1PRQA

Acanthamoeba castellanii profilin ia
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
125
structure length
125
Chain Sequence
b'SWQTYVDTNLVGTGAVTQAAILGLDGNTWATSAGFAVTPAQGQTLASAFNNADPIRASGFDLAGVHYVTLRADDRSIYGKKGSAGVITVKTSKSILVGVYNEKIQPGTAANVVEKLADYLIGQGF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROFILIN IA
publication title Crystal packing induces a conformational change in profilin-I from Acanthamoeba castellanii.
pubmed doi rcsb
source organism Acanthamoeba castellanii
molecule tags Contractile protein
total genus 34
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 1997-08-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.30 Alpha Beta 2-Layer Sandwich Beta-Lactamase Dynein light chain 2a, cytoplasmic 1prqA00
4QWOA 5FDSA 1PNEA 3T1XA 3D9YA 1SKOA 1AWIA 1VEUA 3CPTA 2PBDP 5FEGA 1PRQA 2ZL1B 3L7HA 1HLUP 3MSHA 3NECA 3T1RA 1CJFA 3LEQA 3U4LP 2V8CA 2ACGA 2E8JA 3LGOA 1CQAA 1D1JA 2PRFA 3KYEA 2HZ5A 3UB5P 1PFLA 4FTXA 1FIKA 3T1QB 1F2KA 2JKFA 5FEFA 1SZVA 2B95A 1J3WA 5EM0A 1VETB 1YPRA 3NULA 4FUWA 2ZL1A 5EV0A 1K0KA 4X25A 1SKOB 3DAVA 4X1MA 1VEUB 1ACFA 2BTFP 2VK3A 4D60A 1CF0A 2PAVP 5EM1A 2V8FA 5EVEA 1Z09A 2JKGA 3MS6A 3L9KA 3T1SA 1Y4OA 1FILA 1A0KA 4ESPA 3CHWP 3CPTB 4X1LA 1VETA 1G5UA 3T12B
chains in the Genus database with same CATH superfamily
1N4OA 3RH8B 1K25A 4CQHA 3UDFA 3E4OA 4KUKA 4MBHA 3PYPA 4OQIA 4ARZB 4GOGA 3W4QA 5HPFA 1XX2A 2R9XA 3H82B 1V9YA 1NYMA 1ERQA 1L2SA 2WZXA 2B02A 2Y2JA 4OQGA 3BFFA 3HJKA 2XA7S 3LGOA 3OC2A 3PXPA 1KDWA 1LSVA 2EA9A 3BLSA 4GZBA 1BZAA 3HLFA 3GRJA 5E2HA 3T1QB 3MZEA 3SW1A 2FZ0A 1UGUA 3NC8A 3VP3A 1QMEA 4JXSA 2JCHA 1KE3A 1NLYA 3ITBA 1ES5A 1MBLA 2W3HA 2DRWA 3RTYA 4E3LA 1RGYA 4B9OA 4QPRA 2VK3A 5C5KA 3IF5A 1K54C 2X01A 2ZC4B 3R7WA 3ITAA 1NZUA 2G2WA 1YSPA 3VOZA 3PBRA 1N9LA 3ZHHA 3E2KA 3P98A 3O5YA 5KIZA 3VP0A 1C3BA 4GB7A 2D01A 1YT4A 2Y2KA 1XA7A 3DTEA 2ZQDA 4GJ4A 3UB7A 4RYEA 4RA7A 5L07A 2OV5A 1Q2PA 4S2MA 2D02A 3Q7ZA 4WYYA 4GHIB 4QWOA 4OPRA 4QU3A 4Y13A 2VGJA 1D06A 3GVBA 3UPPA 3L7HA 2A24B 4HHDA 1K38A 1XFQA 1NJ4A 2ZJ9A 3EGXC 4K0XA 3LEQA 3A0RA 5CX7A 3VE3A 2PR5A 3DTMA 3FYZA 3G2ZA 1JTDA 2VKSA 4OP8A 4I38A 3LR4A 3HLCA 2GDNA 3CUEC 4NXBA 2R78A 2ZQ8A 3NBLA 1OJGA 3OZHA 4RX2A 3DTKA 3VFHA 4E3IA 1NRFA 5FI6A 2XRNA 3P09A 2EX9A 4JBFA 3C7VA 4L0LA 5FQJA 2B95A 2VJWA 2C6WB 2HJEA 3QP2A 2O9BA 4DMZA 1L0FA 3T4OA 3MXSA 3NULA 3QP4A 2XD5A 2O99A 2PBYA 3LCEA 4X25A 4S2NC 3M2JA 1CEGA 4EETB 4EW7A 3MKEA 3LIAA 1H8YA 4R4RA 2I9VA 1XPBA 1N9NA 3ZNTA 2P9VB 3VP2A 4DDSA 3N6IA 3IS2A 5CHJA 2Y2LA 3WS4A 3BQ8A 5KMWA 1Q2QA 3OCNA 3IHBA 1FILA 2H0TA 3LI8A 1TEMA 1M40A 1DJAA 3CPTB 3F1OB 4UHUA 3AGEA 4BWIA 4KG5A 4NXGA 5F82A 3OPPA 1JVJA 2H28A 1K54A 3C7UA 2HDRA 4X69A 1IYSA 3CPTA 5DTTA 1HTZA 3E4PA 3C8CA 4UQIM 1FCMA 2VV6A 1TS7A 2KX6A 4E6WA 4HEFA 4R23A 5E2EA 3UDXA 4MMNA 4DN0A 2ZM0A 2W0NA 1U60A 3IHAA 1AXBA 3QP8A 4ETZA 3PBTA 4R6LA 3MZDA 3ZFZA 2KDKA 2PRFA 1BLPA 2Z2MB 3NDEA 5HPIA 1PFLA 2QZ6A 3HUNA 4HBUA 1H8ZA 5F83A 5G4ZA 4WZ5C 1XKZA 4CLCC 4C75A 3IF6B 1VETB 4LRYC 2BASA 1SKFA 3ZCZA 4LV1A 1MY8A 1KDSA 1SCWA 3LR0A 4NG2A 3G35A 2IWCA 4F3LB 3CUEA 2OWHA 5EM1A 1PIOA 2OAP1 1HZOA 1XJ6A 1DP6A 2IWDA 5HSQA 2V9AA 1E3UA 5DKLA 2GNXA 4ESPA 3O87A 4I3AA 3BY8A 4Z1WA 3ZG5A 2PU4A 1MWRA 2Q0OA 2XGNA 5HZHA 2VLGA 3BW6A 3LIFA 4WEJA 4B4XA 3UDIA 5F69A 2HP6A 1UWNX 5U47A 3F1NB 2RCXA 3GECA 4X68A 3FPWA 1UWPX 3T50A 5I5LA 2JE5A 4UA6A 1XP4A 3LY3A 4WMCD 4L9EA 5L2FA 1XGIA 3IXGA 1CJFA 2X02A 1P9RA 2A2LA 2Z6CA 4ZAMA 3F1NA 3U4LP 4BBVA 2Y91A 5J3WA 2UWXA 1IEMA 4QB8A 3N8LA 2H5SA 3S7PA 2O0YA 5M18A 1FSWA 1LL8A 4KZ5A 3KYEA 3N8SA 2CMNA 4KUOA 3CMZA 1OTAA 3OCLA 1GCEA 1YLZA 4FTXA 4WL9A 5HW3A 2QJ5A 4CJNA 5CGWA 4BLMA 3SH8A 4DDYA 1ZC2A 2QMIA 5DJUA 3MF0A 1P0ZA 3FZCA 4X6TA 4KZ9A 4X1MA 3NOUC 4WEKA 4D60A 3A0SA 3R4KA 2PD7A 4RQ9A 3LUQA 5HWVA 1PWCA 3HVFA 2HJ9C 4KQDA 4FH2A 4Y0UA 1Y54A 1OT9A 4HOIA 4WZ5A 4HJ4A 4CLCA 5BOHA 2PHYA 2B5RA 2HDUA 2W1RA 1TD5A 1E4DA 5GLCA 4LRXC 3PAEA 4H6JA 3BFEA 1SHVA 5DF7A 4JGOA 1K6SA 3DWKA 5GHZA 5FAOA 2Y55A 5FDSA 4G3KA 3LIBA 2XK1A 2FFYA 1E25A 2ZBBA 2VEAA 1GSXA 3KSFA 4JXWA 5EVLA 5FEGA 1FCNA 3K3CA 5FQQA 1BLCA 4ZJ1A 1KE4A 4L9GA 5HD5A 1PYYA 4DKIA 4IEDA 4HIAA 1PWGA 4B4ZA 5TGFA 2FH5A 3B42A 4R38A 4ETXA 1X0OA 2G7UA 5F6AA 4KENB 3IX8A 5DTKA 4DJ3A 5E43A 1YLTA 4OOYA 3V3SA 4XUXA 1CQAA 1F5MA 2M7VA 3S7OA 2J3WA 1BT5A 1S4SA 4HBTA 3S1YA 5EOOA 1VB6A 3NOTC 5HWTA 3FV7A 4GW9A 2PYPA 2XR0A 1WE4A 1YKDA 1D7EA 5FEFA 3UE1A 5JYPA 4O01A 2HP5A 4PM7A 1ESIA 5EVIA 4N9KA 3C4OA 2R9WA 1EROA 3JYIA 3UB8A 1S67L 3VFFA 1ONGA 1GHIA 2I72A 4GCZA 5AVEA 3PHYA 4KQQA 3TSGA 1VEUB 2AVXA 5GLAA 5CTNA 2Y8HA 5DF8A 4XT2B 1KGEA 5HAIA 1K4EA 4HH2A 3OPRA 4ZJ3A 5G4YA 3QP1A 3DTIA 4HY8A 3G4PA 2INWA 1SDEA 4PMAA 4PPRA 4KG2A 4Y17A 4BD1A 5CEDA 2FFFB 3VP4A 4MN5A 1YLWA 2EX8A 4MNRA 2L0WA 1G5UA 2PU2A 2ZC6B 3BY9A 2J3TD 3LEZA 1NLZA 1GA9A 2WKEA 1CK3A 4DF6A 2ZL1B 3V67A 4LV2A 3EEHA 4NEED 3ZDJA 5MC7A 3OBFA 1BTLA 3UB9A 2Y2GA 2JKRM 4BBTA 5EOEA 5F1GA 2Y2NA 5KSHA 3SH7A 2JKRI 2OLVA 2Y2QA 3UO9A 4NK3A 4EERA 4P0MA 3OLOA 2XA7M 5FI7A 1P9WA 2VZWA 4HI4A 4QJGA 2X71A 1RCJA 1BSGA 4Y0OA 4FOFA 1IKGA 3HUMA 3CWFA 4OOMA 5IHVA 3LR3A 3GSGA 1EW0A 1SZVA 3QP5A 2ZC3B 3HLEA 2WAFA 4ARZA 1MWTA 5D3OA 3H82A 4E3MA 1SKOB 4EBNA 2QKPA 2OAQ1 1NZOA 4GDBA 1JTGA 5FQIA 1OTEA 3VSLA 3F1PB 3UNWA 1K6RA 5FQKA 2Y2IA 5DKKA 1QMFA 1IELA 1JWZA 3JVUA 4E3JA 1ZG6A 3S7QA 4Q0IA 2H0YA 3UE6A 3U2AA 2ZMVA 3OPHA 3ZG0A 3T4QA 3DWZA 3KSIA 1I2WA 5IU1A 5L10A 5DTSA 4LGWA 1W8QA 4EEUA 3W8KA 3QNCA 5EUAA 5TR7A 5E2FA 4HNBA 4MBFA 3IWQA 2XDMA 1XA1A 4EUZA 2EXBA 1JWVA 3IH8A 5HX9A 5DFXA 4BL2A 2GX5A 1LSWA 5EECA 1ES4A 3OOVA 1XXMA 1VM1A 3CAXA 4GHIA 5TBMB 1ESUA 4OQHA 4BD0A 5CHMA 3CJMA 2HDSA 5FI2A 3T4TA 1PW1A 4NETA 3IXDA 1MWUA 2A24A 1BLHA 3T4SA 4E3KA 3IF6C 4FSFA 2XFTA 1W8YA 1BULA 2PR6A 1PWDA 4IVKA 1I2SA 3MQOA 4B88A 5IT5A 5TFQA 4KQOA 1ONHA 3O3VA 3IBJA 4O8GA 5DVAA 3LIDA 2V2FF 3CITA 4JGPA 4LCLA 2WGIA 4X1LA 1YMXA 4EQ1A 4LRZE 4WZ4A 1S66L 4JF4A 1MPLA 4S2LA 3BEBA 2VV7A 3ZYTA 4R3BA 2KOIA 2A3UA 2WZZA 1TS8A 2L4RA 1OTIA 3UE3A 2IA2A 5CGSA 4R1GA 1FCOA 2XLNA 1GHMA 2P9VA 3V39A 1KGFA 3IQAA 1IKIA 1I5QA 3UPNA 3C2WA 3Q07A 4MEZA 5LBRA 3WS1A 4OQ0A 3EWKA 4R70A 3HLWA 3FKVA 2H10A 1OT6A 5M19A 3F1OA 4NKPA 3C5AA 3Q81A 4U0XA 4EBLA 4GN2A 2G2UA 3HBRA 4PHTA 1DY6A 1LL5A 3TG9A 1GSVA 4FUWA 1DJCA 3N4IA 3IXHA 2ZM2A 2V1ZA 2P04A 5FASA 2PD8A 3V3RA 3PBOA 4WUJA 1VQQA 4GDNA 4HJ6A 5A93A 2WGWB 2ZC7A 4P87A 1IOUA 4EUVA 3V50A 1IYPA 4E3OA 4DE0A 2J9PA 1E3UD 3VSKA 1Y4OA 2WGWA 3MKFA 3BFDA 4ZRRA 2Q9NA 3KSGA 3CI6A 4OPYA 3IF6A 5CEBA 1VETA 3A3JA 4N1XA 1T1BA 2XFSA 3T1XA 1G68A 1WYBA 3LR5A 3IXBA 4F3LA 5HAQA 3MQ0A 2V20A 1TS0A 3MSHA 2WGVA 4U3TA 3FC7A 2Y2OA 4UA7A 1LI0A 2K7SA 2OSUA 3A3DA 5IS1A 5HAPA 2OWJA 3LY4A 4OP5A 4KZBA 3WRZA 1ODVA 1V9ZA 2XH9A 4GKUA 4MN7A 5K5BA 5FDHA 4R3JA 5EVIC 3Q1FA 1S1YA 2DMWA 2QPNA 4WELA 3KYZA 1H5XA 5DFYA 3HREA 3JPUA 3W2ZA 1FOFA 3B33A 4EU0A 2QJ7A 3NJAA 3NCKA 1XGJA 5L8MA 3M2KA 4LLOB 4OLGA 3IBRA 3C4PA 4P6BA 1CF0A 3LFVA 3G32A 5FL3A 1XJ4A 2Y2MA 4X53A 2GZAA 3NOPC 3O88A 4Y15A 2EXAA 2V0UA 5HDSA 4IUKA 5CECA 4A5RA 4WMCA 4R3AA 5FSRA 5EFWA 4YFMA 1JWPA 1K56A 4CLCD 3IT9A 4OKPA 2ZQAA 2O9AA 3G30A 2BLSA 3T4JA 3ZVWA 1TF1A 4DE3A 2Z6DA 2A49A 3I7JA 1S6RA 2XD1A 3WS5A 4LV3A 1ERMA 4LFUA 4IVIA 1H8MA 5FQMA 3NY4A 4LCMA 2ZOHA 2YKFA 2W3GA 3UY6A 2HF6A 1PW8A 4HJ3A 4EBPA 1DP9A 2J9OA 5AJGA 2JHEA 3QHYA 3ZNYA 3Q7VB 2EFXA 1O7EA 2HPBA 2W1TB 4L9FA 3GV9A 4EV4A 2WKPA 3JVVA 5HDCA 4Q0JA 5FAQA 3EOIA 4K91A 1CEFA 2JC7A 3VMAA 3T4KA 3UB5P 5DF9A 1YLYA 3MFXA 4P6ZM 4EWFA 1MKIA 4HQAA 4G3WA 2W3FA 5KSCA 5AQ9A 2C5WB 3H7WB 4MCWA 4HESA 2BTFP 3GMWA 3T4LA 3IH9A 3UPOA 1MC0A 4C3QA 4N9LA 1LLBA 4P6ZS 2J8YA 4EXOA 4DE1A 1Z09A 1L0DA 3ZVTA 1K55C 3KO6A 1NY0A 4IUHA 3VOLA 3LI9A 1S4RA 3MXQA 3IWIA 4JGQA 3GDIA 4IBRA 2WKQA 3UMEA 3GR2A 3PBNA 3EQUA 3H9WA 4HP9A 1OTDA 1VEUA 1OMEA 3M6BA 4XT2A 2OOLA 5A91A 4GS9B 4C6YA 1TVFA 3MJQA 3NDGA 4KZ8A 1L0GA 1W79A 2WK0A 5E2GA 3TOIA 1HD8A 4Q8IA 1XJ3A 5AQBA 3HLBA 3BWLA 2JBFA 2WADA 1P97A 1W7FA 5HWWA 1FIKA 5CHUA 3W4OA 4CPKA 3HJIA 2EWVA 4KZ7A 2VV8A 4PM9A 5EM0A 1YPRA 1K57A 2V1BA 2ZL1A 2Z2LB 5HFOA 4AFIA 2M1CA 5FA7A 4QHCA 4Y5FA 4JXGA 3CLOA 4R0QA 5G18A 2JKGA 5JYOA 3VOYA 3ZG8B 4YWZA 1FR1A 2EX2A 4E04A 2W27A 2UV0E 3KSHA 1CI9A 2ZQ7A 3HL9A 2DCFA 3C38A 3MR0A 3FWLA 4ME4A 4S2JA 4PM5A 3B3XA 2LB9A 3ZGAB 1MXOA 3BM6A 2HP9A 4WF0A 1M6KA 1SKOA 1GA0A 5DJTA 4BJPA 4S2PA 3F1PA 2KLIA 5GLBA 1IYQA 4I39A 3WWXA 2Y2HA 3HCYA 4R4SA 2PDRA 1K55A 3OPLA 3ZG7B 4N92A 1Y28A 2XROA 3R7WB 4I5SA 4NXFA 4BL3A 1XJ2A 1BLSA 1D1JA 2WUQA 2HZ5A 5HL6A 2JKFA 5HD3A 3A3EA 2ZC5B 2V0WA 4IBXA 4DXCA 2ZD8A 1F98A 4JF5A 4PAUA 1J9MA 3GQZA 2WAEA 3FPVA 1STZA 4O7DA 3A0VA 4KZ3A 3QP6A 3TW8A 3E2LA 4JKTA 3S22A 3MQQA 2PT7A 3B47A 1N9BA 4JPMA 4WM9A 1ZTUA 4OONA 1KOUA 4GLQA 4WLAA 2PAVP 3NIAA 1NRJA 3K2NA 2V8FA 2Y79A 3S4XA 1DJBA 4ZJ2A 4DXBA 4F94A 4JXVA 4S2OA 3RXWA 5TBMA 5AQAA 3HUOA 1F9IA 1KVMA 1ES2A 4MLLA 5GHXA 1ZG4A 4RX3A 5FATA 4X55A 3WRTA 3Q82A 4LPZA 1YM1A 2Q9MA 1AWIA 3CZDA 4EEPA 2W3DA 2HV1A 2W3EA 2XQZA 3SS5A 4YOFA 3HLDA 4N1HA 4QD4A 4MBKA 4DJ2A 1NWZA 5FQ9A 3BQAA 1W63Q 2V8CA 2P74A 1OTBA 1RGZA 3LO7A 1GSWA 3MMHA 2EX6A 3LIEA 1WYCA 3AGDA 2M7UA 3IS2B 1G6OA 4XXRA 4ZBEA 4LENA 3ULFA 1RP5A 4OPZA 3N8RA 1F2KA 4K08A 3LYXA 4CLCE 2ZLYA 4PM8A 3UB6A 4Y2FA 4KG6A 4YNRA 4KZ4A 1EI5A 5EV0A 2V1AA 5CRFA 1K0KA 2XEPA 1YQSA 4EQIA 3PBSA 4JGRA 4WBGA 2VA0A 4OOLA 2GJ3A 3TJZC 3G31A 5F68A 4Y0TA 2WKHA 1PI4A 1LSXA 5EVEA 3IX3A 2XSSA 1G6AA 3HLGA 1MZUA 4O0PA 2BG1A 3VP1A 3BRMA 5AQ7A 4BBUA 3CHWP 4QY6A 5M1AA 2NUTC 3BFGA 4GD8A 1DRMA 1YSQA 3MFDA 5J7EA 3E4QA 4II7A 1YLJA 3ISGA 4BENA 3G34A 4YINA 4M4XA 1PNEA 2VX8A 4PKYA 4JLFA 5CERA 1PI5A 3VV4A 4NXEA 2PBDP 4UQIS 3PR6A 1PRQA 1MWSA 2ZMAA 3NI9A 3LICA 5CTMA 3SOIA 4DRTA 1FSYA 2L1MA 1H3QA 1LT0A 2RL3A 2B18A 4UAAA 3MBZA 2NUPC 4FH4A 1L3LA 4OVDA 4ID4A 1T1AA 3WS0A 1NYYA 3A3FA 1WA9A 4E6XA 1ZKJA 2Y2PA 4Z9QA 3O86A 1TS6A 3CG5A 1YLPA 1LHYA 5J8XA 5FAPA 5A8BA 4OPQA 1VHMA 2HDQA 4B93A 4XUZA 2DNSA 4LV0A 3G2YA 4OLDA 5GL9A 4UEYA 4I3JA 5GHYA 1L0EA 4FCFA 5EE8A 3RXXA 4S2IA 1K4FA 5HL1A 4S2NA 1T18A 1KE0A 4RVAA 4X56A 3G6OA 4PM6A 3S7NA 3EQVA 3UN7A 3MS6A 4IJGA 2ZMFA 1KVLA 3L9KA 3T1SA 2EFUA 4K0WA 1FQGA 4E3NA 3IX4A 3DW0A 4P85A 3KYQA 1S1ZA 1K56D 4BMWA 1YAXA 3D9YA 2JN7A 4DE2A 2HGVA 4OH0A 4Y3IA 2J7VA 1LI9A 3SH9A 1W5DA 4HP4A 1H0MA 3P7NA 3BJNA 3D3OA 3T1RA 1O07A 3MZFA 5L09A 4S2KA 3RFBA 3KX0X 4GNUA 1W63M 1N9OA 3ZQ5A 3P01A 3FKWA 3TRCA 3A3IA 5J4EA 3FG8A 2VGLM 3BLMA 4G3VA 2PYRA 1TDLA 2ZM8A 1K57C 3D4FA 5AVFA 4CLCB 1T1CA 2ZQ9A 5CGXA 5GLDA 1KGGA 4KQRA 4I3IA 4H6JB 2QHKA 2OLUA 2WKIA 1YMSA 3ICYA 4HH3A 2K31A 1OPXA 3E0YA 2ZOIA 1PZOA 5F5YA 3DAVA 2VGLS 2J3TC 3N7WA 1DP8A 1ACFA 3Q7VA 1BYWA 1EWZA 2W1TA 2WKRA 2VGKA 3PTEA 3UE0A 2E8IA 1ES3A 5A92A 3RJUA 5EVID 4EESA 4BQMA 4UA9A 1MKMA 3AGFA 3NHQA 3BECA 2Y4AA 3PBQA 3SS4A 3PAGA 4KZ6A 5HDDA 3T12B 3H7WA 1LL9A 5I94A 1FR6A 1CI8A 3D72A 2QWSA 4M3KA 5EVIB 3BFCA 1HVBA 4KZAA 2K2NA 3ZG9B 3EGDC 5F1FA 1HLUP 3NECA 3TE8A 2J80A 2JKTM 1ZHHB 4GD6A 1XFNA 4ZTKA 3C30A 2JKTI 1PZPA 1G28A 4D2OA 4WN5A 2CC1A 2ACGA 1JNUA 5CXWA 3IWOA 2E8JA 1ALQA 2IWBA 1SDNA 4U0TA 2YKHA 1S0WA 5HARA 4JF6A 3BYDA 3K3DA 4MDZA 1OJ5A 3VE4A 4IHQA 5A90A 3MXRA 3M6HA 1J3WA 2WYXA 4ZDXA 3QNBA 4Y7PA 4PKYG 3DBAA 3EEAA 4GS9A 1TDGA 2O9CA 2EWWA 1IYOA 4H8RA 2P7JA 3SZTA 1Z6FA 3UMDA 1IFQA 2P08A 3V5MA 1NXYA 3SS3A 2Y59A 2ZQCA 3W4PA 3E98A 4MN6A 2LB5A 2MJ6A 1A0KA 4Q0HA 5KZHA 3WS2A 1GHPA 1T19A 1BUEA 2QYBA 2XF3A 4QY5A 3GTCA 5EPHA 5TJJA 4FD8A
chains in the Genus database with same CATH topology
4QWOA 5FDSA 1PNEA 3T1XA 3D9YA 1SKOA 1AWIA 1VEUA 3CPTA 2PBDP 5FEGA 1PRQA 2ZL1B 3L7HA 1HLUP 3MSHA 3NECA 3T1RA 1CJFA 3LEQA 3U4LP 2V8CA 2ACGA 2E8JA 3LGOA 1CQAA 1D1JA 2PRFA 3KYEA 2HZ5A 3UB5P 1PFLA 4FTXA 1FIKA 3T1QB 1F2KA 2JKFA 5FEFA 1SZVA 2B95A 1J3WA 5EM0A 1VETB 1YPRA 3NULA 4FUWA 2ZL1A 5EV0A 1K0KA 4X25A 1SKOB 3DAVA 4X1MA 1VEUB 1ACFA 2BTFP 2VK3A 4D60A 1CF0A 2PAVP 5EM1A 2V8FA 5EVEA 1Z09A 2JKGA 3MS6A 3L9KA 3T1SA 1Y4OA 1FILA 1A0KA 4ESPA 3CHWP 3CPTB 4X1LA 1VETA 1G5UA 3T12B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QWO A;  5FDS A;  1PNE A;  3T1X A;  3D9Y A;  1SKO A;  1AWI A;  1VEU A;  3CPT A;  2PBD P;  5FEG A;  1PRQ A;  2ZL1 B;  3L7H A;  1HLU P;  3MSH A;  3NEC A;  3T1R A;  1CJF A;  3LEQ A;  3U4L P;  2V8C A;  2ACG A;  2E8J A;  3LGO A;  1CQA A;  1D1J A;  2PRF A;  3KYE A;  2HZ5 A;  3UB5 P;  1PFL A;  4FTX A;  1FIK A;  3T1Q B;  1F2K A;  2JKF A;  5FEF A;  1SZV A;  2B95 A;  1J3W A;  5EM0 A;  1VET B;  1YPR A;  3NUL A;  4FUW A;  2ZL1 A;  5EV0 A;  1K0K A;  4X25 A;  1SKO B;  3DAV A;  4X1M A;  1VEU B;  1ACF A;  2BTF P;  2VK3 A;  4D60 A;  1CF0 A;  2PAV P;  5EM1 A;  2V8F A;  5EVE A;  1Z09 A;  2JKG A;  3MS6 A;  3L9K A;  3T1S A;  1Y4O A;  1FIL A;  1A0K A;  4ESP A;  3CHW P;  3CPT B;  4X1L A;  1VET A;  1G5U A;  3T12 B; 
#chains in the Genus database with same CATH topology
 1N4O A;  3RH8 B;  1K25 A;  4CQH A;  3UDF A;  3E4O A;  4KUK A;  4MBH A;  3PYP A;  4OQI A;  4ARZ B;  4GOG A;  3W4Q A;  5HPF A;  1XX2 A;  2R9X A;  3H82 B;  1V9Y A;  1NYM A;  1ERQ A;  1L2S A;  2WZX A;  2B02 A;  2Y2J A;  4OQG A;  3BFF A;  3HJK A;  2XA7 S;  3LGO A;  3OC2 A;  3PXP A;  1KDW A;  1LSV A;  2EA9 A;  3BLS A;  4GZB A;  1BZA A;  3HLF A;  3GRJ A;  5E2H A;  3T1Q B;  3MZE A;  3SW1 A;  2FZ0 A;  1UGU A;  3NC8 A;  3VP3 A;  1QME A;  4JXS A;  2JCH A;  1KE3 A;  1NLY A;  3ITB A;  1ES5 A;  1MBL A;  2W3H A;  2DRW A;  3RTY A;  4E3L A;  1RGY A;  4B9O A;  4QPR A;  2VK3 A;  5C5K A;  3IF5 A;  1K54 C;  2X01 A;  2ZC4 B;  3R7W A;  3ITA A;  1NZU A;  2G2W A;  1YSP A;  3VOZ A;  3PBR A;  1N9L A;  3ZHH A;  3E2K A;  3P98 A;  3O5Y A;  5KIZ A;  3VP0 A;  1C3B A;  4GB7 A;  2D01 A;  1YT4 A;  2Y2K A;  1XA7 A;  3DTE A;  2ZQD A;  4GJ4 A;  3UB7 A;  4RYE A;  4RA7 A;  5L07 A;  2OV5 A;  1Q2P A;  4S2M A;  2D02 A;  3Q7Z A;  4WYY A;  4GHI B;  4QWO A;  4OPR A;  4QU3 A;  4Y13 A;  2VGJ A;  1D06 A;  3GVB A;  3UPP A;  3L7H A;  2A24 B;  4HHD A;  1K38 A;  1XFQ A;  1NJ4 A;  2ZJ9 A;  3EGX C;  4K0X A;  3LEQ A;  3A0R A;  5CX7 A;  3VE3 A;  2PR5 A;  3DTM A;  3FYZ A;  3G2Z A;  1JTD A;  2VKS A;  4OP8 A;  4I38 A;  3LR4 A;  3HLC A;  2GDN A;  3CUE C;  4NXB A;  2R78 A;  2ZQ8 A;  3NBL A;  1OJG A;  3OZH A;  4RX2 A;  3DTK A;  3VFH A;  4E3I A;  1NRF A;  5FI6 A;  2XRN A;  3P09 A;  2EX9 A;  4JBF A;  3C7V A;  4L0L A;  5FQJ A;  2B95 A;  2VJW A;  2C6W B;  2HJE A;  3QP2 A;  2O9B A;  4DMZ A;  1L0F A;  3T4O A;  3MXS A;  3NUL A;  3QP4 A;  2XD5 A;  2O99 A;  2PBY A;  3LCE A;  4X25 A;  4S2N C;  3M2J A;  1CEG A;  4EET B;  4EW7 A;  3MKE A;  3LIA A;  1H8Y A;  4R4R A;  2I9V A;  1XPB A;  1N9N A;  3ZNT A;  2P9V B;  3VP2 A;  4DDS A;  3N6I A;  3IS2 A;  5CHJ A;  2Y2L A;  3WS4 A;  3BQ8 A;  5KMW A;  1Q2Q A;  3OCN A;  3IHB A;  1FIL A;  2H0T A;  3LI8 A;  1TEM A;  1M40 A;  1DJA A;  3CPT B;  3F1O B;  4UHU A;  3AGE A;  4BWI A;  4KG5 A;  4NXG A;  5F82 A;  3OPP A;  1JVJ A;  2H28 A;  1K54 A;  3C7U A;  2HDR A;  4X69 A;  1IYS A;  3CPT A;  5DTT A;  1HTZ A;  3E4P A;  3C8C A;  4UQI M;  1FCM A;  2VV6 A;  1TS7 A;  2KX6 A;  4E6W A;  4HEF A;  4R23 A;  5E2E A;  3UDX A;  4MMN A;  4DN0 A;  2ZM0 A;  2W0N A;  1U60 A;  3IHA A;  1AXB A;  3QP8 A;  4ETZ A;  3PBT A;  4R6L A;  3MZD A;  3ZFZ A;  2KDK A;  2PRF A;  1BLP A;  2Z2M B;  3NDE A;  5HPI A;  1PFL A;  2QZ6 A;  3HUN A;  4HBU A;  1H8Z A;  5F83 A;  5G4Z A;  4WZ5 C;  1XKZ A;  4CLC C;  4C75 A;  3IF6 B;  1VET B;  4LRY C;  2BAS A;  1SKF A;  3ZCZ A;  4LV1 A;  1MY8 A;  1KDS A;  1SCW A;  3LR0 A;  4NG2 A;  3G35 A;  2IWC A;  4F3L B;  3CUE A;  2OWH A;  5EM1 A;  1PIO A;  2OAP 1;  1HZO A;  1XJ6 A;  1DP6 A;  2IWD A;  5HSQ A;  2V9A A;  1E3U A;  5DKL A;  2GNX A;  4ESP A;  3O87 A;  4I3A A;  3BY8 A;  4Z1W A;  3ZG5 A;  2PU4 A;  1MWR A;  2Q0O A;  2XGN A;  5HZH A;  2VLG A;  3BW6 A;  3LIF A;  4WEJ A;  4B4X A;  3UDI A;  5F69 A;  2HP6 A;  1UWN X;  5U47 A;  3F1N B;  2RCX A;  3GEC A;  4X68 A;  3FPW A;  1UWP X;  3T50 A;  5I5L A;  2JE5 A;  4UA6 A;  1XP4 A;  3LY3 A;  4WMC D;  4L9E A;  5L2F A;  1XGI A;  3IXG A;  1CJF A;  2X02 A;  1P9R A;  2A2L A;  2Z6C A;  4ZAM A;  3F1N A;  3U4L P;  4BBV A;  2Y91 A;  5J3W A;  2UWX A;  1IEM A;  4QB8 A;  3N8L A;  2H5S A;  3S7P A;  2O0Y A;  5M18 A;  1FSW A;  1LL8 A;  4KZ5 A;  3KYE A;  3N8S A;  2CMN A;  4KUO A;  3CMZ A;  1OTA A;  3OCL A;  1GCE A;  1YLZ A;  4FTX A;  4WL9 A;  5HW3 A;  2QJ5 A;  4CJN A;  5CGW A;  4BLM A;  3SH8 A;  4DDY A;  1ZC2 A;  2QMI A;  5DJU A;  3MF0 A;  1P0Z A;  3FZC A;  4X6T A;  4KZ9 A;  4X1M A;  3NOU C;  4WEK A;  4D60 A;  3A0S A;  3R4K A;  2PD7 A;  4RQ9 A;  3LUQ A;  5HWV A;  1PWC A;  3HVF A;  2HJ9 C;  4KQD A;  4FH2 A;  4Y0U A;  1Y54 A;  1OT9 A;  4HOI A;  4WZ5 A;  4HJ4 A;  4CLC A;  5BOH A;  2PHY A;  2B5R A;  2HDU A;  2W1R A;  1TD5 A;  1E4D A;  5GLC A;  4LRX C;  3PAE A;  4H6J A;  3BFE A;  1SHV A;  5DF7 A;  4JGO A;  1K6S A;  3DWK A;  5GHZ A;  5FAO A;  2Y55 A;  5FDS A;  4G3K A;  3LIB A;  2XK1 A;  2FFY A;  1E25 A;  2ZBB A;  2VEA A;  1GSX A;  3KSF A;  4JXW A;  5EVL A;  5FEG A;  1FCN A;  3K3C A;  5FQQ A;  1BLC A;  4ZJ1 A;  1KE4 A;  4L9G A;  5HD5 A;  1PYY A;  4DKI A;  4IED A;  4HIA A;  1PWG A;  4B4Z A;  5TGF A;  2FH5 A;  3B42 A;  4R38 A;  4ETX A;  1X0O A;  2G7U A;  5F6A A;  4KEN B;  3IX8 A;  5DTK A;  4DJ3 A;  5E43 A;  1YLT A;  4OOY A;  3V3S A;  4XUX A;  1CQA A;  1F5M A;  2M7V A;  3S7O A;  2J3W A;  1BT5 A;  1S4S A;  4HBT A;  3S1Y A;  5EOO A;  1VB6 A;  3NOT C;  5HWT A;  3FV7 A;  4GW9 A;  2PYP A;  2XR0 A;  1WE4 A;  1YKD A;  1D7E A;  5FEF A;  3UE1 A;  5JYP A;  4O01 A;  2HP5 A;  4PM7 A;  1ESI A;  5EVI A;  4N9K A;  3C4O A;  2R9W A;  1ERO A;  3JYI A;  3UB8 A;  1S67 L;  3VFF A;  1ONG A;  1GHI A;  2I72 A;  4GCZ A;  5AVE A;  3PHY A;  4KQQ A;  3TSG A;  1VEU B;  2AVX A;  5GLA A;  5CTN A;  2Y8H A;  5DF8 A;  4XT2 B;  1KGE A;  5HAI A;  1K4E A;  4HH2 A;  3OPR A;  4ZJ3 A;  5G4Y A;  3QP1 A;  3DTI A;  4HY8 A;  3G4P A;  2INW A;  1SDE A;  4PMA A;  4PPR A;  4KG2 A;  4Y17 A;  4BD1 A;  5CED A;  2FFF B;  3VP4 A;  4MN5 A;  1YLW A;  2EX8 A;  4MNR A;  2L0W A;  1G5U A;  2PU2 A;  2ZC6 B;  3BY9 A;  2J3T D;  3LEZ A;  1NLZ A;  1GA9 A;  2WKE A;  1CK3 A;  4DF6 A;  2ZL1 B;  3V67 A;  4LV2 A;  3EEH A;  4NEE D;  3ZDJ A;  5MC7 A;  3OBF A;  1BTL A;  3UB9 A;  2Y2G A;  2JKR M;  4BBT A;  5EOE A;  5F1G A;  2Y2N A;  5KSH A;  3SH7 A;  2JKR I;  2OLV A;  2Y2Q A;  3UO9 A;  4NK3 A;  4EER A;  4P0M A;  3OLO A;  2XA7 M;  5FI7 A;  1P9W A;  2VZW A;  4HI4 A;  4QJG A;  2X71 A;  1RCJ A;  1BSG A;  4Y0O A;  4FOF A;  1IKG A;  3HUM A;  3CWF A;  4OOM A;  5IHV A;  3LR3 A;  3GSG A;  1EW0 A;  1SZV A;  3QP5 A;  2ZC3 B;  3HLE A;  2WAF A;  4ARZ A;  1MWT A;  5D3O A;  3H82 A;  4E3M A;  1SKO B;  4EBN A;  2QKP A;  2OAQ 1;  1NZO A;  4GDB A;  1JTG A;  5FQI A;  1OTE A;  3VSL A;  3F1P B;  3UNW A;  1K6R A;  5FQK A;  2Y2I A;  5DKK A;  1QMF A;  1IEL A;  1JWZ A;  3JVU A;  4E3J A;  1ZG6 A;  3S7Q A;  4Q0I A;  2H0Y A;  3UE6 A;  3U2A A;  2ZMV A;  3OPH A;  3ZG0 A;  3T4Q A;  3DWZ A;  3KSI A;  1I2W A;  5IU1 A;  5L10 A;  5DTS A;  4LGW A;  1W8Q A;  4EEU A;  3W8K A;  3QNC A;  5EUA A;  5TR7 A;  5E2F A;  4HNB A;  4MBF A;  3IWQ A;  2XDM A;  1XA1 A;  4EUZ A;  2EXB A;  1JWV A;  3IH8 A;  5HX9 A;  5DFX A;  4BL2 A;  2GX5 A;  1LSW A;  5EEC A;  1ES4 A;  3OOV A;  1XXM A;  1VM1 A;  3CAX A;  4GHI A;  5TBM B;  1ESU A;  4OQH A;  4BD0 A;  5CHM A;  3CJM A;  2HDS A;  5FI2 A;  3T4T A;  1PW1 A;  4NET A;  3IXD A;  1MWU A;  2A24 A;  1BLH A;  3T4S A;  4E3K A;  3IF6 C;  4FSF A;  2XFT A;  1W8Y A;  1BUL A;  2PR6 A;  1PWD A;  4IVK A;  1I2S A;  3MQO A;  4B88 A;  5IT5 A;  5TFQ A;  4KQO A;  1ONH A;  3O3V A;  3IBJ A;  4O8G A;  5DVA A;  3LID A;  2V2F F;  3CIT A;  4JGP A;  4LCL A;  2WGI A;  4X1L A;  1YMX A;  4EQ1 A;  4LRZ E;  4WZ4 A;  1S66 L;  4JF4 A;  1MPL A;  4S2L A;  3BEB A;  2VV7 A;  3ZYT A;  4R3B A;  2KOI A;  2A3U A;  2WZZ A;  1TS8 A;  2L4R A;  1OTI A;  3UE3 A;  2IA2 A;  5CGS A;  4R1G A;  1FCO A;  2XLN A;  1GHM A;  2P9V A;  3V39 A;  1KGF A;  3IQA A;  1IKI A;  1I5Q A;  3UPN A;  3C2W A;  3Q07 A;  4MEZ A;  5LBR A;  3WS1 A;  4OQ0 A;  3EWK A;  4R70 A;  3HLW A;  3FKV A;  2H10 A;  1OT6 A;  5M19 A;  3F1O A;  4NKP A;  3C5A A;  3Q81 A;  4U0X A;  4EBL A;  4GN2 A;  2G2U A;  3HBR A;  4PHT A;  1DY6 A;  1LL5 A;  3TG9 A;  1GSV A;  4FUW A;  1DJC A;  3N4I A;  3IXH A;  2ZM2 A;  2V1Z A;  2P04 A;  5FAS A;  2PD8 A;  3V3R A;  3PBO A;  4WUJ A;  1VQQ A;  4GDN A;  4HJ6 A;  5A93 A;  2WGW B;  2ZC7 A;  4P87 A;  1IOU A;  4EUV A;  3V50 A;  1IYP A;  4E3O A;  4DE0 A;  2J9P A;  1E3U D;  3VSK A;  1Y4O A;  2WGW A;  3MKF A;  3BFD A;  4ZRR A;  2Q9N A;  3KSG A;  3CI6 A;  4OPY A;  3IF6 A;  5CEB A;  1VET A;  3A3J A;  4N1X A;  1T1B A;  2XFS A;  3T1X A;  1G68 A;  1WYB A;  3LR5 A;  3IXB A;  4F3L A;  5HAQ A;  3MQ0 A;  2V20 A;  1TS0 A;  3MSH A;  2WGV A;  4U3T A;  3FC7 A;  2Y2O A;  4UA7 A;  1LI0 A;  2K7S A;  2OSU A;  3A3D A;  5IS1 A;  5HAP A;  2OWJ A;  3LY4 A;  4OP5 A;  4KZB A;  3WRZ A;  1ODV A;  1V9Z A;  2XH9 A;  4GKU A;  4MN7 A;  5K5B A;  5FDH A;  4R3J A;  5EVI C;  3Q1F A;  1S1Y A;  2DMW A;  2QPN A;  4WEL A;  3KYZ A;  1H5X A;  5DFY A;  3HRE A;  3JPU A;  3W2Z A;  1FOF A;  3B33 A;  4EU0 A;  2QJ7 A;  3NJA A;  3NCK A;  1XGJ A;  5L8M A;  3M2K A;  4LLO B;  4OLG A;  3IBR A;  3C4P A;  4P6B A;  1CF0 A;  3LFV A;  3G32 A;  5FL3 A;  1XJ4 A;  2Y2M A;  4X53 A;  2GZA A;  3NOP C;  3O88 A;  4Y15 A;  2EXA A;  2V0U A;  5HDS A;  4IUK A;  5CEC A;  4A5R A;  4WMC A;  4R3A A;  5FSR A;  5EFW A;  4YFM A;  1JWP A;  1K56 A;  4CLC D;  3IT9 A;  4OKP A;  2ZQA A;  2O9A A;  3G30 A;  2BLS A;  3T4J A;  3ZVW A;  1TF1 A;  4DE3 A;  2Z6D A;  2A49 A;  3I7J A;  1S6R A;  2XD1 A;  3WS5 A;  4LV3 A;  1ERM A;  4LFU A;  4IVI A;  1H8M A;  5FQM A;  3NY4 A;  4LCM A;  2ZOH A;  2YKF A;  2W3G A;  3UY6 A;  2HF6 A;  1PW8 A;  4HJ3 A;  4EBP A;  1DP9 A;  2J9O A;  5AJG A;  2JHE A;  3QHY A;  3ZNY A;  3Q7V B;  2EFX A;  1O7E A;  2HPB A;  2W1T B;  4L9F A;  3GV9 A;  4EV4 A;  2WKP A;  3JVV A;  5HDC A;  4Q0J A;  5FAQ A;  3EOI A;  4K91 A;  1CEF A;  2JC7 A;  3VMA A;  3T4K A;  3UB5 P;  5DF9 A;  1YLY A;  3MFX A;  4P6Z M;  4EWF A;  1MKI A;  4HQA A;  4G3W A;  2W3F A;  5KSC A;  5AQ9 A;  2C5W B;  3H7W B;  4MCW A;  4HES A;  2BTF P;  3GMW A;  3T4L A;  3IH9 A;  3UPO A;  1MC0 A;  4C3Q A;  4N9L A;  1LLB A;  4P6Z S;  2J8Y A;  4EXO A;  4DE1 A;  1Z09 A;  1L0D A;  3ZVT A;  1K55 C;  3KO6 A;  1NY0 A;  4IUH A;  3VOL A;  3LI9 A;  1S4R A;  3MXQ A;  3IWI A;  4JGQ A;  3GDI A;  4IBR A;  2WKQ A;  3UME A;  3GR2 A;  3PBN A;  3EQU A;  3H9W A;  4HP9 A;  1OTD A;  1VEU A;  1OME A;  3M6B A;  4XT2 A;  2OOL A;  5A91 A;  4GS9 B;  4C6Y A;  1TVF A;  3MJQ A;  3NDG A;  4KZ8 A;  1L0G A;  1W79 A;  2WK0 A;  5E2G A;  3TOI A;  1HD8 A;  4Q8I A;  1XJ3 A;  5AQB A;  3HLB A;  3BWL A;  2JBF A;  2WAD A;  1P97 A;  1W7F A;  5HWW A;  1FIK A;  5CHU A;  3W4O A;  4CPK A;  3HJI A;  2EWV A;  4KZ7 A;  2VV8 A;  4PM9 A;  5EM0 A;  1YPR A;  1K57 A;  2V1B A;  2ZL1 A;  2Z2L B;  5HFO A;  4AFI A;  2M1C A;  5FA7 A;  4QHC A;  4Y5F A;  4JXG A;  3CLO A;  4R0Q A;  5G18 A;  2JKG A;  5JYO A;  3VOY A;  3ZG8 B;  4YWZ A;  1FR1 A;  2EX2 A;  4E04 A;  2W27 A;  2UV0 E;  3KSH A;  1CI9 A;  2ZQ7 A;  3HL9 A;  2DCF A;  3C38 A;  3MR0 A;  3FWL A;  4ME4 A;  4S2J A;  4PM5 A;  3B3X A;  2LB9 A;  3ZGA B;  1MXO A;  3BM6 A;  2HP9 A;  4WF0 A;  1M6K A;  1SKO A;  1GA0 A;  5DJT A;  4BJP A;  4S2P A;  3F1P A;  2KLI A;  5GLB A;  1IYQ A;  4I39 A;  3WWX A;  2Y2H A;  3HCY A;  4R4S A;  2PDR A;  1K55 A;  3OPL A;  3ZG7 B;  4N92 A;  1Y28 A;  2XRO A;  3R7W B;  4I5S A;  4NXF A;  4BL3 A;  1XJ2 A;  1BLS A;  1D1J A;  2WUQ A;  2HZ5 A;  5HL6 A;  2JKF A;  5HD3 A;  3A3E A;  2ZC5 B;  2V0W A;  4IBX A;  4DXC A;  2ZD8 A;  1F98 A;  4JF5 A;  4PAU A;  1J9M A;  3GQZ A;  2WAE A;  3FPV A;  1STZ A;  4O7D A;  3A0V A;  4KZ3 A;  3QP6 A;  3TW8 A;  3E2L A;  4JKT A;  3S22 A;  3MQQ A;  2PT7 A;  3B47 A;  1N9B A;  4JPM A;  4WM9 A;  1ZTU A;  4OON A;  1KOU A;  4GLQ A;  4WLA A;  2PAV P;  3NIA A;  1NRJ A;  3K2N A;  2V8F A;  2Y79 A;  3S4X A;  1DJB A;  4ZJ2 A;  4DXB A;  4F94 A;  4JXV A;  4S2O A;  3RXW A;  5TBM A;  5AQA A;  3HUO A;  1F9I A;  1KVM A;  1ES2 A;  4MLL A;  5GHX A;  1ZG4 A;  4RX3 A;  5FAT A;  4X55 A;  3WRT A;  3Q82 A;  4LPZ A;  1YM1 A;  2Q9M A;  1AWI A;  3CZD A;  4EEP A;  2W3D A;  2HV1 A;  2W3E A;  2XQZ A;  3SS5 A;  4YOF A;  3HLD A;  4N1H A;  4QD4 A;  4MBK A;  4DJ2 A;  1NWZ A;  5FQ9 A;  3BQA A;  1W63 Q;  2V8C A;  2P74 A;  1OTB A;  1RGZ A;  3LO7 A;  1GSW A;  3MMH A;  2EX6 A;  3LIE A;  1WYC A;  3AGD A;  2M7U A;  3IS2 B;  1G6O A;  4XXR A;  4ZBE A;  4LEN A;  3ULF A;  1RP5 A;  4OPZ A;  3N8R A;  1F2K A;  4K08 A;  3LYX A;  4CLC E;  2ZLY A;  4PM8 A;  3UB6 A;  4Y2F A;  4KG6 A;  4YNR A;  4KZ4 A;  1EI5 A;  5EV0 A;  2V1A A;  5CRF A;  1K0K A;  2XEP A;  1YQS A;  4EQI A;  3PBS A;  4JGR A;  4WBG A;  2VA0 A;  4OOL A;  2GJ3 A;  3TJZ C;  3G31 A;  5F68 A;  4Y0T A;  2WKH A;  1PI4 A;  1LSX A;  5EVE A;  3IX3 A;  2XSS A;  1G6A A;  3HLG A;  1MZU A;  4O0P A;  2BG1 A;  3VP1 A;  3BRM A;  5AQ7 A;  4BBU A;  3CHW P;  4QY6 A;  5M1A A;  2NUT C;  3BFG A;  4GD8 A;  1DRM A;  1YSQ A;  3MFD A;  5J7E A;  3E4Q A;  4II7 A;  1YLJ A;  3ISG A;  4BEN A;  3G34 A;  4YIN A;  4M4X A;  1PNE A;  2VX8 A;  4PKY A;  4JLF A;  5CER A;  1PI5 A;  3VV4 A;  4NXE A;  2PBD P;  4UQI S;  3PR6 A;  1PRQ A;  1MWS A;  2ZMA A;  3NI9 A;  3LIC A;  5CTM A;  3SOI A;  4DRT A;  1FSY A;  2L1M A;  1H3Q A;  1LT0 A;  2RL3 A;  2B18 A;  4UAA A;  3MBZ A;  2NUP C;  4FH4 A;  1L3L A;  4OVD A;  4ID4 A;  1T1A A;  3WS0 A;  1NYY A;  3A3F A;  1WA9 A;  4E6X A;  1ZKJ A;  2Y2P A;  4Z9Q A;  3O86 A;  1TS6 A;  3CG5 A;  1YLP A;  1LHY A;  5J8X A;  5FAP A;  5A8B A;  4OPQ A;  1VHM A;  2HDQ A;  4B93 A;  4XUZ A;  2DNS A;  4LV0 A;  3G2Y A;  4OLD A;  5GL9 A;  4UEY A;  4I3J A;  5GHY A;  1L0E A;  4FCF A;  5EE8 A;  3RXX A;  4S2I A;  1K4F A;  5HL1 A;  4S2N A;  1T18 A;  1KE0 A;  4RVA A;  4X56 A;  3G6O A;  4PM6 A;  3S7N A;  3EQV A;  3UN7 A;  3MS6 A;  4IJG A;  2ZMF A;  1KVL A;  3L9K A;  3T1S A;  2EFU A;  4K0W A;  1FQG A;  4E3N A;  3IX4 A;  3DW0 A;  4P85 A;  3KYQ A;  1S1Z A;  1K56 D;  4BMW A;  1YAX A;  3D9Y A;  2JN7 A;  4DE2 A;  2HGV A;  4OH0 A;  4Y3I A;  2J7V A;  1LI9 A;  3SH9 A;  1W5D A;  4HP4 A;  1H0M A;  3P7N A;  3BJN A;  3D3O A;  3T1R A;  1O07 A;  3MZF A;  5L09 A;  4S2K A;  3RFB A;  3KX0 X;  4GNU A;  1W63 M;  1N9O A;  3ZQ5 A;  3P01 A;  3FKW A;  3TRC A;  3A3I A;  5J4E A;  3FG8 A;  2VGL M;  3BLM A;  4G3V A;  2PYR A;  1TDL A;  2ZM8 A;  1K57 C;  3D4F A;  5AVF A;  4CLC B;  1T1C A;  2ZQ9 A;  5CGX A;  5GLD A;  1KGG A;  4KQR A;  4I3I A;  4H6J B;  2QHK A;  2OLU A;  2WKI A;  1YMS A;  3ICY A;  4HH3 A;  2K31 A;  1OPX A;  3E0Y A;  2ZOI A;  1PZO A;  5F5Y A;  3DAV A;  2VGL S;  2J3T C;  3N7W A;  1DP8 A;  1ACF A;  3Q7V A;  1BYW A;  1EWZ A;  2W1T A;  2WKR A;  2VGK A;  3PTE A;  3UE0 A;  2E8I A;  1ES3 A;  5A92 A;  3RJU A;  5EVI D;  4EES A;  4BQM A;  4UA9 A;  1MKM A;  3AGF A;  3NHQ A;  3BEC A;  2Y4A A;  3PBQ A;  3SS4 A;  3PAG A;  4KZ6 A;  5HDD A;  3T12 B;  3H7W A;  1LL9 A;  5I94 A;  1FR6 A;  1CI8 A;  3D72 A;  2QWS A;  4M3K A;  5EVI B;  3BFC A;  1HVB A;  4KZA A;  2K2N A;  3ZG9 B;  3EGD C;  5F1F A;  1HLU P;  3NEC A;  3TE8 A;  2J80 A;  2JKT M;  1ZHH B;  4GD6 A;  1XFN A;  4ZTK A;  3C30 A;  2JKT I;  1PZP A;  1G28 A;  4D2O A;  4WN5 A;  2CC1 A;  2ACG A;  1JNU A;  5CXW A;  3IWO A;  2E8J A;  1ALQ A;  2IWB A;  1SDN A;  4U0T A;  2YKH A;  1S0W A;  5HAR A;  4JF6 A;  3BYD A;  3K3D A;  4MDZ A;  1OJ5 A;  3VE4 A;  4IHQ A;  5A90 A;  3MXR A;  3M6H A;  1J3W A;  2WYX A;  4ZDX A;  3QNB A;  4Y7P A;  4PKY G;  3DBA A;  3EEA A;  4GS9 A;  1TDG A;  2O9C A;  2EWW A;  1IYO A;  4H8R A;  2P7J A;  3SZT A;  1Z6F A;  3UMD A;  1IFQ A;  2P08 A;  3V5M A;  1NXY A;  3SS3 A;  2Y59 A;  2ZQC A;  3W4P A;  3E98 A;  4MN6 A;  2LB5 A;  2MJ6 A;  1A0K A;  4Q0H A;  5KZH A;  3WS2 A;  1GHP A;  1T19 A;  1BUE A;  2QYB A;  2XF3 A;  4QY5 A;  3GTC A;  5EPH A;  5TJJ A;  4FD8 A; 
#chains in the Genus database with same CATH homology
 4QWO A;  5FDS A;  1PNE A;  3T1X A;  3D9Y A;  1SKO A;  1AWI A;  1VEU A;  3CPT A;  2PBD P;  5FEG A;  1PRQ A;  2ZL1 B;  3L7H A;  1HLU P;  3MSH A;  3NEC A;  3T1R A;  1CJF A;  3LEQ A;  3U4L P;  2V8C A;  2ACG A;  2E8J A;  3LGO A;  1CQA A;  1D1J A;  2PRF A;  3KYE A;  2HZ5 A;  3UB5 P;  1PFL A;  4FTX A;  1FIK A;  3T1Q B;  1F2K A;  2JKF A;  5FEF A;  1SZV A;  2B95 A;  1J3W A;  5EM0 A;  1VET B;  1YPR A;  3NUL A;  4FUW A;  2ZL1 A;  5EV0 A;  1K0K A;  4X25 A;  1SKO B;  3DAV A;  4X1M A;  1VEU B;  1ACF A;  2BTF P;  2VK3 A;  4D60 A;  1CF0 A;  2PAV P;  5EM1 A;  2V8F A;  5EVE A;  1Z09 A;  2JKG A;  3MS6 A;  3L9K A;  3T1S A;  1Y4O A;  1FIL A;  1A0K A;  4ESP A;  3CHW P;  3CPT B;  4X1L A;  1VET A;  1G5U A;  3T12 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...