRA 5HZHA 1D7EA 1L0GA 3LR3A 2JKTI 2CMNA 5A90A 1JWVA 2QWSA 3LYXA 4NKPA 1HD8A 2GNXA 4KZ8A 1TS8A 3FPWA 3O87A 1WYCA 5L09A 1VEUB 1NZOA 3IX4A 5M19A 1PWCA 5FEFA 1I2SA 4LENA 3KYEA 4P6ZS 5CEDA 1PNEA 3V3SA 2JKGA 3F1PB 2HV1A 3L7HA 5FATA 3ZGAB 3ZG5A 3T4SA 4ZBEA 3EGXC 4I3JA 3IH8A 3MKEA 3KYZA 4GD8A 2V0WA 3VV4A 3E4QA 4Y13A 3EEAA 3MF0A 4S2PA 2QJ5A 3IF5A 2HP6A 1VEUA 2WYXA 4R0QA 3ZHHA 3NDGA 4UEYA 4OQ0A 5J8XA 3RXWA 2Y55A 1T1CA 3NBLA 5J4EA 4NXGA 4YNRA 3U4LP 4ME4A 5HPIA 4EXOA 3UO9A 4YFMA 1LL5A 1T19A 1IKGA 2K2NA 4UQIM 3E98A 1MWUA 1KGFA 3E2KA 1ESIA 1UGUA 3UMDA 1MZUA 3NHQA 1XFNA 3EQUA 5FQIA 3CPTB 1LSVA 3LUQA 1S4SA 2A2LA 1MWTA 2W1RA 5DTSA 3BM6A 4EW7A 4N9KA 3VOYA 3O5YA 2X01A 2XK1A 1RGZA 5DVAA 3CUEC 4I3IA 3UE3A 3SZTA 4HIAA 2Z6DA 4K91A 2A3UA 1DP8A 3ZNTA 1GSXA 1G5UA 2ZMFA 2QMIA 4ARZA 3Q81A 1S1YA 3FKVA 3MXQA 4GB7A 4JF6A 3JPUA 4X1LA 3T1XA 3C38A 2ZC5B 2ZLYA 1I5QA 2YKHA 2XD1A 2EX6A 3EQVA 1Z09A 2ZBBA 4RX3A 1MBLA 3G2YA 1XKZA 4IHQA 3NIAA 3ZVWA 3ZG9B 4ZJ2A 4ARZB 3E4OA 5L8MA 3T12B 3UB7A 2QHKA 3ZNYA 3MQQA 3N6IA 4KZ6A 3UDIA 3V50A 2PHYA 2PU4A 1F9IA 1MY8A 2ZC7A 4ZJ1A 3G2ZA 2FFFB 3DBAA 5F1GA 3PBNA 4Y7PA 3PR6A 3NJAA 4UA9A 2V20A 3T4TA 4KQQA 4U0XA 1IKIA 2HGVA 1P0ZA 3OBFA 5FDSA 2IWDA 2I9VA 4CQHA 5HD5A 4MBFA 2ZC4B 1KVLA 1J3WA 2M1CA 4HJ4A 1SCWA 1RCJA 4HQAA 3OCNA 2BASA 2VV6A 3TW8A 1SKFA 4JGQA 2K7SA 3WS2A 4Y2FA 3LR0A 1VQQA 5KZHA 2QZ6A 4U3TA 4JGOA 3R4KA 4YOFA 1VM1A 2A24B 5DKKA 2EX2A 3NCKA 1PW8A 3BQ8A 1XA7A 1PWDA 3N8RA 3LIDA 1T1BA 4K08A 1MWSA 2V9AA 3AGEA 1L2SA 3B42A 1NYYA 4HNBA 5GLDA 3VE4A 3NOPC 4HY8A 3A0SA 4HJ6A 3CZDA 1PZOA 3CMZA 3PHYA 4QHCA 1STZA 5F83A 2L4RA 4L9FA 3IXGA 2XA7M 2KDKA 1RGYA 4GKUA 3EGDC 4DJ3A 1DJCA 2WGIA 3IF6B 2V1ZA 3K3DA 1BLSA 1MPLA 3Q1FA 1EWZA 4BBTA 1LL9A 3IXDA 3VFHA 3PBQA 5EVLA 3ZVTA 3VP1A 1D06A 3FG8A 3QP1A 3DTMA 5F68A 1SHVA 4KZBA 4HH3A 3W4PA 2V0UA 2GDNA 4PM6A 1G28A 1UWPX 4WLAA 4EEPA 1J9MA 4LFUA 1N9LA 4I38A 4OKPA 1ODVA 5FL3A 4F3LA 1GSVA 1DJAA 4XXRA 4JF4A 2Y2QA 3TSGA 2M7VA 2XROA 1K25A 3ISGA 3C30A 3UB8A 4EWFA 1FOFA 2JE5A 5CGXA 3VMAA 4S2KA 5TR7A 4PAUA 4RYEA 4Q8IA 5F69A 1IOUA 3IHAA 3O3VA 3E4PA 3LY3A 4X68A 1LHYA 2C6WB 4LLOB 1K55C 3A3JA 2JKTM 2A24A 4QJGA 4OOMA 2EA9A 3IT9A 5EV0A 3S22A 1Q2PA 2JHEA 1CEGA 2Y79A 2L0WA 1ERQA 3HUNA 3PBRA 3CJMA 4IUKA 4DN0A 1C3BA 3MQOA 4WMCD 3VOZA 4S2JA 4DMZA 3BQAA 1TDGA 2OLVA 3UB9A 3W8KA 4FOFA 4X6TA 2HDSA 3GMWA 2ACGA 2DRWA 3G31A 2MJ6A 1GHPA 3SH9A 4E04A 3KSGA 3VSLA 3IWOA 1T1AA 3V5MA 3BWLA 4BENA 3OZHA 1NXYA 1ES2A 5GHYA 4JKTA 2YKFA 3BLMA 4Z1WA 3PBSA 4NG2A 1FR1A 1XP4A 1XPBA 5FAQA 5CRFA 2WKHA 4HESA 3T1RA 4GS9B 4KZAA 3M6HA 5HDCA 4DDSA 4FH4A 4X69A 1H8YA 5E2EA 2O9AA 3LY4A 2Y2HA 3S7QA 4L9GA 3HCYA 1XGJA 3PBTA 1PYYA 2Y59A 4PKYG 3OCLA 1EI5A 2P7JA 3L9KA 3F1OB 2VEAA 2WKRA 3WS1A 2ZM0A 2KLIA 1SZVA 1A0KA 2XGNA 3C4OA 5L2FA 3A0VA 3EOIA 3GQZA 4EU0A 4B9OA 2K31A 2LB9A 5FI2A 1IEMA 3HLBA 3LCEA 1BUEA
chains in the Genus database with same CATH topology
1YSPA 4ME4A 2QKPA 5HPIA 4EXOA 3F1OA 5IU1A 4HOIA 5HWWA 4IJGA 2J3TD 1T19A 3LIFA 4ETXA 3D3OA 2K2NA 2OWHA 4UQIM 3E98A 3R7WA 3HJKA 2VJWA 3KYQA 4KQDA 1P97A 1UGUA 3CITA 4KUOA 1S67L 1MZUA 3UMDA 3NHQA 1XFNA 3EQUA 4GJ4A 5HPFA 5G4YA 2VKSA 1LSVA 5DKLA 3LUQA 1W63Q 4WL9A 2JN7A 2VLGA 3S7PA 1S4SA 2A2LA 2W1RA 1XFQA 3OLOA 5DF9A 4EW7A 1H8MA 3U2AA 3TJZC 2OWJA 3LI9A 4MN5A 2V1BA 3O5YA 3LIAA 3IBJA 4P6ZM 4BMWA 3VE3A 3RFBA 3CUEC 4I3IA 3UE3A 3ZYTA 3KX0X 4BJPA 5J3WA 4KQOA 1UWNX 2EWVA 4Y3IA 4HIAA 3CI6A 4Y5FA 2Z6DA 3ICYA 1DP8A 2PT7A 4M4XA 3T4KA 1GSXA 2ZMFA 1W63M 4ARZA 3GECA 1S1YA 2HF6A 3MXQA 5DJUA 2PD8A 5EFWA 3C38A 3S7NA 5IT5A 4BBUA 3IS2A 3S7OA 2B02A 2YKHA 2PYRA 2EWWA 3EQVA 4L9EA 2M7UA 2O9CA 2ZBBA 5HWTA 4EQ1A 1DRMA 2NUTC 3B47A 4IHQA 3ULFA 1KOUA 2W3DA 4ARZB 3C8CA 3G6OA 3E4OA 5L8MA 3UB7A 2QHKA 1NRJA 2V1AA 3BY9A 4EERA 3MQQA 2VV8A 4OOLA 5I5LA 4FSFA 4G3VA 3EWKA 4O0PA 4UQIS 3OOVA 4NXBA 5HL6A 2XSSA 2W3HA 2PHYA 1ZHHB 4HP4A 1F9IA 3OC2A 3GDIA 4L0LA 1XJ4A 1F5MA 3DBAA 4CLCA 3PBNA 4GW9A 3PR6A 3NJAA 3T4TA 2PR5A 1OJ5A 4F3LB 2HGVA 1P0ZA 2ZMVA 5DJTA 3OBFA 4R38A 2W27A 3ZQ5A 1YSQA 2I9VA 2QJ7A 4CQHA 5HD5A 1IFQA 1OTDA 3LIBA 5HDSA 2P04A 2M1CA 2FZ0A 3RH8B 2FH5A 4HJ4A 2JKRI 3A0RA 4HQAA 3R7WB 3OCNA 2BASA 2VV6A 3K3CA 1LSXA 2IA2A 3TW8A 1BYWA 3W2ZA 1JNUA 4CLCD 4JGQA 2K7SA 2LB5A 4Y2FA 3H82B 3LR0A 2NUPC 4MCWA 1LSWA 2Y8HA 3CLOA 4IUHA 4JGOA 2PR6A 2ZOIA 3R4KA 4YOFA 1V9ZA 2R78A 4PHTA 2INWA 2A24B 4H6JA 5DKKA 1OTIA 5TJJA 4WUJA 3BQ8A 3LIDA 1T1BA 4GLQA 4K08A 2W3EA 4Q0IA 5LBRA 4CLCE 5J7EA 2PYPA 2V9AA 5AVEA 3H82A 4EETB 3KSHA 3V67A 3LI8A 3B42A 3KSIA 4HNBA 5MC7A 3VE4A 3UB6A 3C2WA 3NOPC 4HY8A 3A0SA 4HJ6A 1TF1A 5KSHA 3PHYA 1XJ3A 1STZA 4H6JB 4DJ2A 3BY8A 4LRXC 2J80A 2L4RA 4XT2B 5F6AA 4JGPA 4L9FA 1P9WA 2XA7M 2ZOHA 2KDKA 1F98A 4YWZA 1V9YA 4KUKA 2O99A 2Z6CA 3UMEA 3EGDC 4MN6A 4DJ3A 5HD3A 3K3DA 2WKQA 3IBRA 4MN7A 3MJQA 4G3WA 3LFVA 4WEKA 4BBTA 2B18A 2P08A 3VOLA 2OOLA 4XT2A 4O8GA 2D01A 1YKDA 1MKMA 1XJ6A 3PBQA 3CAXA 1Y28A 3TRCA 1D06A 2W1TB 2O9BA 3FG8A 2H28A 5F68A 3T4JA 1TS6A 4CLCC 4GS9A 5A8BA 2GJ3A 1S4RA 3BW6A 4HH3A 3SW1A 2V0UA 2GX5A 1G28A 1UWPX 4WLAA 3JVVA 4EEPA 3NOTC 3E0YA 1S66L 1N9LA 4I38A 4WN5A 1ODVA 5FL3A 1OTAA 4F3LA 1GSVA 4LRYC 2J3TC 1H3QA 3H9WA 1OTEA 4LPZA 5HWVA 5KIZA 2VGLS 4BWIA 2W1TA 1T18A 3HJIA 2M7VA 3B33A 3NOUC 2XROA 3CUEA 4ZRRA 4EUVA 2XRNA 3C30A 3UB8A 3MR0A 1OT9A 5F5YA 1TS0A 4G3KA 4PAUA 4QPRA 4R3AA 4Q0JA 1YAXA 3EEHA 3UE6A 4WEJA 2VA0A 3D72A 3FC7A 5F69A 1IOUA 5G4ZA 4EEUA 4Q0HA 2VX8A 4HI4A 3PXPA 3E4PA 1X0OA 4HJ3A 1OJGA 4GCZA 2KOIA 2XA7S 4LLOB 1NLYA 1OT6A 2JKTM 2A24A 1NWZA 4OOMA 1N9NA 3PBOA 2EA9A 3PYPA 2JHEA 1DP6A 2D02A 5AVFA 5C5KA 1G6OA 2Y79A 5DFXA 1N9OA 3T4LA 2L0WA 4R70A 1NLZA 3PBRA 4NXEA 4IUKA 2L1MA 4AFIA 4NXFA 4DN0A 1WA9A 3MQOA 2OAQ1 5TBMB 2WKPA 4DMZA 3BQAA 4WELA 5CX7A 3UB9A 3BJNA 4FOFA 2DMWA 1VHMA 4II7A 4I5SA 3JVUA 5IS1A 2MJ6A 2O0YA 3H7WA 1P9RA 4MMNA 2VV7A 5DFYA 1TD5A 5HDDA 4E04A 5HSQA 1LT0A 3KSGA 3LIEA 4HP9A 4JGRA 4BBVA 4NEED 1T1AA 3BWLA 3MMHA 5TBMA 2HJ9C 3T50A 3KSFA 4HHDA 1MC0A 3CWFA 5K5BA 4MDZA 3IS2B 2YKFA 3MQ0A 2W3GA 4Z1WA 3PBSA 2HJEA 3LR5A 3H7WB 2GZAA 1ZTUA 3P7NA 4HH2A 2VZWA 4I3AA 1S1ZA 4R6LA 2VGLM 3RTYA 4B93A 4GS9B 1TS7A 5HDCA 3F1PA 2OAP1 1LL8A 4WF0A 3T4QA 3LICA 2G7UA 2W3FA 3MFXA 5HZHA 3T4OA 1OTBA 1D7EA 2JKRM 1GSWA 3LR3A 2JKTI 2CMNA 2O9AA 2QWSA 3LYXA 4NKPA 3KO6A 2GNXA 4L9GA 1TS8A 3FPWA 3S7QA 3HCYA 4ETZA 3PBTA 3FPVA 2PDRA 2KX6A 2QYBA 4PKYG 4EESA 3OCLA 4GHIA 4O01A 3F1NA 1OPXA 4P6ZS 4CLCB 4PKYA 2P7JA 3LR4A 4LRZE 3F1PB 3F1OB 2VEAA 2HV1A 2W0NA 3P01A 2WKRA 1VB6A 3T4SA 4RQ9A 2KLIA 3EGXC 4I3JA 3KYZA 2V0WA 3VV4A 3E4QA 5AJGA 1XJ2A 3EEAA 3MF0A 2QJ5A 3K2NA 1EW0A 4I39A 2PD7A 3A0VA 3EOIA 4EU0A 3TE8A 4B9OA 2K31A 4UEYA 2LB9A 1DP9A 1T1CA 4GHIB 5J4EA 3F1NB 4NXGA 4YNRA 2J3WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IBR A;  2QKP A;  3MJQ A;  5TBM B;  4EXO A;  5F68 A;  2WKP A;  3F1O A;  5IU1 A;  3VE4 A;  4GW9 A;  4HOI A;  5HWW A;  3NJA A;  4BBT A;  3UB9 A;  1T19 A;  3LIF A;  3VOL A;  2OWH A;  2PR5 A;  2OOL A;  3HJK A;  1OJ5 A;  4XT2 A;  4KQD A;  4F3L B;  1P97 A;  1UGU A;  4I5S A;  4KUO A;  1S67 L;  1MZU A;  3UMD A;  5IS1 A;  3NHQ A;  1P0Z A;  2D01 A;  3H7W A;  1XJ6 A;  5DJT A;  1XFN A;  2VV7 A;  3CAX A;  1Y28 A;  5G4Y A;  4R38 A;  1LSV A;  2W27 A;  5DKL A;  1D06 A;  3LUQ A;  3FG8 A;  4WL9 A;  5HDD A;  3ZQ5 A;  4E04 A;  2JN7 A;  5HSQ A;  2H28 A;  1LT0 A;  1S4S A;  2I9V A;  2QJ7 A;  2VLG A;  1TS6 A;  3LIE A;  4GS9 A;  4HP9 A;  1XFQ A;  4JGR A;  5HD5 A;  2GJ3 A;  4BBV A;  5A8B A;  1S4R A;  1OTD A;  3LIB A;  1T1A A;  3OLO A;  2V0U A;  3BWL A;  4HH3 A;  5HDS A;  5TBM A;  4EW7 A;  1G28 A;  1UWP X;  2OWJ A;  4WLA A;  3LI9 A;  4MN5 A;  3T50 A;  2M1C A;  2V1B A;  4EEP A;  3NOT C;  4HHD A;  3CWF A;  3LIA A;  3RH8 B;  1S66 L;  4HJ4 A;  1N9L A;  3A0R A;  4HQA A;  4I38 A;  3IS2 B;  2YKF A;  1ODV A;  2BAS A;  4WN5 A;  1OTA A;  2VV6 A;  3K3C A;  4I3I A;  1LSX A;  1GSV A;  3KX0 X;  4LRY C;  4F3L A;  1BYW A;  5J3W A;  5J7E A;  3H7W B;  1JNU A;  1UWN X;  4JGQ A;  2K7S A;  3H9W A;  4HIA A;  1OTE A;  3P7N A;  3H82 B;  4HH2 A;  4LPZ A;  5HWV A;  5KIZ A;  4I3A A;  2Z6D A;  1LSW A;  1DP8 A;  1S1Z A;  3ICY A;  4M4X A;  1T18 A;  3HJI A;  4R6L A;  3RTY A;  1GSX A;  3B33 A;  3CLO A;  3NOU C;  4GS9 B;  1TS7 A;  5HDC A;  3GEC A;  3UB8 A;  1S1Y A;  3F1P A;  4JGO A;  2PR6 A;  3MXQ A;  5DJU A;  1LL8 A;  3MR0 A;  2ZOI A;  4WF0 A;  1V9Z A;  2PD8 A;  2R78 A;  3LIC A;  5EFW A;  2INW A;  1OT9 A;  5F5Y A;  2A24 B;  3MFX A;  4H6J A;  5HZH A;  1TS0 A;  1OTB A;  1D7E A;  5DKK A;  4BBU A;  1OTI A;  1GSW A;  3IS2 A;  2B02 A;  2YKH A;  2PYR A;  4R3A A;  4WUJ A;  3EEH A;  2CMN A;  4L9E A;  3UE6 A;  3FC7 A;  3D72 A;  1T1B A;  2ZBB A;  2QWS A;  3LID A;  3LYX A;  4K08 A;  5F69 A;  5G4Z A;  2PYP A;  4L9G A;  5HWT A;  1TS8 A;  4HI4 A;  4EEU A;  4EQ1 A;  2V9A A;  5AVE A;  1DRM A;  3H82 A;  4EET B;  3E4P A;  2PDR A;  3LI8 A;  3ULF A;  2KX6 A;  4HNB A;  1KOU A;  4PKY G;  4EES A;  4GHI A;  3UB6 A;  1X0O A;  3C2W A;  3NOP C;  4HJ3 A;  1OJG A;  3F1N A;  4GCZ A;  3A0S A;  4HY8 A;  5HD3 A;  4PKY A;  2P7J A;  4HJ6 A;  3C8C A;  3G6O A;  3E4O A;  4LRZ E;  3F1P B;  3F1O B;  4LLO B;  2VEA A;  2HV1 A;  3UB7 A;  2QHK A;  2W0N A;  2V1A A;  2WKR A;  3BY9 A;  3PHY A;  1XJ3 A;  1OT6 A;  2VV8 A;  1VB6 A;  3MQQ A;  5I5L A;  4EER A;  4RQ9 A;  2A24 A;  4NXG A;  1NWZ A;  4H6J B;  1N9N A;  4I3J A;  3EWK A;  2EA9 A;  3PYP A;  2V0W A;  4DJ2 A;  3BY8 A;  3E4Q A;  2J80 A;  2L4R A;  4LRX C;  4XT2 B;  1XJ2 A;  4JGP A;  5F6A A;  3VE3 A;  2JHE A;  4NXB A;  4L9F A;  1DP6 A;  2D02 A;  2QJ5 A;  5AVF A;  2PHY A;  1EW0 A;  1N9O A;  2ZOH A;  4I39 A;  2PD7 A;  2KDK A;  4HP4 A;  1F98 A;  2L0W A;  1F9I A;  3A0V A;  4R70 A;  4YWZ A;  4B9O A;  1V9Y A;  4KUK A;  4NXE A;  3SW1 A;  3UME A;  2L1M A;  2Z6C A;  3GDI A;  4NXF A;  1DP9 A;  4MN6 A;  1T1C A;  1WA9 A;  4GHI B;  1XJ4 A;  4DJ3 A;  5J4E A;  3F1N B;  3MQO A;  3K3D A;  2WKQ A; 
#chains in the Genus database with same CATH topology
 5AQA A;  2QKP A;  4DRT A;  3F1O A;  1L0E A;  4R23 A;  5HWW A;  4ETX A;  2PBD P;  2VJW A;  3KYQ A;  4KQD A;  4KUO A;  4Y0U A;  1BSG A;  4GJ4 A;  4XUX A;  3S7P A;  3OLO A;  5DF9 A;  4FD8 A;  3SS5 A;  2OWJ A;  5FQJ A;  3FV7 A;  3UE0 A;  4GDB A;  3WRZ A;  4BMW A;  3RFB A;  4MBH A;  4Y3I A;  3N8L A;  2WGV A;  2X02 A;  4Y5F A;  2PT7 A;  4Z9Q A;  1ONG A;  1K54 C;  3GEC A;  2BG1 A;  5DJU A;  4PM5 A;  5EFW A;  1K57 C;  3QHY A;  3S7N A;  3DAV A;  1OME A;  3HLE A;  5FAP A;  2B95 A;  2PYR A;  4OP5 A;  3OPP A;  1CF0 A;  1H0M A;  3BFF A;  5CTM A;  1BZA A;  1PIO A;  2NUT C;  3ULF A;  1ES5 A;  2OSU A;  1IEL A;  1AXB A;  1HLU P;  3C8C A;  3G6O A;  3CHW P;  4DE1 A;  2V1A A;  3BY9 A;  4OOL A;  4JXW A;  1TDL A;  3Q07 A;  4G3V A;  3Q7Z A;  1YT4 A;  3S4X A;  3LEZ A;  3ZG7 B;  1FIK A;  1W7F A;  1HZO A;  3A3I A;  2OV5 A;  4L0L A;  1F5M A;  2R9X A;  5JYP A;  4GW9 A;  3BEB A;  1W5D A;  4F3L B;  3GSG A;  3E2L A;  4OON A;  2ZMV A;  3JYI A;  3ITA A;  1K56 A;  4P6B A;  2W27 A;  3ZQ5 A;  2ZC3 B;  4X56 A;  1ZKJ A;  4NK3 A;  1Y4O A;  2Q9N A;  4UA6 A;  4UAA A;  2FZ0 A;  4KZ9 A;  2FH5 A;  5HAR A;  2JKR I;  3R7W B;  3K3C A;  1LSX A;  2AVX A;  3MZF A;  4CLC D;  5EEC A;  1E25 A;  4P85 A;  1WE4 A;  1YMX A;  4S2N C;  4P0M A;  2ZMA A;  3MBZ A;  5DF8 A;  2R78 A;  1U60 A;  2CC1 A;  3HVF A;  1OTI A;  4WUJ A;  3QP4 A;  2C5W B;  4GLQ A;  5TFQ A;  1LI9 A;  2EFX A;  1YQS A;  5CGS A;  2EXB A;  3D9Y A;  4EET B;  4BD1 A;  3KSI A;  5MC7 A;  5FQ9 A;  5GLC A;  2RCX A;  2G2W A;  3A3D A;  2ZD8 A;  4KZ4 A;  3WRT A;  4DJ2 A;  4LRX C;  5F6A A;  4JGP A;  5GHX A;  4Y17 A;  5E2H A;  3O86 A;  3VFF A;  2O99 A;  3UME A;  1FCM A;  4X1M A;  5FDH A;  3IBR A;  4OOY A;  3HUO A;  4OPY A;  5CHJ A;  2ZQD A;  2P08 A;  3BYD A;  4O8G A;  3OPH A;  2PU2 A;  1YKD A;  1MKM A;  1XJ6 A;  2XLN A;  3GRJ A;  4OP8 A;  5FI6 A;  3CAX A;  3VP4 A;  3IQA A;  2W1T B;  5EM0 A;  1JTD A;  5EVI C;  4X25 A;  3T4J A;  3IF6 A;  1TS6 A;  4GS9 A;  1PW1 A;  2EFU A;  2R9W A;  2EX8 A;  2H0T A;  1OTA A;  4GD6 A;  4ID4 A;  2WZZ A;  4KEN B;  3WS0 A;  4OQH A;  4EBN A;  4LCM A;  2W1T A;  5AQB A;  3HJI A;  3CUE A;  4EUV A;  2Q0O A;  4QWO A;  4ESP A;  3WS4 A;  1Y54 A;  1OT9 A;  2HDR A;  1TS0 A;  3UNW A;  3HLD A;  4KQR A;  4R3A A;  1YAX A;  2VA0 A;  3BFG A;  5G4Z A;  4IVI A;  1JWZ A;  4KZ7 A;  4WZ5 C;  5L10 A;  4ZJ3 A;  5DTK A;  1X0O A;  4HJ3 A;  2XA7 S;  4JPM A;  2WUQ A;  1IYP A;  4R1G A;  3PBO A;  3LEQ A;  2HDQ A;  1MXO A;  1DP6 A;  5AVF A;  5C5K A;  4OPR A;  1N9O A;  1KGG A;  3BFD A;  4R70 A;  1NLZ A;  4UHU A;  4NXF A;  1KE0 A;  4O7D A;  2Y4A A;  2JKF A;  5EE8 A;  4WZ4 A;  2OAQ 1;  3LGO A;  1L3L A;  4LV1 A;  1K55 A;  2DMW A;  1VHM A;  4II7 A;  3MS6 A;  2Y2L A;  2O0Y A;  3H7W A;  4S2O A;  2VV7 A;  1MWR A;  3TOI A;  1ES3 A;  4GN2 A;  3W4O A;  5HSQ A;  1LT0 A;  2Y2P A;  4BBV A;  1KE3 A;  5FI7 A;  4DE3 A;  1ERO A;  5E43 A;  4C3Q A;  4DXC A;  3MZD A;  3IS2 B;  3MQ0 A;  5FA7 A;  4S2N A;  1ZTU A;  1VET A;  4OH0 A;  3MXS A;  4X53 A;  3BLS A;  4K0W A;  4I3A A;  4RA7 A;  1S1Z A;  4R6L A;  1ACF A;  3RTY A;  1K6S A;  2BTF P;  5DF7 A;  3HL9 A;  3QP2 A;  1LL8 A;  2V8C A;  4WF0 A;  3PTE A;  4WBG A;  2W3F A;  3MFX A;  5FAO A;  1OTB A;  2JKR M;  1YLT A;  1GSW A;  4UA7 A;  1WYB A;  5GHZ A;  4C75 A;  3KO6 A;  2HP5 A;  5A93 A;  3FPV A;  2PDR A;  2QYB A;  4EV4 A;  2H0Y A;  4GHI A;  4O01 A;  3F1N A;  1OPX A;  3SH7 A;  1ZG4 A;  1N4O A;  2W0N A;  3P01 A;  3ZG0 A;  3C7U A;  1S0W A;  1VB6 A;  4M3K A;  4MLL A;  3NEC A;  3HRE A;  4GNU A;  4S2L A;  1XJ2 A;  5FQQ A;  4D2O A;  5CER A;  3K2N A;  1EW0 A;  2Y2G A;  4I39 A;  5HX9 A;  3UY6 A;  5GLA A;  1DP9 A;  1DY6 A;  3F1N B;  1YSP A;  2WAD A;  5IU1 A;  2J3T D;  2WGW A;  3LIF A;  2QPN A;  3M6B A;  3G35 A;  3R7W A;  3HJK A;  1P97 A;  3CIT A;  1S67 L;  3M2J A;  4IBX A;  2PAV P;  5HPF A;  5DKL A;  4N9L A;  2JN7 A;  2VLG A;  1XFQ A;  1GA9 A;  4DKI A;  4E3N A;  3LI9 A;  5AQ9 A;  3GTC A;  2V2F F;  4P6Z M;  3VE3 A;  1W8Q A;  3ZYT A;  3KX0 X;  2XFS A;  4E3M A;  1UWN X;  2EWV A;  2E8J A;  3FKW A;  3ICY A;  3NY4 A;  4M4X A;  1G6A A;  4EQI A;  1W63 M;  3G32 A;  5FQM A;  3TG9 A;  1LLB A;  3FWL A;  2PD8 A;  3AGD A;  2EXA A;  4BBU A;  5HFO A;  3IS2 A;  2B02 A;  3OPL A;  1TEM A;  2WAF A;  3M2K A;  2EWW A;  4L9E A;  2M7U A;  3VP0 A;  1BLC A;  4EQ1 A;  1VET B;  2PRF A;  2XDM A;  1DRM A;  4S2M A;  1KOU A;  1SDN A;  5E2F A;  5CHM A;  1NRJ A;  4EER A;  5I5L A;  4JXG A;  4LCL A;  4UQI S;  3OOV A;  4NXB A;  4ZAM A;  1CI9 A;  2W3H A;  1ZHH B;  1E3U D;  1CI8 A;  3GDI A;  3ZCZ A;  4CLC A;  1IYQ A;  4P87 A;  3G34 A;  1O7E A;  3HLC A;  1NY0 A;  1OJ5 A;  1ZC2 A;  5DJT A;  5CXW A;  3WWX A;  2ZJ9 A;  3DW0 A;  2QJ7 A;  1AWI A;  4OVD A;  4LV3 A;  4DF6 A;  1OTD A;  3LIB A;  5HDS A;  2P04 A;  4DE2 A;  1XXM A;  3DTE A;  5EUA A;  2WGW B;  1YMS A;  2ZL1 A;  3RH8 B;  1IYS A;  3A0R A;  2WKI A;  1W8Y A;  2IWB A;  1BYW A;  4E6X A;  1YLJ A;  1JNU A;  2WAE A;  3ZG8 B;  4KG2 A;  2LB5 A;  2XR0 A;  3DWZ A;  2NUP C;  1LSW A;  2Y8H A;  1FCO A;  2XD5 A;  4OQG A;  3CLO A;  3FZC A;  2H10 A;  2PR6 A;  3W4Q A;  2ZOI A;  3BFE A;  1V9Z A;  4GZB A;  5AQ7 A;  4PHT A;  2X71 A;  3AGF A;  1H8Z A;  1FQG A;  3G30 A;  5FQK A;  5J7E A;  2W3E A;  5AVE A;  4RVA A;  3LI8 A;  3V67 A;  2UWX A;  3UB6 A;  2Z2L B;  3IX3 A;  4Y0O A;  3NC8 A;  1K54 A;  5KSH A;  3QP8 A;  5IHV A;  1XJ3 A;  3ZDJ A;  5M1A A;  3BY8 A;  2J80 A;  4XT2 B;  3DTI A;  4EBP A;  4B88 A;  2ZQA A;  4FH2 A;  1L0F A;  1F98 A;  4KUK A;  4BLM A;  4E3J A;  2E8I A;  4MN6 A;  5U47 A;  4EUZ A;  2WKQ A;  4MN7 A;  3MJQ A;  4PPR A;  1RP5 A;  4DXB A;  5EPH A;  4WEK A;  4CJN A;  1NJ4 A;  3DWK A;  2B18 A;  3VOL A;  1SDE A;  3QNC A;  2HPB A;  1F2K A;  1JWP A;  3TRC A;  4JLF A;  1PFL A;  4D60 A;  4PM7 A;  2HZ5 A;  4CLC C;  5A8B A;  2GJ3 A;  5KMW A;  3SW1 A;  2GX5 A;  2XQZ A;  3IH9 A;  4A5R A;  3NOT C;  3E0Y A;  2XEP A;  4WN5 A;  4OPZ A;  2XF3 A;  5G18 A;  4LRY C;  3SS3 A;  5I94 A;  1CQA A;  1H3Q A;  1I2W A;  1OTE A;  4LPZ A;  5HWV A;  5KIZ A;  4BWI A;  5KSC A;  5TGF A;  3B33 A;  1BUL A;  2XRN A;  5BOH A;  3T1S A;  4B4X A;  4G3K A;  1PI4 A;  2P74 A;  5EM1 A;  4F94 A;  4QPR A;  4Q0J A;  3EEH A;  4JBF A;  3UE6 A;  4WEJ A;  3D72 A;  4Q0H A;  1KDW A;  1NYM A;  4HI4 A;  5HAP A;  3PXP A;  4GCZ A;  2KOI A;  3UPP A;  1M6K A;  2Z2M B;  3DTK A;  3UDF A;  3Q7V B;  1N9N A;  2XFT A;  3PYP A;  3IF6 C;  1MKI A;  3LO7 A;  1PZP A;  3IX8 A;  3IWI A;  2PBY A;  4R4R A;  1Q2Q A;  3T4L A;  5CEC A;  3WS5 A;  4NXE A;  2L1M A;  4AFI A;  3G4P A;  1YLW A;  2WKP A;  1LI0 A;  4WEL A;  1Z6F A;  2DCF A;  3RJU A;  1S6R A;  4I5S A;  5IS1 A;  1E4D A;  2EX9 A;  2ZQC A;  3IXB A;  4MMN A;  1FCN A;  4HP9 A;  3GVB A;  4FUW A;  1H5X A;  4MNR A;  1SKO B;  1NZU A;  4PMA A;  2HJ9 C;  3T50 A;  4N1H A;  4HHD A;  3CWF A;  2J8Y A;  4MDZ A;  3A3E A;  5EOE A;  4E3L A;  1BT5 A;  3LR5 A;  3H7W B;  2GZA A;  2BLS A;  3P7N A;  2DNS A;  3QP6 A;  4ZDX A;  5EVI A;  1TS7 A;  5A91 A;  3F1P A;  2OAP 1;  2I72 A;  2ZM8 A;  4N92 A;  2J9O A;  3T4O A;  3N4I A;  5HAQ A;  4C6Y A;  1YLY A;  2RL3 A;  1W79 A;  4OQI A;  3D4F A;  1M40 A;  4ETZ A;  3I7J A;  5E2G A;  2KX6 A;  3MFD A;  4XUZ A;  4EES A;  5EVI B;  4CLC B;  1XA1 A;  2UV0 E;  4PKY A;  3LR4 A;  3NDE A;  4LRZ E;  1D1J A;  4KG5 A;  4CPK A;  3MKF A;  1ALQ A;  2HP9 A;  4NET A;  4RQ9 A;  3MSH A;  5AJG A;  3HLG A;  1CJF A;  2PD7 A;  2G2U A;  3TE8 A;  4KG6 A;  2ZQ7 A;  4N1X A;  4GHI B;  4R3B A;  1GCE A;  5HL1 A;  2J3W A;  3Q82 A;  3UPN A;  1N9B A;  2ZC6 B;  4HOI A;  4IJG A;  2ZL1 B;  4KZ3 A;  3D3O A;  2OWH A;  2J7V A;  1HVB A;  2A49 A;  2VK3 A;  5G4Y A;  2VKS A;  4WL9 A;  1W63 Q;  3VP3 A;  1K6R A;  4IVK A;  1DJB A;  3RXX A;  1H8M A;  1YLP A;  3U2A A;  3TJZ C;  3UB5 P;  4MN5 A;  2V1B A;  3LIA A;  3IBJ A;  5FSR A;  1JTG A;  4BJP A;  5J3W A;  1YPR A;  4KQO A;  4R4S A;  4R3J A;  4FCF A;  1L0D A;  1ZG6 A;  3CI6 A;  3BEC A;  1BLP A;  3T4K A;  5GL9 A;  3VP2 A;  2HF6 A;  3PAE A;  4WZ5 A;  4PM9 A;  1XGI A;  5IT5 A;  2ZQ9 A;  3S7O A;  1QMF A;  1ES4 A;  2O9C A;  1KDS A;  5HWT A;  3GR2 A;  3NUL A;  3B47 A;  4YIN A;  2W3D A;  4S2I A;  4JF5 A;  5A92 A;  1G68 A;  3FYZ A;  1YLZ A;  5D3O A;  2VV8 A;  2Y2N A;  3P09 A;  1FIL A;  4FSF A;  3EWK A;  4O0P A;  4GOG A;  3SH8 A;  3UPO A;  1CK3 A;  5EOO A;  1IYO A;  5HL6 A;  2XSS A;  3HBR A;  4HP4 A;  4DE0 A;  1HTZ A;  3VSK A;  3OC2 A;  1K56 D;  1XJ4 A;  2WZX A;  5JYO A;  1GHM A;  4LV0 A;  5FAS A;  1FSW A;  4OLG A;  3V3R A;  5FEG A;  5M18 A;  4X55 A;  2PR5 A;  4BL2 A;  1JVJ A;  2JCH A;  1ONH A;  4R38 A;  2JC7 A;  1YSQ A;  2Q9M A;  1IFQ A;  4WM9 A;  4IED A;  1XX2 A;  4LGW A;  4HBT A;  2IA2 A;  3W2Z A;  4OLD A;  3H82 B;  1K0K A;  2VGJ A;  4GDN A;  4MCW A;  4MEZ A;  4IUH A;  1ERM A;  2ZQ8 A;  3MZE A;  2INW A;  1NRF A;  3C4P A;  4H6J A;  1PI5 A;  5TJJ A;  3N7W A;  4OPQ A;  1FR6 A;  5LBR A;  4CLC E;  4Q0I A;  4EBL A;  2PYP A;  5CHU A;  3H82 A;  1K4F A;  2H5S A;  3KSH A;  4BD0 A;  1TVF A;  3C2W A;  3P98 A;  5DTT A;  1FSY A;  1TF1 A;  2B5R A;  3QP5 A;  4QY5 A;  4H6J B;  2FFY A;  2OLU A;  2ZM2 A;  4QD4 A;  4RX2 A;  1P9W A;  2Y2K A;  2Y2M A;  2ZOH A;  4YWZ A;  1V9Y A;  2Z6C A;  4E6W A;  4WYY A;  5HD3 A;  2Y91 A;  4H8R A;  2JBF A;  4G3W A;  4Y0T A;  1SKO A;  2P9V B;  3LFV A;  5CGW A;  2WKE A;  4IBR A;  4MBK A;  5EVE A;  1K4E A;  2OOL A;  4XT2 A;  5CTN A;  3T1Q B;  2D01 A;  3IXH A;  1Y28 A;  5F82 A;  3QNB A;  2O9B A;  2V8F A;  2H28 A;  1PWG A;  1S4R A;  3BW6 A;  2Y2I A;  1BTL A;  5L07 A;  3JVV A;  4ZTK A;  1S66 L;  5GLB A;  3N8S A;  3V39 A;  2J3T C;  4KZ5 A;  1KE4 A;  3H9W A;  2VGL S;  3UE1 A;  1T18 A;  3PAG A;  3NOU C;  3HUM A;  4E3K A;  4ZRR A;  2WK0 A;  3SOI A;  4QB8 A;  3MR0 A;  3IHB A;  5F5Y A;  2Y2O A;  1GHI A;  4FTX A;  3O88 A;  1YM1 A;  3FC7 A;  2VGK A;  4EEU A;  2VX8 A;  5EVI D;  4K0X A;  4HEF A;  1OJG A;  5HAI A;  4E3I A;  3IWQ A;  3A3F A;  1NLY A;  3CG5 A;  1OT6 A;  3BFC A;  1NWZ A;  3BRM A;  3SS4 A;  4JXS A;  2D02 A;  4BQM A;  1G6O A;  5DFX A;  3S1Y A;  3GV9 A;  1K38 A;  3CPT A;  3UN7 A;  4U0T A;  1WA9 A;  5TBM B;  3ZFZ A;  3C5A A;  3C7V A;  3Q7V A;  1O07 A;  5CX7 A;  4HBU A;  1QME A;  3BJN A;  3HLF A;  4LV2 A;  1GA0 A;  4JXV A;  3JVU A;  1P9R A;  4QU3 A;  4DDY A;  4E3O A;  5DFY A;  1TD5 A;  5HDD A;  5F1F A;  4PM8 A;  4B4Z A;  3LIE A;  4JGR A;  3UDX A;  4NEE D;  3MMH A;  5TBM A;  1E3U A;  4Y15 A;  2HDU A;  2P9V A;  3HLW A;  3B3X A;  2IWC A;  3KSF A;  1K57 A;  1MC0 A;  5CEB A;  5K5B A;  3OPR A;  2Y2J A;  4BL3 A;  2W3G A;  4QY6 A;  2HJE A;  1PRQ A;  4WMC A;  1KGE A;  1KVM A;  2J9P A;  4HH2 A;  2VZW A;  3ITB A;  2XH9 A;  2VGL M;  3NI9 A;  4B93 A;  1BLH A;  1ESU A;  5HW3 A;  1CEF A;  3T4Q A;  3LIC A;  2G7U A;  3MXR A;  5HZH A;  1D7E A;  1L0G A;  3LR3 A;  2JKT I;  2CMN A;  5A90 A;  1JWV A;  2QWS A;  3LYX A;  4NKP A;  1HD8 A;  2GNX A;  4KZ8 A;  1TS8 A;  3FPW A;  3O87 A;  1WYC A;  5L09 A;  1VEU B;  1NZO A;  3IX4 A;  5M19 A;  1PWC A;  5FEF A;  1I2S A;  4LEN A;  3KYE A;  4P6Z S;  5CED A;  1PNE A;  3V3S A;  2JKG A;  3F1P B;  2HV1 A;  3L7H A;  5FAT A;  3ZGA B;  3ZG5 A;  3T4S A;  4ZBE A;  3EGX C;  4I3J A;  3IH8 A;  3MKE A;  3KYZ A;  4GD8 A;  2V0W A;  3VV4 A;  3E4Q A;  4Y13 A;  3EEA A;  3MF0 A;  4S2P A;  2QJ5 A;  3IF5 A;  2HP6 A;  1VEU A;  2WYX A;  4R0Q A;  3ZHH A;  3NDG A;  4UEY A;  4OQ0 A;  5J8X A;  3RXW A;  2Y55 A;  1T1C A;  3NBL A;  5J4E A;  4NXG A;  4YNR A;  3U4L P;  4ME4 A;  5HPI A;  4EXO A;  3UO9 A;  4YFM A;  1LL5 A;  1T19 A;  1IKG A;  2K2N A;  4UQI M;  3E98 A;  1MWU A;  1KGF A;  3E2K A;  1ESI A;  1UGU A;  3UMD A;  1MZU A;  3NHQ A;  1XFN A;  3EQU A;  5FQI A;  3CPT B;  1LSV A;  3LUQ A;  1S4S A;  2A2L A;  1MWT A;  2W1R A;  5DTS A;  3BM6 A;  4EW7 A;  4N9K A;  3VOY A;  3O5Y A;  2X01 A;  2XK1 A;  1RGZ A;  5DVA A;  3CUE C;  4I3I A;  3UE3 A;  3SZT A;  4HIA A;  2Z6D A;  4K91 A;  2A3U A;  1DP8 A;  3ZNT A;  1GSX A;  1G5U A;  2ZMF A;  2QMI A;  4ARZ A;  3Q81 A;  1S1Y A;  3FKV A;  3MXQ A;  4GB7 A;  4JF6 A;  3JPU A;  4X1L A;  3T1X A;  3C38 A;  2ZC5 B;  2ZLY A;  1I5Q A;  2YKH A;  2XD1 A;  2EX6 A;  3EQV A;  1Z09 A;  2ZBB A;  4RX3 A;  1MBL A;  3G2Y A;  1XKZ A;  4IHQ A;  3NIA A;  3ZVW A;  3ZG9 B;  4ZJ2 A;  4ARZ B;  3E4O A;  5L8M A;  3T12 B;  3UB7 A;  2QHK A;  3ZNY A;  3MQQ A;  3N6I A;  4KZ6 A;  3UDI A;  3V50 A;  2PHY A;  2PU4 A;  1F9I A;  1MY8 A;  2ZC7 A;  4ZJ1 A;  3G2Z A;  2FFF B;  3DBA A;  5F1G A;  3PBN A;  4Y7P A;  3PR6 A;  3NJA A;  4UA9 A;  2V20 A;  3T4T A;  4KQQ A;  4U0X A;  1IKI A;  2HGV A;  1P0Z A;  3OBF A;  5FDS A;  2IWD A;  2I9V A;  4CQH A;  5HD5 A;  4MBF A;  2ZC4 B;  1KVL A;  1J3W A;  2M1C A;  4HJ4 A;  1SCW A;  1RCJ A;  4HQA A;  3OCN A;  2BAS A;  2VV6 A;  3TW8 A;  1SKF A;  4JGQ A;  2K7S A;  3WS2 A;  4Y2F A;  3LR0 A;  1VQQ A;  5KZH A;  2QZ6 A;  4U3T A;  4JGO A;  3R4K A;  4YOF A;  1VM1 A;  2A24 B;  5DKK A;  2EX2 A;  3NCK A;  1PW8 A;  3BQ8 A;  1XA7 A;  1PWD A;  3N8R A;  3LID A;  1T1B A;  4K08 A;  1MWS A;  2V9A A;  3AGE A;  1L2S A;  3B42 A;  1NYY A;  4HNB A;  5GLD A;  3VE4 A;  3NOP C;  4HY8 A;  3A0S A;  4HJ6 A;  3CZD A;  1PZO A;  3CMZ A;  3PHY A;  4QHC A;  1STZ A;  5F83 A;  2L4R A;  4L9F A;  3IXG A;  2XA7 M;  2KDK A;  1RGY A;  4GKU A;  3EGD C;  4DJ3 A;  1DJC A;  2WGI A;  3IF6 B;  2V1Z A;  3K3D A;  1BLS A;  1MPL A;  3Q1F A;  1EWZ A;  4BBT A;  1LL9 A;  3IXD A;  3VFH A;  3PBQ A;  5EVL A;  3ZVT A;  3VP1 A;  1D06 A;  3FG8 A;  3QP1 A;  3DTM A;  5F68 A;  1SHV A;  4KZB A;  4HH3 A;  3W4P A;  2V0U A;  2GDN A;  4PM6 A;  1G28 A;  1UWP X;  4WLA A;  4EEP A;  1J9M A;  4LFU A;  1N9L A;  4I38 A;  4OKP A;  1ODV A;  5FL3 A;  4F3L A;  1GSV A;  1DJA A;  4XXR A;  4JF4 A;  2Y2Q A;  3TSG A;  2M7V A;  2XRO A;  1K25 A;  3ISG A;  3C30 A;  3UB8 A;  4EWF A;  1FOF A;  2JE5 A;  5CGX A;  3VMA A;  4S2K A;  5TR7 A;  4PAU A;  4RYE A;  4Q8I A;  5F69 A;  1IOU A;  3IHA A;  3O3V A;  3E4P A;  3LY3 A;  4X68 A;  1LHY A;  2C6W B;  4LLO B;  1K55 C;  3A3J A;  2JKT M;  2A24 A;  4QJG A;  4OOM A;  2EA9 A;  3IT9 A;  5EV0 A;  3S22 A;  1Q2P A;  2JHE A;  1CEG A;  2Y79 A;  2L0W A;  1ERQ A;  3HUN A;  3PBR A;  3CJM A;  4IUK A;  4DN0 A;  1C3B A;  3MQO A;  4WMC D;  3VOZ A;  4S2J A;  4DMZ A;  3BQA A;  1TDG A;  2OLV A;  3UB9 A;  3W8K A;  4FOF A;  4X6T A;  2HDS A;  3GMW A;  2ACG A;  2DRW A;  3G31 A;  2MJ6 A;  1GHP A;  3SH9 A;  4E04 A;  3KSG A;  3VSL A;  3IWO A;  1T1A A;  3V5M A;  3BWL A;  4BEN A;  3OZH A;  1NXY A;  1ES2 A;  5GHY A;  4JKT A;  2YKF A;  3BLM A;  4Z1W A;  3PBS A;  4NG2 A;  1FR1 A;  1XP4 A;  1XPB A;  5FAQ A;  5CRF A;  2WKH A;  4HES A;  3T1R A;  4GS9 B;  4KZA A;  3M6H A;  5HDC A;  4DDS A;  4FH4 A;  4X69 A;  1H8Y A;  5E2E A;  2O9A A;  3LY4 A;  2Y2H A;  3S7Q A;  4L9G A;  3HCY A;  1XGJ A;  3PBT A;  1PYY A;  2Y59 A;  4PKY G;  3OCL A;  1EI5 A;  2P7J A;  3L9K A;  3F1O B;  2VEA A;  2WKR A;  3WS1 A;  2ZM0 A;  2KLI A;  1SZV A;  1A0K A;  2XGN A;  3C4O A;  5L2F A;  3A0V A;  3EOI A;  3GQZ A;  4EU0 A;  4B9O A;  2K31 A;  2LB9 A;  5FI2 A;  1IEM A;  3HLB A;  3LCE A;  1BUE A; 
#chains in the Genus database with same CATH homology
 1YSP A;  4ME4 A;  2QKP A;  5HPI A;  4EXO A;  3F1O A;  5IU1 A;  4HOI A;  5HWW A;  4IJG A;  2J3T D;  1T19 A;  3LIF A;  4ETX A;  3D3O A;  2K2N A;  2OWH A;  4UQI M;  3E98 A;  3R7W A;  3HJK A;  2VJW A;  3KYQ A;  4KQD A;  1P97 A;  1UGU A;  3CIT A;  4KUO A;  1S67 L;  1MZU A;  3UMD A;  3NHQ A;  1XFN A;  3EQU A;  4GJ4 A;  5HPF A;  5G4Y A;  2VKS A;  1LSV A;  5DKL A;  3LUQ A;  1W63 Q;  4WL9 A;  2JN7 A;  2VLG A;  3S7P A;  1S4S A;  2A2L A;  2W1R A;  1XFQ A;  3OLO A;  5DF9 A;  4EW7 A;  1H8M A;  3U2A A;  3TJZ C;  2OWJ A;  3LI9 A;  4MN5 A;  2V1B A;  3O5Y A;  3LIA A;  3IBJ A;  4P6Z M;  4BMW A;  3VE3 A;  3RFB A;  3CUE C;  4I3I A;  3UE3 A;  3ZYT A;  3KX0 X;  4BJP A;  5J3W A;  4KQO A;  1UWN X;  2EWV A;  4Y3I A;  4HIA A;  3CI6 A;  4Y5F A;  2Z6D A;  3ICY A;  1DP8 A;  2PT7 A;  4M4X A;  3T4K A;  1GSX A;  2ZMF A;  1W63 M;  4ARZ A;  3GEC A;  1S1Y A;  2HF6 A;  3MXQ A;  5DJU A;  2PD8 A;  5EFW A;  3C38 A;  3S7N A;  5IT5 A;  4BBU A;  3IS2 A;  3S7O A;  2B02 A;  2YKH A;  2PYR A;  2EWW A;  3EQV A;  4L9E A;  2M7U A;  2O9C A;  2ZBB A;  5HWT A;  4EQ1 A;  1DRM A;  2NUT C;  3B47 A;  4IHQ A;  3ULF A;  1KOU A;  2W3D A;  4ARZ B;  3C8C A;  3G6O A;  3E4O A;  5L8M A;  3UB7 A;  2QHK A;  1NRJ A;  2V1A A;  3BY9 A;  4EER A;  3MQQ A;  2VV8 A;  4OOL A;  5I5L A;  4FSF A;  4G3V A;  3EWK A;  4O0P A;  4UQI S;  3OOV A;  4NXB A;  5HL6 A;  2XSS A;  2W3H A;  2PHY A;  1ZHH B;  4HP4 A;  1F9I A;  3OC2 A;  3GDI A;  4L0L A;  1XJ4 A;  1F5M A;  3DBA A;  4CLC A;  3PBN A;  4GW9 A;  3PR6 A;  3NJA A;  3T4T A;  2PR5 A;  1OJ5 A;  4F3L B;  2HGV A;  1P0Z A;  2ZMV A;  5DJT A;  3OBF A;  4R38 A;  2W27 A;  3ZQ5 A;  1YSQ A;  2I9V A;  2QJ7 A;  4CQH A;  5HD5 A;  1IFQ A;  1OTD A;  3LIB A;  5HDS A;  2P04 A;  2M1C A;  2FZ0 A;  3RH8 B;  2FH5 A;  4HJ4 A;  2JKR I;  3A0R A;  4HQA A;  3R7W B;  3OCN A;  2BAS A;  2VV6 A;  3K3C A;  1LSX A;  2IA2 A;  3TW8 A;  1BYW A;  3W2Z A;  1JNU A;  4CLC D;  4JGQ A;  2K7S A;  2LB5 A;  4Y2F A;  3H82 B;  3LR0 A;  2NUP C;  4MCW A;  1LSW A;  2Y8H A;  3CLO A;  4IUH A;  4JGO A;  2PR6 A;  2ZOI A;  3R4K A;  4YOF A;  1V9Z A;  2R78 A;  4PHT A;  2INW A;  2A24 B;  4H6J A;  5DKK A;  1OTI A;  5TJJ A;  4WUJ A;  3BQ8 A;  3LID A;  1T1B A;  4GLQ A;  4K08 A;  2W3E A;  4Q0I A;  5LBR A;  4CLC E;  5J7E A;  2PYP A;  2V9A A;  5AVE A;  3H82 A;  4EET B;  3KSH A;  3V67 A;  3LI8 A;  3B42 A;  3KSI A;  4HNB A;  5MC7 A;  3VE4 A;  3UB6 A;  3C2W A;  3NOP C;  4HY8 A;  3A0S A;  4HJ6 A;  1TF1 A;  5KSH A;  3PHY A;  1XJ3 A;  1STZ A;  4H6J B;  4DJ2 A;  3BY8 A;  4LRX C;  2J80 A;  2L4R A;  4XT2 B;  5F6A A;  4JGP A;  4L9F A;  1P9W A;  2XA7 M;  2ZOH A;  2KDK A;  1F98 A;  4YWZ A;  1V9Y A;  4KUK A;  2O99 A;  2Z6C A;  3UME A;  3EGD C;  4MN6 A;  4DJ3 A;  5HD3 A;  3K3D A;  2WKQ A;  3IBR A;  4MN7 A;  3MJQ A;  4G3W A;  3LFV A;  4WEK A;  4BBT A;  2B18 A;  2P08 A;  3VOL A;  2OOL A;  4XT2 A;  4O8G A;  2D01 A;  1YKD A;  1MKM A;  1XJ6 A;  3PBQ A;  3CAX A;  1Y28 A;  3TRC A;  1D06 A;  2W1T B;  2O9B A;  3FG8 A;  2H28 A;  5F68 A;  3T4J A;  1TS6 A;  4CLC C;  4GS9 A;  5A8B A;  2GJ3 A;  1S4R A;  3BW6 A;  4HH3 A;  3SW1 A;  2V0U A;  2GX5 A;  1G28 A;  1UWP X;  4WLA A;  3JVV A;  4EEP A;  3NOT C;  3E0Y A;  1S66 L;  1N9L A;  4I38 A;  4WN5 A;  1ODV A;  5FL3 A;  1OTA A;  4F3L A;  1GSV A;  4LRY C;  2J3T C;  1H3Q A;  3H9W A;  1OTE A;  4LPZ A;  5HWV A;  5KIZ A;  2VGL S;  4BWI A;  2W1T A;  1T18 A;  3HJI A;  2M7V A;  3B33 A;  3NOU C;  2XRO A;  3CUE A;  4ZRR A;  4EUV A;  2XRN A;  3C30 A;  3UB8 A;  3MR0 A;  1OT9 A;  5F5Y A;  1TS0 A;  4G3K A;  4PAU A;  4QPR A;  4R3A A;  4Q0J A;  1YAX A;  3EEH A;  3UE6 A;  4WEJ A;  2VA0 A;  3D72 A;  3FC7 A;  5F69 A;  1IOU A;  5G4Z A;  4EEU A;  4Q0H A;  2VX8 A;  4HI4 A;  3PXP A;  3E4P A;  1X0O A;  4HJ3 A;  1OJG A;  4GCZ A;  2KOI A;  2XA7 S;  4LLO B;  1NLY A;  1OT6 A;  2JKT M;  2A24 A;  1NWZ A;  4OOM A;  1N9N A;  3PBO A;  2EA9 A;  3PYP A;  2JHE A;  1DP6 A;  2D02 A;  5AVF A;  5C5K A;  1G6O A;  2Y79 A;  5DFX A;  1N9O A;  3T4L A;  2L0W A;  4R70 A;  1NLZ A;  3PBR A;  4NXE A;  4IUK A;  2L1M A;  4AFI A;  4NXF A;  4DN0 A;  1WA9 A;  3MQO A;  2OAQ 1;  5TBM B;  2WKP A;  4DMZ A;  3BQA A;  4WEL A;  5CX7 A;  3UB9 A;  3BJN A;  4FOF A;  2DMW A;  1VHM A;  4II7 A;  4I5S A;  3JVU A;  5IS1 A;  2MJ6 A;  2O0Y A;  3H7W A;  1P9R A;  4MMN A;  2VV7 A;  5DFY A;  1TD5 A;  5HDD A;  4E04 A;  5HSQ A;  1LT0 A;  3KSG A;  3LIE A;  4HP9 A;  4JGR A;  4BBV A;  4NEE D;  1T1A A;  3BWL A;  3MMH A;  5TBM A;  2HJ9 C;  3T50 A;  3KSF A;  4HHD A;  1MC0 A;  3CWF A;  5K5B A;  4MDZ A;  3IS2 B;  2YKF A;  3MQ0 A;  2W3G A;  4Z1W A;  3PBS A;  2HJE A;  3LR5 A;  3H7W B;  2GZA A;  1ZTU A;  3P7N A;  4HH2 A;  2VZW A;  4I3A A;  1S1Z A;  4R6L A;  2VGL M;  3RTY A;  4B93 A;  4GS9 B;  1TS7 A;  5HDC A;  3F1P A;  2OAP 1;  1LL8 A;  4WF0 A;  3T4Q A;  3LIC A;  2G7U A;  2W3F A;  3MFX A;  5HZH A;  3T4O A;  1OTB A;  1D7E A;  2JKR M;  1GSW A;  3LR3 A;  2JKT I;  2CMN A;  2O9A A;  2QWS A;  3LYX A;  4NKP A;  3KO6 A;  2GNX A;  4L9G A;  1TS8 A;  3FPW A;  3S7Q A;  3HCY A;  4ETZ A;  3PBT A;  3FPV A;  2PDR A;  2KX6 A;  2QYB A;  4PKY G;  4EES A;  3OCL A;  4GHI A;  4O01 A;  3F1N A;  1OPX A;  4P6Z S;  4CLC B;  4PKY A;  2P7J A;  3LR4 A;  4LRZ E;  3F1P B;  3F1O B;  2VEA A;  2HV1 A;  2W0N A;  3P01 A;  2WKR A;  1VB6 A;  3T4S A;  4RQ9 A;  2KLI A;  3EGX C;  4I3J A;  3KYZ A;  2V0W A;  3VV4 A;  3E4Q A;  5AJG A;  1XJ2 A;  3EEA A;  3MF0 A;  2QJ5 A;  3K2N A;  1EW0 A;  4I39 A;  2PD7 A;  3A0V A;  3EOI A;  4EU0 A;  3TE8 A;  4B9O A;  2K31 A;  4UEY A;  2LB9 A;  1DP9 A;  1T1C A;  4GHI B;  5J4E A;  3F1N B;  4NXG A;  4YNR A;  2J3W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...