3P98A

The crystal structure of the extended spectrum beta-lactamase tem-72 reveals inhibition by citrate
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
263
structure length
263
Chain Sequence
HPETLVKVKDAEDKLGARVGYIELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRWEPELNEAIPNDERDTTTPAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGASKRGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactamase TEM-72
publication title Structure of the extended-spectrum [beta]-lactamase TEM-72 inhibited by citrate
pubmed doi rcsb
source organism Morganella morganii
molecule tags Hydrolase
total genus 99
structure length 263
sequence length 263
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-10-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 3p98A00
3JYIA 3OPLA 2XH9A 1XXMA 3FYZA 2EFUA 3I7JA 1TVFA 3HLFA 4YINA 3DWKA 5KZHA 1TDLA 4S2KA 1K6SA 3HLCA 5GLCA 4OOYA 1DJAA 1RP5A 2OLUA 2ZM0A 3G30A 2CC1A 3O86A 4KZ5A 5FQJA 5CGXA 3RJUA 3EQVA 4EBPA 1WE4A 4ZAMA 3ZVTA 5GLAA 4OPRA 2HP6A 3IF6A 3UE3A 1LL9A 3CMZA 2WYXA 3P98A 3IXBA 1MWSA 3M6BA 1E25A 3BFDA 2QPNA 2EX6A 1MXOA 2Y2KA 3IHAA 3BYDA 3NY4A 4EBNA 1HVBA 4BD0A 1E3UA 2A3UA 3HUNA 4P87A 1RGZA 4UHUA 4N9KA 4QY5A 5EVIC 3LCEA 1K55A 2WKHA 1M6KA 3ZG8B 4S2IA 2ZC3B 3Q7ZA 3GRJA 4LV1A 3A3EA 3ZG9B 1IYOA 4OH0A 2HP5A 2GDNA 3GMWA 5E2EA 5FQ9A 3HVFA 5A90A 1XA1A 2Y2PA 4WZ5C 2V1ZA 3UN7A 4GNUA 4JF6A 4QHCA 2VGJA 1L0FA 4OQIA 3NBLA 5CGWA 4M3KA 5G18A 3VOZA 2WADA 2J8YA 4OOMA 5EVLA 3WS5A 1AXBA 3G32A 1KVLA 3ZCZA 3ZDJA 1IKIA 1H8YA 4OPYA 4JPMA 4GB7A 2Y2JA 1SDEA 5F82A 2XK1A 3SH8A 4LV3A 1LLBA 1KGEA 4JXSA 4GKUA 5A91A 4OQGA 1BUEA 4LV0A 4X55A 3VP4A 3CJMA 3WS2A 5EOEA 4WELA 1BLSA 5CXWA 3UPOA 5E2FA 4UA6A 3CZDA 3IWQA 3B3XA 3FWLA 1PZPA 2WAFA 1K25A 3IXGA 2G2UA 3IHBA 2ZQ7A 5A92A 1SKFA 5HFOA 5AQBA 1HD8A 2WZZA 2Y2MA 5FATA 3M2KA 2ZQCA 4X53A 1TEMA 4S2NA 1ES5A 1YQSA 3MXSA 4HBTA 1OMEA 1IEMA 3HBRA 1BLCA 4KZBA 3MZDA 4WZ5A 4E6WA 3DWZA 4N92A 4PPRA 3UDIA 1H5XA 2EX9A 5GLBA 5FAQA 4K91A 5M1AA 1ONHA 5M19A 4OKPA 3TOIA 2Y2IA 5GHZA 1L0EA 3V50A 1FCNA 3HL9A 3PBQA 1RCJA 2G2WA 1ESIA 4RYEA 2WK0A 4XUXA 3ITAA 2XFSA 4DXCA 1NY0A 2ZC7A 3BECA 1K57C 4U0TA 2HP9A 5J8XA 5CHUA 3HUMA 4E3IA 4FCFA 4RVAA 4E3JA 1GA0A 5DTTA 1KDWA 4R1GA 1JWVA 1KE4A 4ZJ2A 1NZUA 3PAGA 4QB8A 1PW8A 2ZC5B 1ES4A 1LI0A 3HLEA 3VP3A 1Z6FA 4D2OA 1XP4A 5EOOA 2OV5A 5HAPA 3N7WA 3E2KA 2R9WA 4Y0UA 4DE1A 4R4SA 1KVMA 2XFTA 4S2LA 4DE2A 4EUZA 4E3OA 4S2MA 1PZOA 2BLSA 5A93A 1PI5A 2HDRA 2PU2A 3HREA 4DDSA 5AQAA 1YLPA 3NDGA 1PYYA 3BRMA 1YLZA 3S4XA 4BENA 5F83A 3UE1A 4GD8A 2Y91A 5IHVA 3MKEA 4JXWA 1U60A 4RA7A 3BLSA 3PAEA 3ZNTA 4C6YA 4P85A 3IF5A 4PM6A 4EV4A 1GHMA 5GLDA 1Q2PA 3LEZA 4DF6A 4ID4A 3UNWA 3G34A 3W4OA 1I2SA 4ZTKA 3OZHA 1FCOA 4JXVA 3VOYA 1K54C 1K57A 3HLBA 2EFXA 2XD1A 2H5SA 2FFFB 2OLVA 4PM5A 4WBGA 2P74A 3HLDA 3GVBA 1W8YA 5CGSA 5GHYA 4XXRA 4QU3A 4KQQA 2ZQDA 4MBFA 1G68A 3M6HA 3IWOA 3HLWA 2A49A 4U0XA 2P9VB 4P6BA 3C4PA 2ZQAA 1YLJA 1L0DA 1LI9A 2FFYA 5M18A 3G2ZA 1YT4A 3M2JA 3ZHHA 2OSUA 4IVIA 1EROA 1NRFA 4E3NA 3W8KA 5HAIA 2Y59A 4HESA 5GL9A 5EPHA 1CEFA 2H10A 1MWTA 2IWDA 3N8SA 4YFMA 3FKVA 5FQMA 2BG1A 4IVKA 2Z2LB 2DRWA 3VP2A 3BM6A 3N4IA 4WMCA 1NZOA 3N6IA 4Q8IA 1KGFA 5KSHA 1RGYA 5EVIB 3BLMA 5DF8A 3AGFA 2WKIA 4KQOA 3O87A 5DVAA 1K4EA 3ITBA 5EECA 3RXWA 1N9BA 5HW3A 3A3FA 2ZMAA 3MFDA 3SH7A 2P9VA 4E3LA 5KSCA 3A3JA 2Y2LA 1O7EA 5E43A 1W5DA 2Y55A 4CPKA 1EI5A 4S2JA 5AQ9A 4BQMA 3AGDA 4EQIA 2WKEA 3RXXA 3UDFA 1H8ZA 4R23A 5E2GA 3ZVWA 5FA7A 1NXYA 1YM1A 2RL3A 1QMEA 1I5QA 3PBTA 4R0QA 4DXBA 1O07A 1VM1A 3ZG5A 1K38A 4PMAA 4R3BA 4HBUA 1YMXA 1ZKJA 1L0GA 3SS5A 4EWFA 3GTCA 4N9LA 1FQGA 3VFFA 5KMWA 2ZC4B 1ES2A 5D3OA 2HDQA 3WS4A 3SS4A 1XPBA 2WZXA 2X71A 2HDUA 2HDSA 1ZG4A 3G35A 3S1YA 5EVIA 3C7VA 1W7FA 4IEDA 2ZM8A 3UPPA 2XD5A 4A5RA 4OP8A 4OQHA 3G4PA 3Q07A 2C6WB 4WEJA 1JTDA 3IH9A 3OPRA 2ZJ9A 1GHPA 2WAEA 3BFGA 3FV7A 1PWGA 1C3BA 3MXRA 1BTLA 1XGIA 5TGFA 4LCLA 4GOGA 1DJCA 1Y54A 1YLWA 2JCHA 1XKZA 3AGEA 4X69A 1FSYA 5EE8A 2Q9NA 5FI7A 4DRTA 3WS0A 2PU4A 2Y4AA 3SOIA 3V5MA 4CJNA 3IXHA 2Y2HA 5CRFA 1WYBA 5TR7A 4KG5A 5I94A 2I72A 2B5RA 3VMAA 4P0MA 2QZ6A 2XQZA 4NETA 1EWZA 4L0LA 3VP0A 3BEBA 4X6TA 4B4XA 4PM9A 2EXAA 2JE5A 4OONA 3UE0A 2XEPA 1W79A 2EX8A 2IWCA 3OPHA 1NYYA 4BLMA 1GHIA 5HX9A 2HPBA 3SH9A 2RCXA 3VP1A 3A3IA 1CI8A 4IBRA 3FKWA 2WGWB 1E3UD 3OCLA 5CECA 5JYPA 3NCKA 3GV9A 4WM9A 2XF3A 3QHYA 4GDBA 1FR6A 3PBNA 5JYOA 4WZ4A 3O3VA 4KENB 1IKGA 2XLNA 3WRZA 4QJGA 1LL5A 4MEZA 1M40A 4BJPA 3PBRA 5FQQA 3IF6C 4ZJ3A 1ZC2A 4NK3A 1YLYA 4FD8A 5HARA 1K6RA 3N8LA 1S6RA 3A3DA 3C4OA 4RX2A 1XA7A 4O7DA 3V3RA 2ZQ8A 3WWXA 4E3KA 1JTGA 2JC7A 4C75A 4JKTA 3VSLA 4E6XA 1VQQA 4S2PA 1SCWA 3BFEA 4MBKA 4OLGA 1IELA 3NC8A 5CTNA 1L2SA 2WGWA 5HL1A 3G31A 3ZNYA 4KZ9A 3MBZA 3WRTA 1CEGA 3QNBA 3BFFA 2ZLYA 4PM7A 5CHMA 4GDNA 1MPLA 4OLDA 1DY6A 3S22A 1Q2QA 4GZBA 1DJBA 3G2YA 3OPPA 1MWUA 3C7UA 3DW0A 4UA7A 3NIAA 4OPZA 4JF4A 3WS1A 3NI9A 5GHXA 3ZG7B 4BL3A 4JBFA 1GCEA 3TSGA 3ZG0A 2V20A 5FASA 4KQRA 4LV2A 2R9XA 4QD4A 2ZM2A 5EVID 1K4FA 1PIOA 4BL2A 2Q9MA 5HAQA 4JLFA 3LY3A 3MKFA 5FQIA 2WGIA 1IYPA 2DNSA 3P09A 4Y0OA 3VFHA 1G6AA 2DCFA 1SDNA 3HUOA 5CTMA 1FR1A 4HEFA 1PW1A 4OP5A 1K54A 1HZOA 4KZAA 4MBHA 3EQUA 1TDGA 4MNRA 1I2WA 4PM8A 1K56A 4K0XA 1PWCA 2C5WB 3GR2A 4S2NC 3V39A 1E4DA 1ERMA 1JWZA 4R3JA 4GD6A 1W8QA 3FZCA 4H8RA 1ZG6A 2Y2OA 2X01A 1MKIA 1BZAA 3OCNA 1HTZA 2Y2GA 3C5AA 4KZ3A 3PTEA 4N1HA 4X68A 2X02A 4XUZA 5CHJA 1PWDA 5EUAA 3UY6A 4FSFA 3N8RA 1N4OA 3NDEA 1XGJA 2XR0A 5FAOA 5FSRA 1S0WA 5FAPA 4DKIA 5AQ7A 5E2HA 3QNCA 3Q7VB 1YLTA 4K0WA 4DE0A 2ZQ9A 3ZGAB 4EBLA 5F1FA 1CI9A 3GQZA 1BSGA 1IYQA 1IYSA 3UDXA 3IQAA 1BT5A 5FQKA 2PBYA 3PBSA 1XX2A 1FOFA 4KG2A 3CG5A 4JXGA 4Y7PA 5U47A 4KZ4A 3GSGA 2UWXA 2XDMA 4R4RA 5FI6A 5CEDA 4F94A 1QMFA 2WGVA 4OVDA 3BFCA 2Y2QA 3V3SA 3W4PA 2XGNA 5DTKA 1BLPA 3IXDA 4UAAA 2V2FF 4WEKA 2J7VA 3PBOA 4X56A 1WYCA 5CERA 3O88A 5TFQA 4C3QA 3Q7VA 5BOHA 1NYMA 4UA9A 2J9PA 2Z2MB 3Q1FA 1LHYA 4DE3A 1CK3A 4LENA 4DDYA 1KDSA 2WUQA 2ZC6B 1JWPA 1ESUA 4B4ZA 3IWIA 4ZBEA 3E2LA 1NJ4A 1MWRA 1KE0A 4LCMA 4FH2A 1ONGA 3DTMA 3TG9A 4E3MA 4S2OA 1YMSA 2J9OA 3IH8A 4ZJ1A 3MZEA 2EX2A 2E8IA 1FSWA 4FH4A 4Y0TA 2H0YA 1PI4A 3Q81A 1ES3A 4IBXA 2JBFA 3Q82A 4KZ8A 5DF7A 4Z9QA 3MZFA 4RX3A 4KZ7A 4WMCD 1ALQA 1FCMA 4OPQA 5FI2A 2IWBA 2H0TA 4JF5A 5L2FA 3ZFZA 1MY8A 2EXBA 4KG6A 1J9MA 3IF6B 4U3TA 5DTSA 4KZ6A 1K55C 1JVJA 1MBLA 4B88A 1KGGA 3HLGA 2ZD8A 5CEBA 4OOLA 1BLHA 3D4FA 4WYYA 4GN2A 3UO9A 3VSKA 3IT9A 4QY6A 3ISGA 5DF9A 3LO7A 1ERQA 1K56D 3LY4A 4MLLA 4OQ0A 1GA9A 3OC2A 1BULA 5F1GA 5FDHA 3UPNA 1KE3A 2QMIA 2VGKA 2Y2NA 4BD1A 1SHVA 3SS3A 3W4QA 4ZDXA 4N1XA
chains in the Genus database with same CATH superfamily
2W1TA 1XXMA 3DWKA 5KZHA 4S2KA 5GLCA 4OOYA 4WL9A 4F3LA 2CC1A 3O86A 5CGXA 5GLAA 5F68A 3IF6A 1LL9A 2QKPA 2Y2KA 4EBNA 4BD0A 1XFQA 1SKOA 4UHUA 4EEUA 5DFXA 4S2IA 4DJ3A 1XJ3A 3ZG9B 5E2EA 5FQ9A 5A90A 1XA1A 2Y8HA 4QHCA 2M7UA 2ZMVA 3NBLA 3SW1A 5HDDA 1D1JA 4OOMA 5EVLA 3CUEA 3WS5A 1S1YA 3ZCZA 1TF1A 2J3WA 2PBDP 1SDEA 5F82A 2XK1A 3SH8A 5F6AA 1ACFA 4JXSA 5FL3A 4X55A 4LV0A 3WS2A 3T4QA 5E2FA 3FWLA 1K25A 3PR6A 1SKFA 5HFOA 1HD8A 2ZQCA 1TS0A 1TEMA 1OTIA 1YQSA 1IFQA 3MZDA 4E6WA 3DWZA 4N92A 1OTDA 5GLBA 5M1AA 4OKPA 2Y2IA 5GHZA 3BW6A 1JNUA 1RCJA 2G2WA 1VEUB 3CLOA 2XFSA 2ZC7A 4ETZA 5CHUA 3TW8A 3JVVA 4E3IA 4FCFA 1JWVA 4LPZA 2ZC5B 1LI0A 3HLEA 4D60A 1Z6FA 1OT6A 2OV5A 3QP6A 4BBTA 3H7WB 4HY8A 5IS1A 4DE2A 4S2MA 3VOLA 2O9BA 3NDGA 1PYYA 3LR3A 3BRMA 1YLZA 4WF0A 5F83A 2Y91A 1ZTUA 3PAEA 4MCWA 3ZNTA 1Q2PA 3G34A 1K57A 4CLCC 2EFXA 2XD1A 2FFFB 4L9GA 3HLDA 1F2KA 5GHYA 4QU3A 2ZQDA 1G68A 3HLWA 3T1XA 1F5MA 2ZQAA 1L0DA 4JGRA 1NRFA 1PRQA 2Y59A 2L1MA 2H10A 2IWDA 3FKVA 3VE3A 3A0SA 3N4IA 1MC0A 1NZOA 4Q8IA 1KGFA 4R6LA 5DF8A 5DVAA 5HW3A 5KSCA 3A3JA 3KSGA 5E43A 4CPKA 3E0YA 3AGDA 5FDSA 1VM1A 4PMAA 2ZC4B 2NUPC 1OT9A 2WZXA 3HJKA 2J3TC 4OP8A 5IU1A 2C6WB 3OPRA 2WAEA 1C3BA 1BTLA 1J3WA 4AFIA 1DJCA 1XKZA 5EE8A 4WLAA 2Y4AA 5IT5A 2Y2HA 1UWNX 2B5RA 2QZ6A 4NETA 1EWZA 2B95A 4I3IA 2W3DA 4B4XA 4HQAA 2XEPA 5HD3A 1NYYA 4BLMA 3LYXA 1LSVA 3MQ0A 3VP1A 5MC7A 3T4LA 3B42A 5JYPA 5TJJA 4HJ6A 3PBNA 2KLIA 3WRZA 4B9OA 1TD5A 1LL5A 4BJPA 3PBRA 4ZJ3A 1VETB 1ZC2A 3CWFA 4FD8A 3V67A 4DN0A 4EXOA 1K6RA 3N8LA 3C4OA 3QP8A 1XFNA 1XA7A 4O7DA 3V3RA 1VHMA 2L0WA 4X25A 3KSIA 3VSLA 1N9OA 4S2PA 1UWPX 1IELA 3HJIA 5HL1A 3GECA 3QNBA 4ARZA 1TS7A 3G2YA 2KDKA 1S4SA 4GHIA 2Z6DA 3KYEA 1UGUA 2ZM2A 1PIOA 3T4JA 2Q9MA 1W63M 4JLFA 3LY3A 3MKFA 5FQIA 1S1ZA 2V9AA 2DNSA 1G6AA 3HUOA 4Y15A 1FR1A 1I2WA 4K0XA 3NJAA 5CX7A 1W8QA 4H8RA 1MKIA 4PKYA 3C5AA 4KZ3A 3PTEA 4XUZA 3UY6A 4FSFA 4BMWA 3NDEA 1XGJA 1Z09A 5FAPA 2D01A 5E2HA 3Q7VB 4K0WA 3UB9A 2ZQ9A 1AWIA 4H6JB 1CF0A 4EBLA 2YKFA 1CI9A 1BSGA 2EWWA 5FQKA 4KG2A 2UWXA 2XDMA 3E4PA 1T19A 2XGNA 4UAAA 5TBMA 1OPXA 3T4OA 3IX8A 1WYCA 2GJ3A 5BOHA 5HSQA 4NKPA 1H8MA 3Q1FA 4ETXA 1CK3A 4LENA 4DDYA 1KDSA 1ESUA 4ZBEA 4LFUA 2VX8A 1MWRA 3B33A 4E3MA 4PKYG 1T1AA 1DP9A 1YMSA 2J9OA 3RH8B 1PNEA 3Q82A 4F3LB 5DF7A 4KZ7A 4WMCD 1NLYA 2YKHA 1J9MA 3IF6B 4U3TA 2OWHA 5CEBA 1D06A 1S4RA 4GN2A 3IT9A 3MF0A 1SKOB 3TOIA 3UPNA 2DMWA 1KE3A 3PHYA 2W3EA 2L4RA 3SS3A 3NOTC 3JYIA 3OPLA 4IJGA 1TDLA 2OLUA 2ZM0A 4IUKA 4KZ5A 3EQVA 4ZAMA 2LB9A 2HP6A 3BQ8A 1MWSA 3BFDA 2QPNA 1HVBA 1E3UA 4P87A 1RGZA 3T12B 1K55A 2WKHA 2VZWA 4Y5FA 2ZC3B 1IYOA 2HP5A 3HVFA 1YAXA 4GNUA 5FEGA 5AJGA 2VGJA 1L0FA 1MZUA 1OJGA 1IKIA 4JPMA 1BUEA 1V9YA 5EOEA 4WELA 4UA6A 3B3XA 1PZPA 3IXGA 2P08A 2OOLA 2ZQ7A 5A92A 1BYWA 2Y2MA 5C5KA 3T4TA 2JKGA 4S2NA 1ES5A 1OMEA 3HBRA 2V8CA 3UDIA 1H5XA 2EX9A 4GS9A 3T4KA 1ONHA 1F98A 4Y17A 4EERA 1L0EA 3PBQA 4DXCA 3BECA 3HUMA 1GA0A 2VK3A 1KE4A 3LICA 4QB8A 3SZTA 3MMHA 4D2OA 2R9WA 3C2WA 1KVMA 4S2LA 3CPTB 2BLSA 3BWLA 1PI5A 3HREA 5AQAA 3S4XA 4BENA 3UE1A 3ZQ5A 4HHDA 2O9CA 3BLSA 4EV4A 1GHMA 3H9WA 2VA0A 3LEZA 4ID4A 3W4OA 1I2SA 4ZTKA 1FCOA 1K54C 2H5SA 2OLVA 4PM5A 3GDIA 3GVBA 2A49A 1NRJA 3MFXA 3C4PA 4G3VA 2FFYA 3LR0A 1YT4A 5DKLA 3M2JA 3ZHHA 4E3NA 3OBFA 3W8KA 4LRZE 5F69A 3JVUA 5GL9A 3LIBA 1MWTA 2GX5A 4R3AA 3TE8A 2DRWA 2WKQA 3U2AA 2P7JA 3L9KA 3N6IA 3AGFA 4JGOA 1LSWA 5EECA 2QHKA 1N9BA 2ZMAA 3MFDA 3SH7A 4BBVA 2UV0E 2I9VA 4CLCA 2Y2LA 3LGOA 1W5DA 2Y55A 1EI5A 4EQIA 4LRXC 2WKEA 3UDFA 3EEHA 5E2GA 3ZVWA 2RL3A 1QMEA 1I5QA 3PBTA 2K2NA 3IX3A 4HBUA 1YMXA 1L0GA 3VFFA 1XJ4A 1ES2A 3NOPC 2HDUA 1ZG4A 3S1YA 5EVIA 3C7VA 1W7FA 3UPPA 4EEPA 4A5RA 4OQHA 5DJUA 3Q07A 4WEJA 3IH9A 3BFGA 4HI4A 1PWGA 2VEAA 2KOIA 4LCLA 1Y54A 2ZBBA 3E4OA 2ZL1A 4DRTA 3SOIA 1WYBA 4KG5A 5I94A 4XT2A 1STZA 4Y3IA 5EFWA 5LBRA 2OAP1 2PT7A 2EXAA 1LL8A 1W79A 3OPHA 4EW7A 3A3IA 1CI8A 3OCLA 5CECA 2XF3A 4L9EA 1FR6A 4ARZB 5JYOA 4WZ4A 1K0KA 2XLNA 1M40A 5FQQA 3IF6C 3P7NA 4GHIB 5HARA 3D72A 2D02A 3O5YA 2ZQ8A 4C75A 4UEYA 2WGWA 3G31A 3ZNYA 3FPWA 4GDNA 3ICYA 3CUEC 1GSVA 2O9AA 1WA9A 3DW0A 4UA7A 3NIAA 2Q0OA 2NUTC 2P04A 4BL3A 5FASA 1GCEA 2V20A 2XA7M 4KQRA 4LV2A 3FPVA 5EVID 4NG2A 4NXGA 5HDSA 1K4FA 1F9IA 2XA7S 2PRFA 3P09A 1IYPA 3VFHA 4KUOA 2B18A 4MBHA 3EQUA 1PWCA 1E4DA 1JWZA 4R3JA 4GD6A 3EEAA 3LFVA 4P6ZM 2X01A 1BZAA 2Y2GA 3IS2A 4N1HA 5EUAA 4P6ZS 2VKSA 3N8RA 2H28A 1N4OA 2XR0A 5FAOA 1S0WA 5F5YA 4HJ4A 3D3OA 4JGPA 1NLZA 2PR5A 1IYQA 1BT5A 3F1NA 1XX2A 5U47A 4KZ4A 3LEQA 5FI6A 2VV7A 4F94A 1QMFA 3CITA 1ZHHB 1OTBA 4MDZA 2M7VA 4OVDA 2Y2QA 3V3SA 3W4PA 5DTKA 1BLPA 3IXDA 3C30A 3K3DA 5EVEA 5CERA 1S66L 5TFQA 3G6OA 1NYMA 1G28A 3MS6A 2Y79A 2ZC6B 2B02A 3DTKA 4B4ZA 4Q0IA 4LCMA 1ONGA 2ACGA 2FH5A 3TG9A 4S2OA 4HIAA 2OWJA 2W3FA 5KIZA 1YSQA 3Q81A 2OAQ1 4I3JA 4RX3A 5FI2A 5L2FA 1A0KA 1MY8A 2VJWA 5HWVA 1MBLA 4B88A 1KGGA 4OOLA 4WYYA 4MLLA 5FDHA 1BULA 2VGKA 3F1PA 4ZRRA 4ZDXA 2INWA 2XH9A 3VV4A 3T1SA 3PXPA 4YINA 1K6SA 3HLCA 1DJAA 3TJZC 5FQJA 3C38A 1W63Q 3IXBA 3M6BA 1E25A 3BYDA 2A3UA 3H82A 4QY5A 3D9YA 4CQHA 4KQDA 3ZG8B 4G3KA 4LV1A 3GRJA 3A3EA 4WUJA 4WZ5C 1Y28A 3UB6A 3E98A 4OQIA 3UMEA 5G18A 2J8YA 2A24A 1AXBA 3G32A 3T4SA 4NXFA 3ZDJA 4GB7A 4LV3A 4GS9B 1KGEA 4GKUA 5A91A 2EWVA 4FOFA 3DTEA 1BLSA 4GW9A 5CXWA 2A2LA 2R78A 3CZDA 3IWQA 5J3WA 3IHBA 2WZZA 2JKRM 3M2KA 4X53A 2M1CA 3MXSA 2IA2A 4KZBA 2WKPA 2E8JA 5M19A 3R4KA 3ZYTA 4EESA 1FCNA 4XUXA 4RYEA 2WK0A 1NY0A 5DTTA 1KDWA 2EA9A 2W1TB 1PW8A 1ES4A 5EOOA 5HAPA 3E2KA 4E3OA 1PZOA 1V9ZA 5A93A 2HDRA 4DDSA 1YLPA 5IHVA 1U60A 2FZ0A 3EGDC 4P85A 4PM6A 2W3GA 5GLDA 1T18A 3B47A 1GSXA 4Y13A 3OZHA 4JXVA 3VOYA 3HLBA 4WBGA 1W8YA 1P9WA 1YPRA 4BBUA 5DFYA 4MBFA 1FILA 4R38A 3IWOA 2PDRA 4P6BA 4I38A 4CLCB 2MJ6A 2XSSA 3W2ZA 5M18A 4II7A 3G2ZA 4EQ1A 2OSUA 1H3QA 4HESA 1CEFA 5FQMA 4YNRA 3NOUC 4MMNA 3QP2A 2ZOIA 3BM6A 5EVIB 4KQOA 4DJ2A 1K4EA 3ITBA 1T1CA 1DP6A 3A3FA 2P9VA 4E3LA 3T1RA 3HCYA 5HDCA 2VGLM 1O7EA 2V1AA 4S2JA 4IHQA 4R23A 2VGLS 1YM1A 3KYQA 4DXBA 4R0QA 1O07A 4YWZA 2ZL1B 4R3BA 1ZKJA 3SS5A 4EWFA 1FQGA 1YSPA 2HDQA 4XT2B 2HDSA 2JKRI 1TS8A 3G35A 2HF6A 2PAVP 3LIDA 4PAUA 1GHPA 4M4XA 3MXRA 4O01A 5TGFA 1YLWA 2JCHA 3AGEA 1FSYA 2Q9NA 4X1LA 2PU4A 4CJNA 3IXHA 1GSWA 5TR7A 3UB8A 4H6JA 3RTYA 4B93A 3BEBA 4X6TA 4PM9A 2W1RA 4OONA 3S7QA 2EX8A 2IWCA 4RQ9A 1GHIA 3LIEA 3SH9A 1D7EA 4DMZA 4ME4A 2WGWB 1E3UD 4QPRA 4O8GA 5HD5A 2LB5A 4WM9A 4GDBA 3O3VA 4KENB 1IKGA 4MEZA 1P97A 4G3WA 1VB6A 4HH2A 4RX2A 3LR5A 1JTGA 1VQQA 2QJ5A 1SCWA 3BFEA 4MBKA 3NC8A 1L2SA 3MBZA 3WRTA 5A8BA 4PM7A 1MPLA 3E4QA 4O0PA 4OLDA 1Q2QA 4GZBA 3S22A 1DJBA 3OPPA 1MWUA 3C7UA 3DTIA 4JF4A 5GHXA 3ZG7B 4JBFA 3IS2B 3ZG0A 2R9XA 1XJ6A 5HAQA 3NECA 1N9NA 2DCFA 5CTMA 4HEFA 4Q0HA 3F1NB 4MNRA 1MKMA 1K56A 3LIAA 5L10A 4S2NC 2HGVA 3FZCA 1ZG6A 2Y2OA 1CJFA 4LGWA 1HTZA 4X68A 2X02A 1PWDA 4I5SA 3OLOA 5FSRA 5AQ7A 3EOIA 1YLTA 4MN7A 4DE0A 1LT0A 4NEED 3ZGAB 2WKRA 1P9RA 3MSHA 5F1FA 1H0MA 1IYSA 1NWZA 3IQAA 3PBSA 4HH3A 1FOFA 4Z1WA 1P0ZA 3GSGA 5CEDA 1G5UA 2JKTM 2K7SA 4WEKA 2J7VA 3PBOA 4X56A 5I5LA 3O88A 4C3QA 3T1QB 4UA9A 2J9PA 2Z2MB 1LHYA 3RFBA 3UB7A 3MQQA 2QYBA 1JWPA 3CI6A 2HV1A 4FH2A 1OTEA 3DTMA 5FEFA 3L7HA 2V1BA 2V0WA 3F1PB 3IH8A 4R70A 2BASA 1FSWA 4IUHA 1PI4A 2G7UA 4IBXA 2JBFA 5J7EA 2GZAA 4Z9QA 4NXBA 3FG8A 1ALQA 1FCMA 4Q0JA 2IWBA 3R7WA 4JF5A 5L07A 5J4EA 4KZ6A 3F1OA 2JHEA 1T1BA 2ZD8A 3VSKA 1BLHA 3D4FA 4CLCD 4QY6A 3ISGA 5DF9A 3H82B 1ERQA 1K56D 3LO7A 1GA9A 3OC2A 3IX4A 3UMDA 3K3CA 3W4QA 5DJTA 4N1XA 3FYZA 2EFUA 3I7JA 1TVFA 3HLFA 1RP5A 3G30A 3RJUA 4EBPA 2BTFP 1WE4A 3ZVTA 2A24B 4OPRA 3BJNA 3CPTA 3UE3A 3CMZA 2WYXA 3P98A 1PFLA 3IHAA 1FIKA 1MXOA 2EX6A 3NY4A 3HUNA 4N9KA 5EVIC 3S7NA 3S7OA 3LCEA 1M6KA 3Q7ZA 4OH0A 2GDNA 3GMWA 2Y2PA 2V1ZA 2PR6A 3UN7A 4JF6A 3FC7A 5CGWA 4M3KA 5TBMB 3VOZA 2WADA 1KVLA 1H8YA 4OPYA 2Y2JA 1HLUP 1EW0A 1LLBA 5HWTA 3BY8A 2J3TD 1N9LA 4OQGA 3VP4A 3CJMA 4L9FA 3UPOA 2WAFA 2JKTI 2G2UA 3MJQA 3KX0X 5AQBA 3C8CA 3KYZA 5FATA 2O0YA 4HP9A 3DBAA 4HBTA 5EM0A 1IEMA 4WZ5A 1BLCA 5AVFA 3A0VA 4YOFA 5DKKA 4CLCE 4HP4A 4PPRA 3BQAA 1L3LA 5FAQA 4K91A 3MXQA 1X0OA 3V50A 3IBRA 3HL9A 1ESIA 3ITAA 4WN5A 4U0TA 3MQOA 1K57C 2HP9A 5J8XA 5HZHA 4RVAA 4E3JA 2QWSA 4R1GA 4ZJ2A 1NZUA 3PAGA 2V8FA 3KO6A 3VP3A 1XP4A 3P01A 3N7WA 4Y0UA 4DE1A 4R4SA 2XFTA 1SZVA 4EUZA 2JKFA 3LUQA 2PU2A 1XJ2A 4GCZA 1VEUA 4GD8A 3MKEA 4JXWA 4RA7A 4C6YA 3IF5A 4DF6A 4JGQA 4EETB 3UNWA 2P74A 5L09A 3H7WA 5CGSA 4GJ4A 4XXRA 4KQQA 3K2NA 4FUWA 3M6HA 4U0XA 2P9VB 2CMNA 1YLJA 2XROA 1LI9A 1S67L 2PYRA 2ZOHA 1DP8A 4IVIA 1EROA 3MR0A 5HAIA 5EPHA 3N8SA 4YFMA 3S7PA 2BG1A 4IVKA 2Z2LB 4EU0A 2VV6A 3VP2A 4HOIA 4WMCA 5HPIA 5KSHA 1RGYA 3BLMA 2WKIA 3O87A 3T50A 3RXWA 4FTXA 2JN7A 5AQ9A 3UB5P 4BQMA 3RXXA 1H8ZA 2K31A 2J80A 3NULA 5FA7A 1NXYA 1Y4OA 1IOUA 2QJ7A 3ZG5A 1K38A 4Y2FA 2GNXA 2O99A 3GTCA 3KSHA 4N9LA 5KMWA 5D3OA 2PYPA 3OOVA 3WS4A 3SS4A 1XPBA 2X71A 4MN6A 1G6OA 4IEDA 2ZM8A 2XD5A 3G4PA 4LLOB 3PYPA 3LI9A 1JTDA 2ZJ9A 3FV7A 1XGIA 4GOGA 2PD8A 4X69A 5FI7A 3WS0A 3V5MA 3EGXC 5CRFA 2I72A 3VMAA 4P0MA 3CHWP 4PHTA 2XQZA 5AVEA 4L0LA 4BWIA 2PD7A 3VP0A 5G4ZA 2JE5A 3UE0A 5HX9A 2HPBA 2RCXA 2HJ9C 4IBRA 3FKWA 2Z6CA 3NCKA 3GV9A 3QHYA 2ZMFA 4QJGA 2VLGA 3IBJA 4NK3A 1YLYA 2W0NA 1S6RA 3A3DA 3WWXA 4E3KA 1DRMA 2JC7A 3VE4A 3UE6A 5EM1A 4JKTA 4E6XA 5K5BA 3DAVA 1YKDA 4OLGA 5CTNA 4KZ9A 1CEGA 3BFFA 2ZLYA 5CHMA 1ODVA 1DY6A 4QWOA 1VETA 4OPZA 3QP4A 3TRCA 5HPFA 3WS1A 1OJ5A 3NI9A 4KUKA 3TSGA 3LIFA 4QD4A 4BL2A 2WGIA 4UQIM 4Y0OA 1CQAA 1SDNA 2PHYA 1PW1A 4UQIS 2W27A 4I39A 4OP5A 1K54A 1HZOA 4KZAA 1TDGA 4PM8A 1LSXA 5HL6A 2V0UA 3V39A 2C5WB 3GR2A 1ERMA 2AVXA 4EUVA 3JPUA 3OCNA 5CHJA 2HJEA 3BY9A 4DKIA 3QP5A 3ULFA 3QNCA 2VV8A 3EWKA 4MN5A 5G4YA 4I3AA 5EV0A 3GQZA 3UDXA 1KOUA 2PBYA 4Y7PA 3CG5A 4JXGA 4HNBA 4R4RA 3NHQA 2WGVA 1OTAA 2XRNA 3BFCA 4NXEA 2V2FF 3LR4A 2KX6A 3Q7VA 4DE3A 3R7WB 3KSFA 3LI8A 2WUQA 3F1OB 3IWIA 3E2LA 4ESPA 1NJ4A 1KE0A 4E04A 3A0RA 3QP1A 5L8MA 4ZJ1A 5HWWA 3MZEA 2EX2A 2E8IA 4FH4A 4Y0TA 2H0YA 1ES3A 4KZ8A 2W3HA 3MZFA 4OPQA 2H0TA 2HZ5A 4K08A 3ZFZA 4X1MA 2EXBA 4KG6A 5DTSA 1K55C 1JVJA 1TS6A 3HLGA 3U4LP 3UO9A 3CAXA 4GLQA 3LY4A 4OQ0A 5F1GA 4LRYC 2QMIA 2Y2NA 4BD1A 1SHVA 4HJ3A
chains in the Genus database with same CATH topology
3JYIA 3OPLA 2XH9A 1XXMA 3FYZA 2EFUA 3I7JA 1TVFA 3HLFA 4YINA 3DWKA 5KZHA 1TDLA 4S2KA 1K6SA 3HLCA 5GLCA 4OOYA 1DJAA 1RP5A 2OLUA 2ZM0A 3G30A 2CC1A 3O86A 4KZ5A 5FQJA 5CGXA 3RJUA 3EQVA 4EBPA 1WE4A 4ZAMA 3ZVTA 5GLAA 4OPRA 2HP6A 3IF6A 3UE3A 1LL9A 3CMZA 2WYXA 3P98A 3IXBA 1MWSA 3M6BA 1E25A 3BFDA 2QPNA 2EX6A 1MXOA 2Y2KA 3IHAA 3BYDA 3NY4A 4EBNA 1HVBA 4BD0A 1E3UA 2A3UA 3HUNA 4P87A 1RGZA 4UHUA 4N9KA 4QY5A 5EVIC 3LCEA 1K55A 2WKHA 1M6KA 3ZG8B 4S2IA 2ZC3B 3Q7ZA 3GRJA 4LV1A 3A3EA 3ZG9B 1IYOA 4OH0A 2HP5A 2GDNA 3GMWA 5E2EA 5FQ9A 3HVFA 5A90A 1XA1A 2Y2PA 4WZ5C 2V1ZA 3UN7A 4GNUA 4JF6A 4QHCA 2VGJA 1L0FA 4OQIA 3NBLA 5CGWA 4M3KA 5G18A 3VOZA 2WADA 2J8YA 4OOMA 5EVLA 3WS5A 1AXBA 3G32A 1KVLA 3ZCZA 3ZDJA 1IKIA 1H8YA 4OPYA 4JPMA 4GB7A 2Y2JA 1SDEA 5F82A 2XK1A 3SH8A 4LV3A 1LLBA 1KGEA 4JXSA 4GKUA 5A91A 4OQGA 1BUEA 4LV0A 4X55A 3VP4A 3CJMA 3WS2A 5EOEA 4WELA 1BLSA 5CXWA 3UPOA 5E2FA 4UA6A 3CZDA 3IWQA 3B3XA 3FWLA 1PZPA 2WAFA 1K25A 3IXGA 2G2UA 3IHBA 2ZQ7A 5A92A 1SKFA 5HFOA 5AQBA 1HD8A 2WZZA 2Y2MA 5FATA 3M2KA 2ZQCA 4X53A 1TEMA 4S2NA 1ES5A 1YQSA 3MXSA 4HBTA 1OMEA 1IEMA 3HBRA 1BLCA 4KZBA 3MZDA 4WZ5A 4E6WA 3DWZA 4N92A 4PPRA 3UDIA 1H5XA 2EX9A 5GLBA 5FAQA 4K91A 5M1AA 1ONHA 5M19A 4OKPA 3TOIA 2Y2IA 5GHZA 1L0EA 3V50A 1FCNA 3HL9A 3PBQA 1RCJA 2G2WA 1ESIA 4RYEA 2WK0A 4XUXA 3ITAA 2XFSA 4DXCA 1NY0A 2ZC7A 3BECA 1K57C 4U0TA 2HP9A 5J8XA 5CHUA 3HUMA 4E3IA 4FCFA 4RVAA 4E3JA 1GA0A 5DTTA 1KDWA 4R1GA 1JWVA 1KE4A 4ZJ2A 1NZUA 3PAGA 4QB8A 1PW8A 2ZC5B 1ES4A 1LI0A 3HLEA 3VP3A 1Z6FA 4D2OA 1XP4A 5EOOA 2OV5A 5HAPA 3N7WA 3E2KA 2R9WA 4Y0UA 4DE1A 4R4SA 1KVMA 2XFTA 4S2LA 4DE2A 4EUZA 4E3OA 4S2MA 1PZOA 2BLSA 5A93A 1PI5A 2HDRA 2PU2A 3HREA 4DDSA 5AQAA 1YLPA 3NDGA 1PYYA 3BRMA 1YLZA 3S4XA 4BENA 5F83A 3UE1A 4GD8A 2Y91A 5IHVA 3MKEA 4JXWA 1U60A 4RA7A 3BLSA 3PAEA 3ZNTA 4C6YA 4P85A 3IF5A 4PM6A 4EV4A 1GHMA 5GLDA 1Q2PA 3LEZA 4DF6A 4ID4A 3UNWA 3G34A 3W4OA 1I2SA 4ZTKA 3OZHA 1FCOA 4JXVA 3VOYA 1K54C 1K57A 3HLBA 2EFXA 2XD1A 2H5SA 2FFFB 2OLVA 4PM5A 4WBGA 2P74A 3HLDA 3GVBA 1W8YA 5CGSA 5GHYA 4XXRA 4QU3A 4KQQA 2ZQDA 4MBFA 1G68A 3M6HA 3IWOA 3HLWA 2A49A 4U0XA 2P9VB 4P6BA 3C4PA 2ZQAA 1YLJA 1L0DA 1LI9A 2FFYA 5M18A 3G2ZA 1YT4A 3M2JA 3ZHHA 2OSUA 4IVIA 1EROA 1NRFA 4E3NA 3W8KA 5HAIA 2Y59A 4HESA 5GL9A 5EPHA 1CEFA 2H10A 1MWTA 2IWDA 3N8SA 4YFMA 3FKVA 5FQMA 2BG1A 4IVKA 2Z2LB 2DRWA 3VP2A 3BM6A 3N4IA 4WMCA 1NZOA 3N6IA 4Q8IA 1KGFA 5KSHA 1RGYA 5EVIB 3BLMA 5DF8A 3AGFA 2WKIA 4KQOA 3O87A 5DVAA 1K4EA 3ITBA 5EECA 3RXWA 1N9BA 5HW3A 3A3FA 2ZMAA 3MFDA 3SH7A 2P9VA 4E3LA 5KSCA 3A3JA 2Y2LA 1O7EA 5E43A 1W5DA 2Y55A 4CPKA 1EI5A 4S2JA 5AQ9A 4BQMA 3AGDA 4EQIA 2WKEA 3RXXA 3UDFA 1H8ZA 4R23A 5E2GA 3ZVWA 5FA7A 1NXYA 1YM1A 2RL3A 1QMEA 1I5QA 3PBTA 4R0QA 4DXBA 1O07A 1VM1A 3ZG5A 1K38A 4PMAA 4R3BA 4HBUA 1YMXA 1ZKJA 1L0GA 3SS5A 4EWFA 3GTCA 4N9LA 1FQGA 3VFFA 5KMWA 2ZC4B 1ES2A 5D3OA 2HDQA 3WS4A 3SS4A 1XPBA 2WZXA 2X71A 2HDUA 2HDSA 1ZG4A 3G35A 3S1YA 5EVIA 3C7VA 1W7FA 4IEDA 2ZM8A 3UPPA 2XD5A 4A5RA 4OP8A 4OQHA 3G4PA 3Q07A 2C6WB 4WEJA 1JTDA 3IH9A 3OPRA 2ZJ9A 1GHPA 2WAEA 3BFGA 3FV7A 1PWGA 1C3BA 3MXRA 1BTLA 1XGIA 5TGFA 4LCLA 4GOGA 1DJCA 1Y54A 1YLWA 2JCHA 1XKZA 3AGEA 4X69A 1FSYA 5EE8A 2Q9NA 5FI7A 4DRTA 3WS0A 2PU4A 2Y4AA 3SOIA 3V5MA 4CJNA 3IXHA 2Y2HA 5CRFA 1WYBA 5TR7A 4KG5A 5I94A 2I72A 2B5RA 3VMAA 4P0MA 2QZ6A 2XQZA 4NETA 1EWZA 4L0LA 3VP0A 3BEBA 4X6TA 4B4XA 4PM9A 2EXAA 2JE5A 4OONA 3UE0A 2XEPA 1W79A 2EX8A 2IWCA 3OPHA 1NYYA 4BLMA 1GHIA 5HX9A 2HPBA 3SH9A 2RCXA 3VP1A 3A3IA 1CI8A 4IBRA 3FKWA 2WGWB 1E3UD 3OCLA 5CECA 5JYPA 3NCKA 3GV9A 4WM9A 2XF3A 3QHYA 4GDBA 1FR6A 3PBNA 5JYOA 4WZ4A 3O3VA 4KENB 1IKGA 2XLNA 3WRZA 4QJGA 1LL5A 4MEZA 1M40A 4BJPA 3PBRA 5FQQA 3IF6C 4ZJ3A 1ZC2A 4NK3A 1YLYA 4FD8A 5HARA 1K6RA 3N8LA 1S6RA 3A3DA 3C4OA 4RX2A 1XA7A 4O7DA 3V3RA 2ZQ8A 3WWXA 4E3KA 1JTGA 2JC7A 4C75A 4JKTA 3VSLA 4E6XA 1VQQA 4S2PA 1SCWA 3BFEA 4MBKA 4OLGA 1IELA 3NC8A 5CTNA 1L2SA 2WGWA 5HL1A 3G31A 3ZNYA 4KZ9A 3MBZA 3WRTA 1CEGA 3QNBA 3BFFA 2ZLYA 4PM7A 5CHMA 4GDNA 1MPLA 4OLDA 1DY6A 3S22A 1Q2QA 4GZBA 1DJBA 3G2YA 3OPPA 1MWUA 3C7UA 3DW0A 4UA7A 3NIAA 4OPZA 4JF4A 3WS1A 3NI9A 5GHXA 3ZG7B 4BL3A 4JBFA 1GCEA 3TSGA 3ZG0A 2V20A 5FASA 4KQRA 4LV2A 2R9XA 4QD4A 2ZM2A 5EVID 1K4FA 1PIOA 4BL2A 2Q9MA 5HAQA 4JLFA 3LY3A 3MKFA 5FQIA 2WGIA 1IYPA 2DNSA 3P09A 4Y0OA 3VFHA 1G6AA 2DCFA 1SDNA 3HUOA 5CTMA 1FR1A 4HEFA 1PW1A 4OP5A 1K54A 1HZOA 4KZAA 4MBHA 3EQUA 1TDGA 4MNRA 1I2WA 4PM8A 1K56A 4K0XA 1PWCA 2C5WB 3GR2A 4S2NC 3V39A 1E4DA 1ERMA 1JWZA 4R3JA 4GD6A 1W8QA 3FZCA 4H8RA 1ZG6A 2Y2OA 2X01A 1MKIA 1BZAA 3OCNA 1HTZA 2Y2GA 3C5AA 4KZ3A 3PTEA 4N1HA 4X68A 2X02A 4XUZA 5CHJA 1PWDA 5EUAA 3UY6A 4FSFA 3N8RA 1N4OA 3NDEA 1XGJA 2XR0A 5FAOA 5FSRA 1S0WA 5FAPA 4DKIA 5AQ7A 5E2HA 3QNCA 3Q7VB 1YLTA 4K0WA 4DE0A 2ZQ9A 3ZGAB 4EBLA 5F1FA 1CI9A 3GQZA 1BSGA 1IYQA 1IYSA 3UDXA 3IQAA 1BT5A 5FQKA 2PBYA 3PBSA 1XX2A 1FOFA 4KG2A 3CG5A 4JXGA 4Y7PA 5U47A 4KZ4A 3GSGA 2UWXA 2XDMA 4R4RA 5FI6A 5CEDA 4F94A 1QMFA 2WGVA 4OVDA 3BFCA 2Y2QA 3V3SA 3W4PA 2XGNA 5DTKA 1BLPA 3IXDA 4UAAA 2V2FF 4WEKA 2J7VA 3PBOA 4X56A 1WYCA 5CERA 3O88A 5TFQA 4C3QA 3Q7VA 5BOHA 1NYMA 4UA9A 2J9PA 2Z2MB 3Q1FA 1LHYA 4DE3A 1CK3A 4LENA 4DDYA 1KDSA 2WUQA 2ZC6B 1JWPA 1ESUA 4B4ZA 3IWIA 4ZBEA 3E2LA 1NJ4A 1MWRA 1KE0A 4LCMA 4FH2A 1ONGA 3DTMA 3TG9A 4E3MA 4S2OA 1YMSA 2J9OA 3IH8A 4ZJ1A 3MZEA 2EX2A 2E8IA 1FSWA 4FH4A 4Y0TA 2H0YA 1PI4A 3Q81A 1ES3A 4IBXA 2JBFA 3Q82A 4KZ8A 5DF7A 4Z9QA 3MZFA 4RX3A 4KZ7A 4WMCD 1ALQA 1FCMA 4OPQA 5FI2A 2IWBA 2H0TA 4JF5A 5L2FA 3ZFZA 1MY8A 2EXBA 4KG6A 1J9MA 3IF6B 4U3TA 5DTSA 4KZ6A 1K55C 1JVJA 1MBLA 4B88A 1KGGA 3HLGA 2ZD8A 5CEBA 4OOLA 1BLHA 3D4FA 4WYYA 4GN2A 3UO9A 3VSKA 3IT9A 4QY6A 3ISGA 5DF9A 3LO7A 1ERQA 1K56D 3LY4A 4MLLA 4OQ0A 1GA9A 3OC2A 1BULA 5F1GA 5FDHA 3UPNA 1KE3A 2QMIA 2VGKA 2Y2NA 4BD1A 1SHVA 3SS3A 3W4QA 4ZDXA 4N1XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JYI A;  3OPL A;  2XH9 A;  1XXM A;  3FYZ A;  2EFU A;  3I7J A;  1TVF A;  3HLF A;  4YIN A;  3DWK A;  5KZH A;  1TDL A;  4S2K A;  1K6S A;  3HLC A;  5GLC A;  4OOY A;  1DJA A;  1RP5 A;  2OLU A;  2ZM0 A;  3G30 A;  2CC1 A;  3O86 A;  4KZ5 A;  5FQJ A;  5CGX A;  3RJU A;  3EQV A;  4EBP A;  1WE4 A;  4ZAM A;  3ZVT A;  5GLA A;  4OPR A;  2HP6 A;  3IF6 A;  3UE3 A;  1LL9 A;  3CMZ A;  2WYX A;  3P98 A;  3IXB A;  1MWS A;  3M6B A;  1E25 A;  3BFD A;  2QPN A;  2EX6 A;  1MXO A;  2Y2K A;  3IHA A;  3BYD A;  3NY4 A;  4EBN A;  1HVB A;  4BD0 A;  1E3U A;  2A3U A;  3HUN A;  4P87 A;  1RGZ A;  4UHU A;  4N9K A;  4QY5 A;  5EVI C;  3LCE A;  1K55 A;  2WKH A;  1M6K A;  3ZG8 B;  4S2I A;  2ZC3 B;  3Q7Z A;  3GRJ A;  4LV1 A;  3A3E A;  3ZG9 B;  1IYO A;  4OH0 A;  2HP5 A;  2GDN A;  3GMW A;  5E2E A;  5FQ9 A;  3HVF A;  5A90 A;  1XA1 A;  2Y2P A;  4WZ5 C;  2V1Z A;  3UN7 A;  4GNU A;  4JF6 A;  4QHC A;  2VGJ A;  1L0F A;  4OQI A;  3NBL A;  5CGW A;  4M3K A;  5G18 A;  3VOZ A;  2WAD A;  2J8Y A;  4OOM A;  5EVL A;  3WS5 A;  1AXB A;  3G32 A;  1KVL A;  3ZCZ A;  3ZDJ A;  1IKI A;  1H8Y A;  4OPY A;  4JPM A;  4GB7 A;  2Y2J A;  1SDE A;  5F82 A;  2XK1 A;  3SH8 A;  4LV3 A;  1LLB A;  1KGE A;  4JXS A;  4GKU A;  5A91 A;  4OQG A;  1BUE A;  4LV0 A;  4X55 A;  3VP4 A;  3CJM A;  3WS2 A;  5EOE A;  4WEL A;  1BLS A;  5CXW A;  3UPO A;  5E2F A;  4UA6 A;  3CZD A;  3IWQ A;  3B3X A;  3FWL A;  1PZP A;  2WAF A;  1K25 A;  3IXG A;  2G2U A;  3IHB A;  2ZQ7 A;  5A92 A;  1SKF A;  5HFO A;  5AQB A;  1HD8 A;  2WZZ A;  2Y2M A;  5FAT A;  3M2K A;  2ZQC A;  4X53 A;  1TEM A;  4S2N A;  1ES5 A;  1YQS A;  3MXS A;  4HBT A;  1OME A;  1IEM A;  3HBR A;  1BLC A;  4KZB A;  3MZD A;  4WZ5 A;  4E6W A;  3DWZ A;  4N92 A;  4PPR A;  3UDI A;  1H5X A;  2EX9 A;  5GLB A;  5FAQ A;  4K91 A;  5M1A A;  1ONH A;  5M19 A;  4OKP A;  3TOI A;  2Y2I A;  5GHZ A;  1L0E A;  3V50 A;  1FCN A;  3HL9 A;  3PBQ A;  1RCJ A;  2G2W A;  1ESI A;  4RYE A;  2WK0 A;  4XUX A;  3ITA A;  2XFS A;  4DXC A;  1NY0 A;  2ZC7 A;  3BEC A;  1K57 C;  4U0T A;  2HP9 A;  5J8X A;  5CHU A;  3HUM A;  4E3I A;  4FCF A;  4RVA A;  4E3J A;  1GA0 A;  5DTT A;  1KDW A;  4R1G A;  1JWV A;  1KE4 A;  4ZJ2 A;  1NZU A;  3PAG A;  4QB8 A;  1PW8 A;  2ZC5 B;  1ES4 A;  1LI0 A;  3HLE A;  3VP3 A;  1Z6F A;  4D2O A;  1XP4 A;  5EOO A;  2OV5 A;  5HAP A;  3N7W A;  3E2K A;  2R9W A;  4Y0U A;  4DE1 A;  4R4S A;  1KVM A;  2XFT A;  4S2L A;  4DE2 A;  4EUZ A;  4E3O A;  4S2M A;  1PZO A;  2BLS A;  5A93 A;  1PI5 A;  2HDR A;  2PU2 A;  3HRE A;  4DDS A;  5AQA A;  1YLP A;  3NDG A;  1PYY A;  3BRM A;  1YLZ A;  3S4X A;  4BEN A;  5F83 A;  3UE1 A;  4GD8 A;  2Y91 A;  5IHV A;  3MKE A;  4JXW A;  1U60 A;  4RA7 A;  3BLS A;  3PAE A;  3ZNT A;  4C6Y A;  4P85 A;  3IF5 A;  4PM6 A;  4EV4 A;  1GHM A;  5GLD A;  1Q2P A;  3LEZ A;  4DF6 A;  4ID4 A;  3UNW A;  3G34 A;  3W4O A;  1I2S A;  4ZTK A;  3OZH A;  1FCO A;  4JXV A;  3VOY A;  1K54 C;  1K57 A;  3HLB A;  2EFX A;  2XD1 A;  2H5S A;  2FFF B;  2OLV A;  4PM5 A;  4WBG A;  2P74 A;  3HLD A;  3GVB A;  1W8Y A;  5CGS A;  5GHY A;  4XXR A;  4QU3 A;  4KQQ A;  2ZQD A;  4MBF A;  1G68 A;  3M6H A;  3IWO A;  3HLW A;  2A49 A;  4U0X A;  2P9V B;  4P6B A;  3C4P A;  2ZQA A;  1YLJ A;  1L0D A;  1LI9 A;  2FFY A;  5M18 A;  3G2Z A;  1YT4 A;  3M2J A;  3ZHH A;  2OSU A;  4IVI A;  1ERO A;  1NRF A;  4E3N A;  3W8K A;  5HAI A;  2Y59 A;  4HES A;  5GL9 A;  5EPH A;  1CEF A;  2H10 A;  1MWT A;  2IWD A;  3N8S A;  4YFM A;  3FKV A;  5FQM A;  2BG1 A;  4IVK A;  2Z2L B;  2DRW A;  3VP2 A;  3BM6 A;  3N4I A;  4WMC A;  1NZO A;  3N6I A;  4Q8I A;  1KGF A;  5KSH A;  1RGY A;  5EVI B;  3BLM A;  5DF8 A;  3AGF A;  2WKI A;  4KQO A;  3O87 A;  5DVA A;  1K4E A;  3ITB A;  5EEC A;  3RXW A;  1N9B A;  5HW3 A;  3A3F A;  2ZMA A;  3MFD A;  3SH7 A;  2P9V A;  4E3L A;  5KSC A;  3A3J A;  2Y2L A;  1O7E A;  5E43 A;  1W5D A;  2Y55 A;  4CPK A;  1EI5 A;  4S2J A;  5AQ9 A;  4BQM A;  3AGD A;  4EQI A;  2WKE A;  3RXX A;  3UDF A;  1H8Z A;  4R23 A;  5E2G A;  3ZVW A;  5FA7 A;  1NXY A;  1YM1 A;  2RL3 A;  1QME A;  1I5Q A;  3PBT A;  4R0Q A;  4DXB A;  1O07 A;  1VM1 A;  3ZG5 A;  1K38 A;  4PMA A;  4R3B A;  4HBU A;  1YMX A;  1ZKJ A;  1L0G A;  3SS5 A;  4EWF A;  3GTC A;  4N9L A;  1FQG A;  3VFF A;  5KMW A;  2ZC4 B;  1ES2 A;  5D3O A;  2HDQ A;  3WS4 A;  3SS4 A;  1XPB A;  2WZX A;  2X71 A;  2HDU A;  2HDS A;  1ZG4 A;  3G35 A;  3S1Y A;  5EVI A;  3C7V A;  1W7F A;  4IED A;  2ZM8 A;  3UPP A;  2XD5 A;  4A5R A;  4OP8 A;  4OQH A;  3G4P A;  3Q07 A;  2C6W B;  4WEJ A;  1JTD A;  3IH9 A;  3OPR A;  2ZJ9 A;  1GHP A;  2WAE A;  3BFG A;  3FV7 A;  1PWG A;  1C3B A;  3MXR A;  1BTL A;  1XGI A;  5TGF A;  4LCL A;  4GOG A;  1DJC A;  1Y54 A;  1YLW A;  2JCH A;  1XKZ A;  3AGE A;  4X69 A;  1FSY A;  5EE8 A;  2Q9N A;  5FI7 A;  4DRT A;  3WS0 A;  2PU4 A;  2Y4A A;  3SOI A;  3V5M A;  4CJN A;  3IXH A;  2Y2H A;  5CRF A;  1WYB A;  5TR7 A;  4KG5 A;  5I94 A;  2I72 A;  2B5R A;  3VMA A;  4P0M A;  2QZ6 A;  2XQZ A;  4NET A;  1EWZ A;  4L0L A;  3VP0 A;  3BEB A;  4X6T A;  4B4X A;  4PM9 A;  2EXA A;  2JE5 A;  4OON A;  3UE0 A;  2XEP A;  1W79 A;  2EX8 A;  2IWC A;  3OPH A;  1NYY A;  4BLM A;  1GHI A;  5HX9 A;  2HPB A;  3SH9 A;  2RCX A;  3VP1 A;  3A3I A;  1CI8 A;  4IBR A;  3FKW A;  2WGW B;  1E3U D;  3OCL A;  5CEC A;  5JYP A;  3NCK A;  3GV9 A;  4WM9 A;  2XF3 A;  3QHY A;  4GDB A;  1FR6 A;  3PBN A;  5JYO A;  4WZ4 A;  3O3V A;  4KEN B;  1IKG A;  2XLN A;  3WRZ A;  4QJG A;  1LL5 A;  4MEZ A;  1M40 A;  4BJP A;  3PBR A;  5FQQ A;  3IF6 C;  4ZJ3 A;  1ZC2 A;  4NK3 A;  1YLY A;  4FD8 A;  5HAR A;  1K6R A;  3N8L A;  1S6R A;  3A3D A;  3C4O A;  4RX2 A;  1XA7 A;  4O7D A;  3V3R A;  2ZQ8 A;  3WWX A;  4E3K A;  1JTG A;  2JC7 A;  4C75 A;  4JKT A;  3VSL A;  4E6X A;  1VQQ A;  4S2P A;  1SCW A;  3BFE A;  4MBK A;  4OLG A;  1IEL A;  3NC8 A;  5CTN A;  1L2S A;  2WGW A;  5HL1 A;  3G31 A;  3ZNY A;  4KZ9 A;  3MBZ A;  3WRT A;  1CEG A;  3QNB A;  3BFF A;  2ZLY A;  4PM7 A;  5CHM A;  4GDN A;  1MPL A;  4OLD A;  1DY6 A;  3S22 A;  1Q2Q A;  4GZB A;  1DJB A;  3G2Y A;  3OPP A;  1MWU A;  3C7U A;  3DW0 A;  4UA7 A;  3NIA A;  4OPZ A;  4JF4 A;  3WS1 A;  3NI9 A;  5GHX A;  3ZG7 B;  4BL3 A;  4JBF A;  1GCE A;  3TSG A;  3ZG0 A;  2V20 A;  5FAS A;  4KQR A;  4LV2 A;  2R9X A;  4QD4 A;  2ZM2 A;  5EVI D;  1K4F A;  1PIO A;  4BL2 A;  2Q9M A;  5HAQ A;  4JLF A;  3LY3 A;  3MKF A;  5FQI A;  2WGI A;  1IYP A;  2DNS A;  3P09 A;  4Y0O A;  3VFH A;  1G6A A;  2DCF A;  1SDN A;  3HUO A;  5CTM A;  1FR1 A;  4HEF A;  1PW1 A;  4OP5 A;  1K54 A;  1HZO A;  4KZA A;  4MBH A;  3EQU A;  1TDG A;  4MNR A;  1I2W A;  4PM8 A;  1K56 A;  4K0X A;  1PWC A;  2C5W B;  3GR2 A;  4S2N C;  3V39 A;  1E4D A;  1ERM A;  1JWZ A;  4R3J A;  4GD6 A;  1W8Q A;  3FZC A;  4H8R A;  1ZG6 A;  2Y2O A;  2X01 A;  1MKI A;  1BZA A;  3OCN A;  1HTZ A;  2Y2G A;  3C5A A;  4KZ3 A;  3PTE A;  4N1H A;  4X68 A;  2X02 A;  4XUZ A;  5CHJ A;  1PWD A;  5EUA A;  3UY6 A;  4FSF A;  3N8R A;  1N4O A;  3NDE A;  1XGJ A;  2XR0 A;  5FAO A;  5FSR A;  1S0W A;  5FAP A;  4DKI A;  5AQ7 A;  5E2H A;  3QNC A;  3Q7V B;  1YLT A;  4K0W A;  4DE0 A;  2ZQ9 A;  3ZGA B;  4EBL A;  5F1F A;  1CI9 A;  3GQZ A;  1BSG A;  1IYQ A;  1IYS A;  3UDX A;  3IQA A;  1BT5 A;  5FQK A;  2PBY A;  3PBS A;  1XX2 A;  1FOF A;  4KG2 A;  3CG5 A;  4JXG A;  4Y7P A;  5U47 A;  4KZ4 A;  3GSG A;  2UWX A;  2XDM A;  4R4R A;  5FI6 A;  5CED A;  4F94 A;  1QMF A;  2WGV A;  4OVD A;  3BFC A;  2Y2Q A;  3V3S A;  3W4P A;  2XGN A;  5DTK A;  1BLP A;  3IXD A;  4UAA A;  2V2F F;  4WEK A;  2J7V A;  3PBO A;  4X56 A;  1WYC A;  5CER A;  3O88 A;  5TFQ A;  4C3Q A;  3Q7V A;  5BOH A;  1NYM A;  4UA9 A;  2J9P A;  2Z2M B;  3Q1F A;  1LHY A;  4DE3 A;  1CK3 A;  4LEN A;  4DDY A;  1KDS A;  2WUQ A;  2ZC6 B;  1JWP A;  1ESU A;  4B4Z A;  3IWI A;  4ZBE A;  3E2L A;  1NJ4 A;  1MWR A;  1KE0 A;  4LCM A;  4FH2 A;  1ONG A;  3DTM A;  3TG9 A;  4E3M A;  4S2O A;  1YMS A;  2J9O A;  3IH8 A;  4ZJ1 A;  3MZE A;  2EX2 A;  2E8I A;  1FSW A;  4FH4 A;  4Y0T A;  2H0Y A;  1PI4 A;  3Q81 A;  1ES3 A;  4IBX A;  2JBF A;  3Q82 A;  4KZ8 A;  5DF7 A;  4Z9Q A;  3MZF A;  4RX3 A;  4KZ7 A;  4WMC D;  1ALQ A;  1FCM A;  4OPQ A;  5FI2 A;  2IWB A;  2H0T A;  4JF5 A;  5L2F A;  3ZFZ A;  1MY8 A;  2EXB A;  4KG6 A;  1J9M A;  3IF6 B;  4U3T A;  5DTS A;  4KZ6 A;  1K55 C;  1JVJ A;  1MBL A;  4B88 A;  1KGG A;  3HLG A;  2ZD8 A;  5CEB A;  4OOL A;  1BLH A;  3D4F A;  4WYY A;  4GN2 A;  3UO9 A;  3VSK A;  3IT9 A;  4QY6 A;  3ISG A;  5DF9 A;  3LO7 A;  1ERQ A;  1K56 D;  3LY4 A;  4MLL A;  4OQ0 A;  1GA9 A;  3OC2 A;  1BUL A;  5F1G A;  5FDH A;  3UPN A;  1KE3 A;  2QMI A;  2VGK A;  2Y2N A;  4BD1 A;  1SHV A;  3SS3 A;  3W4Q A;  4ZDX A;  4N1X A; 
#chains in the Genus database with same CATH topology
 2W1T A;  1XXM A;  3DWK A;  5KZH A;  4S2K A;  5GLC A;  4OOY A;  4WL9 A;  4F3L A;  2CC1 A;  3O86 A;  5CGX A;  5GLA A;  5F68 A;  3IF6 A;  1LL9 A;  2QKP A;  2Y2K A;  4EBN A;  4BD0 A;  1XFQ A;  1SKO A;  4UHU A;  4EEU A;  5DFX A;  4S2I A;  4DJ3 A;  1XJ3 A;  3ZG9 B;  5E2E A;  5FQ9 A;  5A90 A;  1XA1 A;  2Y8H A;  4QHC A;  2M7U A;  2ZMV A;  3NBL A;  3SW1 A;  5HDD A;  1D1J A;  4OOM A;  5EVL A;  3CUE A;  3WS5 A;  1S1Y A;  3ZCZ A;  1TF1 A;  2J3W A;  2PBD P;  1SDE A;  5F82 A;  2XK1 A;  3SH8 A;  5F6A A;  1ACF A;  4JXS A;  5FL3 A;  4X55 A;  4LV0 A;  3WS2 A;  3T4Q A;  5E2F A;  3FWL A;  1K25 A;  3PR6 A;  1SKF A;  5HFO A;  1HD8 A;  2ZQC A;  1TS0 A;  1TEM A;  1OTI A;  1YQS A;  1IFQ A;  3MZD A;  4E6W A;  3DWZ A;  4N92 A;  1OTD A;  5GLB A;  5M1A A;  4OKP A;  2Y2I A;  5GHZ A;  3BW6 A;  1JNU A;  1RCJ A;  2G2W A;  1VEU B;  3CLO A;  2XFS A;  2ZC7 A;  4ETZ A;  5CHU A;  3TW8 A;  3JVV A;  4E3I A;  4FCF A;  1JWV A;  4LPZ A;  2ZC5 B;  1LI0 A;  3HLE A;  4D60 A;  1Z6F A;  1OT6 A;  2OV5 A;  3QP6 A;  4BBT A;  3H7W B;  4HY8 A;  5IS1 A;  4DE2 A;  4S2M A;  3VOL A;  2O9B A;  3NDG A;  1PYY A;  3LR3 A;  3BRM A;  1YLZ A;  4WF0 A;  5F83 A;  2Y91 A;  1ZTU A;  3PAE A;  4MCW A;  3ZNT A;  1Q2P A;  3G34 A;  1K57 A;  4CLC C;  2EFX A;  2XD1 A;  2FFF B;  4L9G A;  3HLD A;  1F2K A;  5GHY A;  4QU3 A;  2ZQD A;  1G68 A;  3HLW A;  3T1X A;  1F5M A;  2ZQA A;  1L0D A;  4JGR A;  1NRF A;  1PRQ A;  2Y59 A;  2L1M A;  2H10 A;  2IWD A;  3FKV A;  3VE3 A;  3A0S A;  3N4I A;  1MC0 A;  1NZO A;  4Q8I A;  1KGF A;  4R6L A;  5DF8 A;  5DVA A;  5HW3 A;  5KSC A;  3A3J A;  3KSG A;  5E43 A;  4CPK A;  3E0Y A;  3AGD A;  5FDS A;  1VM1 A;  4PMA A;  2ZC4 B;  2NUP C;  1OT9 A;  2WZX A;  3HJK A;  2J3T C;  4OP8 A;  5IU1 A;  2C6W B;  3OPR A;  2WAE A;  1C3B A;  1BTL A;  1J3W A;  4AFI A;  1DJC A;  1XKZ A;  5EE8 A;  4WLA A;  2Y4A A;  5IT5 A;  2Y2H A;  1UWN X;  2B5R A;  2QZ6 A;  4NET A;  1EWZ A;  2B95 A;  4I3I A;  2W3D A;  4B4X A;  4HQA A;  2XEP A;  5HD3 A;  1NYY A;  4BLM A;  3LYX A;  1LSV A;  3MQ0 A;  3VP1 A;  5MC7 A;  3T4L A;  3B42 A;  5JYP A;  5TJJ A;  4HJ6 A;  3PBN A;  2KLI A;  3WRZ A;  4B9O A;  1TD5 A;  1LL5 A;  4BJP A;  3PBR A;  4ZJ3 A;  1VET B;  1ZC2 A;  3CWF A;  4FD8 A;  3V67 A;  4DN0 A;  4EXO A;  1K6R A;  3N8L A;  3C4O A;  3QP8 A;  1XFN A;  1XA7 A;  4O7D A;  3V3R A;  1VHM A;  2L0W A;  4X25 A;  3KSI A;  3VSL A;  1N9O A;  4S2P A;  1UWP X;  1IEL A;  3HJI A;  5HL1 A;  3GEC A;  3QNB A;  4ARZ A;  1TS7 A;  3G2Y A;  2KDK A;  1S4S A;  4GHI A;  2Z6D A;  3KYE A;  1UGU A;  2ZM2 A;  1PIO A;  3T4J A;  2Q9M A;  1W63 M;  4JLF A;  3LY3 A;  3MKF A;  5FQI A;  1S1Z A;  2V9A A;  2DNS A;  1G6A A;  3HUO A;  4Y15 A;  1FR1 A;  1I2W A;  4K0X A;  3NJA A;  5CX7 A;  1W8Q A;  4H8R A;  1MKI A;  4PKY A;  3C5A A;  4KZ3 A;  3PTE A;  4XUZ A;  3UY6 A;  4FSF A;  4BMW A;  3NDE A;  1XGJ A;  1Z09 A;  5FAP A;  2D01 A;  5E2H A;  3Q7V B;  4K0W A;  3UB9 A;  2ZQ9 A;  1AWI A;  4H6J B;  1CF0 A;  4EBL A;  2YKF A;  1CI9 A;  1BSG A;  2EWW A;  5FQK A;  4KG2 A;  2UWX A;  2XDM A;  3E4P A;  1T19 A;  2XGN A;  4UAA A;  5TBM A;  1OPX A;  3T4O A;  3IX8 A;  1WYC A;  2GJ3 A;  5BOH A;  5HSQ A;  4NKP A;  1H8M A;  3Q1F A;  4ETX A;  1CK3 A;  4LEN A;  4DDY A;  1KDS A;  1ESU A;  4ZBE A;  4LFU A;  2VX8 A;  1MWR A;  3B33 A;  4E3M A;  4PKY G;  1T1A A;  1DP9 A;  1YMS A;  2J9O A;  3RH8 B;  1PNE A;  3Q82 A;  4F3L B;  5DF7 A;  4KZ7 A;  4WMC D;  1NLY A;  2YKH A;  1J9M A;  3IF6 B;  4U3T A;  2OWH A;  5CEB A;  1D06 A;  1S4R A;  4GN2 A;  3IT9 A;  3MF0 A;  1SKO B;  3TOI A;  3UPN A;  2DMW A;  1KE3 A;  3PHY A;  2W3E A;  2L4R A;  3SS3 A;  3NOT C;  3JYI A;  3OPL A;  4IJG A;  1TDL A;  2OLU A;  2ZM0 A;  4IUK A;  4KZ5 A;  3EQV A;  4ZAM A;  2LB9 A;  2HP6 A;  3BQ8 A;  1MWS A;  3BFD A;  2QPN A;  1HVB A;  1E3U A;  4P87 A;  1RGZ A;  3T12 B;  1K55 A;  2WKH A;  2VZW A;  4Y5F A;  2ZC3 B;  1IYO A;  2HP5 A;  3HVF A;  1YAX A;  4GNU A;  5FEG A;  5AJG A;  2VGJ A;  1L0F A;  1MZU A;  1OJG A;  1IKI A;  4JPM A;  1BUE A;  1V9Y A;  5EOE A;  4WEL A;  4UA6 A;  3B3X A;  1PZP A;  3IXG A;  2P08 A;  2OOL A;  2ZQ7 A;  5A92 A;  1BYW A;  2Y2M A;  5C5K A;  3T4T A;  2JKG A;  4S2N A;  1ES5 A;  1OME A;  3HBR A;  2V8C A;  3UDI A;  1H5X A;  2EX9 A;  4GS9 A;  3T4K A;  1ONH A;  1F98 A;  4Y17 A;  4EER A;  1L0E A;  3PBQ A;  4DXC A;  3BEC A;  3HUM A;  1GA0 A;  2VK3 A;  1KE4 A;  3LIC A;  4QB8 A;  3SZT A;  3MMH A;  4D2O A;  2R9W A;  3C2W A;  1KVM A;  4S2L A;  3CPT B;  2BLS A;  3BWL A;  1PI5 A;  3HRE A;  5AQA A;  3S4X A;  4BEN A;  3UE1 A;  3ZQ5 A;  4HHD A;  2O9C A;  3BLS A;  4EV4 A;  1GHM A;  3H9W A;  2VA0 A;  3LEZ A;  4ID4 A;  3W4O A;  1I2S A;  4ZTK A;  1FCO A;  1K54 C;  2H5S A;  2OLV A;  4PM5 A;  3GDI A;  3GVB A;  2A49 A;  1NRJ A;  3MFX A;  3C4P A;  4G3V A;  2FFY A;  3LR0 A;  1YT4 A;  5DKL A;  3M2J A;  3ZHH A;  4E3N A;  3OBF A;  3W8K A;  4LRZ E;  5F69 A;  3JVU A;  5GL9 A;  3LIB A;  1MWT A;  2GX5 A;  4R3A A;  3TE8 A;  2DRW A;  2WKQ A;  3U2A A;  2P7J A;  3L9K A;  3N6I A;  3AGF A;  4JGO A;  1LSW A;  5EEC A;  2QHK A;  1N9B A;  2ZMA A;  3MFD A;  3SH7 A;  4BBV A;  2UV0 E;  2I9V A;  4CLC A;  2Y2L A;  3LGO A;  1W5D A;  2Y55 A;  1EI5 A;  4EQI A;  4LRX C;  2WKE A;  3UDF A;  3EEH A;  5E2G A;  3ZVW A;  2RL3 A;  1QME A;  1I5Q A;  3PBT A;  2K2N A;  3IX3 A;  4HBU A;  1YMX A;  1L0G A;  3VFF A;  1XJ4 A;  1ES2 A;  3NOP C;  2HDU A;  1ZG4 A;  3S1Y A;  5EVI A;  3C7V A;  1W7F A;  3UPP A;  4EEP A;  4A5R A;  4OQH A;  5DJU A;  3Q07 A;  4WEJ A;  3IH9 A;  3BFG A;  4HI4 A;  1PWG A;  2VEA A;  2KOI A;  4LCL A;  1Y54 A;  2ZBB A;  3E4O A;  2ZL1 A;  4DRT A;  3SOI A;  1WYB A;  4KG5 A;  5I94 A;  4XT2 A;  1STZ A;  4Y3I A;  5EFW A;  5LBR A;  2OAP 1;  2PT7 A;  2EXA A;  1LL8 A;  1W79 A;  3OPH A;  4EW7 A;  3A3I A;  1CI8 A;  3OCL A;  5CEC A;  2XF3 A;  4L9E A;  1FR6 A;  4ARZ B;  5JYO A;  4WZ4 A;  1K0K A;  2XLN A;  1M40 A;  5FQQ A;  3IF6 C;  3P7N A;  4GHI B;  5HAR A;  3D72 A;  2D02 A;  3O5Y A;  2ZQ8 A;  4C75 A;  4UEY A;  2WGW A;  3G31 A;  3ZNY A;  3FPW A;  4GDN A;  3ICY A;  3CUE C;  1GSV A;  2O9A A;  1WA9 A;  3DW0 A;  4UA7 A;  3NIA A;  2Q0O A;  2NUT C;  2P04 A;  4BL3 A;  5FAS A;  1GCE A;  2V20 A;  2XA7 M;  4KQR A;  4LV2 A;  3FPV A;  5EVI D;  4NG2 A;  4NXG A;  5HDS A;  1K4F A;  1F9I A;  2XA7 S;  2PRF A;  3P09 A;  1IYP A;  3VFH A;  4KUO A;  2B18 A;  4MBH A;  3EQU A;  1PWC A;  1E4D A;  1JWZ A;  4R3J A;  4GD6 A;  3EEA A;  3LFV A;  4P6Z M;  2X01 A;  1BZA A;  2Y2G A;  3IS2 A;  4N1H A;  5EUA A;  4P6Z S;  2VKS A;  3N8R A;  2H28 A;  1N4O A;  2XR0 A;  5FAO A;  1S0W A;  5F5Y A;  4HJ4 A;  3D3O A;  4JGP A;  1NLZ A;  2PR5 A;  1IYQ A;  1BT5 A;  3F1N A;  1XX2 A;  5U47 A;  4KZ4 A;  3LEQ A;  5FI6 A;  2VV7 A;  4F94 A;  1QMF A;  3CIT A;  1ZHH B;  1OTB A;  4MDZ A;  2M7V A;  4OVD A;  2Y2Q A;  3V3S A;  3W4P A;  5DTK A;  1BLP A;  3IXD A;  3C30 A;  3K3D A;  5EVE A;  5CER A;  1S66 L;  5TFQ A;  3G6O A;  1NYM A;  1G28 A;  3MS6 A;  2Y79 A;  2ZC6 B;  2B02 A;  3DTK A;  4B4Z A;  4Q0I A;  4LCM A;  1ONG A;  2ACG A;  2FH5 A;  3TG9 A;  4S2O A;  4HIA A;  2OWJ A;  2W3F A;  5KIZ A;  1YSQ A;  3Q81 A;  2OAQ 1;  4I3J A;  4RX3 A;  5FI2 A;  5L2F A;  1A0K A;  1MY8 A;  2VJW A;  5HWV A;  1MBL A;  4B88 A;  1KGG A;  4OOL A;  4WYY A;  4MLL A;  5FDH A;  1BUL A;  2VGK A;  3F1P A;  4ZRR A;  4ZDX A;  2INW A;  2XH9 A;  3VV4 A;  3T1S A;  3PXP A;  4YIN A;  1K6S A;  3HLC A;  1DJA A;  3TJZ C;  5FQJ A;  3C38 A;  1W63 Q;  3IXB A;  3M6B A;  1E25 A;  3BYD A;  2A3U A;  3H82 A;  4QY5 A;  3D9Y A;  4CQH A;  4KQD A;  3ZG8 B;  4G3K A;  4LV1 A;  3GRJ A;  3A3E A;  4WUJ A;  4WZ5 C;  1Y28 A;  3UB6 A;  3E98 A;  4OQI A;  3UME A;  5G18 A;  2J8Y A;  2A24 A;  1AXB A;  3G32 A;  3T4S A;  4NXF A;  3ZDJ A;  4GB7 A;  4LV3 A;  4GS9 B;  1KGE A;  4GKU A;  5A91 A;  2EWV A;  4FOF A;  3DTE A;  1BLS A;  4GW9 A;  5CXW A;  2A2L A;  2R78 A;  3CZD A;  3IWQ A;  5J3W A;  3IHB A;  2WZZ A;  2JKR M;  3M2K A;  4X53 A;  2M1C A;  3MXS A;  2IA2 A;  4KZB A;  2WKP A;  2E8J A;  5M19 A;  3R4K A;  3ZYT A;  4EES A;  1FCN A;  4XUX A;  4RYE A;  2WK0 A;  1NY0 A;  5DTT A;  1KDW A;  2EA9 A;  2W1T B;  1PW8 A;  1ES4 A;  5EOO A;  5HAP A;  3E2K A;  4E3O A;  1PZO A;  1V9Z A;  5A93 A;  2HDR A;  4DDS A;  1YLP A;  5IHV A;  1U60 A;  2FZ0 A;  3EGD C;  4P85 A;  4PM6 A;  2W3G A;  5GLD A;  1T18 A;  3B47 A;  1GSX A;  4Y13 A;  3OZH A;  4JXV A;  3VOY A;  3HLB A;  4WBG A;  1W8Y A;  1P9W A;  1YPR A;  4BBU A;  5DFY A;  4MBF A;  1FIL A;  4R38 A;  3IWO A;  2PDR A;  4P6B A;  4I38 A;  4CLC B;  2MJ6 A;  2XSS A;  3W2Z A;  5M18 A;  4II7 A;  3G2Z A;  4EQ1 A;  2OSU A;  1H3Q A;  4HES A;  1CEF A;  5FQM A;  4YNR A;  3NOU C;  4MMN A;  3QP2 A;  2ZOI A;  3BM6 A;  5EVI B;  4KQO A;  4DJ2 A;  1K4E A;  3ITB A;  1T1C A;  1DP6 A;  3A3F A;  2P9V A;  4E3L A;  3T1R A;  3HCY A;  5HDC A;  2VGL M;  1O7E A;  2V1A A;  4S2J A;  4IHQ A;  4R23 A;  2VGL S;  1YM1 A;  3KYQ A;  4DXB A;  4R0Q A;  1O07 A;  4YWZ A;  2ZL1 B;  4R3B A;  1ZKJ A;  3SS5 A;  4EWF A;  1FQG A;  1YSP A;  2HDQ A;  4XT2 B;  2HDS A;  2JKR I;  1TS8 A;  3G35 A;  2HF6 A;  2PAV P;  3LID A;  4PAU A;  1GHP A;  4M4X A;  3MXR A;  4O01 A;  5TGF A;  1YLW A;  2JCH A;  3AGE A;  1FSY A;  2Q9N A;  4X1L A;  2PU4 A;  4CJN A;  3IXH A;  1GSW A;  5TR7 A;  3UB8 A;  4H6J A;  3RTY A;  4B93 A;  3BEB A;  4X6T A;  4PM9 A;  2W1R A;  4OON A;  3S7Q A;  2EX8 A;  2IWC A;  4RQ9 A;  1GHI A;  3LIE A;  3SH9 A;  1D7E A;  4DMZ A;  4ME4 A;  2WGW B;  1E3U D;  4QPR A;  4O8G A;  5HD5 A;  2LB5 A;  4WM9 A;  4GDB A;  3O3V A;  4KEN B;  1IKG A;  4MEZ A;  1P97 A;  4G3W A;  1VB6 A;  4HH2 A;  4RX2 A;  3LR5 A;  1JTG A;  1VQQ A;  2QJ5 A;  1SCW A;  3BFE A;  4MBK A;  3NC8 A;  1L2S A;  3MBZ A;  3WRT A;  5A8B A;  4PM7 A;  1MPL A;  3E4Q A;  4O0P A;  4OLD A;  1Q2Q A;  4GZB A;  3S22 A;  1DJB A;  3OPP A;  1MWU A;  3C7U A;  3DTI A;  4JF4 A;  5GHX A;  3ZG7 B;  4JBF A;  3IS2 B;  3ZG0 A;  2R9X A;  1XJ6 A;  5HAQ A;  3NEC A;  1N9N A;  2DCF A;  5CTM A;  4HEF A;  4Q0H A;  3F1N B;  4MNR A;  1MKM A;  1K56 A;  3LIA A;  5L10 A;  4S2N C;  2HGV A;  3FZC A;  1ZG6 A;  2Y2O A;  1CJF A;  4LGW A;  1HTZ A;  4X68 A;  2X02 A;  1PWD A;  4I5S A;  3OLO A;  5FSR A;  5AQ7 A;  3EOI A;  1YLT A;  4MN7 A;  4DE0 A;  1LT0 A;  4NEE D;  3ZGA B;  2WKR A;  1P9R A;  3MSH A;  5F1F A;  1H0M A;  1IYS A;  1NWZ A;  3IQA A;  3PBS A;  4HH3 A;  1FOF A;  4Z1W A;  1P0Z A;  3GSG A;  5CED A;  1G5U A;  2JKT M;  2K7S A;  4WEK A;  2J7V A;  3PBO A;  4X56 A;  5I5L A;  3O88 A;  4C3Q A;  3T1Q B;  4UA9 A;  2J9P A;  2Z2M B;  1LHY A;  3RFB A;  3UB7 A;  3MQQ A;  2QYB A;  1JWP A;  3CI6 A;  2HV1 A;  4FH2 A;  1OTE A;  3DTM A;  5FEF A;  3L7H A;  2V1B A;  2V0W A;  3F1P B;  3IH8 A;  4R70 A;  2BAS A;  1FSW A;  4IUH A;  1PI4 A;  2G7U A;  4IBX A;  2JBF A;  5J7E A;  2GZA A;  4Z9Q A;  4NXB A;  3FG8 A;  1ALQ A;  1FCM A;  4Q0J A;  2IWB A;  3R7W A;  4JF5 A;  5L07 A;  5J4E A;  4KZ6 A;  3F1O A;  2JHE A;  1T1B A;  2ZD8 A;  3VSK A;  1BLH A;  3D4F A;  4CLC D;  4QY6 A;  3ISG A;  5DF9 A;  3H82 B;  1ERQ A;  1K56 D;  3LO7 A;  1GA9 A;  3OC2 A;  3IX4 A;  3UMD A;  3K3C A;  3W4Q A;  5DJT A;  4N1X A;  3FYZ A;  2EFU A;  3I7J A;  1TVF A;  3HLF A;  1RP5 A;  3G30 A;  3RJU A;  4EBP A;  2BTF P;  1WE4 A;  3ZVT A;  2A24 B;  4OPR A;  3BJN A;  3CPT A;  3UE3 A;  3CMZ A;  2WYX A;  3P98 A;  1PFL A;  3IHA A;  1FIK A;  1MXO A;  2EX6 A;  3NY4 A;  3HUN A;  4N9K A;  5EVI C;  3S7N A;  3S7O A;  3LCE A;  1M6K A;  3Q7Z A;  4OH0 A;  2GDN A;  3GMW A;  2Y2P A;  2V1Z A;  2PR6 A;  3UN7 A;  4JF6 A;  3FC7 A;  5CGW A;  4M3K A;  5TBM B;  3VOZ A;  2WAD A;  1KVL A;  1H8Y A;  4OPY A;  2Y2J A;  1HLU P;  1EW0 A;  1LLB A;  5HWT A;  3BY8 A;  2J3T D;  1N9L A;  4OQG A;  3VP4 A;  3CJM A;  4L9F A;  3UPO A;  2WAF A;  2JKT I;  2G2U A;  3MJQ A;  3KX0 X;  5AQB A;  3C8C A;  3KYZ A;  5FAT A;  2O0Y A;  4HP9 A;  3DBA A;  4HBT A;  5EM0 A;  1IEM A;  4WZ5 A;  1BLC A;  5AVF A;  3A0V A;  4YOF A;  5DKK A;  4CLC E;  4HP4 A;  4PPR A;  3BQA A;  1L3L A;  5FAQ A;  4K91 A;  3MXQ A;  1X0O A;  3V50 A;  3IBR A;  3HL9 A;  1ESI A;  3ITA A;  4WN5 A;  4U0T A;  3MQO A;  1K57 C;  2HP9 A;  5J8X A;  5HZH A;  4RVA A;  4E3J A;  2QWS A;  4R1G A;  4ZJ2 A;  1NZU A;  3PAG A;  2V8F A;  3KO6 A;  3VP3 A;  1XP4 A;  3P01 A;  3N7W A;  4Y0U A;  4DE1 A;  4R4S A;  2XFT A;  1SZV A;  4EUZ A;  2JKF A;  3LUQ A;  2PU2 A;  1XJ2 A;  4GCZ A;  1VEU A;  4GD8 A;  3MKE A;  4JXW A;  4RA7 A;  4C6Y A;  3IF5 A;  4DF6 A;  4JGQ A;  4EET B;  3UNW A;  2P74 A;  5L09 A;  3H7W A;  5CGS A;  4GJ4 A;  4XXR A;  4KQQ A;  3K2N A;  4FUW A;  3M6H A;  4U0X A;  2P9V B;  2CMN A;  1YLJ A;  2XRO A;  1LI9 A;  1S67 L;  2PYR A;  2ZOH A;  1DP8 A;  4IVI A;  1ERO A;  3MR0 A;  5HAI A;  5EPH A;  3N8S A;  4YFM A;  3S7P A;  2BG1 A;  4IVK A;  2Z2L B;  4EU0 A;  2VV6 A;  3VP2 A;  4HOI A;  4WMC A;  5HPI A;  5KSH A;  1RGY A;  3BLM A;  2WKI A;  3O87 A;  3T50 A;  3RXW A;  4FTX A;  2JN7 A;  5AQ9 A;  3UB5 P;  4BQM A;  3RXX A;  1H8Z A;  2K31 A;  2J80 A;  3NUL A;  5FA7 A;  1NXY A;  1Y4O A;  1IOU A;  2QJ7 A;  3ZG5 A;  1K38 A;  4Y2F A;  2GNX A;  2O99 A;  3GTC A;  3KSH A;  4N9L A;  5KMW A;  5D3O A;  2PYP A;  3OOV A;  3WS4 A;  3SS4 A;  1XPB A;  2X71 A;  4MN6 A;  1G6O A;  4IED A;  2ZM8 A;  2XD5 A;  3G4P A;  4LLO B;  3PYP A;  3LI9 A;  1JTD A;  2ZJ9 A;  3FV7 A;  1XGI A;  4GOG A;  2PD8 A;  4X69 A;  5FI7 A;  3WS0 A;  3V5M A;  3EGX C;  5CRF A;  2I72 A;  3VMA A;  4P0M A;  3CHW P;  4PHT A;  2XQZ A;  5AVE A;  4L0L A;  4BWI A;  2PD7 A;  3VP0 A;  5G4Z A;  2JE5 A;  3UE0 A;  5HX9 A;  2HPB A;  2RCX A;  2HJ9 C;  4IBR A;  3FKW A;  2Z6C A;  3NCK A;  3GV9 A;  3QHY A;  2ZMF A;  4QJG A;  2VLG A;  3IBJ A;  4NK3 A;  1YLY A;  2W0N A;  1S6R A;  3A3D A;  3WWX A;  4E3K A;  1DRM A;  2JC7 A;  3VE4 A;  3UE6 A;  5EM1 A;  4JKT A;  4E6X A;  5K5B A;  3DAV A;  1YKD A;  4OLG A;  5CTN A;  4KZ9 A;  1CEG A;  3BFF A;  2ZLY A;  5CHM A;  1ODV A;  1DY6 A;  4QWO A;  1VET A;  4OPZ A;  3QP4 A;  3TRC A;  5HPF A;  3WS1 A;  1OJ5 A;  3NI9 A;  4KUK A;  3TSG A;  3LIF A;  4QD4 A;  4BL2 A;  2WGI A;  4UQI M;  4Y0O A;  1CQA A;  1SDN A;  2PHY A;  1PW1 A;  4UQI S;  2W27 A;  4I39 A;  4OP5 A;  1K54 A;  1HZO A;  4KZA A;  1TDG A;  4PM8 A;  1LSX A;  5HL6 A;  2V0U A;  3V39 A;  2C5W B;  3GR2 A;  1ERM A;  2AVX A;  4EUV A;  3JPU A;  3OCN A;  5CHJ A;  2HJE A;  3BY9 A;  4DKI A;  3QP5 A;  3ULF A;  3QNC A;  2VV8 A;  3EWK A;  4MN5 A;  5G4Y A;  4I3A A;  5EV0 A;  3GQZ A;  3UDX A;  1KOU A;  2PBY A;  4Y7P A;  3CG5 A;  4JXG A;  4HNB A;  4R4R A;  3NHQ A;  2WGV A;  1OTA A;  2XRN A;  3BFC A;  4NXE A;  2V2F F;  3LR4 A;  2KX6 A;  3Q7V A;  4DE3 A;  3R7W B;  3KSF A;  3LI8 A;  2WUQ A;  3F1O B;  3IWI A;  3E2L A;  4ESP A;  1NJ4 A;  1KE0 A;  4E04 A;  3A0R A;  3QP1 A;  5L8M A;  4ZJ1 A;  5HWW A;  3MZE A;  2EX2 A;  2E8I A;  4FH4 A;  4Y0T A;  2H0Y A;  1ES3 A;  4KZ8 A;  2W3H A;  3MZF A;  4OPQ A;  2H0T A;  2HZ5 A;  4K08 A;  3ZFZ A;  4X1M A;  2EXB A;  4KG6 A;  5DTS A;  1K55 C;  1JVJ A;  1TS6 A;  3HLG A;  3U4L P;  3UO9 A;  3CAX A;  4GLQ A;  3LY4 A;  4OQ0 A;  5F1G A;  4LRY C;  2QMI A;  2Y2N A;  4BD1 A;  1SHV A;  4HJ3 A; 
#chains in the Genus database with same CATH homology
 3JYI A;  3OPL A;  2XH9 A;  1XXM A;  3FYZ A;  2EFU A;  3I7J A;  1TVF A;  3HLF A;  4YIN A;  3DWK A;  5KZH A;  1TDL A;  4S2K A;  1K6S A;  3HLC A;  5GLC A;  4OOY A;  1DJA A;  1RP5 A;  2OLU A;  2ZM0 A;  3G30 A;  2CC1 A;  3O86 A;  4KZ5 A;  5FQJ A;  5CGX A;  3RJU A;  3EQV A;  4EBP A;  1WE4 A;  4ZAM A;  3ZVT A;  5GLA A;  4OPR A;  2HP6 A;  3IF6 A;  3UE3 A;  1LL9 A;  3CMZ A;  2WYX A;  3P98 A;  3IXB A;  1MWS A;  3M6B A;  1E25 A;  3BFD A;  2QPN A;  2EX6 A;  1MXO A;  2Y2K A;  3IHA A;  3BYD A;  3NY4 A;  4EBN A;  1HVB A;  4BD0 A;  1E3U A;  2A3U A;  3HUN A;  4P87 A;  1RGZ A;  4UHU A;  4N9K A;  4QY5 A;  5EVI C;  3LCE A;  1K55 A;  2WKH A;  1M6K A;  3ZG8 B;  4S2I A;  2ZC3 B;  3Q7Z A;  3GRJ A;  4LV1 A;  3A3E A;  3ZG9 B;  1IYO A;  4OH0 A;  2HP5 A;  2GDN A;  3GMW A;  5E2E A;  5FQ9 A;  3HVF A;  5A90 A;  1XA1 A;  2Y2P A;  4WZ5 C;  2V1Z A;  3UN7 A;  4GNU A;  4JF6 A;  4QHC A;  2VGJ A;  1L0F A;  4OQI A;  3NBL A;  5CGW A;  4M3K A;  5G18 A;  3VOZ A;  2WAD A;  2J8Y A;  4OOM A;  5EVL A;  3WS5 A;  1AXB A;  3G32 A;  1KVL A;  3ZCZ A;  3ZDJ A;  1IKI A;  1H8Y A;  4OPY A;  4JPM A;  4GB7 A;  2Y2J A;  1SDE A;  5F82 A;  2XK1 A;  3SH8 A;  4LV3 A;  1LLB A;  1KGE A;  4JXS A;  4GKU A;  5A91 A;  4OQG A;  1BUE A;  4LV0 A;  4X55 A;  3VP4 A;  3CJM A;  3WS2 A;  5EOE A;  4WEL A;  1BLS A;  5CXW A;  3UPO A;  5E2F A;  4UA6 A;  3CZD A;  3IWQ A;  3B3X A;  3FWL A;  1PZP A;  2WAF A;  1K25 A;  3IXG A;  2G2U A;  3IHB A;  2ZQ7 A;  5A92 A;  1SKF A;  5HFO A;  5AQB A;  1HD8 A;  2WZZ A;  2Y2M A;  5FAT A;  3M2K A;  2ZQC A;  4X53 A;  1TEM A;  4S2N A;  1ES5 A;  1YQS A;  3MXS A;  4HBT A;  1OME A;  1IEM A;  3HBR A;  1BLC A;  4KZB A;  3MZD A;  4WZ5 A;  4E6W A;  3DWZ A;  4N92 A;  4PPR A;  3UDI A;  1H5X A;  2EX9 A;  5GLB A;  5FAQ A;  4K91 A;  5M1A A;  1ONH A;  5M19 A;  4OKP A;  3TOI A;  2Y2I A;  5GHZ A;  1L0E A;  3V50 A;  1FCN A;  3HL9 A;  3PBQ A;  1RCJ A;  2G2W A;  1ESI A;  4RYE A;  2WK0 A;  4XUX A;  3ITA A;  2XFS A;  4DXC A;  1NY0 A;  2ZC7 A;  3BEC A;  1K57 C;  4U0T A;  2HP9 A;  5J8X A;  5CHU A;  3HUM A;  4E3I A;  4FCF A;  4RVA A;  4E3J A;  1GA0 A;  5DTT A;  1KDW A;  4R1G A;  1JWV A;  1KE4 A;  4ZJ2 A;  1NZU A;  3PAG A;  4QB8 A;  1PW8 A;  2ZC5 B;  1ES4 A;  1LI0 A;  3HLE A;  3VP3 A;  1Z6F A;  4D2O A;  1XP4 A;  5EOO A;  2OV5 A;  5HAP A;  3N7W A;  3E2K A;  2R9W A;  4Y0U A;  4DE1 A;  4R4S A;  1KVM A;  2XFT A;  4S2L A;  4DE2 A;  4EUZ A;  4E3O A;  4S2M A;  1PZO A;  2BLS A;  5A93 A;  1PI5 A;  2HDR A;  2PU2 A;  3HRE A;  4DDS A;  5AQA A;  1YLP A;  3NDG A;  1PYY A;  3BRM A;  1YLZ A;  3S4X A;  4BEN A;  5F83 A;  3UE1 A;  4GD8 A;  2Y91 A;  5IHV A;  3MKE A;  4JXW A;  1U60 A;  4RA7 A;  3BLS A;  3PAE A;  3ZNT A;  4C6Y A;  4P85 A;  3IF5 A;  4PM6 A;  4EV4 A;  1GHM A;  5GLD A;  1Q2P A;  3LEZ A;  4DF6 A;  4ID4 A;  3UNW A;  3G34 A;  3W4O A;  1I2S A;  4ZTK A;  3OZH A;  1FCO A;  4JXV A;  3VOY A;  1K54 C;  1K57 A;  3HLB A;  2EFX A;  2XD1 A;  2H5S A;  2FFF B;  2OLV A;  4PM5 A;  4WBG A;  2P74 A;  3HLD A;  3GVB A;  1W8Y A;  5CGS A;  5GHY A;  4XXR A;  4QU3 A;  4KQQ A;  2ZQD A;  4MBF A;  1G68 A;  3M6H A;  3IWO A;  3HLW A;  2A49 A;  4U0X A;  2P9V B;  4P6B A;  3C4P A;  2ZQA A;  1YLJ A;  1L0D A;  1LI9 A;  2FFY A;  5M18 A;  3G2Z A;  1YT4 A;  3M2J A;  3ZHH A;  2OSU A;  4IVI A;  1ERO A;  1NRF A;  4E3N A;  3W8K A;  5HAI A;  2Y59 A;  4HES A;  5GL9 A;  5EPH A;  1CEF A;  2H10 A;  1MWT A;  2IWD A;  3N8S A;  4YFM A;  3FKV A;  5FQM A;  2BG1 A;  4IVK A;  2Z2L B;  2DRW A;  3VP2 A;  3BM6 A;  3N4I A;  4WMC A;  1NZO A;  3N6I A;  4Q8I A;  1KGF A;  5KSH A;  1RGY A;  5EVI B;  3BLM A;  5DF8 A;  3AGF A;  2WKI A;  4KQO A;  3O87 A;  5DVA A;  1K4E A;  3ITB A;  5EEC A;  3RXW A;  1N9B A;  5HW3 A;  3A3F A;  2ZMA A;  3MFD A;  3SH7 A;  2P9V A;  4E3L A;  5KSC A;  3A3J A;  2Y2L A;  1O7E A;  5E43 A;  1W5D A;  2Y55 A;  4CPK A;  1EI5 A;  4S2J A;  5AQ9 A;  4BQM A;  3AGD A;  4EQI A;  2WKE A;  3RXX A;  3UDF A;  1H8Z A;  4R23 A;  5E2G A;  3ZVW A;  5FA7 A;  1NXY A;  1YM1 A;  2RL3 A;  1QME A;  1I5Q A;  3PBT A;  4R0Q A;  4DXB A;  1O07 A;  1VM1 A;  3ZG5 A;  1K38 A;  4PMA A;  4R3B A;  4HBU A;  1YMX A;  1ZKJ A;  1L0G A;  3SS5 A;  4EWF A;  3GTC A;  4N9L A;  1FQG A;  3VFF A;  5KMW A;  2ZC4 B;  1ES2 A;  5D3O A;  2HDQ A;  3WS4 A;  3SS4 A;  1XPB A;  2WZX A;  2X71 A;  2HDU A;  2HDS A;  1ZG4 A;  3G35 A;  3S1Y A;  5EVI A;  3C7V A;  1W7F A;  4IED A;  2ZM8 A;  3UPP A;  2XD5 A;  4A5R A;  4OP8 A;  4OQH A;  3G4P A;  3Q07 A;  2C6W B;  4WEJ A;  1JTD A;  3IH9 A;  3OPR A;  2ZJ9 A;  1GHP A;  2WAE A;  3BFG A;  3FV7 A;  1PWG A;  1C3B A;  3MXR A;  1BTL A;  1XGI A;  5TGF A;  4LCL A;  4GOG A;  1DJC A;  1Y54 A;  1YLW A;  2JCH A;  1XKZ A;  3AGE A;  4X69 A;  1FSY A;  5EE8 A;  2Q9N A;  5FI7 A;  4DRT A;  3WS0 A;  2PU4 A;  2Y4A A;  3SOI A;  3V5M A;  4CJN A;  3IXH A;  2Y2H A;  5CRF A;  1WYB A;  5TR7 A;  4KG5 A;  5I94 A;  2I72 A;  2B5R A;  3VMA A;  4P0M A;  2QZ6 A;  2XQZ A;  4NET A;  1EWZ A;  4L0L A;  3VP0 A;  3BEB A;  4X6T A;  4B4X A;  4PM9 A;  2EXA A;  2JE5 A;  4OON A;  3UE0 A;  2XEP A;  1W79 A;  2EX8 A;  2IWC A;  3OPH A;  1NYY A;  4BLM A;  1GHI A;  5HX9 A;  2HPB A;  3SH9 A;  2RCX A;  3VP1 A;  3A3I A;  1CI8 A;  4IBR A;  3FKW A;  2WGW B;  1E3U D;  3OCL A;  5CEC A;  5JYP A;  3NCK A;  3GV9 A;  4WM9 A;  2XF3 A;  3QHY A;  4GDB A;  1FR6 A;  3PBN A;  5JYO A;  4WZ4 A;  3O3V A;  4KEN B;  1IKG A;  2XLN A;  3WRZ A;  4QJG A;  1LL5 A;  4MEZ A;  1M40 A;  4BJP A;  3PBR A;  5FQQ A;  3IF6 C;  4ZJ3 A;  1ZC2 A;  4NK3 A;  1YLY A;  4FD8 A;  5HAR A;  1K6R A;  3N8L A;  1S6R A;  3A3D A;  3C4O A;  4RX2 A;  1XA7 A;  4O7D A;  3V3R A;  2ZQ8 A;  3WWX A;  4E3K A;  1JTG A;  2JC7 A;  4C75 A;  4JKT A;  3VSL A;  4E6X A;  1VQQ A;  4S2P A;  1SCW A;  3BFE A;  4MBK A;  4OLG A;  1IEL A;  3NC8 A;  5CTN A;  1L2S A;  2WGW A;  5HL1 A;  3G31 A;  3ZNY A;  4KZ9 A;  3MBZ A;  3WRT A;  1CEG A;  3QNB A;  3BFF A;  2ZLY A;  4PM7 A;  5CHM A;  4GDN A;  1MPL A;  4OLD A;  1DY6 A;  3S22 A;  1Q2Q A;  4GZB A;  1DJB A;  3G2Y A;  3OPP A;  1MWU A;  3C7U A;  3DW0 A;  4UA7 A;  3NIA A;  4OPZ A;  4JF4 A;  3WS1 A;  3NI9 A;  5GHX A;  3ZG7 B;  4BL3 A;  4JBF A;  1GCE A;  3TSG A;  3ZG0 A;  2V20 A;  5FAS A;  4KQR A;  4LV2 A;  2R9X A;  4QD4 A;  2ZM2 A;  5EVI D;  1K4F A;  1PIO A;  4BL2 A;  2Q9M A;  5HAQ A;  4JLF A;  3LY3 A;  3MKF A;  5FQI A;  2WGI A;  1IYP A;  2DNS A;  3P09 A;  4Y0O A;  3VFH A;  1G6A A;  2DCF A;  1SDN A;  3HUO A;  5CTM A;  1FR1 A;  4HEF A;  1PW1 A;  4OP5 A;  1K54 A;  1HZO A;  4KZA A;  4MBH A;  3EQU A;  1TDG A;  4MNR A;  1I2W A;  4PM8 A;  1K56 A;  4K0X A;  1PWC A;  2C5W B;  3GR2 A;  4S2N C;  3V39 A;  1E4D A;  1ERM A;  1JWZ A;  4R3J A;  4GD6 A;  1W8Q A;  3FZC A;  4H8R A;  1ZG6 A;  2Y2O A;  2X01 A;  1MKI A;  1BZA A;  3OCN A;  1HTZ A;  2Y2G A;  3C5A A;  4KZ3 A;  3PTE A;  4N1H A;  4X68 A;  2X02 A;  4XUZ A;  5CHJ A;  1PWD A;  5EUA A;  3UY6 A;  4FSF A;  3N8R A;  1N4O A;  3NDE A;  1XGJ A;  2XR0 A;  5FAO A;  5FSR A;  1S0W A;  5FAP A;  4DKI A;  5AQ7 A;  5E2H A;  3QNC A;  3Q7V B;  1YLT A;  4K0W A;  4DE0 A;  2ZQ9 A;  3ZGA B;  4EBL A;  5F1F A;  1CI9 A;  3GQZ A;  1BSG A;  1IYQ A;  1IYS A;  3UDX A;  3IQA A;  1BT5 A;  5FQK A;  2PBY A;  3PBS A;  1XX2 A;  1FOF A;  4KG2 A;  3CG5 A;  4JXG A;  4Y7P A;  5U47 A;  4KZ4 A;  3GSG A;  2UWX A;  2XDM A;  4R4R A;  5FI6 A;  5CED A;  4F94 A;  1QMF A;  2WGV A;  4OVD A;  3BFC A;  2Y2Q A;  3V3S A;  3W4P A;  2XGN A;  5DTK A;  1BLP A;  3IXD A;  4UAA A;  2V2F F;  4WEK A;  2J7V A;  3PBO A;  4X56 A;  1WYC A;  5CER A;  3O88 A;  5TFQ A;  4C3Q A;  3Q7V A;  5BOH A;  1NYM A;  4UA9 A;  2J9P A;  2Z2M B;  3Q1F A;  1LHY A;  4DE3 A;  1CK3 A;  4LEN A;  4DDY A;  1KDS A;  2WUQ A;  2ZC6 B;  1JWP A;  1ESU A;  4B4Z A;  3IWI A;  4ZBE A;  3E2L A;  1NJ4 A;  1MWR A;  1KE0 A;  4LCM A;  4FH2 A;  1ONG A;  3DTM A;  3TG9 A;  4E3M A;  4S2O A;  1YMS A;  2J9O A;  3IH8 A;  4ZJ1 A;  3MZE A;  2EX2 A;  2E8I A;  1FSW A;  4FH4 A;  4Y0T A;  2H0Y A;  1PI4 A;  3Q81 A;  1ES3 A;  4IBX A;  2JBF A;  3Q82 A;  4KZ8 A;  5DF7 A;  4Z9Q A;  3MZF A;  4RX3 A;  4KZ7 A;  4WMC D;  1ALQ A;  1FCM A;  4OPQ A;  5FI2 A;  2IWB A;  2H0T A;  4JF5 A;  5L2F A;  3ZFZ A;  1MY8 A;  2EXB A;  4KG6 A;  1J9M A;  3IF6 B;  4U3T A;  5DTS A;  4KZ6 A;  1K55 C;  1JVJ A;  1MBL A;  4B88 A;  1KGG A;  3HLG A;  2ZD8 A;  5CEB A;  4OOL A;  1BLH A;  3D4F A;  4WYY A;  4GN2 A;  3UO9 A;  3VSK A;  3IT9 A;  4QY6 A;  3ISG A;  5DF9 A;  3LO7 A;  1ERQ A;  1K56 D;  3LY4 A;  4MLL A;  4OQ0 A;  1GA9 A;  3OC2 A;  1BUL A;  5F1G A;  5FDH A;  3UPN A;  1KE3 A;  2QMI A;  2VGK A;  2Y2N A;  4BD1 A;  1SHV A;  3SS3 A;  3W4Q A;  4ZDX A;  4N1X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...