1YMSA

X-ray crystallographic structure of ctx-m-9 beta-lactamase complexed with nafcinin-like boronic acid inhibitor
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
263
structure length
263
Chain Sequence
b'QTSAVQQKLAALEKSSGGRLGVALIDTADNTQVLYRGDERFPMCSTSKVMAAAAVLKQSETQKQLLNQPVEIKPADLVNYNPIAEKHVNGTMTLAELSAAALQYSDNTAMNKLIAQLGGPGGVTAFARAIGDETFRLDRTEPTLNTAIPGDPRDTTTPRAMAQTLRQLTLGHALGETQRAQLVTWLKGNTTGAASIRAGLPTSWTAGDKTGSGDYGTTNDIAVIWPQGRAPLVLVTYFTQPQQNAESRRDVLASAARIIAEGL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords beta-lactamase CTX-M-9
publication title Structure, Function, and Inhibition along the Reaction Coordinate of CTX-M beta-Lactamases.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 97
structure length 263
sequence length 263
chains with identical sequence B
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2005-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 1ymsA00
1EWZA 2EX8A 4RYEA 2XLNA 2Y2MA 2H0YA 3UE3A 4GKUA 4WZ5C 1BUEA 2R9XA 1EROA 1DJBA 5FQIA 4X69A 4DDSA 4Q8IA 3O3VA 3E2KA 5M1AA 1ONGA 4R0QA 3N6IA 3VFFA 1K57C 5AQAA 4IVIA 2DRWA 4K0XA 4KZ3A 2Q9MA 4KG5A 3ZVWA 3PBTA 4IEDA 3LY4A 4S2LA 4LV2A 1WYBA 1ONHA 3Q1FA 1QMEA 4S2JA 3IH9A 2QMIA 4UA9A 4X6TA 4FSFA 1PI5A 1E3UA 2HP6A 3OCNA 3EQVA 2HPBA 1PYYA 2Y91A 3HLWA 1YLTA 3IXDA 2OSUA 1GCEA 2GDNA 4BENA 4PM6A 1W8QA 4EUZA 1FSYA 3CG5A 3I7JA 5CHUA 2JC7A 4X68A 4S2MA 4Y0UA 2ZQ7A 3ZG0A 4X56A 1ESUA 5GHXA 5EOEA 3OCLA 5CRFA 5FSRA 4R1GA 1JWPA 3OPRA 2Y55A 4E6XA 2X02A 3IF6A 2WZXA 5E2FA 1GHIA 3IXGA 4KZ5A 1DJCA 4K0WA 4MEZA 1LI9A 3M2JA 4P6BA 1YLZA 1Z6FA 4C75A 4H8RA 1FR6A 3CJMA 1CI8A 3UDXA 1SHVA 3GR2A 3IWQA 1NXYA 2WGWB 4YINA 2Y2OA 5F1GA 1XPBA 3VOZA 4ZDXA 3AGEA 5EVIB 3HLFA 1W5DA 2HDRA 1BTLA 2WAEA 3MZFA 3W4PA 3ZNYA 2Y59A 3FKWA 3WWXA 4E3MA 4N1HA 4JF6A 1KDSA 1XX2A 1YLJA 5KSHA 4DKIA 4KZ9A 1CEGA 5JYPA 1EI5A 4NK3A 1XA7A 1NZOA 1PW1A 1KGGA 1PZPA 2H10A 2J9PA 1RCJA 1MWSA 4XUZA 4N1XA 5CERA 4OOYA 2X71A 3GTCA 4NETA 5GLAA 1SDEA 2FFFB 4P85A 5CXWA 2OV5A 1IYQA 5FQMA 1YLYA 4OPYA 5FA7A 4S2KA 3EQUA 1H8YA 1G68A 5HW3A 1NYMA 1CEFA 1FR1A 4FCFA 2H0TA 1M40A 3M2KA 4D2OA 1PIOA 1YLWA 2HP5A 2EXAA 3ZG8B 1XGIA 4PM5A 3UE0A 4DDYA 4OLDA 2WUQA 2EX6A 1XP4A 3PAEA 2C6WB 4OVDA 2ZJ9A 3NCKA 2WK0A 1RGYA 3G4PA 5FQQA 3WS2A 3G2ZA 3IHAA 2WZZA 4OKPA 5EVID 3A3EA 3FV7A 3A3DA 3C4PA 1ESIA 4WELA 1ZG4A 3IHBA 4QY5A 1K56D 2CC1A 1JTGA 2ZM8A 5HL1A 2WAFA 5E2GA 4WBGA 3RJUA 4DE3A 3VOYA 2HDQA 4KQOA 3BFEA 4KZ8A 3PBRA 4OLGA 4QD4A 5EVIC 3IH8A 4BL2A 5EECA 4EWFA 5M19A 5AQ7A 4LCLA 4E3NA 4WM9A 2X01A 2IWCA 2XK1A 3S1YA 4UA6A 2BG1A 1FCNA 5DTKA 2Z2MB 3N8LA 1HZOA 1MXOA 3C7VA 3BFCA 1N9BA 1ZG6A 5F83A 4WMCA 5FAOA 3V3SA 2VGKA 1IKIA 2XEPA 2Y2PA 1E25A 2V1ZA 2ZQDA 3G31A 4KZ4A 4S2NC 1I2WA 4Z9QA 5HAPA 3ITAA 5HAIA 3FKVA 3NI9A 4KG6A 1PZOA 2V2FF 3G30A 2R9WA 2HDUA 2Y2JA 3TG9A 1FCOA 2EFUA 2ZC5B 3GV9A 3RXWA 3BRMA 2XGNA 4GDBA 4UAAA 1NZUA 4QY6A 5DF8A 4WYYA 1JTDA 4BD0A 3HLDA 3VSKA 2I72A 3GSGA 3UPPA 1WYCA 3Q7VA 4UA7A 5A92A 1FSWA 5CHMA 3Q7ZA 3VP3A 2XFSA 4U0TA 3HLBA 1HTZA 1MPLA 1FQGA 1KGFA 3IWOA 4GZBA 3SOIA 4DXCA 3W4OA 5G18A 4IBRA 3ZG9B 1BLSA 4C6YA 2IWDA 5F1FA 4LV3A 1K6RA 1K54C 1TDLA 3IF6B 3IXBA 1FCMA 1OMEA 5CEBA 3IF5A 2Y2LA 5BOHA 1MWTA 2J9OA 4GDNA 5L2FA 1IYPA 4B4XA 5CECA 3HVFA 2WGIA 3VP0A 1BSGA 3MBZA 4EBNA 3WS0A 2ZC6B 1XXMA 4LV1A 2ZQAA 1E4DA 2WKEA 2P9VA 2PBYA 4GN2A 4KZ7A 3O88A 1L0GA 4CPKA 4OQ0A 4PM9A 4MBFA 4JXVA 3N8RA 1HVBA 2XF3A 4FD8A 1AXBA 4GNUA 1YT4A 4LCMA 4MNRA 3UN7A 5KSCA 3P09A 1YMSA 4OH0A 2ZLYA 3G35A 3MFDA 4CJNA 1H5XA 1SCWA 3ZCZA 3BLMA 4KG2A 2QZ6A 4EV4A 3BEBA 4KQQA 5EOOA 1MWRA 4XXRA 5GHZA 4EBPA 1S6RA 3BLSA 5GLDA 4P87A 2HP9A 1NJ4A 3C4OA 2A49A 2WGVA 4EQIA 4GB7A 3WS4A 1XKZA 1BLHA 1U60A 5FI2A 4OOLA 2DCFA 3W8KA 4A5RA 3OPPA 5FATA 3ITBA 1LL9A 1MY8A 1MWUA 3BFDA 1H8ZA 1FOFA 1W7FA 3Q82A 3NDEA 3IF6C 1ES2A 4QU3A 2J8YA 1SDNA 2Z2LB 2XR0A 5E2EA 1CI9A 2EX2A 4U3TA 4OQGA 4R4SA 5KMWA 4MLLA 4KQRA 4RA7A 4X55A 1JWZA 1MKIA 3IXHA 2JCHA 4PM8A 4OONA 1HD8A 5TFQA 1O7EA 3HUOA 2WYXA 4OP8A 1QMFA 4KENB 2RCXA 3O86A 4B4ZA 5HAQA 2WGWA 3ZDJA 5KZHA 2ZQ9A 5IHVA 1K4EA 5FI7A 1IYOA 4E3JA 5TR7A 4E6WA 5F82A 5DVAA 1MBLA 1IEMA 2ZD8A 1K56A 1RP5A 2Y2KA 3S4XA 4C3QA 5I94A 4RVAA 4WZ4A 1TVFA 4F94A 3MZEA 4ZAMA 2ZQ8A 3LCEA 4L0LA 3S22A 3UDFA 1K55A 2Y2HA 4E3OA 4GD8A 5FAQA 5CEDA 3MKEA 4DE1A 4JXSA 2H5SA 2BLSA 3ZFZA 1YMXA 1JWVA 2P74A 4DRTA 4N92A 3LEZA 2WADA 2OLUA 1TDGA 5GLBA 1ZKJA 2PU4A 4OP5A 2C5WB 5AQ9A 4JLFA 2Y2NA 5EUAA 2Y2GA 1BZAA 3HL9A 5A91A 3QNBA 4WZ5A 3SH8A 3NIAA 4YFMA 1VM1A 3N8SA 1L0DA 4OOMA 2XD1A 4E3IA 3DWKA 2ZQCA 4N9KA 1PI4A 3HREA 3V50A 1XA1A 2A3UA 5DF7A 3UO9A 4ZTKA 5FQKA 1K57A 4QHCA 1TEMA 4S2PA 1ERMA 1J9MA 1NY0A 3IQAA 5CHJA 1PWCA 2B5RA 3N7WA 3VP2A 5M18A 1K25A 3Q07A 4JXGA 1LL5A 2JE5A 4DE2A 3MKFA 4LENA 1BT5A 1SKFA 4BLMA 3ZHHA 3BFGA 5D3OA 2WKIA 3ZVTA 2OLVA 1RGZA 3GRJA 4IVKA 4M3KA 4R4RA 4WMCD 1KDWA 5EE8A 1LI0A 2ZC7A 3G32A 2ZC3B 1WE4A 4RX3A 4S2IA 3QHYA 4ZJ3A 2RL3A 4FH4A 4K91A 2P9VB 4S2OA 4ZJ2A 2E8IA 3GVBA 1KE3A 1IKGA 2Y2IA 3DWZA 3G34A 4JF4A 1BLCA 1PWDA 1LLBA 3AGDA 3HLCA 4LV0A 1GA0A 4Y7PA 4BJPA 3C7UA 3OC2A 2XFTA 3DW0A 2EXBA 3CMZA 4PMAA 4Y0TA 5CGSA 3BFFA 5HFOA 5CTNA 1Q2PA 1JVJA 3G2YA 3SS4A 1Y54A 4IBXA 3UE1A 5DTSA 3SH9A 4JBFA 4O7DA 4R3JA 5CTMA 2J7VA 3IT9A 2JBFA 3MXSA 2XH9A 1M6KA 3VP1A 3BM6A 5EVLA 3PTEA 5FDHA 3ZGAB 4DF6A 2QPNA 5HARA 1LHYA 5DTTA 3ISGA 2G2WA 4KZAA 1IYSA 3BECA 4XUXA 1E3UD 5FQJA 3BYDA 1K6SA 1L0FA 3W4QA 1KGEA 4JPMA 3NY4A 4ZJ1A 4Y0OA 3WRZA 1NYYA 3LO7A 4JF5A 2EX9A 4OQHA 3N4IA 2ZC4B 4GD6A 1BLPA 4E3LA 2XDMA 1ZC2A 4BD1A 1ERQA 3VFHA 3C5AA 1G6AA 1KE4A 3E2LA 3DTMA 2G2UA 4OPQA 3HLGA 4HBUA 4WEKA 4UHUA 4GOGA 1IELA 3GMWA 3V3RA 3JYIA 5FAPA 1YM1A 5AQBA 5TGFA 5CGWA 5FQ9A 1O07A 3CZDA 2ZM0A 1C3BA 3HUNA 3B3XA 5CGXA 3UPNA 3V39A 4MBHA 4BQMA 4ID4A 1ES3A 5DF9A 2ZMAA 2DNSA 5FASA 3PBSA 2WKHA 3VP4A 3V5MA 2FFYA 4QJGA 2XQZA 4X53A 1YLPA 4PPRA 1I5QA 4MBKA 4FH2A 3M6BA 4JKTA 1GHMA 3HBRA 3FZCA 1S0WA 5GL9A 3SS5A 5EVIA 3UPOA 1KVLA 4DXBA 4KZBA 3AGFA 3P98A 1BULA 4OQIA 1K4FA 1XGJA 4WEJA 3ZG7B 1PW8A 1ES5A 3LY3A 3WRTA 1KE0A 3A3JA 4QB8A 2Y4AA 3VSLA 4DE0A 5EPHA 3MXRA 3OPHA 1NRFA 3TOIA 5A90A 3M6HA 5U47A 3MZDA 3D4FA 3PBQA 4JXWA 4P0MA 3VMAA 4B88A 3SH7A 1KVMA 2UWXA 4S2NA 3SS3A 4HEFA 4RX2A 4R3BA 1GHPA 4HBTA 5J8XA 2PU2A 3RXXA 1DY6A 3NC8A 3NBLA 1I2SA 1VQQA 5GLCA 4U0XA 3TSGA 5FI6A 3OZHA 3Q7VB 5GHYA 1N4OA 2VGJA 3Q81A 5JYOA 1L2SA 1L0EA 1K38A 1ALQA 4E3KA 1ES4A 3QNCA 4N9LA 3ZG5A 1W79A 5A93A 3UDIA 3NDGA 3UY6A 2EFXA 4OPRA 4EBLA 1CK3A 2ZM2A 3GQZA 4HESA 2V20A 1GA9A 3IWIA 3PBOA 3FWLA 2IWBA 3OPLA 2HDSA 4ZBEA 2XD5A 5E43A 3HLEA 3FYZA 3UNWA 3WS1A 4OPZA 3WS5A 1W8YA 2Y2QA 3A3FA 3A3IA 3O87A 5E2HA 1K54A 1YQSA 1K55C 3PAGA 4PM7A 4R23A 2Q9NA 4BL3A 1PWGA 3ZNTA 1DJAA 3HUMA 5HX9A 4KZ6A 1Q2QA 3PBNA
chains in the Genus database with same CATH superfamily
1EWZA 1PNEA 2XLNA 3F1OA 2R9XA 5HZHA 1S67L 1ONGA 4R0QA 2JKGA 1V9ZA 4GJ4A 3N6IA 3VFFA 4K0XA 4KG5A 3PBTA 4CLCA 3S7OA 4FSFA 3EQVA 4NXEA 4BENA 3IXDA 1F5MA 1GCEA 2GDNA 2G7UA 4Q0IA 5CHUA 2ZOHA 4X68A 4Y0UA 4E04A 3ZG0A 1ESUA 3OCLA 2WKPA 3IF6A 1GHIA 3IXGA 4KZ5A 4P6BA 4MEZA 1LI9A 1YLZA 3OLOA 4H8RA 3H82A 1CI8A 2OWHA 1SHVA 1D06A 2WGWB 5F1GA 3U2AA 3W4PA 4X1LA 5FL3A 2Y59A 4E3MA 4JF6A 1XX2A 5KSHA 5JYPA 4HP4A 2VK3A 1PZPA 2H10A 1RCJA 1MWSA 4NETA 2I9VA 4RQ9A 4OPYA 5FA7A 4S2KA 1H8YA 3LUQA 5DFYA 3PR6A 2H0TA 3M2KA 2W3FA 2HP5A 2J3WA 4DDYA 4OLDA 2EX6A 3PAEA 3UMEA 2C6WB 3NCKA 2W1TA 5MC7A 3G4PA 3VE3A 3IHAA 1A0KA 4AFIA 4BBTA 3K3DA 4QY5A 4WBGA 4PKYG 3PBRA 4OLGA 3MMHA 2HV1A 2BG1A 5DTKA 3N8LA 4R70A 5F83A 4UQIM 3NHQA 1VETB 1E25A 2V1ZA 2ZQDA 5HAPA 5HAIA 4KG6A 3UB5P 3GDIA 1TS6A 3TG9A 1FCOA 2ZC5B 4UAAA 4EEPA 5F5YA 3O5YA 4EW7A 4BD0A 3CUEC 1NRJA 2XFSA 3LR3A 1W63Q 1FQGA 3E4QA 3LIEA 3ZG9B 5F1FA 3IXBA 1TDLA 4ESPA 2VV8A 3IF5A 1MWTA 3MR0A 3UB7A 4GDNA 1GSWA 1IYPA 4B4XA 3VV4A 3WS0A 4LV1A 1VEUB 2PD7A 4KZ7A 2P04A 1L0GA 1OTAA 5L10A 2B18A 3F1NB 1OJ5A 2JN7A 1XFQA 2XF3A 4FD8A 1YT4A 2ZLYA 2VV6A 1H5XA 1YPRA 4CLCC 1P0ZA 4EBPA 2WGVA 3IBJA 1BLHA 4MN5A 5FI2A 4OOLA 2DCFA 3SZTA 4LRZE 1FOFA 3NDEA 2GNXA 3IF6C 3KSIA 4JGPA 4U3TA 3T4JA 1JWZA 2JCHA 4LLOB 5TFQA 1O7EA 4OP8A 5DKLA 4KENB 3H7WB 5EFWA 2ZQ9A 5IHVA 5DVAA 2ZD8A 4RVAA 1K55A 3RTYA 5FAQA 4DE1A 2H5SA 3QP5A 2BLSA 3LFVA 1JWVA 5L07A 4X1MA 3LEZA 2OLUA 5GLBA 5AQ9A 4JLFA 5EUAA 3HL9A 3JVUA 2DMWA 4YFMA 1VM1A 3N8SA 1SZVA 1L0DA 1D7EA 3B47A 4OOMA 2ZQCA 2W3EA 3HREA 3V50A 3UO9A 4ZTKA 4ETXA 4CLCB 4QHCA 1J9MA 1PWCA 3N7WA 1K25A 4DMZA 1UWNX 3MKFA 1BT5A 3IBRA 1SKFA 1STZA 4BLMA 3C2WA 1IOUA 2WKIA 4GHIA 1RGZA 4S2IA 4K91A 5L09A 4S2OA 4ZJ2A 1ZHHB 3GVBA 1KE3A 2Y2IA 3G34A 1BLCA 1GA0A 3KYQA 2PYPA 3OC2A 3CMZA 3BFFA 3G2YA 1JVJA 3SS4A 1Y54A 2VA0A 5DTSA 3ICYA 3MXSA 5AVEA 4DF6A 5EVLA 3PTEA 1LHYA 4FUWA 3BECA 2XSSA 5FQJA 3LGOA 1K6SA 1L0FA 3T1QB 3W4QA 4JPMA 4ZJ1A 3T4OA 5G4ZA 4HOIA 3MQOA 4GD6A 4E3LA 4UEYA 2W0NA 3C5AA 1VB6A 3E2LA 4OPQA 3LICA 4GOGA 2W1TB 5AQBA 5TGFA 1O07A 2ZM0A 3T4QA 3B3XA 5CGXA 3UPNA 4BQMA 3ZQ5A 1ES3A 4O01A 3PBSA 1D1JA 3V5MA 1OT9A 4X53A 4MBKA 3LIDA 3SS5A 1KVLA 3P98A 2OOLA 4WEJA 1ES5A 3WRTA 4P6ZM 3A3JA 5U47A 3PBQA 3SH7A 2UWXA 3SS3A 5J8XA 3NC8A 2J3TD 1I2SA 1VQQA 4U0XA 5FI6A 3F1PA 1L0EA 1YKDA 1ALQA 1LL8A 3QNCA 1XFNA 1W79A 3K2NA 3GQZA 4D60A 2YKFA 4L9EA 2PDRA 3LI8A 3W2ZA 3HLEA 3FYZA 3WS5A 1W8YA 3A3IA 1BYWA 2YKHA 1K55C 3PAGA 4PM7A 2Q9NA 1DJAA 3HUMA 5F6AA 3VE4A 2Z6DA 4RYEA 2Y2MA 2ZMVA 4GKUA 1EROA 1DJBA 5FQIA 4DDSA 3NJAA 3O3VA 1CF0A 1GSXA 1VETA 4IEDA 3LY4A 5HWTA 1QMEA 4UA9A 4IUKA 1E3UA 2HP6A 3S7PA 3HLWA 1T1AA 2OSUA 3LYXA 2HGVA 3I7JA 3LR5A 3MF0A 4X56A 4O0PA 5GHXA 5EOEA 5HD3A 3T1XA 2W27A 1KOUA 3KSGA 3OPRA 4E6XA 5E2FA 3C8CA 4K0WA 5TBMB 1Z6FA 4C75A 1FR6A 1TD5A 4Y2FA 3GR2A 3UDXA 3IWQA 4YINA 4MN7A 1W5DA 1BTLA 4I38A 1VEUA 3ZNYA 3RFBA 3FKWA 1Y4OA 1YLJA 4GLQA 4LRXC 4DKIA 1CEGA 4B93A 1EI5A 4NK3A 1NZOA 3KYEA 1V9YA 5CERA 4BMWA 3GTCA 1SDEA 4PKYA 1GSVA 4QWOA 2OV5A 5K5BA 3DAVA 3EQUA 5C5KA 4Y5FA 1G68A 1CEFA 1FR1A 2L0WA 2P7JA 2EXAA 1XGIA 3UE0A 4OVDA 4MDZA 1PRQA 3BQAA 3WS2A 2WZZA 4OKPA 2QWSA 3A3DA 3C4PA 1K56D 2CC1A 2ZM8A 2WAFA 5AQ7A 4I3JA 2XK1A 3S1YA 2EWVA 2Y79A 1FCNA 3MFXA 1HZOA 5IU1A 1N9BA 1ZG6A 1XJ3A 2XEPA 2Y2PA 5KIZA 5HSQA 3CPTB 4Z9QA 3ITAA 1PZOA 2V2FF 1DP9A 3RXWA 2XGNA 4ARZB 4QY6A 3EWKA 3OOVA 3A0SA 3UPPA 1WYCA 4HJ4A 4UA7A 3Q7ZA 4GZBA 1SKOA 4IBRA 2IWDA 1FCMA 2Y2LA 2J9OA 5L2FA 3MXQA 2M1CA 2WGIA 2PT7A 1BSGA 2ZC6B 2JKTI 4GN2A 3O88A 4CPKA 4JXVA 3CITA 1PFLA 4MNRA 3G35A 1SCWA 4EV4A 3BEBA 5EOOA 2PHYA 3BLSA 4YNRA 2Q0OA 4P87A 3C4OA 3ZYTA 3DBAA 3MSHA 3WS4A 1U60A 2BASA 1XJ6A 4A5RA 4Y3IA 3OPPA 3PYPA 1EW0A 1H8ZA 3BJNA 2ZBBA 2NUPC 5FEFA 1OJGA 1SDNA 2Z2LB 5HPIA 3F1PB 4EXOA 3G6OA 4OQGA 5KMWA 3LIFA 5F69A 4X55A 4WL9A 1MKIA 4EU0A 3IXHA 1HD8A 5HAQA 5KZHA 1MKMA 5HWWA 2OWJA 1LSWA 5TR7A 1IEMA 1RP5A 2Y2KA 3L7HA 5I94A 4IUHA 5EM1A 3MZEA 4ZAMA 3IS2B 3S22A 5CEDA 3MKEA 1DP6A 3ZFZA 1T1BA 1VHMA 2P74A 4N92A 3PHYA 5I5LA 4OP5A 1ODVA 4WZ5A 4E3IA 2ACGA 1H3QA 2HZ5A 5DF7A 5F68A 1K57A 4S2PA 3IQAA 5HWVA 3VP2A 3Q07A 4DE2A 3BFGA 5D3OA 3L9KA 3ZVTA 3GRJA 4IVKA 4R4RA 5EE8A 3G32A 2RL3A 1WA9A 3D72A 3EEHA 2QJ5A 4BJPA 2XFTA 4IJGA 4Y0TA 5HFOA 3KX0X 4I3IA 4IBXA 2GJ3A 2J7VA 2JBFA 3UMDA 3BM6A 5DTTA 4CLCD 3UB6A 4NXFA 4Y0OA 2HJ9C 3ULFA 4OQHA 4WF0A 3VFHA 3K3CA 1KE4A 3DTMA 1W63M 3HLGA 4K08A 4LRYC 1S1ZA 1IELA 2V8CA 1LT0A 3V3RA 3JYIA 5CGWA 4G3VA 5FQ9A 3CZDA 2V1BA 1F2KA 3HUNA 4MBHA 1T1CA 5DF9A 3MQ0A 5TBMA 4DJ3A 2XROA 2FFYA 4QJGA 1YLPA 4PPRA 3M6BA 3FZCA 1S0WA 3UPOA 2O9CA 3LI9A 4DXBA 1AWIA 1XJ2A 1BULA 4OQIA 1K4FA 1XGJA 3CWFA 2E8JA 1KE0A 2Y4AA 4DE0A 3MZDA 3D4FA 3VMAA 2PD8A 3B33A 3LEQA 1GHPA 2V8FA 4HBTA 2PU2A 3RXXA 3NBLA 3LR4A 4Y17A 3T1RA 5GLCA 3OZHA 3QP2A 1L2SA 1K38A 4N9LA 3ZG5A 3UDIA 4EBLA 4HESA 1CK3A 1SKOB 2ZM2A 3IWIA 1GA9A 3FWLA 4ZBEA 1YSQA 2V1AA 2XD5A 3CI6A 3U4LP 5CX7A 3O87A 4KQDA 2KDKA 3FC7A 1F98A 1PWGA 2HJEA 4KZ6A 1Q2QA 2V9AA 2EX8A 4WZ5C 1BUEA 2ZL1B 3E2KA 3C38A 2VJWA 3CPTA 1K57C 5AQAA 4IVIA 2DRWA 4KZ3A 3ZVWA 5HDSA 4S2LA 4LV2A 1S66L 1ONHA 3Q1FA 3NULA 1UGUA 4S2JA 3IH9A 3NOTC 1PI5A 4ARZA 1PYYA 2MJ6A 4PM6A 3CG5A 3CHWP 2JC7A 4S2MA 5HL6A 5HPFA 3QP1A 5FSRA 1JWPA 5EVEA 2X02A 2WZXA 1DJCA 3M2JA 5G4YA 3EEAA 5A8BA 1MC0A 4ETZA 2W3GA 2Y2OA 1J3WA 3AGEA 5EVIB 3HLFA 2HDRA 3LIAA 1N9OA 3QP8A 4KZ9A 2LB5A 2BTFP 1N9NA 4XUZA 1FIKA 2X71A 4BBUA 5GLAA 5HD5A 2FFFB 2JKFA 4P85A 5CXWA 1IYQA 2JKTM 4GCZA 5IS1A 2CMNA 5HW3A 1NYMA 4EERA 4FCFA 1M40A 4PM5A 5FEGA 2ZJ9A 4NEED 2WK0A 5DJTA 3UB8A 1RGYA 5FQQA 1NLYA 1ESIA 4WELA 1P9WA 5HL1A 5E2GA 4DE3A 3CAXA 2GZAA 4KQOA 4KZ8A 3IH8A 3T50A 3TE8A 5EECA 4EWFA 4WM9A 2X01A 2IWCA 4EEUA 5HDDA 4UA6A 2Z2MB 1MXOA 3C7VA 4WMCA 2VGKA 1IKIA 1S4RA 4HJ3A 3D9YA 4PHTA 4KZ4A 3G31A 3BQ8A 3FKVA 3IS2A 2HDUA 3BRMA 4GDBA 1NZUA 3HJIA 3DTIA 1JTDA 1NWZA 2I72A 2L4RA 5A92A 4U0TA 3HLBA 4QPRA 1MPLA 3IWOA 1KGFA 3MJQA 2XA7S 2OAQ1 4DXCA 5G18A 4C6YA 3T12B 1YAXA 5BOHA 5CECA 2K2NA 3VP0A 4EBNA 3HCYA 1XXMA 2ZQAA 1E4DA 2PBYA 3R7WB 4OQ0A 4PM9A 4MBFA 3E4PA 4L9GA 5KSCA 4GNUA 3UN7A 4I3AA 1N9LA 3P09A 4HH2A 4OH0A 3PXPA 4CJNA 3ZCZA 3BLMA 4KG2A 2QZ6A 4XT2A 1ZTUA 3MS6A 4HJ6A 1MWRA 1S1YA 5GLDA 2EWWA 1NJ4A 1OTDA 2A49A 4GB7A 3BW6A 2KLIA 1LSVA 3NECA 3W8KA 1LL9A 1MY8A 3BFDA 5L8MA 1ES2A 2VEAA 3T4SA 4QU3A 2XR0A 5E2EA 3BY8A 2LB9A 2EX2A 4R4SA 4MLLA 4RA7A 3S7QA 1OTIA 4LFUA 3IX8A 1QMFA 3O86A 3FPWA 4B4ZA 2IA2A 1F9IA 5FI7A 4L9FA 2B95A 3UE6A 5F82A 4C3QA 2ZOIA 4WZ4A 2QYBA 2Y2HA 4E3OA 4GD8A 4I5SA 1L3LA 1YMXA 4MN6A 4DRTA 2FH5A 2WADA 2Z6CA 1ZKJA 2PU4A 1HLUP 5A91A 4JGQA 1BZAA 1OPXA 3SH8A 4CQHA 2XRNA 1PI4A 5EV0A 2A3UA 3CUEA 1H0MA 4FTXA 1TEMA 1ERMA 1NY0A 2B5RA 2L1MA 2NUTC 1LL5A 4LENA 3ZHHA 4M3KA 4WMCD 1LI0A 1WE4A 3QHYA 4FH4A 2P9VB 1H8MA 2E8IA 1IKGA 3DWZA 3QP4A 1DP8A 4JF4A 1PWDA 3C30A 4LV0A 4Y7PA 3DW0A 5CGSA 5CTNA 2Y8HA 5AJGA 3TW8A 3UE1A 4JBFA 4R3JA 2XH9A 2KX6A 4R6LA 4Q0HA 2QPNA 2PRFA 3ISGA 5LBRA 2ZL1A 4XUXA 1E3UD 3BYDA 3NY4A 1NYYA 4JF5A 1ZC2A 4BD1A 1ERQA 4WEKA 4HBUA 1G6OA 4UHUA 5EM0A 2WKRA 5FAPA 1YM1A 1G28A 3BWLA 1C3BA 3V39A 2HF6A 4ID4A 2INWA 4KUKA 2DNSA 5FASA 4HIAA 2WKHA 3VP4A 4ME4A 2OAP1 1I5QA 2JHEA 4Y13A 4JKTA 3HBRA 5GL9A 4I39A 5EVIA 1OTEA 4MCWA 3AGFA 3KSFA 3DTEA 1P9RA 3ZG7B 1PW8A 2PYRA 5EPHA 3MXRA 3OPHA 1NRFA 3TOIA 5A90A 3M6HA 4B9OA 4Q0JA 5HDCA 4P0MA 4B88A 1KVMA 4S2NA 3V67A 1ACFA 4HEFA 4R3BA 4R3AA 3SW1A 3EGXC 4EUVA 2VGLS 5A93A 1OT6A 2EFXA 1K0KA 2QJ7A 2V20A 3PBOA 4IHQA 4ZRRA 2VV7A 3OPLA 2HDSA 4II7A 2V0WA 3HJKA 5IT5A 5E43A 3UNWA 2Y2QA 3FG8A 3P01A 5E2HA 1K54A 1YQSA 4HH3A 2A24B 4R23A 4BL3A 4HQAA 3ZNTA 3VOLA 3PBNA 1LSXA 2A2LA 4DJ2A 3UE3A 2H0YA 2H28A 3GECA 4Q8IA 4X69A 5M1AA 4R38A 4XT2B 2VLGA 4JGOA 2V0UA 2Q9MA 4WUJA 1WYBA 4X6TA 2QMIA 3OCNA 2HPBA 2Y91A 1YLTA 1W8QA 4EUZA 1FSYA 2ZQ7A 1P97A 5CRFA 4R1GA 2Y55A 3E4OA 3CJMA 1NXYA 2UV0E 1XPBA 3VOZA 4ZDXA 5TJJA 2KOIA 1Y28A 2WAEA 3MZFA 3R7WA 3WWXA 4N1HA 1KDSA 4H6JB 1XA7A 1TF1A 1PW1A 1KGGA 2J9PA 4N1XA 4OOYA 2JKRI 3LIBA 3H9WA 3EOIA 4F3LB 5FQMA 4PAUA 1YLYA 2W3DA 1CQAA 4D2OA 1PIOA 1YLWA 3D3OA 3ZG8B 2WUQA 1NLZA 1XP4A 3TRCA 1X0OA 3G2ZA 5EVID 3A3EA 3FV7A 3NOPC 4NXBA 1ZG4A 3IHBA 1JTGA 4Z1WA 2M7UA 3RJUA 3VOYA 2HDQA 3BFEA 2QHKA 4QD4A 5EVIC 3EGDC 4BL2A 5M19A 3F1OB 4LCLA 4E3NA 2XA7M 3A0RA 3DTKA 3BFCA 5FAOA 3V3SA 3IX3A 4YWZA 4S2NC 1I2WA 3NI9A 2W3HA 3IX4A 3G30A 2R9WA 2Y2JA 3P7NA 2EFUA 3GV9A 2PR6A 1Z09A 5DF8A 4WYYA 3HLDA 3VSKA 3GSGA 3CLOA 4HY8A 3Q7VA 4BBVA 1FSWA 5CHMA 3VP3A 1HTZA 3SOIA 3W4OA 1BLSA 4HP9A 1TS0A 4UQIS 4LV3A 3OBFA 1XJ4A 3T4LA 1K6RA 1K54C 3IF6B 1OMEA 5CEBA 4EESA 3H82B 4GS9A 1UWPX 3HVFA 3MBZA 2WKEA 2P9VA 4NG2A 2VKSA 3N8RA 1HVBA 1AXBA 4LCMA 1JNUA 1YMSA 4EETB 3MFDA 4KQQA 4G3KA 5DKKA 4XXRA 5GHZA 1S6RA 2WKQA 2HP9A 4HHDA 2K31A 3QP6A 4EQIA 3JVVA 5J7EA 2PAVP 1XKZA 3A0VA 2PBDP 2GX5A 3TJZC 5FATA 3ITBA 4G3WA 1MZUA 4LGWA 1MWUA 2PR5A 2K7SA 3Q82A 1W7FA 2J8YA 1CI9A 4Y15A 4WLAA 4KQRA 1IFQA 4PM8A 4OONA 2FZ0A 2ZMFA 2M7VA 3HUOA 2WYXA 2RCXA 2WGWA 3ZDJA 1K4EA 4E3JA 1IYOA 4E6WA 1MBLA 1K56A 3S4XA 4LPZA 1S4SA 1TVFA 4F94A 2D01A 2ZQ8A 3LCEA 4L0LA 3UDFA 3E98A 4JXSA 2O9AA 1TDGA 4HI4A 2C5WB 2Y2NA 2Y2GA 3QNBA 4MMNA 3NIAA 2P08A 2XD1A 3DWKA 4N9KA 2J3TC 1XA1A 5FQKA 5AVFA 3RH8B 3T4TA 5CHJA 5M18A 4DN0A 4JXGA 2JE5A 3T1SA 2OLVA 1KDWA 2ZC7A 2ZC3B 1T18A 4RX3A 4ZJ3A 3JPUA 4WN5A 4KUOA 3KYZA 4M4XA 1LLBA 2B02A 3AGDA 3HLCA 4BWIA 4FOFA 3C7UA 2EA9A 2EXBA 4PMAA 1Q2PA 3T4KA 3SH9A 2A24A 4O7DA 5CTMA 3IT9A 1M6KA 3VP1A 3ZGAB 4HNBA 5FDHA 5HARA 2G2WA 4KZAA 2AVXA 1IYSA 1FILA 1TS7A 4O8GA 3KSHA 2VX8A 1KGEA 3B42A 3WRZA 3LO7A 5DFXA 1YSPA 2EX9A 3N4IA 4NXGA 2O9BA 2QKPA 2ZC4B 1BLPA 1OTBA 2J80A 2XDMA 1G6AA 4X25A 1CJFA 2G2UA 3BY9A 2D02A 4NKPA 3GMWA 1TS8A 3E0YA 4YOFA 2ZMAA 3F1NA 5J4EA 2XQZA 3LR0A 4FH2A 2VGLM 1GHMA 4KZBA 3FPVA 4GW9A 3LY3A 1DRMA 4H6JA 4QB8A 3VSLA 2W1RA 4JXWA 1G5UA 4RX2A 4F3LA 1DY6A 3NOUC 4EQ1A 3TSGA 3Q7VB 5GHYA 1N4OA 2VGJA 3Q81A 4GHIB 5FDSA 5JYOA 4E3KA 1ES4A 1T19A 3S7NA 3KO6A 5DJUA 3NDGA 3UY6A 5J3WA 4OPRA 2O99A 3UB9A 2IWBA 3H7WA 2JKRM 4JGRA 4P6ZS 3WS1A 2VZWA 3MQQA 4OPZA 3A3FA 4CLCE 4GS9B 2O0YA 3R4KA 2R78A 5HX9A
chains in the Genus database with same CATH topology
1EWZA 2EX8A 4RYEA 2XLNA 2Y2MA 2H0YA 3UE3A 4GKUA 4WZ5C 1BUEA 2R9XA 1EROA 1DJBA 5FQIA 4X69A 4DDSA 4Q8IA 3O3VA 3E2KA 5M1AA 1ONGA 4R0QA 3N6IA 3VFFA 1K57C 5AQAA 4IVIA 2DRWA 4K0XA 4KZ3A 2Q9MA 4KG5A 3ZVWA 3PBTA 4IEDA 3LY4A 4S2LA 4LV2A 1WYBA 1ONHA 3Q1FA 1QMEA 4S2JA 3IH9A 2QMIA 4UA9A 4X6TA 4FSFA 1PI5A 1E3UA 2HP6A 3OCNA 3EQVA 2HPBA 1PYYA 2Y91A 3HLWA 1YLTA 3IXDA 2OSUA 1GCEA 2GDNA 4BENA 4PM6A 1W8QA 4EUZA 1FSYA 3CG5A 3I7JA 5CHUA 2JC7A 4X68A 4S2MA 4Y0UA 2ZQ7A 3ZG0A 4X56A 1ESUA 5GHXA 5EOEA 3OCLA 5CRFA 5FSRA 4R1GA 1JWPA 3OPRA 2Y55A 4E6XA 2X02A 3IF6A 2WZXA 5E2FA 1GHIA 3IXGA 4KZ5A 1DJCA 4K0WA 4MEZA 1LI9A 3M2JA 4P6BA 1YLZA 1Z6FA 4C75A 4H8RA 1FR6A 3CJMA 1CI8A 3UDXA 1SHVA 3GR2A 3IWQA 1NXYA 2WGWB 4YINA 2Y2OA 5F1GA 1XPBA 3VOZA 4ZDXA 3AGEA 5EVIB 3HLFA 1W5DA 2HDRA 1BTLA 2WAEA 3MZFA 3W4PA 3ZNYA 2Y59A 3FKWA 3WWXA 4E3MA 4N1HA 4JF6A 1KDSA 1XX2A 1YLJA 5KSHA 4DKIA 4KZ9A 1CEGA 5JYPA 1EI5A 4NK3A 1XA7A 1NZOA 1PW1A 1KGGA 1PZPA 2H10A 2J9PA 1RCJA 1MWSA 4XUZA 4N1XA 5CERA 4OOYA 2X71A 3GTCA 4NETA 5GLAA 1SDEA 2FFFB 4P85A 5CXWA 2OV5A 1IYQA 5FQMA 1YLYA 4OPYA 5FA7A 4S2KA 3EQUA 1H8YA 1G68A 5HW3A 1NYMA 1CEFA 1FR1A 4FCFA 2H0TA 1M40A 3M2KA 4D2OA 1PIOA 1YLWA 2HP5A 2EXAA 3ZG8B 1XGIA 4PM5A 3UE0A 4DDYA 4OLDA 2WUQA 2EX6A 1XP4A 3PAEA 2C6WB 4OVDA 2ZJ9A 3NCKA 2WK0A 1RGYA 3G4PA 5FQQA 3WS2A 3G2ZA 3IHAA 2WZZA 4OKPA 5EVID 3A3EA 3FV7A 3A3DA 3C4PA 1ESIA 4WELA 1ZG4A 3IHBA 4QY5A 1K56D 2CC1A 1JTGA 2ZM8A 5HL1A 2WAFA 5E2GA 4WBGA 3RJUA 4DE3A 3VOYA 2HDQA 4KQOA 3BFEA 4KZ8A 3PBRA 4OLGA 4QD4A 5EVIC 3IH8A 4BL2A 5EECA 4EWFA 5M19A 5AQ7A 4LCLA 4E3NA 4WM9A 2X01A 2IWCA 2XK1A 3S1YA 4UA6A 2BG1A 1FCNA 5DTKA 2Z2MB 3N8LA 1HZOA 1MXOA 3C7VA 3BFCA 1N9BA 1ZG6A 5F83A 4WMCA 5FAOA 3V3SA 2VGKA 1IKIA 2XEPA 2Y2PA 1E25A 2V1ZA 2ZQDA 3G31A 4KZ4A 4S2NC 1I2WA 4Z9QA 5HAPA 3ITAA 5HAIA 3FKVA 3NI9A 4KG6A 1PZOA 2V2FF 3G30A 2R9WA 2HDUA 2Y2JA 3TG9A 1FCOA 2EFUA 2ZC5B 3GV9A 3RXWA 3BRMA 2XGNA 4GDBA 4UAAA 1NZUA 4QY6A 5DF8A 4WYYA 1JTDA 4BD0A 3HLDA 3VSKA 2I72A 3GSGA 3UPPA 1WYCA 3Q7VA 4UA7A 5A92A 1FSWA 5CHMA 3Q7ZA 3VP3A 2XFSA 4U0TA 3HLBA 1HTZA 1MPLA 1FQGA 1KGFA 3IWOA 4GZBA 3SOIA 4DXCA 3W4OA 5G18A 4IBRA 3ZG9B 1BLSA 4C6YA 2IWDA 5F1FA 4LV3A 1K6RA 1K54C 1TDLA 3IF6B 3IXBA 1FCMA 1OMEA 5CEBA 3IF5A 2Y2LA 5BOHA 1MWTA 2J9OA 4GDNA 5L2FA 1IYPA 4B4XA 5CECA 3HVFA 2WGIA 3VP0A 1BSGA 3MBZA 4EBNA 3WS0A 2ZC6B 1XXMA 4LV1A 2ZQAA 1E4DA 2WKEA 2P9VA 2PBYA 4GN2A 4KZ7A 3O88A 1L0GA 4CPKA 4OQ0A 4PM9A 4MBFA 4JXVA 3N8RA 1HVBA 2XF3A 4FD8A 1AXBA 4GNUA 1YT4A 4LCMA 4MNRA 3UN7A 5KSCA 3P09A 1YMSA 4OH0A 2ZLYA 3G35A 3MFDA 4CJNA 1H5XA 1SCWA 3ZCZA 3BLMA 4KG2A 2QZ6A 4EV4A 3BEBA 4KQQA 5EOOA 1MWRA 4XXRA 5GHZA 4EBPA 1S6RA 3BLSA 5GLDA 4P87A 2HP9A 1NJ4A 3C4OA 2A49A 2WGVA 4EQIA 4GB7A 3WS4A 1XKZA 1BLHA 1U60A 5FI2A 4OOLA 2DCFA 3W8KA 4A5RA 3OPPA 5FATA 3ITBA 1LL9A 1MY8A 1MWUA 3BFDA 1H8ZA 1FOFA 1W7FA 3Q82A 3NDEA 3IF6C 1ES2A 4QU3A 2J8YA 1SDNA 2Z2LB 2XR0A 5E2EA 1CI9A 2EX2A 4U3TA 4OQGA 4R4SA 5KMWA 4MLLA 4KQRA 4RA7A 4X55A 1JWZA 1MKIA 3IXHA 2JCHA 4PM8A 4OONA 1HD8A 5TFQA 1O7EA 3HUOA 2WYXA 4OP8A 1QMFA 4KENB 2RCXA 3O86A 4B4ZA 5HAQA 2WGWA 3ZDJA 5KZHA 2ZQ9A 5IHVA 1K4EA 5FI7A 1IYOA 4E3JA 5TR7A 4E6WA 5F82A 5DVAA 1MBLA 1IEMA 2ZD8A 1K56A 1RP5A 2Y2KA 3S4XA 4C3QA 5I94A 4RVAA 4WZ4A 1TVFA 4F94A 3MZEA 4ZAMA 2ZQ8A 3LCEA 4L0LA 3S22A 3UDFA 1K55A 2Y2HA 4E3OA 4GD8A 5FAQA 5CEDA 3MKEA 4DE1A 4JXSA 2H5SA 2BLSA 3ZFZA 1YMXA 1JWVA 2P74A 4DRTA 4N92A 3LEZA 2WADA 2OLUA 1TDGA 5GLBA 1ZKJA 2PU4A 4OP5A 2C5WB 5AQ9A 4JLFA 2Y2NA 5EUAA 2Y2GA 1BZAA 3HL9A 5A91A 3QNBA 4WZ5A 3SH8A 3NIAA 4YFMA 1VM1A 3N8SA 1L0DA 4OOMA 2XD1A 4E3IA 3DWKA 2ZQCA 4N9KA 1PI4A 3HREA 3V50A 1XA1A 2A3UA 5DF7A 3UO9A 4ZTKA 5FQKA 1K57A 4QHCA 1TEMA 4S2PA 1ERMA 1J9MA 1NY0A 3IQAA 5CHJA 1PWCA 2B5RA 3N7WA 3VP2A 5M18A 1K25A 3Q07A 4JXGA 1LL5A 2JE5A 4DE2A 3MKFA 4LENA 1BT5A 1SKFA 4BLMA 3ZHHA 3BFGA 5D3OA 2WKIA 3ZVTA 2OLVA 1RGZA 3GRJA 4IVKA 4M3KA 4R4RA 4WMCD 1KDWA 5EE8A 1LI0A 2ZC7A 3G32A 2ZC3B 1WE4A 4RX3A 4S2IA 3QHYA 4ZJ3A 2RL3A 4FH4A 4K91A 2P9VB 4S2OA 4ZJ2A 2E8IA 3GVBA 1KE3A 1IKGA 2Y2IA 3DWZA 3G34A 4JF4A 1BLCA 1PWDA 1LLBA 3AGDA 3HLCA 4LV0A 1GA0A 4Y7PA 4BJPA 3C7UA 3OC2A 2XFTA 3DW0A 2EXBA 3CMZA 4PMAA 4Y0TA 5CGSA 3BFFA 5HFOA 5CTNA 1Q2PA 1JVJA 3G2YA 3SS4A 1Y54A 4IBXA 3UE1A 5DTSA 3SH9A 4JBFA 4O7DA 4R3JA 5CTMA 2J7VA 3IT9A 2JBFA 3MXSA 2XH9A 1M6KA 3VP1A 3BM6A 5EVLA 3PTEA 5FDHA 3ZGAB 4DF6A 2QPNA 5HARA 1LHYA 5DTTA 3ISGA 2G2WA 4KZAA 1IYSA 3BECA 4XUXA 1E3UD 5FQJA 3BYDA 1K6SA 1L0FA 3W4QA 1KGEA 4JPMA 3NY4A 4ZJ1A 4Y0OA 3WRZA 1NYYA 3LO7A 4JF5A 2EX9A 4OQHA 3N4IA 2ZC4B 4GD6A 1BLPA 4E3LA 2XDMA 1ZC2A 4BD1A 1ERQA 3VFHA 3C5AA 1G6AA 1KE4A 3E2LA 3DTMA 2G2UA 4OPQA 3HLGA 4HBUA 4WEKA 4UHUA 4GOGA 1IELA 3GMWA 3V3RA 3JYIA 5FAPA 1YM1A 5AQBA 5TGFA 5CGWA 5FQ9A 1O07A 3CZDA 2ZM0A 1C3BA 3HUNA 3B3XA 5CGXA 3UPNA 3V39A 4MBHA 4BQMA 4ID4A 1ES3A 5DF9A 2ZMAA 2DNSA 5FASA 3PBSA 2WKHA 3VP4A 3V5MA 2FFYA 4QJGA 2XQZA 4X53A 1YLPA 4PPRA 1I5QA 4MBKA 4FH2A 3M6BA 4JKTA 1GHMA 3HBRA 3FZCA 1S0WA 5GL9A 3SS5A 5EVIA 3UPOA 1KVLA 4DXBA 4KZBA 3AGFA 3P98A 1BULA 4OQIA 1K4FA 1XGJA 4WEJA 3ZG7B 1PW8A 1ES5A 3LY3A 3WRTA 1KE0A 3A3JA 4QB8A 2Y4AA 3VSLA 4DE0A 5EPHA 3MXRA 3OPHA 1NRFA 3TOIA 5A90A 3M6HA 5U47A 3MZDA 3D4FA 3PBQA 4JXWA 4P0MA 3VMAA 4B88A 3SH7A 1KVMA 2UWXA 4S2NA 3SS3A 4HEFA 4RX2A 4R3BA 1GHPA 4HBTA 5J8XA 2PU2A 3RXXA 1DY6A 3NC8A 3NBLA 1I2SA 1VQQA 5GLCA 4U0XA 3TSGA 5FI6A 3OZHA 3Q7VB 5GHYA 1N4OA 2VGJA 3Q81A 5JYOA 1L2SA 1L0EA 1K38A 1ALQA 4E3KA 1ES4A 3QNCA 4N9LA 3ZG5A 1W79A 5A93A 3UDIA 3NDGA 3UY6A 2EFXA 4OPRA 4EBLA 1CK3A 2ZM2A 3GQZA 4HESA 2V20A 1GA9A 3IWIA 3PBOA 3FWLA 2IWBA 3OPLA 2HDSA 4ZBEA 2XD5A 5E43A 3HLEA 3FYZA 3UNWA 3WS1A 4OPZA 3WS5A 1W8YA 2Y2QA 3A3FA 3A3IA 3O87A 5E2HA 1K54A 1YQSA 1K55C 3PAGA 4PM7A 4R23A 2Q9NA 4BL3A 1PWGA 3ZNTA 1DJAA 3HUMA 5HX9A 4KZ6A 1Q2QA 3PBNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EWZ A;  2EX8 A;  4RYE A;  2XLN A;  2Y2M A;  2H0Y A;  3UE3 A;  4GKU A;  4WZ5 C;  1BUE A;  2R9X A;  1ERO A;  1DJB A;  5FQI A;  4X69 A;  4DDS A;  4Q8I A;  3O3V A;  3E2K A;  5M1A A;  1ONG A;  4R0Q A;  3N6I A;  3VFF A;  1K57 C;  5AQA A;  4IVI A;  2DRW A;  4K0X A;  4KZ3 A;  2Q9M A;  4KG5 A;  3ZVW A;  3PBT A;  4IED A;  3LY4 A;  4S2L A;  4LV2 A;  1WYB A;  1ONH A;  3Q1F A;  1QME A;  4S2J A;  3IH9 A;  2QMI A;  4UA9 A;  4X6T A;  4FSF A;  1PI5 A;  1E3U A;  2HP6 A;  3OCN A;  3EQV A;  2HPB A;  1PYY A;  2Y91 A;  3HLW A;  1YLT A;  3IXD A;  2OSU A;  1GCE A;  2GDN A;  4BEN A;  4PM6 A;  1W8Q A;  4EUZ A;  1FSY A;  3CG5 A;  3I7J A;  5CHU A;  2JC7 A;  4X68 A;  4S2M A;  4Y0U A;  2ZQ7 A;  3ZG0 A;  4X56 A;  1ESU A;  5GHX A;  5EOE A;  3OCL A;  5CRF A;  5FSR A;  4R1G A;  1JWP A;  3OPR A;  2Y55 A;  4E6X A;  2X02 A;  3IF6 A;  2WZX A;  5E2F A;  1GHI A;  3IXG A;  4KZ5 A;  1DJC A;  4K0W A;  4MEZ A;  1LI9 A;  3M2J A;  4P6B A;  1YLZ A;  1Z6F A;  4C75 A;  4H8R A;  1FR6 A;  3CJM A;  1CI8 A;  3UDX A;  1SHV A;  3GR2 A;  3IWQ A;  1NXY A;  2WGW B;  4YIN A;  2Y2O A;  5F1G A;  1XPB A;  3VOZ A;  4ZDX A;  3AGE A;  5EVI B;  3HLF A;  1W5D A;  2HDR A;  1BTL A;  2WAE A;  3MZF A;  3W4P A;  3ZNY A;  2Y59 A;  3FKW A;  3WWX A;  4E3M A;  4N1H A;  4JF6 A;  1KDS A;  1XX2 A;  1YLJ A;  5KSH A;  4DKI A;  4KZ9 A;  1CEG A;  5JYP A;  1EI5 A;  4NK3 A;  1XA7 A;  1NZO A;  1PW1 A;  1KGG A;  1PZP A;  2H10 A;  2J9P A;  1RCJ A;  1MWS A;  4XUZ A;  4N1X A;  5CER A;  4OOY A;  2X71 A;  3GTC A;  4NET A;  5GLA A;  1SDE A;  2FFF B;  4P85 A;  5CXW A;  2OV5 A;  1IYQ A;  5FQM A;  1YLY A;  4OPY A;  5FA7 A;  4S2K A;  3EQU A;  1H8Y A;  1G68 A;  5HW3 A;  1NYM A;  1CEF A;  1FR1 A;  4FCF A;  2H0T A;  1M40 A;  3M2K A;  4D2O A;  1PIO A;  1YLW A;  2HP5 A;  2EXA A;  3ZG8 B;  1XGI A;  4PM5 A;  3UE0 A;  4DDY A;  4OLD A;  2WUQ A;  2EX6 A;  1XP4 A;  3PAE A;  2C6W B;  4OVD A;  2ZJ9 A;  3NCK A;  2WK0 A;  1RGY A;  3G4P A;  5FQQ A;  3WS2 A;  3G2Z A;  3IHA A;  2WZZ A;  4OKP A;  5EVI D;  3A3E A;  3FV7 A;  3A3D A;  3C4P A;  1ESI A;  4WEL A;  1ZG4 A;  3IHB A;  4QY5 A;  1K56 D;  2CC1 A;  1JTG A;  2ZM8 A;  5HL1 A;  2WAF A;  5E2G A;  4WBG A;  3RJU A;  4DE3 A;  3VOY A;  2HDQ A;  4KQO A;  3BFE A;  4KZ8 A;  3PBR A;  4OLG A;  4QD4 A;  5EVI C;  3IH8 A;  4BL2 A;  5EEC A;  4EWF A;  5M19 A;  5AQ7 A;  4LCL A;  4E3N A;  4WM9 A;  2X01 A;  2IWC A;  2XK1 A;  3S1Y A;  4UA6 A;  2BG1 A;  1FCN A;  5DTK A;  2Z2M B;  3N8L A;  1HZO A;  1MXO A;  3C7V A;  3BFC A;  1N9B A;  1ZG6 A;  5F83 A;  4WMC A;  5FAO A;  3V3S A;  2VGK A;  1IKI A;  2XEP A;  2Y2P A;  1E25 A;  2V1Z A;  2ZQD A;  3G31 A;  4KZ4 A;  4S2N C;  1I2W A;  4Z9Q A;  5HAP A;  3ITA A;  5HAI A;  3FKV A;  3NI9 A;  4KG6 A;  1PZO A;  2V2F F;  3G30 A;  2R9W A;  2HDU A;  2Y2J A;  3TG9 A;  1FCO A;  2EFU A;  2ZC5 B;  3GV9 A;  3RXW A;  3BRM A;  2XGN A;  4GDB A;  4UAA A;  1NZU A;  4QY6 A;  5DF8 A;  4WYY A;  1JTD A;  4BD0 A;  3HLD A;  3VSK A;  2I72 A;  3GSG A;  3UPP A;  1WYC A;  3Q7V A;  4UA7 A;  5A92 A;  1FSW A;  5CHM A;  3Q7Z A;  3VP3 A;  2XFS A;  4U0T A;  3HLB A;  1HTZ A;  1MPL A;  1FQG A;  1KGF A;  3IWO A;  4GZB A;  3SOI A;  4DXC A;  3W4O A;  5G18 A;  4IBR A;  3ZG9 B;  1BLS A;  4C6Y A;  2IWD A;  5F1F A;  4LV3 A;  1K6R A;  1K54 C;  1TDL A;  3IF6 B;  3IXB A;  1FCM A;  1OME A;  5CEB A;  3IF5 A;  2Y2L A;  5BOH A;  1MWT A;  2J9O A;  4GDN A;  5L2F A;  1IYP A;  4B4X A;  5CEC A;  3HVF A;  2WGI A;  3VP0 A;  1BSG A;  3MBZ A;  4EBN A;  3WS0 A;  2ZC6 B;  1XXM A;  4LV1 A;  2ZQA A;  1E4D A;  2WKE A;  2P9V A;  2PBY A;  4GN2 A;  4KZ7 A;  3O88 A;  1L0G A;  4CPK A;  4OQ0 A;  4PM9 A;  4MBF A;  4JXV A;  3N8R A;  1HVB A;  2XF3 A;  4FD8 A;  1AXB A;  4GNU A;  1YT4 A;  4LCM A;  4MNR A;  3UN7 A;  5KSC A;  3P09 A;  1YMS A;  4OH0 A;  2ZLY A;  3G35 A;  3MFD A;  4CJN A;  1H5X A;  1SCW A;  3ZCZ A;  3BLM A;  4KG2 A;  2QZ6 A;  4EV4 A;  3BEB A;  4KQQ A;  5EOO A;  1MWR A;  4XXR A;  5GHZ A;  4EBP A;  1S6R A;  3BLS A;  5GLD A;  4P87 A;  2HP9 A;  1NJ4 A;  3C4O A;  2A49 A;  2WGV A;  4EQI A;  4GB7 A;  3WS4 A;  1XKZ A;  1BLH A;  1U60 A;  5FI2 A;  4OOL A;  2DCF A;  3W8K A;  4A5R A;  3OPP A;  5FAT A;  3ITB A;  1LL9 A;  1MY8 A;  1MWU A;  3BFD A;  1H8Z A;  1FOF A;  1W7F A;  3Q82 A;  3NDE A;  3IF6 C;  1ES2 A;  4QU3 A;  2J8Y A;  1SDN A;  2Z2L B;  2XR0 A;  5E2E A;  1CI9 A;  2EX2 A;  4U3T A;  4OQG A;  4R4S A;  5KMW A;  4MLL A;  4KQR A;  4RA7 A;  4X55 A;  1JWZ A;  1MKI A;  3IXH A;  2JCH A;  4PM8 A;  4OON A;  1HD8 A;  5TFQ A;  1O7E A;  3HUO A;  2WYX A;  4OP8 A;  1QMF A;  4KEN B;  2RCX A;  3O86 A;  4B4Z A;  5HAQ A;  2WGW A;  3ZDJ A;  5KZH A;  2ZQ9 A;  5IHV A;  1K4E A;  5FI7 A;  1IYO A;  4E3J A;  5TR7 A;  4E6W A;  5F82 A;  5DVA A;  1MBL A;  1IEM A;  2ZD8 A;  1K56 A;  1RP5 A;  2Y2K A;  3S4X A;  4C3Q A;  5I94 A;  4RVA A;  4WZ4 A;  1TVF A;  4F94 A;  3MZE A;  4ZAM A;  2ZQ8 A;  3LCE A;  4L0L A;  3S22 A;  3UDF A;  1K55 A;  2Y2H A;  4E3O A;  4GD8 A;  5FAQ A;  5CED A;  3MKE A;  4DE1 A;  4JXS A;  2H5S A;  2BLS A;  3ZFZ A;  1YMX A;  1JWV A;  2P74 A;  4DRT A;  4N92 A;  3LEZ A;  2WAD A;  2OLU A;  1TDG A;  5GLB A;  1ZKJ A;  2PU4 A;  4OP5 A;  2C5W B;  5AQ9 A;  4JLF A;  2Y2N A;  5EUA A;  2Y2G A;  1BZA A;  3HL9 A;  5A91 A;  3QNB A;  4WZ5 A;  3SH8 A;  3NIA A;  4YFM A;  1VM1 A;  3N8S A;  1L0D A;  4OOM A;  2XD1 A;  4E3I A;  3DWK A;  2ZQC A;  4N9K A;  1PI4 A;  3HRE A;  3V50 A;  1XA1 A;  2A3U A;  5DF7 A;  3UO9 A;  4ZTK A;  5FQK A;  1K57 A;  4QHC A;  1TEM A;  4S2P A;  1ERM A;  1J9M A;  1NY0 A;  3IQA A;  5CHJ A;  1PWC A;  2B5R A;  3N7W A;  3VP2 A;  5M18 A;  1K25 A;  3Q07 A;  4JXG A;  1LL5 A;  2JE5 A;  4DE2 A;  3MKF A;  4LEN A;  1BT5 A;  1SKF A;  4BLM A;  3ZHH A;  3BFG A;  5D3O A;  2WKI A;  3ZVT A;  2OLV A;  1RGZ A;  3GRJ A;  4IVK A;  4M3K A;  4R4R A;  4WMC D;  1KDW A;  5EE8 A;  1LI0 A;  2ZC7 A;  3G32 A;  2ZC3 B;  1WE4 A;  4RX3 A;  4S2I A;  3QHY A;  4ZJ3 A;  2RL3 A;  4FH4 A;  4K91 A;  2P9V B;  4S2O A;  4ZJ2 A;  2E8I A;  3GVB A;  1KE3 A;  1IKG A;  2Y2I A;  3DWZ A;  3G34 A;  4JF4 A;  1BLC A;  1PWD A;  1LLB A;  3AGD A;  3HLC A;  4LV0 A;  1GA0 A;  4Y7P A;  4BJP A;  3C7U A;  3OC2 A;  2XFT A;  3DW0 A;  2EXB A;  3CMZ A;  4PMA A;  4Y0T A;  5CGS A;  3BFF A;  5HFO A;  5CTN A;  1Q2P A;  1JVJ A;  3G2Y A;  3SS4 A;  1Y54 A;  4IBX A;  3UE1 A;  5DTS A;  3SH9 A;  4JBF A;  4O7D A;  4R3J A;  5CTM A;  2J7V A;  3IT9 A;  2JBF A;  3MXS A;  2XH9 A;  1M6K A;  3VP1 A;  3BM6 A;  5EVL A;  3PTE A;  5FDH A;  3ZGA B;  4DF6 A;  2QPN A;  5HAR A;  1LHY A;  5DTT A;  3ISG A;  2G2W A;  4KZA A;  1IYS A;  3BEC A;  4XUX A;  1E3U D;  5FQJ A;  3BYD A;  1K6S A;  1L0F A;  3W4Q A;  1KGE A;  4JPM A;  3NY4 A;  4ZJ1 A;  4Y0O A;  3WRZ A;  1NYY A;  3LO7 A;  4JF5 A;  2EX9 A;  4OQH A;  3N4I A;  2ZC4 B;  4GD6 A;  1BLP A;  4E3L A;  2XDM A;  1ZC2 A;  4BD1 A;  1ERQ A;  3VFH A;  3C5A A;  1G6A A;  1KE4 A;  3E2L A;  3DTM A;  2G2U A;  4OPQ A;  3HLG A;  4HBU A;  4WEK A;  4UHU A;  4GOG A;  1IEL A;  3GMW A;  3V3R A;  3JYI A;  5FAP A;  1YM1 A;  5AQB A;  5TGF A;  5CGW A;  5FQ9 A;  1O07 A;  3CZD A;  2ZM0 A;  1C3B A;  3HUN A;  3B3X A;  5CGX A;  3UPN A;  3V39 A;  4MBH A;  4BQM A;  4ID4 A;  1ES3 A;  5DF9 A;  2ZMA A;  2DNS A;  5FAS A;  3PBS A;  2WKH A;  3VP4 A;  3V5M A;  2FFY A;  4QJG A;  2XQZ A;  4X53 A;  1YLP A;  4PPR A;  1I5Q A;  4MBK A;  4FH2 A;  3M6B A;  4JKT A;  1GHM A;  3HBR A;  3FZC A;  1S0W A;  5GL9 A;  3SS5 A;  5EVI A;  3UPO A;  1KVL A;  4DXB A;  4KZB A;  3AGF A;  3P98 A;  1BUL A;  4OQI A;  1K4F A;  1XGJ A;  4WEJ A;  3ZG7 B;  1PW8 A;  1ES5 A;  3LY3 A;  3WRT A;  1KE0 A;  3A3J A;  4QB8 A;  2Y4A A;  3VSL A;  4DE0 A;  5EPH A;  3MXR A;  3OPH A;  1NRF A;  3TOI A;  5A90 A;  3M6H A;  5U47 A;  3MZD A;  3D4F A;  3PBQ A;  4JXW A;  4P0M A;  3VMA A;  4B88 A;  3SH7 A;  1KVM A;  2UWX A;  4S2N A;  3SS3 A;  4HEF A;  4RX2 A;  4R3B A;  1GHP A;  4HBT A;  5J8X A;  2PU2 A;  3RXX A;  1DY6 A;  3NC8 A;  3NBL A;  1I2S A;  1VQQ A;  5GLC A;  4U0X A;  3TSG A;  5FI6 A;  3OZH A;  3Q7V B;  5GHY A;  1N4O A;  2VGJ A;  3Q81 A;  5JYO A;  1L2S A;  1L0E A;  1K38 A;  1ALQ A;  4E3K A;  1ES4 A;  3QNC A;  4N9L A;  3ZG5 A;  1W79 A;  5A93 A;  3UDI A;  3NDG A;  3UY6 A;  2EFX A;  4OPR A;  4EBL A;  1CK3 A;  2ZM2 A;  3GQZ A;  4HES A;  2V20 A;  1GA9 A;  3IWI A;  3PBO A;  3FWL A;  2IWB A;  3OPL A;  2HDS A;  4ZBE A;  2XD5 A;  5E43 A;  3HLE A;  3FYZ A;  3UNW A;  3WS1 A;  4OPZ A;  3WS5 A;  1W8Y A;  2Y2Q A;  3A3F A;  3A3I A;  3O87 A;  5E2H A;  1K54 A;  1YQS A;  1K55 C;  3PAG A;  4PM7 A;  4R23 A;  2Q9N A;  4BL3 A;  1PWG A;  3ZNT A;  1DJA A;  3HUM A;  5HX9 A;  4KZ6 A;  1Q2Q A;  3PBN A; 
#chains in the Genus database with same CATH topology
 1EWZ A;  1PNE A;  2XLN A;  3F1O A;  2R9X A;  5HZH A;  1S67 L;  1ONG A;  4R0Q A;  2JKG A;  1V9Z A;  4GJ4 A;  3N6I A;  3VFF A;  4K0X A;  4KG5 A;  3PBT A;  4CLC A;  3S7O A;  4FSF A;  3EQV A;  4NXE A;  4BEN A;  3IXD A;  1F5M A;  1GCE A;  2GDN A;  2G7U A;  4Q0I A;  5CHU A;  2ZOH A;  4X68 A;  4Y0U A;  4E04 A;  3ZG0 A;  1ESU A;  3OCL A;  2WKP A;  3IF6 A;  1GHI A;  3IXG A;  4KZ5 A;  4P6B A;  4MEZ A;  1LI9 A;  1YLZ A;  3OLO A;  4H8R A;  3H82 A;  1CI8 A;  2OWH A;  1SHV A;  1D06 A;  2WGW B;  5F1G A;  3U2A A;  3W4P A;  4X1L A;  5FL3 A;  2Y59 A;  4E3M A;  4JF6 A;  1XX2 A;  5KSH A;  5JYP A;  4HP4 A;  2VK3 A;  1PZP A;  2H10 A;  1RCJ A;  1MWS A;  4NET A;  2I9V A;  4RQ9 A;  4OPY A;  5FA7 A;  4S2K A;  1H8Y A;  3LUQ A;  5DFY A;  3PR6 A;  2H0T A;  3M2K A;  2W3F A;  2HP5 A;  2J3W A;  4DDY A;  4OLD A;  2EX6 A;  3PAE A;  3UME A;  2C6W B;  3NCK A;  2W1T A;  5MC7 A;  3G4P A;  3VE3 A;  3IHA A;  1A0K A;  4AFI A;  4BBT A;  3K3D A;  4QY5 A;  4WBG A;  4PKY G;  3PBR A;  4OLG A;  3MMH A;  2HV1 A;  2BG1 A;  5DTK A;  3N8L A;  4R70 A;  5F83 A;  4UQI M;  3NHQ A;  1VET B;  1E25 A;  2V1Z A;  2ZQD A;  5HAP A;  5HAI A;  4KG6 A;  3UB5 P;  3GDI A;  1TS6 A;  3TG9 A;  1FCO A;  2ZC5 B;  4UAA A;  4EEP A;  5F5Y A;  3O5Y A;  4EW7 A;  4BD0 A;  3CUE C;  1NRJ A;  2XFS A;  3LR3 A;  1W63 Q;  1FQG A;  3E4Q A;  3LIE A;  3ZG9 B;  5F1F A;  3IXB A;  1TDL A;  4ESP A;  2VV8 A;  3IF5 A;  1MWT A;  3MR0 A;  3UB7 A;  4GDN A;  1GSW A;  1IYP A;  4B4X A;  3VV4 A;  3WS0 A;  4LV1 A;  1VEU B;  2PD7 A;  4KZ7 A;  2P04 A;  1L0G A;  1OTA A;  5L10 A;  2B18 A;  3F1N B;  1OJ5 A;  2JN7 A;  1XFQ A;  2XF3 A;  4FD8 A;  1YT4 A;  2ZLY A;  2VV6 A;  1H5X A;  1YPR A;  4CLC C;  1P0Z A;  4EBP A;  2WGV A;  3IBJ A;  1BLH A;  4MN5 A;  5FI2 A;  4OOL A;  2DCF A;  3SZT A;  4LRZ E;  1FOF A;  3NDE A;  2GNX A;  3IF6 C;  3KSI A;  4JGP A;  4U3T A;  3T4J A;  1JWZ A;  2JCH A;  4LLO B;  5TFQ A;  1O7E A;  4OP8 A;  5DKL A;  4KEN B;  3H7W B;  5EFW A;  2ZQ9 A;  5IHV A;  5DVA A;  2ZD8 A;  4RVA A;  1K55 A;  3RTY A;  5FAQ A;  4DE1 A;  2H5S A;  3QP5 A;  2BLS A;  3LFV A;  1JWV A;  5L07 A;  4X1M A;  3LEZ A;  2OLU A;  5GLB A;  5AQ9 A;  4JLF A;  5EUA A;  3HL9 A;  3JVU A;  2DMW A;  4YFM A;  1VM1 A;  3N8S A;  1SZV A;  1L0D A;  1D7E A;  3B47 A;  4OOM A;  2ZQC A;  2W3E A;  3HRE A;  3V50 A;  3UO9 A;  4ZTK A;  4ETX A;  4CLC B;  4QHC A;  1J9M A;  1PWC A;  3N7W A;  1K25 A;  4DMZ A;  1UWN X;  3MKF A;  1BT5 A;  3IBR A;  1SKF A;  1STZ A;  4BLM A;  3C2W A;  1IOU A;  2WKI A;  4GHI A;  1RGZ A;  4S2I A;  4K91 A;  5L09 A;  4S2O A;  4ZJ2 A;  1ZHH B;  3GVB A;  1KE3 A;  2Y2I A;  3G34 A;  1BLC A;  1GA0 A;  3KYQ A;  2PYP A;  3OC2 A;  3CMZ A;  3BFF A;  3G2Y A;  1JVJ A;  3SS4 A;  1Y54 A;  2VA0 A;  5DTS A;  3ICY A;  3MXS A;  5AVE A;  4DF6 A;  5EVL A;  3PTE A;  1LHY A;  4FUW A;  3BEC A;  2XSS A;  5FQJ A;  3LGO A;  1K6S A;  1L0F A;  3T1Q B;  3W4Q A;  4JPM A;  4ZJ1 A;  3T4O A;  5G4Z A;  4HOI A;  3MQO A;  4GD6 A;  4E3L A;  4UEY A;  2W0N A;  3C5A A;  1VB6 A;  3E2L A;  4OPQ A;  3LIC A;  4GOG A;  2W1T B;  5AQB A;  5TGF A;  1O07 A;  2ZM0 A;  3T4Q A;  3B3X A;  5CGX A;  3UPN A;  4BQM A;  3ZQ5 A;  1ES3 A;  4O01 A;  3PBS A;  1D1J A;  3V5M A;  1OT9 A;  4X53 A;  4MBK A;  3LID A;  3SS5 A;  1KVL A;  3P98 A;  2OOL A;  4WEJ A;  1ES5 A;  3WRT A;  4P6Z M;  3A3J A;  5U47 A;  3PBQ A;  3SH7 A;  2UWX A;  3SS3 A;  5J8X A;  3NC8 A;  2J3T D;  1I2S A;  1VQQ A;  4U0X A;  5FI6 A;  3F1P A;  1L0E A;  1YKD A;  1ALQ A;  1LL8 A;  3QNC A;  1XFN A;  1W79 A;  3K2N A;  3GQZ A;  4D60 A;  2YKF A;  4L9E A;  2PDR A;  3LI8 A;  3W2Z A;  3HLE A;  3FYZ A;  3WS5 A;  1W8Y A;  3A3I A;  1BYW A;  2YKH A;  1K55 C;  3PAG A;  4PM7 A;  2Q9N A;  1DJA A;  3HUM A;  5F6A A;  3VE4 A;  2Z6D A;  4RYE A;  2Y2M A;  2ZMV A;  4GKU A;  1ERO A;  1DJB A;  5FQI A;  4DDS A;  3NJA A;  3O3V A;  1CF0 A;  1GSX A;  1VET A;  4IED A;  3LY4 A;  5HWT A;  1QME A;  4UA9 A;  4IUK A;  1E3U A;  2HP6 A;  3S7P A;  3HLW A;  1T1A A;  2OSU A;  3LYX A;  2HGV A;  3I7J A;  3LR5 A;  3MF0 A;  4X56 A;  4O0P A;  5GHX A;  5EOE A;  5HD3 A;  3T1X A;  2W27 A;  1KOU A;  3KSG A;  3OPR A;  4E6X A;  5E2F A;  3C8C A;  4K0W A;  5TBM B;  1Z6F A;  4C75 A;  1FR6 A;  1TD5 A;  4Y2F A;  3GR2 A;  3UDX A;  3IWQ A;  4YIN A;  4MN7 A;  1W5D A;  1BTL A;  4I38 A;  1VEU A;  3ZNY A;  3RFB A;  3FKW A;  1Y4O A;  1YLJ A;  4GLQ A;  4LRX C;  4DKI A;  1CEG A;  4B93 A;  1EI5 A;  4NK3 A;  1NZO A;  3KYE A;  1V9Y A;  5CER A;  4BMW A;  3GTC A;  1SDE A;  4PKY A;  1GSV A;  4QWO A;  2OV5 A;  5K5B A;  3DAV A;  3EQU A;  5C5K A;  4Y5F A;  1G68 A;  1CEF A;  1FR1 A;  2L0W A;  2P7J A;  2EXA A;  1XGI A;  3UE0 A;  4OVD A;  4MDZ A;  1PRQ A;  3BQA A;  3WS2 A;  2WZZ A;  4OKP A;  2QWS A;  3A3D A;  3C4P A;  1K56 D;  2CC1 A;  2ZM8 A;  2WAF A;  5AQ7 A;  4I3J A;  2XK1 A;  3S1Y A;  2EWV A;  2Y79 A;  1FCN A;  3MFX A;  1HZO A;  5IU1 A;  1N9B A;  1ZG6 A;  1XJ3 A;  2XEP A;  2Y2P A;  5KIZ A;  5HSQ A;  3CPT B;  4Z9Q A;  3ITA A;  1PZO A;  2V2F F;  1DP9 A;  3RXW A;  2XGN A;  4ARZ B;  4QY6 A;  3EWK A;  3OOV A;  3A0S A;  3UPP A;  1WYC A;  4HJ4 A;  4UA7 A;  3Q7Z A;  4GZB A;  1SKO A;  4IBR A;  2IWD A;  1FCM A;  2Y2L A;  2J9O A;  5L2F A;  3MXQ A;  2M1C A;  2WGI A;  2PT7 A;  1BSG A;  2ZC6 B;  2JKT I;  4GN2 A;  3O88 A;  4CPK A;  4JXV A;  3CIT A;  1PFL A;  4MNR A;  3G35 A;  1SCW A;  4EV4 A;  3BEB A;  5EOO A;  2PHY A;  3BLS A;  4YNR A;  2Q0O A;  4P87 A;  3C4O A;  3ZYT A;  3DBA A;  3MSH A;  3WS4 A;  1U60 A;  2BAS A;  1XJ6 A;  4A5R A;  4Y3I A;  3OPP A;  3PYP A;  1EW0 A;  1H8Z A;  3BJN A;  2ZBB A;  2NUP C;  5FEF A;  1OJG A;  1SDN A;  2Z2L B;  5HPI A;  3F1P B;  4EXO A;  3G6O A;  4OQG A;  5KMW A;  3LIF A;  5F69 A;  4X55 A;  4WL9 A;  1MKI A;  4EU0 A;  3IXH A;  1HD8 A;  5HAQ A;  5KZH A;  1MKM A;  5HWW A;  2OWJ A;  1LSW A;  5TR7 A;  1IEM A;  1RP5 A;  2Y2K A;  3L7H A;  5I94 A;  4IUH A;  5EM1 A;  3MZE A;  4ZAM A;  3IS2 B;  3S22 A;  5CED A;  3MKE A;  1DP6 A;  3ZFZ A;  1T1B A;  1VHM A;  2P74 A;  4N92 A;  3PHY A;  5I5L A;  4OP5 A;  1ODV A;  4WZ5 A;  4E3I A;  2ACG A;  1H3Q A;  2HZ5 A;  5DF7 A;  5F68 A;  1K57 A;  4S2P A;  3IQA A;  5HWV A;  3VP2 A;  3Q07 A;  4DE2 A;  3BFG A;  5D3O A;  3L9K A;  3ZVT A;  3GRJ A;  4IVK A;  4R4R A;  5EE8 A;  3G32 A;  2RL3 A;  1WA9 A;  3D72 A;  3EEH A;  2QJ5 A;  4BJP A;  2XFT A;  4IJG A;  4Y0T A;  5HFO A;  3KX0 X;  4I3I A;  4IBX A;  2GJ3 A;  2J7V A;  2JBF A;  3UMD A;  3BM6 A;  5DTT A;  4CLC D;  3UB6 A;  4NXF A;  4Y0O A;  2HJ9 C;  3ULF A;  4OQH A;  4WF0 A;  3VFH A;  3K3C A;  1KE4 A;  3DTM A;  1W63 M;  3HLG A;  4K08 A;  4LRY C;  1S1Z A;  1IEL A;  2V8C A;  1LT0 A;  3V3R A;  3JYI A;  5CGW A;  4G3V A;  5FQ9 A;  3CZD A;  2V1B A;  1F2K A;  3HUN A;  4MBH A;  1T1C A;  5DF9 A;  3MQ0 A;  5TBM A;  4DJ3 A;  2XRO A;  2FFY A;  4QJG A;  1YLP A;  4PPR A;  3M6B A;  3FZC A;  1S0W A;  3UPO A;  2O9C A;  3LI9 A;  4DXB A;  1AWI A;  1XJ2 A;  1BUL A;  4OQI A;  1K4F A;  1XGJ A;  3CWF A;  2E8J A;  1KE0 A;  2Y4A A;  4DE0 A;  3MZD A;  3D4F A;  3VMA A;  2PD8 A;  3B33 A;  3LEQ A;  1GHP A;  2V8F A;  4HBT A;  2PU2 A;  3RXX A;  3NBL A;  3LR4 A;  4Y17 A;  3T1R A;  5GLC A;  3OZH A;  3QP2 A;  1L2S A;  1K38 A;  4N9L A;  3ZG5 A;  3UDI A;  4EBL A;  4HES A;  1CK3 A;  1SKO B;  2ZM2 A;  3IWI A;  1GA9 A;  3FWL A;  4ZBE A;  1YSQ A;  2V1A A;  2XD5 A;  3CI6 A;  3U4L P;  5CX7 A;  3O87 A;  4KQD A;  2KDK A;  3FC7 A;  1F98 A;  1PWG A;  2HJE A;  4KZ6 A;  1Q2Q A;  2V9A A;  2EX8 A;  4WZ5 C;  1BUE A;  2ZL1 B;  3E2K A;  3C38 A;  2VJW A;  3CPT A;  1K57 C;  5AQA A;  4IVI A;  2DRW A;  4KZ3 A;  3ZVW A;  5HDS A;  4S2L A;  4LV2 A;  1S66 L;  1ONH A;  3Q1F A;  3NUL A;  1UGU A;  4S2J A;  3IH9 A;  3NOT C;  1PI5 A;  4ARZ A;  1PYY A;  2MJ6 A;  4PM6 A;  3CG5 A;  3CHW P;  2JC7 A;  4S2M A;  5HL6 A;  5HPF A;  3QP1 A;  5FSR A;  1JWP A;  5EVE A;  2X02 A;  2WZX A;  1DJC A;  3M2J A;  5G4Y A;  3EEA A;  5A8B A;  1MC0 A;  4ETZ A;  2W3G A;  2Y2O A;  1J3W A;  3AGE A;  5EVI B;  3HLF A;  2HDR A;  3LIA A;  1N9O A;  3QP8 A;  4KZ9 A;  2LB5 A;  2BTF P;  1N9N A;  4XUZ A;  1FIK A;  2X71 A;  4BBU A;  5GLA A;  5HD5 A;  2FFF B;  2JKF A;  4P85 A;  5CXW A;  1IYQ A;  2JKT M;  4GCZ A;  5IS1 A;  2CMN A;  5HW3 A;  1NYM A;  4EER A;  4FCF A;  1M40 A;  4PM5 A;  5FEG A;  2ZJ9 A;  4NEE D;  2WK0 A;  5DJT A;  3UB8 A;  1RGY A;  5FQQ A;  1NLY A;  1ESI A;  4WEL A;  1P9W A;  5HL1 A;  5E2G A;  4DE3 A;  3CAX A;  2GZA A;  4KQO A;  4KZ8 A;  3IH8 A;  3T50 A;  3TE8 A;  5EEC A;  4EWF A;  4WM9 A;  2X01 A;  2IWC A;  4EEU A;  5HDD A;  4UA6 A;  2Z2M B;  1MXO A;  3C7V A;  4WMC A;  2VGK A;  1IKI A;  1S4R A;  4HJ3 A;  3D9Y A;  4PHT A;  4KZ4 A;  3G31 A;  3BQ8 A;  3FKV A;  3IS2 A;  2HDU A;  3BRM A;  4GDB A;  1NZU A;  3HJI A;  3DTI A;  1JTD A;  1NWZ A;  2I72 A;  2L4R A;  5A92 A;  4U0T A;  3HLB A;  4QPR A;  1MPL A;  3IWO A;  1KGF A;  3MJQ A;  2XA7 S;  2OAQ 1;  4DXC A;  5G18 A;  4C6Y A;  3T12 B;  1YAX A;  5BOH A;  5CEC A;  2K2N A;  3VP0 A;  4EBN A;  3HCY A;  1XXM A;  2ZQA A;  1E4D A;  2PBY A;  3R7W B;  4OQ0 A;  4PM9 A;  4MBF A;  3E4P A;  4L9G A;  5KSC A;  4GNU A;  3UN7 A;  4I3A A;  1N9L A;  3P09 A;  4HH2 A;  4OH0 A;  3PXP A;  4CJN A;  3ZCZ A;  3BLM A;  4KG2 A;  2QZ6 A;  4XT2 A;  1ZTU A;  3MS6 A;  4HJ6 A;  1MWR A;  1S1Y A;  5GLD A;  2EWW A;  1NJ4 A;  1OTD A;  2A49 A;  4GB7 A;  3BW6 A;  2KLI A;  1LSV A;  3NEC A;  3W8K A;  1LL9 A;  1MY8 A;  3BFD A;  5L8M A;  1ES2 A;  2VEA A;  3T4S A;  4QU3 A;  2XR0 A;  5E2E A;  3BY8 A;  2LB9 A;  2EX2 A;  4R4S A;  4MLL A;  4RA7 A;  3S7Q A;  1OTI A;  4LFU A;  3IX8 A;  1QMF A;  3O86 A;  3FPW A;  4B4Z A;  2IA2 A;  1F9I A;  5FI7 A;  4L9F A;  2B95 A;  3UE6 A;  5F82 A;  4C3Q A;  2ZOI A;  4WZ4 A;  2QYB A;  2Y2H A;  4E3O A;  4GD8 A;  4I5S A;  1L3L A;  1YMX A;  4MN6 A;  4DRT A;  2FH5 A;  2WAD A;  2Z6C A;  1ZKJ A;  2PU4 A;  1HLU P;  5A91 A;  4JGQ A;  1BZA A;  1OPX A;  3SH8 A;  4CQH A;  2XRN A;  1PI4 A;  5EV0 A;  2A3U A;  3CUE A;  1H0M A;  4FTX A;  1TEM A;  1ERM A;  1NY0 A;  2B5R A;  2L1M A;  2NUT C;  1LL5 A;  4LEN A;  3ZHH A;  4M3K A;  4WMC D;  1LI0 A;  1WE4 A;  3QHY A;  4FH4 A;  2P9V B;  1H8M A;  2E8I A;  1IKG A;  3DWZ A;  3QP4 A;  1DP8 A;  4JF4 A;  1PWD A;  3C30 A;  4LV0 A;  4Y7P A;  3DW0 A;  5CGS A;  5CTN A;  2Y8H A;  5AJG A;  3TW8 A;  3UE1 A;  4JBF A;  4R3J A;  2XH9 A;  2KX6 A;  4R6L A;  4Q0H A;  2QPN A;  2PRF A;  3ISG A;  5LBR A;  2ZL1 A;  4XUX A;  1E3U D;  3BYD A;  3NY4 A;  1NYY A;  4JF5 A;  1ZC2 A;  4BD1 A;  1ERQ A;  4WEK A;  4HBU A;  1G6O A;  4UHU A;  5EM0 A;  2WKR A;  5FAP A;  1YM1 A;  1G28 A;  3BWL A;  1C3B A;  3V39 A;  2HF6 A;  4ID4 A;  2INW A;  4KUK A;  2DNS A;  5FAS A;  4HIA A;  2WKH A;  3VP4 A;  4ME4 A;  2OAP 1;  1I5Q A;  2JHE A;  4Y13 A;  4JKT A;  3HBR A;  5GL9 A;  4I39 A;  5EVI A;  1OTE A;  4MCW A;  3AGF A;  3KSF A;  3DTE A;  1P9R A;  3ZG7 B;  1PW8 A;  2PYR A;  5EPH A;  3MXR A;  3OPH A;  1NRF A;  3TOI A;  5A90 A;  3M6H A;  4B9O A;  4Q0J A;  5HDC A;  4P0M A;  4B88 A;  1KVM A;  4S2N A;  3V67 A;  1ACF A;  4HEF A;  4R3B A;  4R3A A;  3SW1 A;  3EGX C;  4EUV A;  2VGL S;  5A93 A;  1OT6 A;  2EFX A;  1K0K A;  2QJ7 A;  2V20 A;  3PBO A;  4IHQ A;  4ZRR A;  2VV7 A;  3OPL A;  2HDS A;  4II7 A;  2V0W A;  3HJK A;  5IT5 A;  5E43 A;  3UNW A;  2Y2Q A;  3FG8 A;  3P01 A;  5E2H A;  1K54 A;  1YQS A;  4HH3 A;  2A24 B;  4R23 A;  4BL3 A;  4HQA A;  3ZNT A;  3VOL A;  3PBN A;  1LSX A;  2A2L A;  4DJ2 A;  3UE3 A;  2H0Y A;  2H28 A;  3GEC A;  4Q8I A;  4X69 A;  5M1A A;  4R38 A;  4XT2 B;  2VLG A;  4JGO A;  2V0U A;  2Q9M A;  4WUJ A;  1WYB A;  4X6T A;  2QMI A;  3OCN A;  2HPB A;  2Y91 A;  1YLT A;  1W8Q A;  4EUZ A;  1FSY A;  2ZQ7 A;  1P97 A;  5CRF A;  4R1G A;  2Y55 A;  3E4O A;  3CJM A;  1NXY A;  2UV0 E;  1XPB A;  3VOZ A;  4ZDX A;  5TJJ A;  2KOI A;  1Y28 A;  2WAE A;  3MZF A;  3R7W A;  3WWX A;  4N1H A;  1KDS A;  4H6J B;  1XA7 A;  1TF1 A;  1PW1 A;  1KGG A;  2J9P A;  4N1X A;  4OOY A;  2JKR I;  3LIB A;  3H9W A;  3EOI A;  4F3L B;  5FQM A;  4PAU A;  1YLY A;  2W3D A;  1CQA A;  4D2O A;  1PIO A;  1YLW A;  3D3O A;  3ZG8 B;  2WUQ A;  1NLZ A;  1XP4 A;  3TRC A;  1X0O A;  3G2Z A;  5EVI D;  3A3E A;  3FV7 A;  3NOP C;  4NXB A;  1ZG4 A;  3IHB A;  1JTG A;  4Z1W A;  2M7U A;  3RJU A;  3VOY A;  2HDQ A;  3BFE A;  2QHK A;  4QD4 A;  5EVI C;  3EGD C;  4BL2 A;  5M19 A;  3F1O B;  4LCL A;  4E3N A;  2XA7 M;  3A0R A;  3DTK A;  3BFC A;  5FAO A;  3V3S A;  3IX3 A;  4YWZ A;  4S2N C;  1I2W A;  3NI9 A;  2W3H A;  3IX4 A;  3G30 A;  2R9W A;  2Y2J A;  3P7N A;  2EFU A;  3GV9 A;  2PR6 A;  1Z09 A;  5DF8 A;  4WYY A;  3HLD A;  3VSK A;  3GSG A;  3CLO A;  4HY8 A;  3Q7V A;  4BBV A;  1FSW A;  5CHM A;  3VP3 A;  1HTZ A;  3SOI A;  3W4O A;  1BLS A;  4HP9 A;  1TS0 A;  4UQI S;  4LV3 A;  3OBF A;  1XJ4 A;  3T4L A;  1K6R A;  1K54 C;  3IF6 B;  1OME A;  5CEB A;  4EES A;  3H82 B;  4GS9 A;  1UWP X;  3HVF A;  3MBZ A;  2WKE A;  2P9V A;  4NG2 A;  2VKS A;  3N8R A;  1HVB A;  1AXB A;  4LCM A;  1JNU A;  1YMS A;  4EET B;  3MFD A;  4KQQ A;  4G3K A;  5DKK A;  4XXR A;  5GHZ A;  1S6R A;  2WKQ A;  2HP9 A;  4HHD A;  2K31 A;  3QP6 A;  4EQI A;  3JVV A;  5J7E A;  2PAV P;  1XKZ A;  3A0V A;  2PBD P;  2GX5 A;  3TJZ C;  5FAT A;  3ITB A;  4G3W A;  1MZU A;  4LGW A;  1MWU A;  2PR5 A;  2K7S A;  3Q82 A;  1W7F A;  2J8Y A;  1CI9 A;  4Y15 A;  4WLA A;  4KQR A;  1IFQ A;  4PM8 A;  4OON A;  2FZ0 A;  2ZMF A;  2M7V A;  3HUO A;  2WYX A;  2RCX A;  2WGW A;  3ZDJ A;  1K4E A;  4E3J A;  1IYO A;  4E6W A;  1MBL A;  1K56 A;  3S4X A;  4LPZ A;  1S4S A;  1TVF A;  4F94 A;  2D01 A;  2ZQ8 A;  3LCE A;  4L0L A;  3UDF A;  3E98 A;  4JXS A;  2O9A A;  1TDG A;  4HI4 A;  2C5W B;  2Y2N A;  2Y2G A;  3QNB A;  4MMN A;  3NIA A;  2P08 A;  2XD1 A;  3DWK A;  4N9K A;  2J3T C;  1XA1 A;  5FQK A;  5AVF A;  3RH8 B;  3T4T A;  5CHJ A;  5M18 A;  4DN0 A;  4JXG A;  2JE5 A;  3T1S A;  2OLV A;  1KDW A;  2ZC7 A;  2ZC3 B;  1T18 A;  4RX3 A;  4ZJ3 A;  3JPU A;  4WN5 A;  4KUO A;  3KYZ A;  4M4X A;  1LLB A;  2B02 A;  3AGD A;  3HLC A;  4BWI A;  4FOF A;  3C7U A;  2EA9 A;  2EXB A;  4PMA A;  1Q2P A;  3T4K A;  3SH9 A;  2A24 A;  4O7D A;  5CTM A;  3IT9 A;  1M6K A;  3VP1 A;  3ZGA B;  4HNB A;  5FDH A;  5HAR A;  2G2W A;  4KZA A;  2AVX A;  1IYS A;  1FIL A;  1TS7 A;  4O8G A;  3KSH A;  2VX8 A;  1KGE A;  3B42 A;  3WRZ A;  3LO7 A;  5DFX A;  1YSP A;  2EX9 A;  3N4I A;  4NXG A;  2O9B A;  2QKP A;  2ZC4 B;  1BLP A;  1OTB A;  2J80 A;  2XDM A;  1G6A A;  4X25 A;  1CJF A;  2G2U A;  3BY9 A;  2D02 A;  4NKP A;  3GMW A;  1TS8 A;  3E0Y A;  4YOF A;  2ZMA A;  3F1N A;  5J4E A;  2XQZ A;  3LR0 A;  4FH2 A;  2VGL M;  1GHM A;  4KZB A;  3FPV A;  4GW9 A;  3LY3 A;  1DRM A;  4H6J A;  4QB8 A;  3VSL A;  2W1R A;  4JXW A;  1G5U A;  4RX2 A;  4F3L A;  1DY6 A;  3NOU C;  4EQ1 A;  3TSG A;  3Q7V B;  5GHY A;  1N4O A;  2VGJ A;  3Q81 A;  4GHI B;  5FDS A;  5JYO A;  4E3K A;  1ES4 A;  1T19 A;  3S7N A;  3KO6 A;  5DJU A;  3NDG A;  3UY6 A;  5J3W A;  4OPR A;  2O99 A;  3UB9 A;  2IWB A;  3H7W A;  2JKR M;  4JGR A;  4P6Z S;  3WS1 A;  2VZW A;  3MQQ A;  4OPZ A;  3A3F A;  4CLC E;  4GS9 B;  2O0Y A;  3R4K A;  2R78 A;  5HX9 A; 
#chains in the Genus database with same CATH homology
 1EWZ A;  2EX8 A;  4RYE A;  2XLN A;  2Y2M A;  2H0Y A;  3UE3 A;  4GKU A;  4WZ5 C;  1BUE A;  2R9X A;  1ERO A;  1DJB A;  5FQI A;  4X69 A;  4DDS A;  4Q8I A;  3O3V A;  3E2K A;  5M1A A;  1ONG A;  4R0Q A;  3N6I A;  3VFF A;  1K57 C;  5AQA A;  4IVI A;  2DRW A;  4K0X A;  4KZ3 A;  2Q9M A;  4KG5 A;  3ZVW A;  3PBT A;  4IED A;  3LY4 A;  4S2L A;  4LV2 A;  1WYB A;  1ONH A;  3Q1F A;  1QME A;  4S2J A;  3IH9 A;  2QMI A;  4UA9 A;  4X6T A;  4FSF A;  1PI5 A;  1E3U A;  2HP6 A;  3OCN A;  3EQV A;  2HPB A;  1PYY A;  2Y91 A;  3HLW A;  1YLT A;  3IXD A;  2OSU A;  1GCE A;  2GDN A;  4BEN A;  4PM6 A;  1W8Q A;  4EUZ A;  1FSY A;  3CG5 A;  3I7J A;  5CHU A;  2JC7 A;  4X68 A;  4S2M A;  4Y0U A;  2ZQ7 A;  3ZG0 A;  4X56 A;  1ESU A;  5GHX A;  5EOE A;  3OCL A;  5CRF A;  5FSR A;  4R1G A;  1JWP A;  3OPR A;  2Y55 A;  4E6X A;  2X02 A;  3IF6 A;  2WZX A;  5E2F A;  1GHI A;  3IXG A;  4KZ5 A;  1DJC A;  4K0W A;  4MEZ A;  1LI9 A;  3M2J A;  4P6B A;  1YLZ A;  1Z6F A;  4C75 A;  4H8R A;  1FR6 A;  3CJM A;  1CI8 A;  3UDX A;  1SHV A;  3GR2 A;  3IWQ A;  1NXY A;  2WGW B;  4YIN A;  2Y2O A;  5F1G A;  1XPB A;  3VOZ A;  4ZDX A;  3AGE A;  5EVI B;  3HLF A;  1W5D A;  2HDR A;  1BTL A;  2WAE A;  3MZF A;  3W4P A;  3ZNY A;  2Y59 A;  3FKW A;  3WWX A;  4E3M A;  4N1H A;  4JF6 A;  1KDS A;  1XX2 A;  1YLJ A;  5KSH A;  4DKI A;  4KZ9 A;  1CEG A;  5JYP A;  1EI5 A;  4NK3 A;  1XA7 A;  1NZO A;  1PW1 A;  1KGG A;  1PZP A;  2H10 A;  2J9P A;  1RCJ A;  1MWS A;  4XUZ A;  4N1X A;  5CER A;  4OOY A;  2X71 A;  3GTC A;  4NET A;  5GLA A;  1SDE A;  2FFF B;  4P85 A;  5CXW A;  2OV5 A;  1IYQ A;  5FQM A;  1YLY A;  4OPY A;  5FA7 A;  4S2K A;  3EQU A;  1H8Y A;  1G68 A;  5HW3 A;  1NYM A;  1CEF A;  1FR1 A;  4FCF A;  2H0T A;  1M40 A;  3M2K A;  4D2O A;  1PIO A;  1YLW A;  2HP5 A;  2EXA A;  3ZG8 B;  1XGI A;  4PM5 A;  3UE0 A;  4DDY A;  4OLD A;  2WUQ A;  2EX6 A;  1XP4 A;  3PAE A;  2C6W B;  4OVD A;  2ZJ9 A;  3NCK A;  2WK0 A;  1RGY A;  3G4P A;  5FQQ A;  3WS2 A;  3G2Z A;  3IHA A;  2WZZ A;  4OKP A;  5EVI D;  3A3E A;  3FV7 A;  3A3D A;  3C4P A;  1ESI A;  4WEL A;  1ZG4 A;  3IHB A;  4QY5 A;  1K56 D;  2CC1 A;  1JTG A;  2ZM8 A;  5HL1 A;  2WAF A;  5E2G A;  4WBG A;  3RJU A;  4DE3 A;  3VOY A;  2HDQ A;  4KQO A;  3BFE A;  4KZ8 A;  3PBR A;  4OLG A;  4QD4 A;  5EVI C;  3IH8 A;  4BL2 A;  5EEC A;  4EWF A;  5M19 A;  5AQ7 A;  4LCL A;  4E3N A;  4WM9 A;  2X01 A;  2IWC A;  2XK1 A;  3S1Y A;  4UA6 A;  2BG1 A;  1FCN A;  5DTK A;  2Z2M B;  3N8L A;  1HZO A;  1MXO A;  3C7V A;  3BFC A;  1N9B A;  1ZG6 A;  5F83 A;  4WMC A;  5FAO A;  3V3S A;  2VGK A;  1IKI A;  2XEP A;  2Y2P A;  1E25 A;  2V1Z A;  2ZQD A;  3G31 A;  4KZ4 A;  4S2N C;  1I2W A;  4Z9Q A;  5HAP A;  3ITA A;  5HAI A;  3FKV A;  3NI9 A;  4KG6 A;  1PZO A;  2V2F F;  3G30 A;  2R9W A;  2HDU A;  2Y2J A;  3TG9 A;  1FCO A;  2EFU A;  2ZC5 B;  3GV9 A;  3RXW A;  3BRM A;  2XGN A;  4GDB A;  4UAA A;  1NZU A;  4QY6 A;  5DF8 A;  4WYY A;  1JTD A;  4BD0 A;  3HLD A;  3VSK A;  2I72 A;  3GSG A;  3UPP A;  1WYC A;  3Q7V A;  4UA7 A;  5A92 A;  1FSW A;  5CHM A;  3Q7Z A;  3VP3 A;  2XFS A;  4U0T A;  3HLB A;  1HTZ A;  1MPL A;  1FQG A;  1KGF A;  3IWO A;  4GZB A;  3SOI A;  4DXC A;  3W4O A;  5G18 A;  4IBR A;  3ZG9 B;  1BLS A;  4C6Y A;  2IWD A;  5F1F A;  4LV3 A;  1K6R A;  1K54 C;  1TDL A;  3IF6 B;  3IXB A;  1FCM A;  1OME A;  5CEB A;  3IF5 A;  2Y2L A;  5BOH A;  1MWT A;  2J9O A;  4GDN A;  5L2F A;  1IYP A;  4B4X A;  5CEC A;  3HVF A;  2WGI A;  3VP0 A;  1BSG A;  3MBZ A;  4EBN A;  3WS0 A;  2ZC6 B;  1XXM A;  4LV1 A;  2ZQA A;  1E4D A;  2WKE A;  2P9V A;  2PBY A;  4GN2 A;  4KZ7 A;  3O88 A;  1L0G A;  4CPK A;  4OQ0 A;  4PM9 A;  4MBF A;  4JXV A;  3N8R A;  1HVB A;  2XF3 A;  4FD8 A;  1AXB A;  4GNU A;  1YT4 A;  4LCM A;  4MNR A;  3UN7 A;  5KSC A;  3P09 A;  1YMS A;  4OH0 A;  2ZLY A;  3G35 A;  3MFD A;  4CJN A;  1H5X A;  1SCW A;  3ZCZ A;  3BLM A;  4KG2 A;  2QZ6 A;  4EV4 A;  3BEB A;  4KQQ A;  5EOO A;  1MWR A;  4XXR A;  5GHZ A;  4EBP A;  1S6R A;  3BLS A;  5GLD A;  4P87 A;  2HP9 A;  1NJ4 A;  3C4O A;  2A49 A;  2WGV A;  4EQI A;  4GB7 A;  3WS4 A;  1XKZ A;  1BLH A;  1U60 A;  5FI2 A;  4OOL A;  2DCF A;  3W8K A;  4A5R A;  3OPP A;  5FAT A;  3ITB A;  1LL9 A;  1MY8 A;  1MWU A;  3BFD A;  1H8Z A;  1FOF A;  1W7F A;  3Q82 A;  3NDE A;  3IF6 C;  1ES2 A;  4QU3 A;  2J8Y A;  1SDN A;  2Z2L B;  2XR0 A;  5E2E A;  1CI9 A;  2EX2 A;  4U3T A;  4OQG A;  4R4S A;  5KMW A;  4MLL A;  4KQR A;  4RA7 A;  4X55 A;  1JWZ A;  1MKI A;  3IXH A;  2JCH A;  4PM8 A;  4OON A;  1HD8 A;  5TFQ A;  1O7E A;  3HUO A;  2WYX A;  4OP8 A;  1QMF A;  4KEN B;  2RCX A;  3O86 A;  4B4Z A;  5HAQ A;  2WGW A;  3ZDJ A;  5KZH A;  2ZQ9 A;  5IHV A;  1K4E A;  5FI7 A;  1IYO A;  4E3J A;  5TR7 A;  4E6W A;  5F82 A;  5DVA A;  1MBL A;  1IEM A;  2ZD8 A;  1K56 A;  1RP5 A;  2Y2K A;  3S4X A;  4C3Q A;  5I94 A;  4RVA A;  4WZ4 A;  1TVF A;  4F94 A;  3MZE A;  4ZAM A;  2ZQ8 A;  3LCE A;  4L0L A;  3S22 A;  3UDF A;  1K55 A;  2Y2H A;  4E3O A;  4GD8 A;  5FAQ A;  5CED A;  3MKE A;  4DE1 A;  4JXS A;  2H5S A;  2BLS A;  3ZFZ A;  1YMX A;  1JWV A;  2P74 A;  4DRT A;  4N92 A;  3LEZ A;  2WAD A;  2OLU A;  1TDG A;  5GLB A;  1ZKJ A;  2PU4 A;  4OP5 A;  2C5W B;  5AQ9 A;  4JLF A;  2Y2N A;  5EUA A;  2Y2G A;  1BZA A;  3HL9 A;  5A91 A;  3QNB A;  4WZ5 A;  3SH8 A;  3NIA A;  4YFM A;  1VM1 A;  3N8S A;  1L0D A;  4OOM A;  2XD1 A;  4E3I A;  3DWK A;  2ZQC A;  4N9K A;  1PI4 A;  3HRE A;  3V50 A;  1XA1 A;  2A3U A;  5DF7 A;  3UO9 A;  4ZTK A;  5FQK A;  1K57 A;  4QHC A;  1TEM A;  4S2P A;  1ERM A;  1J9M A;  1NY0 A;  3IQA A;  5CHJ A;  1PWC A;  2B5R A;  3N7W A;  3VP2 A;  5M18 A;  1K25 A;  3Q07 A;  4JXG A;  1LL5 A;  2JE5 A;  4DE2 A;  3MKF A;  4LEN A;  1BT5 A;  1SKF A;  4BLM A;  3ZHH A;  3BFG A;  5D3O A;  2WKI A;  3ZVT A;  2OLV A;  1RGZ A;  3GRJ A;  4IVK A;  4M3K A;  4R4R A;  4WMC D;  1KDW A;  5EE8 A;  1LI0 A;  2ZC7 A;  3G32 A;  2ZC3 B;  1WE4 A;  4RX3 A;  4S2I A;  3QHY A;  4ZJ3 A;  2RL3 A;  4FH4 A;  4K91 A;  2P9V B;  4S2O A;  4ZJ2 A;  2E8I A;  3GVB A;  1KE3 A;  1IKG A;  2Y2I A;  3DWZ A;  3G34 A;  4JF4 A;  1BLC A;  1PWD A;  1LLB A;  3AGD A;  3HLC A;  4LV0 A;  1GA0 A;  4Y7P A;  4BJP A;  3C7U A;  3OC2 A;  2XFT A;  3DW0 A;  2EXB A;  3CMZ A;  4PMA A;  4Y0T A;  5CGS A;  3BFF A;  5HFO A;  5CTN A;  1Q2P A;  1JVJ A;  3G2Y A;  3SS4 A;  1Y54 A;  4IBX A;  3UE1 A;  5DTS A;  3SH9 A;  4JBF A;  4O7D A;  4R3J A;  5CTM A;  2J7V A;  3IT9 A;  2JBF A;  3MXS A;  2XH9 A;  1M6K A;  3VP1 A;  3BM6 A;  5EVL A;  3PTE A;  5FDH A;  3ZGA B;  4DF6 A;  2QPN A;  5HAR A;  1LHY A;  5DTT A;  3ISG A;  2G2W A;  4KZA A;  1IYS A;  3BEC A;  4XUX A;  1E3U D;  5FQJ A;  3BYD A;  1K6S A;  1L0F A;  3W4Q A;  1KGE A;  4JPM A;  3NY4 A;  4ZJ1 A;  4Y0O A;  3WRZ A;  1NYY A;  3LO7 A;  4JF5 A;  2EX9 A;  4OQH A;  3N4I A;  2ZC4 B;  4GD6 A;  1BLP A;  4E3L A;  2XDM A;  1ZC2 A;  4BD1 A;  1ERQ A;  3VFH A;  3C5A A;  1G6A A;  1KE4 A;  3E2L A;  3DTM A;  2G2U A;  4OPQ A;  3HLG A;  4HBU A;  4WEK A;  4UHU A;  4GOG A;  1IEL A;  3GMW A;  3V3R A;  3JYI A;  5FAP A;  1YM1 A;  5AQB A;  5TGF A;  5CGW A;  5FQ9 A;  1O07 A;  3CZD A;  2ZM0 A;  1C3B A;  3HUN A;  3B3X A;  5CGX A;  3UPN A;  3V39 A;  4MBH A;  4BQM A;  4ID4 A;  1ES3 A;  5DF9 A;  2ZMA A;  2DNS A;  5FAS A;  3PBS A;  2WKH A;  3VP4 A;  3V5M A;  2FFY A;  4QJG A;  2XQZ A;  4X53 A;  1YLP A;  4PPR A;  1I5Q A;  4MBK A;  4FH2 A;  3M6B A;  4JKT A;  1GHM A;  3HBR A;  3FZC A;  1S0W A;  5GL9 A;  3SS5 A;  5EVI A;  3UPO A;  1KVL A;  4DXB A;  4KZB A;  3AGF A;  3P98 A;  1BUL A;  4OQI A;  1K4F A;  1XGJ A;  4WEJ A;  3ZG7 B;  1PW8 A;  1ES5 A;  3LY3 A;  3WRT A;  1KE0 A;  3A3J A;  4QB8 A;  2Y4A A;  3VSL A;  4DE0 A;  5EPH A;  3MXR A;  3OPH A;  1NRF A;  3TOI A;  5A90 A;  3M6H A;  5U47 A;  3MZD A;  3D4F A;  3PBQ A;  4JXW A;  4P0M A;  3VMA A;  4B88 A;  3SH7 A;  1KVM A;  2UWX A;  4S2N A;  3SS3 A;  4HEF A;  4RX2 A;  4R3B A;  1GHP A;  4HBT A;  5J8X A;  2PU2 A;  3RXX A;  1DY6 A;  3NC8 A;  3NBL A;  1I2S A;  1VQQ A;  5GLC A;  4U0X A;  3TSG A;  5FI6 A;  3OZH A;  3Q7V B;  5GHY A;  1N4O A;  2VGJ A;  3Q81 A;  5JYO A;  1L2S A;  1L0E A;  1K38 A;  1ALQ A;  4E3K A;  1ES4 A;  3QNC A;  4N9L A;  3ZG5 A;  1W79 A;  5A93 A;  3UDI A;  3NDG A;  3UY6 A;  2EFX A;  4OPR A;  4EBL A;  1CK3 A;  2ZM2 A;  3GQZ A;  4HES A;  2V20 A;  1GA9 A;  3IWI A;  3PBO A;  3FWL A;  2IWB A;  3OPL A;  2HDS A;  4ZBE A;  2XD5 A;  5E43 A;  3HLE A;  3FYZ A;  3UNW A;  3WS1 A;  4OPZ A;  3WS5 A;  1W8Y A;  2Y2Q A;  3A3F A;  3A3I A;  3O87 A;  5E2H A;  1K54 A;  1YQS A;  1K55 C;  3PAG A;  4PM7 A;  4R23 A;  2Q9N A;  4BL3 A;  1PWG A;  3ZNT A;  1DJA A;  3HUM A;  5HX9 A;  4KZ6 A;  1Q2Q A;  3PBN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...