1PRQA

Acanthamoeba castellanii profilin ia
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
125
structure length
125
Chain Sequence
SWQTYVDTNLVGTGAVTQAAILGLDGNTWATSAGFAVTPAQGQTLASAFNNADPIRASGFDLAGVHYVTLRADDRSIYGKKGSAGVITVKTSKSILVGVYNEKIQPGTAANVVEKLADYLIGQGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Contractile protein
molecule keywords PROFILIN IA
publication title Crystal packing induces a conformational change in profilin-I from Acanthamoeba castellanii.
pubmed doi rcsb
source organism Acanthamoeba castellanii
total genus 34
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 1997-08-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.30 Alpha Beta 2-Layer Sandwich Beta-Lactamase Dynein light chain 2a, cytoplasmic 1prqA00
1Z09A 1VETA 2ACGA 1K0KA 3MSHA 4D60A 1YPRA 2JKGA 3NECA 4FTXA 4X1MA 1Y4OA 2JKFA 3KYEA 3T1RA 2PBDP 2E8JA 1VETB 3CHWP 4X25A 5FEGA 2V8CA 2VK3A 3T1QB 3CPTA 3CPTB 1CJFA 3T1XA 1PFLA 1ACFA 1CF0A 2BTFP 1SZVA 1AWIA 3U4LP 1F2KA 4QWOA 1SKOA 2PRFA 1VEUA 1VEUB 3NULA 1HLUP 3LGOA 3T12B 5EM0A 5EM1A 3L7HA 4FUWA 2ZL1A 1CQAA 4ESPA 1FIKA 1FILA 4X1LA 1SKOB 1D1JA 5FDSA 5FEFA 1J3WA 3LEQA 3MS6A 1G5UA 2HZ5A 5EVEA 2B95A 3UB5P 3D9YA 2PAVP 2ZL1B 2V8FA 3T1SA 1A0KA 1PNEA 3L9KA 5EV0A 1PRQA 3DAVA
chains in the Genus database with same CATH superfamily
4OVDA 5E2GA 3ICYA 3QP8A 3MSHA 5FA7A 3V67A 5HARA 4E6WA 5GHZA 4GDNA 4DE2A 4P85A 5GLDA 2WZXA 3FPVA 4S2IA 2OWHA 4BJPA 2E8JA 2GX5A 2PT7A 2HF6A 4UQIM 2B5RA 4DJ2A 3CPTA 3GVBA 1MWTA 1F5MA 5HAQA 3BJNA 3E0YA 4WEJA 3M6HA 5FSRA 5AQ9A 1T1BA 2EX9A 1SKOA 2JKRM 4EBNA 3RTYA 1OJGA 1LI0A 4EETB 1L0DA 4BL2A 5EM0A 3HLBA 4R3BA 2D02A 2WZZA 4GN2A 1QMFA 3UPNA 3PHYA 3LEZA 3LCEA 5L2FA 3A3IA 3OPRA 3V39A 5F1FA 4GCZA 2R9XA 4QPRA 1LL9A 2V0UA 5FEFA 4OPQA 1OMEA 1S67L 2IA2A 1YLYA 3SH9A 2PHYA 1I2WA 5KSHA 2W3HA 3D9YA 2V8FA 3T1SA 2XFTA 4OH0A 3IBJA 4OQHA 1FCNA 5EV0A 3UE1A 4GS9B 3V3SA 2M7UA 4UQIS 5HW3A 2L4RA 2ACGA 4EWFA 2OAP1 5HPIA 4IEDA 1NYMA 2WUQA 1X0OA 2V1ZA 3EGXC 3EQVA 3UO9A 2AVXA 3IWIA 3C4PA 4R38A 4RQ9A 4RX2A 4Y2FA 1W8QA 3UN7A 2WAEA 4GD8A 2HDQA 4EESA 4S2LA 4CLCD 3KSIA 4UA7A 3PBSA 4Y0OA 3RXWA 4O0PA 3F1PB 3GSGA 1CF0A 2BTFP 1HTZA 2XGNA 1KVLA 2JKRI 5HWTA 4OOYA 3T4SA 2QJ7A 1PWDA 3T4OA 1I2SA 5AQBA 5HDDA 1G28A 5FQKA 4HP4A 3MFDA 1EWZA 3HJIA 2Y2NA 3HLWA 4GS9A 3O88A 5L09A 1BLCA 4FOFA 3B3XA 1TS6A 2EX2A 5EVIA 3T4TA 2EA9A 3G32A 2LB5A 4JBFA 3HLFA 3G4PA 2HDRA 4HEFA 4Z1WA 2BLSA 4XUZA 3H7WB 3IH8A 2OLUA 1NLYA 3CJMA 3UB5P 4IBRA 2PAVP 3ZVWA 4HY8A 1TD5A 4EQIA 4IUKA 1G6AA 2ZM2A 4MCWA 2H5SA 3T50A 5L07A 4WZ5A 4C3QA 1Z09A 1LL8A 4S2OA 1Q2QA 4GNUA 1ONGA 3NOTC 5FI6A 4PKYA 1XJ2A 4Q0JA 5HDSA 3DWZA 4KZAA 1HZOA 4X55A 2B02A 3ZQ5A 5F6AA 3SH7A 4WM9A 1LSXA 5DFXA 3T4KA 1NRFA 4N92A 4GKUA 5DKKA 1VETB 5M19A 2Y2MA 2V8CA 4KZ8A 2IWBA 3BYDA 3ZVTA 3NDEA 3NOPC 2ZQDA 3CLOA 1AWIA 1ESIA 5HD5A 3UMEA 1KDWA 2W1RA 4Y5FA 3HVFA 2PRFA 3A3FA 4JF5A 4P6ZM 2EWVA 3TRCA 4CQHA 3QP5A 3TE8A 4CJNA 2ZOIA 1TS0A 2MJ6A 2J3TD 4L0LA 4BWIA 2K31A 5KZHA 1GHMA 4WN5A 1XP4A 3GV9A 2V1AA 4KZ3A 1D1JA 2J8YA 1J3WA 5HL1A 5E2FA 2G2WA 1XJ3A 2XD5A 4HNBA 2Z6CA 1D06A 4WL9A 5CEDA 5EVEA 2VX8A 3BY8A 4S2NA 2Q9NA 1NRJA 2CMNA 1BLPA 3HJKA 2VLGA 4BBVA 2HV1A 5EUAA 3MFXA 1VETA 2QPNA 1P97A 5JYOA 3B33A 1LHYA 5AJGA 3OBFA 1K56D 4WMCA 1FR6A 1Y4OA 2O0YA 1L3LA 2JKFA 2ZBBA 4F3LB 3HL9A 4N1HA 1IYOA 1PIOA 3MJQA 2XROA 2Y8HA 4P6ZS 3ZNYA 4S2NC 2P04A 1T1CA 3BQ8A 4EUVA 4C6YA 2VK3A 1FSWA 1L2SA 3RFBA 2R78A 1MWSA 4N1XA 4YFMA 4Y0UA 4B9OA 1F2KA 3ISGA 2XR0A 1HVBA 2XA7S 3GR2A 3FC7A 2VZWA 3NOUC 1VEUB 3NBLA 5EM1A 5IT5A 3IQAA 3UDIA 1K25A 5J7EA 4H6JA 2ZQAA 1NLZA 3UE0A 3GMWA 3G34A 4R70A 2X01A 4JXVA 3EGDC 2V0WA 2ZQ9A 4XT2A 2VGJA 1E3UD 2M1CA 5L10A 4B4ZA 4KZBA 5J8XA 4L9FA 2OLVA 4EW7A 4XXRA 3MF0A 3PBTA 5CEBA 1G68A 4NXGA 1A0KA 4OLGA 1TS8A 4G3WA 4EQ1A 4DDYA 4E3OA 3UNWA 1K0KA 3SS3A 1TS7A 3NC8A 3BQAA 1GA0A 1WE4A 5G4YA 4BBUA 2EFUA 3CUEC 5LBRA 3BW6A 3FPWA 5G4ZA 2W27A 5DJTA 1PYYA 2EX8A 3AGDA 3Q7ZA 4I5SA 1YAXA 3MZEA 4GLQA 4MN6A 4UHUA 1RCJA 2VGLS 4FD8A 3T4LA 4EV4A 1K54A 3R7WB 4PM5A 1P9WA 1LLBA 2O99A 4IHQA 1FSYA 2HJ9C 2V1BA 3HLGA 1YT4A 1PFLA 3A3DA 1YLTA 4E04A 5E43A 4ME4A 2DCFA 4KUKA 1MWRA 4QWOA 4HQAA 3ZGAB 3E4QA 3WS0A 4KZ9A 3RH8B 1DJAA 1MWUA 5EPHA 3CITA 4YINA 4H8RA 2VJWA 1K54C 1XKZA 3WS1A 3BLSA 2FH5A 2DMWA 2ZLYA 1S66L 5TFQA 2W3DA 3NY4A 3KO6A 5EECA 4C75A 3LI8A 3EWKA 4OKPA 3UDFA 5TR7A 2XSSA 5KSCA 3T4QA 3S4XA 2OAQ1 5DVAA 4DXBA 4LENA 2WKRA 4UEYA 3LY3A 1NYYA 2Z2LB 4PPRA 4KZ5A 1MKMA 2QYBA 2FFFB 3R7WA 3ITAA 2IWCA 4X56A 3ULFA 4RYEA 4I38A 4JF6A 3PR6A 4WLAA 1K55A 4GD6A 5TJJA 4ZJ2A 4DRTA 1JTDA 1QMEA 1H8YA 4Y17A 1N9NA 4HBUA 1XPBA 1WYCA 4NKPA 2VEAA 3IF5A 5FEGA 2OSUA 1EW0A 4P87A 4CLCB 3T1QB 3A3EA 1W7FA 4A5RA 4EEPA 2W1TB 3IS2B 1VB6A 5A91A 3KSGA 3C5AA 2JHEA 4PM6A 1K55C 5FDHA 3LR4A 5FQMA 2DRWA 3VV4A 4GDBA 5CGXA 3I7JA 4MDZA 4NXBA 4QD4A 2ZC7A 4QHCA 5CTMA 1ES4A 5CHMA 5GLCA 5HWWA 2HP9A 3H82B 2UWXA 4HHDA 4YOFA 3G30A 1SDNA 2K2NA 4JGQA 1M40A 2B95A 4LPZA 2K7SA 4IVIA 3PBRA 1NZUA 5CTNA 4R4SA 1LSWA 3LR3A 3MZDA 1PI5A 1K4EA 3OC2A 3S7NA 1ZC2A 1FR1A 3SZTA 5AVFA 4LRZE 3ZYTA 1K4FA 3IX3A 4BL3A 3LIBA 3S1YA 2JKTM 4R23A 2P08A 4X1MA 1G6OA 2W1TA 5AVEA 1F98A 1NY0A 3IS2A 5GHXA 4N9LA 3BFCA 5FASA 3KYEA 2L0WA 2ZC3B 2P74A 1T1AA 4FH2A 4HOIA 2Y2PA 5CGSA 4Y0TA 1YLZA 1YMXA 1Y54A 4JPMA 4GW9A 1SDEA 4RVAA 3T1XA 5CERA 1FQGA 4LV0A 1RGYA 1S1ZA 1ZG6A 4NG2A 5GL9A 1OTAA 4HBTA 4CLCC 3H82A 1ZTUA 2H0TA 4D2OA 4Z9QA 1KE3A 4R3JA 3DTKA 3N8RA 5JYPA 1NWZA 3GTCA 4O8GA 3L7HA 4G3VA 5FAPA 1GHIA 4UAAA 2ZC6B 5HD3A 1J9MA 4X1LA 1YLWA 3E2LA 2Q0OA 5F69A 2PR6A 3VP1A 2WKIA 1KGEA 2WAFA 3FG8A 4N9KA 3WS2A 2VV8A 2OOLA 4KG2A 3BWLA 5TBMB 3BRMA 5HAIA 2Y91A 4HP9A 5FI2A 3O3VA 5HAPA 3SS5A 4ZBEA 4HI4A 3SS4A 5HPFA 3HLEA 4P0MA 3ZG7B 2JKTI 4LCLA 3KSHA 1YSPA 2VA0A 3Q7VB 5E2EA 3BFGA 3FZCA 3T1RA 3D3OA 3ZFZA 1GSXA 4GHIB 4OQIA 3PYPA 3IHBA 3LIAA 3NCKA 5FAOA 3K2NA 2KOIA 1OTBA 3QNBA 3F1PA 4OPYA 3A0VA 2HP6A 1KGGA 3U4LP 4R1GA 4MNRA 1Z6FA 3JVVA 4ZAMA 3LIFA 1BT5A 5IU1A 4E3KA 3V5MA 4DE0A 4Y3IA 3OLOA 1DP8A 3O87A 1YLPA 3ZG8B 2P7JA 4R6LA 1SKFA 1IYPA 2XH9A 2XK1A 4ZTKA 3IBRA 3W8KA 4BD0A 4KG6A 4JF4A 2YKHA 2J3TC 5EVID 3IH9A 3LIEA 3EEHA 3H7WA 1G5UA 1LSVA 2EWWA 3BY9A 1S0WA 2UV0E 3LFVA 4M3KA 3Q7VA 4PM8A 1S4SA 3H9WA 4E3JA 4GHIA 2WKEA 3MKEA 2ZMAA 4PM7A 5CHUA 1GCEA 1XFNA 2X71A 3VOLA 4HIAA 3VFFA 3EQUA 2XA7M 1H3QA 3RJUA 3UB7A 2PDRA 3FV7A 4FTXA 4PM9A 1PWGA 5DTTA 3V50A 3CHWP 1XGIA 5HDCA 3TJZC 3VFHA 3VE3A 1N9OA 4JXSA 3DBAA 1ACFA 2XF3A 1YQSA 4O7DA 2A24B 4LGWA 1VM1A 5FI7A 3CMZA 1H0MA 2H10A 3M6BA 5EOEA 3UE6A 1DRMA 4EU0A 2ZMVA 4FUWA 2VGKA 5KMWA 3MZFA 1IKGA 2ZJ9A 5HL6A 3FYZA 2G7UA 2QWSA 1VHMA 1ES2A 1TF1A 4JGOA 2Y2JA 2VGLM 3IF6B 2P9VB 3E98A 3M2KA 4L9GA 1UWPX 2GJ3A 1S1YA 2J3WA 3CUEA 3TSGA 4K91A 1DJCA 3WS4A 1MY8A 1VQQA 4HJ4A 3NDGA 3W4OA 4LRXC 3IXGA 1KE0A 1CEGA 1LL5A 2BG1A 2Z2MB 4LCMA 4LV2A 2XRNA 3SOIA 3MQOA 1BUEA 1L0GA 4KG5A 3BEBA 1Y28A 4WMCD 1BTLA 5FQQA 4F3LA 2A24A 3LR0A 3U2AA 3BECA 2A3UA 2PBDP 4JXGA 5GLBA 4NXEA 3F1NB 1K57C 3P09A 4IJGA 2J9OA 4U3TA 3IHAA 2W3EA 4LFUA 2A2LA 3G6OA 4HJ6A 4WUJA 4ARZB 3BFDA 4LV1A 3OPPA 3QP6A 2PU2A 3ZG0A 2KX6A 4KQOA 4MN7A 4K08A 2H0YA 4MMNA 4YWZA 1VEUA 3IF6A 4S2JA 3HUNA 4IUHA 2QJ5A 2P9VA 3W4PA 1SCWA 1N4OA 1O07A 2C5WB 3KYQA 2ZC5B 4Y13A 4DKIA 1CQAA 4ESPA 3CAXA 4UA9A 4E3LA 2I72A 4AFIA 1W79A 3O86A 3VP4A 2WYXA 3KX0X 4S2MA 1W5DA 4OP8A 2PYRA 1OTEA 4X6TA 4ZRRA 5FDSA 5EFWA 3B47A 4UA6A 2Y2IA 1KVMA 1CEFA 2Y2QA 2WK0A 5M18A 3IF6C 4FH4A 2OWJA 4U0XA 4R4RA 3F1NA 4KQRA 3OOVA 1F9IA 4DXCA 4FSFA 3IT9A 1CI8A 3C38A 4BLMA 4E3IA 4OOLA 2HP5A 1YPRA 3N8SA 3K3DA 4BBTA 1ONHA 5CXWA 4MBHA 1MBLA 3IWQA 1STZA 1JVJA 3G35A 3IX4A 2W3FA 3MMHA 1E4DA 3PTEA 1CI9A 1XFQA 1KE4A 4OONA 1UWNX 2Y2GA 2ZQCA 4I3IA 4Y7PA 3W4QA 1ZKJA 1FCMA 2Y2OA 3SH8A 2H28A 2WKHA 2Y79A 5FATA 1JWZA 3CPTB 4OLDA 2GDNA 3IX8A 5CHJA 2WGIA 3BM6A 5DF7A 2QMIA 1M6KA 2GZAA 4DE1A 5DTSA 2PBYA 5F68A 3NULA 3T12B 3C8CA 2VV6A 4WELA 2KDKA 3QP4A 1IKIA 1CK3A 1OPXA 2EXAA 3FKVA 4OPRA 5J4EA 5DFYA 4WF0A 1RP5A 1W63M 3MBZA 1FILA 2VV7A 1YMSA 1MXOA 1Q2PA 3VSKA 3LEQA 4KZ4A 1PW8A 3MS6A 3HBRA 1MKIA 3HLDA 5GHYA 1WA9A 5DJUA 1OTIA 1K38A 2CC1A 1XJ6A 3MKFA 1KDSA 1NXYA 4HH2A 2JC7A 5MC7A 5A93A 1IEMA 3PXPA 1TVFA 2M7VA 1DP9A 1L0FA 4U0TA 1S4RA 5F1GA 3MXQA 3VP3A 2BASA 1U60A 1KOUA 4II7A 5TGFA 3Q07A 3NECA 1I5QA 3HCYA 4GZBA 5DF8A 4S2KA 1W63Q 4HH3A 3VP0A 4XUXA 2PYPA 3C30A 5DKLA 3G2YA 4ZDXA 3Q1FA 2V2FF 5EOOA 4DE3A 5BOHA 4YNRA 4CLCA 3R4KA 3VSLA 2NUTC 1V9YA 3CZDA 4EEUA 1JWPA 1XGJA 2W3GA 1K6RA 2RL3A 1OT6A 1E25A 3UB6A 3CWFA 3LICA 1N9BA 4RX3A 2HDUA 4MEZA 5A92A 2Y55A 3IXDA 5HX9A 3DTIA 3VE4A 1IOUA 3SW1A 1O7EA 4KENB 4OOMA 3T4JA 4EUZA 4GOGA 4OPZA 1H8ZA 2QHKA 3E4OA 1K6SA 3WS5A 2DNSA 5EVLA 5EVIB 2ZMFA 2Z6DA 1GA9A 1NZOA 2X02A 3ZHHA 2HZ5A 3EEAA 2EXBA 4WBGA 4EXOA 2ZL1B 1P9RA 4F94A 3M2JA 4PHTA 1PNEA 1IYQA 5K5BA 5U47A 3QNCA 3ZG9B 3UB8A 4LLOB 4B88A 4PKYG 3QHYA 1LT0A 1YM1A 2XD1A 4D60A 1EROA 2C6WB 2PD8A 2Y2HA 4Q0HA 4M4XA 4WYYA 2FFYA 4QJGA 3NJAA 1PZPA 3TG9A 5J3WA 2A49A 4ETZA 1T18A 1XX2A 4I3JA 3MXRA 4BMWA 3JYIA 2V20A 4ZJ1A 1H8MA 4K0XA 4X69A 1TEMA 1FCOA 3LYXA 3TOIA 1BULA 1DJBA 5IS1A 1IFQA 4JGRA 1ES5A 4G3KA 4B93A 1C3BA 4X68A 1HLUP 3HREA 3LGOA 4MBKA 3W2ZA 3BLMA 2JN7A 3OZHA 2ZL1A 2ZQ8A 3FKWA 3MQQA 3CI6A 1XA1A 4PMAA 2KLIA 5L8MA 2LB9A 3PBNA 4E3NA 3EOIA 1N9LA 2JE5A 2Y2LA 3VMAA 2XEPA 4JKTA 1V9ZA 1P0ZA 1PZOA 5I5LA 4P6BA 5HWVA 5EVIC 1S6RA 5TBMA 4DJ3A 3UE3A 3IXBA 4QU3A 1OT9A 2EX6A 1RGZA 4FCFA 1ERMA 3NIAA 5HFOA 2JBFA 3ITBA 2XDMA 4DF6A 4CPKA 4X53A 1TDLA 4R0QA 1T19A 2L1MA 3NI9A 3OPHA 3DTEA 1K56A 4WZ5C 4B4XA 3P7NA 3IWOA 3P98A 3G31A 3NHQA 3VOZA 5E2HA 1IYSA 5FL3A 4LV3A 5F5YA 4GB7A 4CLCE 4WEKA 4IBXA 3UY6A 3TW8A 2Y59A 2Y4AA 3OCLA 1PWCA 2ZM8A 4X25A 3GDIA 3VP2A 4ETXA 3WRZA 1IELA 1KGFA 3C7VA 1UGUA 4RA7A 3CG5A 3PBQA 1BZAA 3UPPA 1ERQA 2HJEA 4NXFA 1ALQA 3N6IA 2O9CA 3UB9A 3C4OA 3MQ0A 2PR5A 4KQQA 2PD7A 3KYZA 2IWDA 3P01A 4I3AA 3OCNA 5FQ9A 3VOYA 1BYWA 3RXXA 3JVUA 3LIDA 2WKPA 1ES3A 5FAQA 3C7UA 4H6JB 3C2WA 3DWKA 4O01A 1OTDA 3G2ZA 5HZHA 1FIKA 1XJ4A 1W8YA 2WKQA 1E3UA 4XT2B 3OPLA 4NK3A 3MXSA 3K3CA 3HUMA 4WZ4A 4E6XA 4BQMA 1ODVA 4EBLA 1HD8A 1YLJA 2W0NA 4HJ3A 3D4FA 5IHVA 1PW1A 1ZG4A 3S7OA 1EI5A 1MZUA 3ZCZA 2JKGA 2E8IA 3HUOA 5AQAA 4LRYC 1K57A 2JCHA 4EERA 4MLLA 1JNUA 3O5YA 3GECA 2OV5A 4KZ7A 4ID4A 2XFSA 2NUPC 5G18A 3A3JA 3A0RA 3S7PA 2QZ6A 1SHVA 2XLNA 3UPOA 4KUOA 2QKPA 4OP5A 1GHPA 4DN0A 4OQ0A 2ZM0A 2WGVA 2V9AA 1CJFA 3LO7A 1LI9A 4K0WA 4R3AA 1SZVA 3E4PA 3WRTA 3S22A 5CGWA 3PAGA 2WADA 4QB8A 1ESUA 3Q82A 3B42A 2XQZA 5DF9A 5F83A 1MPLA 1PI4A 4NETA 1GSVA 1L0EA 1AXBA 3A0SA 3HLCA 3F1OB 1WYBA 3BFEA 3E2KA 2Q9MA 3UDXA 3PBOA 4Y15A 4PAUA 4NEED 4GJ4A 3GRJA 5KIZA 2R9WA 4BD1A 2D01A 3IXHA 3V3RA 2EFXA 2ZD8A 4I39A 3Q81A 3D72A 2B18A 5I94A 5FQJA 2VKSA 4OQGA 3S7QA 5CECA 1XA7A 1PRQA 4MN5A 3DAVA 2INWA 1H5XA 2WGWB 1JTGA 4DDSA 3N4IA 3N8LA 4MBFA 4EBPA 2J7VA 4Q0IA 2J9PA 1FOFA 3AGEA 3N7WA 5DTKA 1D7EA 2ZC4B 3MR0A 1GSWA 5D3OA 5FQIA 3LR5A 2HGVA 4QY6A 2J80A 3KSFA 5C5KA 4E3MA 5CRFA 3WWXA 1DY6A 2HDSA 3AGFA 3PAEA 2HPBA 5A8BA 5AQ7A 2G2UA 4L9EA 4DMZA 3ZNTA 3LI9A 4ARZA 1ZHHB 3LUQA 5M1AA 1BSGA 3UMDA 2O9BA 1JWVA 4HESA 3FWLA 4KZ6A 3F1OA 4QY5A 3LY4A 1YKDA 5A90A 2YKFA 1NJ4A 3DTMA 2O9AA 3DW0A 3BFFA 1OJ5A 5CX7A 3ZG5A 1DP6A 1BLSA 2GNXA 3GQZA 3QP1A 2WGWA 2ZQ7A 5EE8A 4JGPA 1XXMA 4ZJ3A 4Q8IA 4JXWA 1SKOB 2I9VA 3JPUA 2PU4A 5F82A 4IVKA 1BLHA 1TDGA 1YSQA 4JLFA 5GLAA 2Y2KA 4BENA 5HSQA 3QP2A 2ZOHA 3ZDJA 4S2PA 2FZ0A 3L9KA 1MC0A 4KQDA 2RCXA
chains in the Genus database with same CATH topology
1Z09A 1VETA 2ACGA 1K0KA 3MSHA 4D60A 1YPRA 2JKGA 3NECA 4FTXA 4X1MA 1Y4OA 2JKFA 3KYEA 3T1RA 2PBDP 2E8JA 1VETB 3CHWP 4X25A 5FEGA 2V8CA 2VK3A 3T1QB 3CPTA 3CPTB 1CJFA 3T1XA 1PFLA 1ACFA 1CF0A 2BTFP 1SZVA 1AWIA 3U4LP 1F2KA 4QWOA 1SKOA 2PRFA 1VEUA 1VEUB 3NULA 1HLUP 3LGOA 3T12B 5EM0A 5EM1A 3L7HA 4FUWA 2ZL1A 1CQAA 4ESPA 1FIKA 1FILA 4X1LA 1SKOB 1D1JA 5FDSA 5FEFA 1J3WA 3LEQA 3MS6A 1G5UA 2HZ5A 5EVEA 2B95A 3UB5P 3D9YA 2PAVP 2ZL1B 2V8FA 3T1SA 1A0KA 1PNEA 3L9KA 5EV0A 1PRQA 3DAVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Z09 A;  1VET A;  2ACG A;  1K0K A;  3MSH A;  4D60 A;  1YPR A;  2JKG A;  3NEC A;  4FTX A;  4X1M A;  1Y4O A;  2JKF A;  3KYE A;  3T1R A;  2PBD P;  2E8J A;  1VET B;  3CHW P;  4X25 A;  5FEG A;  2V8C A;  2VK3 A;  3T1Q B;  3CPT A;  3CPT B;  1CJF A;  3T1X A;  1PFL A;  1ACF A;  1CF0 A;  2BTF P;  1SZV A;  1AWI A;  3U4L P;  1F2K A;  4QWO A;  1SKO A;  2PRF A;  1VEU A;  1VEU B;  3NUL A;  1HLU P;  3LGO A;  3T12 B;  5EM0 A;  5EM1 A;  3L7H A;  4FUW A;  2ZL1 A;  1CQA A;  4ESP A;  1FIK A;  1FIL A;  4X1L A;  1SKO B;  1D1J A;  5FDS A;  5FEF A;  1J3W A;  3LEQ A;  3MS6 A;  1G5U A;  2HZ5 A;  5EVE A;  2B95 A;  3UB5 P;  3D9Y A;  2PAV P;  2ZL1 B;  2V8F A;  3T1S A;  1A0K A;  1PNE A;  3L9K A;  5EV0 A;  1PRQ A;  3DAV A; 
#chains in the Genus database with same CATH topology
 4OVD A;  5E2G A;  3ICY A;  3QP8 A;  3MSH A;  5FA7 A;  3V67 A;  5HAR A;  4E6W A;  5GHZ A;  4GDN A;  4DE2 A;  4P85 A;  5GLD A;  2WZX A;  3FPV A;  4S2I A;  2OWH A;  4BJP A;  2E8J A;  2GX5 A;  2PT7 A;  2HF6 A;  4UQI M;  2B5R A;  4DJ2 A;  3CPT A;  3GVB A;  1MWT A;  1F5M A;  5HAQ A;  3BJN A;  3E0Y A;  4WEJ A;  3M6H A;  5FSR A;  5AQ9 A;  1T1B A;  2EX9 A;  1SKO A;  2JKR M;  4EBN A;  3RTY A;  1OJG A;  1LI0 A;  4EET B;  1L0D A;  4BL2 A;  5EM0 A;  3HLB A;  4R3B A;  2D02 A;  2WZZ A;  4GN2 A;  1QMF A;  3UPN A;  3PHY A;  3LEZ A;  3LCE A;  5L2F A;  3A3I A;  3OPR A;  3V39 A;  5F1F A;  4GCZ A;  2R9X A;  4QPR A;  1LL9 A;  2V0U A;  5FEF A;  4OPQ A;  1OME A;  1S67 L;  2IA2 A;  1YLY A;  3SH9 A;  2PHY A;  1I2W A;  5KSH A;  2W3H A;  3D9Y A;  2V8F A;  3T1S A;  2XFT A;  4OH0 A;  3IBJ A;  4OQH A;  1FCN A;  5EV0 A;  3UE1 A;  4GS9 B;  3V3S A;  2M7U A;  4UQI S;  5HW3 A;  2L4R A;  2ACG A;  4EWF A;  2OAP 1;  5HPI A;  4IED A;  1NYM A;  2WUQ A;  1X0O A;  2V1Z A;  3EGX C;  3EQV A;  3UO9 A;  2AVX A;  3IWI A;  3C4P A;  4R38 A;  4RQ9 A;  4RX2 A;  4Y2F A;  1W8Q A;  3UN7 A;  2WAE A;  4GD8 A;  2HDQ A;  4EES A;  4S2L A;  4CLC D;  3KSI A;  4UA7 A;  3PBS A;  4Y0O A;  3RXW A;  4O0P A;  3F1P B;  3GSG A;  1CF0 A;  2BTF P;  1HTZ A;  2XGN A;  1KVL A;  2JKR I;  5HWT A;  4OOY A;  3T4S A;  2QJ7 A;  1PWD A;  3T4O A;  1I2S A;  5AQB A;  5HDD A;  1G28 A;  5FQK A;  4HP4 A;  3MFD A;  1EWZ A;  3HJI A;  2Y2N A;  3HLW A;  4GS9 A;  3O88 A;  5L09 A;  1BLC A;  4FOF A;  3B3X A;  1TS6 A;  2EX2 A;  5EVI A;  3T4T A;  2EA9 A;  3G32 A;  2LB5 A;  4JBF A;  3HLF A;  3G4P A;  2HDR A;  4HEF A;  4Z1W A;  2BLS A;  4XUZ A;  3H7W B;  3IH8 A;  2OLU A;  1NLY A;  3CJM A;  3UB5 P;  4IBR A;  2PAV P;  3ZVW A;  4HY8 A;  1TD5 A;  4EQI A;  4IUK A;  1G6A A;  2ZM2 A;  4MCW A;  2H5S A;  3T50 A;  5L07 A;  4WZ5 A;  4C3Q A;  1Z09 A;  1LL8 A;  4S2O A;  1Q2Q A;  4GNU A;  1ONG A;  3NOT C;  5FI6 A;  4PKY A;  1XJ2 A;  4Q0J A;  5HDS A;  3DWZ A;  4KZA A;  1HZO A;  4X55 A;  2B02 A;  3ZQ5 A;  5F6A A;  3SH7 A;  4WM9 A;  1LSX A;  5DFX A;  3T4K A;  1NRF A;  4N92 A;  4GKU A;  5DKK A;  1VET B;  5M19 A;  2Y2M A;  2V8C A;  4KZ8 A;  2IWB A;  3BYD A;  3ZVT A;  3NDE A;  3NOP C;  2ZQD A;  3CLO A;  1AWI A;  1ESI A;  5HD5 A;  3UME A;  1KDW A;  2W1R A;  4Y5F A;  3HVF A;  2PRF A;  3A3F A;  4JF5 A;  4P6Z M;  2EWV A;  3TRC A;  4CQH A;  3QP5 A;  3TE8 A;  4CJN A;  2ZOI A;  1TS0 A;  2MJ6 A;  2J3T D;  4L0L A;  4BWI A;  2K31 A;  5KZH A;  1GHM A;  4WN5 A;  1XP4 A;  3GV9 A;  2V1A A;  4KZ3 A;  1D1J A;  2J8Y A;  1J3W A;  5HL1 A;  5E2F A;  2G2W A;  1XJ3 A;  2XD5 A;  4HNB A;  2Z6C A;  1D06 A;  4WL9 A;  5CED A;  5EVE A;  2VX8 A;  3BY8 A;  4S2N A;  2Q9N A;  1NRJ A;  2CMN A;  1BLP A;  3HJK A;  2VLG A;  4BBV A;  2HV1 A;  5EUA A;  3MFX A;  1VET A;  2QPN A;  1P97 A;  5JYO A;  3B33 A;  1LHY A;  5AJG A;  3OBF A;  1K56 D;  4WMC A;  1FR6 A;  1Y4O A;  2O0Y A;  1L3L A;  2JKF A;  2ZBB A;  4F3L B;  3HL9 A;  4N1H A;  1IYO A;  1PIO A;  3MJQ A;  2XRO A;  2Y8H A;  4P6Z S;  3ZNY A;  4S2N C;  2P04 A;  1T1C A;  3BQ8 A;  4EUV A;  4C6Y A;  2VK3 A;  1FSW A;  1L2S A;  3RFB A;  2R78 A;  1MWS A;  4N1X A;  4YFM A;  4Y0U A;  4B9O A;  1F2K A;  3ISG A;  2XR0 A;  1HVB A;  2XA7 S;  3GR2 A;  3FC7 A;  2VZW A;  3NOU C;  1VEU B;  3NBL A;  5EM1 A;  5IT5 A;  3IQA A;  3UDI A;  1K25 A;  5J7E A;  4H6J A;  2ZQA A;  1NLZ A;  3UE0 A;  3GMW A;  3G34 A;  4R70 A;  2X01 A;  4JXV A;  3EGD C;  2V0W A;  2ZQ9 A;  4XT2 A;  2VGJ A;  1E3U D;  2M1C A;  5L10 A;  4B4Z A;  4KZB A;  5J8X A;  4L9F A;  2OLV A;  4EW7 A;  4XXR A;  3MF0 A;  3PBT A;  5CEB A;  1G68 A;  4NXG A;  1A0K A;  4OLG A;  1TS8 A;  4G3W A;  4EQ1 A;  4DDY A;  4E3O A;  3UNW A;  1K0K A;  3SS3 A;  1TS7 A;  3NC8 A;  3BQA A;  1GA0 A;  1WE4 A;  5G4Y A;  4BBU A;  2EFU A;  3CUE C;  5LBR A;  3BW6 A;  3FPW A;  5G4Z A;  2W27 A;  5DJT A;  1PYY A;  2EX8 A;  3AGD A;  3Q7Z A;  4I5S A;  1YAX A;  3MZE A;  4GLQ A;  4MN6 A;  4UHU A;  1RCJ A;  2VGL S;  4FD8 A;  3T4L A;  4EV4 A;  1K54 A;  3R7W B;  4PM5 A;  1P9W A;  1LLB A;  2O99 A;  4IHQ A;  1FSY A;  2HJ9 C;  2V1B A;  3HLG A;  1YT4 A;  1PFL A;  3A3D A;  1YLT A;  4E04 A;  5E43 A;  4ME4 A;  2DCF A;  4KUK A;  1MWR A;  4QWO A;  4HQA A;  3ZGA B;  3E4Q A;  3WS0 A;  4KZ9 A;  3RH8 B;  1DJA A;  1MWU A;  5EPH A;  3CIT A;  4YIN A;  4H8R A;  2VJW A;  1K54 C;  1XKZ A;  3WS1 A;  3BLS A;  2FH5 A;  2DMW A;  2ZLY A;  1S66 L;  5TFQ A;  2W3D A;  3NY4 A;  3KO6 A;  5EEC A;  4C75 A;  3LI8 A;  3EWK A;  4OKP A;  3UDF A;  5TR7 A;  2XSS A;  5KSC A;  3T4Q A;  3S4X A;  2OAQ 1;  5DVA A;  4DXB A;  4LEN A;  2WKR A;  4UEY A;  3LY3 A;  1NYY A;  2Z2L B;  4PPR A;  4KZ5 A;  1MKM A;  2QYB A;  2FFF B;  3R7W A;  3ITA A;  2IWC A;  4X56 A;  3ULF A;  4RYE A;  4I38 A;  4JF6 A;  3PR6 A;  4WLA A;  1K55 A;  4GD6 A;  5TJJ A;  4ZJ2 A;  4DRT A;  1JTD A;  1QME A;  1H8Y A;  4Y17 A;  1N9N A;  4HBU A;  1XPB A;  1WYC A;  4NKP A;  2VEA A;  3IF5 A;  5FEG A;  2OSU A;  1EW0 A;  4P87 A;  4CLC B;  3T1Q B;  3A3E A;  1W7F A;  4A5R A;  4EEP A;  2W1T B;  3IS2 B;  1VB6 A;  5A91 A;  3KSG A;  3C5A A;  2JHE A;  4PM6 A;  1K55 C;  5FDH A;  3LR4 A;  5FQM A;  2DRW A;  3VV4 A;  4GDB A;  5CGX A;  3I7J A;  4MDZ A;  4NXB A;  4QD4 A;  2ZC7 A;  4QHC A;  5CTM A;  1ES4 A;  5CHM A;  5GLC A;  5HWW A;  2HP9 A;  3H82 B;  2UWX A;  4HHD A;  4YOF A;  3G30 A;  1SDN A;  2K2N A;  4JGQ A;  1M40 A;  2B95 A;  4LPZ A;  2K7S A;  4IVI A;  3PBR A;  1NZU A;  5CTN A;  4R4S A;  1LSW A;  3LR3 A;  3MZD A;  1PI5 A;  1K4E A;  3OC2 A;  3S7N A;  1ZC2 A;  1FR1 A;  3SZT A;  5AVF A;  4LRZ E;  3ZYT A;  1K4F A;  3IX3 A;  4BL3 A;  3LIB A;  3S1Y A;  2JKT M;  4R23 A;  2P08 A;  4X1M A;  1G6O A;  2W1T A;  5AVE A;  1F98 A;  1NY0 A;  3IS2 A;  5GHX A;  4N9L A;  3BFC A;  5FAS A;  3KYE A;  2L0W A;  2ZC3 B;  2P74 A;  1T1A A;  4FH2 A;  4HOI A;  2Y2P A;  5CGS A;  4Y0T A;  1YLZ A;  1YMX A;  1Y54 A;  4JPM A;  4GW9 A;  1SDE A;  4RVA A;  3T1X A;  5CER A;  1FQG A;  4LV0 A;  1RGY A;  1S1Z A;  1ZG6 A;  4NG2 A;  5GL9 A;  1OTA A;  4HBT A;  4CLC C;  3H82 A;  1ZTU A;  2H0T A;  4D2O A;  4Z9Q A;  1KE3 A;  4R3J A;  3DTK A;  3N8R A;  5JYP A;  1NWZ A;  3GTC A;  4O8G A;  3L7H A;  4G3V A;  5FAP A;  1GHI A;  4UAA A;  2ZC6 B;  5HD3 A;  1J9M A;  4X1L A;  1YLW A;  3E2L A;  2Q0O A;  5F69 A;  2PR6 A;  3VP1 A;  2WKI A;  1KGE A;  2WAF A;  3FG8 A;  4N9K A;  3WS2 A;  2VV8 A;  2OOL A;  4KG2 A;  3BWL A;  5TBM B;  3BRM A;  5HAI A;  2Y91 A;  4HP9 A;  5FI2 A;  3O3V A;  5HAP A;  3SS5 A;  4ZBE A;  4HI4 A;  3SS4 A;  5HPF A;  3HLE A;  4P0M A;  3ZG7 B;  2JKT I;  4LCL A;  3KSH A;  1YSP A;  2VA0 A;  3Q7V B;  5E2E A;  3BFG A;  3FZC A;  3T1R A;  3D3O A;  3ZFZ A;  1GSX A;  4GHI B;  4OQI A;  3PYP A;  3IHB A;  3LIA A;  3NCK A;  5FAO A;  3K2N A;  2KOI A;  1OTB A;  3QNB A;  3F1P A;  4OPY A;  3A0V A;  2HP6 A;  1KGG A;  3U4L P;  4R1G A;  4MNR A;  1Z6F A;  3JVV A;  4ZAM A;  3LIF A;  1BT5 A;  5IU1 A;  4E3K A;  3V5M A;  4DE0 A;  4Y3I A;  3OLO A;  1DP8 A;  3O87 A;  1YLP A;  3ZG8 B;  2P7J A;  4R6L A;  1SKF A;  1IYP A;  2XH9 A;  2XK1 A;  4ZTK A;  3IBR A;  3W8K A;  4BD0 A;  4KG6 A;  4JF4 A;  2YKH A;  2J3T C;  5EVI D;  3IH9 A;  3LIE A;  3EEH A;  3H7W A;  1G5U A;  1LSV A;  2EWW A;  3BY9 A;  1S0W A;  2UV0 E;  3LFV A;  4M3K A;  3Q7V A;  4PM8 A;  1S4S A;  3H9W A;  4E3J A;  4GHI A;  2WKE A;  3MKE A;  2ZMA A;  4PM7 A;  5CHU A;  1GCE A;  1XFN A;  2X71 A;  3VOL A;  4HIA A;  3VFF A;  3EQU A;  2XA7 M;  1H3Q A;  3RJU A;  3UB7 A;  2PDR A;  3FV7 A;  4FTX A;  4PM9 A;  1PWG A;  5DTT A;  3V50 A;  3CHW P;  1XGI A;  5HDC A;  3TJZ C;  3VFH A;  3VE3 A;  1N9O A;  4JXS A;  3DBA A;  1ACF A;  2XF3 A;  1YQS A;  4O7D A;  2A24 B;  4LGW A;  1VM1 A;  5FI7 A;  3CMZ A;  1H0M A;  2H10 A;  3M6B A;  5EOE A;  3UE6 A;  1DRM A;  4EU0 A;  2ZMV A;  4FUW A;  2VGK A;  5KMW A;  3MZF A;  1IKG A;  2ZJ9 A;  5HL6 A;  3FYZ A;  2G7U A;  2QWS A;  1VHM A;  1ES2 A;  1TF1 A;  4JGO A;  2Y2J A;  2VGL M;  3IF6 B;  2P9V B;  3E98 A;  3M2K A;  4L9G A;  1UWP X;  2GJ3 A;  1S1Y A;  2J3W A;  3CUE A;  3TSG A;  4K91 A;  1DJC A;  3WS4 A;  1MY8 A;  1VQQ A;  4HJ4 A;  3NDG A;  3W4O A;  4LRX C;  3IXG A;  1KE0 A;  1CEG A;  1LL5 A;  2BG1 A;  2Z2M B;  4LCM A;  4LV2 A;  2XRN A;  3SOI A;  3MQO A;  1BUE A;  1L0G A;  4KG5 A;  3BEB A;  1Y28 A;  4WMC D;  1BTL A;  5FQQ A;  4F3L A;  2A24 A;  3LR0 A;  3U2A A;  3BEC A;  2A3U A;  2PBD P;  4JXG A;  5GLB A;  4NXE A;  3F1N B;  1K57 C;  3P09 A;  4IJG A;  2J9O A;  4U3T A;  3IHA A;  2W3E A;  4LFU A;  2A2L A;  3G6O A;  4HJ6 A;  4WUJ A;  4ARZ B;  3BFD A;  4LV1 A;  3OPP A;  3QP6 A;  2PU2 A;  3ZG0 A;  2KX6 A;  4KQO A;  4MN7 A;  4K08 A;  2H0Y A;  4MMN A;  4YWZ A;  1VEU A;  3IF6 A;  4S2J A;  3HUN A;  4IUH A;  2QJ5 A;  2P9V A;  3W4P A;  1SCW A;  1N4O A;  1O07 A;  2C5W B;  3KYQ A;  2ZC5 B;  4Y13 A;  4DKI A;  1CQA A;  4ESP A;  3CAX A;  4UA9 A;  4E3L A;  2I72 A;  4AFI A;  1W79 A;  3O86 A;  3VP4 A;  2WYX A;  3KX0 X;  4S2M A;  1W5D A;  4OP8 A;  2PYR A;  1OTE A;  4X6T A;  4ZRR A;  5FDS A;  5EFW A;  3B47 A;  4UA6 A;  2Y2I A;  1KVM A;  1CEF A;  2Y2Q A;  2WK0 A;  5M18 A;  3IF6 C;  4FH4 A;  2OWJ A;  4U0X A;  4R4R A;  3F1N A;  4KQR A;  3OOV A;  1F9I A;  4DXC A;  4FSF A;  3IT9 A;  1CI8 A;  3C38 A;  4BLM A;  4E3I A;  4OOL A;  2HP5 A;  1YPR A;  3N8S A;  3K3D A;  4BBT A;  1ONH A;  5CXW A;  4MBH A;  1MBL A;  3IWQ A;  1STZ A;  1JVJ A;  3G35 A;  3IX4 A;  2W3F A;  3MMH A;  1E4D A;  3PTE A;  1CI9 A;  1XFQ A;  1KE4 A;  4OON A;  1UWN X;  2Y2G A;  2ZQC A;  4I3I A;  4Y7P A;  3W4Q A;  1ZKJ A;  1FCM A;  2Y2O A;  3SH8 A;  2H28 A;  2WKH A;  2Y79 A;  5FAT A;  1JWZ A;  3CPT B;  4OLD A;  2GDN A;  3IX8 A;  5CHJ A;  2WGI A;  3BM6 A;  5DF7 A;  2QMI A;  1M6K A;  2GZA A;  4DE1 A;  5DTS A;  2PBY A;  5F68 A;  3NUL A;  3T12 B;  3C8C A;  2VV6 A;  4WEL A;  2KDK A;  3QP4 A;  1IKI A;  1CK3 A;  1OPX A;  2EXA A;  3FKV A;  4OPR A;  5J4E A;  5DFY A;  4WF0 A;  1RP5 A;  1W63 M;  3MBZ A;  1FIL A;  2VV7 A;  1YMS A;  1MXO A;  1Q2P A;  3VSK A;  3LEQ A;  4KZ4 A;  1PW8 A;  3MS6 A;  3HBR A;  1MKI A;  3HLD A;  5GHY A;  1WA9 A;  5DJU A;  1OTI A;  1K38 A;  2CC1 A;  1XJ6 A;  3MKF A;  1KDS A;  1NXY A;  4HH2 A;  2JC7 A;  5MC7 A;  5A93 A;  1IEM A;  3PXP A;  1TVF A;  2M7V A;  1DP9 A;  1L0F A;  4U0T A;  1S4R A;  5F1G A;  3MXQ A;  3VP3 A;  2BAS A;  1U60 A;  1KOU A;  4II7 A;  5TGF A;  3Q07 A;  3NEC A;  1I5Q A;  3HCY A;  4GZB A;  5DF8 A;  4S2K A;  1W63 Q;  4HH3 A;  3VP0 A;  4XUX A;  2PYP A;  3C30 A;  5DKL A;  3G2Y A;  4ZDX A;  3Q1F A;  2V2F F;  5EOO A;  4DE3 A;  5BOH A;  4YNR A;  4CLC A;  3R4K A;  3VSL A;  2NUT C;  1V9Y A;  3CZD A;  4EEU A;  1JWP A;  1XGJ A;  2W3G A;  1K6R A;  2RL3 A;  1OT6 A;  1E25 A;  3UB6 A;  3CWF A;  3LIC A;  1N9B A;  4RX3 A;  2HDU A;  4MEZ A;  5A92 A;  2Y55 A;  3IXD A;  5HX9 A;  3DTI A;  3VE4 A;  1IOU A;  3SW1 A;  1O7E A;  4KEN B;  4OOM A;  3T4J A;  4EUZ A;  4GOG A;  4OPZ A;  1H8Z A;  2QHK A;  3E4O A;  1K6S A;  3WS5 A;  2DNS A;  5EVL A;  5EVI B;  2ZMF A;  2Z6D A;  1GA9 A;  1NZO A;  2X02 A;  3ZHH A;  2HZ5 A;  3EEA A;  2EXB A;  4WBG A;  4EXO A;  2ZL1 B;  1P9R A;  4F94 A;  3M2J A;  4PHT A;  1PNE A;  1IYQ A;  5K5B A;  5U47 A;  3QNC A;  3ZG9 B;  3UB8 A;  4LLO B;  4B88 A;  4PKY G;  3QHY A;  1LT0 A;  1YM1 A;  2XD1 A;  4D60 A;  1ERO A;  2C6W B;  2PD8 A;  2Y2H A;  4Q0H A;  4M4X A;  4WYY A;  2FFY A;  4QJG A;  3NJA A;  1PZP A;  3TG9 A;  5J3W A;  2A49 A;  4ETZ A;  1T18 A;  1XX2 A;  4I3J A;  3MXR A;  4BMW A;  3JYI A;  2V20 A;  4ZJ1 A;  1H8M A;  4K0X A;  4X69 A;  1TEM A;  1FCO A;  3LYX A;  3TOI A;  1BUL A;  1DJB A;  5IS1 A;  1IFQ A;  4JGR A;  1ES5 A;  4G3K A;  4B93 A;  1C3B A;  4X68 A;  1HLU P;  3HRE A;  3LGO A;  4MBK A;  3W2Z A;  3BLM A;  2JN7 A;  3OZH A;  2ZL1 A;  2ZQ8 A;  3FKW A;  3MQQ A;  3CI6 A;  1XA1 A;  4PMA A;  2KLI A;  5L8M A;  2LB9 A;  3PBN A;  4E3N A;  3EOI A;  1N9L A;  2JE5 A;  2Y2L A;  3VMA A;  2XEP A;  4JKT A;  1V9Z A;  1P0Z A;  1PZO A;  5I5L A;  4P6B A;  5HWV A;  5EVI C;  1S6R A;  5TBM A;  4DJ3 A;  3UE3 A;  3IXB A;  4QU3 A;  1OT9 A;  2EX6 A;  1RGZ A;  4FCF A;  1ERM A;  3NIA A;  5HFO A;  2JBF A;  3ITB A;  2XDM A;  4DF6 A;  4CPK A;  4X53 A;  1TDL A;  4R0Q A;  1T19 A;  2L1M A;  3NI9 A;  3OPH A;  3DTE A;  1K56 A;  4WZ5 C;  4B4X A;  3P7N A;  3IWO A;  3P98 A;  3G31 A;  3NHQ A;  3VOZ A;  5E2H A;  1IYS A;  5FL3 A;  4LV3 A;  5F5Y A;  4GB7 A;  4CLC E;  4WEK A;  4IBX A;  3UY6 A;  3TW8 A;  2Y59 A;  2Y4A A;  3OCL A;  1PWC A;  2ZM8 A;  4X25 A;  3GDI A;  3VP2 A;  4ETX A;  3WRZ A;  1IEL A;  1KGF A;  3C7V A;  1UGU A;  4RA7 A;  3CG5 A;  3PBQ A;  1BZA A;  3UPP A;  1ERQ A;  2HJE A;  4NXF A;  1ALQ A;  3N6I A;  2O9C A;  3UB9 A;  3C4O A;  3MQ0 A;  2PR5 A;  4KQQ A;  2PD7 A;  3KYZ A;  2IWD A;  3P01 A;  4I3A A;  3OCN A;  5FQ9 A;  3VOY A;  1BYW A;  3RXX A;  3JVU A;  3LID A;  2WKP A;  1ES3 A;  5FAQ A;  3C7U A;  4H6J B;  3C2W A;  3DWK A;  4O01 A;  1OTD A;  3G2Z A;  5HZH A;  1FIK A;  1XJ4 A;  1W8Y A;  2WKQ A;  1E3U A;  4XT2 B;  3OPL A;  4NK3 A;  3MXS A;  3K3C A;  3HUM A;  4WZ4 A;  4E6X A;  4BQM A;  1ODV A;  4EBL A;  1HD8 A;  1YLJ A;  2W0N A;  4HJ3 A;  3D4F A;  5IHV A;  1PW1 A;  1ZG4 A;  3S7O A;  1EI5 A;  1MZU A;  3ZCZ A;  2JKG A;  2E8I A;  3HUO A;  5AQA A;  4LRY C;  1K57 A;  2JCH A;  4EER A;  4MLL A;  1JNU A;  3O5Y A;  3GEC A;  2OV5 A;  4KZ7 A;  4ID4 A;  2XFS A;  2NUP C;  5G18 A;  3A3J A;  3A0R A;  3S7P A;  2QZ6 A;  1SHV A;  2XLN A;  3UPO A;  4KUO A;  2QKP A;  4OP5 A;  1GHP A;  4DN0 A;  4OQ0 A;  2ZM0 A;  2WGV A;  2V9A A;  1CJF A;  3LO7 A;  1LI9 A;  4K0W A;  4R3A A;  1SZV A;  3E4P A;  3WRT A;  3S22 A;  5CGW A;  3PAG A;  2WAD A;  4QB8 A;  1ESU A;  3Q82 A;  3B42 A;  2XQZ A;  5DF9 A;  5F83 A;  1MPL A;  1PI4 A;  4NET A;  1GSV A;  1L0E A;  1AXB A;  3A0S A;  3HLC A;  3F1O B;  1WYB A;  3BFE A;  3E2K A;  2Q9M A;  3UDX A;  3PBO A;  4Y15 A;  4PAU A;  4NEE D;  4GJ4 A;  3GRJ A;  5KIZ A;  2R9W A;  4BD1 A;  2D01 A;  3IXH A;  3V3R A;  2EFX A;  2ZD8 A;  4I39 A;  3Q81 A;  3D72 A;  2B18 A;  5I94 A;  5FQJ A;  2VKS A;  4OQG A;  3S7Q A;  5CEC A;  1XA7 A;  1PRQ A;  4MN5 A;  3DAV A;  2INW A;  1H5X A;  2WGW B;  1JTG A;  4DDS A;  3N4I A;  3N8L A;  4MBF A;  4EBP A;  2J7V A;  4Q0I A;  2J9P A;  1FOF A;  3AGE A;  3N7W A;  5DTK A;  1D7E A;  2ZC4 B;  3MR0 A;  1GSW A;  5D3O A;  5FQI A;  3LR5 A;  2HGV A;  4QY6 A;  2J80 A;  3KSF A;  5C5K A;  4E3M A;  5CRF A;  3WWX A;  1DY6 A;  2HDS A;  3AGF A;  3PAE A;  2HPB A;  5A8B A;  5AQ7 A;  2G2U A;  4L9E A;  4DMZ A;  3ZNT A;  3LI9 A;  4ARZ A;  1ZHH B;  3LUQ A;  5M1A A;  1BSG A;  3UMD A;  2O9B A;  1JWV A;  4HES A;  3FWL A;  4KZ6 A;  3F1O A;  4QY5 A;  3LY4 A;  1YKD A;  5A90 A;  2YKF A;  1NJ4 A;  3DTM A;  2O9A A;  3DW0 A;  3BFF A;  1OJ5 A;  5CX7 A;  3ZG5 A;  1DP6 A;  1BLS A;  2GNX A;  3GQZ A;  3QP1 A;  2WGW A;  2ZQ7 A;  5EE8 A;  4JGP A;  1XXM A;  4ZJ3 A;  4Q8I A;  4JXW A;  1SKO B;  2I9V A;  3JPU A;  2PU4 A;  5F82 A;  4IVK A;  1BLH A;  1TDG A;  1YSQ A;  4JLF A;  5GLA A;  2Y2K A;  4BEN A;  5HSQ A;  3QP2 A;  2ZOH A;  3ZDJ A;  4S2P A;  2FZ0 A;  3L9K A;  1MC0 A;  4KQD A;  2RCX A; 
#chains in the Genus database with same CATH homology
 1Z09 A;  1VET A;  2ACG A;  1K0K A;  3MSH A;  4D60 A;  1YPR A;  2JKG A;  3NEC A;  4FTX A;  4X1M A;  1Y4O A;  2JKF A;  3KYE A;  3T1R A;  2PBD P;  2E8J A;  1VET B;  3CHW P;  4X25 A;  5FEG A;  2V8C A;  2VK3 A;  3T1Q B;  3CPT A;  3CPT B;  1CJF A;  3T1X A;  1PFL A;  1ACF A;  1CF0 A;  2BTF P;  1SZV A;  1AWI A;  3U4L P;  1F2K A;  4QWO A;  1SKO A;  2PRF A;  1VEU A;  1VEU B;  3NUL A;  1HLU P;  3LGO A;  3T12 B;  5EM0 A;  5EM1 A;  3L7H A;  4FUW A;  2ZL1 A;  1CQA A;  4ESP A;  1FIK A;  1FIL A;  4X1L A;  1SKO B;  1D1J A;  5FDS A;  5FEF A;  1J3W A;  3LEQ A;  3MS6 A;  1G5U A;  2HZ5 A;  5EVE A;  2B95 A;  3UB5 P;  3D9Y A;  2PAV P;  2ZL1 B;  2V8F A;  3T1S A;  1A0K A;  1PNE A;  3L9K A;  5EV0 A;  1PRQ A;  3DAV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...