3P98A

The crystal structure of the extended spectrum beta-lactamase tem-72 reveals inhibition by citrate
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
263
structure length
263
Chain Sequence
HPETLVKVKDAEDKLGARVGYIELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRWEPELNEAIPNDERDTTTPAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGASKRGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the extended-spectrum [beta]-lactamase TEM-72 inhibited by citrate
pubmed doi rcsb
source organism Morganella morganii
molecule tags Hydrolase
molecule keywords Beta-lactamase TEM-72
total genus 99
structure length 263
sequence length 263
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-10-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 3p98A00
3WS4A 1I2SA 5EVIC 3VOYA 4GKUA 5AQAA 4BD0A 4KENB 2Y2IA 1KGEA 3VP1A 3V3SA 3NC8A 4DE0A 5TFQA 3OCNA 1MWUA 1TDGA 4JKTA 4GDBA 1YLTA 1HD8A 4JXSA 3PBRA 3WRTA 3N6IA 1LL5A 4KG2A 4N92A 4NK3A 2WK0A 1CEGA 5CHUA 1ONHA 1GHIA 3A3FA 5HX9A 1N9BA 4QJGA 4KZ7A 5L2FA 1BLSA 2OLVA 2OSUA 4X6TA 1BLPA 2XH9A 1S6RA 4MBKA 4BD1A 1GHPA 1Y54A 1ESIA 1S0WA 1K55A 1W5DA 3O87A 4KZ6A 3GQZA 4ID4A 1DJCA 3ZGAB 4X69A 4GB7A 3IHBA 3M2JA 4BL3A 4GZBA 4R23A 3IF6A 1KVMA 2RCXA 2XLNA 1Z6FA 3DWZA 3P09A 1QMFA 3HREA 4IBXA 3RXXA 3WS2A 4CJNA 5IHVA 3ZNYA 2HDUA 1MWRA 2UWXA 4LENA 3ZVTA 4UA7A 3S22A 5CHMA 4S2NC 3SS4A 3UDFA 3UO9A 1CEFA 2EX9A 2QPNA 2HP6A 3QNCA 1PYYA 2DCFA 2J8YA 2RL3A 4E3LA 5JYOA 4P85A 4XXRA 5CGXA 5HAQA 2ZQ7A 3ZG8B 5EVLA 1U60A 1W79A 1XKZA 1K55C 3SH7A 3UDIA 3C4PA 3M2KA 2A3UA 3IXHA 4JBFA 4C75A 3BECA 2V1ZA 4GDNA 1TDLA 2WUQA 3NBLA 5CXWA 5GHZA 4KZBA 3RJUA 1PW8A 4Q8IA 5F83A 4OQ0A 1ALQA 3D4FA 2V2FF 4S2PA 2ZLYA 4OOYA 2X01A 1YQSA 3HUMA 3Q07A 2H5SA 4OQHA 4MEZA 1GHMA 2JBFA 4OH0A 4S2MA 4LCMA 3Q1FA 3UPOA 1J9MA 2OLUA 2H0YA 1E3UA 5EVIA 5FQ9A 5DTTA 5GLBA 4E3KA 4GNUA 2HPBA 3VFFA 4OPRA 5HARA 3MZEA 3BM6A 3G30A 3GTCA 1HTZA 4EWFA 1KVLA 3BRMA 2Y2HA 4DRTA 1NJ4A 2ZQ9A 1XGIA 2IWBA 4Y0OA 2Y2MA 1K25A 2G2WA 1WYBA 1K4EA 4OQGA 1XA7A 2ZC5B 4XUXA 3C4OA 4KZ8A 4OOMA 4EUZA 1KDWA 5A93A 4MBFA 1JWPA 1BLHA 4IVKA 4ZDXA 3MFDA 5HW3A 2J9PA 1K6RA 3CZDA 2Y2GA 2EXAA 4OQIA 4EBLA 3SH9A 3IF6B 4UA9A 3AGDA 1LHYA 3V3RA 4WMCD 2GDNA 4JXVA 2PBYA 1XX2A 2ZM8A 2Z2LB 4F94A 3BLSA 3HLWA 3NY4A 3LY4A 4JXGA 3UDXA 1YLPA 4GN2A 4OPQA 3IF6C 5CGWA 5DF9A 4JF6A 1O7EA 4IBRA 1MWSA 1PZOA 3TOIA 1NZUA 2HDRA 4WZ5A 4O7DA 1G68A 5CTMA 1W8QA 1RP5A 5DVAA 4B4ZA 3CG5A 4WBGA 4OONA 3NIAA 4X56A 4ZJ1A 3WS0A 4A5RA 3GRJA 3E2KA 5F1GA 1H8YA 4WEJA 2PU4A 4D2OA 1FCNA 3Q81A 1H5XA 5FA7A 3ZFZA 3VP0A 2ZQ8A 2ZQAA 2FFFB 4OVDA 1ZG6A 1L2SA 4DE1A 5FSRA 2ZQCA 3QHYA 3FV7A 1I2WA 1JWVA 4HEFA 1KE3A 3MZDA 2XK1A 2Z2MB 1JTDA 2Q9NA 4R0QA 5E43A 1GA0A 4OLGA 5A91A 1SDNA 1KDSA 2WGVA 5EVIB 2Y91A 2OV5A 2ZM2A 3IXBA 4PM7A 1XP4A 4UAAA 1TEMA 5AQBA 3LEZA 3MKFA 4PM5A 1K54C 1L0FA 1EWZA 3P98A 4X55A 1E4DA 5CECA 5HL1A 3A3DA 3NDGA 4QY5A 2DRWA 3G2YA 4S2LA 3VP2A 4R4RA 3LCEA 5FI2A 4DF6A 1BT5A 1TVFA 2ZD8A 5J8XA 5FI7A 5A92A 1MWTA 3ZDJA 2WYXA 2WAEA 3Q7VA 1DJBA 1YLYA 3SOIA 3LY3A 3FWLA 3PTEA 1FCMA 2H10A 1GA9A 3A3EA 3UE0A 3FKWA 1DJAA 3GSGA 1OMEA 2Q9MA 1MBLA 4BQMA 1SCWA 5F1FA 3W4PA 2XR0A 3FYZA 1KE4A 4P6BA 3B3XA 1K54A 3W4OA 2C5WB 3C7VA 1C3BA 3VFHA 4KZAA 1FSWA 1BUEA 5GLCA 5FI6A 4GD6A 3N7WA 1FOFA 1DY6A 1LI0A 5FAPA 3CJMA 4BLMA 4UA6A 2HDSA 4LV3A 4S2IA 1K38A 2ZMAA 2Y2JA 5E2FA 5HFOA 2XEPA 5FDHA 1ZC2A 3DW0A 5TR7A 1NY0A 3BFGA 3IWOA 3HLDA 3G2ZA 3WRZA 1NYMA 2XF3A 1NXYA 2ZC3B 5CEBA 5FAOA 5JYPA 4Y0UA 2XQZA 3BFDA 3HVFA 5DTSA 5CHJA 3NCKA 3I7JA 3HLCA 1K4FA 3O88A 2WGWB 3BFCA 5EOEA 3PAEA 5KMWA 3HL9A 3Q82A 4K0XA 5CEDA 3UPNA 4JF5A 1XXMA 2WKHA 3SS3A 4N1HA 2V20A 1PWCA 4DDYA 2Y2NA 5FQIA 1IKIA 4N9LA 5AQ9A 1WYCA 3M6BA 2B5RA 1HZOA 1K56A 4X68A 3VP4A 1VM1A 2Y59A 5EECA 5FASA 1ES3A 1FCOA 4S2JA 4E3MA 1CI8A 3HLGA 1SHVA 3WWXA 1PI4A 4HESA 3UPPA 3Q7VB 3G34A 4OP8A 1YLWA 2XDMA 3ZG5A 3ITBA 1PWGA 4JLFA 2BLSA 4E3IA 3OPHA 4L0LA 4YINA 4IVIA 1IYSA 4RX3A 1M6KA 3M6HA 3HBRA 4RX2A 4ZTKA 5KSHA 3HLFA 4QU3A 4ZJ3A 1O07A 2PU2A 2WAFA 3BEBA 5DTKA 4FH2A 4RVAA 4OPZA 1NYYA 1ES5A 2G2UA 3FZCA 3AGFA 4KG6A 4BJPA 4R3BA 1SKFA 3GMWA 4QY6A 5G18A 1FR6A 4IEDA 2H0TA 2R9WA 4WEKA 1ERQA 4RA7A 5HAIA 1BZAA 1KGGA 3UN7A 3VMAA 3VSLA 2XFSA 3OPLA 2WGIA 4QD4A 3OC2A 2JE5A 1I5QA 4KQRA 4FH4A 4KZ3A 2P9VB 4HBTA 4Y0TA 3V5MA 1IYOA 1FQGA 3G35A 3GV9A 4RYEA 1Q2QA 1EI5A 3IXDA 5A90A 3A3IA 5TGFA 2HP9A 1IYQA 4HBUA 4MBHA 3MXSA 3IXGA 4KZ4A 3RXWA 3V50A 1SDEA 3VSKA 4U0TA 4PM6A 2WGWA 4ZBEA 1N4OA 1NRFA 3TG9A 4WYYA 2WKEA 3ZVWA 5BOHA 2X71A 4UHUA 1YM1A 3IH9A 2Y2OA 1M40A 5EOOA 1FSYA 4C6YA 3OPPA 4H8RA 5KSCA 3ISGA 4E6XA 1L0EA 3ZG0A 3BFEA 4DXCA 1HVBA 4FCFA 3ZG9B 4EV4A 2Y2KA 3IF5A 3NDEA 5CGSA 3A3JA 4B4XA 4WZ4A 5U47A 4OOLA 4LCLA 4WZ5C 5EVID 2EX6A 3N8SA 4JF4A 1WE4A 5FQMA 3UY6A 2P74A 4EBNA 1XGJA 2C6WB 3VOZA 1K57C 2IWDA 1BTLA 2ZC6B 4N9KA 2XD5A 3IWIA 1XPBA 2IWCA 4QHCA 2Y2LA 3WS1A 1BLCA 3VP3A 3ITAA 3IHAA 5AQ7A 4R3JA 1BULA 2Y2QA 3OCLA 4WELA 4JXWA 4ZAMA 3IT9A 1JTGA 1LL9A 4K0WA 2WZZA 1PW1A 2JC7A 1GCEA 2XD1A 3EQVA 3OZHA 4YFMA 4DE3A 4BENA 4OKPA 4U3TA 4DKIA 3SS5A 3TSGA 1Q2PA 2EX2A 1AXBA 1YLZA 3E2LA 5FQJA 5M19A 5M18A 4KG5A 3O3VA 2HP5A 1ZG4A 4K91A 3ZHHA 4U0XA 4C3QA 3W4QA 2QMIA 2J9OA 2ZQDA 1MKIA 4R1GA 1MXOA 1EROA 4Y7PA 2P9VA 3PBTA 1MY8A 2HDQA 2EXBA 4XUZA 1RGZA 3ZNTA 3BLMA 2QZ6A 4E3OA 5GL9A 3GR2A 4Z9QA 4MLLA 3JYIA 2EFXA 1K56D 1MPLA 3PBSA 4GOGA 4E3NA 2WKIA 3ZCZA 4MNRA 3EQUA 1ES4A 2ZC7A 1PZPA 4B88A 3IH8A 1QMEA 3N4IA 5M1AA 5KZHA 4NETA 2XFTA 2EFUA 5GLAA 4OPYA 1YT4A 3S1YA 3HUOA 3NI9A 3N8LA 3W8KA 3OPRA 4KQOA 3IQAA 3PBQA 4PM8A 1E25A 3PAGA 4KZ9A 5EUAA 4P0MA 4S2OA 4JPMA 5CRFA 4DE2A 3BYDA 1RCJA 1ONGA 4N1XA 1G6AA 2A49A 3DTMA 3HLEA 3IWQA 3QNBA 4OLDA 5GLDA 4EQIA 3AGEA 3S4XA 2Y4AA 1RGYA 5E2HA 3HUNA 4FD8A 2VGKA 1ES2A 5FQQA 4KQQA 1LI9A 5DF8A 4ZJ2A 4R4SA 1ZKJA 2DNSA 1YMSA 5EE8A 4X53A 3UE1A 3MKEA 4P87A 3GVBA 3BFFA 1KE0A 5CTNA 3LO7A 5FAQA 2WADA 4PPRA 4CPKA 1K57A 4PM9A 3UNWA 2XGNA 4DDSA 1CK3A 4LV2A 2CC1A 1KGFA 4S2NA 5FQKA 4PMAA 2FFYA 4LV0A 5GHYA 3C7UA 1W8YA 4E3JA 2X02A 4LV1A 5CERA 5E2GA 1L0GA 2Y55A 4M3KA 3C5AA 3Q7ZA 2BG1A 5FATA 2ZC4B 1XA1A 2E8IA 2ZJ9A 1NZOA 1BSGA 4E6WA 1YLJA 3ZG7B 1IELA 3PBNA 4EBPA 4KZ5A 5I94A 3MZFA 5EPHA 2I72A 2WZXA 4WMCA 1IKGA 2VGJA 4WM9A 1ESUA 2Y2PA 3G32A 1JVJA 3N8RA 1H8ZA 4OP5A 4GD8A 2ZM0A 3O86A 1L0DA 4FSFA 4BL2A 1PWDA 3SH8A 3V39A 3WS5A 3FKVA 3PBOA 1IEMA 1IYPA 1K6SA 2J7VA 3G4PA 5D3OA 5HAPA 3G31A 1ERMA 1JWZA 5F82A 1W7FA 4DXBA 5DF7A 1E3UD 1PIOA 1VQQA 4S2KA 1CI9A 1PI5A 1YMXA 2EX8A 2JCHA 1FR1A 3UE3A 3DWKA 3HLBA 1LLBA 5E2EA 2R9XA 3CMZA 5GHXA 3MXRA 4QB8A 3MBZA
chains in the Genus database with same CATH superfamily
4GHIB 1I2SA 4GKUA 4JGQA 4KENB 3VP1A 3NC8A 1S66L 2L1MA 3LYXA 1TDGA 4JGOA 1YLTA 3BY8A 3F1PB 3MS6A 4N92A 2O9AA 2KDKA 2WK0A 2VV6A 4CLCB 4H6JB 1Y54A 4L9EA 3O87A 4ID4A 1DJCA 3ZGAB 3M2JA 3ZQ5A 3IF6A 1H0MA 2RCXA 3WS2A 1OTEA 5IHVA 1MWRA 2OOLA 4S2NC 4EEPA 3KSHA 3S7OA 3MMHA 5CGXA 3ZG8B 5L10A 1W79A 3C4PA 2VEAA 3IXHA 4C75A 2WUQA 5CXWA 2PR5A 2D01A 5F83A 2MJ6A 1ALQA 3EWKA 4HP4A 4OQHA 4LLOB 4MEZA 5EM1A 1NLZA 4E04A 4MN6A 3F1PA 2HPBA 4OPRA 3MZEA 3GTCA 5G4YA 2Y2HA 4DRTA 2JKRM 1K25A 2G2WA 2Y2MA 4CLCA 4EUZA 4KZ8A 4MBFA 1BLHA 5HW3A 2J9PA 3R4KA 4OQIA 3SH9A 2PBYA 2ZM8A 1L3LA 5HDDA 2FZ0A 5F69A 4GN2A 4OPQA 4CLCE 1NZUA 2HDRA 1G68A 1G5UA 4B4ZA 3CG5A 4ZJ1A 3WS0A 2JHEA 4WEJA 2M7UA 3V67A 1XJ6A 4I3JA 1L2SA 3U2AA 4NXBA 3FV7A 1KE3A 2GZAA 3MZDA 2V8FA 2Q9NA 3PYPA 5A91A 4RQ9A 2Y91A 2ZM2A 4UAAA 5AQBA 1XP4A 5IS1A 3D72A 3LEZA 4KUOA 4X55A 3BY9A 4S2LA 3PHYA 3LCEA 3EEHA 3EEAA 2WAEA 3MR0A 1DJBA 3SOIA 3A3EA 2H10A 5F1FA 3FYZA 1STZA 1VETB 3A0VA 4P6BA 1K54A 2C5WB 3S7QA 4KQDA 1BUEA 5FI6A 2JKRI 3N7WA 1CF0A 1MKMA 4LPZA 2V9AA 4ZRRA 4HY8A 4LV3A 2O0YA 5HFOA 3DW0A 3WRZA 3G2ZA 2V0WA 2R78A 4Y0UA 2XQZA 3BFDA 5CHJA 3CWFA 5HL6A 2WGWB 5EOEA 3PAEA 5KMWA 3L7HA 5CEDA 2JKGA 3UPNA 4ARZB 5AQ9A 1VB6A 3PXPA 3H82B 1K56A 2OWJA 1VM1A 3TJZC 2NUTC 3Q7VB 3DAVA 1YLWA 2PDRA 5HSQA 2A24A 4L0LA 1GSWA 2O99A 3M6HA 4RX2A 1ZHHB 3HLFA 4Y2FA 1O07A 4ZJ3A 4LFUA 2QJ5A 5DTKA 4RVAA 3H7WB 3AGFA 4KG6A 4BJPA 4R3BA 1DP6A 3DBAA 3JVUA 3P7NA 4IEDA 2YKHA 2W1RA 4EQ1A 4RA7A 3OPLA 2WGIA 2JE5A 4KQRA 1VEUA 1FQGA 3IXDA 4DJ2A 3RXWA 3VSKA 4U0TA 4PM6A 4ZBEA 2LB5A 1NRFA 4WF0A 4UHUA 3IH9A 4AFIA 1OT6A 3CUEA 4Y3IA 3BFEA 4DXCA 1HVBA 2Y2KA 3A3JA 4OOLA 3NECA 5FEFA 2EX6A 3N8SA 3UY6A 2IWDA 1BTLA 4Y5FA 3IWIA 2Y2LA 3VP3A 1P97A 4R3JA 3OCLA 4MMNA 3IT9A 3C2WA 4K0WA 1PW1A 2JC7A 3EQVA 5HPIA 4BENA 4P6ZM 4U3TA 4I39A 1YLZA 5FQJA 1CQAA 4K91A 2ZOIA 4C3QA 2QMIA 4QWOA 2ZQDA 4R1GA 4I3AA 1MZUA 5GL9A 2ZL1B 1XFNA 2HGVA 1UWPX 3JYIA 1K56D 4E3NA 4B88A 1DP9A 3IH8A 3QP4A 5M1AA 3O5YA 3D9YA 1J3WA 4MDZA 4G3KA 4LRYC 4R3AA 4PM8A 4L9GA 2WKQA 2A49A 3DTMA 3HLEA 3IWQA 4EQIA 3DTEA 4D60A 3B33A 1RGYA 3HUNA 1ES2A 3HJKA 1ZKJA 3GVBA 4XT2B 5CTNA 3LO7A 2WADA 4R38A 3JVVA 5FQKA 4LV0A 5GHYA 3CLOA 2HJ9C 3KSIA 2J80A 2ZC4B 2ZJ9A 1NZOA 3CAXA 5I94A 4KZ5A 2ZL1A 5EPHA 4X1MA 2WZXA 4WMCA 1IKGA 1ESUA 5HZHA 1BYWA 3N8RA 2H28A 1EW0A 5CX7A 4FSFA 1PWDA 4ME4A 2J7VA 1VQQA 4S2KA 1CI9A 3TE8A 3HLBA 3MJQA 5GHXA 3MBZA 3WS4A 2GJ3A 5EVIC 4QPRA 4HJ3A 3VOYA 4BD0A 4GJ4A 1KGEA 4P6ZS 1LSXA 2KX6A 5TFQA 3OCNA 4JKTA 4GDBA 3MQQA 3PBRA 3N6IA 4PAUA 1LL5A 4KG2A 4XT2A 4NK3A 1ONHA 4LRZE 3VE4A 1OJ5A 1N9BA 4KZ7A 2W3EA 2OSUA 1S0WA 1W5DA 1JNUA 4X69A 2XRNA 3IBJA 4GZBA 3UE6A 1KVMA 3RXXA 5MC7A 5J3WA 3ZNYA 3HJIA 2VV7A 4PKYG 5CHMA 5HDSA 4B9OA 1CEFA 4JGRA 2HP6A 1YKDA 2DCFA 2J8YA 2RL3A 4E3LA 5JYOA 4XXRA 1U60A 1XKZA 1K55C 3LR5A 4I3IA 4JGPA 2V1ZA 5HWWA 1AWIA 3NBLA 3RJUA 4KZBA 4WUJA 1SZVA 1OTIA 2W3GA 4Q8IA 3IX8A 4S2PA 2H5SA 2V1BA 3Q1FA 2OLUA 5EVIA 5DTTA 4EWFA 3BRMA 1NJ4A 3CI6A 4UQIM 4Y0OA 1XA7A 4XUXA 2J3WA 4FOFA 4OOMA 1KDWA 3T50A 1JWPA 4IVKA 3ZYTA 3AGDA 2XSSA 1OPXA 4F94A 3HLWA 1K0KA 3LY4A 3NY4A 1YLPA 3IF6C 1O7EA 1MWSA 1PZOA 1F2KA 4WZ5A 3UB5P 4O7DA 5DVAA 4X56A 4WBGA 2Z6DA 4MCWA 3VV4A 4A5RA 3GRJA 1H8YA 2PAVP 4UQIS 1FCNA 3Q81A 1H5XA 3ZFZA 2ZQ8A 2ZMFA 1ZG6A 4LRXC 3SZTA 3UB8A 2ZQCA 1XJ2A 3IBRA 3C8CA 3UMDA 3KX0X 1GA0A 2Y8HA 1TS6A 1KDSA 5EVIB 2V1AA 2OV5A 4PM7A 3MKFA 1L0FA 1EWZA 5CECA 1E4DA 5HL1A 3BQ8A 1UWNX 5FI2A 1LSVA 1TVFA 4KUKA 1YLYA 3PTEA 2JKTI 4HP9A 3W4PA 2XR0A 1YPRA 3HCYA 1Y28A 2W1TA 1C3BA 5FEGA 4KZAA 1FSWA 3IX3A 5GLCA 3PR6A 5EVEA 4EEUA 1FOFA 1LI0A 5FAPA 1K38A 3MFXA 3EGXC 2Y2JA 3BW6A 3LUQA 3K2NA 3IWOA 3HLDA 2QKPA 1NXYA 2ZC3B 5CEBA 5FAOA 3K3DA 3TW8A 4DMZA 1K4FA 2W3FA 4IUKA 2XROA 1GSXA 2LB9A 5HDCA 1XXMA 2WKHA 3SS3A 1WA9A 4N1HA 5FQIA 3A0SA 1IKIA 3M6BA 2B5RA 1HZOA 3VP4A 2IA2A 2EWVA 5EECA 4NG2A 4S2JA 2VGLS 4Y15A 3UPPA 3G34A 4OP8A 4FUWA 3ZG5A 1PWGA 2FH5A 3OPHA 4YINA 1IYSA 4RX3A 1N9LA 1D1JA 1PNEA 2QHKA 2PU2A 4FH2A 2G2UA 1TS7A 1SKFA 1Z09A 4QY6A 4HJ4A 2O9BA 4YWZA 5G18A 2J3TC 3T1RA 4WEKA 1ERQA 2AVXA 3UN7A 3VMAA 3VSLA 2XFSA 4QD4A 4DN0A 3LIAA 3MQ0A 4FH4A 4Y0TA 5AJGA 3G35A 1EI5A 4YOFA 5A90A 2PD7A 5TGFA 2HP9A 1IYQA 4HBUA 4MBHA 4KZ4A 2W3DA 2ACGA 5BOHA 1YM1A 1N9OA 1W63Q 5KSCA 3ISGA 4PHTA 3ZG0A 3QP2A 4F3LB 5U47A 5EVID 4EBNA 1XGJA 2C6WB 4IUHA 1OJGA 1X0OA 4N9KA 1YSQA 1OTAA 2XD5A 4HNBA 2IWCA 4QHCA 4EXOA 4HOIA 3T4QA 3OZHA 3SS5A 1AXBA 5M19A 4KG5A 2HP5A 1ZG4A 4X1LA 3F1NB 2J9OA 3T4JA 4Y7PA 2P9VA 2QYBA 3PBTA 1W63M 2OWHA 1NRJA 4XUZA 4Y17A 2QZ6A 1D06A 4NXGA 1MPLA 3LIEA 5HD3A 1ES4A 2ZC7A 1PZPA 4CLCC 2QWSA 3N4IA 4EW7A 2EFUA 3EGDC 4F3LA 3S1YA 3IQAA 3PAGA 4KZ9A 5EUAA 4JPMA 4DE2A 3BYDA 4OLDA 3S4XA 3B42A 5E2HA 5DF8A 4ZJ2A 4R4SA 4X53A 3MKEA 4WN5A 1KE0A 3LR0A 5EM0A 5FAQA 3LFVA 1K57A 4PM9A 1CK3A 4PMAA 2FFYA 5E2GA 4L9FA 4M3KA 1YLJA 3ZG7B 4EBPA 3PBNA 3MZFA 2KLIA 2I72A 1JVJA 4OP5A 2ZM0A 2EA9A 5TBMA 2NUPC 4LGWA 3SH8A 3V39A 3PBOA 3T1XA 1IYPA 1K6SA 1ERMA 1W7FA 1E3UD 1YMXA 2A2LA 3T4KA 3OLOA 1NWZA 1MWUA 1HD8A 1T1BA 1CEGA 3A3FA 2VGLM 5L2FA 2OLVA 4X6TA 4BD1A 1GHPA 1ESIA 3CITA 4GLQA 1TS0A 3IHBA 4R23A 3P09A 3DWZA 1QMFA 2K31A 3LEQA 1FILA 1OT9A 4LENA 4UA7A 4Q0IA 5F5YA 3LI9A 3UDFA 3UO9A 3F1OA 5TBMB 3QNCA 5HAQA 4HH2A 3SH7A 3M2KA 3T4SA 4JBFA 5TJJA 3MSHA 4GDNA 1TDLA 3NOUC 2B95A 4OQ0A 3D4FA 2ZLYA 4OOYA 2X01A 3HUMA 3Q07A 1GHMA 2JBFA 1IFQA 2V0UA 1T1CA 1V9YA 2H0YA 2OAQ1 4E3KA 4GNUA 2HJEA 3VFFA 4BWIA 3G30A 3LIDA 1WYBA 4OQGA 2ZC5B 4GS9A 2HV1A 3SW1A 3KSGA 4BBTA 3CZDA 4Q0HA 2BTFP 3IF6B 4UA9A 3V3RA 3KSFA 5DJTA 2GDNA 3D3OA 4JXVA 1XX2A 3E4QA 2Z2LB 3BLSA 4NXFA 3E0YA 4I5SA 3UDXA 4NKPA 5CGWA 4JF6A 2W27A 3F1OB 3TOIA 2PR6A 4O8GA 5F1GA 5FL3A 3VP0A 2ZQAA 2FFFB 3NHQA 3QHYA 1I2WA 1JWVA 5A8BA 4R0QA 5E43A 3BJNA 1SDNA 1TEMA 1K54C 4HHDA 4ARZA 5F68A 3UB7A 4QY5A 2W0NA 3G2YA 3VP2A 4R4RA 3T4OA 4GS9B 2XA7S 4DF6A 1BT5A 3G6OA 5FI7A 2WYXA 3Q7VA 2B18A 3NOPC 3LY3A 2A24B 3UE0A 3GSGA 2Q9MA 1SCWA 3KYZA 4ETXA 3T4TA 3W4OA 2JKTM 3VFHA 3CHWP 4Z1WA 1DY6A 4UA6A 2HDSA 4S2IA 2ZMAA 1ZTUA 5FDHA 1LSWA 1ZC2A 2B02A 1NY0A 2VV8A 1VEUB 5JYPA 5DTSA 3HVFA 1H8MA 3TRCA 3FG8A 3NCKA 3O88A 4HH3A 3BFCA 2OAP1 3Q82A 4K0XA 4EERA 4JF5A 3QP1A 1DP8A 1PWCA 2QJ7A 4DDYA 4Y13A 2Y2NA 4N9LA 1WYCA 1IOUA 2VKSA 2Y59A 5FASA 1FCOA 2PBDP 1PI4A 2XDMA 4JLFA 2BLSA 4E3IA 1T18A 4IVIA 1XJ3A 1M6KA 3HBRA 4ZTKA 5KSHA 2PRFA 5FDSA 1VETA 2WAFA 5DFXA 1CJFA 1ODVA 4OPZA 1NYYA 1ES5A 3KO6A 2H0TA 2O9CA 1T19A 1KGGA 1S1YA 2HZ5A 4HBTA 1IYOA 4RYEA 4NEED 2K2NA 4X25A 3IXGA 1SDEA 2Z6CA 2WGWA 3T4LA 2WKEA 2XA7M 2ZBBA 1FSYA 5IU1A 1H3QA 4CLCD 1N9NA 3NDEA 5CGSA 1FIKA 1UGUA 2HF6A 3H82A 4EETB 4FTXA 1PRQA 5HPFA 3VOZA 4BBVA 1K57C 2ZC6B 2Q0OA 1TF1A 1XPBA 1BLCA 5K5BA 3ITAA 3IHAA 5AQ7A 3LR4A 4WELA 3QP6A 4ZAMA 1JTGA 1LL9A 3H7WA 1GCEA 4DKIA 3KYEA 1Q2PA 2EX2A 3E2LA 3CPTB 5M18A 4PKYA 3ZHHA 3W4QA 2GNXA 1MXOA 1MY8A 4HIAA 4Z9QA 4MLLA 2WKRA 3PBSA 4GOGA 4O01A 3ZCZA 4MNRA 3EQUA 2G7UA 1QMEA 5KZHA 2XFTA 4OPYA 1YT4A 4HQAA 4KQOA 2PD8A 4S2OA 5CRFA 1RCJA 1ONGA 4N1XA 1G28A 3QNBA 5GLDA 1T1AA 3AGEA 2Y4AA 5L8MA 2VGKA 3IX4A 5HWVA 2GX5A 1F98A 2DNSA 5EE8A 1YMSA 3UE1A 2E8JA 3S7NA 4P87A 4CQHA 1TD5A 3CPTA 2YKFA 2CC1A 3MQOA 5HD5A 3BQAA 3C7UA 4E3JA 2J3TD 2X02A 4LV1A 1YAXA 2Y55A 4DJ3A 3Q7ZA 2BG1A 1XA1A 5L09A 4E6WA 1BSGA 4O0PA 1IELA 2JN7A 2Y2PA 4R6LA 1VHMA 3E4OA 3O86A 3R7WA 3WS5A 3RFBA 4ETZA 3G4PA 5D3OA 5HAPA 2BASA 5F82A 4DXBA 5DF7A 1PIOA 1V9ZA 2EX8A 2JCHA 1FR1A 1LLBA 3CMZA 3MXRA 3UB9A 1LL8A 4MN7A 5AQAA 2Y2IA 3V3SA 4DE0A 1P9WA 2PHYA 4R70A 1XJ4A 3FPVA 3IS2B 4JXSA 3WRTA 5AVFA 5CHUA 1GHIA 1ACFA 5HX9A 4QJGA 1BLSA 1BLPA 2XH9A 1S6RA 4MBKA 4B93A 1K55A 4KZ6A 3GQZA 2P7JA 4GB7A 1F9IA 4BL3A 2L0WA 4IBXA 2XLNA 1Z6FA 4CJNA 3HREA 1OTDA 2HDUA 2UWXA 3ZVTA 3S22A 3SS4A 3UB6A 4Q0JA 2VX8A 2EX9A 2QPNA 1S4SA 2I9VA 3R7WB 1PYYA 2CMNA 4P85A 2ZQ7A 5EVLA 1HLUP 1XFQA 3UDIA 4BBUA 2VA0A 2A3UA 3BECA 4EUVA 2VJWA 5GHZA 5L07A 3LI8A 1PW8A 2D02A 4ESPA 1F5MA 4WLAA 3T1QB 2V2FF 2ZMVA 3LGOA 1YQSA 5G4ZA 4OH0A 4S2MA 4LCMA 3UPOA 1J9MA 1E3UA 5FQ9A 5GLBA 3IS2A 4UEYA 5HARA 3BM6A 4WL9A 1HTZA 1KVLA 1XGIA 2ZQ9A 3GDIA 2IWBA 1K4EA 3C4OA 5IT5A 5A93A 4ZDXA 3H9WA 3MFDA 3NOTC 1K6RA 2Y2GA 2EXAA 4EBLA 1LHYA 1Y4OA 4WMCD 4NXEA 3RTYA 4JXGA 3BWLA 3KYQA 5DF9A 4IBRA 1YSPA 4M4XA 3VOLA 5CTMA 1W8QA 1RP5A 2V8CA 2P04A 4OONA 3NIAA 3E2KA 4MN5A 4YNRA 2PU4A 4D2OA 3GECA 5FA7A 4OVDA 3L9KA 4DE1A 5FSRA 3LIFA 3ULFA 3C30A 4HEFA 3QP8A 2VLGA 2XK1A 2Z2MB 3EOIA 1JTDA 3NULA 4OLGA 3OBFA 4GW9A 4EU0A 2WGVA 1PFLA 3CUEC 3IXBA 3A0RA 4PM5A 3P98A 5C5KA 3A3DA 3NDGA 2DRWA 2ZD8A 5J8XA 5A92A 1MWTA 2M7VA 3ZDJA 5EV0A 2VK3A 3E98A 3FWLA 2P08A 1FCMA 1GA9A 3FKWA 1DJAA 1S4RA 3LR3A 1OMEA 4BQMA 1MBLA 4HI4A 1LT0A 1KE4A 3B3XA 3C7VA 5KIZA 4GD6A 3LICA 3DTIA 2EWWA 2ZOHA 2UV0E 3CJMA 4BLMA 2WKPA 5E2FA 2XEPA 5TR7A 3BFGA 3OOVA 1NYMA 2XF3A 2JKFA 5DKLA 2KOIA 3I7JA 3HLCA 3HL9A 3T1SA 2V20A 5DFYA 5J7EA 3FC7A 4BMWA 4X68A 3UMEA 1ES3A 4E3MA 1CI8A 3HLGA 5LBRA 1SHVA 3WWXA 3JPUA 4HESA 5DJUA 3VE3A 3ITBA 4QU3A 2Y79A 3BEBA 1KOUA 1OTBA 2W1TB 3FZCA 3GMWA 3QP5A 1FR6A 2R9WA 5F6AA 3P01A 4I38A 1SKOA 5HAIA 2PYPA 1BZAA 4GCZA 1TS8A 3OC2A 1I5QA 2M1CA 4G3VA 4KZ3A 1G6OA 2P9VB 4G3WA 3V5MA 3GV9A 1Q2QA 3A3IA 3MXSA 3V50A 4HJ6A 1N4OA 3TG9A 4WYYA 3ZVWA 2X71A 4C6YA 2Y2OA 5EOOA 1M40A 3OPPA 4H8RA 4E6XA 1L0EA 4FCFA 3ZG9B 4EV4A 3IF5A 4B4XA 4WZ4A 4LCLA 4WZ5C 4JF4A 1WE4A 5FQMA 2P74A 1P9RA 3FPWA 3WS1A 1BULA 2Y2QA 3C38A 4JXWA 1A0KA 4DE3A 2WZZA 2XD1A 4YFMA 5DKKA 4OKPA 3TSGA 3LIBA 1SKOB 3O3VA 4U0XA 4K08A 1MKIA 3E4PA 1EROA 2HDQA 2EXBA 1RGZA 3ZNTA 3BLMA 4E3OA 3GR2A 4IHQA 2EFXA 2WKIA 1S67L 2VZWA 5AVEA 1GSVA 4NETA 5GLAA 2K7SA 2INWA 5I5LA 3HUOA 3NI9A 3N8LA 3W8KA 1NLYA 3RH8B 3OPRA 3PBQA 3MF0A 2L4RA 1E25A 4P0MA 3T12B 3DTKA 4GHIA 2W3HA 1G6AA 4FD8A 4EESA 5FQQA 4KQQA 1LI9A 3ICYA 3BFFA 2DMWA 1S1ZA 4PPRA 4CPKA 3NJAA 3S7PA 3UNWA 4DDSA 2XGNA 3F1NA 2PT7A 4LV2A 4H6JA 4S2NA 1KGFA 5J4EA 4IJGA 5HWTA 1W8YA 5CERA 1L0GA 3MXQA 3C5AA 3W2ZA 5FATA 5EFWA 2E8IA 3K3CA 3B47A 2VGJA 1D7EA 4WM9A 1P0ZA 3G32A 3U4LP 1H8ZA 4GD8A 1L0DA 4BL2A 1DRMA 3FKVA 1IEMA 3G31A 1JWZA 1PI5A 1MC0A 3UE3A 4II7A 3DWKA 5E2EA 2R9XA 2PYRA 4QB8A
chains in the Genus database with same CATH topology
3WS4A 1I2SA 5EVIC 3VOYA 4GKUA 5AQAA 4BD0A 4KENB 2Y2IA 1KGEA 3VP1A 3V3SA 3NC8A 4DE0A 5TFQA 3OCNA 1MWUA 1TDGA 4JKTA 4GDBA 1YLTA 1HD8A 4JXSA 3PBRA 3WRTA 3N6IA 1LL5A 4KG2A 4N92A 4NK3A 2WK0A 1CEGA 5CHUA 1ONHA 1GHIA 3A3FA 5HX9A 1N9BA 4QJGA 4KZ7A 5L2FA 1BLSA 2OLVA 2OSUA 4X6TA 1BLPA 2XH9A 1S6RA 4MBKA 4BD1A 1GHPA 1Y54A 1ESIA 1S0WA 1K55A 1W5DA 3O87A 4KZ6A 3GQZA 4ID4A 1DJCA 3ZGAB 4X69A 4GB7A 3IHBA 3M2JA 4BL3A 4GZBA 4R23A 3IF6A 1KVMA 2RCXA 2XLNA 1Z6FA 3DWZA 3P09A 1QMFA 3HREA 4IBXA 3RXXA 3WS2A 4CJNA 5IHVA 3ZNYA 2HDUA 1MWRA 2UWXA 4LENA 3ZVTA 4UA7A 3S22A 5CHMA 4S2NC 3SS4A 3UDFA 3UO9A 1CEFA 2EX9A 2QPNA 2HP6A 3QNCA 1PYYA 2DCFA 2J8YA 2RL3A 4E3LA 5JYOA 4P85A 4XXRA 5CGXA 5HAQA 2ZQ7A 3ZG8B 5EVLA 1U60A 1W79A 1XKZA 1K55C 3SH7A 3UDIA 3C4PA 3M2KA 2A3UA 3IXHA 4JBFA 4C75A 3BECA 2V1ZA 4GDNA 1TDLA 2WUQA 3NBLA 5CXWA 5GHZA 4KZBA 3RJUA 1PW8A 4Q8IA 5F83A 4OQ0A 1ALQA 3D4FA 2V2FF 4S2PA 2ZLYA 4OOYA 2X01A 1YQSA 3HUMA 3Q07A 2H5SA 4OQHA 4MEZA 1GHMA 2JBFA 4OH0A 4S2MA 4LCMA 3Q1FA 3UPOA 1J9MA 2OLUA 2H0YA 1E3UA 5EVIA 5FQ9A 5DTTA 5GLBA 4E3KA 4GNUA 2HPBA 3VFFA 4OPRA 5HARA 3MZEA 3BM6A 3G30A 3GTCA 1HTZA 4EWFA 1KVLA 3BRMA 2Y2HA 4DRTA 1NJ4A 2ZQ9A 1XGIA 2IWBA 4Y0OA 2Y2MA 1K25A 2G2WA 1WYBA 1K4EA 4OQGA 1XA7A 2ZC5B 4XUXA 3C4OA 4KZ8A 4OOMA 4EUZA 1KDWA 5A93A 4MBFA 1JWPA 1BLHA 4IVKA 4ZDXA 3MFDA 5HW3A 2J9PA 1K6RA 3CZDA 2Y2GA 2EXAA 4OQIA 4EBLA 3SH9A 3IF6B 4UA9A 3AGDA 1LHYA 3V3RA 4WMCD 2GDNA 4JXVA 2PBYA 1XX2A 2ZM8A 2Z2LB 4F94A 3BLSA 3HLWA 3NY4A 3LY4A 4JXGA 3UDXA 1YLPA 4GN2A 4OPQA 3IF6C 5CGWA 5DF9A 4JF6A 1O7EA 4IBRA 1MWSA 1PZOA 3TOIA 1NZUA 2HDRA 4WZ5A 4O7DA 1G68A 5CTMA 1W8QA 1RP5A 5DVAA 4B4ZA 3CG5A 4WBGA 4OONA 3NIAA 4X56A 4ZJ1A 3WS0A 4A5RA 3GRJA 3E2KA 5F1GA 1H8YA 4WEJA 2PU4A 4D2OA 1FCNA 3Q81A 1H5XA 5FA7A 3ZFZA 3VP0A 2ZQ8A 2ZQAA 2FFFB 4OVDA 1ZG6A 1L2SA 4DE1A 5FSRA 2ZQCA 3QHYA 3FV7A 1I2WA 1JWVA 4HEFA 1KE3A 3MZDA 2XK1A 2Z2MB 1JTDA 2Q9NA 4R0QA 5E43A 1GA0A 4OLGA 5A91A 1SDNA 1KDSA 2WGVA 5EVIB 2Y91A 2OV5A 2ZM2A 3IXBA 4PM7A 1XP4A 4UAAA 1TEMA 5AQBA 3LEZA 3MKFA 4PM5A 1K54C 1L0FA 1EWZA 3P98A 4X55A 1E4DA 5CECA 5HL1A 3A3DA 3NDGA 4QY5A 2DRWA 3G2YA 4S2LA 3VP2A 4R4RA 3LCEA 5FI2A 4DF6A 1BT5A 1TVFA 2ZD8A 5J8XA 5FI7A 5A92A 1MWTA 3ZDJA 2WYXA 2WAEA 3Q7VA 1DJBA 1YLYA 3SOIA 3LY3A 3FWLA 3PTEA 1FCMA 2H10A 1GA9A 3A3EA 3UE0A 3FKWA 1DJAA 3GSGA 1OMEA 2Q9MA 1MBLA 4BQMA 1SCWA 5F1FA 3W4PA 2XR0A 3FYZA 1KE4A 4P6BA 3B3XA 1K54A 3W4OA 2C5WB 3C7VA 1C3BA 3VFHA 4KZAA 1FSWA 1BUEA 5GLCA 5FI6A 4GD6A 3N7WA 1FOFA 1DY6A 1LI0A 5FAPA 3CJMA 4BLMA 4UA6A 2HDSA 4LV3A 4S2IA 1K38A 2ZMAA 2Y2JA 5E2FA 5HFOA 2XEPA 5FDHA 1ZC2A 3DW0A 5TR7A 1NY0A 3BFGA 3IWOA 3HLDA 3G2ZA 3WRZA 1NYMA 2XF3A 1NXYA 2ZC3B 5CEBA 5FAOA 5JYPA 4Y0UA 2XQZA 3BFDA 3HVFA 5DTSA 5CHJA 3NCKA 3I7JA 3HLCA 1K4FA 3O88A 2WGWB 3BFCA 5EOEA 3PAEA 5KMWA 3HL9A 3Q82A 4K0XA 5CEDA 3UPNA 4JF5A 1XXMA 2WKHA 3SS3A 4N1HA 2V20A 1PWCA 4DDYA 2Y2NA 5FQIA 1IKIA 4N9LA 5AQ9A 1WYCA 3M6BA 2B5RA 1HZOA 1K56A 4X68A 3VP4A 1VM1A 2Y59A 5EECA 5FASA 1ES3A 1FCOA 4S2JA 4E3MA 1CI8A 3HLGA 1SHVA 3WWXA 1PI4A 4HESA 3UPPA 3Q7VB 3G34A 4OP8A 1YLWA 2XDMA 3ZG5A 3ITBA 1PWGA 4JLFA 2BLSA 4E3IA 3OPHA 4L0LA 4YINA 4IVIA 1IYSA 4RX3A 1M6KA 3M6HA 3HBRA 4RX2A 4ZTKA 5KSHA 3HLFA 4QU3A 4ZJ3A 1O07A 2PU2A 2WAFA 3BEBA 5DTKA 4FH2A 4RVAA 4OPZA 1NYYA 1ES5A 2G2UA 3FZCA 3AGFA 4KG6A 4BJPA 4R3BA 1SKFA 3GMWA 4QY6A 5G18A 1FR6A 4IEDA 2H0TA 2R9WA 4WEKA 1ERQA 4RA7A 5HAIA 1BZAA 1KGGA 3UN7A 3VMAA 3VSLA 2XFSA 3OPLA 2WGIA 4QD4A 3OC2A 2JE5A 1I5QA 4KQRA 4FH4A 4KZ3A 2P9VB 4HBTA 4Y0TA 3V5MA 1IYOA 1FQGA 3G35A 3GV9A 4RYEA 1Q2QA 1EI5A 3IXDA 5A90A 3A3IA 5TGFA 2HP9A 1IYQA 4HBUA 4MBHA 3MXSA 3IXGA 4KZ4A 3RXWA 3V50A 1SDEA 3VSKA 4U0TA 4PM6A 2WGWA 4ZBEA 1N4OA 1NRFA 3TG9A 4WYYA 2WKEA 3ZVWA 5BOHA 2X71A 4UHUA 1YM1A 3IH9A 2Y2OA 1M40A 5EOOA 1FSYA 4C6YA 3OPPA 4H8RA 5KSCA 3ISGA 4E6XA 1L0EA 3ZG0A 3BFEA 4DXCA 1HVBA 4FCFA 3ZG9B 4EV4A 2Y2KA 3IF5A 3NDEA 5CGSA 3A3JA 4B4XA 4WZ4A 5U47A 4OOLA 4LCLA 4WZ5C 5EVID 2EX6A 3N8SA 4JF4A 1WE4A 5FQMA 3UY6A 2P74A 4EBNA 1XGJA 2C6WB 3VOZA 1K57C 2IWDA 1BTLA 2ZC6B 4N9KA 2XD5A 3IWIA 1XPBA 2IWCA 4QHCA 2Y2LA 3WS1A 1BLCA 3VP3A 3ITAA 3IHAA 5AQ7A 4R3JA 1BULA 2Y2QA 3OCLA 4WELA 4JXWA 4ZAMA 3IT9A 1JTGA 1LL9A 4K0WA 2WZZA 1PW1A 2JC7A 1GCEA 2XD1A 3EQVA 3OZHA 4YFMA 4DE3A 4BENA 4OKPA 4U3TA 4DKIA 3SS5A 3TSGA 1Q2PA 2EX2A 1AXBA 1YLZA 3E2LA 5FQJA 5M19A 5M18A 4KG5A 3O3VA 2HP5A 1ZG4A 4K91A 3ZHHA 4U0XA 4C3QA 3W4QA 2QMIA 2J9OA 2ZQDA 1MKIA 4R1GA 1MXOA 1EROA 4Y7PA 2P9VA 3PBTA 1MY8A 2HDQA 2EXBA 4XUZA 1RGZA 3ZNTA 3BLMA 2QZ6A 4E3OA 5GL9A 3GR2A 4Z9QA 4MLLA 3JYIA 2EFXA 1K56D 1MPLA 3PBSA 4GOGA 4E3NA 2WKIA 3ZCZA 4MNRA 3EQUA 1ES4A 2ZC7A 1PZPA 4B88A 3IH8A 1QMEA 3N4IA 5M1AA 5KZHA 4NETA 2XFTA 2EFUA 5GLAA 4OPYA 1YT4A 3S1YA 3HUOA 3NI9A 3N8LA 3W8KA 3OPRA 4KQOA 3IQAA 3PBQA 4PM8A 1E25A 3PAGA 4KZ9A 5EUAA 4P0MA 4S2OA 4JPMA 5CRFA 4DE2A 3BYDA 1RCJA 1ONGA 4N1XA 1G6AA 2A49A 3DTMA 3HLEA 3IWQA 3QNBA 4OLDA 5GLDA 4EQIA 3AGEA 3S4XA 2Y4AA 1RGYA 5E2HA 3HUNA 4FD8A 2VGKA 1ES2A 5FQQA 4KQQA 1LI9A 5DF8A 4ZJ2A 4R4SA 1ZKJA 2DNSA 1YMSA 5EE8A 4X53A 3UE1A 3MKEA 4P87A 3GVBA 3BFFA 1KE0A 5CTNA 3LO7A 5FAQA 2WADA 4PPRA 4CPKA 1K57A 4PM9A 3UNWA 2XGNA 4DDSA 1CK3A 4LV2A 2CC1A 1KGFA 4S2NA 5FQKA 4PMAA 2FFYA 4LV0A 5GHYA 3C7UA 1W8YA 4E3JA 2X02A 4LV1A 5CERA 5E2GA 1L0GA 2Y55A 4M3KA 3C5AA 3Q7ZA 2BG1A 5FATA 2ZC4B 1XA1A 2E8IA 2ZJ9A 1NZOA 1BSGA 4E6WA 1YLJA 3ZG7B 1IELA 3PBNA 4EBPA 4KZ5A 5I94A 3MZFA 5EPHA 2I72A 2WZXA 4WMCA 1IKGA 2VGJA 4WM9A 1ESUA 2Y2PA 3G32A 1JVJA 3N8RA 1H8ZA 4OP5A 4GD8A 2ZM0A 3O86A 1L0DA 4FSFA 4BL2A 1PWDA 3SH8A 3V39A 3WS5A 3FKVA 3PBOA 1IEMA 1IYPA 1K6SA 2J7VA 3G4PA 5D3OA 5HAPA 3G31A 1ERMA 1JWZA 5F82A 1W7FA 4DXBA 5DF7A 1E3UD 1PIOA 1VQQA 4S2KA 1CI9A 1PI5A 1YMXA 2EX8A 2JCHA 1FR1A 3UE3A 3DWKA 3HLBA 1LLBA 5E2EA 2R9XA 3CMZA 5GHXA 3MXRA 4QB8A 3MBZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WS4 A;  1I2S A;  5EVI C;  3VOY A;  4GKU A;  5AQA A;  4BD0 A;  4KEN B;  2Y2I A;  1KGE A;  3VP1 A;  3V3S A;  3NC8 A;  4DE0 A;  5TFQ A;  3OCN A;  1MWU A;  1TDG A;  4JKT A;  4GDB A;  1YLT A;  1HD8 A;  4JXS A;  3PBR A;  3WRT A;  3N6I A;  1LL5 A;  4KG2 A;  4N92 A;  4NK3 A;  2WK0 A;  1CEG A;  5CHU A;  1ONH A;  1GHI A;  3A3F A;  5HX9 A;  1N9B A;  4QJG A;  4KZ7 A;  5L2F A;  1BLS A;  2OLV A;  2OSU A;  4X6T A;  1BLP A;  2XH9 A;  1S6R A;  4MBK A;  4BD1 A;  1GHP A;  1Y54 A;  1ESI A;  1S0W A;  1K55 A;  1W5D A;  3O87 A;  4KZ6 A;  3GQZ A;  4ID4 A;  1DJC A;  3ZGA B;  4X69 A;  4GB7 A;  3IHB A;  3M2J A;  4BL3 A;  4GZB A;  4R23 A;  3IF6 A;  1KVM A;  2RCX A;  2XLN A;  1Z6F A;  3DWZ A;  3P09 A;  1QMF A;  3HRE A;  4IBX A;  3RXX A;  3WS2 A;  4CJN A;  5IHV A;  3ZNY A;  2HDU A;  1MWR A;  2UWX A;  4LEN A;  3ZVT A;  4UA7 A;  3S22 A;  5CHM A;  4S2N C;  3SS4 A;  3UDF A;  3UO9 A;  1CEF A;  2EX9 A;  2QPN A;  2HP6 A;  3QNC A;  1PYY A;  2DCF A;  2J8Y A;  2RL3 A;  4E3L A;  5JYO A;  4P85 A;  4XXR A;  5CGX A;  5HAQ A;  2ZQ7 A;  3ZG8 B;  5EVL A;  1U60 A;  1W79 A;  1XKZ A;  1K55 C;  3SH7 A;  3UDI A;  3C4P A;  3M2K A;  2A3U A;  3IXH A;  4JBF A;  4C75 A;  3BEC A;  2V1Z A;  4GDN A;  1TDL A;  2WUQ A;  3NBL A;  5CXW A;  5GHZ A;  4KZB A;  3RJU A;  1PW8 A;  4Q8I A;  5F83 A;  4OQ0 A;  1ALQ A;  3D4F A;  2V2F F;  4S2P A;  2ZLY A;  4OOY A;  2X01 A;  1YQS A;  3HUM A;  3Q07 A;  2H5S A;  4OQH A;  4MEZ A;  1GHM A;  2JBF A;  4OH0 A;  4S2M A;  4LCM A;  3Q1F A;  3UPO A;  1J9M A;  2OLU A;  2H0Y A;  1E3U A;  5EVI A;  5FQ9 A;  5DTT A;  5GLB A;  4E3K A;  4GNU A;  2HPB A;  3VFF A;  4OPR A;  5HAR A;  3MZE A;  3BM6 A;  3G30 A;  3GTC A;  1HTZ A;  4EWF A;  1KVL A;  3BRM A;  2Y2H A;  4DRT A;  1NJ4 A;  2ZQ9 A;  1XGI A;  2IWB A;  4Y0O A;  2Y2M A;  1K25 A;  2G2W A;  1WYB A;  1K4E A;  4OQG A;  1XA7 A;  2ZC5 B;  4XUX A;  3C4O A;  4KZ8 A;  4OOM A;  4EUZ A;  1KDW A;  5A93 A;  4MBF A;  1JWP A;  1BLH A;  4IVK A;  4ZDX A;  3MFD A;  5HW3 A;  2J9P A;  1K6R A;  3CZD A;  2Y2G A;  2EXA A;  4OQI A;  4EBL A;  3SH9 A;  3IF6 B;  4UA9 A;  3AGD A;  1LHY A;  3V3R A;  4WMC D;  2GDN A;  4JXV A;  2PBY A;  1XX2 A;  2ZM8 A;  2Z2L B;  4F94 A;  3BLS A;  3HLW A;  3NY4 A;  3LY4 A;  4JXG A;  3UDX A;  1YLP A;  4GN2 A;  4OPQ A;  3IF6 C;  5CGW A;  5DF9 A;  4JF6 A;  1O7E A;  4IBR A;  1MWS A;  1PZO A;  3TOI A;  1NZU A;  2HDR A;  4WZ5 A;  4O7D A;  1G68 A;  5CTM A;  1W8Q A;  1RP5 A;  5DVA A;  4B4Z A;  3CG5 A;  4WBG A;  4OON A;  3NIA A;  4X56 A;  4ZJ1 A;  3WS0 A;  4A5R A;  3GRJ A;  3E2K A;  5F1G A;  1H8Y A;  4WEJ A;  2PU4 A;  4D2O A;  1FCN A;  3Q81 A;  1H5X A;  5FA7 A;  3ZFZ A;  3VP0 A;  2ZQ8 A;  2ZQA A;  2FFF B;  4OVD A;  1ZG6 A;  1L2S A;  4DE1 A;  5FSR A;  2ZQC A;  3QHY A;  3FV7 A;  1I2W A;  1JWV A;  4HEF A;  1KE3 A;  3MZD A;  2XK1 A;  2Z2M B;  1JTD A;  2Q9N A;  4R0Q A;  5E43 A;  1GA0 A;  4OLG A;  5A91 A;  1SDN A;  1KDS A;  2WGV A;  5EVI B;  2Y91 A;  2OV5 A;  2ZM2 A;  3IXB A;  4PM7 A;  1XP4 A;  4UAA A;  1TEM A;  5AQB A;  3LEZ A;  3MKF A;  4PM5 A;  1K54 C;  1L0F A;  1EWZ A;  3P98 A;  4X55 A;  1E4D A;  5CEC A;  5HL1 A;  3A3D A;  3NDG A;  4QY5 A;  2DRW A;  3G2Y A;  4S2L A;  3VP2 A;  4R4R A;  3LCE A;  5FI2 A;  4DF6 A;  1BT5 A;  1TVF A;  2ZD8 A;  5J8X A;  5FI7 A;  5A92 A;  1MWT A;  3ZDJ A;  2WYX A;  2WAE A;  3Q7V A;  1DJB A;  1YLY A;  3SOI A;  3LY3 A;  3FWL A;  3PTE A;  1FCM A;  2H10 A;  1GA9 A;  3A3E A;  3UE0 A;  3FKW A;  1DJA A;  3GSG A;  1OME A;  2Q9M A;  1MBL A;  4BQM A;  1SCW A;  5F1F A;  3W4P A;  2XR0 A;  3FYZ A;  1KE4 A;  4P6B A;  3B3X A;  1K54 A;  3W4O A;  2C5W B;  3C7V A;  1C3B A;  3VFH A;  4KZA A;  1FSW A;  1BUE A;  5GLC A;  5FI6 A;  4GD6 A;  3N7W A;  1FOF A;  1DY6 A;  1LI0 A;  5FAP A;  3CJM A;  4BLM A;  4UA6 A;  2HDS A;  4LV3 A;  4S2I A;  1K38 A;  2ZMA A;  2Y2J A;  5E2F A;  5HFO A;  2XEP A;  5FDH A;  1ZC2 A;  3DW0 A;  5TR7 A;  1NY0 A;  3BFG A;  3IWO A;  3HLD A;  3G2Z A;  3WRZ A;  1NYM A;  2XF3 A;  1NXY A;  2ZC3 B;  5CEB A;  5FAO A;  5JYP A;  4Y0U A;  2XQZ A;  3BFD A;  3HVF A;  5DTS A;  5CHJ A;  3NCK A;  3I7J A;  3HLC A;  1K4F A;  3O88 A;  2WGW B;  3BFC A;  5EOE A;  3PAE A;  5KMW A;  3HL9 A;  3Q82 A;  4K0X A;  5CED A;  3UPN A;  4JF5 A;  1XXM A;  2WKH A;  3SS3 A;  4N1H A;  2V20 A;  1PWC A;  4DDY A;  2Y2N A;  5FQI A;  1IKI A;  4N9L A;  5AQ9 A;  1WYC A;  3M6B A;  2B5R A;  1HZO A;  1K56 A;  4X68 A;  3VP4 A;  1VM1 A;  2Y59 A;  5EEC A;  5FAS A;  1ES3 A;  1FCO A;  4S2J A;  4E3M A;  1CI8 A;  3HLG A;  1SHV A;  3WWX A;  1PI4 A;  4HES A;  3UPP A;  3Q7V B;  3G34 A;  4OP8 A;  1YLW A;  2XDM A;  3ZG5 A;  3ITB A;  1PWG A;  4JLF A;  2BLS A;  4E3I A;  3OPH A;  4L0L A;  4YIN A;  4IVI A;  1IYS A;  4RX3 A;  1M6K A;  3M6H A;  3HBR A;  4RX2 A;  4ZTK A;  5KSH A;  3HLF A;  4QU3 A;  4ZJ3 A;  1O07 A;  2PU2 A;  2WAF A;  3BEB A;  5DTK A;  4FH2 A;  4RVA A;  4OPZ A;  1NYY A;  1ES5 A;  2G2U A;  3FZC A;  3AGF A;  4KG6 A;  4BJP A;  4R3B A;  1SKF A;  3GMW A;  4QY6 A;  5G18 A;  1FR6 A;  4IED A;  2H0T A;  2R9W A;  4WEK A;  1ERQ A;  4RA7 A;  5HAI A;  1BZA A;  1KGG A;  3UN7 A;  3VMA A;  3VSL A;  2XFS A;  3OPL A;  2WGI A;  4QD4 A;  3OC2 A;  2JE5 A;  1I5Q A;  4KQR A;  4FH4 A;  4KZ3 A;  2P9V B;  4HBT A;  4Y0T A;  3V5M A;  1IYO A;  1FQG A;  3G35 A;  3GV9 A;  4RYE A;  1Q2Q A;  1EI5 A;  3IXD A;  5A90 A;  3A3I A;  5TGF A;  2HP9 A;  1IYQ A;  4HBU A;  4MBH A;  3MXS A;  3IXG A;  4KZ4 A;  3RXW A;  3V50 A;  1SDE A;  3VSK A;  4U0T A;  4PM6 A;  2WGW A;  4ZBE A;  1N4O A;  1NRF A;  3TG9 A;  4WYY A;  2WKE A;  3ZVW A;  5BOH A;  2X71 A;  4UHU A;  1YM1 A;  3IH9 A;  2Y2O A;  1M40 A;  5EOO A;  1FSY A;  4C6Y A;  3OPP A;  4H8R A;  5KSC A;  3ISG A;  4E6X A;  1L0E A;  3ZG0 A;  3BFE A;  4DXC A;  1HVB A;  4FCF A;  3ZG9 B;  4EV4 A;  2Y2K A;  3IF5 A;  3NDE A;  5CGS A;  3A3J A;  4B4X A;  4WZ4 A;  5U47 A;  4OOL A;  4LCL A;  4WZ5 C;  5EVI D;  2EX6 A;  3N8S A;  4JF4 A;  1WE4 A;  5FQM A;  3UY6 A;  2P74 A;  4EBN A;  1XGJ A;  2C6W B;  3VOZ A;  1K57 C;  2IWD A;  1BTL A;  2ZC6 B;  4N9K A;  2XD5 A;  3IWI A;  1XPB A;  2IWC A;  4QHC A;  2Y2L A;  3WS1 A;  1BLC A;  3VP3 A;  3ITA A;  3IHA A;  5AQ7 A;  4R3J A;  1BUL A;  2Y2Q A;  3OCL A;  4WEL A;  4JXW A;  4ZAM A;  3IT9 A;  1JTG A;  1LL9 A;  4K0W A;  2WZZ A;  1PW1 A;  2JC7 A;  1GCE A;  2XD1 A;  3EQV A;  3OZH A;  4YFM A;  4DE3 A;  4BEN A;  4OKP A;  4U3T A;  4DKI A;  3SS5 A;  3TSG A;  1Q2P A;  2EX2 A;  1AXB A;  1YLZ A;  3E2L A;  5FQJ A;  5M19 A;  5M18 A;  4KG5 A;  3O3V A;  2HP5 A;  1ZG4 A;  4K91 A;  3ZHH A;  4U0X A;  4C3Q A;  3W4Q A;  2QMI A;  2J9O A;  2ZQD A;  1MKI A;  4R1G A;  1MXO A;  1ERO A;  4Y7P A;  2P9V A;  3PBT A;  1MY8 A;  2HDQ A;  2EXB A;  4XUZ A;  1RGZ A;  3ZNT A;  3BLM A;  2QZ6 A;  4E3O A;  5GL9 A;  3GR2 A;  4Z9Q A;  4MLL A;  3JYI A;  2EFX A;  1K56 D;  1MPL A;  3PBS A;  4GOG A;  4E3N A;  2WKI A;  3ZCZ A;  4MNR A;  3EQU A;  1ES4 A;  2ZC7 A;  1PZP A;  4B88 A;  3IH8 A;  1QME A;  3N4I A;  5M1A A;  5KZH A;  4NET A;  2XFT A;  2EFU A;  5GLA A;  4OPY A;  1YT4 A;  3S1Y A;  3HUO A;  3NI9 A;  3N8L A;  3W8K A;  3OPR A;  4KQO A;  3IQA A;  3PBQ A;  4PM8 A;  1E25 A;  3PAG A;  4KZ9 A;  5EUA A;  4P0M A;  4S2O A;  4JPM A;  5CRF A;  4DE2 A;  3BYD A;  1RCJ A;  1ONG A;  4N1X A;  1G6A A;  2A49 A;  3DTM A;  3HLE A;  3IWQ A;  3QNB A;  4OLD A;  5GLD A;  4EQI A;  3AGE A;  3S4X A;  2Y4A A;  1RGY A;  5E2H A;  3HUN A;  4FD8 A;  2VGK A;  1ES2 A;  5FQQ A;  4KQQ A;  1LI9 A;  5DF8 A;  4ZJ2 A;  4R4S A;  1ZKJ A;  2DNS A;  1YMS A;  5EE8 A;  4X53 A;  3UE1 A;  3MKE A;  4P87 A;  3GVB A;  3BFF A;  1KE0 A;  5CTN A;  3LO7 A;  5FAQ A;  2WAD A;  4PPR A;  4CPK A;  1K57 A;  4PM9 A;  3UNW A;  2XGN A;  4DDS A;  1CK3 A;  4LV2 A;  2CC1 A;  1KGF A;  4S2N A;  5FQK A;  4PMA A;  2FFY A;  4LV0 A;  5GHY A;  3C7U A;  1W8Y A;  4E3J A;  2X02 A;  4LV1 A;  5CER A;  5E2G A;  1L0G A;  2Y55 A;  4M3K A;  3C5A A;  3Q7Z A;  2BG1 A;  5FAT A;  2ZC4 B;  1XA1 A;  2E8I A;  2ZJ9 A;  1NZO A;  1BSG A;  4E6W A;  1YLJ A;  3ZG7 B;  1IEL A;  3PBN A;  4EBP A;  4KZ5 A;  5I94 A;  3MZF A;  5EPH A;  2I72 A;  2WZX A;  4WMC A;  1IKG A;  2VGJ A;  4WM9 A;  1ESU A;  2Y2P A;  3G32 A;  1JVJ A;  3N8R A;  1H8Z A;  4OP5 A;  4GD8 A;  2ZM0 A;  3O86 A;  1L0D A;  4FSF A;  4BL2 A;  1PWD A;  3SH8 A;  3V39 A;  3WS5 A;  3FKV A;  3PBO A;  1IEM A;  1IYP A;  1K6S A;  2J7V A;  3G4P A;  5D3O A;  5HAP A;  3G31 A;  1ERM A;  1JWZ A;  5F82 A;  1W7F A;  4DXB A;  5DF7 A;  1E3U D;  1PIO A;  1VQQ A;  4S2K A;  1CI9 A;  1PI5 A;  1YMX A;  2EX8 A;  2JCH A;  1FR1 A;  3UE3 A;  3DWK A;  3HLB A;  1LLB A;  5E2E A;  2R9X A;  3CMZ A;  5GHX A;  3MXR A;  4QB8 A;  3MBZ A; 
#chains in the Genus database with same CATH topology
 4GHI B;  1I2S A;  4GKU A;  4JGQ A;  4KEN B;  3VP1 A;  3NC8 A;  1S66 L;  2L1M A;  3LYX A;  1TDG A;  4JGO A;  1YLT A;  3BY8 A;  3F1P B;  3MS6 A;  4N92 A;  2O9A A;  2KDK A;  2WK0 A;  2VV6 A;  4CLC B;  4H6J B;  1Y54 A;  4L9E A;  3O87 A;  4ID4 A;  1DJC A;  3ZGA B;  3M2J A;  3ZQ5 A;  3IF6 A;  1H0M A;  2RCX A;  3WS2 A;  1OTE A;  5IHV A;  1MWR A;  2OOL A;  4S2N C;  4EEP A;  3KSH A;  3S7O A;  3MMH A;  5CGX A;  3ZG8 B;  5L10 A;  1W79 A;  3C4P A;  2VEA A;  3IXH A;  4C75 A;  2WUQ A;  5CXW A;  2PR5 A;  2D01 A;  5F83 A;  2MJ6 A;  1ALQ A;  3EWK A;  4HP4 A;  4OQH A;  4LLO B;  4MEZ A;  5EM1 A;  1NLZ A;  4E04 A;  4MN6 A;  3F1P A;  2HPB A;  4OPR A;  3MZE A;  3GTC A;  5G4Y A;  2Y2H A;  4DRT A;  2JKR M;  1K25 A;  2G2W A;  2Y2M A;  4CLC A;  4EUZ A;  4KZ8 A;  4MBF A;  1BLH A;  5HW3 A;  2J9P A;  3R4K A;  4OQI A;  3SH9 A;  2PBY A;  2ZM8 A;  1L3L A;  5HDD A;  2FZ0 A;  5F69 A;  4GN2 A;  4OPQ A;  4CLC E;  1NZU A;  2HDR A;  1G68 A;  1G5U A;  4B4Z A;  3CG5 A;  4ZJ1 A;  3WS0 A;  2JHE A;  4WEJ A;  2M7U A;  3V67 A;  1XJ6 A;  4I3J A;  1L2S A;  3U2A A;  4NXB A;  3FV7 A;  1KE3 A;  2GZA A;  3MZD A;  2V8F A;  2Q9N A;  3PYP A;  5A91 A;  4RQ9 A;  2Y91 A;  2ZM2 A;  4UAA A;  5AQB A;  1XP4 A;  5IS1 A;  3D72 A;  3LEZ A;  4KUO A;  4X55 A;  3BY9 A;  4S2L A;  3PHY A;  3LCE A;  3EEH A;  3EEA A;  2WAE A;  3MR0 A;  1DJB A;  3SOI A;  3A3E A;  2H10 A;  5F1F A;  3FYZ A;  1STZ A;  1VET B;  3A0V A;  4P6B A;  1K54 A;  2C5W B;  3S7Q A;  4KQD A;  1BUE A;  5FI6 A;  2JKR I;  3N7W A;  1CF0 A;  1MKM A;  4LPZ A;  2V9A A;  4ZRR A;  4HY8 A;  4LV3 A;  2O0Y A;  5HFO A;  3DW0 A;  3WRZ A;  3G2Z A;  2V0W A;  2R78 A;  4Y0U A;  2XQZ A;  3BFD A;  5CHJ A;  3CWF A;  5HL6 A;  2WGW B;  5EOE A;  3PAE A;  5KMW A;  3L7H A;  5CED A;  2JKG A;  3UPN A;  4ARZ B;  5AQ9 A;  1VB6 A;  3PXP A;  3H82 B;  1K56 A;  2OWJ A;  1VM1 A;  3TJZ C;  2NUT C;  3Q7V B;  3DAV A;  1YLW A;  2PDR A;  5HSQ A;  2A24 A;  4L0L A;  1GSW A;  2O99 A;  3M6H A;  4RX2 A;  1ZHH B;  3HLF A;  4Y2F A;  1O07 A;  4ZJ3 A;  4LFU A;  2QJ5 A;  5DTK A;  4RVA A;  3H7W B;  3AGF A;  4KG6 A;  4BJP A;  4R3B A;  1DP6 A;  3DBA A;  3JVU A;  3P7N A;  4IED A;  2YKH A;  2W1R A;  4EQ1 A;  4RA7 A;  3OPL A;  2WGI A;  2JE5 A;  4KQR A;  1VEU A;  1FQG A;  3IXD A;  4DJ2 A;  3RXW A;  3VSK A;  4U0T A;  4PM6 A;  4ZBE A;  2LB5 A;  1NRF A;  4WF0 A;  4UHU A;  3IH9 A;  4AFI A;  1OT6 A;  3CUE A;  4Y3I A;  3BFE A;  4DXC A;  1HVB A;  2Y2K A;  3A3J A;  4OOL A;  3NEC A;  5FEF A;  2EX6 A;  3N8S A;  3UY6 A;  2IWD A;  1BTL A;  4Y5F A;  3IWI A;  2Y2L A;  3VP3 A;  1P97 A;  4R3J A;  3OCL A;  4MMN A;  3IT9 A;  3C2W A;  4K0W A;  1PW1 A;  2JC7 A;  3EQV A;  5HPI A;  4BEN A;  4P6Z M;  4U3T A;  4I39 A;  1YLZ A;  5FQJ A;  1CQA A;  4K91 A;  2ZOI A;  4C3Q A;  2QMI A;  4QWO A;  2ZQD A;  4R1G A;  4I3A A;  1MZU A;  5GL9 A;  2ZL1 B;  1XFN A;  2HGV A;  1UWP X;  3JYI A;  1K56 D;  4E3N A;  4B88 A;  1DP9 A;  3IH8 A;  3QP4 A;  5M1A A;  3O5Y A;  3D9Y A;  1J3W A;  4MDZ A;  4G3K A;  4LRY C;  4R3A A;  4PM8 A;  4L9G A;  2WKQ A;  2A49 A;  3DTM A;  3HLE A;  3IWQ A;  4EQI A;  3DTE A;  4D60 A;  3B33 A;  1RGY A;  3HUN A;  1ES2 A;  3HJK A;  1ZKJ A;  3GVB A;  4XT2 B;  5CTN A;  3LO7 A;  2WAD A;  4R38 A;  3JVV A;  5FQK A;  4LV0 A;  5GHY A;  3CLO A;  2HJ9 C;  3KSI A;  2J80 A;  2ZC4 B;  2ZJ9 A;  1NZO A;  3CAX A;  5I94 A;  4KZ5 A;  2ZL1 A;  5EPH A;  4X1M A;  2WZX A;  4WMC A;  1IKG A;  1ESU A;  5HZH A;  1BYW A;  3N8R A;  2H28 A;  1EW0 A;  5CX7 A;  4FSF A;  1PWD A;  4ME4 A;  2J7V A;  1VQQ A;  4S2K A;  1CI9 A;  3TE8 A;  3HLB A;  3MJQ A;  5GHX A;  3MBZ A;  3WS4 A;  2GJ3 A;  5EVI C;  4QPR A;  4HJ3 A;  3VOY A;  4BD0 A;  4GJ4 A;  1KGE A;  4P6Z S;  1LSX A;  2KX6 A;  5TFQ A;  3OCN A;  4JKT A;  4GDB A;  3MQQ A;  3PBR A;  3N6I A;  4PAU A;  1LL5 A;  4KG2 A;  4XT2 A;  4NK3 A;  1ONH A;  4LRZ E;  3VE4 A;  1OJ5 A;  1N9B A;  4KZ7 A;  2W3E A;  2OSU A;  1S0W A;  1W5D A;  1JNU A;  4X69 A;  2XRN A;  3IBJ A;  4GZB A;  3UE6 A;  1KVM A;  3RXX A;  5MC7 A;  5J3W A;  3ZNY A;  3HJI A;  2VV7 A;  4PKY G;  5CHM A;  5HDS A;  4B9O A;  1CEF A;  4JGR A;  2HP6 A;  1YKD A;  2DCF A;  2J8Y A;  2RL3 A;  4E3L A;  5JYO A;  4XXR A;  1U60 A;  1XKZ A;  1K55 C;  3LR5 A;  4I3I A;  4JGP A;  2V1Z A;  5HWW A;  1AWI A;  3NBL A;  3RJU A;  4KZB A;  4WUJ A;  1SZV A;  1OTI A;  2W3G A;  4Q8I A;  3IX8 A;  4S2P A;  2H5S A;  2V1B A;  3Q1F A;  2OLU A;  5EVI A;  5DTT A;  4EWF A;  3BRM A;  1NJ4 A;  3CI6 A;  4UQI M;  4Y0O A;  1XA7 A;  4XUX A;  2J3W A;  4FOF A;  4OOM A;  1KDW A;  3T50 A;  1JWP A;  4IVK A;  3ZYT A;  3AGD A;  2XSS A;  1OPX A;  4F94 A;  3HLW A;  1K0K A;  3LY4 A;  3NY4 A;  1YLP A;  3IF6 C;  1O7E A;  1MWS A;  1PZO A;  1F2K A;  4WZ5 A;  3UB5 P;  4O7D A;  5DVA A;  4X56 A;  4WBG A;  2Z6D A;  4MCW A;  3VV4 A;  4A5R A;  3GRJ A;  1H8Y A;  2PAV P;  4UQI S;  1FCN A;  3Q81 A;  1H5X A;  3ZFZ A;  2ZQ8 A;  2ZMF A;  1ZG6 A;  4LRX C;  3SZT A;  3UB8 A;  2ZQC A;  1XJ2 A;  3IBR A;  3C8C A;  3UMD A;  3KX0 X;  1GA0 A;  2Y8H A;  1TS6 A;  1KDS A;  5EVI B;  2V1A A;  2OV5 A;  4PM7 A;  3MKF A;  1L0F A;  1EWZ A;  5CEC A;  1E4D A;  5HL1 A;  3BQ8 A;  1UWN X;  5FI2 A;  1LSV A;  1TVF A;  4KUK A;  1YLY A;  3PTE A;  2JKT I;  4HP9 A;  3W4P A;  2XR0 A;  1YPR A;  3HCY A;  1Y28 A;  2W1T A;  1C3B A;  5FEG A;  4KZA A;  1FSW A;  3IX3 A;  5GLC A;  3PR6 A;  5EVE A;  4EEU A;  1FOF A;  1LI0 A;  5FAP A;  1K38 A;  3MFX A;  3EGX C;  2Y2J A;  3BW6 A;  3LUQ A;  3K2N A;  3IWO A;  3HLD A;  2QKP A;  1NXY A;  2ZC3 B;  5CEB A;  5FAO A;  3K3D A;  3TW8 A;  4DMZ A;  1K4F A;  2W3F A;  4IUK A;  2XRO A;  1GSX A;  2LB9 A;  5HDC A;  1XXM A;  2WKH A;  3SS3 A;  1WA9 A;  4N1H A;  5FQI A;  3A0S A;  1IKI A;  3M6B A;  2B5R A;  1HZO A;  3VP4 A;  2IA2 A;  2EWV A;  5EEC A;  4NG2 A;  4S2J A;  2VGL S;  4Y15 A;  3UPP A;  3G34 A;  4OP8 A;  4FUW A;  3ZG5 A;  1PWG A;  2FH5 A;  3OPH A;  4YIN A;  1IYS A;  4RX3 A;  1N9L A;  1D1J A;  1PNE A;  2QHK A;  2PU2 A;  4FH2 A;  2G2U A;  1TS7 A;  1SKF A;  1Z09 A;  4QY6 A;  4HJ4 A;  2O9B A;  4YWZ A;  5G18 A;  2J3T C;  3T1R A;  4WEK A;  1ERQ A;  2AVX A;  3UN7 A;  3VMA A;  3VSL A;  2XFS A;  4QD4 A;  4DN0 A;  3LIA A;  3MQ0 A;  4FH4 A;  4Y0T A;  5AJG A;  3G35 A;  1EI5 A;  4YOF A;  5A90 A;  2PD7 A;  5TGF A;  2HP9 A;  1IYQ A;  4HBU A;  4MBH A;  4KZ4 A;  2W3D A;  2ACG A;  5BOH A;  1YM1 A;  1N9O A;  1W63 Q;  5KSC A;  3ISG A;  4PHT A;  3ZG0 A;  3QP2 A;  4F3L B;  5U47 A;  5EVI D;  4EBN A;  1XGJ A;  2C6W B;  4IUH A;  1OJG A;  1X0O A;  4N9K A;  1YSQ A;  1OTA A;  2XD5 A;  4HNB A;  2IWC A;  4QHC A;  4EXO A;  4HOI A;  3T4Q A;  3OZH A;  3SS5 A;  1AXB A;  5M19 A;  4KG5 A;  2HP5 A;  1ZG4 A;  4X1L A;  3F1N B;  2J9O A;  3T4J A;  4Y7P A;  2P9V A;  2QYB A;  3PBT A;  1W63 M;  2OWH A;  1NRJ A;  4XUZ A;  4Y17 A;  2QZ6 A;  1D06 A;  4NXG A;  1MPL A;  3LIE A;  5HD3 A;  1ES4 A;  2ZC7 A;  1PZP A;  4CLC C;  2QWS A;  3N4I A;  4EW7 A;  2EFU A;  3EGD C;  4F3L A;  3S1Y A;  3IQA A;  3PAG A;  4KZ9 A;  5EUA A;  4JPM A;  4DE2 A;  3BYD A;  4OLD A;  3S4X A;  3B42 A;  5E2H A;  5DF8 A;  4ZJ2 A;  4R4S A;  4X53 A;  3MKE A;  4WN5 A;  1KE0 A;  3LR0 A;  5EM0 A;  5FAQ A;  3LFV A;  1K57 A;  4PM9 A;  1CK3 A;  4PMA A;  2FFY A;  5E2G A;  4L9F A;  4M3K A;  1YLJ A;  3ZG7 B;  4EBP A;  3PBN A;  3MZF A;  2KLI A;  2I72 A;  1JVJ A;  4OP5 A;  2ZM0 A;  2EA9 A;  5TBM A;  2NUP C;  4LGW A;  3SH8 A;  3V39 A;  3PBO A;  3T1X A;  1IYP A;  1K6S A;  1ERM A;  1W7F A;  1E3U D;  1YMX A;  2A2L A;  3T4K A;  3OLO A;  1NWZ A;  1MWU A;  1HD8 A;  1T1B A;  1CEG A;  3A3F A;  2VGL M;  5L2F A;  2OLV A;  4X6T A;  4BD1 A;  1GHP A;  1ESI A;  3CIT A;  4GLQ A;  1TS0 A;  3IHB A;  4R23 A;  3P09 A;  3DWZ A;  1QMF A;  2K31 A;  3LEQ A;  1FIL A;  1OT9 A;  4LEN A;  4UA7 A;  4Q0I A;  5F5Y A;  3LI9 A;  3UDF A;  3UO9 A;  3F1O A;  5TBM B;  3QNC A;  5HAQ A;  4HH2 A;  3SH7 A;  3M2K A;  3T4S A;  4JBF A;  5TJJ A;  3MSH A;  4GDN A;  1TDL A;  3NOU C;  2B95 A;  4OQ0 A;  3D4F A;  2ZLY A;  4OOY A;  2X01 A;  3HUM A;  3Q07 A;  1GHM A;  2JBF A;  1IFQ A;  2V0U A;  1T1C A;  1V9Y A;  2H0Y A;  2OAQ 1;  4E3K A;  4GNU A;  2HJE A;  3VFF A;  4BWI A;  3G30 A;  3LID A;  1WYB A;  4OQG A;  2ZC5 B;  4GS9 A;  2HV1 A;  3SW1 A;  3KSG A;  4BBT A;  3CZD A;  4Q0H A;  2BTF P;  3IF6 B;  4UA9 A;  3V3R A;  3KSF A;  5DJT A;  2GDN A;  3D3O A;  4JXV A;  1XX2 A;  3E4Q A;  2Z2L B;  3BLS A;  4NXF A;  3E0Y A;  4I5S A;  3UDX A;  4NKP A;  5CGW A;  4JF6 A;  2W27 A;  3F1O B;  3TOI A;  2PR6 A;  4O8G A;  5F1G A;  5FL3 A;  3VP0 A;  2ZQA A;  2FFF B;  3NHQ A;  3QHY A;  1I2W A;  1JWV A;  5A8B A;  4R0Q A;  5E43 A;  3BJN A;  1SDN A;  1TEM A;  1K54 C;  4HHD A;  4ARZ A;  5F68 A;  3UB7 A;  4QY5 A;  2W0N A;  3G2Y A;  3VP2 A;  4R4R A;  3T4O A;  4GS9 B;  2XA7 S;  4DF6 A;  1BT5 A;  3G6O A;  5FI7 A;  2WYX A;  3Q7V A;  2B18 A;  3NOP C;  3LY3 A;  2A24 B;  3UE0 A;  3GSG A;  2Q9M A;  1SCW A;  3KYZ A;  4ETX A;  3T4T A;  3W4O A;  2JKT M;  3VFH A;  3CHW P;  4Z1W A;  1DY6 A;  4UA6 A;  2HDS A;  4S2I A;  2ZMA A;  1ZTU A;  5FDH A;  1LSW A;  1ZC2 A;  2B02 A;  1NY0 A;  2VV8 A;  1VEU B;  5JYP A;  5DTS A;  3HVF A;  1H8M A;  3TRC A;  3FG8 A;  3NCK A;  3O88 A;  4HH3 A;  3BFC A;  2OAP 1;  3Q82 A;  4K0X A;  4EER A;  4JF5 A;  3QP1 A;  1DP8 A;  1PWC A;  2QJ7 A;  4DDY A;  4Y13 A;  2Y2N A;  4N9L A;  1WYC A;  1IOU A;  2VKS A;  2Y59 A;  5FAS A;  1FCO A;  2PBD P;  1PI4 A;  2XDM A;  4JLF A;  2BLS A;  4E3I A;  1T18 A;  4IVI A;  1XJ3 A;  1M6K A;  3HBR A;  4ZTK A;  5KSH A;  2PRF A;  5FDS A;  1VET A;  2WAF A;  5DFX A;  1CJF A;  1ODV A;  4OPZ A;  1NYY A;  1ES5 A;  3KO6 A;  2H0T A;  2O9C A;  1T19 A;  1KGG A;  1S1Y A;  2HZ5 A;  4HBT A;  1IYO A;  4RYE A;  4NEE D;  2K2N A;  4X25 A;  3IXG A;  1SDE A;  2Z6C A;  2WGW A;  3T4L A;  2WKE A;  2XA7 M;  2ZBB A;  1FSY A;  5IU1 A;  1H3Q A;  4CLC D;  1N9N A;  3NDE A;  5CGS A;  1FIK A;  1UGU A;  2HF6 A;  3H82 A;  4EET B;  4FTX A;  1PRQ A;  5HPF A;  3VOZ A;  4BBV A;  1K57 C;  2ZC6 B;  2Q0O A;  1TF1 A;  1XPB A;  1BLC A;  5K5B A;  3ITA A;  3IHA A;  5AQ7 A;  3LR4 A;  4WEL A;  3QP6 A;  4ZAM A;  1JTG A;  1LL9 A;  3H7W A;  1GCE A;  4DKI A;  3KYE A;  1Q2P A;  2EX2 A;  3E2L A;  3CPT B;  5M18 A;  4PKY A;  3ZHH A;  3W4Q A;  2GNX A;  1MXO A;  1MY8 A;  4HIA A;  4Z9Q A;  4MLL A;  2WKR A;  3PBS A;  4GOG A;  4O01 A;  3ZCZ A;  4MNR A;  3EQU A;  2G7U A;  1QME A;  5KZH A;  2XFT A;  4OPY A;  1YT4 A;  4HQA A;  4KQO A;  2PD8 A;  4S2O A;  5CRF A;  1RCJ A;  1ONG A;  4N1X A;  1G28 A;  3QNB A;  5GLD A;  1T1A A;  3AGE A;  2Y4A A;  5L8M A;  2VGK A;  3IX4 A;  5HWV A;  2GX5 A;  1F98 A;  2DNS A;  5EE8 A;  1YMS A;  3UE1 A;  2E8J A;  3S7N A;  4P87 A;  4CQH A;  1TD5 A;  3CPT A;  2YKF A;  2CC1 A;  3MQO A;  5HD5 A;  3BQA A;  3C7U A;  4E3J A;  2J3T D;  2X02 A;  4LV1 A;  1YAX A;  2Y55 A;  4DJ3 A;  3Q7Z A;  2BG1 A;  1XA1 A;  5L09 A;  4E6W A;  1BSG A;  4O0P A;  1IEL A;  2JN7 A;  2Y2P A;  4R6L A;  1VHM A;  3E4O A;  3O86 A;  3R7W A;  3WS5 A;  3RFB A;  4ETZ A;  3G4P A;  5D3O A;  5HAP A;  2BAS A;  5F82 A;  4DXB A;  5DF7 A;  1PIO A;  1V9Z A;  2EX8 A;  2JCH A;  1FR1 A;  1LLB A;  3CMZ A;  3MXR A;  3UB9 A;  1LL8 A;  4MN7 A;  5AQA A;  2Y2I A;  3V3S A;  4DE0 A;  1P9W A;  2PHY A;  4R70 A;  1XJ4 A;  3FPV A;  3IS2 B;  4JXS A;  3WRT A;  5AVF A;  5CHU A;  1GHI A;  1ACF A;  5HX9 A;  4QJG A;  1BLS A;  1BLP A;  2XH9 A;  1S6R A;  4MBK A;  4B93 A;  1K55 A;  4KZ6 A;  3GQZ A;  2P7J A;  4GB7 A;  1F9I A;  4BL3 A;  2L0W A;  4IBX A;  2XLN A;  1Z6F A;  4CJN A;  3HRE A;  1OTD A;  2HDU A;  2UWX A;  3ZVT A;  3S22 A;  3SS4 A;  3UB6 A;  4Q0J A;  2VX8 A;  2EX9 A;  2QPN A;  1S4S A;  2I9V A;  3R7W B;  1PYY A;  2CMN A;  4P85 A;  2ZQ7 A;  5EVL A;  1HLU P;  1XFQ A;  3UDI A;  4BBU A;  2VA0 A;  2A3U A;  3BEC A;  4EUV A;  2VJW A;  5GHZ A;  5L07 A;  3LI8 A;  1PW8 A;  2D02 A;  4ESP A;  1F5M A;  4WLA A;  3T1Q B;  2V2F F;  2ZMV A;  3LGO A;  1YQS A;  5G4Z A;  4OH0 A;  4S2M A;  4LCM A;  3UPO A;  1J9M A;  1E3U A;  5FQ9 A;  5GLB A;  3IS2 A;  4UEY A;  5HAR A;  3BM6 A;  4WL9 A;  1HTZ A;  1KVL A;  1XGI A;  2ZQ9 A;  3GDI A;  2IWB A;  1K4E A;  3C4O A;  5IT5 A;  5A93 A;  4ZDX A;  3H9W A;  3MFD A;  3NOT C;  1K6R A;  2Y2G A;  2EXA A;  4EBL A;  1LHY A;  1Y4O A;  4WMC D;  4NXE A;  3RTY A;  4JXG A;  3BWL A;  3KYQ A;  5DF9 A;  4IBR A;  1YSP A;  4M4X A;  3VOL A;  5CTM A;  1W8Q A;  1RP5 A;  2V8C A;  2P04 A;  4OON A;  3NIA A;  3E2K A;  4MN5 A;  4YNR A;  2PU4 A;  4D2O A;  3GEC A;  5FA7 A;  4OVD A;  3L9K A;  4DE1 A;  5FSR A;  3LIF A;  3ULF A;  3C30 A;  4HEF A;  3QP8 A;  2VLG A;  2XK1 A;  2Z2M B;  3EOI A;  1JTD A;  3NUL A;  4OLG A;  3OBF A;  4GW9 A;  4EU0 A;  2WGV A;  1PFL A;  3CUE C;  3IXB A;  3A0R A;  4PM5 A;  3P98 A;  5C5K A;  3A3D A;  3NDG A;  2DRW A;  2ZD8 A;  5J8X A;  5A92 A;  1MWT A;  2M7V A;  3ZDJ A;  5EV0 A;  2VK3 A;  3E98 A;  3FWL A;  2P08 A;  1FCM A;  1GA9 A;  3FKW A;  1DJA A;  1S4R A;  3LR3 A;  1OME A;  4BQM A;  1MBL A;  4HI4 A;  1LT0 A;  1KE4 A;  3B3X A;  3C7V A;  5KIZ A;  4GD6 A;  3LIC A;  3DTI A;  2EWW A;  2ZOH A;  2UV0 E;  3CJM A;  4BLM A;  2WKP A;  5E2F A;  2XEP A;  5TR7 A;  3BFG A;  3OOV A;  1NYM A;  2XF3 A;  2JKF A;  5DKL A;  2KOI A;  3I7J A;  3HLC A;  3HL9 A;  3T1S A;  2V20 A;  5DFY A;  5J7E A;  3FC7 A;  4BMW A;  4X68 A;  3UME A;  1ES3 A;  4E3M A;  1CI8 A;  3HLG A;  5LBR A;  1SHV A;  3WWX A;  3JPU A;  4HES A;  5DJU A;  3VE3 A;  3ITB A;  4QU3 A;  2Y79 A;  3BEB A;  1KOU A;  1OTB A;  2W1T B;  3FZC A;  3GMW A;  3QP5 A;  1FR6 A;  2R9W A;  5F6A A;  3P01 A;  4I38 A;  1SKO A;  5HAI A;  2PYP A;  1BZA A;  4GCZ A;  1TS8 A;  3OC2 A;  1I5Q A;  2M1C A;  4G3V A;  4KZ3 A;  1G6O A;  2P9V B;  4G3W A;  3V5M A;  3GV9 A;  1Q2Q A;  3A3I A;  3MXS A;  3V50 A;  4HJ6 A;  1N4O A;  3TG9 A;  4WYY A;  3ZVW A;  2X71 A;  4C6Y A;  2Y2O A;  5EOO A;  1M40 A;  3OPP A;  4H8R A;  4E6X A;  1L0E A;  4FCF A;  3ZG9 B;  4EV4 A;  3IF5 A;  4B4X A;  4WZ4 A;  4LCL A;  4WZ5 C;  4JF4 A;  1WE4 A;  5FQM A;  2P74 A;  1P9R A;  3FPW A;  3WS1 A;  1BUL A;  2Y2Q A;  3C38 A;  4JXW A;  1A0K A;  4DE3 A;  2WZZ A;  2XD1 A;  4YFM A;  5DKK A;  4OKP A;  3TSG A;  3LIB A;  1SKO B;  3O3V A;  4U0X A;  4K08 A;  1MKI A;  3E4P A;  1ERO A;  2HDQ A;  2EXB A;  1RGZ A;  3ZNT A;  3BLM A;  4E3O A;  3GR2 A;  4IHQ A;  2EFX A;  2WKI A;  1S67 L;  2VZW A;  5AVE A;  1GSV A;  4NET A;  5GLA A;  2K7S A;  2INW A;  5I5L A;  3HUO A;  3NI9 A;  3N8L A;  3W8K A;  1NLY A;  3RH8 B;  3OPR A;  3PBQ A;  3MF0 A;  2L4R A;  1E25 A;  4P0M A;  3T12 B;  3DTK A;  4GHI A;  2W3H A;  1G6A A;  4FD8 A;  4EES A;  5FQQ A;  4KQQ A;  1LI9 A;  3ICY A;  3BFF A;  2DMW A;  1S1Z A;  4PPR A;  4CPK A;  3NJA A;  3S7P A;  3UNW A;  4DDS A;  2XGN A;  3F1N A;  2PT7 A;  4LV2 A;  4H6J A;  4S2N A;  1KGF A;  5J4E A;  4IJG A;  5HWT A;  1W8Y A;  5CER A;  1L0G A;  3MXQ A;  3C5A A;  3W2Z A;  5FAT A;  5EFW A;  2E8I A;  3K3C A;  3B47 A;  2VGJ A;  1D7E A;  4WM9 A;  1P0Z A;  3G32 A;  3U4L P;  1H8Z A;  4GD8 A;  1L0D A;  4BL2 A;  1DRM A;  3FKV A;  1IEM A;  3G31 A;  1JWZ A;  1PI5 A;  1MC0 A;  3UE3 A;  4II7 A;  3DWK A;  5E2E A;  2R9X A;  2PYR A;  4QB8 A; 
#chains in the Genus database with same CATH homology
 3WS4 A;  1I2S A;  5EVI C;  3VOY A;  4GKU A;  5AQA A;  4BD0 A;  4KEN B;  2Y2I A;  1KGE A;  3VP1 A;  3V3S A;  3NC8 A;  4DE0 A;  5TFQ A;  3OCN A;  1MWU A;  1TDG A;  4JKT A;  4GDB A;  1YLT A;  1HD8 A;  4JXS A;  3PBR A;  3WRT A;  3N6I A;  1LL5 A;  4KG2 A;  4N92 A;  4NK3 A;  2WK0 A;  1CEG A;  5CHU A;  1ONH A;  1GHI A;  3A3F A;  5HX9 A;  1N9B A;  4QJG A;  4KZ7 A;  5L2F A;  1BLS A;  2OLV A;  2OSU A;  4X6T A;  1BLP A;  2XH9 A;  1S6R A;  4MBK A;  4BD1 A;  1GHP A;  1Y54 A;  1ESI A;  1S0W A;  1K55 A;  1W5D A;  3O87 A;  4KZ6 A;  3GQZ A;  4ID4 A;  1DJC A;  3ZGA B;  4X69 A;  4GB7 A;  3IHB A;  3M2J A;  4BL3 A;  4GZB A;  4R23 A;  3IF6 A;  1KVM A;  2RCX A;  2XLN A;  1Z6F A;  3DWZ A;  3P09 A;  1QMF A;  3HRE A;  4IBX A;  3RXX A;  3WS2 A;  4CJN A;  5IHV A;  3ZNY A;  2HDU A;  1MWR A;  2UWX A;  4LEN A;  3ZVT A;  4UA7 A;  3S22 A;  5CHM A;  4S2N C;  3SS4 A;  3UDF A;  3UO9 A;  1CEF A;  2EX9 A;  2QPN A;  2HP6 A;  3QNC A;  1PYY A;  2DCF A;  2J8Y A;  2RL3 A;  4E3L A;  5JYO A;  4P85 A;  4XXR A;  5CGX A;  5HAQ A;  2ZQ7 A;  3ZG8 B;  5EVL A;  1U60 A;  1W79 A;  1XKZ A;  1K55 C;  3SH7 A;  3UDI A;  3C4P A;  3M2K A;  2A3U A;  3IXH A;  4JBF A;  4C75 A;  3BEC A;  2V1Z A;  4GDN A;  1TDL A;  2WUQ A;  3NBL A;  5CXW A;  5GHZ A;  4KZB A;  3RJU A;  1PW8 A;  4Q8I A;  5F83 A;  4OQ0 A;  1ALQ A;  3D4F A;  2V2F F;  4S2P A;  2ZLY A;  4OOY A;  2X01 A;  1YQS A;  3HUM A;  3Q07 A;  2H5S A;  4OQH A;  4MEZ A;  1GHM A;  2JBF A;  4OH0 A;  4S2M A;  4LCM A;  3Q1F A;  3UPO A;  1J9M A;  2OLU A;  2H0Y A;  1E3U A;  5EVI A;  5FQ9 A;  5DTT A;  5GLB A;  4E3K A;  4GNU A;  2HPB A;  3VFF A;  4OPR A;  5HAR A;  3MZE A;  3BM6 A;  3G30 A;  3GTC A;  1HTZ A;  4EWF A;  1KVL A;  3BRM A;  2Y2H A;  4DRT A;  1NJ4 A;  2ZQ9 A;  1XGI A;  2IWB A;  4Y0O A;  2Y2M A;  1K25 A;  2G2W A;  1WYB A;  1K4E A;  4OQG A;  1XA7 A;  2ZC5 B;  4XUX A;  3C4O A;  4KZ8 A;  4OOM A;  4EUZ A;  1KDW A;  5A93 A;  4MBF A;  1JWP A;  1BLH A;  4IVK A;  4ZDX A;  3MFD A;  5HW3 A;  2J9P A;  1K6R A;  3CZD A;  2Y2G A;  2EXA A;  4OQI A;  4EBL A;  3SH9 A;  3IF6 B;  4UA9 A;  3AGD A;  1LHY A;  3V3R A;  4WMC D;  2GDN A;  4JXV A;  2PBY A;  1XX2 A;  2ZM8 A;  2Z2L B;  4F94 A;  3BLS A;  3HLW A;  3NY4 A;  3LY4 A;  4JXG A;  3UDX A;  1YLP A;  4GN2 A;  4OPQ A;  3IF6 C;  5CGW A;  5DF9 A;  4JF6 A;  1O7E A;  4IBR A;  1MWS A;  1PZO A;  3TOI A;  1NZU A;  2HDR A;  4WZ5 A;  4O7D A;  1G68 A;  5CTM A;  1W8Q A;  1RP5 A;  5DVA A;  4B4Z A;  3CG5 A;  4WBG A;  4OON A;  3NIA A;  4X56 A;  4ZJ1 A;  3WS0 A;  4A5R A;  3GRJ A;  3E2K A;  5F1G A;  1H8Y A;  4WEJ A;  2PU4 A;  4D2O A;  1FCN A;  3Q81 A;  1H5X A;  5FA7 A;  3ZFZ A;  3VP0 A;  2ZQ8 A;  2ZQA A;  2FFF B;  4OVD A;  1ZG6 A;  1L2S A;  4DE1 A;  5FSR A;  2ZQC A;  3QHY A;  3FV7 A;  1I2W A;  1JWV A;  4HEF A;  1KE3 A;  3MZD A;  2XK1 A;  2Z2M B;  1JTD A;  2Q9N A;  4R0Q A;  5E43 A;  1GA0 A;  4OLG A;  5A91 A;  1SDN A;  1KDS A;  2WGV A;  5EVI B;  2Y91 A;  2OV5 A;  2ZM2 A;  3IXB A;  4PM7 A;  1XP4 A;  4UAA A;  1TEM A;  5AQB A;  3LEZ A;  3MKF A;  4PM5 A;  1K54 C;  1L0F A;  1EWZ A;  3P98 A;  4X55 A;  1E4D A;  5CEC A;  5HL1 A;  3A3D A;  3NDG A;  4QY5 A;  2DRW A;  3G2Y A;  4S2L A;  3VP2 A;  4R4R A;  3LCE A;  5FI2 A;  4DF6 A;  1BT5 A;  1TVF A;  2ZD8 A;  5J8X A;  5FI7 A;  5A92 A;  1MWT A;  3ZDJ A;  2WYX A;  2WAE A;  3Q7V A;  1DJB A;  1YLY A;  3SOI A;  3LY3 A;  3FWL A;  3PTE A;  1FCM A;  2H10 A;  1GA9 A;  3A3E A;  3UE0 A;  3FKW A;  1DJA A;  3GSG A;  1OME A;  2Q9M A;  1MBL A;  4BQM A;  1SCW A;  5F1F A;  3W4P A;  2XR0 A;  3FYZ A;  1KE4 A;  4P6B A;  3B3X A;  1K54 A;  3W4O A;  2C5W B;  3C7V A;  1C3B A;  3VFH A;  4KZA A;  1FSW A;  1BUE A;  5GLC A;  5FI6 A;  4GD6 A;  3N7W A;  1FOF A;  1DY6 A;  1LI0 A;  5FAP A;  3CJM A;  4BLM A;  4UA6 A;  2HDS A;  4LV3 A;  4S2I A;  1K38 A;  2ZMA A;  2Y2J A;  5E2F A;  5HFO A;  2XEP A;  5FDH A;  1ZC2 A;  3DW0 A;  5TR7 A;  1NY0 A;  3BFG A;  3IWO A;  3HLD A;  3G2Z A;  3WRZ A;  1NYM A;  2XF3 A;  1NXY A;  2ZC3 B;  5CEB A;  5FAO A;  5JYP A;  4Y0U A;  2XQZ A;  3BFD A;  3HVF A;  5DTS A;  5CHJ A;  3NCK A;  3I7J A;  3HLC A;  1K4F A;  3O88 A;  2WGW B;  3BFC A;  5EOE A;  3PAE A;  5KMW A;  3HL9 A;  3Q82 A;  4K0X A;  5CED A;  3UPN A;  4JF5 A;  1XXM A;  2WKH A;  3SS3 A;  4N1H A;  2V20 A;  1PWC A;  4DDY A;  2Y2N A;  5FQI A;  1IKI A;  4N9L A;  5AQ9 A;  1WYC A;  3M6B A;  2B5R A;  1HZO A;  1K56 A;  4X68 A;  3VP4 A;  1VM1 A;  2Y59 A;  5EEC A;  5FAS A;  1ES3 A;  1FCO A;  4S2J A;  4E3M A;  1CI8 A;  3HLG A;  1SHV A;  3WWX A;  1PI4 A;  4HES A;  3UPP A;  3Q7V B;  3G34 A;  4OP8 A;  1YLW A;  2XDM A;  3ZG5 A;  3ITB A;  1PWG A;  4JLF A;  2BLS A;  4E3I A;  3OPH A;  4L0L A;  4YIN A;  4IVI A;  1IYS A;  4RX3 A;  1M6K A;  3M6H A;  3HBR A;  4RX2 A;  4ZTK A;  5KSH A;  3HLF A;  4QU3 A;  4ZJ3 A;  1O07 A;  2PU2 A;  2WAF A;  3BEB A;  5DTK A;  4FH2 A;  4RVA A;  4OPZ A;  1NYY A;  1ES5 A;  2G2U A;  3FZC A;  3AGF A;  4KG6 A;  4BJP A;  4R3B A;  1SKF A;  3GMW A;  4QY6 A;  5G18 A;  1FR6 A;  4IED A;  2H0T A;  2R9W A;  4WEK A;  1ERQ A;  4RA7 A;  5HAI A;  1BZA A;  1KGG A;  3UN7 A;  3VMA A;  3VSL A;  2XFS A;  3OPL A;  2WGI A;  4QD4 A;  3OC2 A;  2JE5 A;  1I5Q A;  4KQR A;  4FH4 A;  4KZ3 A;  2P9V B;  4HBT A;  4Y0T A;  3V5M A;  1IYO A;  1FQG A;  3G35 A;  3GV9 A;  4RYE A;  1Q2Q A;  1EI5 A;  3IXD A;  5A90 A;  3A3I A;  5TGF A;  2HP9 A;  1IYQ A;  4HBU A;  4MBH A;  3MXS A;  3IXG A;  4KZ4 A;  3RXW A;  3V50 A;  1SDE A;  3VSK A;  4U0T A;  4PM6 A;  2WGW A;  4ZBE A;  1N4O A;  1NRF A;  3TG9 A;  4WYY A;  2WKE A;  3ZVW A;  5BOH A;  2X71 A;  4UHU A;  1YM1 A;  3IH9 A;  2Y2O A;  1M40 A;  5EOO A;  1FSY A;  4C6Y A;  3OPP A;  4H8R A;  5KSC A;  3ISG A;  4E6X A;  1L0E A;  3ZG0 A;  3BFE A;  4DXC A;  1HVB A;  4FCF A;  3ZG9 B;  4EV4 A;  2Y2K A;  3IF5 A;  3NDE A;  5CGS A;  3A3J A;  4B4X A;  4WZ4 A;  5U47 A;  4OOL A;  4LCL A;  4WZ5 C;  5EVI D;  2EX6 A;  3N8S A;  4JF4 A;  1WE4 A;  5FQM A;  3UY6 A;  2P74 A;  4EBN A;  1XGJ A;  2C6W B;  3VOZ A;  1K57 C;  2IWD A;  1BTL A;  2ZC6 B;  4N9K A;  2XD5 A;  3IWI A;  1XPB A;  2IWC A;  4QHC A;  2Y2L A;  3WS1 A;  1BLC A;  3VP3 A;  3ITA A;  3IHA A;  5AQ7 A;  4R3J A;  1BUL A;  2Y2Q A;  3OCL A;  4WEL A;  4JXW A;  4ZAM A;  3IT9 A;  1JTG A;  1LL9 A;  4K0W A;  2WZZ A;  1PW1 A;  2JC7 A;  1GCE A;  2XD1 A;  3EQV A;  3OZH A;  4YFM A;  4DE3 A;  4BEN A;  4OKP A;  4U3T A;  4DKI A;  3SS5 A;  3TSG A;  1Q2P A;  2EX2 A;  1AXB A;  1YLZ A;  3E2L A;  5FQJ A;  5M19 A;  5M18 A;  4KG5 A;  3O3V A;  2HP5 A;  1ZG4 A;  4K91 A;  3ZHH A;  4U0X A;  4C3Q A;  3W4Q A;  2QMI A;  2J9O A;  2ZQD A;  1MKI A;  4R1G A;  1MXO A;  1ERO A;  4Y7P A;  2P9V A;  3PBT A;  1MY8 A;  2HDQ A;  2EXB A;  4XUZ A;  1RGZ A;  3ZNT A;  3BLM A;  2QZ6 A;  4E3O A;  5GL9 A;  3GR2 A;  4Z9Q A;  4MLL A;  3JYI A;  2EFX A;  1K56 D;  1MPL A;  3PBS A;  4GOG A;  4E3N A;  2WKI A;  3ZCZ A;  4MNR A;  3EQU A;  1ES4 A;  2ZC7 A;  1PZP A;  4B88 A;  3IH8 A;  1QME A;  3N4I A;  5M1A A;  5KZH A;  4NET A;  2XFT A;  2EFU A;  5GLA A;  4OPY A;  1YT4 A;  3S1Y A;  3HUO A;  3NI9 A;  3N8L A;  3W8K A;  3OPR A;  4KQO A;  3IQA A;  3PBQ A;  4PM8 A;  1E25 A;  3PAG A;  4KZ9 A;  5EUA A;  4P0M A;  4S2O A;  4JPM A;  5CRF A;  4DE2 A;  3BYD A;  1RCJ A;  1ONG A;  4N1X A;  1G6A A;  2A49 A;  3DTM A;  3HLE A;  3IWQ A;  3QNB A;  4OLD A;  5GLD A;  4EQI A;  3AGE A;  3S4X A;  2Y4A A;  1RGY A;  5E2H A;  3HUN A;  4FD8 A;  2VGK A;  1ES2 A;  5FQQ A;  4KQQ A;  1LI9 A;  5DF8 A;  4ZJ2 A;  4R4S A;  1ZKJ A;  2DNS A;  1YMS A;  5EE8 A;  4X53 A;  3UE1 A;  3MKE A;  4P87 A;  3GVB A;  3BFF A;  1KE0 A;  5CTN A;  3LO7 A;  5FAQ A;  2WAD A;  4PPR A;  4CPK A;  1K57 A;  4PM9 A;  3UNW A;  2XGN A;  4DDS A;  1CK3 A;  4LV2 A;  2CC1 A;  1KGF A;  4S2N A;  5FQK A;  4PMA A;  2FFY A;  4LV0 A;  5GHY A;  3C7U A;  1W8Y A;  4E3J A;  2X02 A;  4LV1 A;  5CER A;  5E2G A;  1L0G A;  2Y55 A;  4M3K A;  3C5A A;  3Q7Z A;  2BG1 A;  5FAT A;  2ZC4 B;  1XA1 A;  2E8I A;  2ZJ9 A;  1NZO A;  1BSG A;  4E6W A;  1YLJ A;  3ZG7 B;  1IEL A;  3PBN A;  4EBP A;  4KZ5 A;  5I94 A;  3MZF A;  5EPH A;  2I72 A;  2WZX A;  4WMC A;  1IKG A;  2VGJ A;  4WM9 A;  1ESU A;  2Y2P A;  3G32 A;  1JVJ A;  3N8R A;  1H8Z A;  4OP5 A;  4GD8 A;  2ZM0 A;  3O86 A;  1L0D A;  4FSF A;  4BL2 A;  1PWD A;  3SH8 A;  3V39 A;  3WS5 A;  3FKV A;  3PBO A;  1IEM A;  1IYP A;  1K6S A;  2J7V A;  3G4P A;  5D3O A;  5HAP A;  3G31 A;  1ERM A;  1JWZ A;  5F82 A;  1W7F A;  4DXB A;  5DF7 A;  1E3U D;  1PIO A;  1VQQ A;  4S2K A;  1CI9 A;  1PI5 A;  1YMX A;  2EX8 A;  2JCH A;  1FR1 A;  3UE3 A;  3DWK A;  3HLB A;  1LLB A;  5E2E A;  2R9X A;  3CMZ A;  5GHX A;  3MXR A;  4QB8 A;  3MBZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...