1YMSA

X-ray crystallographic structure of ctx-m-9 beta-lactamase complexed with nafcinin-like boronic acid inhibitor
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
263
structure length
263
Chain Sequence
QTSAVQQKLAALEKSSGGRLGVALIDTADNTQVLYRGDERFPMCSTSKVMAAAAVLKQSETQKQLLNQPVEIKPADLVNYNPIAEKHVNGTMTLAELSAAALQYSDNTAMNKLIAQLGGPGGVTAFARAIGDETFRLDRTEPTLNTAIPGDPRDTTTPRAMAQTLRQLTLGHALGETQRAQLVTWLKGNTTGAASIRAGLPTSWTAGDKTGSGDYGTTNDIAVIWPQGRAPLVLVTYFTQPQQNAESRRDVLASAARIIAEGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords beta-lactamase CTX-M-9
publication title Structure, Function, and Inhibition along the Reaction Coordinate of CTX-M beta-Lactamases.
pubmed doi rcsb
source organism Escherichia coli
total genus 97
structure length 263
sequence length 263
chains with identical sequence B
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2005-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 1ymsA00
3G2YA 1BLSA 4ZBEA 3NY4A 1BLHA 1JWZA 3ZHHA 4JPMA 3ZCZA 3UDIA 5JYOA 3CJMA 5HAQA 3W4PA 1JTGA 1ES3A 1G6AA 5GHZA 1CEGA 1DJAA 4BLMA 4K0XA 1NYMA 1JWPA 3P98A 4C3QA 3VSKA 4OQIA 3UPPA 1Q2QA 2WKEA 2ZC7A 3Q07A 3HREA 4X68A 3QHYA 1PI5A 1XP4A 2Y4AA 1K25A 2ZMAA 4PM6A 2Y59A 4XUZA 3IHAA 2Z2LB 3UPOA 4OPYA 3S1YA 5TFQA 1PW1A 3M2JA 4JXWA 4WZ5C 3HLEA 5AQBA 3QNCA 4OLGA 1LI9A 1WE4A 4QY6A 5F1FA 4E3JA 1HVBA 3BFGA 4S2NC 2A49A 3EQVA 3IXHA 4WMCA 2XQZA 4JF4A 3ZG9B 1I2SA 2P74A 4P87A 2B5RA 1ONHA 3OPHA 4OONA 1L0GA 1DJBA 5F1GA 3MZDA 5CGWA 4OQ0A 3IHBA 1BULA 3VOZA 2XGNA 4IEDA 3HLDA 5CTMA 3TOIA 4OOYA 2VGJA 4JLFA 5GLCA 5BOHA 3MFDA 1IKGA 3MZFA 4B4ZA 5HAPA 4FH2A 3VOYA 3E2LA 3IWIA 1YLWA 4JXGA 1BUEA 4R1GA 4GB7A 3N8SA 1IYOA 4XXRA 3ZG0A 4BD1A 4WM9A 1ONGA 1RGZA 3V50A 2WAEA 2R9WA 5DTSA 4ZTKA 3MBZA 4OH0A 5HX9A 2FFYA 2Y2GA 2V20A 3G2ZA 3O86A 5FQMA 3UDXA 5A93A 1W5DA 5FI7A 4DXBA 4U0XA 1IELA 1ZG4A 3N7WA 2HDSA 5FQKA 4E3OA 3Q7VB 4YINA 3G32A 4OPZA 5M1AA 2X01A 4GN2A 5FI2A 1MXOA 2EXAA 1YT4A 3OPRA 3NBLA 4WEJA 1CK3A 1K38A 4B4XA 1ESIA 1TVFA 3PBRA 2Y2OA 3UE3A 4JXSA 4PM9A 1W8YA 2ZC3B 1C3BA 5E2FA 4P85A 3A3JA 3JYIA 4NK3A 4UAAA 5EVIA 3VP1A 1IYPA 1EROA 4KQQA 1ES4A 1BTLA 2Y2KA 3QNBA 2XF3A 3GTCA 3CZDA 1KVMA 4KG2A 4OVDA 5EOEA 1BSGA 3BRMA 4BL3A 2ZJ9A 3N8RA 1K4FA 3RJUA 1K56A 1SDNA 1N4OA 5CHJA 5D3OA 3E2KA 3AGDA 1W8QA 2ZC4B 2EXBA 4UA6A 1GCEA 3OCNA 5A92A 3G35A 3M6HA 1WYBA 1CI9A 3O88A 3LO7A 5CGXA 2J9OA 1L0EA 3G4PA 2Q9NA 2C6WB 1QMEA 3FZCA 2G2WA 2Y91A 4LV1A 1K57C 2HP9A 4KQRA 5FAQA 3S22A 4M3KA 1CEFA 4GDBA 4MBHA 3SH9A 5CERA 5E2GA 2H0TA 3AGEA 2ZM8A 3LY3A 4R3JA 1NJ4A 4LENA 3IF6C 3ZGAB 3HLGA 1SDEA 2PBYA 5GLBA 4K0WA 4QHCA 5E43A 3OPPA 3P09A 2Y2JA 2WAFA 4YFMA 4EUZA 4EV4A 1PYYA 4OKPA 2H10A 3DW0A 4ZDXA 1YLZA 2WK0A 4P0MA 3DTMA 1WYCA 1FOFA 1CI8A 4LV0A 5HL1A 3OZHA 4BJPA 3C5AA 4R3BA 4CPKA 2ZQ8A 1TDLA 1BLPA 2JE5A 2ZM0A 1TEMA 4OOLA 3PAEA 5FAPA 4DE1A 1YLYA 4QD4A 1EI5A 4XUXA 2X02A 2Z2MB 4R4RA 4OPRA 1H8ZA 4KENB 4KG5A 3BEBA 5EUAA 4MNRA 4OP8A 1KE0A 3NDEA 1OMEA 4C75A 5FDHA 5AQ7A 4IBRA 3WRZA 4DKIA 3A3IA 2HDRA 4FD8A 2E8IA 4OPQA 1E3UA 2IWBA 2WADA 1KE4A 2EX6A 4PM5A 1O07A 4JF6A 3ZVWA 5HW3A 4KZ7A 4EBLA 1ZG6A 1SCWA 1XGJA 4KZ8A 1YMSA 1Y54A 3NDGA 3SOIA 4S2MA 1K54A 1LL5A 2ZLYA 4S2NA 2WGWB 2ZQ9A 1KDWA 1Q2PA 4L0LA 3VFFA 1H5XA 3NCKA 3BFCA 5E2HA 1RCJA 1NZUA 5GL9A 4S2JA 1K4EA 2WGIA 3VP2A 1FR1A 4KZ9A 5G18A 4ID4A 2WUQA 4OOMA 4D2OA 2WGVA 2HPBA 3M2KA 3NI9A 4FCFA 5GLDA 3C7VA 1GHPA 1JVJA 1JWVA 3OCLA 3TSGA 3UE0A 3WS5A 5EOOA 5DVAA 2OSUA 2DCFA 2Y55A 1K55A 1KGEA 1SKFA 3AGFA 5CTNA 4DXCA 5GLAA 3BM6A 1PI4A 5GHYA 5EVID 3D4FA 3EQUA 5CXWA 3HBRA 4N9LA 4GD6A 2P9VB 3BECA 4IVIA 4Y0UA 5FI6A 4QJGA 2HP5A 1MY8A 1DY6A 1XXMA 3Q7VA 3Q7ZA 1LL9A 4LV3A 4PMAA 3G31A 5HFOA 5KZHA 4WYYA 3VP0A 3W4QA 1BZAA 1KE3A 1W79A 4PM8A 5A90A 1E4DA 3ITBA 5KSCA 3SS5A 3WS2A 4DE0A 1FQGA 2BG1A 4GZBA 4QY5A 2JC7A 4KZ6A 1YQSA 4MBFA 4RA7A 1ES2A 4A5RA 2Q9MA 1BT5A 2PU4A 1FCMA 1L0FA 1GA9A 1IYQA 3VP4A 3ZG5A 1I5QA 5A91A 1PWCA 4GNUA 3UDFA 1G68A 2JBFA 1U60A 2V1ZA 2V2FF 2DNSA 1ERMA 2ZQCA 3HLBA 4RX3A 1QMFA 4H8RA 4KZ5A 1SHVA 5EVIC 1PZOA 2A3UA 3HVFA 5DF9A 4WZ4A 2DRWA 3GMWA 4RVAA 4P6BA 5L2FA 4HBUA 4S2KA 5CEDA 1IEMA 1JTDA 1M40A 4FSFA 3FKVA 1I2WA 4PPRA 3TG9A 5E2EA 3NIAA 2Y2PA 3WS1A 4ZJ2A 2G2UA 3A3EA 3HL9A 4S2PA 1FCNA 2ZC5B 5M18A 2XD5A 5IHVA 4E3IA 3FWLA 1PW8A 3MKEA 3N6IA 4IVKA 5EECA 2Y2IA 3IWQA 4E3LA 3LEZA 2BLSA 1K57A 4RYEA 4BD0A 3GSGA 2J9PA 4FH4A 3ZFZA 4R0QA 5JYPA 3W8KA 1K6SA 1YM1A 4DF6A 2XR0A 1W7FA 4B88A 5FA7A 5FQJA 3NC8A 2X71A 3BFDA 1YLTA 3IXDA 1MWTA 5M19A 3BLMA 4N92A 2RCXA 3RXXA 2EFUA 3IF6B 5FAOA 2R9XA 3CG5A 4R4SA 3IH9A 4X6TA 5CEBA 5FATA 3ISGA 4KG6A 4NETA 4DDYA 3IH8A 4HBTA 4QU3A 4BQMA 4EBNA 3WRTA 1MBLA 1EWZA 2XLNA 3C7UA 3HUMA 3IXBA 3MZEA 4OP5A 1PWGA 2XK1A 1XA1A 4WMCD 3HUOA 1BLCA 4CJNA 3O3VA 4PM7A 3PBTA 3UE1A 3PAGA 3PBQA 3WS4A 1O7EA 4Z9QA 1TDGA 4LCLA 1KVLA 1XA7A 4OQHA 1XX2A 4X55A 5KSHA 3GRJA 3FYZA 4N1HA 1YLPA 2JCHA 3B3XA 3O87A 1ERQA 4F94A 3ZNTA 3Q82A 3WWXA 4X56A 3HLFA 3V3RA 4K91A 4JKTA 1ALQA 3SS4A 4IBXA 4EBPA 2Y2QA 4KZAA 1PIOA 3IF5A 4KZ4A 1E25A 5FQ9A 1FR6A 5TR7A 2ZQDA 1N9BA 3OC2A 4U3TA 4WZ5A 1IKIA 4S2IA 5CECA 1XPBA 3A3DA 1L2SA 1AXBA 3V3SA 2RL3A 1H8YA 3OPLA 3PBSA 4E6XA 1MWRA 3PBOA 4E6WA 2WGWA 5TGFA 1ZC2A 3IXGA 5DTKA 3FKWA 3N8LA 1LHYA 1IYSA 2QMIA 3VFHA 1K54C 5FASA 2FFFB 3S4XA 4GKUA 3W4OA 1L0DA 4JF5A 1DJCA 5GHXA 5F83A 1KGGA 2XH9A 5HARA 5I94A 2QPNA 4ZJ1A 1ES5A 1KDSA 2WKHA 2ZQ7A 3G30A 4LCMA 1ESUA 4LV2A 2HP6A 1XKZA 1S6RA 2ZD8A 3UPNA 3M6BA 4UA9A 5CRFA 4KZBA 4MEZA 2H0YA 4S2OA 1VQQA 4WELA 1MKIA 2Y2MA 1MWUA 1YMXA 2P9VA 3GVBA 5CHMA 4DE3A 1GHIA 5EE8A 2OLVA 5EVLA 2WKIA 1K55C 2OLUA 2ZM2A 3UO9A 3ZG8B 5EPHA 3V39A 4X69A 1K56D 4UA7A 3A3FA 2IWCA 4RX2A 3HLWA 3BFEA 4WBGA 3WS0A 4BENA 2VGKA 3ZVTA 2EX2A 3BYDA 3DWZA 4ZAMA 1NZOA 2WZZA 3IQAA 3MXRA 5FQIA 5HAIA 4E3NA 4Q8IA 5F82A 4DE2A 3BFFA 2EX8A 4E3KA 4Y0TA 1GHMA 2GDNA 1MWSA 5J8XA 2PU2A 2H5SA 2XFSA 3IT9A 2IWDA 4OQGA 5CGSA 4DDSA 1HTZA 3SH7A 5CHUA 5FSRA 1FCOA 4MBKA 1KGFA 3LCEA 3MKFA 4N9KA 3VSLA 4BL2A 1M6KA 1MPLA 4C6YA 4O7DA 2Y2HA 2WYXA 2HDUA 2WZXA 3GR2A 4EQIA 1LLBA 3LY4A 2OV5A 5EVIB 4X53A 1ZKJA 1LI0A 1RP5A 1S0WA 4R23A 4WEKA 1GA0A 2J8YA 1NRFA 3HUNA 4QB8A 4U0TA 5DTTA 3VP3A 4EWFA 5DF8A 2XD1A 5FQQA 1FSYA 4N1XA 4ZJ3A 5AQAA 3V5MA 1J9MA 3CMZA 4JXVA 3HLCA 3I7JA 4UHUA 3G34A 3PBNA 4GD8A 4KZ3A 2CC1A 1HZOA 2I72A 1YLJA 3BLSA 3VMAA 3N4IA 4MLLA 1PWDA 1Z6FA 3ZG7B 4S2LA 3C4OA 3Q81A 3ITAA 2C5WB 3SS3A 3PTEA 1NXYA 3GV9A 4HESA 4JBFA 5U47A 3RXWA 4KQOA 1FSWA 4Y7PA 2HDQA 3IF6A 3ZNYA 2XEPA 1XGIA 3C4PA 2EX9A 5DF7A 3UNWA 4E3MA 2Y2NA 4OLDA 1E3UD 1K6RA 2ZQAA 1NYYA 1HD8A 1NY0A 2XDMA 3Q1FA 2QZ6A 4DRTA 2UWXA 3DWKA 2Y2LA 2J7VA 1VM1A 1RGYA 2ZC6B 4GOGA 3MXSA 3UY6A 2XFTA 3GQZA 5KMWA 3FV7A 3UN7A 4Y0OA 3SH8A 1PZPA 4GDNA 4HEFA 3ZDJA 2EFXA 3IWOA 5AQ9A
chains in the Genus database with same CATH superfamily
3G2YA 3FC7A 3NY4A 3ULFA 3UDIA 1ES3A 3NJAA 1CEGA 4K0XA 2PBDP 4OQIA 3C2WA 2YKHA 5FEGA 3QHYA 1PI5A 1XP4A 1K25A 3KX0X 4R70A 2Z2LB 3UPOA 4OPYA 3S1YA 2DMWA 3E4PA 4WZ5C 4OLGA 5HDDA 1WE4A 2V0WA 4QY6A 1YSQA 4S2NC 3EQVA 4P87A 2B5RA 3OPHA 4OONA 1DJBA 5F1GA 4L9FA 3IHBA 3VOZA 2XGNA 3TOIA 4OOYA 1IKGA 3OBFA 1IYOA 4XXRA 5DTSA 4H6JB 4ZTKA 3H7WB 4OH0A 5HX9A 1J3WA 5A93A 3UDXA 3PXPA 1W5DA 4IHQA 4DXBA 4O0PA 3U2AA 4LRYC 1ZG4A 1TS7A 2ZL1B 3IX8A 3OPRA 1CK3A 1K38A 1ESIA 1V9YA 3MSHA 4NXGA 1W8YA 3JYIA 4HIAA 1EROA 4KQQA 3QNBA 2Y79A 1P0ZA 4OVDA 3BRMA 2ZJ9A 2VGLM 5IT5A 3RJUA 1SDNA 5D3OA 3IBJA 3E2KA 3IS2A 4UA6A 3LR3A 1L0EA 2Y91A 4LV1A 2HP9A 5G4ZA 4EQ1A 4M3KA 2R78A 4GDBA 5CERA 2ZM8A 2HV1A 3IF6C 3ZGAB 3HLGA 5GLBA 3CHWP 4K0WA 4QHCA 3CUEC 2PYPA 3P09A 4YFMA 4OKPA 3G6OA 3SZTA 2H10A 4P0MA 2GJ3A 2M7UA 3OZHA 5HD5A 4BJPA 3C5AA 5L07A 2ZQ8A 1TDLA 1NLZA 3DTEA 1YLYA 4UQIM 4QD4A 1EI5A 4XUXA 3JVVA 4KG5A 5EUAA 4MNRA 3LICA 1OMEA 4PHTA 3WRZA 5EM1A 2V1BA 2VZWA 5LBRA 2WADA 4PM5A 5HW3A 1SCWA 1OT9A 5TBMB 1T19A 4S2MA 4S2NA 4DJ2A 1H8MA 1Q2PA 3VFFA 4HOIA 5FEFA 4GLQA 2WGIA 5DKKA 2WUQA 4OOMA 4FCFA 2WKPA 2J80A 3TSGA 3WS5A 1K55A 1MKMA 1PI4A 5GHYA 3LI8A 3R7WB 4N9LA 2P9VB 2HP5A 1MY8A 5J3WA 1DY6A 3Q7VA 4LV3A 2INWA 4G3WA 4Y5FA 1OTEA 4F3LB 1CJFA 4Y13A 1YKDA 4GZBA 3OOVA 3RFBA 2JC7A 4KZ6A 1PNEA 4MBFA 3EEAA 4A5RA 4RQ9A 2PU4A 1FCMA 1L0FA 1GA9A 5A91A 1PWCA 1DP8A 1D7EA 4RX3A 4H8RA 1SHVA 1ODVA 4ARZB 1PRQA 1PZOA 2A3UA 3HVFA 3KSIA 4WZ4A 4GHIB 5L2FA 5CEDA 2VLGA 1JTDA 3HJKA 2LB5A 3TG9A 5HZHA 2Y2PA 1G6OA 2B02A 2E8JA 1FCNA 2ZC5B 3FWLA 5EECA 2BASA 3LEZA 2BLSA 4R0QA 3RH8B 4DF6A 5FA7A 2X71A 5HWWA 3BLMA 4QWOA 2HGVA 3IF6B 1XFNA 3IBRA 4X6TA 4KG6A 3CUEA 2V1AA 2XLNA 3C7UA 1PWGA 1FILA 1BLCA 4R38A 2VGLS 1NWZA 3WS4A 5DFXA 4Z9QA 1TDGA 4G3VA 1XA7A 4OQHA 1UWNX 4ESPA 3A0VA 3FYZA 1YLPA 3B3XA 3O87A 1W63M 4F94A 2VV8A 3WWXA 3HLFA 1ALQA 3H82B 4KZ4A 1PIOA 2J3WA 1FR6A 1N9BA 1N9NA 1IKIA 4S2IA 5CECA 5J7EA 3OPLA 1MWRA 1N9LA 3V67A 5DTKA 1T1CA 1IYSA 4HP9A 1G5UA 4GKUA 4JF5A 4R3AA 1ES5A 1FIKA 3LIEA 1XKZA 1S6RA 2ZD8A 3UPNA 3M6BA 4UQIS 1XFQA 2Y2MA 5CHMA 3KSHA 3E0YA 2WKIA 2OLUA 4X1MA 3V39A 4UA7A 4BBVA 2W1TA 3TJZC 3DWZA 4Q8IA 2B95A 2GDNA 2XFSA 2A24A 1KGFA 4N9KA 5HDCA 3E4OA 4C6YA 2NUTC 2W0NA 2HDUA 4FOFA 3LIFA 4YWZA 1ZKJA 3S7QA 4R23A 2J8YA 3VP3A 3QP8A 4PAUA 5DF8A 2FZ0A 5HWVA 1GSXA 3V5MA 3CMZA 4EW7A 3I7JA 4UHUA 2CC1A 1HZOA 5L10A 3VMAA 4MLLA 3ZG7B 3C4OA 3Q81A 1S4RA 2CMNA 4HESA 5EFWA 4FTXA 1FSWA 3F1PA 3MMHA 2EX9A 5DF7A 3UNWA 4E3MA 2Y2NA 1E3UD 2ZQAA 1F5MA 4JGQA 2HZ5A 1RGYA 2ZC6B 3MXSA 3NECA 3GQZA 3EEHA 4Y0OA 3SH8A 2JKRI 3IWOA 5AQ9A 4ZBEA 1BLHA 3CJMA 5HAQA 5GHZA 4ETXA 2GX5A 4E04A 3ICYA 1JWPA 3P98A 3PHYA 2PR5A 4QPRA 2WKEA 2ZC7A 2Y4AA 4PM6A 2Y59A 4XUZA 2XROA 3CLOA 1PW1A 4JXWA 4GCZA 5AQBA 5F1FA 3T4JA 3IXHA 3ZG9B 1ONHA 5F68A 1XJ3A 5CTMA 5BOHA 3MZFA 4B4ZA 3UMEA 4FH2A 3E2LA 3IWIA 3LIBA 1BUEA 3UB8A 4R1GA 4GB7A 1VETB 3V50A 5EVEA 1UWPX 2FFYA 2Y2GA 3O86A 5FQMA 3E4QA 3CI6A 3KO6A 2FH5A 1A0KA 1N9OA 4E3OA 2BTFP 5M1AA 2P04A 5FI2A 1MXOA 2EXAA 3KYQA 3NBLA 1CF0A 1TVFA 3PBRA 3JVUA 5E2FA 4UEYA 4P85A 4UAAA 4NK3A 1BTLA 3CPTA 2XF3A 3GTCA 3CZDA 3LUQA 1Z09A 4KG2A 3EOIA 4BL3A 4BMWA 1K4FA 2ZOIA 3AGDA 1W8QA 4EUVA 1GCEA 3M6HA 1WYBA 1CI9A 3LO7A 3G4PA 2Q9NA 1QMEA 1K57C 2OAP1 3K2NA 1X0OA 2PAVP 5I5LA 4Y15A 1OPXA 5E43A 3HJIA 2Y2JA 4EUZA 1PYYA 2AVXA 2W1RA 3DTMA 1WYCA 2IA2A 3LR4A 5HL1A 1CI8A 4LV0A 4NKPA 1BLPA 2JE5A 3PR6A 1V9ZA 3LEQA 3LYXA 4R4RA 1NRJA 1YPRA 4LGWA 4MDZA 3S7NA 4BWIA 3NDEA 2E8IA 3T4OA 1E3UA 3ZVWA 1XGJA 4KZ8A 1YMSA 3A0SA 2Y8HA 3L7HA 2WGWB 4LPZA 5HPIA 5E2HA 5GL9A 5G18A 4ID4A 3M2KA 4HQAA 3LR0A 2V0UA 4H6JA 3H7WA 5EOOA 2DCFA 2Y55A 1KGEA 5CTNA 3BM6A 5EVID 3D4FA 3HBRA 4Y0UA 3T1RA 1XXMA 2ZL1A 3G31A 1W63Q 3W4QA 3T4TA 1KE3A 1W79A 3P01A 1E4DA 3SS5A 3WS2A 4NG2A 4DN0A 1ES2A 3SW1A 1IYQA 3MQQA 2ZQCA 3VE3A 5L8MA 5EVIC 4GJ4A 3UB9A 2QWSA 2W3FA 1IEMA 4MCWA 1MZUA 1I2WA 3NIAA 4GS9B 3BW6A 3A3EA 4S2PA 3R4KA 5HWTA 1PW8A 3N6IA 3B33A 1TS0A 3D9YA 1T1AA 3IWQA 3UB7A 2JN7A 1DP6A 2D01A 1K57A 4BD0A 1K6SA 5CX7A 2ZMFA 2G7UA 3VE4A 2K31A 3BFDA 1YLTA 3GECA 1MWTA 5M19A 2EFUA 2QJ7A 5FAOA 4R4SA 4DDYA 4NETA 4KQDA 4HBTA 4EBNA 3WRTA 1MBLA 1EWZA 1OJGA 3IXBA 4WMCD 1XA1A 3HUOA 4CJNA 4PM7A 3PBTA 4LCLA 2WKRA 1XX2A 3GRJA 2JCHA 3TW8A 2VK3A 1TF1A 3Q82A 5HD3A 4K91A 4KZAA 1E25A 2ZQDA 3OC2A 4U3TA 4WZ5A 1XPBA 5TBMA 1AXBA 3V3SA 4B9OA 2L1MA 3IXGA 4NXFA 3FKWA 4HI4A 3T4SA 2QMIA 1K54C 2FFFB 3NULA 1L0DA 1DJCA 3FPVA 5HARA 5I94A 2WKHA 1KDSA 4LCMA 2EWWA 4LV2A 4UA9A 5CRFA 4KZBA 2W3DA 4MEZA 4S2OA 3R7WA 1MWUA 2P9VA 2VX8A 5EVLA 3ZYTA 2ZM2A 4F3LA 5HSQA 4WF0A 3ZVTA 2EX2A 3MR0A 4ZAMA 1KOUA 1LT0A 5HAIA 3JPUA 3P7NA 2Q0OA 4Y0TA 1GHMA 5J8XA 2PU2A 3IT9A 4CLCD 1TS6A 5CHUA 1FCOA 4MBKA 3S7OA 4ARZA 3VSLA 2NUPC 4GHIA 1F2KA 3HCYA 1LLBA 3LY4A 5EVIB 4X53A 4Z1WA 4WEKA 3LFVA 1NRFA 4U0TA 3QP6A 4ZJ3A 1J9MA 4NEED 4JXVA 3HLCA 1XJ2A 3G34A 4GD8A 4KZ3A 3T12B 4I3IA 1YLJA 5G4YA 1PWDA 1Z6FA 4CLCC 4IJGA 3PTEA 3GV9A 4JBFA 4Y7PA 4KQOA 2HDQA 3IF6A 2JKTM 4OLDA 3Q1FA 2XDMA 2QZ6A 3O5YA 3DWKA 3UY6A 4GOGA 4KUOA 2XFTA 1PZPA 4Y3IA 4LRXC 2KDKA 1HLUP 3MS6A 3EGXC 4MMNA 3ZHHA 1JWZA 3ZCZA 4JPMA 5JYOA 3T1XA 3W4PA 1G6AA 4BLMA 4D60A 1NYMA 3T4QA 3BY9A 4C3QA 3H82A 4WN5A 3HREA 1Y4OA 2XRNA 5AVFA 4BBTA 1PFLA 3IHAA 3M2JA 1LI9A 1T18A 2JHEA 2A49A 4WMCA 4JF4A 1F98A 4IUKA 2P74A 3L9KA 4CQHA 4OQ0A 4KUKA 1BULA 5C5KA 4IEDA 2VGJA 1OTDA 5GLCA 1TD5A 3MFDA 3VOYA 1VEUA 3N8SA 4AFIA 4BD1A 4WM9A 1ONGA 2L0WA 4LRZE 3MBZA 3G2ZA 5FI7A 4K08A 2PRFA 4MN6A 2K2NA 1IELA 2HDSA 4YINA 3G32A 5DFYA 2GNXA 2X01A 1YT4A 5AVEA 4JXSA 2EA9A 3A3JA 1D1JA 3VP1A 1IYPA 3QP1A 4DJ3A 5EOEA 1BSGA 4HH2A 3MQ0A 1P9RA 1N4OA 3T1SA 3RTYA 2EXBA 2G2WA 5A8BA 4KQRA 4CLCB 3S22A 4HJ6A 1SKOB 5E2GA 2H0TA 3KSFA 2PBYA 4EV4A 1LSVA 1YLZA 2WK0A 3F1PB 1L3LA 4CPKA 1XJ4A 3TRCA 2ZM0A 4OOLA 4DE1A 1H8ZA 2XA7M 2KOIA 2QKPA 5FDSA 1S66L 4I38A 3BEBA 3FG8A 4IUHA 4OP8A 1KE0A 3F1NB 5AQ7A 4IBRA 4OPQA 4EETB 1KE4A 3A0RA 2EX6A 4BBUA 1O07A 4JF6A 4I3AA 3VOLA 2PD8A 4KZ7A 4EBLA 4XT2A 1LL5A 2ZLYA 1KDWA 3BFCA 1NZUA 3NOPC 3VP2A 1FR1A 4KZ9A 3D72A 2WGVA 2HPBA 1VETA 3BWLA 5GLDA 3C7VA 1LL8A 1GHPA 1JWVA 1YAXA 5EM0A 3MF0A 2V9AA 2GZAA 5HL6A 5CXWA 4GD6A 4IVIA 5FI6A 3TE8A 3Q7ZA 1LL9A 5HFOA 4M4XA 4WYYA 2OWJA 1BZAA 5KSCA 3T1QB 1FQGA 1ZHHB 4QY5A 2PHYA 3UB6A 4RA7A 2Q9MA 1BT5A 3IX4A 4HY8A 3VP4A 2JKTI 1I5QA 3UDFA 2JBFA 1U60A 2V2FF 2DNSA 1ERMA 3C30A 1QMFA 5DF9A 2DRWA 4RVAA 4P6BA 4S2KA 1G28A 3F1OB 4FSFA 3FKVA 1S67L 4ZJ2A 2G2UA 3HL9A 2XD5A 4E3IA 2QYBA 4L9GA 1NLYA 2Y2IA 2QHKA 3GSGA 2J9PA 4FH4A 5JYPA 1YM1A 2XR0A 1W7FA 5FQJA 3NC8A 2VEAA 3IXDA 3VV4A 4JGOA 3CG5A 5CEBA 5HDSA 5FATA 3ISGA 4QU3A 4BQMA 4WUJA 3HUMA 3MZEA 5DJUA 1T1BA 3C38A 3UE1A 3PAGA 3PBQA 1O7EA 4YNRA 4FUWA 5KSHA 5IS1A 4MN7A 3ZNTA 3DTIA 5K5BA 4X56A 3V3RA 4IBXA 1LSXA 5FQ9A 5TR7A 3B47A 3A3DA 2PD7A 4X25A 1H8YA 1STZA 4E6XA 3PBOA 4E6WA 2WGWA 5TGFA 1ZC2A 2O9BA 3N8LA 3BY8A 4Y17A 1LHYA 1CQAA 3T50A 5MC7A 3S4XA 3KSGA 5GHXA 3PYPA 3MQOA 1AWIA 2QPNA 4I3JA 4ZJ1A 2ZQ7A 1ESUA 2HP6A 3T4KA 1VQQA 4WELA 1MKIA 2XA7S 4Q0JA 3GVBA 4DE3A 1GHIA 5EE8A 3UO9A 1K55C 5EPHA 4X69A 1K56D 3WS0A 2IWCA 3HLWA 4WBGA 1F9IA 5DKLA 1NZOA 2WZZA 5FQIA 4E3KA 4B93A 1MWSA 1H3QA 2H5SA 2IWDA 4OQGA 2O9AA 1HTZA 3SH7A 5AJGA 3LCEA 3MKFA 3LIDA 4O7DA 4Q0HA 2WYXA 2WZXA 3GR2A 1P97A 2QJ5A 4JGPA 4Q0IA 4X1LA 2L4RA 2OV5A 2P08A 3IX3A 1LI0A 4L9EA 4GS9A 3FPWA 5DTTA 1FSYA 2VKSA 2UV0E 1YSPA 4HH3A 2WKQA 3IS2B 2I72A 1TS8A 3EGDC 4S2LA 1OTBA 1VHMA 2C5WB 2PR6A 1NXYA 4YOFA 3RXWA 2ACGA 2XEPA 3C4PA 2W3HA 4EEPA 1NYYA 1HD8A 2JKFA 2Y2LA 3D3OA 1DP9A 1WA9A 5F6AA 5F5YA 5KMWA 3FV7A 3UN7A 4GDNA 4HEFA 3ZDJA 3CWFA 4WLAA 1BLSA 1JNUA 4ZRRA 3B42A 1JTGA 5DJTA 1DJAA 1ACFA 3UB5P 1LSWA 2VV7A 3VSKA 4EESA 3UPPA 1Q2QA 3DBAA 4LLOB 3Q07A 4X68A 2ZOHA 2ZMAA 5TFQA 1S1ZA 2HJ9C 3HLEA 3QNCA 2HF6A 4PKYG 4E3JA 3NOUC 1HVBA 3BFGA 1UGUA 1H0MA 3LR5A 2XQZA 1I2SA 1L0GA 2MJ6A 3MZDA 5CGWA 3HLDA 4JLFA 5HAPA 1YLWA 4JXGA 3BJNA 2JKGA 2JKRM 3BQAA 2O0YA 3ZG0A 1RGZA 2O9CA 2WAEA 2R9WA 4EERA 4II7A 2B18A 2V20A 4U0XA 4HNBA 1D06A 3N7WA 5FQKA 2W3GA 3Q7VB 4OPZA 3DAVA 4GN2A 4WEJA 4I39A 4B4XA 3CITA 2Y2OA 3UE3A 4PM9A 2ZC3B 1C3BA 5EVIA 1ES4A 2Y2KA 1KVMA 3N8RA 1IFQA 1K56A 2PYRA 5CHJA 2ZC4B 3OCNA 5A92A 3G35A 2KX6A 3NHQA 3UE6A 4MN5A 3O88A 5CGXA 2J9OA 2C6WB 3FZCA 5F69A 4PKYA 5FL3A 2VA0A 3U4LP 5FAQA 4HHDA 1K0KA 1CEFA 4MBHA 3SH9A 2VV6A 3AGEA 3LY3A 4R3JA 1IOUA 1NJ4A 4LENA 1SDEA 2I9VA 3OPPA 5KIZA 2WAFA 3DW0A 4ZDXA 2VJWA 1FOFA 4O8GA 4R3BA 2P7JA 5TJJA 2OWHA 1TEMA 3PAEA 5FAPA 4I5SA 4HP4A 2X02A 2Z2MB 4OPRA 4KENB 3OLOA 4HJ4A 4GW9A 5L09A 4EU0A 3LI9A 4C75A 5FDHA 4DKIA 3A3IA 2HDRA 4FD8A 1OT6A 2IWBA 3BQ8A 4DMZA 4NXBA 1OTAA 1SZVA 3K3DA 1ZG6A 1Y54A 3NDGA 3SOIA 1K54A 1ZTUA 2ZQ9A 4L0LA 4HJ3A 4ETZA 1H5XA 3NCKA 1RCJA 4P6ZM 4S2JA 1K4EA 3EWKA 1Y28A 3NI9A 4NXEA 4D2OA 4LFUA 2PT7A 2OAQ1 2Z6CA 1JVJA 1MC0A 3OCLA 3UE0A 5DVAA 2OSUA 1SKFA 3AGFA 2OOLA 3KYEA 5GLAA 3EQUA 4QJGA 2EWVA 3BECA 1VEUB 1OTIA 4PMAA 4G3KA 5KZHA 3VP0A 4PM8A 5A90A 3KYZA 3ITBA 4DE0A 2W1TB 2BG1A 3UMDA 1YQSA 1EW0A 3K3CA 5J4EA 2J3TD 3ZG5A 4ME4A 2H28A 4GNUA 1G68A 2V1ZA 3HLBA 3MFXA 4O01A 4KZ5A 2A24B 3GMWA 3GDIA 4HBUA 1M40A 4PPRA 5E2EA 2KLIA 3WS1A 5M18A 5IHVA 4CLCA 2W3EA 3MKEA 4IVKA 2J3TC 1SKOA 4E3LA 4RYEA 3ZFZA 3W8KA 4B88A 3MXQA 2PDRA 4N92A 2RCXA 3RXXA 2R9XA 3IH9A 3IH8A 4WL9A 4CLCE 4EEUA 4OP5A 2V8CA 2XK1A 3O3VA 3NOTC 5IU1A 1GSWA 1KVLA 4X55A 3T4LA 4N1HA 2LB9A 1S1YA 1ERQA 3F1NA 3SS4A 4JKTA 4EBPA 2Y2QA 3IF5A 5HPFA 1L2SA 2RL3A 3PBSA 3VFHA 5FASA 2O99A 1S4SA 3W4OA 4Y2FA 2Z6DA 3QP5A 4XT2B 5F83A 1KGGA 2XH9A 3G30A 2W27A 2M7VA 2H0YA 3C8CA 1YMXA 3QP4A 5EV0A 4JGRA 2OLVA 3ZG8B 2D02A 3A3FA 4RX2A 3BFEA 4BENA 3S7PA 3W2ZA 2VGKA 3E98A 3H9WA 3BYDA 3DTKA 4R6LA 2M1CA 3IQAA 3MXRA 4E3NA 5F82A 4DE2A 2XSSA 3BFFA 2EX8A 3LIAA 5CGSA 1BYWA 4DDSA 5FSRA 2V8FA 1GSVA 1M6KA 1MPLA 2YKFA 4BL2A 2Y2HA 4P6ZS 1XJ6A 4EQIA 3QP2A 3F1OA 1P9WA 2ZBBA 1RP5A 1S0WA 4DXCA 3CPTB 1GA0A 3HUNA 4QB8A 4EXOA 4EWFA 2XD1A 1OJ5A 5FQQA 2ZMVA 4N1XA 2HJEA 5AQAA 3PBNA 3BLSA 3N4IA 1VB6A 3ITAA 3LGOA 3SS3A 5U47A 1DRMA 3MJQA 3ZNYA 1XGIA 3ZQ5A 1K6RA 1NY0A 2A2LA 4DRTA 2UWXA 2K7SA 2J7VA 1VM1A 3CAXA 2EFXA
chains in the Genus database with same CATH topology
3G2YA 1BLSA 4ZBEA 3NY4A 1BLHA 1JWZA 3ZHHA 4JPMA 3ZCZA 3UDIA 5JYOA 3CJMA 5HAQA 3W4PA 1JTGA 1ES3A 1G6AA 5GHZA 1CEGA 1DJAA 4BLMA 4K0XA 1NYMA 1JWPA 3P98A 4C3QA 3VSKA 4OQIA 3UPPA 1Q2QA 2WKEA 2ZC7A 3Q07A 3HREA 4X68A 3QHYA 1PI5A 1XP4A 2Y4AA 1K25A 2ZMAA 4PM6A 2Y59A 4XUZA 3IHAA 2Z2LB 3UPOA 4OPYA 3S1YA 5TFQA 1PW1A 3M2JA 4JXWA 4WZ5C 3HLEA 5AQBA 3QNCA 4OLGA 1LI9A 1WE4A 4QY6A 5F1FA 4E3JA 1HVBA 3BFGA 4S2NC 2A49A 3EQVA 3IXHA 4WMCA 2XQZA 4JF4A 3ZG9B 1I2SA 2P74A 4P87A 2B5RA 1ONHA 3OPHA 4OONA 1L0GA 1DJBA 5F1GA 3MZDA 5CGWA 4OQ0A 3IHBA 1BULA 3VOZA 2XGNA 4IEDA 3HLDA 5CTMA 3TOIA 4OOYA 2VGJA 4JLFA 5GLCA 5BOHA 3MFDA 1IKGA 3MZFA 4B4ZA 5HAPA 4FH2A 3VOYA 3E2LA 3IWIA 1YLWA 4JXGA 1BUEA 4R1GA 4GB7A 3N8SA 1IYOA 4XXRA 3ZG0A 4BD1A 4WM9A 1ONGA 1RGZA 3V50A 2WAEA 2R9WA 5DTSA 4ZTKA 3MBZA 4OH0A 5HX9A 2FFYA 2Y2GA 2V20A 3G2ZA 3O86A 5FQMA 3UDXA 5A93A 1W5DA 5FI7A 4DXBA 4U0XA 1IELA 1ZG4A 3N7WA 2HDSA 5FQKA 4E3OA 3Q7VB 4YINA 3G32A 4OPZA 5M1AA 2X01A 4GN2A 5FI2A 1MXOA 2EXAA 1YT4A 3OPRA 3NBLA 4WEJA 1CK3A 1K38A 4B4XA 1ESIA 1TVFA 3PBRA 2Y2OA 3UE3A 4JXSA 4PM9A 1W8YA 2ZC3B 1C3BA 5E2FA 4P85A 3A3JA 3JYIA 4NK3A 4UAAA 5EVIA 3VP1A 1IYPA 1EROA 4KQQA 1ES4A 1BTLA 2Y2KA 3QNBA 2XF3A 3GTCA 3CZDA 1KVMA 4KG2A 4OVDA 5EOEA 1BSGA 3BRMA 4BL3A 2ZJ9A 3N8RA 1K4FA 3RJUA 1K56A 1SDNA 1N4OA 5CHJA 5D3OA 3E2KA 3AGDA 1W8QA 2ZC4B 2EXBA 4UA6A 1GCEA 3OCNA 5A92A 3G35A 3M6HA 1WYBA 1CI9A 3O88A 3LO7A 5CGXA 2J9OA 1L0EA 3G4PA 2Q9NA 2C6WB 1QMEA 3FZCA 2G2WA 2Y91A 4LV1A 1K57C 2HP9A 4KQRA 5FAQA 3S22A 4M3KA 1CEFA 4GDBA 4MBHA 3SH9A 5CERA 5E2GA 2H0TA 3AGEA 2ZM8A 3LY3A 4R3JA 1NJ4A 4LENA 3IF6C 3ZGAB 3HLGA 1SDEA 2PBYA 5GLBA 4K0WA 4QHCA 5E43A 3OPPA 3P09A 2Y2JA 2WAFA 4YFMA 4EUZA 4EV4A 1PYYA 4OKPA 2H10A 3DW0A 4ZDXA 1YLZA 2WK0A 4P0MA 3DTMA 1WYCA 1FOFA 1CI8A 4LV0A 5HL1A 3OZHA 4BJPA 3C5AA 4R3BA 4CPKA 2ZQ8A 1TDLA 1BLPA 2JE5A 2ZM0A 1TEMA 4OOLA 3PAEA 5FAPA 4DE1A 1YLYA 4QD4A 1EI5A 4XUXA 2X02A 2Z2MB 4R4RA 4OPRA 1H8ZA 4KENB 4KG5A 3BEBA 5EUAA 4MNRA 4OP8A 1KE0A 3NDEA 1OMEA 4C75A 5FDHA 5AQ7A 4IBRA 3WRZA 4DKIA 3A3IA 2HDRA 4FD8A 2E8IA 4OPQA 1E3UA 2IWBA 2WADA 1KE4A 2EX6A 4PM5A 1O07A 4JF6A 3ZVWA 5HW3A 4KZ7A 4EBLA 1ZG6A 1SCWA 1XGJA 4KZ8A 1YMSA 1Y54A 3NDGA 3SOIA 4S2MA 1K54A 1LL5A 2ZLYA 4S2NA 2WGWB 2ZQ9A 1KDWA 1Q2PA 4L0LA 3VFFA 1H5XA 3NCKA 3BFCA 5E2HA 1RCJA 1NZUA 5GL9A 4S2JA 1K4EA 2WGIA 3VP2A 1FR1A 4KZ9A 5G18A 4ID4A 2WUQA 4OOMA 4D2OA 2WGVA 2HPBA 3M2KA 3NI9A 4FCFA 5GLDA 3C7VA 1GHPA 1JVJA 1JWVA 3OCLA 3TSGA 3UE0A 3WS5A 5EOOA 5DVAA 2OSUA 2DCFA 2Y55A 1K55A 1KGEA 1SKFA 3AGFA 5CTNA 4DXCA 5GLAA 3BM6A 1PI4A 5GHYA 5EVID 3D4FA 3EQUA 5CXWA 3HBRA 4N9LA 4GD6A 2P9VB 3BECA 4IVIA 4Y0UA 5FI6A 4QJGA 2HP5A 1MY8A 1DY6A 1XXMA 3Q7VA 3Q7ZA 1LL9A 4LV3A 4PMAA 3G31A 5HFOA 5KZHA 4WYYA 3VP0A 3W4QA 1BZAA 1KE3A 1W79A 4PM8A 5A90A 1E4DA 3ITBA 5KSCA 3SS5A 3WS2A 4DE0A 1FQGA 2BG1A 4GZBA 4QY5A 2JC7A 4KZ6A 1YQSA 4MBFA 4RA7A 1ES2A 4A5RA 2Q9MA 1BT5A 2PU4A 1FCMA 1L0FA 1GA9A 1IYQA 3VP4A 3ZG5A 1I5QA 5A91A 1PWCA 4GNUA 3UDFA 1G68A 2JBFA 1U60A 2V1ZA 2V2FF 2DNSA 1ERMA 2ZQCA 3HLBA 4RX3A 1QMFA 4H8RA 4KZ5A 1SHVA 5EVIC 1PZOA 2A3UA 3HVFA 5DF9A 4WZ4A 2DRWA 3GMWA 4RVAA 4P6BA 5L2FA 4HBUA 4S2KA 5CEDA 1IEMA 1JTDA 1M40A 4FSFA 3FKVA 1I2WA 4PPRA 3TG9A 5E2EA 3NIAA 2Y2PA 3WS1A 4ZJ2A 2G2UA 3A3EA 3HL9A 4S2PA 1FCNA 2ZC5B 5M18A 2XD5A 5IHVA 4E3IA 3FWLA 1PW8A 3MKEA 3N6IA 4IVKA 5EECA 2Y2IA 3IWQA 4E3LA 3LEZA 2BLSA 1K57A 4RYEA 4BD0A 3GSGA 2J9PA 4FH4A 3ZFZA 4R0QA 5JYPA 3W8KA 1K6SA 1YM1A 4DF6A 2XR0A 1W7FA 4B88A 5FA7A 5FQJA 3NC8A 2X71A 3BFDA 1YLTA 3IXDA 1MWTA 5M19A 3BLMA 4N92A 2RCXA 3RXXA 2EFUA 3IF6B 5FAOA 2R9XA 3CG5A 4R4SA 3IH9A 4X6TA 5CEBA 5FATA 3ISGA 4KG6A 4NETA 4DDYA 3IH8A 4HBTA 4QU3A 4BQMA 4EBNA 3WRTA 1MBLA 1EWZA 2XLNA 3C7UA 3HUMA 3IXBA 3MZEA 4OP5A 1PWGA 2XK1A 1XA1A 4WMCD 3HUOA 1BLCA 4CJNA 3O3VA 4PM7A 3PBTA 3UE1A 3PAGA 3PBQA 3WS4A 1O7EA 4Z9QA 1TDGA 4LCLA 1KVLA 1XA7A 4OQHA 1XX2A 4X55A 5KSHA 3GRJA 3FYZA 4N1HA 1YLPA 2JCHA 3B3XA 3O87A 1ERQA 4F94A 3ZNTA 3Q82A 3WWXA 4X56A 3HLFA 3V3RA 4K91A 4JKTA 1ALQA 3SS4A 4IBXA 4EBPA 2Y2QA 4KZAA 1PIOA 3IF5A 4KZ4A 1E25A 5FQ9A 1FR6A 5TR7A 2ZQDA 1N9BA 3OC2A 4U3TA 4WZ5A 1IKIA 4S2IA 5CECA 1XPBA 3A3DA 1L2SA 1AXBA 3V3SA 2RL3A 1H8YA 3OPLA 3PBSA 4E6XA 1MWRA 3PBOA 4E6WA 2WGWA 5TGFA 1ZC2A 3IXGA 5DTKA 3FKWA 3N8LA 1LHYA 1IYSA 2QMIA 3VFHA 1K54C 5FASA 2FFFB 3S4XA 4GKUA 3W4OA 1L0DA 4JF5A 1DJCA 5GHXA 5F83A 1KGGA 2XH9A 5HARA 5I94A 2QPNA 4ZJ1A 1ES5A 1KDSA 2WKHA 2ZQ7A 3G30A 4LCMA 1ESUA 4LV2A 2HP6A 1XKZA 1S6RA 2ZD8A 3UPNA 3M6BA 4UA9A 5CRFA 4KZBA 4MEZA 2H0YA 4S2OA 1VQQA 4WELA 1MKIA 2Y2MA 1MWUA 1YMXA 2P9VA 3GVBA 5CHMA 4DE3A 1GHIA 5EE8A 2OLVA 5EVLA 2WKIA 1K55C 2OLUA 2ZM2A 3UO9A 3ZG8B 5EPHA 3V39A 4X69A 1K56D 4UA7A 3A3FA 2IWCA 4RX2A 3HLWA 3BFEA 4WBGA 3WS0A 4BENA 2VGKA 3ZVTA 2EX2A 3BYDA 3DWZA 4ZAMA 1NZOA 2WZZA 3IQAA 3MXRA 5FQIA 5HAIA 4E3NA 4Q8IA 5F82A 4DE2A 3BFFA 2EX8A 4E3KA 4Y0TA 1GHMA 2GDNA 1MWSA 5J8XA 2PU2A 2H5SA 2XFSA 3IT9A 2IWDA 4OQGA 5CGSA 4DDSA 1HTZA 3SH7A 5CHUA 5FSRA 1FCOA 4MBKA 1KGFA 3LCEA 3MKFA 4N9KA 3VSLA 4BL2A 1M6KA 1MPLA 4C6YA 4O7DA 2Y2HA 2WYXA 2HDUA 2WZXA 3GR2A 4EQIA 1LLBA 3LY4A 2OV5A 5EVIB 4X53A 1ZKJA 1LI0A 1RP5A 1S0WA 4R23A 4WEKA 1GA0A 2J8YA 1NRFA 3HUNA 4QB8A 4U0TA 5DTTA 3VP3A 4EWFA 5DF8A 2XD1A 5FQQA 1FSYA 4N1XA 4ZJ3A 5AQAA 3V5MA 1J9MA 3CMZA 4JXVA 3HLCA 3I7JA 4UHUA 3G34A 3PBNA 4GD8A 4KZ3A 2CC1A 1HZOA 2I72A 1YLJA 3BLSA 3VMAA 3N4IA 4MLLA 1PWDA 1Z6FA 3ZG7B 4S2LA 3C4OA 3Q81A 3ITAA 2C5WB 3SS3A 3PTEA 1NXYA 3GV9A 4HESA 4JBFA 5U47A 3RXWA 4KQOA 1FSWA 4Y7PA 2HDQA 3IF6A 3ZNYA 2XEPA 1XGIA 3C4PA 2EX9A 5DF7A 3UNWA 4E3MA 2Y2NA 4OLDA 1E3UD 1K6RA 2ZQAA 1NYYA 1HD8A 1NY0A 2XDMA 3Q1FA 2QZ6A 4DRTA 2UWXA 3DWKA 2Y2LA 2J7VA 1VM1A 1RGYA 2ZC6B 4GOGA 3MXSA 3UY6A 2XFTA 3GQZA 5KMWA 3FV7A 3UN7A 4Y0OA 3SH8A 1PZPA 4GDNA 4HEFA 3ZDJA 2EFXA 3IWOA 5AQ9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3G2Y A;  1BLS A;  4ZBE A;  3NY4 A;  1BLH A;  1JWZ A;  3ZHH A;  4JPM A;  3ZCZ A;  3UDI A;  5JYO A;  3CJM A;  5HAQ A;  3W4P A;  1JTG A;  1ES3 A;  1G6A A;  5GHZ A;  1CEG A;  1DJA A;  4BLM A;  4K0X A;  1NYM A;  1JWP A;  3P98 A;  4C3Q A;  3VSK A;  4OQI A;  3UPP A;  1Q2Q A;  2WKE A;  2ZC7 A;  3Q07 A;  3HRE A;  4X68 A;  3QHY A;  1PI5 A;  1XP4 A;  2Y4A A;  1K25 A;  2ZMA A;  4PM6 A;  2Y59 A;  4XUZ A;  3IHA A;  2Z2L B;  3UPO A;  4OPY A;  3S1Y A;  5TFQ A;  1PW1 A;  3M2J A;  4JXW A;  4WZ5 C;  3HLE A;  5AQB A;  3QNC A;  4OLG A;  1LI9 A;  1WE4 A;  4QY6 A;  5F1F A;  4E3J A;  1HVB A;  3BFG A;  4S2N C;  2A49 A;  3EQV A;  3IXH A;  4WMC A;  2XQZ A;  4JF4 A;  3ZG9 B;  1I2S A;  2P74 A;  4P87 A;  2B5R A;  1ONH A;  3OPH A;  4OON A;  1L0G A;  1DJB A;  5F1G A;  3MZD A;  5CGW A;  4OQ0 A;  3IHB A;  1BUL A;  3VOZ A;  2XGN A;  4IED A;  3HLD A;  5CTM A;  3TOI A;  4OOY A;  2VGJ A;  4JLF A;  5GLC A;  5BOH A;  3MFD A;  1IKG A;  3MZF A;  4B4Z A;  5HAP A;  4FH2 A;  3VOY A;  3E2L A;  3IWI A;  1YLW A;  4JXG A;  1BUE A;  4R1G A;  4GB7 A;  3N8S A;  1IYO A;  4XXR A;  3ZG0 A;  4BD1 A;  4WM9 A;  1ONG A;  1RGZ A;  3V50 A;  2WAE A;  2R9W A;  5DTS A;  4ZTK A;  3MBZ A;  4OH0 A;  5HX9 A;  2FFY A;  2Y2G A;  2V20 A;  3G2Z A;  3O86 A;  5FQM A;  3UDX A;  5A93 A;  1W5D A;  5FI7 A;  4DXB A;  4U0X A;  1IEL A;  1ZG4 A;  3N7W A;  2HDS A;  5FQK A;  4E3O A;  3Q7V B;  4YIN A;  3G32 A;  4OPZ A;  5M1A A;  2X01 A;  4GN2 A;  5FI2 A;  1MXO A;  2EXA A;  1YT4 A;  3OPR A;  3NBL A;  4WEJ A;  1CK3 A;  1K38 A;  4B4X A;  1ESI A;  1TVF A;  3PBR A;  2Y2O A;  3UE3 A;  4JXS A;  4PM9 A;  1W8Y A;  2ZC3 B;  1C3B A;  5E2F A;  4P85 A;  3A3J A;  3JYI A;  4NK3 A;  4UAA A;  5EVI A;  3VP1 A;  1IYP A;  1ERO A;  4KQQ A;  1ES4 A;  1BTL A;  2Y2K A;  3QNB A;  2XF3 A;  3GTC A;  3CZD A;  1KVM A;  4KG2 A;  4OVD A;  5EOE A;  1BSG A;  3BRM A;  4BL3 A;  2ZJ9 A;  3N8R A;  1K4F A;  3RJU A;  1K56 A;  1SDN A;  1N4O A;  5CHJ A;  5D3O A;  3E2K A;  3AGD A;  1W8Q A;  2ZC4 B;  2EXB A;  4UA6 A;  1GCE A;  3OCN A;  5A92 A;  3G35 A;  3M6H A;  1WYB A;  1CI9 A;  3O88 A;  3LO7 A;  5CGX A;  2J9O A;  1L0E A;  3G4P A;  2Q9N A;  2C6W B;  1QME A;  3FZC A;  2G2W A;  2Y91 A;  4LV1 A;  1K57 C;  2HP9 A;  4KQR A;  5FAQ A;  3S22 A;  4M3K A;  1CEF A;  4GDB A;  4MBH A;  3SH9 A;  5CER A;  5E2G A;  2H0T A;  3AGE A;  2ZM8 A;  3LY3 A;  4R3J A;  1NJ4 A;  4LEN A;  3IF6 C;  3ZGA B;  3HLG A;  1SDE A;  2PBY A;  5GLB A;  4K0W A;  4QHC A;  5E43 A;  3OPP A;  3P09 A;  2Y2J A;  2WAF A;  4YFM A;  4EUZ A;  4EV4 A;  1PYY A;  4OKP A;  2H10 A;  3DW0 A;  4ZDX A;  1YLZ A;  2WK0 A;  4P0M A;  3DTM A;  1WYC A;  1FOF A;  1CI8 A;  4LV0 A;  5HL1 A;  3OZH A;  4BJP A;  3C5A A;  4R3B A;  4CPK A;  2ZQ8 A;  1TDL A;  1BLP A;  2JE5 A;  2ZM0 A;  1TEM A;  4OOL A;  3PAE A;  5FAP A;  4DE1 A;  1YLY A;  4QD4 A;  1EI5 A;  4XUX A;  2X02 A;  2Z2M B;  4R4R A;  4OPR A;  1H8Z A;  4KEN B;  4KG5 A;  3BEB A;  5EUA A;  4MNR A;  4OP8 A;  1KE0 A;  3NDE A;  1OME A;  4C75 A;  5FDH A;  5AQ7 A;  4IBR A;  3WRZ A;  4DKI A;  3A3I A;  2HDR A;  4FD8 A;  2E8I A;  4OPQ A;  1E3U A;  2IWB A;  2WAD A;  1KE4 A;  2EX6 A;  4PM5 A;  1O07 A;  4JF6 A;  3ZVW A;  5HW3 A;  4KZ7 A;  4EBL A;  1ZG6 A;  1SCW A;  1XGJ A;  4KZ8 A;  1YMS A;  1Y54 A;  3NDG A;  3SOI A;  4S2M A;  1K54 A;  1LL5 A;  2ZLY A;  4S2N A;  2WGW B;  2ZQ9 A;  1KDW A;  1Q2P A;  4L0L A;  3VFF A;  1H5X A;  3NCK A;  3BFC A;  5E2H A;  1RCJ A;  1NZU A;  5GL9 A;  4S2J A;  1K4E A;  2WGI A;  3VP2 A;  1FR1 A;  4KZ9 A;  5G18 A;  4ID4 A;  2WUQ A;  4OOM A;  4D2O A;  2WGV A;  2HPB A;  3M2K A;  3NI9 A;  4FCF A;  5GLD A;  3C7V A;  1GHP A;  1JVJ A;  1JWV A;  3OCL A;  3TSG A;  3UE0 A;  3WS5 A;  5EOO A;  5DVA A;  2OSU A;  2DCF A;  2Y55 A;  1K55 A;  1KGE A;  1SKF A;  3AGF A;  5CTN A;  4DXC A;  5GLA A;  3BM6 A;  1PI4 A;  5GHY A;  5EVI D;  3D4F A;  3EQU A;  5CXW A;  3HBR A;  4N9L A;  4GD6 A;  2P9V B;  3BEC A;  4IVI A;  4Y0U A;  5FI6 A;  4QJG A;  2HP5 A;  1MY8 A;  1DY6 A;  1XXM A;  3Q7V A;  3Q7Z A;  1LL9 A;  4LV3 A;  4PMA A;  3G31 A;  5HFO A;  5KZH A;  4WYY A;  3VP0 A;  3W4Q A;  1BZA A;  1KE3 A;  1W79 A;  4PM8 A;  5A90 A;  1E4D A;  3ITB A;  5KSC A;  3SS5 A;  3WS2 A;  4DE0 A;  1FQG A;  2BG1 A;  4GZB A;  4QY5 A;  2JC7 A;  4KZ6 A;  1YQS A;  4MBF A;  4RA7 A;  1ES2 A;  4A5R A;  2Q9M A;  1BT5 A;  2PU4 A;  1FCM A;  1L0F A;  1GA9 A;  1IYQ A;  3VP4 A;  3ZG5 A;  1I5Q A;  5A91 A;  1PWC A;  4GNU A;  3UDF A;  1G68 A;  2JBF A;  1U60 A;  2V1Z A;  2V2F F;  2DNS A;  1ERM A;  2ZQC A;  3HLB A;  4RX3 A;  1QMF A;  4H8R A;  4KZ5 A;  1SHV A;  5EVI C;  1PZO A;  2A3U A;  3HVF A;  5DF9 A;  4WZ4 A;  2DRW A;  3GMW A;  4RVA A;  4P6B A;  5L2F A;  4HBU A;  4S2K A;  5CED A;  1IEM A;  1JTD A;  1M40 A;  4FSF A;  3FKV A;  1I2W A;  4PPR A;  3TG9 A;  5E2E A;  3NIA A;  2Y2P A;  3WS1 A;  4ZJ2 A;  2G2U A;  3A3E A;  3HL9 A;  4S2P A;  1FCN A;  2ZC5 B;  5M18 A;  2XD5 A;  5IHV A;  4E3I A;  3FWL A;  1PW8 A;  3MKE A;  3N6I A;  4IVK A;  5EEC A;  2Y2I A;  3IWQ A;  4E3L A;  3LEZ A;  2BLS A;  1K57 A;  4RYE A;  4BD0 A;  3GSG A;  2J9P A;  4FH4 A;  3ZFZ A;  4R0Q A;  5JYP A;  3W8K A;  1K6S A;  1YM1 A;  4DF6 A;  2XR0 A;  1W7F A;  4B88 A;  5FA7 A;  5FQJ A;  3NC8 A;  2X71 A;  3BFD A;  1YLT A;  3IXD A;  1MWT A;  5M19 A;  3BLM A;  4N92 A;  2RCX A;  3RXX A;  2EFU A;  3IF6 B;  5FAO A;  2R9X A;  3CG5 A;  4R4S A;  3IH9 A;  4X6T A;  5CEB A;  5FAT A;  3ISG A;  4KG6 A;  4NET A;  4DDY A;  3IH8 A;  4HBT A;  4QU3 A;  4BQM A;  4EBN A;  3WRT A;  1MBL A;  1EWZ A;  2XLN A;  3C7U A;  3HUM A;  3IXB A;  3MZE A;  4OP5 A;  1PWG A;  2XK1 A;  1XA1 A;  4WMC D;  3HUO A;  1BLC A;  4CJN A;  3O3V A;  4PM7 A;  3PBT A;  3UE1 A;  3PAG A;  3PBQ A;  3WS4 A;  1O7E A;  4Z9Q A;  1TDG A;  4LCL A;  1KVL A;  1XA7 A;  4OQH A;  1XX2 A;  4X55 A;  5KSH A;  3GRJ A;  3FYZ A;  4N1H A;  1YLP A;  2JCH A;  3B3X A;  3O87 A;  1ERQ A;  4F94 A;  3ZNT A;  3Q82 A;  3WWX A;  4X56 A;  3HLF A;  3V3R A;  4K91 A;  4JKT A;  1ALQ A;  3SS4 A;  4IBX A;  4EBP A;  2Y2Q A;  4KZA A;  1PIO A;  3IF5 A;  4KZ4 A;  1E25 A;  5FQ9 A;  1FR6 A;  5TR7 A;  2ZQD A;  1N9B A;  3OC2 A;  4U3T A;  4WZ5 A;  1IKI A;  4S2I A;  5CEC A;  1XPB A;  3A3D A;  1L2S A;  1AXB A;  3V3S A;  2RL3 A;  1H8Y A;  3OPL A;  3PBS A;  4E6X A;  1MWR A;  3PBO A;  4E6W A;  2WGW A;  5TGF A;  1ZC2 A;  3IXG A;  5DTK A;  3FKW A;  3N8L A;  1LHY A;  1IYS A;  2QMI A;  3VFH A;  1K54 C;  5FAS A;  2FFF B;  3S4X A;  4GKU A;  3W4O A;  1L0D A;  4JF5 A;  1DJC A;  5GHX A;  5F83 A;  1KGG A;  2XH9 A;  5HAR A;  5I94 A;  2QPN A;  4ZJ1 A;  1ES5 A;  1KDS A;  2WKH A;  2ZQ7 A;  3G30 A;  4LCM A;  1ESU A;  4LV2 A;  2HP6 A;  1XKZ A;  1S6R A;  2ZD8 A;  3UPN A;  3M6B A;  4UA9 A;  5CRF A;  4KZB A;  4MEZ A;  2H0Y A;  4S2O A;  1VQQ A;  4WEL A;  1MKI A;  2Y2M A;  1MWU A;  1YMX A;  2P9V A;  3GVB A;  5CHM A;  4DE3 A;  1GHI A;  5EE8 A;  2OLV A;  5EVL A;  2WKI A;  1K55 C;  2OLU A;  2ZM2 A;  3UO9 A;  3ZG8 B;  5EPH A;  3V39 A;  4X69 A;  1K56 D;  4UA7 A;  3A3F A;  2IWC A;  4RX2 A;  3HLW A;  3BFE A;  4WBG A;  3WS0 A;  4BEN A;  2VGK A;  3ZVT A;  2EX2 A;  3BYD A;  3DWZ A;  4ZAM A;  1NZO A;  2WZZ A;  3IQA A;  3MXR A;  5FQI A;  5HAI A;  4E3N A;  4Q8I A;  5F82 A;  4DE2 A;  3BFF A;  2EX8 A;  4E3K A;  4Y0T A;  1GHM A;  2GDN A;  1MWS A;  5J8X A;  2PU2 A;  2H5S A;  2XFS A;  3IT9 A;  2IWD A;  4OQG A;  5CGS A;  4DDS A;  1HTZ A;  3SH7 A;  5CHU A;  5FSR A;  1FCO A;  4MBK A;  1KGF A;  3LCE A;  3MKF A;  4N9K A;  3VSL A;  4BL2 A;  1M6K A;  1MPL A;  4C6Y A;  4O7D A;  2Y2H A;  2WYX A;  2HDU A;  2WZX A;  3GR2 A;  4EQI A;  1LLB A;  3LY4 A;  2OV5 A;  5EVI B;  4X53 A;  1ZKJ A;  1LI0 A;  1RP5 A;  1S0W A;  4R23 A;  4WEK A;  1GA0 A;  2J8Y A;  1NRF A;  3HUN A;  4QB8 A;  4U0T A;  5DTT A;  3VP3 A;  4EWF A;  5DF8 A;  2XD1 A;  5FQQ A;  1FSY A;  4N1X A;  4ZJ3 A;  5AQA A;  3V5M A;  1J9M A;  3CMZ A;  4JXV A;  3HLC A;  3I7J A;  4UHU A;  3G34 A;  3PBN A;  4GD8 A;  4KZ3 A;  2CC1 A;  1HZO A;  2I72 A;  1YLJ A;  3BLS A;  3VMA A;  3N4I A;  4MLL A;  1PWD A;  1Z6F A;  3ZG7 B;  4S2L A;  3C4O A;  3Q81 A;  3ITA A;  2C5W B;  3SS3 A;  3PTE A;  1NXY A;  3GV9 A;  4HES A;  4JBF A;  5U47 A;  3RXW A;  4KQO A;  1FSW A;  4Y7P A;  2HDQ A;  3IF6 A;  3ZNY A;  2XEP A;  1XGI A;  3C4P A;  2EX9 A;  5DF7 A;  3UNW A;  4E3M A;  2Y2N A;  4OLD A;  1E3U D;  1K6R A;  2ZQA A;  1NYY A;  1HD8 A;  1NY0 A;  2XDM A;  3Q1F A;  2QZ6 A;  4DRT A;  2UWX A;  3DWK A;  2Y2L A;  2J7V A;  1VM1 A;  1RGY A;  2ZC6 B;  4GOG A;  3MXS A;  3UY6 A;  2XFT A;  3GQZ A;  5KMW A;  3FV7 A;  3UN7 A;  4Y0O A;  3SH8 A;  1PZP A;  4GDN A;  4HEF A;  3ZDJ A;  2EFX A;  3IWO A;  5AQ9 A; 
#chains in the Genus database with same CATH topology
 3G2Y A;  3FC7 A;  3NY4 A;  3ULF A;  3UDI A;  1ES3 A;  3NJA A;  1CEG A;  4K0X A;  2PBD P;  4OQI A;  3C2W A;  2YKH A;  5FEG A;  3QHY A;  1PI5 A;  1XP4 A;  1K25 A;  3KX0 X;  4R70 A;  2Z2L B;  3UPO A;  4OPY A;  3S1Y A;  2DMW A;  3E4P A;  4WZ5 C;  4OLG A;  5HDD A;  1WE4 A;  2V0W A;  4QY6 A;  1YSQ A;  4S2N C;  3EQV A;  4P87 A;  2B5R A;  3OPH A;  4OON A;  1DJB A;  5F1G A;  4L9F A;  3IHB A;  3VOZ A;  2XGN A;  3TOI A;  4OOY A;  1IKG A;  3OBF A;  1IYO A;  4XXR A;  5DTS A;  4H6J B;  4ZTK A;  3H7W B;  4OH0 A;  5HX9 A;  1J3W A;  5A93 A;  3UDX A;  3PXP A;  1W5D A;  4IHQ A;  4DXB A;  4O0P A;  3U2A A;  4LRY C;  1ZG4 A;  1TS7 A;  2ZL1 B;  3IX8 A;  3OPR A;  1CK3 A;  1K38 A;  1ESI A;  1V9Y A;  3MSH A;  4NXG A;  1W8Y A;  3JYI A;  4HIA A;  1ERO A;  4KQQ A;  3QNB A;  2Y79 A;  1P0Z A;  4OVD A;  3BRM A;  2ZJ9 A;  2VGL M;  5IT5 A;  3RJU A;  1SDN A;  5D3O A;  3IBJ A;  3E2K A;  3IS2 A;  4UA6 A;  3LR3 A;  1L0E A;  2Y91 A;  4LV1 A;  2HP9 A;  5G4Z A;  4EQ1 A;  4M3K A;  2R78 A;  4GDB A;  5CER A;  2ZM8 A;  2HV1 A;  3IF6 C;  3ZGA B;  3HLG A;  5GLB A;  3CHW P;  4K0W A;  4QHC A;  3CUE C;  2PYP A;  3P09 A;  4YFM A;  4OKP A;  3G6O A;  3SZT A;  2H10 A;  4P0M A;  2GJ3 A;  2M7U A;  3OZH A;  5HD5 A;  4BJP A;  3C5A A;  5L07 A;  2ZQ8 A;  1TDL A;  1NLZ A;  3DTE A;  1YLY A;  4UQI M;  4QD4 A;  1EI5 A;  4XUX A;  3JVV A;  4KG5 A;  5EUA A;  4MNR A;  3LIC A;  1OME A;  4PHT A;  3WRZ A;  5EM1 A;  2V1B A;  2VZW A;  5LBR A;  2WAD A;  4PM5 A;  5HW3 A;  1SCW A;  1OT9 A;  5TBM B;  1T19 A;  4S2M A;  4S2N A;  4DJ2 A;  1H8M A;  1Q2P A;  3VFF A;  4HOI A;  5FEF A;  4GLQ A;  2WGI A;  5DKK A;  2WUQ A;  4OOM A;  4FCF A;  2WKP A;  2J80 A;  3TSG A;  3WS5 A;  1K55 A;  1MKM A;  1PI4 A;  5GHY A;  3LI8 A;  3R7W B;  4N9L A;  2P9V B;  2HP5 A;  1MY8 A;  5J3W A;  1DY6 A;  3Q7V A;  4LV3 A;  2INW A;  4G3W A;  4Y5F A;  1OTE A;  4F3L B;  1CJF A;  4Y13 A;  1YKD A;  4GZB A;  3OOV A;  3RFB A;  2JC7 A;  4KZ6 A;  1PNE A;  4MBF A;  3EEA A;  4A5R A;  4RQ9 A;  2PU4 A;  1FCM A;  1L0F A;  1GA9 A;  5A91 A;  1PWC A;  1DP8 A;  1D7E A;  4RX3 A;  4H8R A;  1SHV A;  1ODV A;  4ARZ B;  1PRQ A;  1PZO A;  2A3U A;  3HVF A;  3KSI A;  4WZ4 A;  4GHI B;  5L2F A;  5CED A;  2VLG A;  1JTD A;  3HJK A;  2LB5 A;  3TG9 A;  5HZH A;  2Y2P A;  1G6O A;  2B02 A;  2E8J A;  1FCN A;  2ZC5 B;  3FWL A;  5EEC A;  2BAS A;  3LEZ A;  2BLS A;  4R0Q A;  3RH8 B;  4DF6 A;  5FA7 A;  2X71 A;  5HWW A;  3BLM A;  4QWO A;  2HGV A;  3IF6 B;  1XFN A;  3IBR A;  4X6T A;  4KG6 A;  3CUE A;  2V1A A;  2XLN A;  3C7U A;  1PWG A;  1FIL A;  1BLC A;  4R38 A;  2VGL S;  1NWZ A;  3WS4 A;  5DFX A;  4Z9Q A;  1TDG A;  4G3V A;  1XA7 A;  4OQH A;  1UWN X;  4ESP A;  3A0V A;  3FYZ A;  1YLP A;  3B3X A;  3O87 A;  1W63 M;  4F94 A;  2VV8 A;  3WWX A;  3HLF A;  1ALQ A;  3H82 B;  4KZ4 A;  1PIO A;  2J3W A;  1FR6 A;  1N9B A;  1N9N A;  1IKI A;  4S2I A;  5CEC A;  5J7E A;  3OPL A;  1MWR A;  1N9L A;  3V67 A;  5DTK A;  1T1C A;  1IYS A;  4HP9 A;  1G5U A;  4GKU A;  4JF5 A;  4R3A A;  1ES5 A;  1FIK A;  3LIE A;  1XKZ A;  1S6R A;  2ZD8 A;  3UPN A;  3M6B A;  4UQI S;  1XFQ A;  2Y2M A;  5CHM A;  3KSH A;  3E0Y A;  2WKI A;  2OLU A;  4X1M A;  3V39 A;  4UA7 A;  4BBV A;  2W1T A;  3TJZ C;  3DWZ A;  4Q8I A;  2B95 A;  2GDN A;  2XFS A;  2A24 A;  1KGF A;  4N9K A;  5HDC A;  3E4O A;  4C6Y A;  2NUT C;  2W0N A;  2HDU A;  4FOF A;  3LIF A;  4YWZ A;  1ZKJ A;  3S7Q A;  4R23 A;  2J8Y A;  3VP3 A;  3QP8 A;  4PAU A;  5DF8 A;  2FZ0 A;  5HWV A;  1GSX A;  3V5M A;  3CMZ A;  4EW7 A;  3I7J A;  4UHU A;  2CC1 A;  1HZO A;  5L10 A;  3VMA A;  4MLL A;  3ZG7 B;  3C4O A;  3Q81 A;  1S4R A;  2CMN A;  4HES A;  5EFW A;  4FTX A;  1FSW A;  3F1P A;  3MMH A;  2EX9 A;  5DF7 A;  3UNW A;  4E3M A;  2Y2N A;  1E3U D;  2ZQA A;  1F5M A;  4JGQ A;  2HZ5 A;  1RGY A;  2ZC6 B;  3MXS A;  3NEC A;  3GQZ A;  3EEH A;  4Y0O A;  3SH8 A;  2JKR I;  3IWO A;  5AQ9 A;  4ZBE A;  1BLH A;  3CJM A;  5HAQ A;  5GHZ A;  4ETX A;  2GX5 A;  4E04 A;  3ICY A;  1JWP A;  3P98 A;  3PHY A;  2PR5 A;  4QPR A;  2WKE A;  2ZC7 A;  2Y4A A;  4PM6 A;  2Y59 A;  4XUZ A;  2XRO A;  3CLO A;  1PW1 A;  4JXW A;  4GCZ A;  5AQB A;  5F1F A;  3T4J A;  3IXH A;  3ZG9 B;  1ONH A;  5F68 A;  1XJ3 A;  5CTM A;  5BOH A;  3MZF A;  4B4Z A;  3UME A;  4FH2 A;  3E2L A;  3IWI A;  3LIB A;  1BUE A;  3UB8 A;  4R1G A;  4GB7 A;  1VET B;  3V50 A;  5EVE A;  1UWP X;  2FFY A;  2Y2G A;  3O86 A;  5FQM A;  3E4Q A;  3CI6 A;  3KO6 A;  2FH5 A;  1A0K A;  1N9O A;  4E3O A;  2BTF P;  5M1A A;  2P04 A;  5FI2 A;  1MXO A;  2EXA A;  3KYQ A;  3NBL A;  1CF0 A;  1TVF A;  3PBR A;  3JVU A;  5E2F A;  4UEY A;  4P85 A;  4UAA A;  4NK3 A;  1BTL A;  3CPT A;  2XF3 A;  3GTC A;  3CZD A;  3LUQ A;  1Z09 A;  4KG2 A;  3EOI A;  4BL3 A;  4BMW A;  1K4F A;  2ZOI A;  3AGD A;  1W8Q A;  4EUV A;  1GCE A;  3M6H A;  1WYB A;  1CI9 A;  3LO7 A;  3G4P A;  2Q9N A;  1QME A;  1K57 C;  2OAP 1;  3K2N A;  1X0O A;  2PAV P;  5I5L A;  4Y15 A;  1OPX A;  5E43 A;  3HJI A;  2Y2J A;  4EUZ A;  1PYY A;  2AVX A;  2W1R A;  3DTM A;  1WYC A;  2IA2 A;  3LR4 A;  5HL1 A;  1CI8 A;  4LV0 A;  4NKP A;  1BLP A;  2JE5 A;  3PR6 A;  1V9Z A;  3LEQ A;  3LYX A;  4R4R A;  1NRJ A;  1YPR A;  4LGW A;  4MDZ A;  3S7N A;  4BWI A;  3NDE A;  2E8I A;  3T4O A;  1E3U A;  3ZVW A;  1XGJ A;  4KZ8 A;  1YMS A;  3A0S A;  2Y8H A;  3L7H A;  2WGW B;  4LPZ A;  5HPI A;  5E2H A;  5GL9 A;  5G18 A;  4ID4 A;  3M2K A;  4HQA A;  3LR0 A;  2V0U A;  4H6J A;  3H7W A;  5EOO A;  2DCF A;  2Y55 A;  1KGE A;  5CTN A;  3BM6 A;  5EVI D;  3D4F A;  3HBR A;  4Y0U A;  3T1R A;  1XXM A;  2ZL1 A;  3G31 A;  1W63 Q;  3W4Q A;  3T4T A;  1KE3 A;  1W79 A;  3P01 A;  1E4D A;  3SS5 A;  3WS2 A;  4NG2 A;  4DN0 A;  1ES2 A;  3SW1 A;  1IYQ A;  3MQQ A;  2ZQC A;  3VE3 A;  5L8M A;  5EVI C;  4GJ4 A;  3UB9 A;  2QWS A;  2W3F A;  1IEM A;  4MCW A;  1MZU A;  1I2W A;  3NIA A;  4GS9 B;  3BW6 A;  3A3E A;  4S2P A;  3R4K A;  5HWT A;  1PW8 A;  3N6I A;  3B33 A;  1TS0 A;  3D9Y A;  1T1A A;  3IWQ A;  3UB7 A;  2JN7 A;  1DP6 A;  2D01 A;  1K57 A;  4BD0 A;  1K6S A;  5CX7 A;  2ZMF A;  2G7U A;  3VE4 A;  2K31 A;  3BFD A;  1YLT A;  3GEC A;  1MWT A;  5M19 A;  2EFU A;  2QJ7 A;  5FAO A;  4R4S A;  4DDY A;  4NET A;  4KQD A;  4HBT A;  4EBN A;  3WRT A;  1MBL A;  1EWZ A;  1OJG A;  3IXB A;  4WMC D;  1XA1 A;  3HUO A;  4CJN A;  4PM7 A;  3PBT A;  4LCL A;  2WKR A;  1XX2 A;  3GRJ A;  2JCH A;  3TW8 A;  2VK3 A;  1TF1 A;  3Q82 A;  5HD3 A;  4K91 A;  4KZA A;  1E25 A;  2ZQD A;  3OC2 A;  4U3T A;  4WZ5 A;  1XPB A;  5TBM A;  1AXB A;  3V3S A;  4B9O A;  2L1M A;  3IXG A;  4NXF A;  3FKW A;  4HI4 A;  3T4S A;  2QMI A;  1K54 C;  2FFF B;  3NUL A;  1L0D A;  1DJC A;  3FPV A;  5HAR A;  5I94 A;  2WKH A;  1KDS A;  4LCM A;  2EWW A;  4LV2 A;  4UA9 A;  5CRF A;  4KZB A;  2W3D A;  4MEZ A;  4S2O A;  3R7W A;  1MWU A;  2P9V A;  2VX8 A;  5EVL A;  3ZYT A;  2ZM2 A;  4F3L A;  5HSQ A;  4WF0 A;  3ZVT A;  2EX2 A;  3MR0 A;  4ZAM A;  1KOU A;  1LT0 A;  5HAI A;  3JPU A;  3P7N A;  2Q0O A;  4Y0T A;  1GHM A;  5J8X A;  2PU2 A;  3IT9 A;  4CLC D;  1TS6 A;  5CHU A;  1FCO A;  4MBK A;  3S7O A;  4ARZ A;  3VSL A;  2NUP C;  4GHI A;  1F2K A;  3HCY A;  1LLB A;  3LY4 A;  5EVI B;  4X53 A;  4Z1W A;  4WEK A;  3LFV A;  1NRF A;  4U0T A;  3QP6 A;  4ZJ3 A;  1J9M A;  4NEE D;  4JXV A;  3HLC A;  1XJ2 A;  3G34 A;  4GD8 A;  4KZ3 A;  3T12 B;  4I3I A;  1YLJ A;  5G4Y A;  1PWD A;  1Z6F A;  4CLC C;  4IJG A;  3PTE A;  3GV9 A;  4JBF A;  4Y7P A;  4KQO A;  2HDQ A;  3IF6 A;  2JKT M;  4OLD A;  3Q1F A;  2XDM A;  2QZ6 A;  3O5Y A;  3DWK A;  3UY6 A;  4GOG A;  4KUO A;  2XFT A;  1PZP A;  4Y3I A;  4LRX C;  2KDK A;  1HLU P;  3MS6 A;  3EGX C;  4MMN A;  3ZHH A;  1JWZ A;  3ZCZ A;  4JPM A;  5JYO A;  3T1X A;  3W4P A;  1G6A A;  4BLM A;  4D60 A;  1NYM A;  3T4Q A;  3BY9 A;  4C3Q A;  3H82 A;  4WN5 A;  3HRE A;  1Y4O A;  2XRN A;  5AVF A;  4BBT A;  1PFL A;  3IHA A;  3M2J A;  1LI9 A;  1T18 A;  2JHE A;  2A49 A;  4WMC A;  4JF4 A;  1F98 A;  4IUK A;  2P74 A;  3L9K A;  4CQH A;  4OQ0 A;  4KUK A;  1BUL A;  5C5K A;  4IED A;  2VGJ A;  1OTD A;  5GLC A;  1TD5 A;  3MFD A;  3VOY A;  1VEU A;  3N8S A;  4AFI A;  4BD1 A;  4WM9 A;  1ONG A;  2L0W A;  4LRZ E;  3MBZ A;  3G2Z A;  5FI7 A;  4K08 A;  2PRF A;  4MN6 A;  2K2N A;  1IEL A;  2HDS A;  4YIN A;  3G32 A;  5DFY A;  2GNX A;  2X01 A;  1YT4 A;  5AVE A;  4JXS A;  2EA9 A;  3A3J A;  1D1J A;  3VP1 A;  1IYP A;  3QP1 A;  4DJ3 A;  5EOE A;  1BSG A;  4HH2 A;  3MQ0 A;  1P9R A;  1N4O A;  3T1S A;  3RTY A;  2EXB A;  2G2W A;  5A8B A;  4KQR A;  4CLC B;  3S22 A;  4HJ6 A;  1SKO B;  5E2G A;  2H0T A;  3KSF A;  2PBY A;  4EV4 A;  1LSV A;  1YLZ A;  2WK0 A;  3F1P B;  1L3L A;  4CPK A;  1XJ4 A;  3TRC A;  2ZM0 A;  4OOL A;  4DE1 A;  1H8Z A;  2XA7 M;  2KOI A;  2QKP A;  5FDS A;  1S66 L;  4I38 A;  3BEB A;  3FG8 A;  4IUH A;  4OP8 A;  1KE0 A;  3F1N B;  5AQ7 A;  4IBR A;  4OPQ A;  4EET B;  1KE4 A;  3A0R A;  2EX6 A;  4BBU A;  1O07 A;  4JF6 A;  4I3A A;  3VOL A;  2PD8 A;  4KZ7 A;  4EBL A;  4XT2 A;  1LL5 A;  2ZLY A;  1KDW A;  3BFC A;  1NZU A;  3NOP C;  3VP2 A;  1FR1 A;  4KZ9 A;  3D72 A;  2WGV A;  2HPB A;  1VET A;  3BWL A;  5GLD A;  3C7V A;  1LL8 A;  1GHP A;  1JWV A;  1YAX A;  5EM0 A;  3MF0 A;  2V9A A;  2GZA A;  5HL6 A;  5CXW A;  4GD6 A;  4IVI A;  5FI6 A;  3TE8 A;  3Q7Z A;  1LL9 A;  5HFO A;  4M4X A;  4WYY A;  2OWJ A;  1BZA A;  5KSC A;  3T1Q B;  1FQG A;  1ZHH B;  4QY5 A;  2PHY A;  3UB6 A;  4RA7 A;  2Q9M A;  1BT5 A;  3IX4 A;  4HY8 A;  3VP4 A;  2JKT I;  1I5Q A;  3UDF A;  2JBF A;  1U60 A;  2V2F F;  2DNS A;  1ERM A;  3C30 A;  1QMF A;  5DF9 A;  2DRW A;  4RVA A;  4P6B A;  4S2K A;  1G28 A;  3F1O B;  4FSF A;  3FKV A;  1S67 L;  4ZJ2 A;  2G2U A;  3HL9 A;  2XD5 A;  4E3I A;  2QYB A;  4L9G A;  1NLY A;  2Y2I A;  2QHK A;  3GSG A;  2J9P A;  4FH4 A;  5JYP A;  1YM1 A;  2XR0 A;  1W7F A;  5FQJ A;  3NC8 A;  2VEA A;  3IXD A;  3VV4 A;  4JGO A;  3CG5 A;  5CEB A;  5HDS A;  5FAT A;  3ISG A;  4QU3 A;  4BQM A;  4WUJ A;  3HUM A;  3MZE A;  5DJU A;  1T1B A;  3C38 A;  3UE1 A;  3PAG A;  3PBQ A;  1O7E A;  4YNR A;  4FUW A;  5KSH A;  5IS1 A;  4MN7 A;  3ZNT A;  3DTI A;  5K5B A;  4X56 A;  3V3R A;  4IBX A;  1LSX A;  5FQ9 A;  5TR7 A;  3B47 A;  3A3D A;  2PD7 A;  4X25 A;  1H8Y A;  1STZ A;  4E6X A;  3PBO A;  4E6W A;  2WGW A;  5TGF A;  1ZC2 A;  2O9B A;  3N8L A;  3BY8 A;  4Y17 A;  1LHY A;  1CQA A;  3T50 A;  5MC7 A;  3S4X A;  3KSG A;  5GHX A;  3PYP A;  3MQO A;  1AWI A;  2QPN A;  4I3J A;  4ZJ1 A;  2ZQ7 A;  1ESU A;  2HP6 A;  3T4K A;  1VQQ A;  4WEL A;  1MKI A;  2XA7 S;  4Q0J A;  3GVB A;  4DE3 A;  1GHI A;  5EE8 A;  3UO9 A;  1K55 C;  5EPH A;  4X69 A;  1K56 D;  3WS0 A;  2IWC A;  3HLW A;  4WBG A;  1F9I A;  5DKL A;  1NZO A;  2WZZ A;  5FQI A;  4E3K A;  4B93 A;  1MWS A;  1H3Q A;  2H5S A;  2IWD A;  4OQG A;  2O9A A;  1HTZ A;  3SH7 A;  5AJG A;  3LCE A;  3MKF A;  3LID A;  4O7D A;  4Q0H A;  2WYX A;  2WZX A;  3GR2 A;  1P97 A;  2QJ5 A;  4JGP A;  4Q0I A;  4X1L A;  2L4R A;  2OV5 A;  2P08 A;  3IX3 A;  1LI0 A;  4L9E A;  4GS9 A;  3FPW A;  5DTT A;  1FSY A;  2VKS A;  2UV0 E;  1YSP A;  4HH3 A;  2WKQ A;  3IS2 B;  2I72 A;  1TS8 A;  3EGD C;  4S2L A;  1OTB A;  1VHM A;  2C5W B;  2PR6 A;  1NXY A;  4YOF A;  3RXW A;  2ACG A;  2XEP A;  3C4P A;  2W3H A;  4EEP A;  1NYY A;  1HD8 A;  2JKF A;  2Y2L A;  3D3O A;  1DP9 A;  1WA9 A;  5F6A A;  5F5Y A;  5KMW A;  3FV7 A;  3UN7 A;  4GDN A;  4HEF A;  3ZDJ A;  3CWF A;  4WLA A;  1BLS A;  1JNU A;  4ZRR A;  3B42 A;  1JTG A;  5DJT A;  1DJA A;  1ACF A;  3UB5 P;  1LSW A;  2VV7 A;  3VSK A;  4EES A;  3UPP A;  1Q2Q A;  3DBA A;  4LLO B;  3Q07 A;  4X68 A;  2ZOH A;  2ZMA A;  5TFQ A;  1S1Z A;  2HJ9 C;  3HLE A;  3QNC A;  2HF6 A;  4PKY G;  4E3J A;  3NOU C;  1HVB A;  3BFG A;  1UGU A;  1H0M A;  3LR5 A;  2XQZ A;  1I2S A;  1L0G A;  2MJ6 A;  3MZD A;  5CGW A;  3HLD A;  4JLF A;  5HAP A;  1YLW A;  4JXG A;  3BJN A;  2JKG A;  2JKR M;  3BQA A;  2O0Y A;  3ZG0 A;  1RGZ A;  2O9C A;  2WAE A;  2R9W A;  4EER A;  4II7 A;  2B18 A;  2V20 A;  4U0X A;  4HNB A;  1D06 A;  3N7W A;  5FQK A;  2W3G A;  3Q7V B;  4OPZ A;  3DAV A;  4GN2 A;  4WEJ A;  4I39 A;  4B4X A;  3CIT A;  2Y2O A;  3UE3 A;  4PM9 A;  2ZC3 B;  1C3B A;  5EVI A;  1ES4 A;  2Y2K A;  1KVM A;  3N8R A;  1IFQ A;  1K56 A;  2PYR A;  5CHJ A;  2ZC4 B;  3OCN A;  5A92 A;  3G35 A;  2KX6 A;  3NHQ A;  3UE6 A;  4MN5 A;  3O88 A;  5CGX A;  2J9O A;  2C6W B;  3FZC A;  5F69 A;  4PKY A;  5FL3 A;  2VA0 A;  3U4L P;  5FAQ A;  4HHD A;  1K0K A;  1CEF A;  4MBH A;  3SH9 A;  2VV6 A;  3AGE A;  3LY3 A;  4R3J A;  1IOU A;  1NJ4 A;  4LEN A;  1SDE A;  2I9V A;  3OPP A;  5KIZ A;  2WAF A;  3DW0 A;  4ZDX A;  2VJW A;  1FOF A;  4O8G A;  4R3B A;  2P7J A;  5TJJ A;  2OWH A;  1TEM A;  3PAE A;  5FAP A;  4I5S A;  4HP4 A;  2X02 A;  2Z2M B;  4OPR A;  4KEN B;  3OLO A;  4HJ4 A;  4GW9 A;  5L09 A;  4EU0 A;  3LI9 A;  4C75 A;  5FDH A;  4DKI A;  3A3I A;  2HDR A;  4FD8 A;  1OT6 A;  2IWB A;  3BQ8 A;  4DMZ A;  4NXB A;  1OTA A;  1SZV A;  3K3D A;  1ZG6 A;  1Y54 A;  3NDG A;  3SOI A;  1K54 A;  1ZTU A;  2ZQ9 A;  4L0L A;  4HJ3 A;  4ETZ A;  1H5X A;  3NCK A;  1RCJ A;  4P6Z M;  4S2J A;  1K4E A;  3EWK A;  1Y28 A;  3NI9 A;  4NXE A;  4D2O A;  4LFU A;  2PT7 A;  2OAQ 1;  2Z6C A;  1JVJ A;  1MC0 A;  3OCL A;  3UE0 A;  5DVA A;  2OSU A;  1SKF A;  3AGF A;  2OOL A;  3KYE A;  5GLA A;  3EQU A;  4QJG A;  2EWV A;  3BEC A;  1VEU B;  1OTI A;  4PMA A;  4G3K A;  5KZH A;  3VP0 A;  4PM8 A;  5A90 A;  3KYZ A;  3ITB A;  4DE0 A;  2W1T B;  2BG1 A;  3UMD A;  1YQS A;  1EW0 A;  3K3C A;  5J4E A;  2J3T D;  3ZG5 A;  4ME4 A;  2H28 A;  4GNU A;  1G68 A;  2V1Z A;  3HLB A;  3MFX A;  4O01 A;  4KZ5 A;  2A24 B;  3GMW A;  3GDI A;  4HBU A;  1M40 A;  4PPR A;  5E2E A;  2KLI A;  3WS1 A;  5M18 A;  5IHV A;  4CLC A;  2W3E A;  3MKE A;  4IVK A;  2J3T C;  1SKO A;  4E3L A;  4RYE A;  3ZFZ A;  3W8K A;  4B88 A;  3MXQ A;  2PDR A;  4N92 A;  2RCX A;  3RXX A;  2R9X A;  3IH9 A;  3IH8 A;  4WL9 A;  4CLC E;  4EEU A;  4OP5 A;  2V8C A;  2XK1 A;  3O3V A;  3NOT C;  5IU1 A;  1GSW A;  1KVL A;  4X55 A;  3T4L A;  4N1H A;  2LB9 A;  1S1Y A;  1ERQ A;  3F1N A;  3SS4 A;  4JKT A;  4EBP A;  2Y2Q A;  3IF5 A;  5HPF A;  1L2S A;  2RL3 A;  3PBS A;  3VFH A;  5FAS A;  2O99 A;  1S4S A;  3W4O A;  4Y2F A;  2Z6D A;  3QP5 A;  4XT2 B;  5F83 A;  1KGG A;  2XH9 A;  3G30 A;  2W27 A;  2M7V A;  2H0Y A;  3C8C A;  1YMX A;  3QP4 A;  5EV0 A;  4JGR A;  2OLV A;  3ZG8 B;  2D02 A;  3A3F A;  4RX2 A;  3BFE A;  4BEN A;  3S7P A;  3W2Z A;  2VGK A;  3E98 A;  3H9W A;  3BYD A;  3DTK A;  4R6L A;  2M1C A;  3IQA A;  3MXR A;  4E3N A;  5F82 A;  4DE2 A;  2XSS A;  3BFF A;  2EX8 A;  3LIA A;  5CGS A;  1BYW A;  4DDS A;  5FSR A;  2V8F A;  1GSV A;  1M6K A;  1MPL A;  2YKF A;  4BL2 A;  2Y2H A;  4P6Z S;  1XJ6 A;  4EQI A;  3QP2 A;  3F1O A;  1P9W A;  2ZBB A;  1RP5 A;  1S0W A;  4DXC A;  3CPT B;  1GA0 A;  3HUN A;  4QB8 A;  4EXO A;  4EWF A;  2XD1 A;  1OJ5 A;  5FQQ A;  2ZMV A;  4N1X A;  2HJE A;  5AQA A;  3PBN A;  3BLS A;  3N4I A;  1VB6 A;  3ITA A;  3LGO A;  3SS3 A;  5U47 A;  1DRM A;  3MJQ A;  3ZNY A;  1XGI A;  3ZQ5 A;  1K6R A;  1NY0 A;  2A2L A;  4DRT A;  2UWX A;  2K7S A;  2J7V A;  1VM1 A;  3CAX A;  2EFX A; 
#chains in the Genus database with same CATH homology
 3G2Y A;  1BLS A;  4ZBE A;  3NY4 A;  1BLH A;  1JWZ A;  3ZHH A;  4JPM A;  3ZCZ A;  3UDI A;  5JYO A;  3CJM A;  5HAQ A;  3W4P A;  1JTG A;  1ES3 A;  1G6A A;  5GHZ A;  1CEG A;  1DJA A;  4BLM A;  4K0X A;  1NYM A;  1JWP A;  3P98 A;  4C3Q A;  3VSK A;  4OQI A;  3UPP A;  1Q2Q A;  2WKE A;  2ZC7 A;  3Q07 A;  3HRE A;  4X68 A;  3QHY A;  1PI5 A;  1XP4 A;  2Y4A A;  1K25 A;  2ZMA A;  4PM6 A;  2Y59 A;  4XUZ A;  3IHA A;  2Z2L B;  3UPO A;  4OPY A;  3S1Y A;  5TFQ A;  1PW1 A;  3M2J A;  4JXW A;  4WZ5 C;  3HLE A;  5AQB A;  3QNC A;  4OLG A;  1LI9 A;  1WE4 A;  4QY6 A;  5F1F A;  4E3J A;  1HVB A;  3BFG A;  4S2N C;  2A49 A;  3EQV A;  3IXH A;  4WMC A;  2XQZ A;  4JF4 A;  3ZG9 B;  1I2S A;  2P74 A;  4P87 A;  2B5R A;  1ONH A;  3OPH A;  4OON A;  1L0G A;  1DJB A;  5F1G A;  3MZD A;  5CGW A;  4OQ0 A;  3IHB A;  1BUL A;  3VOZ A;  2XGN A;  4IED A;  3HLD A;  5CTM A;  3TOI A;  4OOY A;  2VGJ A;  4JLF A;  5GLC A;  5BOH A;  3MFD A;  1IKG A;  3MZF A;  4B4Z A;  5HAP A;  4FH2 A;  3VOY A;  3E2L A;  3IWI A;  1YLW A;  4JXG A;  1BUE A;  4R1G A;  4GB7 A;  3N8S A;  1IYO A;  4XXR A;  3ZG0 A;  4BD1 A;  4WM9 A;  1ONG A;  1RGZ A;  3V50 A;  2WAE A;  2R9W A;  5DTS A;  4ZTK A;  3MBZ A;  4OH0 A;  5HX9 A;  2FFY A;  2Y2G A;  2V20 A;  3G2Z A;  3O86 A;  5FQM A;  3UDX A;  5A93 A;  1W5D A;  5FI7 A;  4DXB A;  4U0X A;  1IEL A;  1ZG4 A;  3N7W A;  2HDS A;  5FQK A;  4E3O A;  3Q7V B;  4YIN A;  3G32 A;  4OPZ A;  5M1A A;  2X01 A;  4GN2 A;  5FI2 A;  1MXO A;  2EXA A;  1YT4 A;  3OPR A;  3NBL A;  4WEJ A;  1CK3 A;  1K38 A;  4B4X A;  1ESI A;  1TVF A;  3PBR A;  2Y2O A;  3UE3 A;  4JXS A;  4PM9 A;  1W8Y A;  2ZC3 B;  1C3B A;  5E2F A;  4P85 A;  3A3J A;  3JYI A;  4NK3 A;  4UAA A;  5EVI A;  3VP1 A;  1IYP A;  1ERO A;  4KQQ A;  1ES4 A;  1BTL A;  2Y2K A;  3QNB A;  2XF3 A;  3GTC A;  3CZD A;  1KVM A;  4KG2 A;  4OVD A;  5EOE A;  1BSG A;  3BRM A;  4BL3 A;  2ZJ9 A;  3N8R A;  1K4F A;  3RJU A;  1K56 A;  1SDN A;  1N4O A;  5CHJ A;  5D3O A;  3E2K A;  3AGD A;  1W8Q A;  2ZC4 B;  2EXB A;  4UA6 A;  1GCE A;  3OCN A;  5A92 A;  3G35 A;  3M6H A;  1WYB A;  1CI9 A;  3O88 A;  3LO7 A;  5CGX A;  2J9O A;  1L0E A;  3G4P A;  2Q9N A;  2C6W B;  1QME A;  3FZC A;  2G2W A;  2Y91 A;  4LV1 A;  1K57 C;  2HP9 A;  4KQR A;  5FAQ A;  3S22 A;  4M3K A;  1CEF A;  4GDB A;  4MBH A;  3SH9 A;  5CER A;  5E2G A;  2H0T A;  3AGE A;  2ZM8 A;  3LY3 A;  4R3J A;  1NJ4 A;  4LEN A;  3IF6 C;  3ZGA B;  3HLG A;  1SDE A;  2PBY A;  5GLB A;  4K0W A;  4QHC A;  5E43 A;  3OPP A;  3P09 A;  2Y2J A;  2WAF A;  4YFM A;  4EUZ A;  4EV4 A;  1PYY A;  4OKP A;  2H10 A;  3DW0 A;  4ZDX A;  1YLZ A;  2WK0 A;  4P0M A;  3DTM A;  1WYC A;  1FOF A;  1CI8 A;  4LV0 A;  5HL1 A;  3OZH A;  4BJP A;  3C5A A;  4R3B A;  4CPK A;  2ZQ8 A;  1TDL A;  1BLP A;  2JE5 A;  2ZM0 A;  1TEM A;  4OOL A;  3PAE A;  5FAP A;  4DE1 A;  1YLY A;  4QD4 A;  1EI5 A;  4XUX A;  2X02 A;  2Z2M B;  4R4R A;  4OPR A;  1H8Z A;  4KEN B;  4KG5 A;  3BEB A;  5EUA A;  4MNR A;  4OP8 A;  1KE0 A;  3NDE A;  1OME A;  4C75 A;  5FDH A;  5AQ7 A;  4IBR A;  3WRZ A;  4DKI A;  3A3I A;  2HDR A;  4FD8 A;  2E8I A;  4OPQ A;  1E3U A;  2IWB A;  2WAD A;  1KE4 A;  2EX6 A;  4PM5 A;  1O07 A;  4JF6 A;  3ZVW A;  5HW3 A;  4KZ7 A;  4EBL A;  1ZG6 A;  1SCW A;  1XGJ A;  4KZ8 A;  1YMS A;  1Y54 A;  3NDG A;  3SOI A;  4S2M A;  1K54 A;  1LL5 A;  2ZLY A;  4S2N A;  2WGW B;  2ZQ9 A;  1KDW A;  1Q2P A;  4L0L A;  3VFF A;  1H5X A;  3NCK A;  3BFC A;  5E2H A;  1RCJ A;  1NZU A;  5GL9 A;  4S2J A;  1K4E A;  2WGI A;  3VP2 A;  1FR1 A;  4KZ9 A;  5G18 A;  4ID4 A;  2WUQ A;  4OOM A;  4D2O A;  2WGV A;  2HPB A;  3M2K A;  3NI9 A;  4FCF A;  5GLD A;  3C7V A;  1GHP A;  1JVJ A;  1JWV A;  3OCL A;  3TSG A;  3UE0 A;  3WS5 A;  5EOO A;  5DVA A;  2OSU A;  2DCF A;  2Y55 A;  1K55 A;  1KGE A;  1SKF A;  3AGF A;  5CTN A;  4DXC A;  5GLA A;  3BM6 A;  1PI4 A;  5GHY A;  5EVI D;  3D4F A;  3EQU A;  5CXW A;  3HBR A;  4N9L A;  4GD6 A;  2P9V B;  3BEC A;  4IVI A;  4Y0U A;  5FI6 A;  4QJG A;  2HP5 A;  1MY8 A;  1DY6 A;  1XXM A;  3Q7V A;  3Q7Z A;  1LL9 A;  4LV3 A;  4PMA A;  3G31 A;  5HFO A;  5KZH A;  4WYY A;  3VP0 A;  3W4Q A;  1BZA A;  1KE3 A;  1W79 A;  4PM8 A;  5A90 A;  1E4D A;  3ITB A;  5KSC A;  3SS5 A;  3WS2 A;  4DE0 A;  1FQG A;  2BG1 A;  4GZB A;  4QY5 A;  2JC7 A;  4KZ6 A;  1YQS A;  4MBF A;  4RA7 A;  1ES2 A;  4A5R A;  2Q9M A;  1BT5 A;  2PU4 A;  1FCM A;  1L0F A;  1GA9 A;  1IYQ A;  3VP4 A;  3ZG5 A;  1I5Q A;  5A91 A;  1PWC A;  4GNU A;  3UDF A;  1G68 A;  2JBF A;  1U60 A;  2V1Z A;  2V2F F;  2DNS A;  1ERM A;  2ZQC A;  3HLB A;  4RX3 A;  1QMF A;  4H8R A;  4KZ5 A;  1SHV A;  5EVI C;  1PZO A;  2A3U A;  3HVF A;  5DF9 A;  4WZ4 A;  2DRW A;  3GMW A;  4RVA A;  4P6B A;  5L2F A;  4HBU A;  4S2K A;  5CED A;  1IEM A;  1JTD A;  1M40 A;  4FSF A;  3FKV A;  1I2W A;  4PPR A;  3TG9 A;  5E2E A;  3NIA A;  2Y2P A;  3WS1 A;  4ZJ2 A;  2G2U A;  3A3E A;  3HL9 A;  4S2P A;  1FCN A;  2ZC5 B;  5M18 A;  2XD5 A;  5IHV A;  4E3I A;  3FWL A;  1PW8 A;  3MKE A;  3N6I A;  4IVK A;  5EEC A;  2Y2I A;  3IWQ A;  4E3L A;  3LEZ A;  2BLS A;  1K57 A;  4RYE A;  4BD0 A;  3GSG A;  2J9P A;  4FH4 A;  3ZFZ A;  4R0Q A;  5JYP A;  3W8K A;  1K6S A;  1YM1 A;  4DF6 A;  2XR0 A;  1W7F A;  4B88 A;  5FA7 A;  5FQJ A;  3NC8 A;  2X71 A;  3BFD A;  1YLT A;  3IXD A;  1MWT A;  5M19 A;  3BLM A;  4N92 A;  2RCX A;  3RXX A;  2EFU A;  3IF6 B;  5FAO A;  2R9X A;  3CG5 A;  4R4S A;  3IH9 A;  4X6T A;  5CEB A;  5FAT A;  3ISG A;  4KG6 A;  4NET A;  4DDY A;  3IH8 A;  4HBT A;  4QU3 A;  4BQM A;  4EBN A;  3WRT A;  1MBL A;  1EWZ A;  2XLN A;  3C7U A;  3HUM A;  3IXB A;  3MZE A;  4OP5 A;  1PWG A;  2XK1 A;  1XA1 A;  4WMC D;  3HUO A;  1BLC A;  4CJN A;  3O3V A;  4PM7 A;  3PBT A;  3UE1 A;  3PAG A;  3PBQ A;  3WS4 A;  1O7E A;  4Z9Q A;  1TDG A;  4LCL A;  1KVL A;  1XA7 A;  4OQH A;  1XX2 A;  4X55 A;  5KSH A;  3GRJ A;  3FYZ A;  4N1H A;  1YLP A;  2JCH A;  3B3X A;  3O87 A;  1ERQ A;  4F94 A;  3ZNT A;  3Q82 A;  3WWX A;  4X56 A;  3HLF A;  3V3R A;  4K91 A;  4JKT A;  1ALQ A;  3SS4 A;  4IBX A;  4EBP A;  2Y2Q A;  4KZA A;  1PIO A;  3IF5 A;  4KZ4 A;  1E25 A;  5FQ9 A;  1FR6 A;  5TR7 A;  2ZQD A;  1N9B A;  3OC2 A;  4U3T A;  4WZ5 A;  1IKI A;  4S2I A;  5CEC A;  1XPB A;  3A3D A;  1L2S A;  1AXB A;  3V3S A;  2RL3 A;  1H8Y A;  3OPL A;  3PBS A;  4E6X A;  1MWR A;  3PBO A;  4E6W A;  2WGW A;  5TGF A;  1ZC2 A;  3IXG A;  5DTK A;  3FKW A;  3N8L A;  1LHY A;  1IYS A;  2QMI A;  3VFH A;  1K54 C;  5FAS A;  2FFF B;  3S4X A;  4GKU A;  3W4O A;  1L0D A;  4JF5 A;  1DJC A;  5GHX A;  5F83 A;  1KGG A;  2XH9 A;  5HAR A;  5I94 A;  2QPN A;  4ZJ1 A;  1ES5 A;  1KDS A;  2WKH A;  2ZQ7 A;  3G30 A;  4LCM A;  1ESU A;  4LV2 A;  2HP6 A;  1XKZ A;  1S6R A;  2ZD8 A;  3UPN A;  3M6B A;  4UA9 A;  5CRF A;  4KZB A;  4MEZ A;  2H0Y A;  4S2O A;  1VQQ A;  4WEL A;  1MKI A;  2Y2M A;  1MWU A;  1YMX A;  2P9V A;  3GVB A;  5CHM A;  4DE3 A;  1GHI A;  5EE8 A;  2OLV A;  5EVL A;  2WKI A;  1K55 C;  2OLU A;  2ZM2 A;  3UO9 A;  3ZG8 B;  5EPH A;  3V39 A;  4X69 A;  1K56 D;  4UA7 A;  3A3F A;  2IWC A;  4RX2 A;  3HLW A;  3BFE A;  4WBG A;  3WS0 A;  4BEN A;  2VGK A;  3ZVT A;  2EX2 A;  3BYD A;  3DWZ A;  4ZAM A;  1NZO A;  2WZZ A;  3IQA A;  3MXR A;  5FQI A;  5HAI A;  4E3N A;  4Q8I A;  5F82 A;  4DE2 A;  3BFF A;  2EX8 A;  4E3K A;  4Y0T A;  1GHM A;  2GDN A;  1MWS A;  5J8X A;  2PU2 A;  2H5S A;  2XFS A;  3IT9 A;  2IWD A;  4OQG A;  5CGS A;  4DDS A;  1HTZ A;  3SH7 A;  5CHU A;  5FSR A;  1FCO A;  4MBK A;  1KGF A;  3LCE A;  3MKF A;  4N9K A;  3VSL A;  4BL2 A;  1M6K A;  1MPL A;  4C6Y A;  4O7D A;  2Y2H A;  2WYX A;  2HDU A;  2WZX A;  3GR2 A;  4EQI A;  1LLB A;  3LY4 A;  2OV5 A;  5EVI B;  4X53 A;  1ZKJ A;  1LI0 A;  1RP5 A;  1S0W A;  4R23 A;  4WEK A;  1GA0 A;  2J8Y A;  1NRF A;  3HUN A;  4QB8 A;  4U0T A;  5DTT A;  3VP3 A;  4EWF A;  5DF8 A;  2XD1 A;  5FQQ A;  1FSY A;  4N1X A;  4ZJ3 A;  5AQA A;  3V5M A;  1J9M A;  3CMZ A;  4JXV A;  3HLC A;  3I7J A;  4UHU A;  3G34 A;  3PBN A;  4GD8 A;  4KZ3 A;  2CC1 A;  1HZO A;  2I72 A;  1YLJ A;  3BLS A;  3VMA A;  3N4I A;  4MLL A;  1PWD A;  1Z6F A;  3ZG7 B;  4S2L A;  3C4O A;  3Q81 A;  3ITA A;  2C5W B;  3SS3 A;  3PTE A;  1NXY A;  3GV9 A;  4HES A;  4JBF A;  5U47 A;  3RXW A;  4KQO A;  1FSW A;  4Y7P A;  2HDQ A;  3IF6 A;  3ZNY A;  2XEP A;  1XGI A;  3C4P A;  2EX9 A;  5DF7 A;  3UNW A;  4E3M A;  2Y2N A;  4OLD A;  1E3U D;  1K6R A;  2ZQA A;  1NYY A;  1HD8 A;  1NY0 A;  2XDM A;  3Q1F A;  2QZ6 A;  4DRT A;  2UWX A;  3DWK A;  2Y2L A;  2J7V A;  1VM1 A;  1RGY A;  2ZC6 B;  4GOG A;  3MXS A;  3UY6 A;  2XFT A;  3GQZ A;  5KMW A;  3FV7 A;  3UN7 A;  4Y0O A;  3SH8 A;  1PZP A;  4GDN A;  4HEF A;  3ZDJ A;  2EFX A;  3IWO A;  5AQ9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...