3UE6A

The dark structure of the blue-light photoreceptor aureochrome1 lov
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
135
structure length
135
Chain Sequence
EDPDYSLVKALQMAQQNFVITDASLPDNPIVYASRGFLTLTGYSLDQILGRNCRFLQGPETDPRAVDKIRNAITKGVDTSVCLLNYRQDGTTFWNLFFVAGLRDSKGNIVNYVGVQSKVSEDYAKLLVNEQNIEY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Aureochrome1
publication title Crystal structures of Aureochrome1 LOV suggest new design strategies for optogenetics.
pubmed doi rcsb
source organism Vaucheria frigida
molecule tags Signaling protein
total genus 39
structure length 135
sequence length 135
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2011-10-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13426 PAS_9 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3ue6A00
4WN5A 4MN6A 2A24A 4BBUA 3LICA 2QHKA 2OOLA 3E4PA 3UB6A 5J3WA 4R70A 3D72A 1T19A 3C8CA 4BBVA 1V9ZA 3LYXA 2L4RA 2VV7A 3MXQA 2YKHA 2V1BA 3E4QA 4HJ4A 1XJ6A 1LT0A 3VE4A 2KX6A 1N9OA 3MQQA 3UMEA 3CWFA 5HZHA 1F9IA 5HDCA 3PHYA 2D02A 3UB8A 1OT6A 4LLOB 5KIZA 1LSXA 5AVFA 4EEPA 1TS6A 1XFQA 1S1ZA 5IS1A 3H82B 2VV8A 3MJQA 4NXEA 2PR6A 5A8BA 1OJ5A 1TS7A 4JGOA 3EWKA 1D7EA 2HV1A 2WKRA 4F3LA 2I9VA 2JN7A 4HOIA 2PYRA 2PDRA 4JGPA 4XT2A 2M1CA 2OWHA 4WF0A 5F5YA 3F1PA 3CAXA 2EA9A 1JNUA 5TBMA 5F6AA 1T1CA 4WL9A 4RQ9A 4R3AA 3NHQA 5J4EA 2L1MA 5DKLA 4HP4A 3UB7A 3G6OA 1T1BA 5DJUA 5HSQA 3NOTC 5DJTA 1S66L 3LI8A 4EEUA 4EERA 1XJ4A 4PKYA 4LRXC 3C2WA 3VE3A 1G28A 4K08A 4HHDA 2VLGA 4JGQA 2J80A 2INWA 1XFNA 4R6LA 3B33A 5HD3A 1P0ZA 2V0WA 4EW7A 1N9LA 4HH2A 3BY9A 1LL8A 1DP8A 1KOUA 1D06A 4HQAA 2K7SA 2D01A 4JGRA 4I5SA 4HY8A 4XT2B 1OTEA 3H7WA 3FG8A 4HNBA 3HJIA 3IS2A 3MQOA 5I5LA 3LUQA 1LSVA 4GHIA 2JHEA 5TBMB 3T50A 4DJ2A 1S67L 4PKYG 3VOLA 1XJ3A 1TS0A 2W0NA 4GW9A 3F1NA 3K3CA 4EESA 1Y28A 2V1AA 1DP6A 5HWWA 3RH8B 1VB6A 4WUJA 4EETB 4GS9A 2A24B 3RTYA 5F68A 4L9EA 4E04A 1GSXA 3P7NA 1OTAA 4HJ3A 3FC7A 4EQ1A 3LIDA 1GSVA 1BYWA 4I3AA 4KUOA 3UE6A 1TS8A 3NJAA 2P7JA 3ZQ5A 1OJGA 4HJ6A 5AVEA 4DJ3A 4HI4A 3LIAA 3PYPA 2Z6CA 1F98A 2QWSA 1OTIA 1T18A 2BASA 2PYPA 4HIAA 5G4ZA 2V0UA 4M4XA 1GSWA 1DRMA 4I38A 2VV6A 4KQDA 3A0SA 4NXBA 4H6JA 3A0RA 4LRYC 1OTBA 3H7WB 3F1OA 4MN5A 5DKKA 2ZOIA 5HDDA 3IS2B 2QKPA 2OWJA 1S1YA 2WKQA 4GHIB 2R78A 2ZBBA 2ZOHA 3GDIA 4B9OA 4WLAA 2PD8A 4HH3A 4EXOA 3F1NB 3LIFA 2W27A 1OTDA 3ULFA 3BY8A 5HWTA 1X0OA 4I3JA 4F3LB 2L0WA 4YWZA 4GS9B 4I3IA 5F69A 4LRZE 3UMDA 4BBTA 4R38A 1P97A 1V9YA 3F1PB 4L9FA 1S4SA 2VEAA 2KDKA 3LIEA 1OT9A 1UWNX 1N9NA 4GCZA 2QJ5A 1S4RA 5IU1A 2PHYA 5HWVA 1ODVA 3MFXA 2V9AA 5G4YA 3UB9A 3NOPC 4LPZA 4L9GA 3HJKA 3A0VA 4HP9A 1UWPX 3IBRA 3SW1A 2H28A 2Z6DA 1LSWA 1EW0A 3K3DA 2WKPA 5EFWA 3LIBA 3ICYA 1XJ2A 5J7EA 2GJ3A 2QJ7A 3NOUC 4H6JB 3KX0X 3LI9A 3F1OB 2PR5A 2PD7A 1UGUA 3E4OA 1DP9A 3H9WA 3H82A 3BWLA 2CMNA 3OLOA 3GECA 5HDSA 5HD5A 3MR0A 4I39A 1T1AA 2B02A 1MZUA 3EEHA 3CLOA 1NWZA 4NXGA 2YKFA 4NXFA 1WA9A 4KUKA
chains in the Genus database with same CATH superfamily
1ALQA 4MN6A 4OLGA 4OOMA 1EROA 1YKDA 3LICA 3C7UA 4R1GA 2QHKA 4Y0UA 2J7VA 3NDGA 2Y2PA 3PR6A 5GL9A 5FL3A 3ZNYA 3SS3A 3N8LA 2W3FA 4R3BA 3D72A 4CLCC 5FI2A 3C8CA 2XH9A 1JTDA 1V9ZA 3LYXA 2L4RA 1N9BA 2BLSA 4QD4A 1YLYA 3V50A 3N7WA 2IA2A 4ZTKA 2V1BA 2O9AA 3E4QA 1H3QA 4PM7A 2UWXA 2KX6A 3IF6B 1N9OA 3LR5A 4Z9QA 1LLBA 5TR7A 2FFFB 1KE4A 5A91A 1F9IA 3PHYA 1H8ZA 2D02A 2ZMFA 3UB8A 4BD0A 1WE4A 2BTFP 1SKOB 5IS1A 3H82B 1VETA 3MJQA 2DRWA 3IT9A 5KSHA 4UA9A 4JGOA 3EWKA 3ZCZA 1L3LA 1D7EA 2HV1A 2PBDP 4WMCD 4HOIA 3P09A 4KZ5A 4FUWA 3CJMA 1BT5A 2BG1A 2HDSA 5F5YA 3CAXA 3DBAA 2QYBA 3UN7A 3BQ8A 2W3HA 2KLIA 1T1CA 3L7HA 1E4DA 2ZL1B 1CEFA 4EBLA 4X25A 4WEKA 5C5KA 3LCEA 4IVIA 5FAQA 3ZG9B 5DTTA 3N8SA 3OCNA 4JLFA 1K54A 5EOEA 2CC1A 1Q2PA 3MZEA 4U0TA 4EERA 1YLZA 2VGLM 3RJUA 2ZM2A 3VSLA 4KZ9A 2OAQ1 4O8GA 4K08A 2VGKA 3KSGA 2WAEA 3W4OA 4DXBA 4GKUA 3BJNA 3QP1A 3HLCA 4E3MA 5F1GA 1ERMA 3UPNA 3HUOA 5CRFA 4EW7A 5DF7A 3FPWA 4QJGA 1LL8A 2J8YA 3HLWA 1KOUA 4X53A 4X69A 4P6BA 1D06A 2HZ5A 2J9PA 1NJ4A 5GLCA 1K6RA 4GDBA 4HQAA 1I2SA 4FH2A 1Z6FA 1M40A 1G6OA 4ESPA 3WS1A 1OTEA 3C4PA 3FG8A 4HNBA 1BZAA 2ZMVA 5FQMA 5GLBA 2P04A 1BLHA 1Y4OA 1S0WA 4XUZA 4PKYG 3UE1A 3PBRA 1K54C 3AGFA 2WGWA 1XX2A 3G30A 4OLDA 4GW9A 2QPNA 3K3CA 3UE3A 4EESA 4OKPA 2V1AA 3C5AA 4EUVA 1DP6A 5HWWA 5EVLA 4PMAA 1KE0A 3P98A 3GVBA 5HX9A 2ZC4B 4WYYA 4X1MA 4R0QA 2GZAA 2J3TD 3RTYA 1SDEA 1GSXA 1W8YA 4D60A 1FOFA 1NLYA 2Z2LB 1FCNA 3LY3A 3LR3A 2JKGA 2ZC3B 3GV9A 5AQ9A 2EXAA 1H8MA 3CI6A 1S6RA 3RFBA 1ZKJA 4EU0A 1K6SA 3KSHA 3PYPA 4OPYA 4EQIA 1T18A 2W1RA 1L0DA 5FASA 1H8YA 2BASA 3O87A 3V67A 2PRFA 3AGEA 4M4XA 1PW8A 5L8MA 4R4RA 1CF0A 5GHYA 1DRMA 3QNCA 4BQMA 2MJ6A 4IUHA 2IWCA 3KYQA 3BM6A 1OTBA 4ETXA 3IS2B 4X55A 3BLSA 2RL3A 4QY6A 3RXXA 4NEED 2XQZA 3KSIA 3CHWP 5FDHA 1FIKA 5CX7A 3VV4A 1BUEA 4OQHA 2Y2IA 1G6AA 4BD1A 1KGGA 2EFXA 1KVMA 1K55A 4Y5FA 3VP0A 3BY8A 4I3JA 1AXBA 5DTKA 1YAXA 4GS9B 1YLJA 4IVKA 4GN2A 5M19A 3LR4A 4LRZE 3UMDA 5D3OA 2DNSA 4LGWA 4MN7A 3BFFA 2WKEA 4MMNA 3SH7A 1OT9A 3N8RA 4CLCE 2ZQDA 3W4QA 3GR2A 1PIOA 4JXWA 3Q1FA 5HL6A 4ETZA 4Y17A 3R4KA 3BLMA 1JVJA 1VHMA 3NOPC 4LPZA 5FA7A 3UY6A 3PXPA 3IBRA 1IYSA 3UPOA 3K3DA 1ES4A 2WKPA 4GD6A 3E2KA 3IF6A 4JKTA 4LV2A 1TD5A 5J7EA 3HUMA 2Q9MA 3CPTB 1FCMA 4BWIA 3LGOA 2RCXA 1U60A 3LI9A 4QY5A 4N1HA 3OCLA 4RVAA 3UB5P 1K55C 1H5XA 4R4SA 1UGUA 1I5QA 3NC8A 3S1YA 1SKOA 1DP9A 2Y55A 4GZBA 3H82A 2OV5A 3GECA 5A90A 4QB8A 1RGYA 3MR0A 3G34A 5CTNA 4I39A 3O3VA 2EFUA 4UHUA 5LBRA 3EEHA 2WYXA 3IWIA 4ARZB 4NXFA 1WA9A 4KUKA 5CGXA 1KGFA 3T1QB 5DF8A 2OAP1 2IWDA 1K4EA 1L2SA 3NI9A 4BBUA 3C7VA 4BJPA 3N4IA 2O9CA 3TOIA 1MC0A 4KZ6A 1GA9A 4Z1WA 5J3WA 2ZL1A 1ZC2A 1LI0A 1FCOA 3IF6C 3PTEA 3C30A 4ZJ2A 1JTGA 2VV7A 4JBFA 2YKHA 4Y0TA 4FOFA 3VE4A 2EX8A 1ZG4A 3DTEA 4G3VA 2E8JA 3UDFA 2B5RA 1K38A 3CMZA 3MQQA 3P01A 3IQAA 4MEZA 5FI7A 3QHYA 5HZHA 2X02A 3Q07A 2V8FA 1QMFA 4UA6A 4IUKA 1OT6A 1L0FA 3LY4A 3ZHHA 1ESIA 5KIZA 3QP4A 4OPQA 4S2MA 1K25A 3PBQA 1S1ZA 2V20A 5DFXA 2G2WA 4OP8A 1PNEA 1IEMA 4U0XA 1MXOA 1TS7A 3JYIA 3TE8A 3HLGA 2W3EA 5L2FA 4EWFA 1DJAA 2JN7A 2WK0A 2WZXA 2JC7A 1YLPA 2O99A 3GSGA 4YFMA 2M1CA 2WGIA 2W1TB 1K56A 3F1PA 3DW0A 2EWWA 3C38A 3OZHA 2UV0E 3MZFA 4RQ9A 5J4EA 2L1MA 1T1BA 3VP4A 5DJUA 4UEYA 1LHYA 2ZQ9A 5DJTA 3IH9A 4S2PA 3CZDA 4IHQA 5EM0A 4EEUA 5I94A 3MSHA 4P6ZS 5DVAA 4PKYA 4LRXC 4C75A 4X68A 4DDSA 3C2WA 1G28A 4JGQA 5JYPA 5EVEA 1MKIA 4Q0HA 3IWOA 3PBNA 3I7JA 5HD3A 4E3JA 1LI9A 3VFFA 2M7UA 1DP8A 4DMZA 3IXBA 3QP6A 5FEGA 2OSUA 4OPZA 3S7OA 4K91A 3DAVA 2V8CA 1NYYA 3QP8A 2D01A 5CTMA 4D2OA 2PU4A 4I5SA 2XA7M 4HY8A 3E2LA 4LENA 3IS2A 3MQOA 5I5LA 5TBMB 3T50A 4S2OA 1MWSA 5FQIA 5TJJA 1MY8A 1P9RA 1XJ3A 2GDNA 1TS0A 2ZQ7A 4K0WA 4XXRA 5FQJA 1E3UA 1W8QA 2K31A 2X71A 2V1ZA 2Y2KA 4BL2A 3A3FA 5L09A 4EETB 3G32A 1PZOA 4DE0A 4GS9A 3BYDA 1O7EA 3OBFA 5EOOA 4PHTA 2Y91A 3MS6A 2R9XA 5F68A 3IF5A 4L9EA 3KYEA 3WRZA 1W63Q 4P6ZM 3P7NA 1OTAA 4RA7A 3FC7A 5EE8A 5E2GA 3ZG8B 1HTZA 3FYZA 2JKTM 1SDNA 1DJBA 5M18A 1MKMA 3SS4A 3W4PA 2X01A 2VX8A 1DJCA 3UE6A 3NJAA 4KZ4A 2P7JA 4JF4A 3ZQ5A 3T4LA 5HARA 4MLLA 2JCHA 4HJ6A 4DJ3A 3E98A 1F98A 2QWSA 2PYPA 4HIAA 2HP9A 3IX8A 5G4ZA 5TFQA 2V0UA 1XXMA 4I38A 4L0LA 3CPTA 4F94A 4NXBA 4U3TA 1SHVA 3EGXC 3IXHA 1XGJA 3A0RA 5EM1A 3H7WB 3M2JA 4MN5A 3M6BA 5DKKA 2QKPA 4HEFA 1S1YA 2WKQA 2R78A 4KQOA 3T4OA 2ZBBA 3A3DA 3GDIA 1G68A 4B9OA 4GOGA 2Y2HA 2PD8A 3NY4A 4HH3A 1MWRA 3LIFA 1YMSA 1VM1A 2W27A 3D9YA 3ISGA 1BLSA 4OH0A 5HAIA 5FEFA 2ZQCA 2XSSA 3NBLA 3ULFA 5HWTA 1X0OA 1IFQA 2L0WA 4FD8A 4Q0IA 4ARZA 3VP1A 5KZHA 5AQ7A 3CG5A 5EECA 1V9YA 1L0EA 4OOYA 3F1PB 4L9FA 1S4SA 3WRTA 2VEAA 2XFSA 2B18A 3Q7VB 3MF0A 1UWNX 1M6KA 4JF6A 5F83A 1S4RA 5CERA 3UDIA 4BMWA 1IOUA 3MFXA 3KYZA 2V9AA 3UB9A 4GDNA 2JKRM 3A0VA 5HAQA 4EV4A 4OP5A 2Z6DA 2GNXA 1LSWA 3BFEA 3V5MA 1MPLA 4OONA 3ICYA 2GJ3A 5FI6A 3R7WB 3LEQA 1ES5A 2XLNA 4H6JB 3F1OB 1E25A 4CLCD 3NECA 1OMEA 2PD7A 3FV7A 1CI8A 3MZDA 2CMNA 3OLOA 1O07A 3O86A 5HD5A 1YSPA 3MBZA 1K56D 1ERQA 2O9BA 2B95A 1NWZA 3FWLA 3A3IA 3VFHA 1FSYA 5HPFA 3FPVA 1XA1A 4B93A 2W1TA 3MMHA 3FKWA 4UQIS 2WZZA 3UNWA 3T4KA 1K0KA 2WAFA 2JE5A 3E4PA 3UB6A 2GX5A 2WADA 1HD8A 2H10A 2HJ9C 3OPLA 3A3EA 1T19A 2XD1A 4UA7A 5GLDA 3G4PA 1BULA 2HF6A 2Y2GA 3DTMA 1HZOA 2PU2A 2J9OA 4HJ4A 3VP3A 1XJ6A 3Q82A 1LT0A 2O0YA 4FSFA 4Y2FA 4ZBEA 5GHXA 3IHBA 4IBRA 2ZC6B 2G2UA 3JPUA 1C3BA 4RX2A 5HDCA 3IXDA 2H5SA 2XF3A 4KZ3A 1NYMA 4PM6A 5AVFA 4EEPA 1TS6A 3NULA 5CECA 1PZPA 1JWZA 2HDRA 4WMCA 2PR6A 1NXYA 1MWUA 1OJ5A 4BLMA 3RXWA 4DN0A 2XFTA 1PI5A 1EI5A 5AQAA 2I9VA 4A5RA 4Q8IA 5HFOA 2PYRA 4JGPA 2Q0OA 2Y4AA 2OWHA 3GTCA 5FAPA 3E0YA 4KG6A 3HL9A 4KENB 2EA9A 4FH4A 1JNUA 5TBMA 4CQHA 5F6AA 4UQIM 4QHCA 3HLDA 3WS4A 1WYBA 3NHQA 4JXSA 5DKLA 3O5YA 4R23A 1K57A 3UB7A 4OQ0A 1CJFA 3G6OA 4BL3A 3PAGA 3HCYA 3MKEA 5HSQA 3NOTC 3S7NA 4HESA 5EVIB 1S66L 5CEDA 5AJGA 3B47A 3PBOA 1XJ4A 1YSQA 4JXGA 1PWDA 1YLTA 2Y2JA 2DCFA 4R6LA 4CJNA 2EWVA 3B33A 1TEMA 1KE3A 2J3WA 2I72A 2V0WA 4FTXA 1ESUA 2WUQA 1N9LA 4HH2A 3TJZC 3BY9A 3ZVWA 4LV3A 2Y2MA 2EXBA 3BFGA 5CXWA 3QNBA 3OPPA 4S2KA 2IWBA 2LB5A 3K2NA 2ZQ8A 2Y2NA 2K7SA 4RX3A 3S4XA 4S2LA 4LFUA 4XT2B 1NRFA 1K57C 3H7WA 4KZ7A 3HJIA 4IEDA 4IJGA 3G31A 5JYOA 3LUQA 4DJ2A 1KVLA 1N4OA 1KDWA 3VOLA 4II7A 2W0NA 5CHMA 2W3GA 1BLPA 3TG9A 2ZC5B 1VEUA 1PRQA 3O88A 3S22A 2A2LA 3RH8B 1FILA 3WWXA 4WUJA 3D3OA 1VQQA 2EX2A 1XP4A 3ITAA 5HPIA 3Q81A 3IHAA 3B42A 1TDLA 1LL9A 5KMWA 3Q7VA 3BQAA 5F82A 2FFYA 2PBYA 3BECA 5DFYA 4N1XA 5HW3A 3IH8A 5FATA 1PFLA 1JWPA 3S7PA 2ZM8A 2C6WB 4OQIA 1NY0A 4JPMA 3CUEA 3W8KA 4OVDA 1YT4A 4MBHA 4Y15A 1OJGA 3BEBA 1W5DA 1STZA 3KSFA 1OTIA 2Y79A 3IXGA 1KGEA 2ACGA 5E2HA 1AWIA 1GSWA 2XGNA 1BTLA 2VV6A 3R7WA 3G2YA 3A0SA 3NIAA 5EPHA 3EQVA 3T12B 4WZ4A 4H6JA 2J3TC 2ZJ9A 3F1OA 1YPRA 3EQUA 4GHIB 2ZD8A 4LCLA 3A3JA 4WLAA 2C5WB 4DXCA 3DWZA 4NG2A 3F1NB 4PM9A 1SCWA 5E2FA 2PT7A 3LO7A 5MC7A 3U2AA 1OTDA 3BFCA 2Y2QA 4UAAA 5GLAA 2HP6A 2VGJA 4KQRA 3SOIA 4I3IA 5F69A 3TW8A 1P97A 3ZVTA 3QP2A 2VGLS 3CUEC 2KDKA 2VA0A 3C4OA 1RGZA 2Y2LA 1F2KA 2M7VA 1PYYA 3GRJA 1ZHHB 2VZWA 1N9NA 4X1LA 2R9WA 5AQBA 4K0XA 2QJ5A 2EX9A 4EUZA 5IU1A 1W7FA 4S2JA 5HWVA 1ODVA 1ONHA 5G4YA 4S2IA 4NK3A 4G3KA 4L9GA 2VKSA 2XDMA 1TVFA 3AGDA 4HP9A 1UWPX 4FCFA 4DKIA 3SW1A 1PW1A 4G3WA 3BRMA 2ZLYA 4Y13A 3OPRA 3PBTA 5EFWA 5J8XA 3LIBA 2QJ7A 5E43A 3NOUC 1RP5A 3IX3A 2VK3A 4OQGA 3KX0X 5L10A 1SKFA 2PR5A 1PWGA 4KG2A 4NKPA 4ZAMA 3E4OA 5U47A 3T1RA 1ZG6A 3H9WA 5FAOA 1CK3A 1D1JA 3BWLA 4M3KA 3CITA 4LV0A 2Y59A 5CGWA 5FQ9A 2P08A 4Q0JA 4PM8A 4XUXA 4ID4A 3BW6A 3NCKA 3FKVA 2OLUA 2WGVA 1NRJA 2XD5A 4DE3A 4WN5A 3VSKA 2A24A 4Y7PA 3S7QA 3TRCA 4N92A 4O01A 3UPPA 4KZ8A 2OOLA 4JF5A 4HBTA 3HLBA 3HVFA 4ZDXA 2LB9A 1IYQA 1CQAA 5EUAA 4R70A 4GB7A 4WBGA 1FR6A 1VEUB 4BBVA 4OOLA 3SS5A 4R3JA 1DY6A 1XPBA 3V3RA 1P9WA 5EVIA 3MXQA 1NZOA 1YQSA 4X56A 1ES2A 1GCEA 3UDXA 4O7DA 4MBFA 4CLCB 1NLZA 4E3IA 4C6YA 1HVBA 3UMEA 3CWFA 2FZ0A 3FZCA 1ZTUA 2ZC7A 1Q2QA 1IYPA 4WELA 3SH8A 4LLOB 1GHPA 2HJEA 4DF6A 4KG5A 1LSXA 3MKFA 3SZTA 2A3UA 1XFQA 4QPRA 2VV8A 3IX4A 2Y8HA 4NETA 4NXEA 3M2KA 2KOIA 3T4SA 2P9VB 5A8BA 1ES3A 5FQKA 1RCJA 4PAUA 2WKIA 3IWQA 1GHIA 2WKRA 4F3LA 3VP2A 2PDRA 2FH5A 4XT2A 5CHJA 4WF0A 1PI4A 2V2FF 3HLEA 3MFDA 1NZUA 1BSGA 2H0YA 4P87A 4YINA 4E6WA 3JVVA 4WL9A 5F1FA 4R3AA 3EOIA 5EVIC 3SH9A 2E8IA 1IELA 1FQGA 4HP4A 2Y2OA 5CHUA 2PAVP 4IBXA 2WKHA 3GMWA 1EWZA 4LCMA 1HLUP 2HGVA 2XK1A 1MBLA 2A49A 3LI8A 2QZ6A 2HPBA 1Z09A 3VMAA 3HUNA 4ME4A 4DE2A 4AFIA 4S2NA 3MXRA 4RYEA 3VE3A 4HHDA 2VLGA 2J80A 1GA0A 4PPRA 2INWA 1XFNA 3ZGAB 4O0PA 1L0GA 4ZRRA 4B88A 2ZQAA 3BFDA 4GJ4A 1P0ZA 4WEJA 1VETB 4ZJ1A 1CI9A 3W2ZA 1ONGA 5FDSA 3DTKA 3DTIA 4PM5A 4QU3A 3EEAA 3ZYTA 5IT5A 3DWKA 4P85A 5EV0A 4DE1A 4JGRA 4WZ5A 3GQZA 4BENA 4E3NA 3OPHA 3V3SA 2P74A 1OPXA 2K2NA 3WS2A 4E3OA 3ZDJA 3JVUA 4LV1A 3LFVA 4X6TA 1LSVA 4GHIA 2JHEA 3D4FA 1S67L 1YMXA 1XGIA 1G5UA 3G2ZA 3HLFA 2XRNA 3PBSA 4GNUA 3F1NA 1TDGA 5K5BA 1Y28A 4C3QA 4S2NC 1W63M 2JKFA 3L9KA 4KZBA 3EGDC 4N9KA 1VB6A 5GHZA 5FQQA 1YLWA 1IKGA 1WYCA 4Y3IA 2H0TA 4H8RA 4HBUA 1GHMA 3OOVA 2A24B 1E3UD 4B4XA 1IYOA 2W3DA 5FSRA 4YNRA 2ZM0A 4MBKA 4E04A 4HJ3A 4EQ1A 3U4LP 5DF9A 3ZG7B 3LIDA 1GSVA 5E2EA 1BYWA 3UE0A 3LEZA 5CGSA 4I3AA 2JKTI 1J9MA 4KUOA 5A92A 2XR0A 5IHVA 1TS8A 2HDQA 4EBNA 1K4FA 1YM1A 1LL5A 4OPRA 3OC2A 4WZ5C 5AVEA 4E6XA 2EX6A 3T1SA 4HI4A 3LIAA 3NDEA 2Z6CA 5CEBA 2OLVA 4KZAA 2XROA 5G18A 5TGFA 2AVXA 5HL1A 3M6HA 1I2WA 4KQDA 3PAEA 4P0MA 3T4JA 3WS5A 1QMEA 3B3XA 3T4TA 4QWOA 3V39A 5A93A 2JBFA 4LRYC 3N6IA 4MCWA 2ZOIA 5HDDA 1JWVA 3MQ0A 5BOHA 2OWJA 2Q9NA 3UO9A 3HBRA 2ZOHA 4GLQA 4N9LA 1CEGA 4CPKA 2QMIA 2WGWB 4Y0OA 4EXOA 2VJWA 3WS0A 1SZVA 3MXSA 5KSCA 4F3LB 1J3WA 3ZFZA 4EBPA 1W79A 4B4ZA 3TSGA 1TF1A 4YWZA 1FSWA 4MDZA 4BBTA 4R38A 1MWTA 1Y54A 3LIEA 1H0MA 4GCZA 1IKIA 5EVID 2PHYA 3G35A 2NUTC 1F5MA 3ITBA 4DDYA 1PWCA 1XKZA 3LR0A 2G7UA 4JXVA 1KDSA 3HJKA 1XA7A 4E3LA 2HP5A 2JKRI 2H28A 4E3KA 4DRTA 1EW0A 4CLCA 3T1XA 1ACFA 1FR1A 4YOFA 3ZG5A 2DMWA 1XJ2A 3QP5A 4ZJ3A 2XA7S 3HREA 4WM9A 3KO6A 3IBJA 5HAPA 1A0KA 4KQQA 5L07A 3T4QA 2Z2MB 3ZG0A 2HDUA 3VOZA 3VOYA 4MNRA 2ZMAA 2NUPC 5HDSA 2P9VA 2XEPA 1T1AA 2B02A 1MZUA 3ZNTA 3CLOA 4NXGA 3Q7ZA 4GD8A 2YKFA 5M1AA 1BLCA 5DTSA
chains in the Genus database with same CATH topology
4WN5A 4MN6A 2A24A 2OAP1 4B93A 2W1TA 3S7QA 3TRCA 4BBUA 4O01A 4OOMA 1YKDA 3MMHA 3LICA 4BJPA 4UQIS 2QHKA 3T4KA 2OOLA 3PR6A 2O9CA 3E4PA 2LB9A 5FL3A 1MC0A 3UB6A 2W3FA 2GX5A 4R70A 5J3WA 2HJ9C 4Z1WA 3D72A 1T19A 4CLCC 3C8CA 4BBVA 4OOLA 3C30A 1V9ZA 3LYXA 2L4RA 2HF6A 1P9WA 2VV7A 2IA2A 3MXQA 2YKHA 2V1BA 2O9AA 3E4QA 4HJ4A 1XJ6A 1H3QA 4FOFA 1LT0A 2O0YA 4FSFA 4Y2FA 3VE4A 4CLCB 1NLZA 4G3VA 2KX6A 1N9OA 3LR5A 3MQQA 3P01A 3UMEA 3CWFA 2FZ0A 5HZHA 1F9IA 1ZTUA 5HDCA 3PHYA 2D02A 2ZMFA 3UB8A 4IUKA 4WELA 1OT6A 4LLOB 2HJEA 5KIZA 1LSXA 5AVFA 4EEPA 1TS6A 3PBQA 1XFQA 1S1ZA 4QPRA 5IS1A 3H82B 2VV8A 3MJQA 2Y8HA 4NXEA 5DFXA 2KOIA 3T4SA 2PR6A 5A8BA 1OJ5A 5KSHA 1TS7A 4DN0A 4JGOA 3TE8A 4PAUA 3EWKA 1D7EA 2W3EA 2HV1A 2WKRA 4F3LA 2I9VA 2JN7A 4HOIA 2PYRA 2O99A 2PDRA 4JGPA 2FH5A 4XT2A 2M1CA 2OWHA 4WF0A 2W1TB 5F5YA 3F1PA 3E0YA 3CAXA 3DBAA 3C38A 2QYBA 2EWWA 2EA9A 1JNUA 3BQ8A 5TBMA 4CQHA 2W3HA 3JVVA 2KLIA 4UQIM 5F6AA 1T1CA 4WL9A 4RQ9A 4R3AA 3EOIA 3NHQA 5J4EA 2L1MA 4WEKA 5DKLA 3O5YA 5C5KA 4HP4A 3UB7A 3G6OA 1T1BA 5DJUA 3OCNA 4UEYA 2HGVA 3HCYA 5HSQA 3NOTC 3S7NA 5DJTA 1S66L 3LI8A 4IHQA 5AJGA 4EEUA 3B47A 3PBOA 4P6ZS 4EERA 4ME4A 2VGLM 1XJ4A 4PKYA 1YSQA 4LRXC 4AFIA 2OAQ1 4O8GA 3C2WA 3VE3A 1G28A 4K08A 4HHDA 2VLGA 4JGQA 3KSGA 2J80A 2INWA 1XFNA 3BJNA 4O0PA 4R6LA 4ZRRA 2EWVA 3B33A 4Q0HA 3PBNA 5HD3A 4GJ4A 1P0ZA 2J3WA 2V0WA 4EW7A 4WEJA 3FPWA 1N9LA 4HH2A 3TJZC 3BY9A 1LL8A 2M7UA 3W2ZA 1DP8A 1KOUA 4DMZA 1D06A 3EEAA 3ZYTA 4HQAA 5IT5A 3S7OA 2LB5A 3K2NA 2K7SA 2D01A 4JGRA 1G6OA 4I5SA 2XA7M 4HY8A 4XT2B 1OTEA 3H7WA 1OPXA 3FG8A 4HNBA 3HJIA 2K2NA 3IS2A 4IJGA 3MQOA 2ZMVA 2P04A 5I5LA 3JVUA 3LFVA 3LUQA 1LSVA 4GHIA 2JHEA 5TBMB 3T50A 4DJ2A 1S67L 5TJJA 4PKYG 2XRNA 3VOLA 1P9RA 3PBRA 1XJ3A 4II7A 1TS0A 3PBSA 2W0NA 4GW9A 2W3GA 3F1NA 3K3CA 3UE3A 4EESA 1Y28A 5K5BA 2K31A 1W63M 2V1AA 4EUVA 1DP6A 5HWWA 2A2LA 3EGDC 3RH8B 1VB6A 4WUJA 3D3OA 4EETB 4GS9A 4Y3IA 3OBFA 5HPIA 3OOVA 2A24B 2GZAA 2J3TD 4PHTA 3RTYA 3B42A 5F68A 4L9EA 2W3DA 4YNRA 1W63Q 4P6ZM 4E04A 3BQAA 1GSXA 3P7NA 1OTAA 4HJ3A 3FC7A 4EQ1A 5DFYA 5DF9A 1NLYA 3LIDA 1GSVA 3LR3A 2JKTM 1BYWA 3S7PA 4I3AA 1MKMA 2JKTI 4KUOA 2VX8A 3UE6A 1TS8A 3NJAA 3CUEA 1H8MA 2P7JA 3CI6A 3ZQ5A 3T4LA 3RFBA 4EU0A 3OC2A 1OJGA 4HJ6A 5AVEA 4DJ3A 4HI4A 3LIAA 3KSHA 3PYPA 2Z6CA 3E98A 1F98A 1STZA 2QWSA 3KSFA 1OTIA 1T18A 2Y79A 2W1RA 2BASA 2PYPA 4HIAA 3V67A 2XROA 5G4ZA 2V0UA 4M4XA 5L8MA 1GSWA 1DRMA 4I38A 4L0LA 2VV6A 4KQDA 3R7WA 3A0SA 4NXBA 3EQVA 2MJ6A 4IUHA 3T4JA 4H6JA 2J3TC 3EGXC 3T4TA 3KYQA 3A0RA 4LRYC 1OTBA 3H7WB 3F1OA 4MCWA 4MN5A 5DKKA 2ZOIA 5HDDA 4ETXA 3MQ0A 3IS2B 2QKPA 2OWJA 1S1YA 2WKQA 4NEED 3EQUA 4GHIB 2R78A 4KQOA 3T4OA 2ZBBA 3KSIA 2ZOHA 4GLQA 3GDIA 4B9OA 4WLAA 5CX7A 2PD8A 3VV4A 4HH3A 4EXOA 3F1NB 3LIFA 2VJWA 2PT7A 2W27A 5MC7A 3U2AA 4Y5FA 1OTDA 2XSSA 3ULFA 3BY8A 5HWTA 1X0OA 4I3JA 4F3LB 1IFQA 2L0WA 4Q0IA 1TF1A 4YWZA 4ARZA 1YAXA 4GS9B 3LR4A 4I3IA 4MDZA 5F69A 4LRZE 3UMDA 4BBTA 4R38A 3TW8A 1P97A 1V9YA 4MN7A 2VGLS 3CUEC 3F1PB 4L9FA 1S4SA 2VEAA 2KDKA 2VA0A 2B18A 4MMNA 3LIEA 3MF0A 1OT9A 2M7VA 1UWNX 4CLCE 1ZHHB 2VZWA 1N9NA 4GCZA 2QJ5A 1S4RA 5IU1A 2PHYA 5HL6A 2NUTC 1F5MA 4BMWA 4ETZA 5HWVA 1IOUA 3R4KA 1ODVA 3MFXA 3KYZA 3LR0A 2G7UA 2V9AA 1VHMA 5G4YA 3UB9A 3NOPC 4LPZA 2JKRM 3PXPA 4G3KA 4L9GA 3HJKA 2VKSA 3A0VA 4HP9A 1UWPX 2JKRI 3IBRA 3SW1A 2H28A 4G3WA 2Z6DA 2GNXA 1LSWA 1EW0A 3K3DA 3PBTA 2WKPA 4CLCA 5EFWA 4YOFA 2DMWA 1TD5A 3LIBA 3ICYA 1XJ2A 5J7EA 2GJ3A 2QJ7A 3R7WB 3NOUC 2XA7S 4BWIA 4H6JB 3KX0X 3LI9A 3F1OB 3OCLA 2PR5A 3KO6A 4CLCD 4NKPA 3IBJA 2PD7A 3T4QA 1UGUA 3E4OA 1DP9A 3H9WA 3H82A 2NUPC 3BWLA 2CMNA 3OLOA 3GECA 3CITA 5HDSA 5HD5A 1YSPA 2P08A 3MR0A 4Q0JA 4I39A 1T1AA 5LBRA 2B02A 1MZUA 2O9BA 3EEHA 3CLOA 3BW6A 1NWZA 4NXGA 4ARZB 2YKFA 4NXFA 5HPFA 1WA9A 3FPVA 4KUKA 1NRJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WN5 A;  4MN6 A;  2A24 A;  4BBU A;  3LIC A;  2QHK A;  2OOL A;  3E4P A;  3UB6 A;  5J3W A;  4R70 A;  3D72 A;  1T19 A;  3C8C A;  4BBV A;  1V9Z A;  3LYX A;  2L4R A;  2VV7 A;  3MXQ A;  2YKH A;  2V1B A;  3E4Q A;  4HJ4 A;  1XJ6 A;  1LT0 A;  3VE4 A;  2KX6 A;  1N9O A;  3MQQ A;  3UME A;  3CWF A;  5HZH A;  1F9I A;  5HDC A;  3PHY A;  2D02 A;  3UB8 A;  1OT6 A;  4LLO B;  5KIZ A;  1LSX A;  5AVF A;  4EEP A;  1TS6 A;  1XFQ A;  1S1Z A;  5IS1 A;  3H82 B;  2VV8 A;  3MJQ A;  4NXE A;  2PR6 A;  5A8B A;  1OJ5 A;  1TS7 A;  4JGO A;  3EWK A;  1D7E A;  2HV1 A;  2WKR A;  4F3L A;  2I9V A;  2JN7 A;  4HOI A;  2PYR A;  2PDR A;  4JGP A;  4XT2 A;  2M1C A;  2OWH A;  4WF0 A;  5F5Y A;  3F1P A;  3CAX A;  2EA9 A;  1JNU A;  5TBM A;  5F6A A;  1T1C A;  4WL9 A;  4RQ9 A;  4R3A A;  3NHQ A;  5J4E A;  2L1M A;  5DKL A;  4HP4 A;  3UB7 A;  3G6O A;  1T1B A;  5DJU A;  5HSQ A;  3NOT C;  5DJT A;  1S66 L;  3LI8 A;  4EEU A;  4EER A;  1XJ4 A;  4PKY A;  4LRX C;  3C2W A;  3VE3 A;  1G28 A;  4K08 A;  4HHD A;  2VLG A;  4JGQ A;  2J80 A;  2INW A;  1XFN A;  4R6L A;  3B33 A;  5HD3 A;  1P0Z A;  2V0W A;  4EW7 A;  1N9L A;  4HH2 A;  3BY9 A;  1LL8 A;  1DP8 A;  1KOU A;  1D06 A;  4HQA A;  2K7S A;  2D01 A;  4JGR A;  4I5S A;  4HY8 A;  4XT2 B;  1OTE A;  3H7W A;  3FG8 A;  4HNB A;  3HJI A;  3IS2 A;  3MQO A;  5I5L A;  3LUQ A;  1LSV A;  4GHI A;  2JHE A;  5TBM B;  3T50 A;  4DJ2 A;  1S67 L;  4PKY G;  3VOL A;  1XJ3 A;  1TS0 A;  2W0N A;  4GW9 A;  3F1N A;  3K3C A;  4EES A;  1Y28 A;  2V1A A;  1DP6 A;  5HWW A;  3RH8 B;  1VB6 A;  4WUJ A;  4EET B;  4GS9 A;  2A24 B;  3RTY A;  5F68 A;  4L9E A;  4E04 A;  1GSX A;  3P7N A;  1OTA A;  4HJ3 A;  3FC7 A;  4EQ1 A;  3LID A;  1GSV A;  1BYW A;  4I3A A;  4KUO A;  3UE6 A;  1TS8 A;  3NJA A;  2P7J A;  3ZQ5 A;  1OJG A;  4HJ6 A;  5AVE A;  4DJ3 A;  4HI4 A;  3LIA A;  3PYP A;  2Z6C A;  1F98 A;  2QWS A;  1OTI A;  1T18 A;  2BAS A;  2PYP A;  4HIA A;  5G4Z A;  2V0U A;  4M4X A;  1GSW A;  1DRM A;  4I38 A;  2VV6 A;  4KQD A;  3A0S A;  4NXB A;  4H6J A;  3A0R A;  4LRY C;  1OTB A;  3H7W B;  3F1O A;  4MN5 A;  5DKK A;  2ZOI A;  5HDD A;  3IS2 B;  2QKP A;  2OWJ A;  1S1Y A;  2WKQ A;  4GHI B;  2R78 A;  2ZBB A;  2ZOH A;  3GDI A;  4B9O A;  4WLA A;  2PD8 A;  4HH3 A;  4EXO A;  3F1N B;  3LIF A;  2W27 A;  1OTD A;  3ULF A;  3BY8 A;  5HWT A;  1X0O A;  4I3J A;  4F3L B;  2L0W A;  4YWZ A;  4GS9 B;  4I3I A;  5F69 A;  4LRZ E;  3UMD A;  4BBT A;  4R38 A;  1P97 A;  1V9Y A;  3F1P B;  4L9F A;  1S4S A;  2VEA A;  2KDK A;  3LIE A;  1OT9 A;  1UWN X;  1N9N A;  4GCZ A;  2QJ5 A;  1S4R A;  5IU1 A;  2PHY A;  5HWV A;  1ODV A;  3MFX A;  2V9A A;  5G4Y A;  3UB9 A;  3NOP C;  4LPZ A;  4L9G A;  3HJK A;  3A0V A;  4HP9 A;  1UWP X;  3IBR A;  3SW1 A;  2H28 A;  2Z6D A;  1LSW A;  1EW0 A;  3K3D A;  2WKP A;  5EFW A;  3LIB A;  3ICY A;  1XJ2 A;  5J7E A;  2GJ3 A;  2QJ7 A;  3NOU C;  4H6J B;  3KX0 X;  3LI9 A;  3F1O B;  2PR5 A;  2PD7 A;  1UGU A;  3E4O A;  1DP9 A;  3H9W A;  3H82 A;  3BWL A;  2CMN A;  3OLO A;  3GEC A;  5HDS A;  5HD5 A;  3MR0 A;  4I39 A;  1T1A A;  2B02 A;  1MZU A;  3EEH A;  3CLO A;  1NWZ A;  4NXG A;  2YKF A;  4NXF A;  1WA9 A;  4KUK A; 
#chains in the Genus database with same CATH topology
 1ALQ A;  4MN6 A;  4OLG A;  4OOM A;  1ERO A;  1YKD A;  3LIC A;  3C7U A;  4R1G A;  2QHK A;  4Y0U A;  2J7V A;  3NDG A;  2Y2P A;  3PR6 A;  5GL9 A;  5FL3 A;  3ZNY A;  3SS3 A;  3N8L A;  2W3F A;  4R3B A;  3D72 A;  4CLC C;  5FI2 A;  3C8C A;  2XH9 A;  1JTD A;  1V9Z A;  3LYX A;  2L4R A;  1N9B A;  2BLS A;  4QD4 A;  1YLY A;  3V50 A;  3N7W A;  2IA2 A;  4ZTK A;  2V1B A;  2O9A A;  3E4Q A;  1H3Q A;  4PM7 A;  2UWX A;  2KX6 A;  3IF6 B;  1N9O A;  3LR5 A;  4Z9Q A;  1LLB A;  5TR7 A;  2FFF B;  1KE4 A;  5A91 A;  1F9I A;  3PHY A;  1H8Z A;  2D02 A;  2ZMF A;  3UB8 A;  4BD0 A;  1WE4 A;  2BTF P;  1SKO B;  5IS1 A;  3H82 B;  1VET A;  3MJQ A;  2DRW A;  3IT9 A;  5KSH A;  4UA9 A;  4JGO A;  3EWK A;  3ZCZ A;  1L3L A;  1D7E A;  2HV1 A;  2PBD P;  4WMC D;  4HOI A;  3P09 A;  4KZ5 A;  4FUW A;  3CJM A;  1BT5 A;  2BG1 A;  2HDS A;  5F5Y A;  3CAX A;  3DBA A;  2QYB A;  3UN7 A;  3BQ8 A;  2W3H A;  2KLI A;  1T1C A;  3L7H A;  1E4D A;  2ZL1 B;  1CEF A;  4EBL A;  4X25 A;  4WEK A;  5C5K A;  3LCE A;  4IVI A;  5FAQ A;  3ZG9 B;  5DTT A;  3N8S A;  3OCN A;  4JLF A;  1K54 A;  5EOE A;  2CC1 A;  1Q2P A;  3MZE A;  4U0T A;  4EER A;  1YLZ A;  2VGL M;  3RJU A;  2ZM2 A;  3VSL A;  4KZ9 A;  2OAQ 1;  4O8G A;  4K08 A;  2VGK A;  3KSG A;  2WAE A;  3W4O A;  4DXB A;  4GKU A;  3BJN A;  3QP1 A;  3HLC A;  4E3M A;  5F1G A;  1ERM A;  3UPN A;  3HUO A;  5CRF A;  4EW7 A;  5DF7 A;  3FPW A;  4QJG A;  1LL8 A;  2J8Y A;  3HLW A;  1KOU A;  4X53 A;  4X69 A;  4P6B A;  1D06 A;  2HZ5 A;  2J9P A;  1NJ4 A;  5GLC A;  1K6R A;  4GDB A;  4HQA A;  1I2S A;  4FH2 A;  1Z6F A;  1M40 A;  1G6O A;  4ESP A;  3WS1 A;  1OTE A;  3C4P A;  3FG8 A;  4HNB A;  1BZA A;  2ZMV A;  5FQM A;  5GLB A;  2P04 A;  1BLH A;  1Y4O A;  1S0W A;  4XUZ A;  4PKY G;  3UE1 A;  3PBR A;  1K54 C;  3AGF A;  2WGW A;  1XX2 A;  3G30 A;  4OLD A;  4GW9 A;  2QPN A;  3K3C A;  3UE3 A;  4EES A;  4OKP A;  2V1A A;  3C5A A;  4EUV A;  1DP6 A;  5HWW A;  5EVL A;  4PMA A;  1KE0 A;  3P98 A;  3GVB A;  5HX9 A;  2ZC4 B;  4WYY A;  4X1M A;  4R0Q A;  2GZA A;  2J3T D;  3RTY A;  1SDE A;  1GSX A;  1W8Y A;  4D60 A;  1FOF A;  1NLY A;  2Z2L B;  1FCN A;  3LY3 A;  3LR3 A;  2JKG A;  2ZC3 B;  3GV9 A;  5AQ9 A;  2EXA A;  1H8M A;  3CI6 A;  1S6R A;  3RFB A;  1ZKJ A;  4EU0 A;  1K6S A;  3KSH A;  3PYP A;  4OPY A;  4EQI A;  1T18 A;  2W1R A;  1L0D A;  5FAS A;  1H8Y A;  2BAS A;  3O87 A;  3V67 A;  2PRF A;  3AGE A;  4M4X A;  1PW8 A;  5L8M A;  4R4R A;  1CF0 A;  5GHY A;  1DRM A;  3QNC A;  4BQM A;  2MJ6 A;  4IUH A;  2IWC A;  3KYQ A;  3BM6 A;  1OTB A;  4ETX A;  3IS2 B;  4X55 A;  3BLS A;  2RL3 A;  4QY6 A;  3RXX A;  4NEE D;  2XQZ A;  3KSI A;  3CHW P;  5FDH A;  1FIK A;  5CX7 A;  3VV4 A;  1BUE A;  4OQH A;  2Y2I A;  1G6A A;  4BD1 A;  1KGG A;  2EFX A;  1KVM A;  1K55 A;  4Y5F A;  3VP0 A;  3BY8 A;  4I3J A;  1AXB A;  5DTK A;  1YAX A;  4GS9 B;  1YLJ A;  4IVK A;  4GN2 A;  5M19 A;  3LR4 A;  4LRZ E;  3UMD A;  5D3O A;  2DNS A;  4LGW A;  4MN7 A;  3BFF A;  2WKE A;  4MMN A;  3SH7 A;  1OT9 A;  3N8R A;  4CLC E;  2ZQD A;  3W4Q A;  3GR2 A;  1PIO A;  4JXW A;  3Q1F A;  5HL6 A;  4ETZ A;  4Y17 A;  3R4K A;  3BLM A;  1JVJ A;  1VHM A;  3NOP C;  4LPZ A;  5FA7 A;  3UY6 A;  3PXP A;  3IBR A;  1IYS A;  3UPO A;  3K3D A;  1ES4 A;  2WKP A;  4GD6 A;  3E2K A;  3IF6 A;  4JKT A;  4LV2 A;  1TD5 A;  5J7E A;  3HUM A;  2Q9M A;  3CPT B;  1FCM A;  4BWI A;  3LGO A;  2RCX A;  1U60 A;  3LI9 A;  4QY5 A;  4N1H A;  3OCL A;  4RVA A;  3UB5 P;  1K55 C;  1H5X A;  4R4S A;  1UGU A;  1I5Q A;  3NC8 A;  3S1Y A;  1SKO A;  1DP9 A;  2Y55 A;  4GZB A;  3H82 A;  2OV5 A;  3GEC A;  5A90 A;  4QB8 A;  1RGY A;  3MR0 A;  3G34 A;  5CTN A;  4I39 A;  3O3V A;  2EFU A;  4UHU A;  5LBR A;  3EEH A;  2WYX A;  3IWI A;  4ARZ B;  4NXF A;  1WA9 A;  4KUK A;  5CGX A;  1KGF A;  3T1Q B;  5DF8 A;  2OAP 1;  2IWD A;  1K4E A;  1L2S A;  3NI9 A;  4BBU A;  3C7V A;  4BJP A;  3N4I A;  2O9C A;  3TOI A;  1MC0 A;  4KZ6 A;  1GA9 A;  4Z1W A;  5J3W A;  2ZL1 A;  1ZC2 A;  1LI0 A;  1FCO A;  3IF6 C;  3PTE A;  3C30 A;  4ZJ2 A;  1JTG A;  2VV7 A;  4JBF A;  2YKH A;  4Y0T A;  4FOF A;  3VE4 A;  2EX8 A;  1ZG4 A;  3DTE A;  4G3V A;  2E8J A;  3UDF A;  2B5R A;  1K38 A;  3CMZ A;  3MQQ A;  3P01 A;  3IQA A;  4MEZ A;  5FI7 A;  3QHY A;  5HZH A;  2X02 A;  3Q07 A;  2V8F A;  1QMF A;  4UA6 A;  4IUK A;  1OT6 A;  1L0F A;  3LY4 A;  3ZHH A;  1ESI A;  5KIZ A;  3QP4 A;  4OPQ A;  4S2M A;  1K25 A;  3PBQ A;  1S1Z A;  2V20 A;  5DFX A;  2G2W A;  4OP8 A;  1PNE A;  1IEM A;  4U0X A;  1MXO A;  1TS7 A;  3JYI A;  3TE8 A;  3HLG A;  2W3E A;  5L2F A;  4EWF A;  1DJA A;  2JN7 A;  2WK0 A;  2WZX A;  2JC7 A;  1YLP A;  2O99 A;  3GSG A;  4YFM A;  2M1C A;  2WGI A;  2W1T B;  1K56 A;  3F1P A;  3DW0 A;  2EWW A;  3C38 A;  3OZH A;  2UV0 E;  3MZF A;  4RQ9 A;  5J4E A;  2L1M A;  1T1B A;  3VP4 A;  5DJU A;  4UEY A;  1LHY A;  2ZQ9 A;  5DJT A;  3IH9 A;  4S2P A;  3CZD A;  4IHQ A;  5EM0 A;  4EEU A;  5I94 A;  3MSH A;  4P6Z S;  5DVA A;  4PKY A;  4LRX C;  4C75 A;  4X68 A;  4DDS A;  3C2W A;  1G28 A;  4JGQ A;  5JYP A;  5EVE A;  1MKI A;  4Q0H A;  3IWO A;  3PBN A;  3I7J A;  5HD3 A;  4E3J A;  1LI9 A;  3VFF A;  2M7U A;  1DP8 A;  4DMZ A;  3IXB A;  3QP6 A;  5FEG A;  2OSU A;  4OPZ A;  3S7O A;  4K91 A;  3DAV A;  2V8C A;  1NYY A;  3QP8 A;  2D01 A;  5CTM A;  4D2O A;  2PU4 A;  4I5S A;  2XA7 M;  4HY8 A;  3E2L A;  4LEN A;  3IS2 A;  3MQO A;  5I5L A;  5TBM B;  3T50 A;  4S2O A;  1MWS A;  5FQI A;  5TJJ A;  1MY8 A;  1P9R A;  1XJ3 A;  2GDN A;  1TS0 A;  2ZQ7 A;  4K0W A;  4XXR A;  5FQJ A;  1E3U A;  1W8Q A;  2K31 A;  2X71 A;  2V1Z A;  2Y2K A;  4BL2 A;  3A3F A;  5L09 A;  4EET B;  3G32 A;  1PZO A;  4DE0 A;  4GS9 A;  3BYD A;  1O7E A;  3OBF A;  5EOO A;  4PHT A;  2Y91 A;  3MS6 A;  2R9X A;  5F68 A;  3IF5 A;  4L9E A;  3KYE A;  3WRZ A;  1W63 Q;  4P6Z M;  3P7N A;  1OTA A;  4RA7 A;  3FC7 A;  5EE8 A;  5E2G A;  3ZG8 B;  1HTZ A;  3FYZ A;  2JKT M;  1SDN A;  1DJB A;  5M18 A;  1MKM A;  3SS4 A;  3W4P A;  2X01 A;  2VX8 A;  1DJC A;  3UE6 A;  3NJA A;  4KZ4 A;  2P7J A;  4JF4 A;  3ZQ5 A;  3T4L A;  5HAR A;  4MLL A;  2JCH A;  4HJ6 A;  4DJ3 A;  3E98 A;  1F98 A;  2QWS A;  2PYP A;  4HIA A;  2HP9 A;  3IX8 A;  5G4Z A;  5TFQ A;  2V0U A;  1XXM A;  4I38 A;  4L0L A;  3CPT A;  4F94 A;  4NXB A;  4U3T A;  1SHV A;  3EGX C;  3IXH A;  1XGJ A;  3A0R A;  5EM1 A;  3H7W B;  3M2J A;  4MN5 A;  3M6B A;  5DKK A;  2QKP A;  4HEF A;  1S1Y A;  2WKQ A;  2R78 A;  4KQO A;  3T4O A;  2ZBB A;  3A3D A;  3GDI A;  1G68 A;  4B9O A;  4GOG A;  2Y2H A;  2PD8 A;  3NY4 A;  4HH3 A;  1MWR A;  3LIF A;  1YMS A;  1VM1 A;  2W27 A;  3D9Y A;  3ISG A;  1BLS A;  4OH0 A;  5HAI A;  5FEF A;  2ZQC A;  2XSS A;  3NBL A;  3ULF A;  5HWT A;  1X0O A;  1IFQ A;  2L0W A;  4FD8 A;  4Q0I A;  4ARZ A;  3VP1 A;  5KZH A;  5AQ7 A;  3CG5 A;  5EEC A;  1V9Y A;  1L0E A;  4OOY A;  3F1P B;  4L9F A;  1S4S A;  3WRT A;  2VEA A;  2XFS A;  2B18 A;  3Q7V B;  3MF0 A;  1UWN X;  1M6K A;  4JF6 A;  5F83 A;  1S4R A;  5CER A;  3UDI A;  4BMW A;  1IOU A;  3MFX A;  3KYZ A;  2V9A A;  3UB9 A;  4GDN A;  2JKR M;  3A0V A;  5HAQ A;  4EV4 A;  4OP5 A;  2Z6D A;  2GNX A;  1LSW A;  3BFE A;  3V5M A;  1MPL A;  4OON A;  3ICY A;  2GJ3 A;  5FI6 A;  3R7W B;  3LEQ A;  1ES5 A;  2XLN A;  4H6J B;  3F1O B;  1E25 A;  4CLC D;  3NEC A;  1OME A;  2PD7 A;  3FV7 A;  1CI8 A;  3MZD A;  2CMN A;  3OLO A;  1O07 A;  3O86 A;  5HD5 A;  1YSP A;  3MBZ A;  1K56 D;  1ERQ A;  2O9B A;  2B95 A;  1NWZ A;  3FWL A;  3A3I A;  3VFH A;  1FSY A;  5HPF A;  3FPV A;  1XA1 A;  4B93 A;  2W1T A;  3MMH A;  3FKW A;  4UQI S;  2WZZ A;  3UNW A;  3T4K A;  1K0K A;  2WAF A;  2JE5 A;  3E4P A;  3UB6 A;  2GX5 A;  2WAD A;  1HD8 A;  2H10 A;  2HJ9 C;  3OPL A;  3A3E A;  1T19 A;  2XD1 A;  4UA7 A;  5GLD A;  3G4P A;  1BUL A;  2HF6 A;  2Y2G A;  3DTM A;  1HZO A;  2PU2 A;  2J9O A;  4HJ4 A;  3VP3 A;  1XJ6 A;  3Q82 A;  1LT0 A;  2O0Y A;  4FSF A;  4Y2F A;  4ZBE A;  5GHX A;  3IHB A;  4IBR A;  2ZC6 B;  2G2U A;  3JPU A;  1C3B A;  4RX2 A;  5HDC A;  3IXD A;  2H5S A;  2XF3 A;  4KZ3 A;  1NYM A;  4PM6 A;  5AVF A;  4EEP A;  1TS6 A;  3NUL A;  5CEC A;  1PZP A;  1JWZ A;  2HDR A;  4WMC A;  2PR6 A;  1NXY A;  1MWU A;  1OJ5 A;  4BLM A;  3RXW A;  4DN0 A;  2XFT A;  1PI5 A;  1EI5 A;  5AQA A;  2I9V A;  4A5R A;  4Q8I A;  5HFO A;  2PYR A;  4JGP A;  2Q0O A;  2Y4A A;  2OWH A;  3GTC A;  5FAP A;  3E0Y A;  4KG6 A;  3HL9 A;  4KEN B;  2EA9 A;  4FH4 A;  1JNU A;  5TBM A;  4CQH A;  5F6A A;  4UQI M;  4QHC A;  3HLD A;  3WS4 A;  1WYB A;  3NHQ A;  4JXS A;  5DKL A;  3O5Y A;  4R23 A;  1K57 A;  3UB7 A;  4OQ0 A;  1CJF A;  3G6O A;  4BL3 A;  3PAG A;  3HCY A;  3MKE A;  5HSQ A;  3NOT C;  3S7N A;  4HES A;  5EVI B;  1S66 L;  5CED A;  5AJG A;  3B47 A;  3PBO A;  1XJ4 A;  1YSQ A;  4JXG A;  1PWD A;  1YLT A;  2Y2J A;  2DCF A;  4R6L A;  4CJN A;  2EWV A;  3B33 A;  1TEM A;  1KE3 A;  2J3W A;  2I72 A;  2V0W A;  4FTX A;  1ESU A;  2WUQ A;  1N9L A;  4HH2 A;  3TJZ C;  3BY9 A;  3ZVW A;  4LV3 A;  2Y2M A;  2EXB A;  3BFG A;  5CXW A;  3QNB A;  3OPP A;  4S2K A;  2IWB A;  2LB5 A;  3K2N A;  2ZQ8 A;  2Y2N A;  2K7S A;  4RX3 A;  3S4X A;  4S2L A;  4LFU A;  4XT2 B;  1NRF A;  1K57 C;  3H7W A;  4KZ7 A;  3HJI A;  4IED A;  4IJG A;  3G31 A;  5JYO A;  3LUQ A;  4DJ2 A;  1KVL A;  1N4O A;  1KDW A;  3VOL A;  4II7 A;  2W0N A;  5CHM A;  2W3G A;  1BLP A;  3TG9 A;  2ZC5 B;  1VEU A;  1PRQ A;  3O88 A;  3S22 A;  2A2L A;  3RH8 B;  1FIL A;  3WWX A;  4WUJ A;  3D3O A;  1VQQ A;  2EX2 A;  1XP4 A;  3ITA A;  5HPI A;  3Q81 A;  3IHA A;  3B42 A;  1TDL A;  1LL9 A;  5KMW A;  3Q7V A;  3BQA A;  5F82 A;  2FFY A;  2PBY A;  3BEC A;  5DFY A;  4N1X A;  5HW3 A;  3IH8 A;  5FAT A;  1PFL A;  1JWP A;  3S7P A;  2ZM8 A;  2C6W B;  4OQI A;  1NY0 A;  4JPM A;  3CUE A;  3W8K A;  4OVD A;  1YT4 A;  4MBH A;  4Y15 A;  1OJG A;  3BEB A;  1W5D A;  1STZ A;  3KSF A;  1OTI A;  2Y79 A;  3IXG A;  1KGE A;  2ACG A;  5E2H A;  1AWI A;  1GSW A;  2XGN A;  1BTL A;  2VV6 A;  3R7W A;  3G2Y A;  3A0S A;  3NIA A;  5EPH A;  3EQV A;  3T12 B;  4WZ4 A;  4H6J A;  2J3T C;  2ZJ9 A;  3F1O A;  1YPR A;  3EQU A;  4GHI B;  2ZD8 A;  4LCL A;  3A3J A;  4WLA A;  2C5W B;  4DXC A;  3DWZ A;  4NG2 A;  3F1N B;  4PM9 A;  1SCW A;  5E2F A;  2PT7 A;  3LO7 A;  5MC7 A;  3U2A A;  1OTD A;  3BFC A;  2Y2Q A;  4UAA A;  5GLA A;  2HP6 A;  2VGJ A;  4KQR A;  3SOI A;  4I3I A;  5F69 A;  3TW8 A;  1P97 A;  3ZVT A;  3QP2 A;  2VGL S;  3CUE C;  2KDK A;  2VA0 A;  3C4O A;  1RGZ A;  2Y2L A;  1F2K A;  2M7V A;  1PYY A;  3GRJ A;  1ZHH B;  2VZW A;  1N9N A;  4X1L A;  2R9W A;  5AQB A;  4K0X A;  2QJ5 A;  2EX9 A;  4EUZ A;  5IU1 A;  1W7F A;  4S2J A;  5HWV A;  1ODV A;  1ONH A;  5G4Y A;  4S2I A;  4NK3 A;  4G3K A;  4L9G A;  2VKS A;  2XDM A;  1TVF A;  3AGD A;  4HP9 A;  1UWP X;  4FCF A;  4DKI A;  3SW1 A;  1PW1 A;  4G3W A;  3BRM A;  2ZLY A;  4Y13 A;  3OPR A;  3PBT A;  5EFW A;  5J8X A;  3LIB A;  2QJ7 A;  5E43 A;  3NOU C;  1RP5 A;  3IX3 A;  2VK3 A;  4OQG A;  3KX0 X;  5L10 A;  1SKF A;  2PR5 A;  1PWG A;  4KG2 A;  4NKP A;  4ZAM A;  3E4O A;  5U47 A;  3T1R A;  1ZG6 A;  3H9W A;  5FAO A;  1CK3 A;  1D1J A;  3BWL A;  4M3K A;  3CIT A;  4LV0 A;  2Y59 A;  5CGW A;  5FQ9 A;  2P08 A;  4Q0J A;  4PM8 A;  4XUX A;  4ID4 A;  3BW6 A;  3NCK A;  3FKV A;  2OLU A;  2WGV A;  1NRJ A;  2XD5 A;  4DE3 A;  4WN5 A;  3VSK A;  2A24 A;  4Y7P A;  3S7Q A;  3TRC A;  4N92 A;  4O01 A;  3UPP A;  4KZ8 A;  2OOL A;  4JF5 A;  4HBT A;  3HLB A;  3HVF A;  4ZDX A;  2LB9 A;  1IYQ A;  1CQA A;  5EUA A;  4R70 A;  4GB7 A;  4WBG A;  1FR6 A;  1VEU B;  4BBV A;  4OOL A;  3SS5 A;  4R3J A;  1DY6 A;  1XPB A;  3V3R A;  1P9W A;  5EVI A;  3MXQ A;  1NZO A;  1YQS A;  4X56 A;  1ES2 A;  1GCE A;  3UDX A;  4O7D A;  4MBF A;  4CLC B;  1NLZ A;  4E3I A;  4C6Y A;  1HVB A;  3UME A;  3CWF A;  2FZ0 A;  3FZC A;  1ZTU A;  2ZC7 A;  1Q2Q A;  1IYP A;  4WEL A;  3SH8 A;  4LLO B;  1GHP A;  2HJE A;  4DF6 A;  4KG5 A;  1LSX A;  3MKF A;  3SZT A;  2A3U A;  1XFQ A;  4QPR A;  2VV8 A;  3IX4 A;  2Y8H A;  4NET A;  4NXE A;  3M2K A;  2KOI A;  3T4S A;  2P9V B;  5A8B A;  1ES3 A;  5FQK A;  1RCJ A;  4PAU A;  2WKI A;  3IWQ A;  1GHI A;  2WKR A;  4F3L A;  3VP2 A;  2PDR A;  2FH5 A;  4XT2 A;  5CHJ A;  4WF0 A;  1PI4 A;  2V2F F;  3HLE A;  3MFD A;  1NZU A;  1BSG A;  2H0Y A;  4P87 A;  4YIN A;  4E6W A;  3JVV A;  4WL9 A;  5F1F A;  4R3A A;  3EOI A;  5EVI C;  3SH9 A;  2E8I A;  1IEL A;  1FQG A;  4HP4 A;  2Y2O A;  5CHU A;  2PAV P;  4IBX A;  2WKH A;  3GMW A;  1EWZ A;  4LCM A;  1HLU P;  2HGV A;  2XK1 A;  1MBL A;  2A49 A;  3LI8 A;  2QZ6 A;  2HPB A;  1Z09 A;  3VMA A;  3HUN A;  4ME4 A;  4DE2 A;  4AFI A;  4S2N A;  3MXR A;  4RYE A;  3VE3 A;  4HHD A;  2VLG A;  2J80 A;  1GA0 A;  4PPR A;  2INW A;  1XFN A;  3ZGA B;  4O0P A;  1L0G A;  4ZRR A;  4B88 A;  2ZQA A;  3BFD A;  4GJ4 A;  1P0Z A;  4WEJ A;  1VET B;  4ZJ1 A;  1CI9 A;  3W2Z A;  1ONG A;  5FDS A;  3DTK A;  3DTI A;  4PM5 A;  4QU3 A;  3EEA A;  3ZYT A;  5IT5 A;  3DWK A;  4P85 A;  5EV0 A;  4DE1 A;  4JGR A;  4WZ5 A;  3GQZ A;  4BEN A;  4E3N A;  3OPH A;  3V3S A;  2P74 A;  1OPX A;  2K2N A;  3WS2 A;  4E3O A;  3ZDJ A;  3JVU A;  4LV1 A;  3LFV A;  4X6T A;  1LSV A;  4GHI A;  2JHE A;  3D4F A;  1S67 L;  1YMX A;  1XGI A;  1G5U A;  3G2Z A;  3HLF A;  2XRN A;  3PBS A;  4GNU A;  3F1N A;  1TDG A;  5K5B A;  1Y28 A;  4C3Q A;  4S2N C;  1W63 M;  2JKF A;  3L9K A;  4KZB A;  3EGD C;  4N9K A;  1VB6 A;  5GHZ A;  5FQQ A;  1YLW A;  1IKG A;  1WYC A;  4Y3I A;  2H0T A;  4H8R A;  4HBU A;  1GHM A;  3OOV A;  2A24 B;  1E3U D;  4B4X A;  1IYO A;  2W3D A;  5FSR A;  4YNR A;  2ZM0 A;  4MBK A;  4E04 A;  4HJ3 A;  4EQ1 A;  3U4L P;  5DF9 A;  3ZG7 B;  3LID A;  1GSV A;  5E2E A;  1BYW A;  3UE0 A;  3LEZ A;  5CGS A;  4I3A A;  2JKT I;  1J9M A;  4KUO A;  5A92 A;  2XR0 A;  5IHV A;  1TS8 A;  2HDQ A;  4EBN A;  1K4F A;  1YM1 A;  1LL5 A;  4OPR A;  3OC2 A;  4WZ5 C;  5AVE A;  4E6X A;  2EX6 A;  3T1S A;  4HI4 A;  3LIA A;  3NDE A;  2Z6C A;  5CEB A;  2OLV A;  4KZA A;  2XRO A;  5G18 A;  5TGF A;  2AVX A;  5HL1 A;  3M6H A;  1I2W A;  4KQD A;  3PAE A;  4P0M A;  3T4J A;  3WS5 A;  1QME A;  3B3X A;  3T4T A;  4QWO A;  3V39 A;  5A93 A;  2JBF A;  4LRY C;  3N6I A;  4MCW A;  2ZOI A;  5HDD A;  1JWV A;  3MQ0 A;  5BOH A;  2OWJ A;  2Q9N A;  3UO9 A;  3HBR A;  2ZOH A;  4GLQ A;  4N9L A;  1CEG A;  4CPK A;  2QMI A;  2WGW B;  4Y0O A;  4EXO A;  2VJW A;  3WS0 A;  1SZV A;  3MXS A;  5KSC A;  4F3L B;  1J3W A;  3ZFZ A;  4EBP A;  1W79 A;  4B4Z A;  3TSG A;  1TF1 A;  4YWZ A;  1FSW A;  4MDZ A;  4BBT A;  4R38 A;  1MWT A;  1Y54 A;  3LIE A;  1H0M A;  4GCZ A;  1IKI A;  5EVI D;  2PHY A;  3G35 A;  2NUT C;  1F5M A;  3ITB A;  4DDY A;  1PWC A;  1XKZ A;  3LR0 A;  2G7U A;  4JXV A;  1KDS A;  3HJK A;  1XA7 A;  4E3L A;  2HP5 A;  2JKR I;  2H28 A;  4E3K A;  4DRT A;  1EW0 A;  4CLC A;  3T1X A;  1ACF A;  1FR1 A;  4YOF A;  3ZG5 A;  2DMW A;  1XJ2 A;  3QP5 A;  4ZJ3 A;  2XA7 S;  3HRE A;  4WM9 A;  3KO6 A;  3IBJ A;  5HAP A;  1A0K A;  4KQQ A;  5L07 A;  3T4Q A;  2Z2M B;  3ZG0 A;  2HDU A;  3VOZ A;  3VOY A;  4MNR A;  2ZMA A;  2NUP C;  5HDS A;  2P9V A;  2XEP A;  1T1A A;  2B02 A;  1MZU A;  3ZNT A;  3CLO A;  4NXG A;  3Q7Z A;  4GD8 A;  2YKF A;  5M1A A;  1BLC A;  5DTS A; 
#chains in the Genus database with same CATH homology
 4WN5 A;  4MN6 A;  2A24 A;  2OAP 1;  4B93 A;  2W1T A;  3S7Q A;  3TRC A;  4BBU A;  4O01 A;  4OOM A;  1YKD A;  3MMH A;  3LIC A;  4BJP A;  4UQI S;  2QHK A;  3T4K A;  2OOL A;  3PR6 A;  2O9C A;  3E4P A;  2LB9 A;  5FL3 A;  1MC0 A;  3UB6 A;  2W3F A;  2GX5 A;  4R70 A;  5J3W A;  2HJ9 C;  4Z1W A;  3D72 A;  1T19 A;  4CLC C;  3C8C A;  4BBV A;  4OOL A;  3C30 A;  1V9Z A;  3LYX A;  2L4R A;  2HF6 A;  1P9W A;  2VV7 A;  2IA2 A;  3MXQ A;  2YKH A;  2V1B A;  2O9A A;  3E4Q A;  4HJ4 A;  1XJ6 A;  1H3Q A;  4FOF A;  1LT0 A;  2O0Y A;  4FSF A;  4Y2F A;  3VE4 A;  4CLC B;  1NLZ A;  4G3V A;  2KX6 A;  1N9O A;  3LR5 A;  3MQQ A;  3P01 A;  3UME A;  3CWF A;  2FZ0 A;  5HZH A;  1F9I A;  1ZTU A;  5HDC A;  3PHY A;  2D02 A;  2ZMF A;  3UB8 A;  4IUK A;  4WEL A;  1OT6 A;  4LLO B;  2HJE A;  5KIZ A;  1LSX A;  5AVF A;  4EEP A;  1TS6 A;  3PBQ A;  1XFQ A;  1S1Z A;  4QPR A;  5IS1 A;  3H82 B;  2VV8 A;  3MJQ A;  2Y8H A;  4NXE A;  5DFX A;  2KOI A;  3T4S A;  2PR6 A;  5A8B A;  1OJ5 A;  5KSH A;  1TS7 A;  4DN0 A;  4JGO A;  3TE8 A;  4PAU A;  3EWK A;  1D7E A;  2W3E A;  2HV1 A;  2WKR A;  4F3L A;  2I9V A;  2JN7 A;  4HOI A;  2PYR A;  2O99 A;  2PDR A;  4JGP A;  2FH5 A;  4XT2 A;  2M1C A;  2OWH A;  4WF0 A;  2W1T B;  5F5Y A;  3F1P A;  3E0Y A;  3CAX A;  3DBA A;  3C38 A;  2QYB A;  2EWW A;  2EA9 A;  1JNU A;  3BQ8 A;  5TBM A;  4CQH A;  2W3H A;  3JVV A;  2KLI A;  4UQI M;  5F6A A;  1T1C A;  4WL9 A;  4RQ9 A;  4R3A A;  3EOI A;  3NHQ A;  5J4E A;  2L1M A;  4WEK A;  5DKL A;  3O5Y A;  5C5K A;  4HP4 A;  3UB7 A;  3G6O A;  1T1B A;  5DJU A;  3OCN A;  4UEY A;  2HGV A;  3HCY A;  5HSQ A;  3NOT C;  3S7N A;  5DJT A;  1S66 L;  3LI8 A;  4IHQ A;  5AJG A;  4EEU A;  3B47 A;  3PBO A;  4P6Z S;  4EER A;  4ME4 A;  2VGL M;  1XJ4 A;  4PKY A;  1YSQ A;  4LRX C;  4AFI A;  2OAQ 1;  4O8G A;  3C2W A;  3VE3 A;  1G28 A;  4K08 A;  4HHD A;  2VLG A;  4JGQ A;  3KSG A;  2J80 A;  2INW A;  1XFN A;  3BJN A;  4O0P A;  4R6L A;  4ZRR A;  2EWV A;  3B33 A;  4Q0H A;  3PBN A;  5HD3 A;  4GJ4 A;  1P0Z A;  2J3W A;  2V0W A;  4EW7 A;  4WEJ A;  3FPW A;  1N9L A;  4HH2 A;  3TJZ C;  3BY9 A;  1LL8 A;  2M7U A;  3W2Z A;  1DP8 A;  1KOU A;  4DMZ A;  1D06 A;  3EEA A;  3ZYT A;  4HQA A;  5IT5 A;  3S7O A;  2LB5 A;  3K2N A;  2K7S A;  2D01 A;  4JGR A;  1G6O A;  4I5S A;  2XA7 M;  4HY8 A;  4XT2 B;  1OTE A;  3H7W A;  1OPX A;  3FG8 A;  4HNB A;  3HJI A;  2K2N A;  3IS2 A;  4IJG A;  3MQO A;  2ZMV A;  2P04 A;  5I5L A;  3JVU A;  3LFV A;  3LUQ A;  1LSV A;  4GHI A;  2JHE A;  5TBM B;  3T50 A;  4DJ2 A;  1S67 L;  5TJJ A;  4PKY G;  2XRN A;  3VOL A;  1P9R A;  3PBR A;  1XJ3 A;  4II7 A;  1TS0 A;  3PBS A;  2W0N A;  4GW9 A;  2W3G A;  3F1N A;  3K3C A;  3UE3 A;  4EES A;  1Y28 A;  5K5B A;  2K31 A;  1W63 M;  2V1A A;  4EUV A;  1DP6 A;  5HWW A;  2A2L A;  3EGD C;  3RH8 B;  1VB6 A;  4WUJ A;  3D3O A;  4EET B;  4GS9 A;  4Y3I A;  3OBF A;  5HPI A;  3OOV A;  2A24 B;  2GZA A;  2J3T D;  4PHT A;  3RTY A;  3B42 A;  5F68 A;  4L9E A;  2W3D A;  4YNR A;  1W63 Q;  4P6Z M;  4E04 A;  3BQA A;  1GSX A;  3P7N A;  1OTA A;  4HJ3 A;  3FC7 A;  4EQ1 A;  5DFY A;  5DF9 A;  1NLY A;  3LID A;  1GSV A;  3LR3 A;  2JKT M;  1BYW A;  3S7P A;  4I3A A;  1MKM A;  2JKT I;  4KUO A;  2VX8 A;  3UE6 A;  1TS8 A;  3NJA A;  3CUE A;  1H8M A;  2P7J A;  3CI6 A;  3ZQ5 A;  3T4L A;  3RFB A;  4EU0 A;  3OC2 A;  1OJG A;  4HJ6 A;  5AVE A;  4DJ3 A;  4HI4 A;  3LIA A;  3KSH A;  3PYP A;  2Z6C A;  3E98 A;  1F98 A;  1STZ A;  2QWS A;  3KSF A;  1OTI A;  1T18 A;  2Y79 A;  2W1R A;  2BAS A;  2PYP A;  4HIA A;  3V67 A;  2XRO A;  5G4Z A;  2V0U A;  4M4X A;  5L8M A;  1GSW A;  1DRM A;  4I38 A;  4L0L A;  2VV6 A;  4KQD A;  3R7W A;  3A0S A;  4NXB A;  3EQV A;  2MJ6 A;  4IUH A;  3T4J A;  4H6J A;  2J3T C;  3EGX C;  3T4T A;  3KYQ A;  3A0R A;  4LRY C;  1OTB A;  3H7W B;  3F1O A;  4MCW A;  4MN5 A;  5DKK A;  2ZOI A;  5HDD A;  4ETX A;  3MQ0 A;  3IS2 B;  2QKP A;  2OWJ A;  1S1Y A;  2WKQ A;  4NEE D;  3EQU A;  4GHI B;  2R78 A;  4KQO A;  3T4O A;  2ZBB A;  3KSI A;  2ZOH A;  4GLQ A;  3GDI A;  4B9O A;  4WLA A;  5CX7 A;  2PD8 A;  3VV4 A;  4HH3 A;  4EXO A;  3F1N B;  3LIF A;  2VJW A;  2PT7 A;  2W27 A;  5MC7 A;  3U2A A;  4Y5F A;  1OTD A;  2XSS A;  3ULF A;  3BY8 A;  5HWT A;  1X0O A;  4I3J A;  4F3L B;  1IFQ A;  2L0W A;  4Q0I A;  1TF1 A;  4YWZ A;  4ARZ A;  1YAX A;  4GS9 B;  3LR4 A;  4I3I A;  4MDZ A;  5F69 A;  4LRZ E;  3UMD A;  4BBT A;  4R38 A;  3TW8 A;  1P97 A;  1V9Y A;  4MN7 A;  2VGL S;  3CUE C;  3F1P B;  4L9F A;  1S4S A;  2VEA A;  2KDK A;  2VA0 A;  2B18 A;  4MMN A;  3LIE A;  3MF0 A;  1OT9 A;  2M7V A;  1UWN X;  4CLC E;  1ZHH B;  2VZW A;  1N9N A;  4GCZ A;  2QJ5 A;  1S4R A;  5IU1 A;  2PHY A;  5HL6 A;  2NUT C;  1F5M A;  4BMW A;  4ETZ A;  5HWV A;  1IOU A;  3R4K A;  1ODV A;  3MFX A;  3KYZ A;  3LR0 A;  2G7U A;  2V9A A;  1VHM A;  5G4Y A;  3UB9 A;  3NOP C;  4LPZ A;  2JKR M;  3PXP A;  4G3K A;  4L9G A;  3HJK A;  2VKS A;  3A0V A;  4HP9 A;  1UWP X;  2JKR I;  3IBR A;  3SW1 A;  2H28 A;  4G3W A;  2Z6D A;  2GNX A;  1LSW A;  1EW0 A;  3K3D A;  3PBT A;  2WKP A;  4CLC A;  5EFW A;  4YOF A;  2DMW A;  1TD5 A;  3LIB A;  3ICY A;  1XJ2 A;  5J7E A;  2GJ3 A;  2QJ7 A;  3R7W B;  3NOU C;  2XA7 S;  4BWI A;  4H6J B;  3KX0 X;  3LI9 A;  3F1O B;  3OCL A;  2PR5 A;  3KO6 A;  4CLC D;  4NKP A;  3IBJ A;  2PD7 A;  3T4Q A;  1UGU A;  3E4O A;  1DP9 A;  3H9W A;  3H82 A;  2NUP C;  3BWL A;  2CMN A;  3OLO A;  3GEC A;  3CIT A;  5HDS A;  5HD5 A;  1YSP A;  2P08 A;  3MR0 A;  4Q0J A;  4I39 A;  1T1A A;  5LBR A;  2B02 A;  1MZU A;  2O9B A;  3EEH A;  3CLO A;  3BW6 A;  1NWZ A;  4NXG A;  4ARZ B;  2YKF A;  4NXF A;  5HPF A;  1WA9 A;  3FPV A;  4KUK A;  1NRJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...