1PRQA

Acanthamoeba castellanii profilin ia
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
125
structure length
125
Chain Sequence
SWQTYVDTNLVGTGAVTQAAILGLDGNTWATSAGFAVTPAQGQTLASAFNNADPIRASGFDLAGVHYVTLRADDRSIYGKKGSAGVITVKTSKSILVGVYNEKIQPGTAANVVEKLADYLIGQGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROFILIN IA
publication title Crystal packing induces a conformational change in profilin-I from Acanthamoeba castellanii.
pubmed doi rcsb
source organism Acanthamoeba castellanii
molecule tags Contractile protein
total genus 34
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 1997-08-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.30 Alpha Beta 2-Layer Sandwich Beta-Lactamase Dynein light chain 2a, cytoplasmic 1prqA00
2JKFA 2ACGA 4FUWA 2PBDP 1VEUA 1Y4OA 1PFLA 4QWOA 3MSHA 3L9KA 3LEQA 3DAVA 2V8CA 2B95A 1FILA 1SKOB 4X25A 2HZ5A 2V8FA 1A0KA 1SZVA 3KYEA 1ACFA 1J3WA 2ZL1A 3CHWP 3T1QB 5FDSA 4D60A 1FIKA 3NULA 5EM1A 1VETA 1Z09A 2BTFP 4X1LA 1YPRA 3T12B 5EM0A 3MS6A 1VEUB 3NECA 3T1SA 1D1JA 3D9YA 3CPTA 4ESPA 1SKOA 5FEFA 3UB5P 1PRQA 5FEGA 2JKGA 1CF0A 1VETB 5EV0A 4X1MA 2PRFA 3LGOA 1AWIA 5EVEA 2E8JA 3T1XA 1HLUP 2PAVP 1PNEA 3L7HA 3CPTB 1CJFA 4FTXA 1CQAA 3T1RA 2VK3A 2ZL1B 3U4LP 1F2KA 1G5UA 1K0KA
chains in the Genus database with same CATH superfamily
2ZQDA 3EWKA 2W1TA 2PBDP 1JTGA 1Y4OA 4K0WA 3OCLA 2HJEA 1E25A 1S0WA 3V39A 3NIAA 3MZDA 3C4OA 2VKSA 1FILA 1K55C 2VV7A 2QKPA 5EOEA 3FV7A 2Z6DA 2HJ9C 4MBKA 2RCXA 4P6ZS 3SH7A 5AQ7A 5GL9A 1FR6A 4WEKA 2EFXA 2XK1A 4GDNA 2HDSA 1GSXA 3PBQA 3KO6A 4DN0A 5EM1A 3LR0A 4PM7A 2EX6A 4IVIA 2ZQAA 2KDKA 4C75A 2FH5A 5DVAA 3ZYTA 3BYDA 3GV9A 5CECA 4JGRA 5KMWA 3UY6A 3BECA 4UQIM 4ZTKA 1FSYA 4S2LA 2O9CA 2KLIA 3BRMA 5FQMA 5IU1A 1H5XA 2WKEA 4LLOB 1CI9A 1IKGA 5FI6A 5EV0A 2XD1A 5LBRA 3G32A 4Y17A 4WZ5A 1HLUP 2NUTC 4HJ4A 4Q8IA 4G3VA 2EA9A 2B5RA 5EOOA 1L0FA 2Y2PA 4QY6A 3QP5A 4BL3A 1F2KA 1K57C 4UAAA 4JF5A 3QP1A 1MPLA 3OC2A 4LFUA 4A5RA 5A90A 1JWVA 4KG6A 4X6TA 4QWOA 4DE1A 1TS7A 4G3WA 2Y91A 1K55A 4ZAMA 3VOLA 1ZTUA 2JKTI 1ZHHB 4IHQA 1FOFA 3R7WB 1SKOB 3UMDA 1VQQA 3IF5A 3WWXA 2W3GA 3IWIA 5DJTA 1M6KA 4UA7A 3OPRA 1BULA 1MKMA 1ACFA 3S7NA 5EFWA 4EBLA 4DDSA 2GDNA 1FQGA 2NUPC 1VETA 2A24A 5F82A 3EQUA 4KZ5A 3E4QA 2HP9A 2KOIA 2WGWB 4MN6A 5DFXA 3B3XA 4GD8A 2DMWA 2ZOHA 4PHTA 4HOIA 2VGJA 3C7VA 4R3BA 3W4OA 3LR5A 1HTZA 3VE4A 4E3JA 3T1XA 4R4RA 2JKRI 3VE3A 4E3KA 1JTDA 1P0ZA 1K57A 2Z2LB 1XFQA 1Z6FA 1K0KA 2JKFA 4AFIA 3C38A 3E2KA 4RA7A 5E43A 4XT2A 2WGIA 3C7UA 4UEYA 3BFCA 3HVFA 1XGIA 3BWLA 1S1ZA 5HFOA 3EEHA 1Q2QA 2Y2KA 3DAVA 2HGVA 2B95A 4HESA 1FCOA 3T4TA 1ES5A 4WF0A 4DJ3A 4I5SA 5EPHA 1W63M 3CITA 3KYEA 2HDRA 1NLZA 1HVBA 3GSGA 2L4RA 2HP6A 1FSWA 1N9LA 3C5AA 3EGDC 2OAQ1 2DRWA 5DTKA 3ZCZA 5CERA 1MKIA 5AJGA 3BEBA 1TVFA 2P04A 2X01A 1IKIA 2ZJ9A 2FFFB 1SCWA 1G68A 3H82A 4PKYG 3S7OA 1D1JA 1EI5A 4IUKA 5TGFA 4E3NA 1SKOA 3ZG8B 2M7UA 5HWVA 5HAQA 1NYYA 1CF0A 4FH4A 3MFDA 1IYSA 4X1MA 3MQOA 4OQHA 2L0WA 2M1CA 1TS6A 2V20A 2ZQ7A 5DTTA 4PM5A 4M4XA 2PAVP 4Y0OA 1KGGA 3MZFA 2PU4A 1WA9A 4NXBA 1D7EA 3H7WB 3DBAA 5I5LA 1PIOA 2V1ZA 2Y4AA 2VGKA 3BY9A 3F1PB 1PFLA 4FD8A 4KZ7A 3UPNA 2WGWA 3L9KA 1NZUA 3NHQA 4OVDA 5M18A 2GX5A 5AQ9A 1P9RA 4R6LA 2PD7A 2W3HA 1XKZA 3MMHA 2V8FA 3FG8A 4CLCB 4FSFA 3R4KA 3EEAA 3EQVA 3B33A 4Y15A 4GHIB 5F83A 3E4OA 5IS1A 1IFQA 3F1NB 3MKEA 2VEAA 1TS0A 3E4PA 3AGDA 1FIKA 1TDGA 1H0MA 4JF6A 4N1HA 2LB5A 3ZQ5A 3O86A 2P9VA 2V1AA 3LYXA 1ESUA 3DTIA 4Y3IA 3LY4A 3SS3A 4ESPA 2ZQ8A 4GDBA 2W27A 2Y2HA 1QMEA 2XR0A 4N9KA 4S2PA 1BTLA 4WBGA 2EX2A 4ME4A 1RCJA 3QP6A 2E8JA 3NOTC 1K54C 3CPTB 3WRTA 3DTKA 1ZG6A 3JVVA 4DF6A 4JGQA 4OLDA 4N1XA 3BLSA 4XUZA 1DP6A 2G7UA 5HPFA 1F5MA 3C4PA 4OPRA 3SS4A 1M40A 4RQ9A 5HWWA 4OPZA 3MSHA 4OQ0A 2OWJA 4MLLA 4BLMA 3FZCA 3MJQA 3UN7A 3P7NA 4L0LA 1XJ2A 3D4FA 4BMWA 4P87A 3N8LA 4HP9A 4E6WA 3FC7A 3V3RA 1SZVA 1K6RA 4IBXA 3FKWA 4HJ6A 1KE3A 3P01A 4M3KA 3A3DA 2DCFA 5E2GA 4WN5A 2PR5A 4CJNA 3EOIA 1KOUA 4GD6A 4LRZE 3Q7ZA 3G6OA 2XROA 4L9FA 3RJUA 3F1PA 1DJAA 2P74A 3ZG9B 3K3DA 4NKPA 4Q0JA 4ID4A 4QJGA 4WL9A 4XUXA 2M7VA 4U0TA 5GHZA 1PWGA 1TD5A 2E8IA 3BQ8A 1GSVA 3A3JA 3LR3A 3LCEA 2ZC6B 4II7A 4B4XA 3SS5A 1PW1A 1JWPA 2Y2LA 4OOYA 4ZJ1A 1OT9A 4BJPA 1K54A 1L0DA 1P9WA 3LIBA 3ZVTA 5HSQA 3BM6A 4C3QA 3BFEA 1CK3A 1XXMA 3S7QA 1DRMA 3KX0X 2ACGA 2PDRA 1E3UA 4EEPA 2Y8HA 4H6JA 3FPWA 4S2JA 2VGLM 4LCMA 1L0EA 4NEED 4R4SA 1AXBA 1DJBA 1W7FA 5CTNA 4JGPA 5EVIC 3G30A 1W8YA 2B02A 2ZMFA 2WAEA 3ITAA 3IXGA 2V9AA 3MQQA 2BLSA 1CI8A 2J7VA 5DKLA 3UB8A 4EXOA 5FSRA 3VFHA 4EUZA 2QWSA 1PI4A 3T1QB 2EX8A 4YFMA 3UE3A 2Y2NA 2A3UA 3OLOA 3NI9A 3KYQA 3RTYA 1E3UD 3G4PA 3M2KA 1ES4A 4JBFA 1X0OA 2I72A 1KE0A 3F1OB 5CHJA 4YOFA 1YQSA 4ETXA 2HF6A 4JGOA 5J8XA 2O9AA 2VA0A 5HZHA 4O01A 4KG2A 4I3AA 2X71A 4Y7PA 1PZPA 3O87A 4WELA 4KQOA 3IWQA 3VP0A 4UQIS 2Y55A 3V3SA 2ZM8A 3LEZA 3TSGA 3M6BA 2Y2QA 4ZBEA 3G2ZA 4EQIA 3ZDJA 3ZG5A 1CJFA 3GTCA 4R38A 1MWRA 3JVUA 1MXOA 1S67L 2JN7A 4FH2A 1T19A 1ES3A 1KVLA 3S1YA 3N4IA 3VSKA 1NWZA 1NY0A 3PTEA 1IYOA 5EVIA 1XFNA 1GCEA 2ZQCA 4F3LB 3SOIA 5TJJA 1Q2PA 3IF6B 1NXYA 4E3IA 4L9EA 2Q0OA 2J9PA 2EFUA 2Z6CA 1IYQA 1GHMA 2WZZA 1BLSA 2K31A 3MZEA 1MY8A 2XEPA 1Y54A 4PM9A 4PPRA 1N4OA 2ZD8A 3VP1A 1UWPX 1GHPA 1SKFA 5F68A 1MZUA 2XQZA 1Z09A 3HJKA 3Q81A 3NOUC 3G2YA 3HLDA 4X1LA 4EBNA 5M1AA 3ICYA 1F98A 4QHCA 3TW8A 5EVID 3K2NA 2X02A 1VEUB 5FATA 3UDXA 4GLQA 3VP3A 4IVKA 1ZKJA 2EX9A 5AVFA 5AQBA 4JLFA 5DF9A 3RXWA 4B88A 3KYZA 3ZG0A 5A93A 4Y2FA 2ZC4B 5M19A 4WZ4A 4PKYA 1IELA 4WEJA 4EU0A 1XPBA 1UGUA 3MR0A 2QMIA 5HX9A 3CMZA 4HIAA 5DKKA 2HDQA 2RL3A 5TBMB 3MFXA 2IWDA 1YT4A 5MC7A 3PBRA 1NJ4A 3N8RA 3HLCA 3PAEA 5L8MA 2V1BA 3T4KA 2C5WB 4OONA 3IQAA 3QP8A 2V8CA 3H9WA 1ONGA 2GNXA 2O99A 2KX6A 3NOPC 4L9GA 3IX8A 4JXWA 4RYEA 2WKQA 3BFGA 4LV1A 5G4ZA 4HP4A 1YMXA 2PU2A 1W79A 5FL3A 4R0QA 1CEFA 2XLNA 1FR1A 3CHWP 2EXBA 3HREA 1XJ6A 3QNCA 3KSFA 5L07A 3G31A 3HLBA 5CEBA 5IT5A 4PAUA 3MS6A 1KVMA 2BG1A 2JCHA 5FI2A 2HPBA 4OLGA 4F3LA 4GCZA 4LV2A 3ISGA 4B4ZA 2JKRM 4EERA 3W4PA 3BW6A 4S2OA 3TRCA 3FPVA 1G28A 3UB9A 3Q82A 5JYPA 3V50A 2R78A 3NDEA 1PNEA 3ITBA 1GHIA 1NYMA 1LLBA 3B47A 4Y13A 1ERQA 3R7WA 3GVBA 3SH9A 2PT7A 3U4LP 1XX2A 4F94A 1N9BA 5GLDA 5F1FA 3UE6A 1YLJA 3N7WA 3C2WA 1H8YA 2WGVA 3G35A 4JPMA 3IX3A 2XD5A 2Z2MB 1VEUA 4IBRA 4KUOA 3LEQA 4P85A 2HP5A 2INWA 1K4EA 2VV6A 4LGWA 1O7EA 2W3DA 1L2SA 1I2SA 1ERMA 2PYPA 4KQQA 4LRXC 5E2HA 1U60A 4R3JA 1F9IA 2PYRA 1LL5A 1YLWA 2OSUA 5CTMA 5J7EA 1TEMA 3RFBA 1ES2A 4WLAA 4OOMA 2OWHA 1LSVA 4D60A 3NULA 3LI9A 2OAP1 2XSSA 4E04A 3P09A 3Q7VB 4GW9A 5HDDA 1O07A 3GMWA 4EETB 5E2FA 4Q0IA 1LT0A 1T1AA 2JBFA 1VHMA 4RX3A 4K08A 3DWZA 4ARZB 4Z1WA 3LGOA 4H8RA 5CEDA 4JXGA 1DY6A 3CI6A 1JWZA 3MXRA 5HAIA 3IBJA 4GOGA 4WM9A 3M6HA 5GLAA 4O7DA 1CQAA 4JF4A 3WS0A 4KZ9A 2ZOIA 5HW3A 1N9NA 1NRJA 4YWZA 3UE0A 3IXBA 1ONHA 2XDMA 5DTSA 4DKIA 4GKUA 4IJGA 2J3WA 3IXDA 5F69A 4CQHA 4CLCC 4UA6A 3NDGA 4XXRA 4QPRA 2CC1A 5DF7A 2C6WB 2H10A 3S4XA 1SDEA 4MN7A 3CG5A 1P97A 1PI5A 2Y2OA 3S22A 2WKRA 3AGFA 3LIEA 5KZHA 1K4FA 2H0TA 2W1TB 4GS9B 1LL8A 3AGEA 3IH8A 3PYPA 2MJ6A 2VJWA 1VM1A 3C30A 2Y2JA 2XA7M 1W63Q 4NETA 4O8GA 2QZ6A 3N6IA 2ZMAA 4X56A 2WADA 3T12B 5EM0A 3HJIA 4LENA 3CJMA 3HBRA 3CWFA 3BQAA 2O0YA 3WS5A 2JHEA 4CLCE 3QP2A 2V0WA 3H7WA 1MC0A 1WE4A 3N8SA 3UE1A 1YLZA 5EVEA 3HUOA 4KZ6A 4HBTA 4JXVA 2CMNA 3IHAA 4NK3A 5HD3A 2XGNA 3IS2B 3IXHA 5L10A 1L3LA 3LFVA 2D01A 2G2WA 4N92A 4NXGA 3M2JA 3NBLA 4QU3A 3PBOA 4CLCA 3UNWA 1PW8A 5HDSA 4OPYA 5HDCA 4GHIA 2PBYA 1EROA 3F1NA 3VOZA 2QPNA 2J9OA 5FAQA 4FOFA 1MWUA 4E3LA 1XA1A 2VGLS 1OJGA 1DJCA 4E6XA 1A0KA 1BLCA 4HH3A 4DXCA 4UHUA 4LCLA 3HLGA 1S4SA 4X53A 5HL6A 3HL9A 4EV4A 1N9OA 4KG5A 4LV0A 4Y5FA 4NXEA 4GN2A 4MBFA 1MBLA 4CLCD 2V0UA 3GECA 4HI4A 2R9XA 2P7JA 4GNUA 3LIDA 5CHUA 1J9MA 2Y79A 3T4LA 1STZA 3CPTA 5KSHA 2XFSA 3E98A 4B93A 3T4OA 4CPKA 3PAGA 3RXXA 3WS1A 3MXQA 4OKPA 1TS8A 2ZBBA 1VETB 3LR4A 4GS9A 3NJAA 2A24B 3C8CA 3NC8A 4U3TA 1AWIA 3D72A 5J3WA 3S7PA 5FQ9A 2W3FA 1ALQA 4MNRA 2J3TC 4B9OA 4FTXA 5GHXA 2H5SA 2ZL1B 3BY8A 1G5UA 3T4SA 3HUMA 2OLVA 4GZBA 2ZC5B 4S2NA 1V9YA 2O9BA 4HY8A 3ULFA 4DJ2A 4FUWA 2EWWA 2VV8A 1DP8A 4OQIA 3VP2A 3I7JA 4RX2A 3BFDA 5J4EA 4ZJ3A 3HCYA 2GZAA 3T4JA 4P6ZM 3GRJA 5FQIA 4LV3A 1BT5A 1OTBA 2JC7A 2XRNA 3VSLA 1VB6A 4NG2A 2G2UA 1TDLA 4S2IA 4QD4A 4BD1A 1TF1A 3UB7A 4ZRRA 1QMFA 4XT2B 2JE5A 5FAPA 1W5DA 4HHDA 4HNBA 3IS2A 1J3WA 2HV1A 5K5BA 3A0SA 5FA7A 5DF8A 2IWBA 5G18A 5FQQA 2K7SA 1IYPA 4UA9A 2LB9A 3GQZA 1JNUA 3IWOA 4BBTA 1E4DA 2XFTA 3MBZA 4BBUA 3BLMA 4GB7A 4PM6A 3TOIA 3D9YA 4E3MA 1OTDA 3VV4A 4MN5A 2VLGA 5FEFA 1YLTA 4EQ1A 5FI7A 2DNSA 1BSGA 1PZOA 2PRFA 1CEGA 2H0YA 5A91A 1UWNX 3CUEC 1PYYA 4MDZA 3H82B 1I5QA 2WUQA 3OCNA 2A49A 2BASA 4LPZA 3QHYA 1DP9A 2WKIA 2WKHA 3UPPA 2VK3A 5HAPA 2ZM2A 1NLYA 3E2LA 3PBNA 3O88A 3FYZA 2PHYA 3U2AA 4EWFA 3SW1A 5FQJA 3IF6C 2WZXA 2IWCA 2IA2A 5HPIA 1JVJA 1FCNA 2WAFA 4KENB 3WS2A 1BYWA 2W0NA 5FAOA 3T50A 5FDHA 1XJ4A 2GJ3A 3KSIA 3V5MA 4KZ8A 2PR6A 5AQAA 4DRTA 5G4YA 1GA0A 2JKTM 3HUNA 3RH8B 1LSWA 4HBUA 4MMNA 5GLBA 5I94A 3UDIA 3PBSA 4PMAA 5CGXA 3W8KA 2ZC3B 3FKVA 2J3TD 5EECA 4OP8A 4EEUA 3F1OA 2ZM0A 4BQMA 3ZNYA 4LRYC 3BJNA 1BLPA 2EXAA 2XH9A 1YLYA 4ZJ2A 2ZL1A 3PHYA 4G3KA 5FDSA 4DXBA 4I39A 4Y0TA 4BENA 3UO9A 3MKFA 5AVEA 2Y59A 1W8QA 3TG9A 2WYXA 3DTMA 2YKFA 4BWIA 4DDYA 1KDWA 3IBRA 3O3VA 1G6OA 1PRQA 3D3OA 5E2EA 3LI8A 4X69A 1OT6A 4OQGA 5DFYA 4Y0UA 3UPOA 3HLWA 1YM1A 3CUEA 3DW0A 3MF0A 2P9VB 1SDNA 3LUQA 5TFQA 4I3IA 4WYYA 1XA7A 3HLEA 4JKTA 1XP4A 3QNBA 2K2NA 5CGWA 4ZDXA 3KSHA 3IF6A 5FASA 3LO7A 2Q9MA 5GHYA 2W1RA 1OTEA 5JYOA 1LI9A 3E0YA 3ZG7B 5F6AA 3MXSA 1S1YA 1RP5A 1KGEA 4HJ3A 4S2MA 2QHKA 5HWTA 1I2WA 3NCKA 3JPUA 1K56A 3UDFA 5KSCA 1XJ3A 3OPHA 3A0RA 3VOYA 2OOLA 4FCFA 4BD0A 2FZ0A 2Y2IA 3VFFA 4X68A 4KUKA 4PM8A 5DJUA 1YMSA 3VMAA 4E3OA 1C3BA 5HD5A 2HDUA 3A3FA 5HARA 2BTFP 1S66L 2PD8A 5A92A 4R3AA 4C6YA 1RGYA 3IX4A 3MQ0A 4R70A 3CAXA 2P08A 4R1GA 2J8YA 3NECA 4R23A 3LY3A 1T18A 4QY5A 4WMCA 4HQAA 4Q0HA 3OOVA 5TBMA 4DE2A 2UV0E 2Y2MA 3UB5P 1Y28A 4D2OA 1K56D 5FEGA 2JKGA 1YLPA 3K3CA 1S4RA 4I3JA 1ZC2A 4MCWA 5FQKA 3DWKA 4OPQA 1K25A 1GA9A 4DMZA 3LIAA 3L7HA 1RGZA 1OPXA 5GLCA 2Y2GA 3UB6A 5C5KA 1BLHA 2H28A 3EGXC 1H3QA 1S6RA 2B18A 5BOHA 1HD8A 1XGJA 5KIZA 3Q07A 4HEFA 4EW7A 2ZLYA 2WK0A 4RVAA 2J80A 4N9LA 2QJ7A 5CGSA 4WMCD 1YSQA 1H8ZA 3KSGA 1KE4A 1EW0A 5F1GA 4MEZA 3Q1FA 2I9VA 1YKDA 5U47A 2ZMVA 5L2FA 4K0XA 1FCMA 4X25A 2WKPA 2QJ5A 4IEDA 1NZOA 2HZ5A 4K91A 3IH9A 1YSPA 4KZAA 3T4QA 4EBPA 1BZAA 2VZWA 3WS4A 3WRZA 3TJZC 2W3EA 4H6JB 2FFYA 3CLOA 1K6SA 4DE3A 1WYBA 1D06A 1OTIA 4OP5A 3LIFA 3JYIA 4EESA 2XF3A 3FWLA 5IHVA 3OPLA 5L09A 1YPRA 1PWDA 3GDIA 5EUAA 3PR6A 4KZBA 4NXFA 1LL9A 5HL1A 3T1SA 3BFFA 4BBVA 3A3IA 1OJ5A 2XA7S 1LHYA 4ETZA 4IUHA 1WYCA 1OTAA 1NRFA 3W2ZA 1HZOA 2ZC7A 2D02A 1ZG4A 3CZDA 1BUEA 1YAXA 3W4QA 2OLUA 1V9ZA 4X55A 1GSWA 4WUJA 2QYBA 1K38A 1KDSA 3HLFA 4HH2A 4KQDA 3VP4A 1G6AA 2VX8A 3SZTA 2L1MA 2V2FF 2OV5A 3TE8A 3A3EA 3UMEA 2UWXA 2EWVA 1PWCA 3P98A 1IOUA 4GJ4A 3GR2A 3PXPA 1IEMA 3QP4A 5EVLA 4P0MA 4DE0A 4P6BA 3Q7VA 1LI0A 4O0PA 1L0GA 4JXSA 4I38A 4OOLA 4BL2A 1OMEA 1ESIA 2Q9NA 1T1CA 3NY4A 4EUVA 5CX7A 4S2NC 5TR7A 4OH0A 2ZQ9A 3A0VA 5EVIB 5CHMA 4QB8A 5EE8A 4ARZA 3SH8A 4KQRA 3ZVWA 1MWSA 2AVXA 3IHBA 2YKHA 1T1BA 3IT9A 4S2KA 5CRFA 3V67A 5A8BA 3B42A 4YINA 3G34A 1SHVA 5F5YA 3DTEA 1LSXA 3OPPA 3ZNTA 3LICA 1KGFA 3PBTA 1MWTA 4KZ3A 3ZFZA 4KZ4A 2R9WA 3OZHA 2A2LA 1H8MA 1ODVA 4U0XA 3ZGAB 1EWZA 4MBHA 5CXWA 5D3OA 3ZHHA 4WZ5C 4YNRA 3OBFA 3T1RA 4Z9QA 3O5YA
chains in the Genus database with same CATH topology
2JKFA 2ACGA 4FUWA 2PBDP 1VEUA 1Y4OA 1PFLA 4QWOA 3MSHA 3L9KA 3LEQA 3DAVA 2V8CA 2B95A 1FILA 1SKOB 4X25A 2HZ5A 2V8FA 1A0KA 1SZVA 3KYEA 1ACFA 1J3WA 2ZL1A 3CHWP 3T1QB 5FDSA 4D60A 1FIKA 3NULA 5EM1A 1VETA 1Z09A 2BTFP 4X1LA 1YPRA 3T12B 5EM0A 3MS6A 1VEUB 3NECA 3T1SA 1D1JA 3D9YA 3CPTA 4ESPA 1SKOA 5FEFA 3UB5P 1PRQA 5FEGA 2JKGA 1CF0A 1VETB 5EV0A 4X1MA 2PRFA 3LGOA 1AWIA 5EVEA 2E8JA 3T1XA 1HLUP 2PAVP 1PNEA 3L7HA 3CPTB 1CJFA 4FTXA 1CQAA 3T1RA 2VK3A 2ZL1B 3U4LP 1F2KA 1G5UA 1K0KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JKF A;  2ACG A;  4FUW A;  2PBD P;  1VEU A;  1Y4O A;  1PFL A;  4QWO A;  3MSH A;  3L9K A;  3LEQ A;  3DAV A;  2V8C A;  2B95 A;  1FIL A;  1SKO B;  4X25 A;  2HZ5 A;  2V8F A;  1A0K A;  1SZV A;  3KYE A;  1ACF A;  1J3W A;  2ZL1 A;  3CHW P;  3T1Q B;  5FDS A;  4D60 A;  1FIK A;  3NUL A;  5EM1 A;  1VET A;  1Z09 A;  2BTF P;  4X1L A;  1YPR A;  3T12 B;  5EM0 A;  3MS6 A;  1VEU B;  3NEC A;  3T1S A;  1D1J A;  3D9Y A;  3CPT A;  4ESP A;  1SKO A;  5FEF A;  3UB5 P;  1PRQ A;  5FEG A;  2JKG A;  1CF0 A;  1VET B;  5EV0 A;  4X1M A;  2PRF A;  3LGO A;  1AWI A;  5EVE A;  2E8J A;  3T1X A;  1HLU P;  2PAV P;  1PNE A;  3L7H A;  3CPT B;  1CJF A;  4FTX A;  1CQA A;  3T1R A;  2VK3 A;  2ZL1 B;  3U4L P;  1F2K A;  1G5U A;  1K0K A; 
#chains in the Genus database with same CATH topology
 2ZQD A;  3EWK A;  2W1T A;  2PBD P;  1JTG A;  1Y4O A;  4K0W A;  3OCL A;  2HJE A;  1E25 A;  1S0W A;  3V39 A;  3NIA A;  3MZD A;  3C4O A;  2VKS A;  1FIL A;  1K55 C;  2VV7 A;  2QKP A;  5EOE A;  3FV7 A;  2Z6D A;  2HJ9 C;  4MBK A;  2RCX A;  4P6Z S;  3SH7 A;  5AQ7 A;  5GL9 A;  1FR6 A;  4WEK A;  2EFX A;  2XK1 A;  4GDN A;  2HDS A;  1GSX A;  3PBQ A;  3KO6 A;  4DN0 A;  5EM1 A;  3LR0 A;  4PM7 A;  2EX6 A;  4IVI A;  2ZQA A;  2KDK A;  4C75 A;  2FH5 A;  5DVA A;  3ZYT A;  3BYD A;  3GV9 A;  5CEC A;  4JGR A;  5KMW A;  3UY6 A;  3BEC A;  4UQI M;  4ZTK A;  1FSY A;  4S2L A;  2O9C A;  2KLI A;  3BRM A;  5FQM A;  5IU1 A;  1H5X A;  2WKE A;  4LLO B;  1CI9 A;  1IKG A;  5FI6 A;  5EV0 A;  2XD1 A;  5LBR A;  3G32 A;  4Y17 A;  4WZ5 A;  1HLU P;  2NUT C;  4HJ4 A;  4Q8I A;  4G3V A;  2EA9 A;  2B5R A;  5EOO A;  1L0F A;  2Y2P A;  4QY6 A;  3QP5 A;  4BL3 A;  1F2K A;  1K57 C;  4UAA A;  4JF5 A;  3QP1 A;  1MPL A;  3OC2 A;  4LFU A;  4A5R A;  5A90 A;  1JWV A;  4KG6 A;  4X6T A;  4QWO A;  4DE1 A;  1TS7 A;  4G3W A;  2Y91 A;  1K55 A;  4ZAM A;  3VOL A;  1ZTU A;  2JKT I;  1ZHH B;  4IHQ A;  1FOF A;  3R7W B;  1SKO B;  3UMD A;  1VQQ A;  3IF5 A;  3WWX A;  2W3G A;  3IWI A;  5DJT A;  1M6K A;  4UA7 A;  3OPR A;  1BUL A;  1MKM A;  1ACF A;  3S7N A;  5EFW A;  4EBL A;  4DDS A;  2GDN A;  1FQG A;  2NUP C;  1VET A;  2A24 A;  5F82 A;  3EQU A;  4KZ5 A;  3E4Q A;  2HP9 A;  2KOI A;  2WGW B;  4MN6 A;  5DFX A;  3B3X A;  4GD8 A;  2DMW A;  2ZOH A;  4PHT A;  4HOI A;  2VGJ A;  3C7V A;  4R3B A;  3W4O A;  3LR5 A;  1HTZ A;  3VE4 A;  4E3J A;  3T1X A;  4R4R A;  2JKR I;  3VE3 A;  4E3K A;  1JTD A;  1P0Z A;  1K57 A;  2Z2L B;  1XFQ A;  1Z6F A;  1K0K A;  2JKF A;  4AFI A;  3C38 A;  3E2K A;  4RA7 A;  5E43 A;  4XT2 A;  2WGI A;  3C7U A;  4UEY A;  3BFC A;  3HVF A;  1XGI A;  3BWL A;  1S1Z A;  5HFO A;  3EEH A;  1Q2Q A;  2Y2K A;  3DAV A;  2HGV A;  2B95 A;  4HES A;  1FCO A;  3T4T A;  1ES5 A;  4WF0 A;  4DJ3 A;  4I5S A;  5EPH A;  1W63 M;  3CIT A;  3KYE A;  2HDR A;  1NLZ A;  1HVB A;  3GSG A;  2L4R A;  2HP6 A;  1FSW A;  1N9L A;  3C5A A;  3EGD C;  2OAQ 1;  2DRW A;  5DTK A;  3ZCZ A;  5CER A;  1MKI A;  5AJG A;  3BEB A;  1TVF A;  2P04 A;  2X01 A;  1IKI A;  2ZJ9 A;  2FFF B;  1SCW A;  1G68 A;  3H82 A;  4PKY G;  3S7O A;  1D1J A;  1EI5 A;  4IUK A;  5TGF A;  4E3N A;  1SKO A;  3ZG8 B;  2M7U A;  5HWV A;  5HAQ A;  1NYY A;  1CF0 A;  4FH4 A;  3MFD A;  1IYS A;  4X1M A;  3MQO A;  4OQH A;  2L0W A;  2M1C A;  1TS6 A;  2V20 A;  2ZQ7 A;  5DTT A;  4PM5 A;  4M4X A;  2PAV P;  4Y0O A;  1KGG A;  3MZF A;  2PU4 A;  1WA9 A;  4NXB A;  1D7E A;  3H7W B;  3DBA A;  5I5L A;  1PIO A;  2V1Z A;  2Y4A A;  2VGK A;  3BY9 A;  3F1P B;  1PFL A;  4FD8 A;  4KZ7 A;  3UPN A;  2WGW A;  3L9K A;  1NZU A;  3NHQ A;  4OVD A;  5M18 A;  2GX5 A;  5AQ9 A;  1P9R A;  4R6L A;  2PD7 A;  2W3H A;  1XKZ A;  3MMH A;  2V8F A;  3FG8 A;  4CLC B;  4FSF A;  3R4K A;  3EEA A;  3EQV A;  3B33 A;  4Y15 A;  4GHI B;  5F83 A;  3E4O A;  5IS1 A;  1IFQ A;  3F1N B;  3MKE A;  2VEA A;  1TS0 A;  3E4P A;  3AGD A;  1FIK A;  1TDG A;  1H0M A;  4JF6 A;  4N1H A;  2LB5 A;  3ZQ5 A;  3O86 A;  2P9V A;  2V1A A;  3LYX A;  1ESU A;  3DTI A;  4Y3I A;  3LY4 A;  3SS3 A;  4ESP A;  2ZQ8 A;  4GDB A;  2W27 A;  2Y2H A;  1QME A;  2XR0 A;  4N9K A;  4S2P A;  1BTL A;  4WBG A;  2EX2 A;  4ME4 A;  1RCJ A;  3QP6 A;  2E8J A;  3NOT C;  1K54 C;  3CPT B;  3WRT A;  3DTK A;  1ZG6 A;  3JVV A;  4DF6 A;  4JGQ A;  4OLD A;  4N1X A;  3BLS A;  4XUZ A;  1DP6 A;  2G7U A;  5HPF A;  1F5M A;  3C4P A;  4OPR A;  3SS4 A;  1M40 A;  4RQ9 A;  5HWW A;  4OPZ A;  3MSH A;  4OQ0 A;  2OWJ A;  4MLL A;  4BLM A;  3FZC A;  3MJQ A;  3UN7 A;  3P7N A;  4L0L A;  1XJ2 A;  3D4F A;  4BMW A;  4P87 A;  3N8L A;  4HP9 A;  4E6W A;  3FC7 A;  3V3R A;  1SZV A;  1K6R A;  4IBX A;  3FKW A;  4HJ6 A;  1KE3 A;  3P01 A;  4M3K A;  3A3D A;  2DCF A;  5E2G A;  4WN5 A;  2PR5 A;  4CJN A;  3EOI A;  1KOU A;  4GD6 A;  4LRZ E;  3Q7Z A;  3G6O A;  2XRO A;  4L9F A;  3RJU A;  3F1P A;  1DJA A;  2P74 A;  3ZG9 B;  3K3D A;  4NKP A;  4Q0J A;  4ID4 A;  4QJG A;  4WL9 A;  4XUX A;  2M7V A;  4U0T A;  5GHZ A;  1PWG A;  1TD5 A;  2E8I A;  3BQ8 A;  1GSV A;  3A3J A;  3LR3 A;  3LCE A;  2ZC6 B;  4II7 A;  4B4X A;  3SS5 A;  1PW1 A;  1JWP A;  2Y2L A;  4OOY A;  4ZJ1 A;  1OT9 A;  4BJP A;  1K54 A;  1L0D A;  1P9W A;  3LIB A;  3ZVT A;  5HSQ A;  3BM6 A;  4C3Q A;  3BFE A;  1CK3 A;  1XXM A;  3S7Q A;  1DRM A;  3KX0 X;  2ACG A;  2PDR A;  1E3U A;  4EEP A;  2Y8H A;  4H6J A;  3FPW A;  4S2J A;  2VGL M;  4LCM A;  1L0E A;  4NEE D;  4R4S A;  1AXB A;  1DJB A;  1W7F A;  5CTN A;  4JGP A;  5EVI C;  3G30 A;  1W8Y A;  2B02 A;  2ZMF A;  2WAE A;  3ITA A;  3IXG A;  2V9A A;  3MQQ A;  2BLS A;  1CI8 A;  2J7V A;  5DKL A;  3UB8 A;  4EXO A;  5FSR A;  3VFH A;  4EUZ A;  2QWS A;  1PI4 A;  3T1Q B;  2EX8 A;  4YFM A;  3UE3 A;  2Y2N A;  2A3U A;  3OLO A;  3NI9 A;  3KYQ A;  3RTY A;  1E3U D;  3G4P A;  3M2K A;  1ES4 A;  4JBF A;  1X0O A;  2I72 A;  1KE0 A;  3F1O B;  5CHJ A;  4YOF A;  1YQS A;  4ETX A;  2HF6 A;  4JGO A;  5J8X A;  2O9A A;  2VA0 A;  5HZH A;  4O01 A;  4KG2 A;  4I3A A;  2X71 A;  4Y7P A;  1PZP A;  3O87 A;  4WEL A;  4KQO A;  3IWQ A;  3VP0 A;  4UQI S;  2Y55 A;  3V3S A;  2ZM8 A;  3LEZ A;  3TSG A;  3M6B A;  2Y2Q A;  4ZBE A;  3G2Z A;  4EQI A;  3ZDJ A;  3ZG5 A;  1CJF A;  3GTC A;  4R38 A;  1MWR A;  3JVU A;  1MXO A;  1S67 L;  2JN7 A;  4FH2 A;  1T19 A;  1ES3 A;  1KVL A;  3S1Y A;  3N4I A;  3VSK A;  1NWZ A;  1NY0 A;  3PTE A;  1IYO A;  5EVI A;  1XFN A;  1GCE A;  2ZQC A;  4F3L B;  3SOI A;  5TJJ A;  1Q2P A;  3IF6 B;  1NXY A;  4E3I A;  4L9E A;  2Q0O A;  2J9P A;  2EFU A;  2Z6C A;  1IYQ A;  1GHM A;  2WZZ A;  1BLS A;  2K31 A;  3MZE A;  1MY8 A;  2XEP A;  1Y54 A;  4PM9 A;  4PPR A;  1N4O A;  2ZD8 A;  3VP1 A;  1UWP X;  1GHP A;  1SKF A;  5F68 A;  1MZU A;  2XQZ A;  1Z09 A;  3HJK A;  3Q81 A;  3NOU C;  3G2Y A;  3HLD A;  4X1L A;  4EBN A;  5M1A A;  3ICY A;  1F98 A;  4QHC A;  3TW8 A;  5EVI D;  3K2N A;  2X02 A;  1VEU B;  5FAT A;  3UDX A;  4GLQ A;  3VP3 A;  4IVK A;  1ZKJ A;  2EX9 A;  5AVF A;  5AQB A;  4JLF A;  5DF9 A;  3RXW A;  4B88 A;  3KYZ A;  3ZG0 A;  5A93 A;  4Y2F A;  2ZC4 B;  5M19 A;  4WZ4 A;  4PKY A;  1IEL A;  4WEJ A;  4EU0 A;  1XPB A;  1UGU A;  3MR0 A;  2QMI A;  5HX9 A;  3CMZ A;  4HIA A;  5DKK A;  2HDQ A;  2RL3 A;  5TBM B;  3MFX A;  2IWD A;  1YT4 A;  5MC7 A;  3PBR A;  1NJ4 A;  3N8R A;  3HLC A;  3PAE A;  5L8M A;  2V1B A;  3T4K A;  2C5W B;  4OON A;  3IQA A;  3QP8 A;  2V8C A;  3H9W A;  1ONG A;  2GNX A;  2O99 A;  2KX6 A;  3NOP C;  4L9G A;  3IX8 A;  4JXW A;  4RYE A;  2WKQ A;  3BFG A;  4LV1 A;  5G4Z A;  4HP4 A;  1YMX A;  2PU2 A;  1W79 A;  5FL3 A;  4R0Q A;  1CEF A;  2XLN A;  1FR1 A;  3CHW P;  2EXB A;  3HRE A;  1XJ6 A;  3QNC A;  3KSF A;  5L07 A;  3G31 A;  3HLB A;  5CEB A;  5IT5 A;  4PAU A;  3MS6 A;  1KVM A;  2BG1 A;  2JCH A;  5FI2 A;  2HPB A;  4OLG A;  4F3L A;  4GCZ A;  4LV2 A;  3ISG A;  4B4Z A;  2JKR M;  4EER A;  3W4P A;  3BW6 A;  4S2O A;  3TRC A;  3FPV A;  1G28 A;  3UB9 A;  3Q82 A;  5JYP A;  3V50 A;  2R78 A;  3NDE A;  1PNE A;  3ITB A;  1GHI A;  1NYM A;  1LLB A;  3B47 A;  4Y13 A;  1ERQ A;  3R7W A;  3GVB A;  3SH9 A;  2PT7 A;  3U4L P;  1XX2 A;  4F94 A;  1N9B A;  5GLD A;  5F1F A;  3UE6 A;  1YLJ A;  3N7W A;  3C2W A;  1H8Y A;  2WGV A;  3G35 A;  4JPM A;  3IX3 A;  2XD5 A;  2Z2M B;  1VEU A;  4IBR A;  4KUO A;  3LEQ A;  4P85 A;  2HP5 A;  2INW A;  1K4E A;  2VV6 A;  4LGW A;  1O7E A;  2W3D A;  1L2S A;  1I2S A;  1ERM A;  2PYP A;  4KQQ A;  4LRX C;  5E2H A;  1U60 A;  4R3J A;  1F9I A;  2PYR A;  1LL5 A;  1YLW A;  2OSU A;  5CTM A;  5J7E A;  1TEM A;  3RFB A;  1ES2 A;  4WLA A;  4OOM A;  2OWH A;  1LSV A;  4D60 A;  3NUL A;  3LI9 A;  2OAP 1;  2XSS A;  4E04 A;  3P09 A;  3Q7V B;  4GW9 A;  5HDD A;  1O07 A;  3GMW A;  4EET B;  5E2F A;  4Q0I A;  1LT0 A;  1T1A A;  2JBF A;  1VHM A;  4RX3 A;  4K08 A;  3DWZ A;  4ARZ B;  4Z1W A;  3LGO A;  4H8R A;  5CED A;  4JXG A;  1DY6 A;  3CI6 A;  1JWZ A;  3MXR A;  5HAI A;  3IBJ A;  4GOG A;  4WM9 A;  3M6H A;  5GLA A;  4O7D A;  1CQA A;  4JF4 A;  3WS0 A;  4KZ9 A;  2ZOI A;  5HW3 A;  1N9N A;  1NRJ A;  4YWZ A;  3UE0 A;  3IXB A;  1ONH A;  2XDM A;  5DTS A;  4DKI A;  4GKU A;  4IJG A;  2J3W A;  3IXD A;  5F69 A;  4CQH A;  4CLC C;  4UA6 A;  3NDG A;  4XXR A;  4QPR A;  2CC1 A;  5DF7 A;  2C6W B;  2H10 A;  3S4X A;  1SDE A;  4MN7 A;  3CG5 A;  1P97 A;  1PI5 A;  2Y2O A;  3S22 A;  2WKR A;  3AGF A;  3LIE A;  5KZH A;  1K4F A;  2H0T A;  2W1T B;  4GS9 B;  1LL8 A;  3AGE A;  3IH8 A;  3PYP A;  2MJ6 A;  2VJW A;  1VM1 A;  3C30 A;  2Y2J A;  2XA7 M;  1W63 Q;  4NET A;  4O8G A;  2QZ6 A;  3N6I A;  2ZMA A;  4X56 A;  2WAD A;  3T12 B;  5EM0 A;  3HJI A;  4LEN A;  3CJM A;  3HBR A;  3CWF A;  3BQA A;  2O0Y A;  3WS5 A;  2JHE A;  4CLC E;  3QP2 A;  2V0W A;  3H7W A;  1MC0 A;  1WE4 A;  3N8S A;  3UE1 A;  1YLZ A;  5EVE A;  3HUO A;  4KZ6 A;  4HBT A;  4JXV A;  2CMN A;  3IHA A;  4NK3 A;  5HD3 A;  2XGN A;  3IS2 B;  3IXH A;  5L10 A;  1L3L A;  3LFV A;  2D01 A;  2G2W A;  4N92 A;  4NXG A;  3M2J A;  3NBL A;  4QU3 A;  3PBO A;  4CLC A;  3UNW A;  1PW8 A;  5HDS A;  4OPY A;  5HDC A;  4GHI A;  2PBY A;  1ERO A;  3F1N A;  3VOZ A;  2QPN A;  2J9O A;  5FAQ A;  4FOF A;  1MWU A;  4E3L A;  1XA1 A;  2VGL S;  1OJG A;  1DJC A;  4E6X A;  1A0K A;  1BLC A;  4HH3 A;  4DXC A;  4UHU A;  4LCL A;  3HLG A;  1S4S A;  4X53 A;  5HL6 A;  3HL9 A;  4EV4 A;  1N9O A;  4KG5 A;  4LV0 A;  4Y5F A;  4NXE A;  4GN2 A;  4MBF A;  1MBL A;  4CLC D;  2V0U A;  3GEC A;  4HI4 A;  2R9X A;  2P7J A;  4GNU A;  3LID A;  5CHU A;  1J9M A;  2Y79 A;  3T4L A;  1STZ A;  3CPT A;  5KSH A;  2XFS A;  3E98 A;  4B93 A;  3T4O A;  4CPK A;  3PAG A;  3RXX A;  3WS1 A;  3MXQ A;  4OKP A;  1TS8 A;  2ZBB A;  1VET B;  3LR4 A;  4GS9 A;  3NJA A;  2A24 B;  3C8C A;  3NC8 A;  4U3T A;  1AWI A;  3D72 A;  5J3W A;  3S7P A;  5FQ9 A;  2W3F A;  1ALQ A;  4MNR A;  2J3T C;  4B9O A;  4FTX A;  5GHX A;  2H5S A;  2ZL1 B;  3BY8 A;  1G5U A;  3T4S A;  3HUM A;  2OLV A;  4GZB A;  2ZC5 B;  4S2N A;  1V9Y A;  2O9B A;  4HY8 A;  3ULF A;  4DJ2 A;  4FUW A;  2EWW A;  2VV8 A;  1DP8 A;  4OQI A;  3VP2 A;  3I7J A;  4RX2 A;  3BFD A;  5J4E A;  4ZJ3 A;  3HCY A;  2GZA A;  3T4J A;  4P6Z M;  3GRJ A;  5FQI A;  4LV3 A;  1BT5 A;  1OTB A;  2JC7 A;  2XRN A;  3VSL A;  1VB6 A;  4NG2 A;  2G2U A;  1TDL A;  4S2I A;  4QD4 A;  4BD1 A;  1TF1 A;  3UB7 A;  4ZRR A;  1QMF A;  4XT2 B;  2JE5 A;  5FAP A;  1W5D A;  4HHD A;  4HNB A;  3IS2 A;  1J3W A;  2HV1 A;  5K5B A;  3A0S A;  5FA7 A;  5DF8 A;  2IWB A;  5G18 A;  5FQQ A;  2K7S A;  1IYP A;  4UA9 A;  2LB9 A;  3GQZ A;  1JNU A;  3IWO A;  4BBT A;  1E4D A;  2XFT A;  3MBZ A;  4BBU A;  3BLM A;  4GB7 A;  4PM6 A;  3TOI A;  3D9Y A;  4E3M A;  1OTD A;  3VV4 A;  4MN5 A;  2VLG A;  5FEF A;  1YLT A;  4EQ1 A;  5FI7 A;  2DNS A;  1BSG A;  1PZO A;  2PRF A;  1CEG A;  2H0Y A;  5A91 A;  1UWN X;  3CUE C;  1PYY A;  4MDZ A;  3H82 B;  1I5Q A;  2WUQ A;  3OCN A;  2A49 A;  2BAS A;  4LPZ A;  3QHY A;  1DP9 A;  2WKI A;  2WKH A;  3UPP A;  2VK3 A;  5HAP A;  2ZM2 A;  1NLY A;  3E2L A;  3PBN A;  3O88 A;  3FYZ A;  2PHY A;  3U2A A;  4EWF A;  3SW1 A;  5FQJ A;  3IF6 C;  2WZX A;  2IWC A;  2IA2 A;  5HPI A;  1JVJ A;  1FCN A;  2WAF A;  4KEN B;  3WS2 A;  1BYW A;  2W0N A;  5FAO A;  3T50 A;  5FDH A;  1XJ4 A;  2GJ3 A;  3KSI A;  3V5M A;  4KZ8 A;  2PR6 A;  5AQA A;  4DRT A;  5G4Y A;  1GA0 A;  2JKT M;  3HUN A;  3RH8 B;  1LSW A;  4HBU A;  4MMN A;  5GLB A;  5I94 A;  3UDI A;  3PBS A;  4PMA A;  5CGX A;  3W8K A;  2ZC3 B;  3FKV A;  2J3T D;  5EEC A;  4OP8 A;  4EEU A;  3F1O A;  2ZM0 A;  4BQM A;  3ZNY A;  4LRY C;  3BJN A;  1BLP A;  2EXA A;  2XH9 A;  1YLY A;  4ZJ2 A;  2ZL1 A;  3PHY A;  4G3K A;  5FDS A;  4DXB A;  4I39 A;  4Y0T A;  4BEN A;  3UO9 A;  3MKF A;  5AVE A;  2Y59 A;  1W8Q A;  3TG9 A;  2WYX A;  3DTM A;  2YKF A;  4BWI A;  4DDY A;  1KDW A;  3IBR A;  3O3V A;  1G6O A;  1PRQ A;  3D3O A;  5E2E A;  3LI8 A;  4X69 A;  1OT6 A;  4OQG A;  5DFY A;  4Y0U A;  3UPO A;  3HLW A;  1YM1 A;  3CUE A;  3DW0 A;  3MF0 A;  2P9V B;  1SDN A;  3LUQ A;  5TFQ A;  4I3I A;  4WYY A;  1XA7 A;  3HLE A;  4JKT A;  1XP4 A;  3QNB A;  2K2N A;  5CGW A;  4ZDX A;  3KSH A;  3IF6 A;  5FAS A;  3LO7 A;  2Q9M A;  5GHY A;  2W1R A;  1OTE A;  5JYO A;  1LI9 A;  3E0Y A;  3ZG7 B;  5F6A A;  3MXS A;  1S1Y A;  1RP5 A;  1KGE A;  4HJ3 A;  4S2M A;  2QHK A;  5HWT A;  1I2W A;  3NCK A;  3JPU A;  1K56 A;  3UDF A;  5KSC A;  1XJ3 A;  3OPH A;  3A0R A;  3VOY A;  2OOL A;  4FCF A;  4BD0 A;  2FZ0 A;  2Y2I A;  3VFF A;  4X68 A;  4KUK A;  4PM8 A;  5DJU A;  1YMS A;  3VMA A;  4E3O A;  1C3B A;  5HD5 A;  2HDU A;  3A3F A;  5HAR A;  2BTF P;  1S66 L;  2PD8 A;  5A92 A;  4R3A A;  4C6Y A;  1RGY A;  3IX4 A;  3MQ0 A;  4R70 A;  3CAX A;  2P08 A;  4R1G A;  2J8Y A;  3NEC A;  4R23 A;  3LY3 A;  1T18 A;  4QY5 A;  4WMC A;  4HQA A;  4Q0H A;  3OOV A;  5TBM A;  4DE2 A;  2UV0 E;  2Y2M A;  3UB5 P;  1Y28 A;  4D2O A;  1K56 D;  5FEG A;  2JKG A;  1YLP A;  3K3C A;  1S4R A;  4I3J A;  1ZC2 A;  4MCW A;  5FQK A;  3DWK A;  4OPQ A;  1K25 A;  1GA9 A;  4DMZ A;  3LIA A;  3L7H A;  1RGZ A;  1OPX A;  5GLC A;  2Y2G A;  3UB6 A;  5C5K A;  1BLH A;  2H28 A;  3EGX C;  1H3Q A;  1S6R A;  2B18 A;  5BOH A;  1HD8 A;  1XGJ A;  5KIZ A;  3Q07 A;  4HEF A;  4EW7 A;  2ZLY A;  2WK0 A;  4RVA A;  2J80 A;  4N9L A;  2QJ7 A;  5CGS A;  4WMC D;  1YSQ A;  1H8Z A;  3KSG A;  1KE4 A;  1EW0 A;  5F1G A;  4MEZ A;  3Q1F A;  2I9V A;  1YKD A;  5U47 A;  2ZMV A;  5L2F A;  4K0X A;  1FCM A;  4X25 A;  2WKP A;  2QJ5 A;  4IED A;  1NZO A;  2HZ5 A;  4K91 A;  3IH9 A;  1YSP A;  4KZA A;  3T4Q A;  4EBP A;  1BZA A;  2VZW A;  3WS4 A;  3WRZ A;  3TJZ C;  2W3E A;  4H6J B;  2FFY A;  3CLO A;  1K6S A;  4DE3 A;  1WYB A;  1D06 A;  1OTI A;  4OP5 A;  3LIF A;  3JYI A;  4EES A;  2XF3 A;  3FWL A;  5IHV A;  3OPL A;  5L09 A;  1YPR A;  1PWD A;  3GDI A;  5EUA A;  3PR6 A;  4KZB A;  4NXF A;  1LL9 A;  5HL1 A;  3T1S A;  3BFF A;  4BBV A;  3A3I A;  1OJ5 A;  2XA7 S;  1LHY A;  4ETZ A;  4IUH A;  1WYC A;  1OTA A;  1NRF A;  3W2Z A;  1HZO A;  2ZC7 A;  2D02 A;  1ZG4 A;  3CZD A;  1BUE A;  1YAX A;  3W4Q A;  2OLU A;  1V9Z A;  4X55 A;  1GSW A;  4WUJ A;  2QYB A;  1K38 A;  1KDS A;  3HLF A;  4HH2 A;  4KQD A;  3VP4 A;  1G6A A;  2VX8 A;  3SZT A;  2L1M A;  2V2F F;  2OV5 A;  3TE8 A;  3A3E A;  3UME A;  2UWX A;  2EWV A;  1PWC A;  3P98 A;  1IOU A;  4GJ4 A;  3GR2 A;  3PXP A;  1IEM A;  3QP4 A;  5EVL A;  4P0M A;  4DE0 A;  4P6B A;  3Q7V A;  1LI0 A;  4O0P A;  1L0G A;  4JXS A;  4I38 A;  4OOL A;  4BL2 A;  1OME A;  1ESI A;  2Q9N A;  1T1C A;  3NY4 A;  4EUV A;  5CX7 A;  4S2N C;  5TR7 A;  4OH0 A;  2ZQ9 A;  3A0V A;  5EVI B;  5CHM A;  4QB8 A;  5EE8 A;  4ARZ A;  3SH8 A;  4KQR A;  3ZVW A;  1MWS A;  2AVX A;  3IHB A;  2YKH A;  1T1B A;  3IT9 A;  4S2K A;  5CRF A;  3V67 A;  5A8B A;  3B42 A;  4YIN A;  3G34 A;  1SHV A;  5F5Y A;  3DTE A;  1LSX A;  3OPP A;  3ZNT A;  3LIC A;  1KGF A;  3PBT A;  1MWT A;  4KZ3 A;  3ZFZ A;  4KZ4 A;  2R9W A;  3OZH A;  2A2L A;  1H8M A;  1ODV A;  4U0X A;  3ZGA B;  1EWZ A;  4MBH A;  5CXW A;  5D3O A;  3ZHH A;  4WZ5 C;  4YNR A;  3OBF A;  3T1R A;  4Z9Q A;  3O5Y A; 
#chains in the Genus database with same CATH homology
 2JKF A;  2ACG A;  4FUW A;  2PBD P;  1VEU A;  1Y4O A;  1PFL A;  4QWO A;  3MSH A;  3L9K A;  3LEQ A;  3DAV A;  2V8C A;  2B95 A;  1FIL A;  1SKO B;  4X25 A;  2HZ5 A;  2V8F A;  1A0K A;  1SZV A;  3KYE A;  1ACF A;  1J3W A;  2ZL1 A;  3CHW P;  3T1Q B;  5FDS A;  4D60 A;  1FIK A;  3NUL A;  5EM1 A;  1VET A;  1Z09 A;  2BTF P;  4X1L A;  1YPR A;  3T12 B;  5EM0 A;  3MS6 A;  1VEU B;  3NEC A;  3T1S A;  1D1J A;  3D9Y A;  3CPT A;  4ESP A;  1SKO A;  5FEF A;  3UB5 P;  1PRQ A;  5FEG A;  2JKG A;  1CF0 A;  1VET B;  5EV0 A;  4X1M A;  2PRF A;  3LGO A;  1AWI A;  5EVE A;  2E8J A;  3T1X A;  1HLU P;  2PAV P;  1PNE A;  3L7H A;  3CPT B;  1CJF A;  4FTX A;  1CQA A;  3T1R A;  2VK3 A;  2ZL1 B;  3U4L P;  1F2K A;  1G5U A;  1K0K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...