1PRQA

Acanthamoeba castellanii profilin ia
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
125
structure length
125
Chain Sequence
SWQTYVDTNLVGTGAVTQAAILGLDGNTWATSAGFAVTPAQGQTLASAFNNADPIRASGFDLAGVHYVTLRADDRSIYGKKGSAGVITVKTSKSILVGVYNEKIQPGTAANVVEKLADYLIGQGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROFILIN IA
publication title Crystal packing induces a conformational change in profilin-I from Acanthamoeba castellanii.
pubmed doi rcsb
source organism Acanthamoeba castellanii
molecule tags Contractile protein
total genus 34
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 1997-08-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.30 Alpha Beta 2-Layer Sandwich Beta-Lactamase Dynein light chain 2a, cytoplasmic 1prqA00
3T1RA 3DAVA 5EM1A 2JKGA 1SZVA 2BTFP 4X25A 5EV0A 1PNEA 1AWIA 3LEQA 3T12B 1VETA 3LGOA 3L9KA 2HZ5A 2ZL1A 3MS6A 3CPTB 5FEGA 5FEFA 3T1SA 2V8FA 1D1JA 2V8CA 4ESPA 1FIKA 4X1LA 4D60A 1Z09A 1PFLA 1VEUB 4FTXA 4X1MA 5EVEA 1K0KA 3KYEA 5EM0A 4FUWA 2PRFA 1SKOB 3T1QB 1J3WA 3NULA 3CPTA 4QWOA 5FDSA 2JKFA 1FILA 1ACFA 3L7HA 3NECA 1A0KA 2B95A 1CQAA 2PAVP 2VK3A 1CF0A 3U4LP 1F2KA 1PRQA 2E8JA 1VEUA 3CHWP 1HLUP 1SKOA 3D9YA 1CJFA 1VETB 2PBDP 2ZL1B 2ACGA 3MSHA 1Y4OA 3UB5P 1YPRA 1G5UA 3T1XA
chains in the Genus database with same CATH superfamily
1L0EA 3BFGA 3QHYA 4BMWA 2P08A 5CHUA 3T4SA 4NXGA 3VP1A 1S67L 1XFQA 4BLMA 2W3DA 3WS5A 3RFBA 1IFQA 3SS5A 4KZ5A 5FQQA 2RL3A 5J4EA 3T1SA 2ZQ7A 3ZG8B 1D1JA 4IUKA 3HUMA 1RP5A 3A3DA 3DW0A 1MBLA 3N7WA 4S2NA 4A5RA 4DRTA 5GHXA 1PFLA 5F1GA 3A0RA 3N8RA 1N9LA 4I38A 4E6XA 4FCFA 4B4ZA 4P87A 3AGDA 1PIOA 4FOFA 3UB8A 1J3WA 4PAUA 4WL9A 1ALQA 1E25A 4KUKA 5EVIA 1S4SA 3BJNA 1PZPA 1MWUA 1XKZA 1KOUA 3BFEA 2KDKA 4KZ8A 3UPPA 5FI7A 2VK3A 4MBFA 3Q82A 3JYIA 2NUTC 2W1RA 4GS9B 3EGDC 3IF6B 4R3BA 3I7JA 1H8YA 1IKGA 5F82A 1BZAA 3CHWP 1WYBA 3HLDA 2QKPA 5CEDA 1BUEA 1MWRA 3V50A 1OTDA 2WGIA 2HGVA 2PBDP 4XT2A 3V3SA 1S1ZA 4OPZA 2OLVA 3OPHA 3DWZA 2QPNA 4Y3IA 2PR6A 3EQVA 5I94A 3E98A 2XA7S 2J3TD 2Y79A 3HUNA 5TJJA 2EX9A 4DDSA 2DMWA 2W1TB 1YMXA 2I9VA 4ME4A 5DTTA 1MZUA 2FH5A 2WAEA 3GQZA 4MNRA 2EFXA 5FEGA 3IF5A 4WLAA 2ZC5B 4BQMA 2V8CA 1G6AA 3S1YA 5HD3A 3UE6A 2FZ0A 4EBNA 3F1PB 4KQQA 3A0SA 1SDNA 1S1YA 1IYQA 2G7UA 3KSGA 3P98A 5FAQA 2OWHA 4IBRA 2KLIA 4KENB 3GRJA 3W4OA 3M2JA 3UB9A 5FDSA 4Q0JA 3IWOA 3TW8A 2HV1A 4R23A 2M7VA 4OPQA 3BLSA 5J7EA 4B4XA 5A92A 5EECA 3TG9A 1F2KA 5CEBA 1BTLA 4DN0A 3AGEA 1HLUP 1KVLA 5J3WA 1ODVA 3V3RA 1YLWA 3WRZA 2BASA 3MBZA 3MJQA 4JXVA 3SZTA 4EWFA 1N9OA 4RX3A 3UY6A 3LI9A 3MXSA 5HW3A 3VOYA 4FH4A 3MQOA 2EWWA 1H0MA 2VGJA 1ES5A 2DRWA 3OPRA 4EQ1A 1D7EA 3NCKA 2JKTI 2Q9NA 2ZM2A 4HIAA 1IEMA 4CLCA 3LEQA 3C4PA 3MZDA 1VETA 3ZGAB 3E2KA 1MXOA 4LV2A 5FEFA 3ZG9B 4IVIA 3G2YA 4NXEA 2JE5A 3ZVTA 1LLBA 1ES3A 3CAXA 3PBTA 4II7A 5HAIA 4JXGA 5CTMA 3GVBA 4QY5A 1JNUA 4X1MA 3RJUA 3IWQA 3KYEA 2OV5A 1K55C 2ZLYA 5DJTA 1N9BA 1GA9A 2L0WA 3NOTC 4GKUA 3OBFA 4JF6A 4PM7A 4Y13A 4MDZA 1N4OA 3KX0X 5DFYA 1ACFA 3WS4A 2J80A 1KGGA 4X68A 5TGFA 3OPLA 1NLYA 3W2ZA 1P9RA 3H82A 5DTSA 3BY8A 1MKMA 1IYSA 1NLZA 3Q07A 1YM1A 4NEED 2W27A 3PXPA 3DTEA 2OOLA 1K57A 1CK3A 3E0YA 2OWJA 3VOZA 3NDEA 4JGPA 1E3UA 4R6LA 4B9OA 4JLFA 3H9WA 1V9ZA 3UB6A 2GNXA 3V5MA 5L2FA 4CJNA 3G2ZA 2O0YA 4LRZE 2PD8A 5AVFA 1VQQA 3GSGA 3NBLA 3SW1A 1TS7A 4M4XA 5KMWA 2H0YA 2Q0OA 4I3IA 4MCWA 1YLYA 2ZQDA 2A24B 4RVAA 4HBTA 4JKTA 4QY6A 2Q9MA 2V0UA 4KZBA 1LHYA 3VP2A 4HHDA 2Y2KA 4ZAMA 1GHMA 2G2UA 3MR0A 1F9IA 1XJ2A 3QP2A 4PPRA 1L3LA 2V20A 4N1HA 3TSGA 3R7WA 4Q0IA 3LCEA 3ITBA 3MXRA 3ZG7B 1P0ZA 4LPZA 2VX8A 3W4QA 3BM6A 3HJIA 2VJWA 5FQ9A 2JKRM 1XA1A 3PYPA 3HLFA 5KSHA 1Q2QA 3U4LP 1PRQA 4Y2FA 5DF7A 3F1NA 3JPUA 5HAPA 4UQIM 4GN2A 1GSXA 2HDRA 4RA7A 1CJFA 2FFYA 1IYOA 1YLTA 1ZKJA 2WKPA 5HWWA 3VFHA 4GHIA 2PD7A 4IVKA 3A3EA 2GX5A 1PI4A 1XXMA 3N4IA 5F1FA 3C4OA 4HQAA 4JGRA 3DAVA 4HJ3A 5CERA 4LENA 5EE8A 5EVID 3IBJA 4X69A 3BFDA 4G3VA 1BULA 3FPWA 3UMDA 3CWFA 4F3LB 1STZA 2Y91A 3MS6A 3QP5A 3QP8A 1XJ6A 5DKKA 1Y54A 1K6RA 1KDSA 3TRCA 4OOLA 2V8FA 2DCFA 3LIDA 1PWCA 5GL9A 4QB8A 5FDHA 3SOIA 2JKTM 4X1LA 2ZQ9A 3LI8A 3JVUA 4LRXC 4CLCC 1EI5A 5HDDA 2WKHA 1PW1A 4KG5A 3S7PA 3B3XA 1QMFA 3LIEA 3SH8A 4NKPA 5HD5A 5AVEA 4O7DA 2ZM8A 3NI9A 3O86A 3N8LA 3OOVA 4B88A 3PAGA 4IUHA 4ZJ3A 2WGWA 3IWIA 1WE4A 3UN7A 3HVFA 5GLDA 4BBTA 2PYRA 4X55A 1O7EA 2ZQCA 4E3MA 1M6KA 3MKEA 4Y5FA 4E3LA 2CC1A 1DP8A 4EERA 4CPKA 1ESIA 1Q2PA 2PU2A 3PAEA 2WKIA 3EEHA 2G2WA 4EEUA 4I5SA 3GV9A 1NZUA 4GDBA 2OAP1 4Q8IA 3LR5A 4G3WA 4E04A 3IS2A 2XLNA 3PBOA 3IH8A 4HOIA 3VE4A 1G6OA 2OAQ1 1K57C 3V67A 1BYWA 2E8IA 1XFNA 4OVDA 3LO7A 1NYYA 2P9VA 4HH2A 1S66L 5A8BA 3KYQA 4U3TA 2XROA 1XGIA 4R70A 1KE0A 4WEKA 1IKIA 1OTAA 3N8SA 2WKQA 5AQ7A 2QZ6A 2A2LA 1GA0A 4WM9A 4DE0A 3HCYA 5F83A 3DTKA 4X56A 3GMWA 3DBAA 1HTZA 1G28A 1K55A 2GJ3A 5BOHA 3A3IA 4WEJA 4MBHA 3UDXA 3CPTA 3ZQ5A 3OCLA 4WF0A 3K3DA 5FASA 2YKHA 3N6IA 2QYBA 2B95A 4CLCD 1PW8A 2PU4A 4DE1A 2VV6A 3FC7A 1UWPX 4L0LA 1DY6A 2B18A 1SKOA 1PWDA 1SCWA 3CZDA 2QMIA 2ACGA 5FI2A 2ZQAA 4P6ZM 2ZBBA 2ZM0A 3BQAA 3UB5P 5IU1A 3UNWA 5HL1A 5J8XA 2K2NA 3DWKA 3NDGA 3D4FA 2IWBA 5LBRA 5L07A 2V1ZA 5EUAA 1T1AA 5FQJA 3CLOA 5HSQA 4BBUA 4HBUA 1OT6A 1KE3A 1AWIA 1ERMA 3T12B 3LGOA 2ZL1A 4C75A 1OJ5A 1K56A 5DTKA 4C6YA 4X6TA 4OONA 3G35A 4BL3A 1JTGA 1XX2A 5EVIB 3RXXA 1FSWA 1Z6FA 3GDIA 1JTDA 3ZDJA 5GLAA 1RGZA 4JPMA 5CECA 1Z09A 2XF3A 4ID4A 1F5MA 1LI9A 5HFOA 1ZG4A 2WKEA 3BY9A 5HPIA 5E2EA 3UDIA 1MWTA 2YKFA 3IH9A 4K91A 4YINA 3UE1A 3EEAA 1FSYA 3SS4A 1JWPA 4XT2B 3H7WA 2Y4AA 5KZHA 4JF5A 1WYCA 5IS1A 2VA0A 2WAFA 2V0WA 2PAVP 2XH9A 1YQSA 1CF0A 2JKRI 3EGXC 3HLWA 4R0QA 3PR6A 3VOLA 1D06A 2PT7A 1I5QA 5A90A 3VP4A 2INWA 4DJ3A 3VMAA 4N92A 2J9PA 3IXGA 4AFIA 4EUZA 1IELA 4NETA 4DE3A 3NHQA 4PKYG 3S7OA 2C6WB 4P0MA 4E6WA 2ZC4B 3NC8A 3K3CA 2JCHA 1RCJA 3UE0A 4EUVA 1SHVA 1VHMA 1FCOA 3GR2A 4HI4A 3Q7VA 1ES2A 2HJ9C 4PKYA 2QJ7A 3T4JA 2PBYA 1TD5A 4H6JA 4ZJ1A 4YNRA 2Z2MB 1KGEA 4CQHA 2ZMAA 2V1BA 3FZCA 4ESPA 5EOEA 3LIFA 4WZ5A 3IX3A 1OT9A 3OCNA 1ESUA 3G31A 4ETZA 4LRYC 1SDEA 2V1AA 1YLPA 4HEFA 4WELA 2JKFA 1DJAA 2B02A 3G4PA 3MZEA 3WWXA 1YSQA 3LIBA 4JXWA 2JHEA 1CQAA 2VLGA 2HP6A 1CI8A 3LR3A 1OTEA 1VEUA 4LLOB 2B5RA 4DMZA 4U0TA 4WBGA 1TS8A 2Y2MA 1XJ3A 2CMNA 4JXSA 4CLCB 1L0FA 5A93A 3F1OA 1VETB 2ZJ9A 3P01A 5F69A 1G68A 4S2PA 3UB7A 4OP5A 1G5UA 4OQGA 1LI0A 4UA6A 3Q7ZA 3CG5A 3RTYA 3IF6C 1OTBA 3TOIA 3PBQA 4H8RA 2PDRA 1W5DA 2XD1A 1W8YA 4ZDXA 2R78A 2ZOHA 3FKWA 3M6HA 1BLHA 4E3NA 4O01A 5HL6A 4NG2A 4HNBA 2NUPC 4OLGA 3D3OA 3T4KA 3MQQA 4EETB 3G34A 3LYXA 1ZC2A 3H82B 4Z1WA 4EQIA 4KQOA 4PM6A 3ZG0A 4O0PA 5EM0A 2PRFA 2KX6A 2JC7A 2EX6A 3RH8B 2D02A 3BFCA 5C5KA 3A3JA 3L7HA 1A0KA 1L2SA 5DFXA 5E2GA 5GHYA 3O87A 5JYPA 4OKPA 2O9AA 5DF8A 3A0VA 2H10A 3LFVA 1UGUA 4OPRA 3GTCA 4FSFA 3HLCA 4MEZA 4OH0A 1KGFA 1YPRA 1GSVA 4Y17A 4E3OA 4WN5A 2EXBA 2VGLS 4G3KA 1LSXA 3HLBA 3MXQA 2J7VA 3LICA 5CXWA 4FD8A 3WS2A 3QP4A 4KUOA 3EQUA 5F6AA 4N9KA 4MN7A 3ZYTA 4L9EA 1TVFA 2O9BA 2X71A 4DXBA 1LT0A 4LFUA 1W63M 4LV1A 1T1BA 3R7WB 3WS0A 3HLGA 2IWCA 4GCZA 3KSHA 5DKLA 2PYPA 2KOIA 3S4XA 1YT4A 4NK3A 4UHUA 4XUXA 4BBVA 2Y2OA 3IQAA 3F1NB 4R3JA 3NY4A 1OJGA 2EA9A 4BL2A 2XGNA 1Y28A 2EFUA 4DKIA 3IX8A 2RCXA 2XFSA 2Y2GA 4QWOA 4S2OA 4GHIB 2XK1A 1TF1A 3AGFA 3BEBA 3ZNTA 3VSLA 5M18A 3ZNYA 1I2WA 3S22A 4WZ5C 4Z9QA 1C3BA 4XUZA 2E8JA 1VB6A 1FOFA 1DP9A 1WA9A 4OP8A 2W3GA 3O3VA 5D3OA 1MKIA 3WRTA 3UPOA 4KQRA 4EBLA 1BLCA 3E2LA 2ZQ8A 5HDCA 4ARZA 1YLJA 3M2KA 1BSGA 5HPFA 1KVMA 5FATA 1UWNX 3T50A 1PZOA 3LY4A 1JWVA 5MC7A 4MBKA 3Q81A 5A91A 3SS3A 2J3WA 1S0WA 4U0XA 4EV4A 2WYXA 5U47A 3C2WA 2M1CA 4MN6A 2M7UA 3UO9A 4X25A 4X53A 3E4QA 1PNEA 2VZWA 3FWLA 3PBSA 2V2FF 5L10A 2H5SA 1GCEA 1F98A 5KSCA 4UQIS 5L8MA 2X02A 5TBMA 1N9NA 3GECA 2ZC3B 3QNCA 2WGWB 4MLLA 3IHAA 1FCMA 1L0DA 4CLCE 4ZRRA 4HJ6A 2A3UA 2PR5A 3FV7A 1K0KA 3ISGA 4R38A 1OPXA 2XA7M 4PM8A 3LEZA 5EOOA 3HUOA 5GLBA 1XP4A 3NULA 3WS1A 2H0TA 4E3IA 4GDNA 4NXFA 4RYEA 5G4YA 4MN5A 1KE4A 3KO6A 5DF9A 5CHJA 3VSKA 4E3KA 4KZ7A 2XFTA 4HH3A 4R1GA 3IS2B 3G6OA 5TBMB 1MWSA 4BENA 2XR0A 1BLPA 1W7FA 3C8CA 4WMCA 4ZTKA 4S2IA 4OQHA 2P9VB 3BRMA 3HBRA 3W8KA 2XD5A 2OSUA 2O9CA 3IXDA 2WK0A 3T4TA 3B33A 3MQ0A 2MJ6A 1NYMA 1S4RA 3KSIA 3M6BA 5FL3A 3HL9A 4GS9A 3IF6A 1NY0A 2JKGA 5AQAA 4FH2A 1M40A 2ZMFA 3MZFA 1O07A 1DJBA 3R4KA 5FQKA 4S2MA 3OC2A 1NRJA 4PM9A 1JVJA 5CGSA 3BECA 3CPTB 5CX7A 4JGOA 4N1XA 1PI5A 2QJ5A 5CHMA 5FSRA 1MY8A 1V9YA 4YWZA 3NIAA 3IHBA 3OPPA 1K4EA 4F94A 4BWIA 4D60A 4K0WA 2A49A 2D01A 1T1CA 1ZTUA 2Y2PA 4QPRA 3JVVA 5EVEA 4L9FA 1W63Q 3Q1FA 4P85A 2W1TA 4FUWA 1SKOB 3T1QB 3QP6A 3ULFA 3S7NA 4IJGA 4D2OA 4Y0UA 3PBNA 3C5AA 3D72A 4GOGA 4GJ4A 1TS6A 1OMEA 3NECA 3T4QA 5FI6A 2OLUA 3E4PA 3ITAA 4PHTA 2Y2QA 1E3UD 3FG8A 3VFFA 3LUQA 3F1PA 2P7JA 4KQDA 1NZOA 4GD6A 3B47A 1LSWA 4HJ4A 3CJMA 1ONGA 1MPLA 5EVLA 1MC0A 3ZCZA 2BLSA 5TR7A 3CUEA 2ZD8A 2Z2LB 2GDNA 2ZL1B 4K0XA 4EEPA 1P97A 2W3EA 2C5WB 3MMHA 1P9WA 3P09A 3E4OA 2EWVA 5M19A 4KZ4A 5F68A 1HVBA 3O88A 2V9AA 3T1RA 5EM1A 1XJ4A 1SZVA 3IXHA 2XRNA 3CMZA 3VP0A 3L9KA 1NXYA 5IT5A 1ERQA 3H7WB 3W4PA 3TE8A 2Y59A 3UE3A 4UA7A 4BD1A 4P6ZS 1W79A 4DXCA 1TEMA 4ETXA 3FKVA 3G32A 2JN7A 5E43A 1DRMA 2EX8A 1LSVA 1T19A 3ZFZA 1FR6A 3O5YA 2PHYA 2W0NA 1YAXA 1W8QA 3VE3A 2Y2NA 4EW7A 4EU0A 1KDWA 1IYPA 4DDYA 1JWZA 1BT5A 4UAAA 3LR0A 2L1MA 3S7QA 5HZHA 3K2NA 1TS0A 3PTEA 3CI6A 4GNUA 4OPYA 4PM5A 3EOIA 3Q7VB 5HDSA 4GB7A 1TDGA 5DVAA 3BYDA 1K54A 4H6JB 3VV4A 2HDSA 4KZ9A 5G18A 5E2HA 3FPVA 4DE2A 3T1XA 1H8MA 1GSWA 4NXBA 1FR1A 5K5BA 3C7VA 4EBPA 4P6BA 3NOPC 2LB5A 4MMNA 3T4OA 4S2LA 1FQGA 1PYYA 4Y15A 3QNBA 3C7UA 2J8YA 2VGLM 4RX2A 3SH7A 3EWKA 2HPBA 5AQBA 1I2SA 3TJZC 2VGKA 1ES4A 1ZHHB 3HLEA 5I5LA 4QHCA 4S2NC 4S2JA 4OOYA 3DTIA 1H5XA 4OOMA 4B93A 1VEUB 2A24A 4EESA 3V39A 4IHQA 5GHZA 2H28A 1IOUA 1BLSA 4HP4A 1AXBA 3F1OB 3KYZA 3VP3A 4Y7PA 1S6RA 5EVIC 1DJCA 2K31A 3PBRA 5CGXA 2WKRA 2HP9A 1LL5A 2ZOIA 3LY3A 5FAPA 5F5YA 2Z6DA 4XXRA 3IX4A 2K7SA 1E4DA 2I72A 5DJUA 4QD4A 3D9YA 3G30A 5CGWA 4M3KA 1K38A 3C38A 4KG6A 2WADA 3MSHA 3DTMA 1Y4OA 2LB9A 4YFMA 4LCMA 1HD8A 1ZG6A 3BW6A 4R4SA 1XA7A 4QU3A 4GW9A 4I39A 4GD8A 3MFXA 3CITA 5JYOA 2Z6CA 5HX9A 2BG1A 3BQ8A 2XQZA 4LV3A 1TDLA 2WUQA 5HWTA 2HDUA 5AJGA 3CUEC 5E2FA 5M1AA 4JF4A 4HESA 2HJEA 2J9OA 4IEDA 2HF6A 4BD0A 4YOFA 3NOUC 3UMEA 1GHPA 4R3AA 2XSSA 2IA2A 1K4FA 1EROA 2O99A 4UA9A 1NJ4A 2VV7A 2Y55A 1CEGA 2WGVA 4IBXA 3RXWA 5HARA 4OLDA 1J9MA 1ONHA 4HY8A 1QMEA 5L09A 2L4RA 2AVXA 4WYYA 3ZG5A 1OTIA 1FIKA 3LIAA 4O8GA 1T18A 4WMCD 4S2KA 1VM1A 1DP6A 4N9LA 1GHIA 4DJ2A 4FTXA 2P04A 4GZBA 3SH9A 2UWXA 1K6SA 2VEAA 4LV0A 4Y0TA 5KIZA 2FFFB 4F3LA 1LL9A 3ZHHA 4Y0OA 3MKFA 3FYZA 3KSFA 2QWSA 2ZMVA 3BLMA 3HREA 2EXAA 2X01A 2EX2A 2VV8A 1NWZA 1YMSA 1YSPA 3UPNA 2Y2HA 5FQMA 2HP5A 4KZ6A 1H8ZA 5EFWA 4JBFA 4ZJ2A 3ZVWA 4BJPA 2DNSA 4R4RA 2WZXA 4LCLA 3A3FA 3BWLA 3HJKA 5CTNA 2ZC7A 4E3JA 3B42A 3NJAA 4QJGA 4KG2A 4LGWA 1H3QA 1K56D 3ICYA 3C30A 3LR4A 2QHKA 4GLQA 5EPHA 2BTFP 4PMAA 4ZBEA 5EV0A 1K25A 1EW0A 4UEYA 1K54C 5TFQA 2W3HA 2HZ5A 1NRFA 2R9WA 4I3AA 5FAOA 3UDFA 4DF6A 4K08A 1PWGA 2ZC6B 4EXOA 1L0GA 3T4LA 3U2AA 1HZOA 3MF0A 4RQ9A 4OQIA 5CRFA 1YKDA 2WZZA 3IXBA 5FA7A 5HWVA 2JBFA 3IT9A 4HP9A 2W3FA 4JGQA 4L9GA 1XGJA 3IBRA 4WZ4A 3BFFA 1XPBA 4KZAA 2Y8HA 2HDQA 4ARZB 2XEPA 1YLZA 2P74A 1FILA 2GZAA 1CEFA 3QP1A 3OLOA 3P7NA 1U60A 2R9XA 1CI9A 4I3JA 4OQ0A 2XDMA 3MFDA 2J3TC 2UV0E 2Y2JA 5GLCA 1LL8A 3OZHA 5FQIA 1SKFA 2Y2LA 4WUJA 1FCNA 2Y2IA 4KZ3A 4Q0HA 2VKSA 5HAQA 5AQ9A 3PHYA 1RGYA 2IWDA 5IHVA 1EWZA 4C3QA 1X0OA 5G4ZA
chains in the Genus database with same CATH topology
3T1RA 3DAVA 5EM1A 2JKGA 1SZVA 2BTFP 4X25A 5EV0A 1PNEA 1AWIA 3LEQA 3T12B 1VETA 3LGOA 3L9KA 2HZ5A 2ZL1A 3MS6A 3CPTB 5FEGA 5FEFA 3T1SA 2V8FA 1D1JA 2V8CA 4ESPA 1FIKA 4X1LA 4D60A 1Z09A 1PFLA 1VEUB 4FTXA 4X1MA 5EVEA 1K0KA 3KYEA 5EM0A 4FUWA 2PRFA 1SKOB 3T1QB 1J3WA 3NULA 3CPTA 4QWOA 5FDSA 2JKFA 1FILA 1ACFA 3L7HA 3NECA 1A0KA 2B95A 1CQAA 2PAVP 2VK3A 1CF0A 3U4LP 1F2KA 1PRQA 2E8JA 1VEUA 3CHWP 1HLUP 1SKOA 3D9YA 1CJFA 1VETB 2PBDP 2ZL1B 2ACGA 3MSHA 1Y4OA 3UB5P 1YPRA 1G5UA 3T1XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3T1R A;  3DAV A;  5EM1 A;  2JKG A;  1SZV A;  2BTF P;  4X25 A;  5EV0 A;  1PNE A;  1AWI A;  3LEQ A;  3T12 B;  1VET A;  3LGO A;  3L9K A;  2HZ5 A;  2ZL1 A;  3MS6 A;  3CPT B;  5FEG A;  5FEF A;  3T1S A;  2V8F A;  1D1J A;  2V8C A;  4ESP A;  1FIK A;  4X1L A;  4D60 A;  1Z09 A;  1PFL A;  1VEU B;  4FTX A;  4X1M A;  5EVE A;  1K0K A;  3KYE A;  5EM0 A;  4FUW A;  2PRF A;  1SKO B;  3T1Q B;  1J3W A;  3NUL A;  3CPT A;  4QWO A;  5FDS A;  2JKF A;  1FIL A;  1ACF A;  3L7H A;  3NEC A;  1A0K A;  2B95 A;  1CQA A;  2PAV P;  2VK3 A;  1CF0 A;  3U4L P;  1F2K A;  1PRQ A;  2E8J A;  1VEU A;  3CHW P;  1HLU P;  1SKO A;  3D9Y A;  1CJF A;  1VET B;  2PBD P;  2ZL1 B;  2ACG A;  3MSH A;  1Y4O A;  3UB5 P;  1YPR A;  1G5U A;  3T1X A; 
#chains in the Genus database with same CATH topology
 1L0E A;  3BFG A;  3QHY A;  4BMW A;  2P08 A;  5CHU A;  3T4S A;  4NXG A;  3VP1 A;  1S67 L;  1XFQ A;  4BLM A;  2W3D A;  3WS5 A;  3RFB A;  1IFQ A;  3SS5 A;  4KZ5 A;  5FQQ A;  2RL3 A;  5J4E A;  3T1S A;  2ZQ7 A;  3ZG8 B;  1D1J A;  4IUK A;  3HUM A;  1RP5 A;  3A3D A;  3DW0 A;  1MBL A;  3N7W A;  4S2N A;  4A5R A;  4DRT A;  5GHX A;  1PFL A;  5F1G A;  3A0R A;  3N8R A;  1N9L A;  4I38 A;  4E6X A;  4FCF A;  4B4Z A;  4P87 A;  3AGD A;  1PIO A;  4FOF A;  3UB8 A;  1J3W A;  4PAU A;  4WL9 A;  1ALQ A;  1E25 A;  4KUK A;  5EVI A;  1S4S A;  3BJN A;  1PZP A;  1MWU A;  1XKZ A;  1KOU A;  3BFE A;  2KDK A;  4KZ8 A;  3UPP A;  5FI7 A;  2VK3 A;  4MBF A;  3Q82 A;  3JYI A;  2NUT C;  2W1R A;  4GS9 B;  3EGD C;  3IF6 B;  4R3B A;  3I7J A;  1H8Y A;  1IKG A;  5F82 A;  1BZA A;  3CHW P;  1WYB A;  3HLD A;  2QKP A;  5CED A;  1BUE A;  1MWR A;  3V50 A;  1OTD A;  2WGI A;  2HGV A;  2PBD P;  4XT2 A;  3V3S A;  1S1Z A;  4OPZ A;  2OLV A;  3OPH A;  3DWZ A;  2QPN A;  4Y3I A;  2PR6 A;  3EQV A;  5I94 A;  3E98 A;  2XA7 S;  2J3T D;  2Y79 A;  3HUN A;  5TJJ A;  2EX9 A;  4DDS A;  2DMW A;  2W1T B;  1YMX A;  2I9V A;  4ME4 A;  5DTT A;  1MZU A;  2FH5 A;  2WAE A;  3GQZ A;  4MNR A;  2EFX A;  5FEG A;  3IF5 A;  4WLA A;  2ZC5 B;  4BQM A;  2V8C A;  1G6A A;  3S1Y A;  5HD3 A;  3UE6 A;  2FZ0 A;  4EBN A;  3F1P B;  4KQQ A;  3A0S A;  1SDN A;  1S1Y A;  1IYQ A;  2G7U A;  3KSG A;  3P98 A;  5FAQ A;  2OWH A;  4IBR A;  2KLI A;  4KEN B;  3GRJ A;  3W4O A;  3M2J A;  3UB9 A;  5FDS A;  4Q0J A;  3IWO A;  3TW8 A;  2HV1 A;  4R23 A;  2M7V A;  4OPQ A;  3BLS A;  5J7E A;  4B4X A;  5A92 A;  5EEC A;  3TG9 A;  1F2K A;  5CEB A;  1BTL A;  4DN0 A;  3AGE A;  1HLU P;  1KVL A;  5J3W A;  1ODV A;  3V3R A;  1YLW A;  3WRZ A;  2BAS A;  3MBZ A;  3MJQ A;  4JXV A;  3SZT A;  4EWF A;  1N9O A;  4RX3 A;  3UY6 A;  3LI9 A;  3MXS A;  5HW3 A;  3VOY A;  4FH4 A;  3MQO A;  2EWW A;  1H0M A;  2VGJ A;  1ES5 A;  2DRW A;  3OPR A;  4EQ1 A;  1D7E A;  3NCK A;  2JKT I;  2Q9N A;  2ZM2 A;  4HIA A;  1IEM A;  4CLC A;  3LEQ A;  3C4P A;  3MZD A;  1VET A;  3ZGA B;  3E2K A;  1MXO A;  4LV2 A;  5FEF A;  3ZG9 B;  4IVI A;  3G2Y A;  4NXE A;  2JE5 A;  3ZVT A;  1LLB A;  1ES3 A;  3CAX A;  3PBT A;  4II7 A;  5HAI A;  4JXG A;  5CTM A;  3GVB A;  4QY5 A;  1JNU A;  4X1M A;  3RJU A;  3IWQ A;  3KYE A;  2OV5 A;  1K55 C;  2ZLY A;  5DJT A;  1N9B A;  1GA9 A;  2L0W A;  3NOT C;  4GKU A;  3OBF A;  4JF6 A;  4PM7 A;  4Y13 A;  4MDZ A;  1N4O A;  3KX0 X;  5DFY A;  1ACF A;  3WS4 A;  2J80 A;  1KGG A;  4X68 A;  5TGF A;  3OPL A;  1NLY A;  3W2Z A;  1P9R A;  3H82 A;  5DTS A;  3BY8 A;  1MKM A;  1IYS A;  1NLZ A;  3Q07 A;  1YM1 A;  4NEE D;  2W27 A;  3PXP A;  3DTE A;  2OOL A;  1K57 A;  1CK3 A;  3E0Y A;  2OWJ A;  3VOZ A;  3NDE A;  4JGP A;  1E3U A;  4R6L A;  4B9O A;  4JLF A;  3H9W A;  1V9Z A;  3UB6 A;  2GNX A;  3V5M A;  5L2F A;  4CJN A;  3G2Z A;  2O0Y A;  4LRZ E;  2PD8 A;  5AVF A;  1VQQ A;  3GSG A;  3NBL A;  3SW1 A;  1TS7 A;  4M4X A;  5KMW A;  2H0Y A;  2Q0O A;  4I3I A;  4MCW A;  1YLY A;  2ZQD A;  2A24 B;  4RVA A;  4HBT A;  4JKT A;  4QY6 A;  2Q9M A;  2V0U A;  4KZB A;  1LHY A;  3VP2 A;  4HHD A;  2Y2K A;  4ZAM A;  1GHM A;  2G2U A;  3MR0 A;  1F9I A;  1XJ2 A;  3QP2 A;  4PPR A;  1L3L A;  2V20 A;  4N1H A;  3TSG A;  3R7W A;  4Q0I A;  3LCE A;  3ITB A;  3MXR A;  3ZG7 B;  1P0Z A;  4LPZ A;  2VX8 A;  3W4Q A;  3BM6 A;  3HJI A;  2VJW A;  5FQ9 A;  2JKR M;  1XA1 A;  3PYP A;  3HLF A;  5KSH A;  1Q2Q A;  3U4L P;  1PRQ A;  4Y2F A;  5DF7 A;  3F1N A;  3JPU A;  5HAP A;  4UQI M;  4GN2 A;  1GSX A;  2HDR A;  4RA7 A;  1CJF A;  2FFY A;  1IYO A;  1YLT A;  1ZKJ A;  2WKP A;  5HWW A;  3VFH A;  4GHI A;  2PD7 A;  4IVK A;  3A3E A;  2GX5 A;  1PI4 A;  1XXM A;  3N4I A;  5F1F A;  3C4O A;  4HQA A;  4JGR A;  3DAV A;  4HJ3 A;  5CER A;  4LEN A;  5EE8 A;  5EVI D;  3IBJ A;  4X69 A;  3BFD A;  4G3V A;  1BUL A;  3FPW A;  3UMD A;  3CWF A;  4F3L B;  1STZ A;  2Y91 A;  3MS6 A;  3QP5 A;  3QP8 A;  1XJ6 A;  5DKK A;  1Y54 A;  1K6R A;  1KDS A;  3TRC A;  4OOL A;  2V8F A;  2DCF A;  3LID A;  1PWC A;  5GL9 A;  4QB8 A;  5FDH A;  3SOI A;  2JKT M;  4X1L A;  2ZQ9 A;  3LI8 A;  3JVU A;  4LRX C;  4CLC C;  1EI5 A;  5HDD A;  2WKH A;  1PW1 A;  4KG5 A;  3S7P A;  3B3X A;  1QMF A;  3LIE A;  3SH8 A;  4NKP A;  5HD5 A;  5AVE A;  4O7D A;  2ZM8 A;  3NI9 A;  3O86 A;  3N8L A;  3OOV A;  4B88 A;  3PAG A;  4IUH A;  4ZJ3 A;  2WGW A;  3IWI A;  1WE4 A;  3UN7 A;  3HVF A;  5GLD A;  4BBT A;  2PYR A;  4X55 A;  1O7E A;  2ZQC A;  4E3M A;  1M6K A;  3MKE A;  4Y5F A;  4E3L A;  2CC1 A;  1DP8 A;  4EER A;  4CPK A;  1ESI A;  1Q2P A;  2PU2 A;  3PAE A;  2WKI A;  3EEH A;  2G2W A;  4EEU A;  4I5S A;  3GV9 A;  1NZU A;  4GDB A;  2OAP 1;  4Q8I A;  3LR5 A;  4G3W A;  4E04 A;  3IS2 A;  2XLN A;  3PBO A;  3IH8 A;  4HOI A;  3VE4 A;  1G6O A;  2OAQ 1;  1K57 C;  3V67 A;  1BYW A;  2E8I A;  1XFN A;  4OVD A;  3LO7 A;  1NYY A;  2P9V A;  4HH2 A;  1S66 L;  5A8B A;  3KYQ A;  4U3T A;  2XRO A;  1XGI A;  4R70 A;  1KE0 A;  4WEK A;  1IKI A;  1OTA A;  3N8S A;  2WKQ A;  5AQ7 A;  2QZ6 A;  2A2L A;  1GA0 A;  4WM9 A;  4DE0 A;  3HCY A;  5F83 A;  3DTK A;  4X56 A;  3GMW A;  3DBA A;  1HTZ A;  1G28 A;  1K55 A;  2GJ3 A;  5BOH A;  3A3I A;  4WEJ A;  4MBH A;  3UDX A;  3CPT A;  3ZQ5 A;  3OCL A;  4WF0 A;  3K3D A;  5FAS A;  2YKH A;  3N6I A;  2QYB A;  2B95 A;  4CLC D;  1PW8 A;  2PU4 A;  4DE1 A;  2VV6 A;  3FC7 A;  1UWP X;  4L0L A;  1DY6 A;  2B18 A;  1SKO A;  1PWD A;  1SCW A;  3CZD A;  2QMI A;  2ACG A;  5FI2 A;  2ZQA A;  4P6Z M;  2ZBB A;  2ZM0 A;  3BQA A;  3UB5 P;  5IU1 A;  3UNW A;  5HL1 A;  5J8X A;  2K2N A;  3DWK A;  3NDG A;  3D4F A;  2IWB A;  5LBR A;  5L07 A;  2V1Z A;  5EUA A;  1T1A A;  5FQJ A;  3CLO A;  5HSQ A;  4BBU A;  4HBU A;  1OT6 A;  1KE3 A;  1AWI A;  1ERM A;  3T12 B;  3LGO A;  2ZL1 A;  4C75 A;  1OJ5 A;  1K56 A;  5DTK A;  4C6Y A;  4X6T A;  4OON A;  3G35 A;  4BL3 A;  1JTG A;  1XX2 A;  5EVI B;  3RXX A;  1FSW A;  1Z6F A;  3GDI A;  1JTD A;  3ZDJ A;  5GLA A;  1RGZ A;  4JPM A;  5CEC A;  1Z09 A;  2XF3 A;  4ID4 A;  1F5M A;  1LI9 A;  5HFO A;  1ZG4 A;  2WKE A;  3BY9 A;  5HPI A;  5E2E A;  3UDI A;  1MWT A;  2YKF A;  3IH9 A;  4K91 A;  4YIN A;  3UE1 A;  3EEA A;  1FSY A;  3SS4 A;  1JWP A;  4XT2 B;  3H7W A;  2Y4A A;  5KZH A;  4JF5 A;  1WYC A;  5IS1 A;  2VA0 A;  2WAF A;  2V0W A;  2PAV P;  2XH9 A;  1YQS A;  1CF0 A;  2JKR I;  3EGX C;  3HLW A;  4R0Q A;  3PR6 A;  3VOL A;  1D06 A;  2PT7 A;  1I5Q A;  5A90 A;  3VP4 A;  2INW A;  4DJ3 A;  3VMA A;  4N92 A;  2J9P A;  3IXG A;  4AFI A;  4EUZ A;  1IEL A;  4NET A;  4DE3 A;  3NHQ A;  4PKY G;  3S7O A;  2C6W B;  4P0M A;  4E6W A;  2ZC4 B;  3NC8 A;  3K3C A;  2JCH A;  1RCJ A;  3UE0 A;  4EUV A;  1SHV A;  1VHM A;  1FCO A;  3GR2 A;  4HI4 A;  3Q7V A;  1ES2 A;  2HJ9 C;  4PKY A;  2QJ7 A;  3T4J A;  2PBY A;  1TD5 A;  4H6J A;  4ZJ1 A;  4YNR A;  2Z2M B;  1KGE A;  4CQH A;  2ZMA A;  2V1B A;  3FZC A;  4ESP A;  5EOE A;  3LIF A;  4WZ5 A;  3IX3 A;  1OT9 A;  3OCN A;  1ESU A;  3G31 A;  4ETZ A;  4LRY C;  1SDE A;  2V1A A;  1YLP A;  4HEF A;  4WEL A;  2JKF A;  1DJA A;  2B02 A;  3G4P A;  3MZE A;  3WWX A;  1YSQ A;  3LIB A;  4JXW A;  2JHE A;  1CQA A;  2VLG A;  2HP6 A;  1CI8 A;  3LR3 A;  1OTE A;  1VEU A;  4LLO B;  2B5R A;  4DMZ A;  4U0T A;  4WBG A;  1TS8 A;  2Y2M A;  1XJ3 A;  2CMN A;  4JXS A;  4CLC B;  1L0F A;  5A93 A;  3F1O A;  1VET B;  2ZJ9 A;  3P01 A;  5F69 A;  1G68 A;  4S2P A;  3UB7 A;  4OP5 A;  1G5U A;  4OQG A;  1LI0 A;  4UA6 A;  3Q7Z A;  3CG5 A;  3RTY A;  3IF6 C;  1OTB A;  3TOI A;  3PBQ A;  4H8R A;  2PDR A;  1W5D A;  2XD1 A;  1W8Y A;  4ZDX A;  2R78 A;  2ZOH A;  3FKW A;  3M6H A;  1BLH A;  4E3N A;  4O01 A;  5HL6 A;  4NG2 A;  4HNB A;  2NUP C;  4OLG A;  3D3O A;  3T4K A;  3MQQ A;  4EET B;  3G34 A;  3LYX A;  1ZC2 A;  3H82 B;  4Z1W A;  4EQI A;  4KQO A;  4PM6 A;  3ZG0 A;  4O0P A;  5EM0 A;  2PRF A;  2KX6 A;  2JC7 A;  2EX6 A;  3RH8 B;  2D02 A;  3BFC A;  5C5K A;  3A3J A;  3L7H A;  1A0K A;  1L2S A;  5DFX A;  5E2G A;  5GHY A;  3O87 A;  5JYP A;  4OKP A;  2O9A A;  5DF8 A;  3A0V A;  2H10 A;  3LFV A;  1UGU A;  4OPR A;  3GTC A;  4FSF A;  3HLC A;  4MEZ A;  4OH0 A;  1KGF A;  1YPR A;  1GSV A;  4Y17 A;  4E3O A;  4WN5 A;  2EXB A;  2VGL S;  4G3K A;  1LSX A;  3HLB A;  3MXQ A;  2J7V A;  3LIC A;  5CXW A;  4FD8 A;  3WS2 A;  3QP4 A;  4KUO A;  3EQU A;  5F6A A;  4N9K A;  4MN7 A;  3ZYT A;  4L9E A;  1TVF A;  2O9B A;  2X71 A;  4DXB A;  1LT0 A;  4LFU A;  1W63 M;  4LV1 A;  1T1B A;  3R7W B;  3WS0 A;  3HLG A;  2IWC A;  4GCZ A;  3KSH A;  5DKL A;  2PYP A;  2KOI A;  3S4X A;  1YT4 A;  4NK3 A;  4UHU A;  4XUX A;  4BBV A;  2Y2O A;  3IQA A;  3F1N B;  4R3J A;  3NY4 A;  1OJG A;  2EA9 A;  4BL2 A;  2XGN A;  1Y28 A;  2EFU A;  4DKI A;  3IX8 A;  2RCX A;  2XFS A;  2Y2G A;  4QWO A;  4S2O A;  4GHI B;  2XK1 A;  1TF1 A;  3AGF A;  3BEB A;  3ZNT A;  3VSL A;  5M18 A;  3ZNY A;  1I2W A;  3S22 A;  4WZ5 C;  4Z9Q A;  1C3B A;  4XUZ A;  2E8J A;  1VB6 A;  1FOF A;  1DP9 A;  1WA9 A;  4OP8 A;  2W3G A;  3O3V A;  5D3O A;  1MKI A;  3WRT A;  3UPO A;  4KQR A;  4EBL A;  1BLC A;  3E2L A;  2ZQ8 A;  5HDC A;  4ARZ A;  1YLJ A;  3M2K A;  1BSG A;  5HPF A;  1KVM A;  5FAT A;  1UWN X;  3T50 A;  1PZO A;  3LY4 A;  1JWV A;  5MC7 A;  4MBK A;  3Q81 A;  5A91 A;  3SS3 A;  2J3W A;  1S0W A;  4U0X A;  4EV4 A;  2WYX A;  5U47 A;  3C2W A;  2M1C A;  4MN6 A;  2M7U A;  3UO9 A;  4X25 A;  4X53 A;  3E4Q A;  1PNE A;  2VZW A;  3FWL A;  3PBS A;  2V2F F;  5L10 A;  2H5S A;  1GCE A;  1F98 A;  5KSC A;  4UQI S;  5L8M A;  2X02 A;  5TBM A;  1N9N A;  3GEC A;  2ZC3 B;  3QNC A;  2WGW B;  4MLL A;  3IHA A;  1FCM A;  1L0D A;  4CLC E;  4ZRR A;  4HJ6 A;  2A3U A;  2PR5 A;  3FV7 A;  1K0K A;  3ISG A;  4R38 A;  1OPX A;  2XA7 M;  4PM8 A;  3LEZ A;  5EOO A;  3HUO A;  5GLB A;  1XP4 A;  3NUL A;  3WS1 A;  2H0T A;  4E3I A;  4GDN A;  4NXF A;  4RYE A;  5G4Y A;  4MN5 A;  1KE4 A;  3KO6 A;  5DF9 A;  5CHJ A;  3VSK A;  4E3K A;  4KZ7 A;  2XFT A;  4HH3 A;  4R1G A;  3IS2 B;  3G6O A;  5TBM B;  1MWS A;  4BEN A;  2XR0 A;  1BLP A;  1W7F A;  3C8C A;  4WMC A;  4ZTK A;  4S2I A;  4OQH A;  2P9V B;  3BRM A;  3HBR A;  3W8K A;  2XD5 A;  2OSU A;  2O9C A;  3IXD A;  2WK0 A;  3T4T A;  3B33 A;  3MQ0 A;  2MJ6 A;  1NYM A;  1S4R A;  3KSI A;  3M6B A;  5FL3 A;  3HL9 A;  4GS9 A;  3IF6 A;  1NY0 A;  2JKG A;  5AQA A;  4FH2 A;  1M40 A;  2ZMF A;  3MZF A;  1O07 A;  1DJB A;  3R4K A;  5FQK A;  4S2M A;  3OC2 A;  1NRJ A;  4PM9 A;  1JVJ A;  5CGS A;  3BEC A;  3CPT B;  5CX7 A;  4JGO A;  4N1X A;  1PI5 A;  2QJ5 A;  5CHM A;  5FSR A;  1MY8 A;  1V9Y A;  4YWZ A;  3NIA A;  3IHB A;  3OPP A;  1K4E A;  4F94 A;  4BWI A;  4D60 A;  4K0W A;  2A49 A;  2D01 A;  1T1C A;  1ZTU A;  2Y2P A;  4QPR A;  3JVV A;  5EVE A;  4L9F A;  1W63 Q;  3Q1F A;  4P85 A;  2W1T A;  4FUW A;  1SKO B;  3T1Q B;  3QP6 A;  3ULF A;  3S7N A;  4IJG A;  4D2O A;  4Y0U A;  3PBN A;  3C5A A;  3D72 A;  4GOG A;  4GJ4 A;  1TS6 A;  1OME A;  3NEC A;  3T4Q A;  5FI6 A;  2OLU A;  3E4P A;  3ITA A;  4PHT A;  2Y2Q A;  1E3U D;  3FG8 A;  3VFF A;  3LUQ A;  3F1P A;  2P7J A;  4KQD A;  1NZO A;  4GD6 A;  3B47 A;  1LSW A;  4HJ4 A;  3CJM A;  1ONG A;  1MPL A;  5EVL A;  1MC0 A;  3ZCZ A;  2BLS A;  5TR7 A;  3CUE A;  2ZD8 A;  2Z2L B;  2GDN A;  2ZL1 B;  4K0X A;  4EEP A;  1P97 A;  2W3E A;  2C5W B;  3MMH A;  1P9W A;  3P09 A;  3E4O A;  2EWV A;  5M19 A;  4KZ4 A;  5F68 A;  1HVB A;  3O88 A;  2V9A A;  3T1R A;  5EM1 A;  1XJ4 A;  1SZV A;  3IXH A;  2XRN A;  3CMZ A;  3VP0 A;  3L9K A;  1NXY A;  5IT5 A;  1ERQ A;  3H7W B;  3W4P A;  3TE8 A;  2Y59 A;  3UE3 A;  4UA7 A;  4BD1 A;  4P6Z S;  1W79 A;  4DXC A;  1TEM A;  4ETX A;  3FKV A;  3G32 A;  2JN7 A;  5E43 A;  1DRM A;  2EX8 A;  1LSV A;  1T19 A;  3ZFZ A;  1FR6 A;  3O5Y A;  2PHY A;  2W0N A;  1YAX A;  1W8Q A;  3VE3 A;  2Y2N A;  4EW7 A;  4EU0 A;  1KDW A;  1IYP A;  4DDY A;  1JWZ A;  1BT5 A;  4UAA A;  3LR0 A;  2L1M A;  3S7Q A;  5HZH A;  3K2N A;  1TS0 A;  3PTE A;  3CI6 A;  4GNU A;  4OPY A;  4PM5 A;  3EOI A;  3Q7V B;  5HDS A;  4GB7 A;  1TDG A;  5DVA A;  3BYD A;  1K54 A;  4H6J B;  3VV4 A;  2HDS A;  4KZ9 A;  5G18 A;  5E2H A;  3FPV A;  4DE2 A;  3T1X A;  1H8M A;  1GSW A;  4NXB A;  1FR1 A;  5K5B A;  3C7V A;  4EBP A;  4P6B A;  3NOP C;  2LB5 A;  4MMN A;  3T4O A;  4S2L A;  1FQG A;  1PYY A;  4Y15 A;  3QNB A;  3C7U A;  2J8Y A;  2VGL M;  4RX2 A;  3SH7 A;  3EWK A;  2HPB A;  5AQB A;  1I2S A;  3TJZ C;  2VGK A;  1ES4 A;  1ZHH B;  3HLE A;  5I5L A;  4QHC A;  4S2N C;  4S2J A;  4OOY A;  3DTI A;  1H5X A;  4OOM A;  4B93 A;  1VEU B;  2A24 A;  4EES A;  3V39 A;  4IHQ A;  5GHZ A;  2H28 A;  1IOU A;  1BLS A;  4HP4 A;  1AXB A;  3F1O B;  3KYZ A;  3VP3 A;  4Y7P A;  1S6R A;  5EVI C;  1DJC A;  2K31 A;  3PBR A;  5CGX A;  2WKR A;  2HP9 A;  1LL5 A;  2ZOI A;  3LY3 A;  5FAP A;  5F5Y A;  2Z6D A;  4XXR A;  3IX4 A;  2K7S A;  1E4D A;  2I72 A;  5DJU A;  4QD4 A;  3D9Y A;  3G30 A;  5CGW A;  4M3K A;  1K38 A;  3C38 A;  4KG6 A;  2WAD A;  3MSH A;  3DTM A;  1Y4O A;  2LB9 A;  4YFM A;  4LCM A;  1HD8 A;  1ZG6 A;  3BW6 A;  4R4S A;  1XA7 A;  4QU3 A;  4GW9 A;  4I39 A;  4GD8 A;  3MFX A;  3CIT A;  5JYO A;  2Z6C A;  5HX9 A;  2BG1 A;  3BQ8 A;  2XQZ A;  4LV3 A;  1TDL A;  2WUQ A;  5HWT A;  2HDU A;  5AJG A;  3CUE C;  5E2F A;  5M1A A;  4JF4 A;  4HES A;  2HJE A;  2J9O A;  4IED A;  2HF6 A;  4BD0 A;  4YOF A;  3NOU C;  3UME A;  1GHP A;  4R3A A;  2XSS A;  2IA2 A;  1K4F A;  1ERO A;  2O99 A;  4UA9 A;  1NJ4 A;  2VV7 A;  2Y55 A;  1CEG A;  2WGV A;  4IBX A;  3RXW A;  5HAR A;  4OLD A;  1J9M A;  1ONH A;  4HY8 A;  1QME A;  5L09 A;  2L4R A;  2AVX A;  4WYY A;  3ZG5 A;  1OTI A;  1FIK A;  3LIA A;  4O8G A;  1T18 A;  4WMC D;  4S2K A;  1VM1 A;  1DP6 A;  4N9L A;  1GHI A;  4DJ2 A;  4FTX A;  2P04 A;  4GZB A;  3SH9 A;  2UWX A;  1K6S A;  2VEA A;  4LV0 A;  4Y0T A;  5KIZ A;  2FFF B;  4F3L A;  1LL9 A;  3ZHH A;  4Y0O A;  3MKF A;  3FYZ A;  3KSF A;  2QWS A;  2ZMV A;  3BLM A;  3HRE A;  2EXA A;  2X01 A;  2EX2 A;  2VV8 A;  1NWZ A;  1YMS A;  1YSP A;  3UPN A;  2Y2H A;  5FQM A;  2HP5 A;  4KZ6 A;  1H8Z A;  5EFW A;  4JBF A;  4ZJ2 A;  3ZVW A;  4BJP A;  2DNS A;  4R4R A;  2WZX A;  4LCL A;  3A3F A;  3BWL A;  3HJK A;  5CTN A;  2ZC7 A;  4E3J A;  3B42 A;  3NJA A;  4QJG A;  4KG2 A;  4LGW A;  1H3Q A;  1K56 D;  3ICY A;  3C30 A;  3LR4 A;  2QHK A;  4GLQ A;  5EPH A;  2BTF P;  4PMA A;  4ZBE A;  5EV0 A;  1K25 A;  1EW0 A;  4UEY A;  1K54 C;  5TFQ A;  2W3H A;  2HZ5 A;  1NRF A;  2R9W A;  4I3A A;  5FAO A;  3UDF A;  4DF6 A;  4K08 A;  1PWG A;  2ZC6 B;  4EXO A;  1L0G A;  3T4L A;  3U2A A;  1HZO A;  3MF0 A;  4RQ9 A;  4OQI A;  5CRF A;  1YKD A;  2WZZ A;  3IXB A;  5FA7 A;  5HWV A;  2JBF A;  3IT9 A;  4HP9 A;  2W3F A;  4JGQ A;  4L9G A;  1XGJ A;  3IBR A;  4WZ4 A;  3BFF A;  1XPB A;  4KZA A;  2Y8H A;  2HDQ A;  4ARZ B;  2XEP A;  1YLZ A;  2P74 A;  1FIL A;  2GZA A;  1CEF A;  3QP1 A;  3OLO A;  3P7N A;  1U60 A;  2R9X A;  1CI9 A;  4I3J A;  4OQ0 A;  2XDM A;  3MFD A;  2J3T C;  2UV0 E;  2Y2J A;  5GLC A;  1LL8 A;  3OZH A;  5FQI A;  1SKF A;  2Y2L A;  4WUJ A;  1FCN A;  2Y2I A;  4KZ3 A;  4Q0H A;  2VKS A;  5HAQ A;  5AQ9 A;  3PHY A;  1RGY A;  2IWD A;  5IHV A;  1EWZ A;  4C3Q A;  1X0O A;  5G4Z A; 
#chains in the Genus database with same CATH homology
 3T1R A;  3DAV A;  5EM1 A;  2JKG A;  1SZV A;  2BTF P;  4X25 A;  5EV0 A;  1PNE A;  1AWI A;  3LEQ A;  3T12 B;  1VET A;  3LGO A;  3L9K A;  2HZ5 A;  2ZL1 A;  3MS6 A;  3CPT B;  5FEG A;  5FEF A;  3T1S A;  2V8F A;  1D1J A;  2V8C A;  4ESP A;  1FIK A;  4X1L A;  4D60 A;  1Z09 A;  1PFL A;  1VEU B;  4FTX A;  4X1M A;  5EVE A;  1K0K A;  3KYE A;  5EM0 A;  4FUW A;  2PRF A;  1SKO B;  3T1Q B;  1J3W A;  3NUL A;  3CPT A;  4QWO A;  5FDS A;  2JKF A;  1FIL A;  1ACF A;  3L7H A;  3NEC A;  1A0K A;  2B95 A;  1CQA A;  2PAV P;  2VK3 A;  1CF0 A;  3U4L P;  1F2K A;  1PRQ A;  2E8J A;  1VEU A;  3CHW P;  1HLU P;  1SKO A;  3D9Y A;  1CJF A;  1VET B;  2PBD P;  2ZL1 B;  2ACG A;  3MSH A;  1Y4O A;  3UB5 P;  1YPR A;  1G5U A;  3T1X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...