3UE6A

The dark structure of the blue-light photoreceptor aureochrome1 lov
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
135
structure length
135
Chain Sequence
EDPDYSLVKALQMAQQNFVITDASLPDNPIVYASRGFLTLTGYSLDQILGRNCRFLQGPETDPRAVDKIRNAITKGVDTSVCLLNYRQDGTTFWNLFFVAGLRDSKGNIVNYVGVQSKVSEDYAKLLVNEQNIEY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structures of Aureochrome1 LOV suggest new design strategies for optogenetics.
pubmed doi rcsb
source organism Vaucheria frigida
molecule tags Signaling protein
molecule keywords Aureochrome1
total genus 39
structure length 135
sequence length 135
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2011-10-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13426 PAS_9 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3ue6A00
5KIZA 5A8BA 2PR5A 4MN6A 4GHIA 1P0ZA 3ZQ5A 3BY9A 1XJ4A 3FC7A 1T1BA 4RQ9A 5DJTA 2Z6CA 3UB9A 4E04A 3F1OB 1OTDA 3LICA 3LI9A 5TBMA 3RTYA 2PYPA 4BBUA 2WKQA 4L9GA 2PDRA 4M4XA 5AVEA 2VV7A 4F3LB 3UB6A 4L9FA 5TBMB 2L4RA 3E4OA 4HJ4A 4HJ6A 2M1CA 3NOTC 2V9AA 1GSVA 1D06A 2HV1A 3HJIA 3F1OA 1TS6A 4WF0A 5HSQA 2OWHA 4EW7A 4LRYC 3NHQA 4B9OA 1TS7A 3LIAA 3UMDA 3ULFA 5IS1A 1S67L 3K3CA 4HIAA 3LIDA 1LSWA 4R70A 4WL9A 5DJUA 1OTBA 5IU1A 1V9YA 4HP4A 4I3JA 1UGUA 3KX0X 4EEUA 5HZHA 2QJ5A 4I39A 2VV6A 2P7JA 1JNUA 2QKPA 1D7EA 2PD8A 3LUQA 4GW9A 4HH3A 4L9EA 4DJ2A 4NXBA 4JGPA 1BYWA 3GECA 3HJKA 1OTAA 4F3LA 1KOUA 3H7WB 4KQDA 4K08A 4R38A 1XJ3A 1OJGA 2L0WA 4GS9B 1MZUA 4JGRA 3P7NA 2A24B 3H9WA 1X0OA 4WLAA 2PYRA 2R78A 1NWZA 3BWLA 1DP6A 1F9IA 3IS2B 3UB7A 3VE4A 3H82A 1N9OA 2PR6A 4NXGA 3CAXA 1TS0A 2PHYA 3LIFA 3MFXA 4HOIA 3BY8A 4I38A 4LLOB 3LYXA 5AVFA 1DRMA 2VV8A 5HDDA 2BASA 2KDKA 2INWA 2QWSA 2KX6A 3MQQA 3NOPC 3OLOA 4I3IA 1T1CA 1T19A 2B02A 2OOLA 4EQ1A 4GHIB 3CWFA 1GSXA 4H6JB 4HQAA 1F98A 5F69A 2YKFA 1OT6A 4NXEA 4EEPA 4HP9A 1DP9A 2V0WA 5HD5A 4EETB 2K7SA 3MQOA 3LI8A 4EESA 4HNBA 5HDCA 2YKHA 1WA9A 4PKYG 5DKKA 3LIBA 1T1AA 2H28A 3T50A 1ODVA 3CLOA 4H6JA 1DP8A 2I9VA 2PD7A 4PKYA 1LSVA 3NJAA 3F1PB 4R6LA 2JN7A 4HJ3A 4HH2A 5HWWA 3MR0A 3VE3A 2J80A 4JGQA 1S4RA 5EFWA 3RH8B 3VOLA 5I5LA 5F5YA 2D02A 2L1MA 1VB6A 2QJ7A 3F1PA 3NOUC 1LSXA 2WKPA 1S66L 1XFQA 5DKLA 4BBTA 2VLGA 4GS9A 2EA9A 3A0SA 2WKRA 3ICYA 1N9LA 1OJ5A 4LPZA 4NXFA 4HHDA 1EW0A 5J4EA 1S4SA 1P97A 2V1AA 5G4YA 4EXOA 2CMNA 3E4QA 1T18A 4WUJA 4KUKA 2ZBBA 3GDIA 1OTIA 2V0UA 3PYPA 3K3DA 1N9NA 2Z6DA 5HWTA 2V1BA 4WN5A 5J7EA 1Y28A 2ZOHA 3EWKA 3A0VA 3A0RA 2QHKA 4JGOA 5G4ZA 4DJ3A 1XJ6A 1GSWA 4HY8A 3C8CA 3D72A 5HDSA 3SW1A 2D01A 1XFNA 5HWVA 3B33A 4R3AA 5HD3A 4BBVA 3EEHA 3C2WA 4KUOA 3H82B 4I5SA 1UWPX 3LIEA 1LL8A 3IS2A 2VEAA 3IBRA 2A24A 2JHEA 1OT9A 2ZOIA 3UE6A 1OTEA 2W0NA 3G6OA 1V9ZA 5F68A 2GJ3A 3H7WA 4I3AA 1S1YA 3PHYA 4MN5A 1G28A 3UMEA 5J3WA 1XJ2A 3E4PA 3MXQA 4LRXC 4EERA 4LRZE 3F1NA 1UWNX 4XT2B 1TS8A 3UB8A 1S1ZA 2W27A 3MJQA 4XT2A 5F6AA 3FG8A 4GCZA 4YWZA 1LT0A 3F1NB 4HI4A 2OWJA
chains in the Genus database with same CATH superfamily
1ALQA 1W8QA 3GV9A 2ZC5B 1ZKJA 3NC8A 4L9GA 4GDBA 2QZ6A 5HX9A 4KZAA 3E4OA 4S2KA 3HJIA 4LV2A 3LEZA 4OPQA 3MMHA 2W1TB 4JBFA 3TOIA 4EEUA 1MWSA 2FZ0A 5KSCA 1Z6FA 3S22A 4L9EA 4Y5FA 4WZ5C 3GECA 4KZ4A 4MBHA 1TEMA 3LR0A 3TJZC 3QNBA 1F9IA 1FOFA 3IX3A 5AQ9A 4HBUA 3LR3A 4Y0OA 3GQZA 2ZL1B 1W5DA 1EI5A 2YKFA 3G34A 4FOFA 1L0EA 4EETB 2R9XA 3CITA 1IKGA 3T50A 2ZMVA 4Z1WA 4E6XA 4NKPA 2K31A 3OPRA 1YSPA 2HZ5A 5FL3A 3F1PA 4XUZA 4GOGA 3V67A 3SS5A 5HAIA 3C7VA 1EW0A 2V1AA 3MKFA 4F94A 1OTIA 1YLYA 5DTSA 4JGOA 3VSLA 2ZQ8A 4FTXA 2D01A 2Y2QA 3CUEC 2Z2LB 3QP6A 5HD3A 3EEHA 1PW8A 3IWIA 2HP5A 3MZDA 1H5XA 2A24A 3OPHA 4N1XA 4OQHA 3T4QA 3T1SA 4ZJ1A 3IF5A 5EVID 1P0ZA 2PBYA 1XGJA 3DWKA 2MJ6A 5D3OA 1MY8A 1TF1A 5AVEA 1BLPA 3BW6A 5TBMB 4HESA 5M19A 5CX7A 2HDRA 3Q1FA 1VHMA 3E0YA 2XD5A 4C75A 5L2FA 1QMEA 4ESPA 1MKMA 1KE0A 5HW3A 3W4QA 4X69A 1N4OA 1MZUA 4JGRA 2VKSA 4X1MA 5AVFA 5L8MA 1DRMA 3MQQA 2IWCA 4JXGA 1DP9A 2Y2HA 3OZHA 3PR6A 4HNBA 5DKKA 4IBXA 3ZG0A 4H6JA 1VEUA 3VP1A 4ETZA 5EFWA 4EV4A 4FH2A 1TVFA 3OCNA 2K2NA 4IVKA 4JF4A 5EECA 3AGEA 3QHYA 3ITBA 2NUTC 5F1FA 1K0KA 2QYBA 4K91A 3E4QA 3IH8A 4DMZA 1YM1A 4S2PA 5LBRA 5U47A 4C3QA 4BWIA 1GSWA 1XPBA 3D72A 3B33A 4BBVA 2E8JA 3FKVA 5TR7A 2GDNA 2HDSA 3NY4A 1PNEA 1XJ2A 2JKRM 5J3WA 4BL2A 4G3KA 1TS8A 4LCMA 1HLUP 4HI4A 1XJ4A 5DJTA 3ITAA 4JF5A 3LICA 4BBUA 3RTYA 1SKOB 5EM1A 3HLGA 1BLHA 3U4LP 2L4RA 3T1QB 3VP3A 1CQAA 3F1OA 3S7OA 3K3CA 3LIDA 3HL9A 3NDGA 5FATA 3DTMA 2VV6A 3PTEA 1FQGA 5G18A 1TDGA 5TFQA 4FSFA 1XKZA 5L09A 2B5RA 3T12B 2VV8A 2QWSA 2EFXA 3N6IA 2GX5A 2Y4AA 4RX3A 1MBLA 3S7QA 3BFDA 2K7SA 1YLWA 3UPNA 5CGWA 1K6RA 4Y3IA 2H10A 1GHPA 1WE4A 1GCEA 3BRMA 5CGSA 4S2NA 3TE8A 5J4EA 4EBPA 4KZ5A 1PIOA 5HWTA 4OH0A 5J7EA 3SOIA 1RGYA 3PAGA 4ZRRA 1FR1A 5CHJA 4DJ3A 3FWLA 4QHCA 1STZA 4WEKA 4EUVA 4K0XA 5M18A 1PZOA 1KVLA 4KUOA 4Y13A 1IFQA 3OPLA 2ZC4B 3AGDA 4WMCA 4I3AA 1CF0A 1GA9A 5CHMA 5F6AA 1XX2A 3EQVA 4D2OA 1KE4A 3VOZA 1ERMA 3R7WA 2DRWA 2XK1A 3B47A 3KSHA 3VFHA 1TS6A 1Q2PA 3W2ZA 4QY6A 1D7EA 4Y0TA 4JGPA 1BYWA 4KQDA 2Q9NA 3P7NA 2E8IA 2LB9A 4Y17A 4N1HA 4WLAA 3UY6A 3ZVWA 3NBLA 2Y59A 3CWFA 4IUKA 1GSXA 4AFIA 3NDEA 5BOHA 1H8MA 4JXSA 1FCNA 4PKYG 5FI2A 1L0GA 1IKIA 4R6LA 2JN7A 3TG9A 2O99A 5CECA 5I5LA 2Q0OA 2L1MA 2J3TC 2WKEA 1XFQA 4GS9A 4ARZA 4CPKA 1KGEA 3V5MA 4B93A 5AQBA 4F3LB 1MWRA 2Y55A 3EWKA 4FD8A 4CJNA 1M40A 3LIEA 1ES3A 5TJJA 2W0NA 5J8XA 3H7WA 4HEFA 4KENB 3Q82A 4MBKA 3PHYA 3MXQA 3FKWA 3F1NA 2UV0E 2WGIA 3CJMA 3I7JA 1RGZA 3GTCA 4U3TA 2WKHA 3HREA 3WRZA 3IXGA 4BMWA 2A3UA 2JKTI 4WL9A 4O8GA 3UPOA 3V39A 2XDMA 1IEMA 3PBSA 4QD4A 1OTBA 3EOIA 5IU1A 1JWPA 2P7JA 1CJFA 2PD8A 2NUPC 1E25A 1PI4A 4JLFA 3LR5A 4K08A 5HPIA 1F2KA 4E3IA 2EXAA 2L0WA 4BD0A 1JTGA 3A3FA 4EWFA 3SH7A 4M3KA 1X0OA 3VV4A 3UDXA 3LCEA 3MFXA 3ZCZA 1Y54A 1RCJA 2B02A 2OOLA 4EQ1A 4FCFA 5F69A 1OT6A 3NECA 4O0PA 1JWZA 3C4PA 1XP4A 5FEFA 3KYZA 4DRTA 3Q81A 3BFFA 3MR0A 5EVIA 3RH8B 3KSGA 5E43A 2G7UA 1YMXA 3ISGA 1M6KA 4EU0A 1N9LA 1OJ5A 5A91A 2HDUA 2XFTA 4WUJA 1PYYA 4Y0UA 4KUKA 3JYIA 5HFOA 3FZCA 3T4OA 1K55C 3BFEA 4DE2A 4EBNA 1PRQA 3IH9A 3QP4A 5FQKA 1EROA 3IBRA 2JHEA 4GZBA 4ZAMA 3TW8A 3O3VA 1BLSA 3ZQ5A 1FIKA 3HUNA 3PXPA 3CZDA 3EQUA 4DXBA 1NRFA 2I72A 4ZJ2A 4DE3A 4BJPA 2ZQ9A 1TS7A 3LIAA 3WS2A 3UMDA 5GHZA 5DJUA 5EOOA 3KYEA 1V9YA 2QJ5A 4NXBA 2B95A 1PZPA 1L0FA 1S6RA 2ZC7A 3G4PA 3IX8A 4PPRA 2J3WA 4JKTA 2R78A 4UAAA 1EWZA 3LYXA 5HDDA 2BASA 4H6JB 3ZHHA 5IT5A 3UE3A 1F5MA 3MXSA 2YKHA 1PW1A 3CLOA 5HL6A 4LV1A 3MS6A 1WYBA 1ZTUA 1XXMA 4RA7A 4ZBEA 5DF8A 2WKPA 5CTMA 3LY3A 2WKRA 4JF6A 5CXWA 2JCHA 4LPZA 4CLCE 1DJBA 2G2WA 3N8RA 4WN5A 5GLAA 2JKFA 3WS4A 2EFUA 4S2NC 2BTFP 3G35A 3V3SA 5GHYA 5G4ZA 4MBFA 2VGJA 1K38A 4C6YA 2PRFA 4GLQA 4WEJA 3PBRA 1J9MA 2DMWA 5L10A 4NK3A 4LRXC 3SZTA 2X71A 4LCLA 2XGNA 3UPPA 5F1GA 1P9WA 3V50A 3IXBA 3QP1A 4P6BA 3G32A 5E2EA 4BQMA 3UO9A 3ULFA 4ETXA 1XA1A 5CRFA 4X56A 4A5RA 1MC0A 2O9AA 1OTAA 2RL3A 1GA0A 3QP2A 3S7PA 1ZC2A 4LV0A 3BWLA 3H82A 3CAXA 3A3IA 4MLLA 4PM5A 4MNRA 3BM6A 4I3IA 2Q9MA 1CEFA 4EEPA 4HP9A 3T4TA 1KE3A 4WYYA 1ODVA 2WGWA 2V1ZA 1FSWA 1LSVA 5CERA 3ZG5A 5HAPA 2HPBA 4S2LA 2Y2KA 3O5YA 4QY5A 1BT5A 2WGWB 4Q0JA 2EA9A 3ICYA 2Y79A 3D3OA 1U60A 4QB8A 1D1JA 4EXOA 3FV7A 4KG5A 1KDWA 3RJUA 3K3DA 3HLWA 2XA7S 2ZQDA 3SW1A 1NLYA 3W4PA 3RXXA 3C2WA 1IYOA 5JYPA 3JPUA 3GR2A 4X25A 1LI0A 3HLFA 3UE6A 5EV0A 3A3JA 3IF6A 4DXCA 2V8FA 2DCFA 1L0DA 1Y4OA 1UWNX 1S1ZA 4YWZA 2JKRI 3UNWA 3QNCA 4PM8A 2W3EA 2UWXA 3P98A 1CI8A 2ZJ9A 1MPLA 2X01A 4X55A 2J8YA 4M4XA 5HAQA 4IJGA 1JWVA 3C4OA 2OAQ1 4OOMA 4Q0IA 5E2FA 4B9OA 1S67L 1SCWA 3O88A 1UGUA 3VFFA 5AQ7A 4I39A 1W63M 4FH4A 4OPRA 1OJGA 3FPWA 1SDEA 3M6HA 1NWZA 3UB7A 2W3FA 1HVBA 1LL5A 4P0MA 4NETA 3CMZA 2HJ9C 1MKIA 2HDQA 5EVEA 4L0LA 3HUMA 1DJCA 2PD7A 4R4SA 3LEQA 5HWWA 5FDHA 4B88A 5F5YA 1S66L 1TD5A 4HBTA 4NXFA 4RVAA 1S4SA 1P97A 5G4YA 3BQAA 3PYPA 4WM9A 2XLNA 3PBOA 2XF3A 4DE0A 3BFCA 1YSQA 2FH5A 3WS5A 3PBQA 2GNXA 1LL8A 3QP8A 5L07A 3G6OA 4KQRA 5AQAA 1K55A 1S1YA 3MFDA 3MKEA 2EX2A 4CLCA 3C5AA 2ZC6B 2XH9A 2PT7A 3PAEA 3FYZA 2C5WB 4RQ9A 2XROA 4PHTA 1YQSA 3LO7A 5GLBA 1J3WA 3IWOA 4EQIA 3E2KA 5IS1A 2EX9A 1MWTA 5FQIA 3T4KA 1SDNA 3HCYA 3HJKA 3UDIA 3IXHA 3KYQA 4P6ZM 1NYYA 4R38A 4GD6A 4OPYA 3N8SA 5F83A 4LGWA 3LGOA 3MBZA 1I2WA 4UA9A 5DVAA 1FCMA 2RCXA 1NRJA 1F98A 4NXEA 4WBGA 1W63Q 2JKTM 4CLCC 5JYOA 3LIBA 2P74A 4R0QA 3ZVTA 2VX8A 2FFYA 2QMIA 3ZG7B 1YLPA 3LFVA 1L3LA 4X1LA 4E3NA 1K56A 3VP4A 1MXOA 2VGLS 4YNRA 1K56D 3A0VA 1PFLA 1XJ6A 3LY4A 2G2UA 4KZ6A 1LI9A 2WADA 4KQQA 1KDSA 3DW0A 3ZGAB 4XXRA 2A2LA 3KSIA 1UWPX 5DTKA 4KQOA 1HZOA 1PI5A 4KZ8A 1OT9A 1H0MA 3MZFA 4UQIM 1ZHHB 2ZM2A 1G6AA 4XT2A 2XQZA 1G68A 1RP5A 4CLCB 5FEGA 4QJGA 2Y2JA 1TDLA 5E2HA 5FQMA 3F1OB 3LI9A 2ZQCA 2WZZA 3BJNA 4BD1A 3CG5A 1AWIA 4JXVA 4EW7A 2A49A 2ZD8A 1E3UD 3D9YA 3S7NA 5CTNA 4NG2A 1DJAA 3IF6B 3H7WB 4R3BA 4MEZA 4KZ9A 1XJ3A 4GKUA 1XGIA 2PBDP 2PYRA 3T4JA 2FFFB 3VE4A 1NYMA 1TS0A 4OLGA 3VP2A 3VOLA 1SKFA 2B18A 4WZ5A 3OLOA 1CEGA 4HQAA 5FI6A 1LL9A 3VMAA 2V8CA 4DKIA 3UN7A 4FUWA 2V2FF 4ZTKA 1L2SA 2JC7A 2XA7M 2KOIA 3IXDA 2LB5A 3ZFZA 5A90A 1PWDA 3OC2A 2QJ7A 1OPXA 3DTEA 4BBTA 1OMEA 1H3QA 2J3TD 4DDYA 1DY6A 1ESUA 1ZG4A 3SS4A 4E6WA 2ZQ7A 3ZG9B 3IT9A 3CI6A 3EGDC 3C8CA 2HP6A 4IEDA 2EXBA 2KLIA 2Y8HA 1A0KA 4MCWA 2W3GA 2GJ3A 3MF0A 2P08A 5C5KA 3E4PA 2Y2NA 4LRZE 2O9CA 3M2JA 3IQAA 4ZJ3A 2EX6A 2OWJA 4PMAA 4GHIA 2QPNA 4RYEA 1QMFA 4OOYA 2Z6CA 2PYPA 4GN2A 4UEYA 1GSVA 3UE1A 4MMNA 1VETA 1XA7A 1YMSA 4PM7A 5HZHA 1W7FA 2J9PA 1JNUA 2H0YA 3BLMA 4F3LA 3RXWA 1KOUA 1CK3A 2A24B 3MZEA 4OVDA 2IA2A 3ZG8B 3S4XA 1HTZA 4IBRA 3IHBA 3Q07A 4GHIB 2XSSA 3DAVA 3LI8A 1NLZA 3G31A 4IVIA 1T1AA 2EX8A 2H28A 4ARZB 2JBFA 4S2MA 2GZAA 3NULA 3F1PB 4HH2A 4UQIS 1KGFA 5DF9A 3N7WA 1CI9A 2Y2LA 4LV3A 3A0SA 2WAEA 2VGKA 3B3XA 4HHDA 1PWGA 2ZBBA 2V0UA 3G2YA 3BLSA 1ESIA 4O01A 2P9VA 2QHKA 2O0YA 2ZL1A 3L7HA 4P85A 4OQ0A 2AVXA 5GLCA 5EVIC 1SZVA 2H5SA 2XR0A 5KSHA 4UHUA 5FAPA 3UE0A 1FR6A 4JXWA 1GHIA 1ERQA 4YFMA 4XT2B 1FCOA 1BZAA 1MWUA 3WRTA 4MN6A 3BY9A 1G6OA 3OPPA 2CC1A 3T4LA 4UA6A 3AGFA 2VV7A 3Q7ZA 1SKOA 5K5BA 4HJ4A 2M1CA 3NOTC 4WF0A 2HV1A 5HPFA 4EBLA 3NHQA 2W3DA 4HIAA 4HP4A 2WAFA 2QKPA 2WK0A 4GW9A 3LUQA 1ES5A 4R1GA 3UB5P 2ZQAA 3H9WA 1K25A 1ES2A 4CQHA 2PHYA 4I38A 4HOIA 2Y2OA 5MC7A 2W3HA 1T1CA 2ACGA 2Y2MA 5GL9A 4EESA 4OP5A 1DP8A 1K57C 2PU2A 1YLZA 3HUOA 4PKYA 4Q0HA 2HGVA 4XUXA 2XD1A 1IYPA 2V20A 3C30A 2OLVA 1VEUB 5TGFA 4O7DA 1P9RA 5DKLA 5EUAA 5CHUA 4EUZA 3TRCA 3NI9A 3DBAA 1N9NA 3GMWA 3OCLA 4KG2A 3M6BA 4BL3A 2IWDA 4HY8A 3P09A 1XFNA 4OQGA 1BLCA 1I5QA 3V3RA 4QWOA 3IS2A 4Y2FA 2XEPA 3W4OA 3VP0A 4KZ7A 3MJQA 1YT4A 4LENA 1LT0A 3JVUA 4Q8IA 3U2AA 1H8YA 2P04A 2VZWA 5FQJA 3MQ0A 3WS0A 5GHXA 4OKPA 3UB6A 4L9FA 4PM9A 1ONHA 2OWHA 4R70A 4ID4A 4WZ4A 4DF6A 4PAUA 3NIAA 4HH3A 4MDZA 2ZM8A 3CHWP 1K54A 1BSGA 1DP6A 1K4FA 2PR6A 3LIFA 4PM6A 2KDKA 2INWA 3GSGA 4OQIA 4OOLA 2Y2IA 1BULA 2EWVA 2P9VB 5A92A 3GVBA 5EPHA 2X02A 5DFYA 2BG1A 2I9VA 4BLMA 3NJAA 3T1XA 4HJ3A 4G3WA 4DDSA 3KO6A 1VB6A 3RFBA 4YOFA 2PAVP 2VLGA 1PWCA 1K4EA 1ACFA 5FASA 2CMNA 3IHAA 4Y7PA 2V1BA 1VQQA 5DFXA 5FI7A 4R23A 1E3UA 3HLDA 1W79A 5EE8A 1ES4A 4WMCD 1E4DA 5E2GA 4ME4A 4WELA 3E98A 3UB8A 3BYDA 5GLDA 4GCZA 1FILA 2W1TA 4X6TA 3F1NB 1VETB 3O86A 4E3LA 2WGVA 4GDNA 1YPRA 2JKGA 1OTDA 3BFGA 4MN7A 5HL1A 2WKQA 5HARA 3R7WB 1D06A 4LRYC 3DTKA 3WWXA 1WYCA 1K57A 4G3VA 5FDSA 4OLDA 3EGXC 3KX0X 2JE5A 4P6ZS 3MSHA 1IELA 4S2JA 1VM1A 4DJ2A 1NZOA 4GJ4A 3R4KA 1KVMA 4GS9B 4DE1A 4S2OA 1GHMA 5KIZA 2OSUA 5FQ9A 3NOPC 3T4SA 1T19A 4R3JA 2C6WB 4U0XA 1H8ZA 4QPRA 5CEDA 2WKIA 3O87A 3OOVA 4OONA 2H0TA 3PBTA 3VE3A 4JGQA 4YINA 4GD8A 1HD8A 1LSXA 4JPMA 3BECA 4BENA 4LFUA 1SHVA 3IX4A 2M7VA 2OAP1 3CUEA 4OP8A 3P01A 5FQQA 4D60A 4P87A 2Y2GA 4OPZA 2M7UA 3SS3A 3SH9A 1JTDA 3A0RA 3C7UA 5DTTA 1JVJA 3G30A 3IF6C 3B42A 5HWVA 4R3AA 2Y91A 3OBFA 4I5SA 1ONGA 1YLTA 2ZOIA 1W8YA 3UMEA 4MN5A 1G28A 2WUQA 3BQ8A 2VK3A 3M2KA 2ZMFA 2W27A 4ZDXA 5EVLA 3VSKA 2PR5A 1BTLA 3IBJA 1T1BA 3A3EA 1FSYA 4E04A 5FAOA 2PDRA 3HLBA 3W8KA 4HJ6A 3N4IA 3E2LA 1YLJA 2V9AA 1G5UA 3JVVA 5HSQA 3HLEA 1IYSA 2IWBA 2ZM0A 4GNUA 2XFSA 5KMWA 1LSWA 2ZC3B 5CGXA 3HVFA 4E3KA 4IHQA 3KSFA 3ZNTA 1ZG6A 2ZLYA 1K6SA 5KZHA 5FA7A 3PBNA 1N9OA 5EOEA 4NXGA 4Z9QA 4X68A 2OLUA 3BY8A 3N8LA 1NXYA 3S1YA 1IYQA 2V0WA 4H8RA 4N92A 3MQOA 4K0WA 5HDCA 1WA9A 3D4FA 1Z09A 3Q7VB 2WZXA 2O9BA 1K54C 4E3MA 2VJWA 2J80A 1S4RA 4X53A 3DWZA 2D02A 3GRJA 4N9LA 2ZMAA 1NZUA 3CPTA 5FSRA 3ZYTA 1I2SA 4IUHA 3TSGA 2R9WA 5IHVA 3L9KA 4RX2A 3A3DA 5HDSA 3IWQA 1KGGA 1AXBA 1C3BA 3H82B 1NJ4A 5I94A 3SH8A 1OTEA 3FPVA 4EERA 1NY0A 3FG8A 5A8BA 2Z2MB 3FC7A 5AJGA 3UB9A 3QP5A 5TBMA 2HF6A 2Y2PA 2W1RA 2WYXA 4UA7A 3BEBA 4B4ZA 5FAQA 4U0TA 2DNSA 4I3JA 4KZ3A 2J9OA 3C38A 1O7EA 3K2NA 4E3JA 1Q2QA 3HBRA 4QU3A 3EEAA 3T1RA 3IS2B 4KG6A 1YAXA 4LLOB 2XRNA 5DF7A 2BLSA 2KX6A 5M1AA 1IOUA 5CEBA 1LLBA 5HD5A 1N9BA 1LHYA 4KZBA 4NEED 4CLCD 3HLCA 3MXRA 5F82A 3NOUC 2OV5A 3Q7VA 3VOYA 1O07A 3ZDJA 5A93A 4N9KA 1T18A 3CPTB 3GDIA 4DN0A 2Z6DA 2HJEA 2VA0A 1Y28A 2ZOHA 1YKDA 4S2IA 4B4XA 1S0WA 4II7A 3UDFA 4R4RA 3ZNYA 5EVIB 4E3OA 4GB7A 2HP9A 5EM0A 2PU4A 3G2ZA 2VEAA 2EWWA 1V9ZA 5F68A 3WS1A 2VGLM 4Y15A 2J7VA 3LR4A 3NCKA 1BUEA 3DTIA
chains in the Genus database with same CATH topology
3JVUA 3U2AA 2P04A 2VZWA 4RQ9A 2XROA 4L9GA 3MQ0A 4BMWA 3UB6A 4L9FA 4PHTA 2JKTI 3E4OA 4WL9A 4O8GA 3HJIA 2OWHA 3MMHA 5IS1A 2W1TB 4R70A 3PBSA 1OTBA 3EOIA 5IU1A 3T4KA 4EEUA 4PAUA 2P7JA 4HH3A 2FZ0A 2PD8A 4MDZA 4L9EA 2NUPC 4Y5FA 3HCYA 3GECA 3HJKA 3LR5A 3KYQA 4K08A 4P6ZM 5HPIA 4R38A 2L0WA 3LR0A 3TJZC 1X0OA 3VV4A 1DP6A 1F9IA 2PR6A 3MFXA 3LIFA 2KDKA 2INWA 3LR3A 2B02A 2OOLA 4OOLA 4EQ1A 2EWVA 1NRJA 1F98A 5F69A 2YKFA 1OT6A 4FOFA 4NXEA 1W63Q 2JKTM 4CLCC 4EETB 4O0PA 3CITA 3LIBA 3T50A 2ZMVA 4Z1WA 2VX8A 5DFYA 3KYZA 4NKPA 2I9VA 2K31A 1YSPA 5FL3A 3NJAA 4HJ3A 3MR0A 4G3WA 3LFVA 3RH8B 3KO6A 3KSGA 2G7UA 1VB6A 3F1PA 3RFBA 4YOFA 2VLGA 4EU0A 1N9LA 1OJ5A 3V67A 1EW0A 2V1AA 2CMNA 2VGLS 4WUJA 4YNRA 4KUKA 1OTIA 2V1BA 5DFXA 3A0VA 3T4OA 4JGOA 1XJ6A 2D01A 3CUEC 5HD3A 3EEHA 2A2LA 3KSIA 1UWPX 4KQOA 4ME4A 3IBRA 2A24A 2JHEA 1OT9A 4WELA 4UQIM 3T4QA 1ZHHB 3TW8A 3E98A 3UB8A 4XT2A 4GCZA 2W1TA 3F1NB 4CLCB 1P0ZA 3ZQ5A 3PXPA 2MJ6A 1OTDA 3F1OB 3LI9A 4MN7A 1TF1A 2WKQA 3EQUA 5AVEA 3BJNA 3BW6A 5TBMB 5CX7A 3R7WB 1D06A 1VHMA 4BJPA 4EW7A 4LRYC 1TS7A 3E0YA 3LIAA 3UMDA 4G3VA 5DJUA 3S7NA 3EGXC 1V9YA 1MKMA 3KX0X 2QJ5A 4P6ZS 4DJ2A 4NXBA 3H7WB 4GJ4A 1XJ3A 3R4KA 4GS9B 1MZUA 4JGRA 2J3WA 2PYRA 2R78A 5KIZA 3T4JA 2VKSA 3VE4A 1TS0A 5AVFA 3LYXA 5HDDA 1DRMA 5L8MA 3VOLA 2B18A 2BASA 3MQQA 3NOPC 3T4SA 3OLOA 1T19A 4H6JB 4HQAA 5IT5A 3UE3A 1DP9A 3PR6A 1F5MA 4HNBA 2YKHA 5DKKA 4QPRA 3CLOA 5HL6A 3OOVA 4H6JA 2XA7M 3PBTA 2KOIA 4ETZA 3VE3A 2LB5A 1ZTUA 4JGQA 5EFWA 3OCNA 3OC2A 2QJ7A 2K2NA 1OPXA 1LSXA 2WKPA 4BBTA 2WKRA 4LPZA 1H3QA 2NUTC 2M7VA 2OAP1 4CLCE 3CUEA 2QYBA 3E4QA 3P01A 2J3TD 4DMZA 4WN5A 2M7UA 5LBRA 3A0RA 5G4ZA 4BWIA 1GSWA 3CI6A 3EGDC 3C8CA 4GLQA 3D72A 4WEJA 3B42A 5HWVA 3B33A 4R3AA 2KLIA 4BBVA 3OBFA 2Y8HA 4I5SA 3PBRA 2ZOIA 2DMWA 4MCWA 2W3GA 2GJ3A 3MF0A 2P08A 3UMEA 4MN5A 1G28A 2JKRM 1XJ2A 3E4PA 4LRXC 5J3WA 5C5KA 4LRZE 3BQ8A 4G3KA 2ZMFA 1TS8A 2O9CA 2W27A 4HI4A 2OWJA 2PR5A 4GHIA 3IBJA 1XJ4A 1T1BA 5DJTA 2Z6CA 4E04A 3LICA 4BBUA 3RTYA 2PYPA 1P9WA 2PDRA 4UEYA 2L4RA 4HJ6A 2V9AA 1GSVA 3F1OA 3JVVA 5HSQA 4MMNA 3S7OA 3ULFA 3K3CA 3LIDA 4ETXA 1LSWA 5HZHA 2VV6A 1JNUA 1MC0A 4IHQA 4F3LA 2O9AA 1OTAA 3KSFA 1KOUA 3S7PA 2A24B 4FSFA 3BWLA 2IA2A 3PBNA 3H82A 1N9OA 4NXGA 3CAXA 3BY8A 2VV8A 2QWSA 4I3IA 4GHIB 2GX5A 2XSSA 4EEPA 4HP9A 3S7QA 2V0WA 2K7SA 3MQOA 3T4TA 3LI8A 1NLZA 5HDCA 1WA9A 1T1AA 2H28A 1ODVA 4Y3IA 2O9BA 4ARZB 2GZAA 1LSVA 3F1PB 2VJWA 4HH2A 4UQIS 2J80A 1S4RA 5DF9A 3O5YA 2D02A 4Q0JA 2EA9A 3A0SA 3ICYA 2Y79A 3TE8A 4HHDA 5J4EA 3D3OA 4EXOA 2ZBBA 2V0UA 3K3DA 5HWTA 3ZYTA 5J7EA 4O01A 4ZRRA 2QHKA 4IUHA 2O0YA 4DJ3A 2XA7S 1STZA 3SW1A 4WEKA 1NLYA 5HDSA 4EUVA 3C2WA 4KUOA 3H82B 1IFQA 5KSHA 3UE6A 1OTEA 3FPVA 4I3AA 4EERA 1UWNX 4XT2B 1S1ZA 4YWZA 5F6AA 3FG8A 2JKRI 3EQVA 2W3EA 5A8BA 4MN6A 3BY9A 3FC7A 5AJGA 1G6OA 3R7WA 3UB9A 5TBMA 3T4LA 3B47A 3KSHA 4M4XA 2HF6A 2VV7A 4IJGA 2W1RA 5K5BA 4HJ4A 2M1CA 2OAQ1 3NOTC 2HV1A 4OOMA 4Q0IA 4WF0A 5HPFA 1TS6A 3NHQA 4B9OA 2W3DA 1S67L 4HIAA 3W2ZA 4HP4A 4I3JA 1UGUA 4I39A 1W63M 2QKPA 1D7EA 4GW9A 3C38A 3LUQA 3K2NA 4JGPA 1BYWA 4KQDA 1OJGA 3FPWA 3P7NA 3H9WA 3EEAA 1NWZA 3IS2B 3UB7A 2LB9A 4CQHA 4WLAA 1YAXA 2PHYA 4I38A 4LLOB 4HOIA 2W3FA 2XRNA 2KX6A 5MC7A 2W3HA 1T1CA 4IUKA 3CWFA 1GSXA 4AFIA 1IOUA 5HD5A 2HJ9C 1H8MA 4EESA 4PKYG 4L0LA 1DP8A 2PD7A 4PKYA 4Q0HA 2HGVA 4R6LA 2JN7A 4NEED 5HWWA 2O99A 4CLCD 3C30A 5I5LA 5F5YA 2L1MA 3NOUC 2J3TC 1P9RA 1S66L 1XFQA 5DKLA 1TD5A 4GS9A 4ARZA 4NXFA 3TRCA 4B93A 1S4SA 1P97A 4F3LB 5G4YA 3BQAA 1T18A 3GDIA 4DN0A 3PYPA 3DBAA 1N9NA 2HJEA 2VA0A 2Z6DA 3OCLA 1Y28A 2ZOHA 3EWKA 1YKDA 3PBOA 4II7A 4HY8A 1XFNA 1YSQA 2FH5A 3PBQA 3LIEA 2GNXA 5TJJA 1LL8A 3IS2A 2VEAA 2EWWA 2W0NA 3G6OA 1V9ZA 4Y2FA 5F68A 3H7WA 1S1YA 2VGLM 3PHYA 3MXQA 3F1NA 4CLCA 3LR4A 3MJQA 1LT0A 2PT7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5KIZ A;  5A8B A;  2PR5 A;  4MN6 A;  4GHI A;  1P0Z A;  3ZQ5 A;  3BY9 A;  1XJ4 A;  3FC7 A;  1T1B A;  4RQ9 A;  5DJT A;  2Z6C A;  3UB9 A;  4E04 A;  3F1O B;  1OTD A;  3LIC A;  3LI9 A;  5TBM A;  3RTY A;  2PYP A;  4BBU A;  2WKQ A;  4L9G A;  2PDR A;  4M4X A;  5AVE A;  2VV7 A;  4F3L B;  3UB6 A;  4L9F A;  5TBM B;  2L4R A;  3E4O A;  4HJ4 A;  4HJ6 A;  2M1C A;  3NOT C;  2V9A A;  1GSV A;  1D06 A;  2HV1 A;  3HJI A;  3F1O A;  1TS6 A;  4WF0 A;  5HSQ A;  2OWH A;  4EW7 A;  4LRY C;  3NHQ A;  4B9O A;  1TS7 A;  3LIA A;  3UMD A;  3ULF A;  5IS1 A;  1S67 L;  3K3C A;  4HIA A;  3LID A;  1LSW A;  4R70 A;  4WL9 A;  5DJU A;  1OTB A;  5IU1 A;  1V9Y A;  4HP4 A;  4I3J A;  1UGU A;  3KX0 X;  4EEU A;  5HZH A;  2QJ5 A;  4I39 A;  2VV6 A;  2P7J A;  1JNU A;  2QKP A;  1D7E A;  2PD8 A;  3LUQ A;  4GW9 A;  4HH3 A;  4L9E A;  4DJ2 A;  4NXB A;  4JGP A;  1BYW A;  3GEC A;  3HJK A;  1OTA A;  4F3L A;  1KOU A;  3H7W B;  4KQD A;  4K08 A;  4R38 A;  1XJ3 A;  1OJG A;  2L0W A;  4GS9 B;  1MZU A;  4JGR A;  3P7N A;  2A24 B;  3H9W A;  1X0O A;  4WLA A;  2PYR A;  2R78 A;  1NWZ A;  3BWL A;  1DP6 A;  1F9I A;  3IS2 B;  3UB7 A;  3VE4 A;  3H82 A;  1N9O A;  2PR6 A;  4NXG A;  3CAX A;  1TS0 A;  2PHY A;  3LIF A;  3MFX A;  4HOI A;  3BY8 A;  4I38 A;  4LLO B;  3LYX A;  5AVF A;  1DRM A;  2VV8 A;  5HDD A;  2BAS A;  2KDK A;  2INW A;  2QWS A;  2KX6 A;  3MQQ A;  3NOP C;  3OLO A;  4I3I A;  1T1C A;  1T19 A;  2B02 A;  2OOL A;  4EQ1 A;  4GHI B;  3CWF A;  1GSX A;  4H6J B;  4HQA A;  1F98 A;  5F69 A;  2YKF A;  1OT6 A;  4NXE A;  4EEP A;  4HP9 A;  1DP9 A;  2V0W A;  5HD5 A;  4EET B;  2K7S A;  3MQO A;  3LI8 A;  4EES A;  4HNB A;  5HDC A;  2YKH A;  1WA9 A;  4PKY G;  5DKK A;  3LIB A;  1T1A A;  2H28 A;  3T50 A;  1ODV A;  3CLO A;  4H6J A;  1DP8 A;  2I9V A;  2PD7 A;  4PKY A;  1LSV A;  3NJA A;  3F1P B;  4R6L A;  2JN7 A;  4HJ3 A;  4HH2 A;  5HWW A;  3MR0 A;  3VE3 A;  2J80 A;  4JGQ A;  1S4R A;  5EFW A;  3RH8 B;  3VOL A;  5I5L A;  5F5Y A;  2D02 A;  2L1M A;  1VB6 A;  2QJ7 A;  3F1P A;  3NOU C;  1LSX A;  2WKP A;  1S66 L;  1XFQ A;  5DKL A;  4BBT A;  2VLG A;  4GS9 A;  2EA9 A;  3A0S A;  2WKR A;  3ICY A;  1N9L A;  1OJ5 A;  4LPZ A;  4NXF A;  4HHD A;  1EW0 A;  5J4E A;  1S4S A;  1P97 A;  2V1A A;  5G4Y A;  4EXO A;  2CMN A;  3E4Q A;  1T18 A;  4WUJ A;  4KUK A;  2ZBB A;  3GDI A;  1OTI A;  2V0U A;  3PYP A;  3K3D A;  1N9N A;  2Z6D A;  5HWT A;  2V1B A;  4WN5 A;  5J7E A;  1Y28 A;  2ZOH A;  3EWK A;  3A0V A;  3A0R A;  2QHK A;  4JGO A;  5G4Z A;  4DJ3 A;  1XJ6 A;  1GSW A;  4HY8 A;  3C8C A;  3D72 A;  5HDS A;  3SW1 A;  2D01 A;  1XFN A;  5HWV A;  3B33 A;  4R3A A;  5HD3 A;  4BBV A;  3EEH A;  3C2W A;  4KUO A;  3H82 B;  4I5S A;  1UWP X;  3LIE A;  1LL8 A;  3IS2 A;  2VEA A;  3IBR A;  2A24 A;  2JHE A;  1OT9 A;  2ZOI A;  3UE6 A;  1OTE A;  2W0N A;  3G6O A;  1V9Z A;  5F68 A;  2GJ3 A;  3H7W A;  4I3A A;  1S1Y A;  3PHY A;  4MN5 A;  1G28 A;  3UME A;  5J3W A;  1XJ2 A;  3E4P A;  3MXQ A;  4LRX C;  4EER A;  4LRZ E;  3F1N A;  1UWN X;  4XT2 B;  1TS8 A;  3UB8 A;  1S1Z A;  2W27 A;  3MJQ A;  4XT2 A;  5F6A A;  3FG8 A;  4GCZ A;  4YWZ A;  1LT0 A;  3F1N B;  4HI4 A;  2OWJ A; 
#chains in the Genus database with same CATH topology
 1ALQ A;  1W8Q A;  3GV9 A;  2ZC5 B;  1ZKJ A;  3NC8 A;  4L9G A;  4GDB A;  2QZ6 A;  5HX9 A;  4KZA A;  3E4O A;  4S2K A;  3HJI A;  4LV2 A;  3LEZ A;  4OPQ A;  3MMH A;  2W1T B;  4JBF A;  3TOI A;  4EEU A;  1MWS A;  2FZ0 A;  5KSC A;  1Z6F A;  3S22 A;  4L9E A;  4Y5F A;  4WZ5 C;  3GEC A;  4KZ4 A;  4MBH A;  1TEM A;  3LR0 A;  3TJZ C;  3QNB A;  1F9I A;  1FOF A;  3IX3 A;  5AQ9 A;  4HBU A;  3LR3 A;  4Y0O A;  3GQZ A;  2ZL1 B;  1W5D A;  1EI5 A;  2YKF A;  3G34 A;  4FOF A;  1L0E A;  4EET B;  2R9X A;  3CIT A;  1IKG A;  3T50 A;  2ZMV A;  4Z1W A;  4E6X A;  4NKP A;  2K31 A;  3OPR A;  1YSP A;  2HZ5 A;  5FL3 A;  3F1P A;  4XUZ A;  4GOG A;  3V67 A;  3SS5 A;  5HAI A;  3C7V A;  1EW0 A;  2V1A A;  3MKF A;  4F94 A;  1OTI A;  1YLY A;  5DTS A;  4JGO A;  3VSL A;  2ZQ8 A;  4FTX A;  2D01 A;  2Y2Q A;  3CUE C;  2Z2L B;  3QP6 A;  5HD3 A;  3EEH A;  1PW8 A;  3IWI A;  2HP5 A;  3MZD A;  1H5X A;  2A24 A;  3OPH A;  4N1X A;  4OQH A;  3T4Q A;  3T1S A;  4ZJ1 A;  3IF5 A;  5EVI D;  1P0Z A;  2PBY A;  1XGJ A;  3DWK A;  2MJ6 A;  5D3O A;  1MY8 A;  1TF1 A;  5AVE A;  1BLP A;  3BW6 A;  5TBM B;  4HES A;  5M19 A;  5CX7 A;  2HDR A;  3Q1F A;  1VHM A;  3E0Y A;  2XD5 A;  4C75 A;  5L2F A;  1QME A;  4ESP A;  1MKM A;  1KE0 A;  5HW3 A;  3W4Q A;  4X69 A;  1N4O A;  1MZU A;  4JGR A;  2VKS A;  4X1M A;  5AVF A;  5L8M A;  1DRM A;  3MQQ A;  2IWC A;  4JXG A;  1DP9 A;  2Y2H A;  3OZH A;  3PR6 A;  4HNB A;  5DKK A;  4IBX A;  3ZG0 A;  4H6J A;  1VEU A;  3VP1 A;  4ETZ A;  5EFW A;  4EV4 A;  4FH2 A;  1TVF A;  3OCN A;  2K2N A;  4IVK A;  4JF4 A;  5EEC A;  3AGE A;  3QHY A;  3ITB A;  2NUT C;  5F1F A;  1K0K A;  2QYB A;  4K91 A;  3E4Q A;  3IH8 A;  4DMZ A;  1YM1 A;  4S2P A;  5LBR A;  5U47 A;  4C3Q A;  4BWI A;  1GSW A;  1XPB A;  3D72 A;  3B33 A;  4BBV A;  2E8J A;  3FKV A;  5TR7 A;  2GDN A;  2HDS A;  3NY4 A;  1PNE A;  1XJ2 A;  2JKR M;  5J3W A;  4BL2 A;  4G3K A;  1TS8 A;  4LCM A;  1HLU P;  4HI4 A;  1XJ4 A;  5DJT A;  3ITA A;  4JF5 A;  3LIC A;  4BBU A;  3RTY A;  1SKO B;  5EM1 A;  3HLG A;  1BLH A;  3U4L P;  2L4R A;  3T1Q B;  3VP3 A;  1CQA A;  3F1O A;  3S7O A;  3K3C A;  3LID A;  3HL9 A;  3NDG A;  5FAT A;  3DTM A;  2VV6 A;  3PTE A;  1FQG A;  5G18 A;  1TDG A;  5TFQ A;  4FSF A;  1XKZ A;  5L09 A;  2B5R A;  3T12 B;  2VV8 A;  2QWS A;  2EFX A;  3N6I A;  2GX5 A;  2Y4A A;  4RX3 A;  1MBL A;  3S7Q A;  3BFD A;  2K7S A;  1YLW A;  3UPN A;  5CGW A;  1K6R A;  4Y3I A;  2H10 A;  1GHP A;  1WE4 A;  1GCE A;  3BRM A;  5CGS A;  4S2N A;  3TE8 A;  5J4E A;  4EBP A;  4KZ5 A;  1PIO A;  5HWT A;  4OH0 A;  5J7E A;  3SOI A;  1RGY A;  3PAG A;  4ZRR A;  1FR1 A;  5CHJ A;  4DJ3 A;  3FWL A;  4QHC A;  1STZ A;  4WEK A;  4EUV A;  4K0X A;  5M18 A;  1PZO A;  1KVL A;  4KUO A;  4Y13 A;  1IFQ A;  3OPL A;  2ZC4 B;  3AGD A;  4WMC A;  4I3A A;  1CF0 A;  1GA9 A;  5CHM A;  5F6A A;  1XX2 A;  3EQV A;  4D2O A;  1KE4 A;  3VOZ A;  1ERM A;  3R7W A;  2DRW A;  2XK1 A;  3B47 A;  3KSH A;  3VFH A;  1TS6 A;  1Q2P A;  3W2Z A;  4QY6 A;  1D7E A;  4Y0T A;  4JGP A;  1BYW A;  4KQD A;  2Q9N A;  3P7N A;  2E8I A;  2LB9 A;  4Y17 A;  4N1H A;  4WLA A;  3UY6 A;  3ZVW A;  3NBL A;  2Y59 A;  3CWF A;  4IUK A;  1GSX A;  4AFI A;  3NDE A;  5BOH A;  1H8M A;  4JXS A;  1FCN A;  4PKY G;  5FI2 A;  1L0G A;  1IKI A;  4R6L A;  2JN7 A;  3TG9 A;  2O99 A;  5CEC A;  5I5L A;  2Q0O A;  2L1M A;  2J3T C;  2WKE A;  1XFQ A;  4GS9 A;  4ARZ A;  4CPK A;  1KGE A;  3V5M A;  4B93 A;  5AQB A;  4F3L B;  1MWR A;  2Y55 A;  3EWK A;  4FD8 A;  4CJN A;  1M40 A;  3LIE A;  1ES3 A;  5TJJ A;  2W0N A;  5J8X A;  3H7W A;  4HEF A;  4KEN B;  3Q82 A;  4MBK A;  3PHY A;  3MXQ A;  3FKW A;  3F1N A;  2UV0 E;  2WGI A;  3CJM A;  3I7J A;  1RGZ A;  3GTC A;  4U3T A;  2WKH A;  3HRE A;  3WRZ A;  3IXG A;  4BMW A;  2A3U A;  2JKT I;  4WL9 A;  4O8G A;  3UPO A;  3V39 A;  2XDM A;  1IEM A;  3PBS A;  4QD4 A;  1OTB A;  3EOI A;  5IU1 A;  1JWP A;  2P7J A;  1CJF A;  2PD8 A;  2NUP C;  1E25 A;  1PI4 A;  4JLF A;  3LR5 A;  4K08 A;  5HPI A;  1F2K A;  4E3I A;  2EXA A;  2L0W A;  4BD0 A;  1JTG A;  3A3F A;  4EWF A;  3SH7 A;  4M3K A;  1X0O A;  3VV4 A;  3UDX A;  3LCE A;  3MFX A;  3ZCZ A;  1Y54 A;  1RCJ A;  2B02 A;  2OOL A;  4EQ1 A;  4FCF A;  5F69 A;  1OT6 A;  3NEC A;  4O0P A;  1JWZ A;  3C4P A;  1XP4 A;  5FEF A;  3KYZ A;  4DRT A;  3Q81 A;  3BFF A;  3MR0 A;  5EVI A;  3RH8 B;  3KSG A;  5E43 A;  2G7U A;  1YMX A;  3ISG A;  1M6K A;  4EU0 A;  1N9L A;  1OJ5 A;  5A91 A;  2HDU A;  2XFT A;  4WUJ A;  1PYY A;  4Y0U A;  4KUK A;  3JYI A;  5HFO A;  3FZC A;  3T4O A;  1K55 C;  3BFE A;  4DE2 A;  4EBN A;  1PRQ A;  3IH9 A;  3QP4 A;  5FQK A;  1ERO A;  3IBR A;  2JHE A;  4GZB A;  4ZAM A;  3TW8 A;  3O3V A;  1BLS A;  3ZQ5 A;  1FIK A;  3HUN A;  3PXP A;  3CZD A;  3EQU A;  4DXB A;  1NRF A;  2I72 A;  4ZJ2 A;  4DE3 A;  4BJP A;  2ZQ9 A;  1TS7 A;  3LIA A;  3WS2 A;  3UMD A;  5GHZ A;  5DJU A;  5EOO A;  3KYE A;  1V9Y A;  2QJ5 A;  4NXB A;  2B95 A;  1PZP A;  1L0F A;  1S6R A;  2ZC7 A;  3G4P A;  3IX8 A;  4PPR A;  2J3W A;  4JKT A;  2R78 A;  4UAA A;  1EWZ A;  3LYX A;  5HDD A;  2BAS A;  4H6J B;  3ZHH A;  5IT5 A;  3UE3 A;  1F5M A;  3MXS A;  2YKH A;  1PW1 A;  3CLO A;  5HL6 A;  4LV1 A;  3MS6 A;  1WYB A;  1ZTU A;  1XXM A;  4RA7 A;  4ZBE A;  5DF8 A;  2WKP A;  5CTM A;  3LY3 A;  2WKR A;  4JF6 A;  5CXW A;  2JCH A;  4LPZ A;  4CLC E;  1DJB A;  2G2W A;  3N8R A;  4WN5 A;  5GLA A;  2JKF A;  3WS4 A;  2EFU A;  4S2N C;  2BTF P;  3G35 A;  3V3S A;  5GHY A;  5G4Z A;  4MBF A;  2VGJ A;  1K38 A;  4C6Y A;  2PRF A;  4GLQ A;  4WEJ A;  3PBR A;  1J9M A;  2DMW A;  5L10 A;  4NK3 A;  4LRX C;  3SZT A;  2X71 A;  4LCL A;  2XGN A;  3UPP A;  5F1G A;  1P9W A;  3V50 A;  3IXB A;  3QP1 A;  4P6B A;  3G32 A;  5E2E A;  4BQM A;  3UO9 A;  3ULF A;  4ETX A;  1XA1 A;  5CRF A;  4X56 A;  4A5R A;  1MC0 A;  2O9A A;  1OTA A;  2RL3 A;  1GA0 A;  3QP2 A;  3S7P A;  1ZC2 A;  4LV0 A;  3BWL A;  3H82 A;  3CAX A;  3A3I A;  4MLL A;  4PM5 A;  4MNR A;  3BM6 A;  4I3I A;  2Q9M A;  1CEF A;  4EEP A;  4HP9 A;  3T4T A;  1KE3 A;  4WYY A;  1ODV A;  2WGW A;  2V1Z A;  1FSW A;  1LSV A;  5CER A;  3ZG5 A;  5HAP A;  2HPB A;  4S2L A;  2Y2K A;  3O5Y A;  4QY5 A;  1BT5 A;  2WGW B;  4Q0J A;  2EA9 A;  3ICY A;  2Y79 A;  3D3O A;  1U60 A;  4QB8 A;  1D1J A;  4EXO A;  3FV7 A;  4KG5 A;  1KDW A;  3RJU A;  3K3D A;  3HLW A;  2XA7 S;  2ZQD A;  3SW1 A;  1NLY A;  3W4P A;  3RXX A;  3C2W A;  1IYO A;  5JYP A;  3JPU A;  3GR2 A;  4X25 A;  1LI0 A;  3HLF A;  3UE6 A;  5EV0 A;  3A3J A;  3IF6 A;  4DXC A;  2V8F A;  2DCF A;  1L0D A;  1Y4O A;  1UWN X;  1S1Z A;  4YWZ A;  2JKR I;  3UNW A;  3QNC A;  4PM8 A;  2W3E A;  2UWX A;  3P98 A;  1CI8 A;  2ZJ9 A;  1MPL A;  2X01 A;  4X55 A;  2J8Y A;  4M4X A;  5HAQ A;  4IJG A;  1JWV A;  3C4O A;  2OAQ 1;  4OOM A;  4Q0I A;  5E2F A;  4B9O A;  1S67 L;  1SCW A;  3O88 A;  1UGU A;  3VFF A;  5AQ7 A;  4I39 A;  1W63 M;  4FH4 A;  4OPR A;  1OJG A;  3FPW A;  1SDE A;  3M6H A;  1NWZ A;  3UB7 A;  2W3F A;  1HVB A;  1LL5 A;  4P0M A;  4NET A;  3CMZ A;  2HJ9 C;  1MKI A;  2HDQ A;  5EVE A;  4L0L A;  3HUM A;  1DJC A;  2PD7 A;  4R4S A;  3LEQ A;  5HWW A;  5FDH A;  4B88 A;  5F5Y A;  1S66 L;  1TD5 A;  4HBT A;  4NXF A;  4RVA A;  1S4S A;  1P97 A;  5G4Y A;  3BQA A;  3PYP A;  4WM9 A;  2XLN A;  3PBO A;  2XF3 A;  4DE0 A;  3BFC A;  1YSQ A;  2FH5 A;  3WS5 A;  3PBQ A;  2GNX A;  1LL8 A;  3QP8 A;  5L07 A;  3G6O A;  4KQR A;  5AQA A;  1K55 A;  1S1Y A;  3MFD A;  3MKE A;  2EX2 A;  4CLC A;  3C5A A;  2ZC6 B;  2XH9 A;  2PT7 A;  3PAE A;  3FYZ A;  2C5W B;  4RQ9 A;  2XRO A;  4PHT A;  1YQS A;  3LO7 A;  5GLB A;  1J3W A;  3IWO A;  4EQI A;  3E2K A;  5IS1 A;  2EX9 A;  1MWT A;  5FQI A;  3T4K A;  1SDN A;  3HCY A;  3HJK A;  3UDI A;  3IXH A;  3KYQ A;  4P6Z M;  1NYY A;  4R38 A;  4GD6 A;  4OPY A;  3N8S A;  5F83 A;  4LGW A;  3LGO A;  3MBZ A;  1I2W A;  4UA9 A;  5DVA A;  1FCM A;  2RCX A;  1NRJ A;  1F98 A;  4NXE A;  4WBG A;  1W63 Q;  2JKT M;  4CLC C;  5JYO A;  3LIB A;  2P74 A;  4R0Q A;  3ZVT A;  2VX8 A;  2FFY A;  2QMI A;  3ZG7 B;  1YLP A;  3LFV A;  1L3L A;  4X1L A;  4E3N A;  1K56 A;  3VP4 A;  1MXO A;  2VGL S;  4YNR A;  1K56 D;  3A0V A;  1PFL A;  1XJ6 A;  3LY4 A;  2G2U A;  4KZ6 A;  1LI9 A;  2WAD A;  4KQQ A;  1KDS A;  3DW0 A;  3ZGA B;  4XXR A;  2A2L A;  3KSI A;  1UWP X;  5DTK A;  4KQO A;  1HZO A;  1PI5 A;  4KZ8 A;  1OT9 A;  1H0M A;  3MZF A;  4UQI M;  1ZHH B;  2ZM2 A;  1G6A A;  4XT2 A;  2XQZ A;  1G68 A;  1RP5 A;  4CLC B;  5FEG A;  4QJG A;  2Y2J A;  1TDL A;  5E2H A;  5FQM A;  3F1O B;  3LI9 A;  2ZQC A;  2WZZ A;  3BJN A;  4BD1 A;  3CG5 A;  1AWI A;  4JXV A;  4EW7 A;  2A49 A;  2ZD8 A;  1E3U D;  3D9Y A;  3S7N A;  5CTN A;  4NG2 A;  1DJA A;  3IF6 B;  3H7W B;  4R3B A;  4MEZ A;  4KZ9 A;  1XJ3 A;  4GKU A;  1XGI A;  2PBD P;  2PYR A;  3T4J A;  2FFF B;  3VE4 A;  1NYM A;  1TS0 A;  4OLG A;  3VP2 A;  3VOL A;  1SKF A;  2B18 A;  4WZ5 A;  3OLO A;  1CEG A;  4HQA A;  5FI6 A;  1LL9 A;  3VMA A;  2V8C A;  4DKI A;  3UN7 A;  4FUW A;  2V2F F;  4ZTK A;  1L2S A;  2JC7 A;  2XA7 M;  2KOI A;  3IXD A;  2LB5 A;  3ZFZ A;  5A90 A;  1PWD A;  3OC2 A;  2QJ7 A;  1OPX A;  3DTE A;  4BBT A;  1OME A;  1H3Q A;  2J3T D;  4DDY A;  1DY6 A;  1ESU A;  1ZG4 A;  3SS4 A;  4E6W A;  2ZQ7 A;  3ZG9 B;  3IT9 A;  3CI6 A;  3EGD C;  3C8C A;  2HP6 A;  4IED A;  2EXB A;  2KLI A;  2Y8H A;  1A0K A;  4MCW A;  2W3G A;  2GJ3 A;  3MF0 A;  2P08 A;  5C5K A;  3E4P A;  2Y2N A;  4LRZ E;  2O9C A;  3M2J A;  3IQA A;  4ZJ3 A;  2EX6 A;  2OWJ A;  4PMA A;  4GHI A;  2QPN A;  4RYE A;  1QMF A;  4OOY A;  2Z6C A;  2PYP A;  4GN2 A;  4UEY A;  1GSV A;  3UE1 A;  4MMN A;  1VET A;  1XA7 A;  1YMS A;  4PM7 A;  5HZH A;  1W7F A;  2J9P A;  1JNU A;  2H0Y A;  3BLM A;  4F3L A;  3RXW A;  1KOU A;  1CK3 A;  2A24 B;  3MZE A;  4OVD A;  2IA2 A;  3ZG8 B;  3S4X A;  1HTZ A;  4IBR A;  3IHB A;  3Q07 A;  4GHI B;  2XSS A;  3DAV A;  3LI8 A;  1NLZ A;  3G31 A;  4IVI A;  1T1A A;  2EX8 A;  2H28 A;  4ARZ B;  2JBF A;  4S2M A;  2GZA A;  3NUL A;  3F1P B;  4HH2 A;  4UQI S;  1KGF A;  5DF9 A;  3N7W A;  1CI9 A;  2Y2L A;  4LV3 A;  3A0S A;  2WAE A;  2VGK A;  3B3X A;  4HHD A;  1PWG A;  2ZBB A;  2V0U A;  3G2Y A;  3BLS A;  1ESI A;  4O01 A;  2P9V A;  2QHK A;  2O0Y A;  2ZL1 A;  3L7H A;  4P85 A;  4OQ0 A;  2AVX A;  5GLC A;  5EVI C;  1SZV A;  2H5S A;  2XR0 A;  5KSH A;  4UHU A;  5FAP A;  3UE0 A;  1FR6 A;  4JXW A;  1GHI A;  1ERQ A;  4YFM A;  4XT2 B;  1FCO A;  1BZA A;  1MWU A;  3WRT A;  4MN6 A;  3BY9 A;  1G6O A;  3OPP A;  2CC1 A;  3T4L A;  4UA6 A;  3AGF A;  2VV7 A;  3Q7Z A;  1SKO A;  5K5B A;  4HJ4 A;  2M1C A;  3NOT C;  4WF0 A;  2HV1 A;  5HPF A;  4EBL A;  3NHQ A;  2W3D A;  4HIA A;  4HP4 A;  2WAF A;  2QKP A;  2WK0 A;  4GW9 A;  3LUQ A;  1ES5 A;  4R1G A;  3UB5 P;  2ZQA A;  3H9W A;  1K25 A;  1ES2 A;  4CQH A;  2PHY A;  4I38 A;  4HOI A;  2Y2O A;  5MC7 A;  2W3H A;  1T1C A;  2ACG A;  2Y2M A;  5GL9 A;  4EES A;  4OP5 A;  1DP8 A;  1K57 C;  2PU2 A;  1YLZ A;  3HUO A;  4PKY A;  4Q0H A;  2HGV A;  4XUX A;  2XD1 A;  1IYP A;  2V20 A;  3C30 A;  2OLV A;  1VEU B;  5TGF A;  4O7D A;  1P9R A;  5DKL A;  5EUA A;  5CHU A;  4EUZ A;  3TRC A;  3NI9 A;  3DBA A;  1N9N A;  3GMW A;  3OCL A;  4KG2 A;  3M6B A;  4BL3 A;  2IWD A;  4HY8 A;  3P09 A;  1XFN A;  4OQG A;  1BLC A;  1I5Q A;  3V3R A;  4QWO A;  3IS2 A;  4Y2F A;  2XEP A;  3W4O A;  3VP0 A;  4KZ7 A;  3MJQ A;  1YT4 A;  4LEN A;  1LT0 A;  3JVU A;  4Q8I A;  3U2A A;  1H8Y A;  2P04 A;  2VZW A;  5FQJ A;  3MQ0 A;  3WS0 A;  5GHX A;  4OKP A;  3UB6 A;  4L9F A;  4PM9 A;  1ONH A;  2OWH A;  4R70 A;  4ID4 A;  4WZ4 A;  4DF6 A;  4PAU A;  3NIA A;  4HH3 A;  4MDZ A;  2ZM8 A;  3CHW P;  1K54 A;  1BSG A;  1DP6 A;  1K4F A;  2PR6 A;  3LIF A;  4PM6 A;  2KDK A;  2INW A;  3GSG A;  4OQI A;  4OOL A;  2Y2I A;  1BUL A;  2EWV A;  2P9V B;  5A92 A;  3GVB A;  5EPH A;  2X02 A;  5DFY A;  2BG1 A;  2I9V A;  4BLM A;  3NJA A;  3T1X A;  4HJ3 A;  4G3W A;  4DDS A;  3KO6 A;  1VB6 A;  3RFB A;  4YOF A;  2PAV P;  2VLG A;  1PWC A;  1K4E A;  1ACF A;  5FAS A;  2CMN A;  3IHA A;  4Y7P A;  2V1B A;  1VQQ A;  5DFX A;  5FI7 A;  4R23 A;  1E3U A;  3HLD A;  1W79 A;  5EE8 A;  1ES4 A;  4WMC D;  1E4D A;  5E2G A;  4ME4 A;  4WEL A;  3E98 A;  3UB8 A;  3BYD A;  5GLD A;  4GCZ A;  1FIL A;  2W1T A;  4X6T A;  3F1N B;  1VET B;  3O86 A;  4E3L A;  2WGV A;  4GDN A;  1YPR A;  2JKG A;  1OTD A;  3BFG A;  4MN7 A;  5HL1 A;  2WKQ A;  5HAR A;  3R7W B;  1D06 A;  4LRY C;  3DTK A;  3WWX A;  1WYC A;  1K57 A;  4G3V A;  5FDS A;  4OLD A;  3EGX C;  3KX0 X;  2JE5 A;  4P6Z S;  3MSH A;  1IEL A;  4S2J A;  1VM1 A;  4DJ2 A;  1NZO A;  4GJ4 A;  3R4K A;  1KVM A;  4GS9 B;  4DE1 A;  4S2O A;  1GHM A;  5KIZ A;  2OSU A;  5FQ9 A;  3NOP C;  3T4S A;  1T19 A;  4R3J A;  2C6W B;  4U0X A;  1H8Z A;  4QPR A;  5CED A;  2WKI A;  3O87 A;  3OOV A;  4OON A;  2H0T A;  3PBT A;  3VE3 A;  4JGQ A;  4YIN A;  4GD8 A;  1HD8 A;  1LSX A;  4JPM A;  3BEC A;  4BEN A;  4LFU A;  1SHV A;  3IX4 A;  2M7V A;  2OAP 1;  3CUE A;  4OP8 A;  3P01 A;  5FQQ A;  4D60 A;  4P87 A;  2Y2G A;  4OPZ A;  2M7U A;  3SS3 A;  3SH9 A;  1JTD A;  3A0R A;  3C7U A;  5DTT A;  1JVJ A;  3G30 A;  3IF6 C;  3B42 A;  5HWV A;  4R3A A;  2Y91 A;  3OBF A;  4I5S A;  1ONG A;  1YLT A;  2ZOI A;  1W8Y A;  3UME A;  4MN5 A;  1G28 A;  2WUQ A;  3BQ8 A;  2VK3 A;  3M2K A;  2ZMF A;  2W27 A;  4ZDX A;  5EVL A;  3VSK A;  2PR5 A;  1BTL A;  3IBJ A;  1T1B A;  3A3E A;  1FSY A;  4E04 A;  5FAO A;  2PDR A;  3HLB A;  3W8K A;  4HJ6 A;  3N4I A;  3E2L A;  1YLJ A;  2V9A A;  1G5U A;  3JVV A;  5HSQ A;  3HLE A;  1IYS A;  2IWB A;  2ZM0 A;  4GNU A;  2XFS A;  5KMW A;  1LSW A;  2ZC3 B;  5CGX A;  3HVF A;  4E3K A;  4IHQ A;  3KSF A;  3ZNT A;  1ZG6 A;  2ZLY A;  1K6S A;  5KZH A;  5FA7 A;  3PBN A;  1N9O A;  5EOE A;  4NXG A;  4Z9Q A;  4X68 A;  2OLU A;  3BY8 A;  3N8L A;  1NXY A;  3S1Y A;  1IYQ A;  2V0W A;  4H8R A;  4N92 A;  3MQO A;  4K0W A;  5HDC A;  1WA9 A;  3D4F A;  1Z09 A;  3Q7V B;  2WZX A;  2O9B A;  1K54 C;  4E3M A;  2VJW A;  2J80 A;  1S4R A;  4X53 A;  3DWZ A;  2D02 A;  3GRJ A;  4N9L A;  2ZMA A;  1NZU A;  3CPT A;  5FSR A;  3ZYT A;  1I2S A;  4IUH A;  3TSG A;  2R9W A;  5IHV A;  3L9K A;  4RX2 A;  3A3D A;  5HDS A;  3IWQ A;  1KGG A;  1AXB A;  1C3B A;  3H82 B;  1NJ4 A;  5I94 A;  3SH8 A;  1OTE A;  3FPV A;  4EER A;  1NY0 A;  3FG8 A;  5A8B A;  2Z2M B;  3FC7 A;  5AJG A;  3UB9 A;  3QP5 A;  5TBM A;  2HF6 A;  2Y2P A;  2W1R A;  2WYX A;  4UA7 A;  3BEB A;  4B4Z A;  5FAQ A;  4U0T A;  2DNS A;  4I3J A;  4KZ3 A;  2J9O A;  3C38 A;  1O7E A;  3K2N A;  4E3J A;  1Q2Q A;  3HBR A;  4QU3 A;  3EEA A;  3T1R A;  3IS2 B;  4KG6 A;  1YAX A;  4LLO B;  2XRN A;  5DF7 A;  2BLS A;  2KX6 A;  5M1A A;  1IOU A;  5CEB A;  1LLB A;  5HD5 A;  1N9B A;  1LHY A;  4KZB A;  4NEE D;  4CLC D;  3HLC A;  3MXR A;  5F82 A;  3NOU C;  2OV5 A;  3Q7V A;  3VOY A;  1O07 A;  3ZDJ A;  5A93 A;  4N9K A;  1T18 A;  3CPT B;  3GDI A;  4DN0 A;  2Z6D A;  2HJE A;  2VA0 A;  1Y28 A;  2ZOH A;  1YKD A;  4S2I A;  4B4X A;  1S0W A;  4II7 A;  3UDF A;  4R4R A;  3ZNY A;  5EVI B;  4E3O A;  4GB7 A;  2HP9 A;  5EM0 A;  2PU4 A;  3G2Z A;  2VEA A;  2EWW A;  1V9Z A;  5F68 A;  3WS1 A;  2VGL M;  4Y15 A;  2J7V A;  3LR4 A;  3NCK A;  1BUE A;  3DTI A; 
#chains in the Genus database with same CATH homology
 3JVU A;  3U2A A;  2P04 A;  2VZW A;  4RQ9 A;  2XRO A;  4L9G A;  3MQ0 A;  4BMW A;  3UB6 A;  4L9F A;  4PHT A;  2JKT I;  3E4O A;  4WL9 A;  4O8G A;  3HJI A;  2OWH A;  3MMH A;  5IS1 A;  2W1T B;  4R70 A;  3PBS A;  1OTB A;  3EOI A;  5IU1 A;  3T4K A;  4EEU A;  4PAU A;  2P7J A;  4HH3 A;  2FZ0 A;  2PD8 A;  4MDZ A;  4L9E A;  2NUP C;  4Y5F A;  3HCY A;  3GEC A;  3HJK A;  3LR5 A;  3KYQ A;  4K08 A;  4P6Z M;  5HPI A;  4R38 A;  2L0W A;  3LR0 A;  3TJZ C;  1X0O A;  3VV4 A;  1DP6 A;  1F9I A;  2PR6 A;  3MFX A;  3LIF A;  2KDK A;  2INW A;  3LR3 A;  2B02 A;  2OOL A;  4OOL A;  4EQ1 A;  2EWV A;  1NRJ A;  1F98 A;  5F69 A;  2YKF A;  1OT6 A;  4FOF A;  4NXE A;  1W63 Q;  2JKT M;  4CLC C;  4EET B;  4O0P A;  3CIT A;  3LIB A;  3T50 A;  2ZMV A;  4Z1W A;  2VX8 A;  5DFY A;  3KYZ A;  4NKP A;  2I9V A;  2K31 A;  1YSP A;  5FL3 A;  3NJA A;  4HJ3 A;  3MR0 A;  4G3W A;  3LFV A;  3RH8 B;  3KO6 A;  3KSG A;  2G7U A;  1VB6 A;  3F1P A;  3RFB A;  4YOF A;  2VLG A;  4EU0 A;  1N9L A;  1OJ5 A;  3V67 A;  1EW0 A;  2V1A A;  2CMN A;  2VGL S;  4WUJ A;  4YNR A;  4KUK A;  1OTI A;  2V1B A;  5DFX A;  3A0V A;  3T4O A;  4JGO A;  1XJ6 A;  2D01 A;  3CUE C;  5HD3 A;  3EEH A;  2A2L A;  3KSI A;  1UWP X;  4KQO A;  4ME4 A;  3IBR A;  2A24 A;  2JHE A;  1OT9 A;  4WEL A;  4UQI M;  3T4Q A;  1ZHH B;  3TW8 A;  3E98 A;  3UB8 A;  4XT2 A;  4GCZ A;  2W1T A;  3F1N B;  4CLC B;  1P0Z A;  3ZQ5 A;  3PXP A;  2MJ6 A;  1OTD A;  3F1O B;  3LI9 A;  4MN7 A;  1TF1 A;  2WKQ A;  3EQU A;  5AVE A;  3BJN A;  3BW6 A;  5TBM B;  5CX7 A;  3R7W B;  1D06 A;  1VHM A;  4BJP A;  4EW7 A;  4LRY C;  1TS7 A;  3E0Y A;  3LIA A;  3UMD A;  4G3V A;  5DJU A;  3S7N A;  3EGX C;  1V9Y A;  1MKM A;  3KX0 X;  2QJ5 A;  4P6Z S;  4DJ2 A;  4NXB A;  3H7W B;  4GJ4 A;  1XJ3 A;  3R4K A;  4GS9 B;  1MZU A;  4JGR A;  2J3W A;  2PYR A;  2R78 A;  5KIZ A;  3T4J A;  2VKS A;  3VE4 A;  1TS0 A;  5AVF A;  3LYX A;  5HDD A;  1DRM A;  5L8M A;  3VOL A;  2B18 A;  2BAS A;  3MQQ A;  3NOP C;  3T4S A;  3OLO A;  1T19 A;  4H6J B;  4HQA A;  5IT5 A;  3UE3 A;  1DP9 A;  3PR6 A;  1F5M A;  4HNB A;  2YKH A;  5DKK A;  4QPR A;  3CLO A;  5HL6 A;  3OOV A;  4H6J A;  2XA7 M;  3PBT A;  2KOI A;  4ETZ A;  3VE3 A;  2LB5 A;  1ZTU A;  4JGQ A;  5EFW A;  3OCN A;  3OC2 A;  2QJ7 A;  2K2N A;  1OPX A;  1LSX A;  2WKP A;  4BBT A;  2WKR A;  4LPZ A;  1H3Q A;  2NUT C;  2M7V A;  2OAP 1;  4CLC E;  3CUE A;  2QYB A;  3E4Q A;  3P01 A;  2J3T D;  4DMZ A;  4WN5 A;  2M7U A;  5LBR A;  3A0R A;  5G4Z A;  4BWI A;  1GSW A;  3CI6 A;  3EGD C;  3C8C A;  4GLQ A;  3D72 A;  4WEJ A;  3B42 A;  5HWV A;  3B33 A;  4R3A A;  2KLI A;  4BBV A;  3OBF A;  2Y8H A;  4I5S A;  3PBR A;  2ZOI A;  2DMW A;  4MCW A;  2W3G A;  2GJ3 A;  3MF0 A;  2P08 A;  3UME A;  4MN5 A;  1G28 A;  2JKR M;  1XJ2 A;  3E4P A;  4LRX C;  5J3W A;  5C5K A;  4LRZ E;  3BQ8 A;  4G3K A;  2ZMF A;  1TS8 A;  2O9C A;  2W27 A;  4HI4 A;  2OWJ A;  2PR5 A;  4GHI A;  3IBJ A;  1XJ4 A;  1T1B A;  5DJT A;  2Z6C A;  4E04 A;  3LIC A;  4BBU A;  3RTY A;  2PYP A;  1P9W A;  2PDR A;  4UEY A;  2L4R A;  4HJ6 A;  2V9A A;  1GSV A;  3F1O A;  3JVV A;  5HSQ A;  4MMN A;  3S7O A;  3ULF A;  3K3C A;  3LID A;  4ETX A;  1LSW A;  5HZH A;  2VV6 A;  1JNU A;  1MC0 A;  4IHQ A;  4F3L A;  2O9A A;  1OTA A;  3KSF A;  1KOU A;  3S7P A;  2A24 B;  4FSF A;  3BWL A;  2IA2 A;  3PBN A;  3H82 A;  1N9O A;  4NXG A;  3CAX A;  3BY8 A;  2VV8 A;  2QWS A;  4I3I A;  4GHI B;  2GX5 A;  2XSS A;  4EEP A;  4HP9 A;  3S7Q A;  2V0W A;  2K7S A;  3MQO A;  3T4T A;  3LI8 A;  1NLZ A;  5HDC A;  1WA9 A;  1T1A A;  2H28 A;  1ODV A;  4Y3I A;  2O9B A;  4ARZ B;  2GZA A;  1LSV A;  3F1P B;  2VJW A;  4HH2 A;  4UQI S;  2J80 A;  1S4R A;  5DF9 A;  3O5Y A;  2D02 A;  4Q0J A;  2EA9 A;  3A0S A;  3ICY A;  2Y79 A;  3TE8 A;  4HHD A;  5J4E A;  3D3O A;  4EXO A;  2ZBB A;  2V0U A;  3K3D A;  5HWT A;  3ZYT A;  5J7E A;  4O01 A;  4ZRR A;  2QHK A;  4IUH A;  2O0Y A;  4DJ3 A;  2XA7 S;  1STZ A;  3SW1 A;  4WEK A;  1NLY A;  5HDS A;  4EUV A;  3C2W A;  4KUO A;  3H82 B;  1IFQ A;  5KSH A;  3UE6 A;  1OTE A;  3FPV A;  4I3A A;  4EER A;  1UWN X;  4XT2 B;  1S1Z A;  4YWZ A;  5F6A A;  3FG8 A;  2JKR I;  3EQV A;  2W3E A;  5A8B A;  4MN6 A;  3BY9 A;  3FC7 A;  5AJG A;  1G6O A;  3R7W A;  3UB9 A;  5TBM A;  3T4L A;  3B47 A;  3KSH A;  4M4X A;  2HF6 A;  2VV7 A;  4IJG A;  2W1R A;  5K5B A;  4HJ4 A;  2M1C A;  2OAQ 1;  3NOT C;  2HV1 A;  4OOM A;  4Q0I A;  4WF0 A;  5HPF A;  1TS6 A;  3NHQ A;  4B9O A;  2W3D A;  1S67 L;  4HIA A;  3W2Z A;  4HP4 A;  4I3J A;  1UGU A;  4I39 A;  1W63 M;  2QKP A;  1D7E A;  4GW9 A;  3C38 A;  3LUQ A;  3K2N A;  4JGP A;  1BYW A;  4KQD A;  1OJG A;  3FPW A;  3P7N A;  3H9W A;  3EEA A;  1NWZ A;  3IS2 B;  3UB7 A;  2LB9 A;  4CQH A;  4WLA A;  1YAX A;  2PHY A;  4I38 A;  4LLO B;  4HOI A;  2W3F A;  2XRN A;  2KX6 A;  5MC7 A;  2W3H A;  1T1C A;  4IUK A;  3CWF A;  1GSX A;  4AFI A;  1IOU A;  5HD5 A;  2HJ9 C;  1H8M A;  4EES A;  4PKY G;  4L0L A;  1DP8 A;  2PD7 A;  4PKY A;  4Q0H A;  2HGV A;  4R6L A;  2JN7 A;  4NEE D;  5HWW A;  2O99 A;  4CLC D;  3C30 A;  5I5L A;  5F5Y A;  2L1M A;  3NOU C;  2J3T C;  1P9R A;  1S66 L;  1XFQ A;  5DKL A;  1TD5 A;  4GS9 A;  4ARZ A;  4NXF A;  3TRC A;  4B93 A;  1S4S A;  1P97 A;  4F3L B;  5G4Y A;  3BQA A;  1T18 A;  3GDI A;  4DN0 A;  3PYP A;  3DBA A;  1N9N A;  2HJE A;  2VA0 A;  2Z6D A;  3OCL A;  1Y28 A;  2ZOH A;  3EWK A;  1YKD A;  3PBO A;  4II7 A;  4HY8 A;  1XFN A;  1YSQ A;  2FH5 A;  3PBQ A;  3LIE A;  2GNX A;  5TJJ A;  1LL8 A;  3IS2 A;  2VEA A;  2EWW A;  2W0N A;  3G6O A;  1V9Z A;  4Y2F A;  5F68 A;  3H7W A;  1S1Y A;  2VGL M;  3PHY A;  3MXQ A;  3F1N A;  4CLC A;  3LR4 A;  3MJQ A;  1LT0 A;  2PT7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...