3P98A

The crystal structure of the extended spectrum beta-lactamase tem-72 reveals inhibition by citrate
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
263
structure length
263
Chain Sequence
HPETLVKVKDAEDKLGARVGYIELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRWEPELNEAIPNDERDTTTPAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGASKRGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Beta-lactamase TEM-72
publication title Structure of the extended-spectrum [beta]-lactamase TEM-72 inhibited by citrate
pubmed doi rcsb
source organism Morganella morganii
total genus 99
structure length 263
sequence length 263
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-10-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 3p98A00
3IWOA 1SDNA 1N9BA 3BEBA 1XGIA 3C7VA 3Q1FA 3CZDA 2P9VB 3A3DA 5M19A 3VP0A 2GDNA 5TFQA 1Q2PA 4GOGA 3MZEA 3OPPA 5GHZA 4E3IA 2HP6A 2Y2PA 4FCFA 3V39A 1W8YA 1ONGA 2EX6A 4OKPA 4S2NA 3ZCZA 4PM9A 1PWCA 4OPQA 3GSGA 5EOEA 5FATA 1DJCA 2XD5A 1NZOA 5DTKA 3C5AA 1ZG6A 2Y2MA 3ITAA 5F1GA 1HVBA 3ZDJA 1K25A 1KVMA 4S2OA 3UO9A 5HAQA 1Y54A 3IF5A 4R4SA 5E2EA 3C4OA 2Y59A 2JE5A 1PIOA 3QHYA 4R23A 2Y4AA 4GD8A 4GDNA 3ZVTA 4KQOA 4IVKA 1JTDA 3G2ZA 1HZOA 1LLBA 1XGJA 4WMCD 1AXBA 4RX3A 4ZJ3A 1KVLA 1DJAA 4X55A 4BL2A 4EUZA 1RCJA 4C3QA 4S2KA 4OQHA 3IQAA 1PWGA 1RGYA 4H8RA 2B5RA 5TGFA 1YLYA 3HLGA 3UPOA 2JCHA 3UE3A 3DW0A 4BD1A 2WK0A 4MLLA 4OPRA 4WZ4A 2DCFA 2JC7A 3PBTA 4EQIA 4F94A 4GNUA 1YM1A 4QU3A 5GLBA 5GL9A 1W8QA 3HL9A 2WZZA 3UE0A 4GKUA 4R4RA 3Q82A 1XPBA 4OOYA 2WAFA 4OOMA 5JYPA 1KGEA 1PZPA 4QY6A 4UHUA 3W8KA 4QJGA 4DXCA 2EX8A 1BLSA 1O07A 5FAOA 2DNSA 4JF5A 3M2KA 1SHVA 3P98A 5EPHA 3Q81A 5EUAA 3BRMA 3SS4A 2XEPA 2Z2MB 2R9XA 4JPMA 4Y7PA 3IHBA 2ZD8A 4M3KA 1GHPA 4CPKA 5HX9A 2WGWA 4MBKA 4RYEA 4KG2A 3BLSA 2WKIA 5HARA 4WEKA 5GLDA 1HD8A 1PW1A 1EI5A 2V1ZA 5HAIA 4KZ9A 4OP5A 5AQ7A 2WGWB 3ZFZA 1DJBA 3N8SA 1FQGA 1KE4A 1S0WA 3FZCA 4JXSA 3CG5A 3G30A 3IF6A 1S6RA 5E2GA 4ZJ2A 3UN7A 3VFHA 1YLPA 2EXAA 1FCNA 2BG1A 1SKFA 2FFYA 3G32A 4GN2A 4LCMA 4OQ0A 4OQGA 5CRFA 1ERMA 1IYPA 5CECA 2QMIA 1ZC2A 1K54A 3NDGA 4UA6A 4WZ5C 4ID4A 4K91A 3MZDA 4JBFA 3A3JA 5EOOA 4X6TA 3ZG5A 4FD8A 3N8RA 1Q2QA 5KMWA 5GHYA 1JWZA 1I2WA 1I5QA 2ZM2A 2Y91A 3GV9A 5CERA 2EXBA 3LEZA 5AQ9A 4PM6A 3N7WA 3Q07A 1FSWA 2FFFB 4S2PA 3VOYA 3OPLA 4HEFA 1YLWA 5FSRA 4B4XA 5FAPA 1FOFA 4KZBA 1ES4A 1IKGA 3IH9A 5AQBA 2Q9MA 5A92A 1XA1A 4E3MA 1YT4A 3RJUA 1BTLA 5EVIC 3VSLA 2J7VA 5M1AA 2H0YA 1CEGA 1K57A 4BL3A 4X53A 4X68A 3GRJA 5DF8A 3SS3A 1YMXA 4XXRA 2Y2GA 4BQMA 4OOLA 5DVAA 2ZLYA 3NBLA 1FR1A 1MWSA 4OLDA 1LI9A 1E25A 2ZQ7A 2WAEA 3HREA 5F83A 2XGNA 4KZ8A 1YLJA 1KE3A 4OP8A 1EWZA 5AQAA 3ZG8B 1WYBA 4X56A 3IXGA 1SCWA 1L0FA 1JVJA 1YMSA 1LHYA 3UDXA 1KGGA 4OH0A 3BLMA 4PMAA 4LCLA 2JBFA 3P09A 4JLFA 2PU2A 4DE0A 2G2UA 1IKIA 2OLUA 4KG5A 2OLVA 4QHCA 2IWDA 2VGJA 3FYZA 2XK1A 3B3XA 2WYXA 3RXWA 1QMFA 3IHAA 3A3IA 3FV7A 2XH9A 1PYYA 4IBRA 3IT9A 2X02A 1BZAA 4QD4A 5E43A 3SH8A 5IHVA 4IVIA 4ZAMA 3MKEA 1ONHA 3O88A 2ZC6B 3CJMA 2QZ6A 2ZQAA 1KDWA 1PZOA 1G6AA 3MFDA 1GCEA 1E4DA 4LV2A 2XR0A 4JXGA 3W4QA 1CI8A 1SDEA 4JF4A 3WS4A 3WRZA 5CHJA 4EWFA 3ZG7B 1FSYA 4HBTA 1FCOA 4S2NC 5HFOA 2Y2HA 2Z2LB 3M2JA 1K4FA 3DWKA 3G31A 4Y0UA 3WWXA 4UA7A 1FR6A 4JKTA 1W5DA 1U60A 4WEJA 2HP5A 2V20A 4WMCA 1IEMA 5EVID 1W7FA 4DKIA 4E6WA 3FKWA 4BJPA 4YFMA 1BLCA 1CEFA 4WZ5A 4U0XA 1K55A 4LV1A 4JXWA 1ZKJA 1WYCA 3S22A 4BD0A 2Y2LA 3A3EA 4DE3A 2X71A 3MXSA 4Q8IA 3BYDA 1K56D 1NYMA 5FQQA 1KGFA 2ZM0A 4R1GA 2J9PA 1IELA 2P74A 5HAPA 4PM5A 4L0LA 1MWRA 3ZHHA 2Q9NA 3G34A 3A3FA 2ZM8A 4HBUA 3E2LA 5EVLA 1MXOA 2EFUA 3M6BA 4N1HA 3N8LA 2J8YA 5DTTA 5KSCA 3GTCA 3VFFA 3ZG0A 1XA7A 3LY4A 3ITBA 1YLZA 1ESUA 2H0TA 4KZ7A 5HW3A 3PBSA 2RL3A 2HPBA 2ZC4B 3G4PA 3HLCA 4WM9A 5EVIA 4WBGA 3UPNA 2QPNA 3GR2A 3NC8A 3LCEA 2A3UA 2WGIA 2Y2JA 3PBRA 3MKFA 1BLHA 1MPLA 1JTGA 4KZ5A 4JF6A 1H5XA 5EVIB 1OMEA 3ISGA 4NK3A 3JYIA 5TR7A 4KZ4A 3HLBA 1DY6A 3IXBA 4DE1A 4KZ3A 3MXRA 4B4ZA 4GDBA 1GA0A 1MWUA 3HLEA 3TSGA 5FQJA 5GLAA 3N4IA 3HLDA 1E3UD 1MY8A 4ZTKA 3VMAA 5U47A 5BOHA 4P85A 3ZNTA 3E2KA 1TDGA 2E8IA 1ERQA 4O7DA 5FI6A 3UPPA 3OPHA 4UA9A 5DF9A 1H8YA 1I2SA 4DDYA 4X69A 1K38A 1CI9A 5FQ9A 4WYYA 5D3OA 2RCXA 3S4XA 1PWDA 1XX2A 5FDHA 1L0EA 2UWXA 1LL5A 3UE1A 3IF6C 3VP4A 4S2IA 3V5MA 4LV3A 4C6YA 5CGSA 4GZBA 2PU4A 3TOIA 2J9OA 3LO7A 4IBXA 4E3KA 5FASA 5FQMA 2A49A 4K0XA 3WS5A 3GQZA 3PBNA 5CGXA 4DE2A 3FWLA 3WS1A 2EX9A 2XD1A 5I94A 3HUNA 4K0WA 5CXWA 4OLGA 2WUQA 2ZQ9A 4EBLA 3MBZA 4C75A 2ZMAA 2H5SA 2ZQDA 1MWTA 4MBHA 2IWCA 4WELA 3S1YA 1JWPA 4E3JA 4DXBA 3QNBA 3RXXA 3IXHA 5J8XA 2EX2A 3EQUA 3NDEA 3V3SA 1K4EA 5EE8A 2HDQA 4NETA 1KE0A 1NJ4A 4B88A 3PAEA 4QB8A 2WGVA 3MZFA 1K6SA 2X01A 3PAGA 3PTEA 1G68A 4R0QA 1PW8A 4OPYA 1M6KA 1NYYA 5CTNA 1VM1A 3SH7A 4EV4A 1IYOA 2HDUA 2WADA 3BFEA 5FI2A 1ES2A 3WS2A 4LV0A 4MNRA 2C6WB 2XF3A 3DTMA 5CHUA 1K57C 4QY5A 1TDLA 1Z6FA 3LY3A 3VOZA 5DTSA 3SH9A 4KZ6A 3SS5A 3IWQA 1GHMA 3NIAA 3N6IA 4ZJ1A 3ZG9B 3Q7ZA 3AGFA 3BFCA 2WKEA 4FH4A 3CMZA 3UNWA 2ZQCA 1BSGA 1PI4A 4OONA 4N1XA 1L0DA 1BULA 4U0TA 1O7EA 2XDMA 4ZDXA 3M6HA 3ZVWA 2VGKA 3HUOA 3O86A 3VP1A 2XFTA 4LENA 4DRTA 4E3OA 3BM6A 1TVFA 1IYSA 1J9MA 4Y0OA 2XLNA 3DWZA 1L2SA 2I72A 2ZC3B 1JWVA 2XFSA 1ALQA 1PI5A 3FKVA 1VQQA 3QNCA 1CK3A 4RX2A 2Y2QA 4P0MA 4U3TA 4HESA 3TG9A 1XP4A 1MKIA 1XKZA 2Y2IA 3HLWA 5A91A 4P87A 3OC2A 2WKHA 1BUEA 4S2LA 5M18A 4KZAA 3ZGAB 2XQZA 2Y2KA 2IWBA 3VP3A 3UY6A 3V50A 4OPZA 4P6BA 4A5RA 3OCLA 5E2FA 4DDSA 1H8ZA 4S2MA 4CJNA 3BFDA 1YLTA 4OQIA 3IH8A 5A93A 4EBPA 1IYQA 4N9KA 4BENA 3I7JA 5CGWA 1ES5A 2Y2OA 4GD6A 3OCNA 4RA7A 1FCMA 1EROA 2HP9A 4KQQA 3V3RA 4BLMA 1W79A 4DF6A 1RP5A 4GB7A 3PBQA 4Z9QA 3IWIA 3BECA 5CHMA 3WS0A 3PBOA 3NY4A 5DF7A 4ZBEA 4MBFA 3C4PA 1MBLA 1NXYA 2ZQ8A 1ES3A 3NI9A 1BT5A 4EBNA 3BFGA 5F82A 2CC1A 5FAQA 2BLSA 1N4OA 1NRFA 2EFXA 3OZHA 5G18A 1K6RA 5GLCA 3ZNYA 3W4OA 4XUZA 3OPRA 1L0GA 4N92A 4UAAA 1M40A 1NY0A 4N9LA 4PM8A 5A90A 5F1FA 3HBRA 5JYOA 5FQKA 5GHXA 1K56A 1YQSA 4PPRA 5CEBA 1TEMA 3O87A 3EQVA 4R3JA 2HDRA 1ESIA 4OVDA 3IF6B 1QMEA 5FQIA 4E3NA 1K55C 4IEDA 3C7UA 3VSKA 2R9WA 3UDIA 2DRWA 4R3BA 3HUMA 4XUXA 5L2FA 3AGEA 4KQRA 3HLFA 1LL9A 4MEZA 2HDSA 3BFFA 3Q7VA 2Y55A 1BLPA 2V2FF 3VP2A 1LI0A 4E6XA 4FH2A 5KZHA 4KG6A 2OV5A 4D2OA 2Y2NA 1WE4A 2C5WB 4PM7A 2OSUA 5E2HA 3AGDA 3Q7VB 4Y0TA 1C3BA 3G2YA 4KENB 1NZUA 5KSHA 5FI7A 2ZC7A 4JXVA 5HL1A 2PBYA 1ZG4A 5EECA 4E3LA 1KDSA 1K54C 2G2WA 3WRTA 1GHIA 1GA9A 2WZXA 3GVBA 1HTZA 2H10A 4FSFA 3UDFA 3W4PA 5CEDA 1XXMA 3D4FA 3GMWA 3O3VA 3HVFA 2ZC5B 4S2JA 4YINA 3SOIA 3IXDA 2P9VA 3G35A 5CTMA 4RVAA 3NCKA 1E3UA 2ZJ9A 5FA7A 1RGZA
chains in the Genus database with same CATH superfamily
1N9BA 3DBAA 1N9OA 1XJ6A 1XGIA 3CZDA 4I3JA 3VP0A 1Q2PA 4GOGA 4E3IA 2KX6A 1YPRA 4S2NA 4PM9A 2M7VA 5EOEA 5FATA 1T1BA 2Y2MA 4HI4A 5HAQA 3IF5A 1DP8A 4R4SA 4E04A 2JE5A 4R23A 2JKFA 3G2ZA 2YKHA 4QWOA 5L10A 1AXBA 3T4SA 3LIEA 5DFXA 1RCJA 4C3QA 3NHQA 1PWGA 1L3LA 5I5LA 1YLYA 2JCHA 3UE3A 3DW0A 4BD1A 5EVEA 4QU3A 3HL9A 3UE0A 1KGEA 4QJGA 4UHUA 2EX8A 3KSGA 2IA2A 3M2KA 3P98A 2PR6A 2Z2MB 2R9XA 4AFIA 2ZD8A 5HL6A 3JVVA 3CAXA 4RYEA 3BLSA 2VEAA 2WKIA 4WEKA 3ICYA 1HD8A 1EI5A 2V1ZA 5HAIA 4DJ2A 4X25A 4OP5A 5AQ7A 3LR3A 3N8SA 1KE4A 4JXSA 3FZCA 3CG5A 3G30A 3IF6A 5E2GA 2P08A 4ID4A 4K91A 4WN5A 2L4RA 3QP5A 4GS9A 4UQIS 3GECA 1Q2QA 4KUOA 4GS9B 1T1CA 1VEUA 2ZM2A 4S2PA 4HEFA 5FEGA 1VEUB 4KZBA 2PAVP 3F1NA 1IKGA 2R78A 3DTIA 4EUVA 3RJUA 1BTLA 3F1NB 3TW8A 4F3LA 4BL3A 3E4OA 2HV1A 3SS3A 4XXRA 2JN7A 3UB8A 4RQ9A 2EA9A 2Z6CA 4F3LB 2O9BA 1MWSA 3H7WA 5L09A 3QP2A 2XGNA 3KSFA 2VKSA 3IX4A 3TJZC 3H7WB 4OP8A 3ZG8B 2A2LA 2GZAA 1L0FA 1YMSA 1LHYA 3UDXA 2M1CA 3BLMA 1OJGA 4PMAA 3E0YA 1YSPA 4DE0A 2NUTC 3LIBA 1Y4OA 1VHMA 1PNEA 3C8CA 2XK1A 4O01A 5EM1A 3H82B 3RXWA 1QMFA 2VX8A 3FV7A 4I39A 2XH9A 1PYYA 5G4YA 3S7PA 2ZMVA 1DRMA 1BZAA 4FOFA 3MKEA 4LGWA 3O88A 4WLAA 2W3HA 2ZC6B 2ZQAA 2EWWA 3IS2A 1GCEA 4LV2A 4EWFA 1CI8A 3WS4A 5CHJA 4NXBA 4HBTA 3T4KA 4EU0A 3DWKA 3IS2B 4Y0UA 3WWXA 3PXPA 3G6OA 2V20A 5AJGA 3R7WA 4WUJA 4BJPA 4YFMA 1CEFA 4WZ5A 4U0XA 5KIZA 2JKRI 1ZKJA 3LR4A 3IX3A 3R7WB 3MXSA 3BYDA 2JKTM 4FUWA 4EQ1A 4PM5A 1ODVA 2GNXA 3E2LA 5EVLA 2Q0OA 5DTTA 5J4EA 4DN0A 3VFFA 4KZ7A 5HW3A 2EWVA 3ULFA 3HLCA 1YSQA 5EVIA 4WBGA 3GR2A 2A3UA 3MKFA 1MPLA 4JF6A 2YKFA 3OOVA 5EVIB 1OMEA 5TR7A 3JYIA 1DY6A 3CUEA 4HH3A 4PHTA 4DE1A 4KZ3A 3TSGA 5EFWA 3OBFA 3BY8A 1ERQA 3OPHA 5DF9A 4PKYA 4IJGA 5FQ9A 1PWDA 2QKPA 3VP4A 2HF6A 1S4RA 4NKPA 3LIFA 2J9OA 3LO7A 1T1AA 3GQZA 5CGXA 2PD8A 3WS1A 1F2KA 4K0WA 5CXWA 4OLGA 2VA0A 5HWWA 3MQ0A 2ZQ9A 1IFQA 4C75A 1MWTA 4MBHA 2IWCA 4DXBA 1JWPA 3EQUA 3V3SA 1OPXA 3PAEA 2OOLA 2X01A 1G68A 4EV4A 2HDUA 3BFEA 5DJUA 4MNRA 2C6WB 2XF3A 3DTMA 1K57C 2K7SA 3LY3A 3SS5A 3NIAA 3U2AA 4G3WA 3K3CA 3ZG9B 2WKEA 1TS8A 3CMZA 1EW0A 2ZQCA 4OONA 1L0DA 1BULA 4NXFA 4U0TA 2W3GA 2VJWA 2VGKA 3HUOA 3E4QA 3MSHA 2XFTA 1J9MA 5HPFA 2XLNA 1G28A 1G6OA 2XFSA 1PI5A 3FKVA 1VQQA 3QNCA 1CK3A 4RX2A 2Y2QA 4P0MA 3TG9A 1OT6A 4ETZA 1XKZA 3HLWA 2XSSA 4P87A 2B18A 2XQZA 2Y2KA 3V50A 3OCLA 4QPRA 4DDSA 4MN7A 2D01A 4BBVA 4H6JB 5HDSA 5K5BA 2HP9A 5HDCA 3V3RA 4BLMA 1W79A 4GB7A 1H3QA 5FDSA 5CHMA 3WS0A 3S7NA 4MBFA 4Q0IA 1ES3A 5F82A 3OZHA 3W4OA 4XUZA 3MXQA 3LR0A 4N9LA 4PM8A 1K56A 3L9KA 3EQVA 4R3JA 3QP1A 2D02A 2W1TA 4HJ6A 3UDIA 5EV0A 4KQRA 2XRNA 2OAP1 1BLPA 2V2FF 2W1TB 2V8FA 4E6XA 5KZHA 1WE4A 2L1MA 5E2HA 3AGDA 1C3BA 5KSHA 1X0OA 2PBYA 2P04A 1T18A 5EECA 1FILA 2G2WA 1GA9A 3GVBA 2H10A 4FSFA 3UDFA 3W4PA 3HJKA 4I3AA 3GMWA 2ZC5B 4HY8A 3G35A 4GHIA 1E3UA 5JYOA 2XA7S 2L0WA 1RGZA 1GSWA 3Q1FA 5M19A 4GHIB 4PAUA 5GHZA 3MZEA 3OPPA 4FCFA 1W8YA 1ONGA 4GLQA 3ZCZA 2J3TD 1PWCA 4OPQA 1DJCA 2QYBA 1LL8A 4HP9A 3D9YA 4IUHA 3C5AA 5DTKA 1ZG6A 3ITAA 5F1GA 3ZDJA 1K25A 4S2OA 5HD5A 4GD8A 4GDNA 3ZVTA 1S67L 2PYRA 4IVKA 5CX7A 4WMCD 1LLBA 4EUZA 4HJ4A 1S1ZA 4HHDA 4OQHA 5TGFA 3HLGA 5TBMA 3KYEA 2WK0A 2DCFA 3CI6A 4EQIA 3P01A 5TBMB 5GL9A 1W8QA 1TF1A 4GKUA 3Q82A 2PR5A 4OOMA 3W8KA 4MCWA 5FAOA 1P0ZA 3F1OA 4R70A 4Y3IA 3SS4A 4JPMA 4M3KA 1LT0A 2VGLS 3F1OB 5HARA 1AWIA 1XFNA 2ACGA 4CLCD 1A0KA 3RTYA 1S0WA 5EM0A 4ZJ2A 2EXAA 2BG1A 1OTAA 1SKFA 2FFYA 4GN2A 4LCMA 4OQ0A 4OQGA 2PRFA 4X1LA 5F68A 1K54A 3NDGA 4UA6A 4WZ5C 3MZDA 4FD8A 4MDZA 5HDDA 5KMWA 1JWZA 1I5QA 3IBRA 5CERA 5AQ9A 4ETXA 1FSWA 4HNBA 5FSRA 5FAPA 5HPIA 3IH9A 5AQBA 1OJ5A 4E3MA 2JHEA 4MN6A 2FZ0A 5EVIC 3VSLA 4BBTA 1K57A 4X53A 4X68A 3KYQA 3BQ8A 3CUEC 5DFYA 3NBLA 2MJ6A 2VV6A 2ZQ7A 5F83A 4Y2FA 1W63M 4G3KA 1KE3A 3VOLA 3MFXA 3IXGA 1SCWA 3NULA 3CHWP 1MKMA 1P9RA 4LCLA 3FG8A 4JLFA 3K2NA 2G2UA 4UQIM 1IKIA 3T4LA 4KG5A 4NG2A 4NXGA 4CLCE 2VGJA 2ZMFA 1NWZA 1ZHHB 3IT9A 3LIDA 2X02A 5E43A 4IVIA 3A0RA 3KO6A 4UEYA 1G6AA 1V9ZA 1E4DA 3V67A 3T4OA 4JF4A 3WRZA 1FSYA 2Y2HA 1K4FA 1W5DA 3T12B 1UGUA 4LFUA 4L9EA 3S22A 4BD0A 4IHQA 5FQQA 1KGFA 4R1GA 1IELA 4L0LA 1MWRA 3ZHHA 2Q9NA 4G3VA 3NJAA 3ITBA 1YLZA 1ESUA 4Y17A 2AVXA 3PBSA 2RL3A 2HPBA 2QPNA 3LCEA 4EEUA 1H5XA 2O9CA 3HLBA 3IXBA 1XJ2A 1TD5A 3MXRA 4GDBA 1GA0A 3HLEA 1HLUP 1F98A 4ZTKA 4P6ZM 4HP4A 5U47A 3ZNTA 3E2KA 1TDGA 4L9FA 1XFQA 4O7DA 3FC7A 1I2SA 4DDYA 3LYXA 1CI9A 5D3OA 5IS1A 3UE1A 2VK3A 2I9VA 4LRZE 3V5MA 2Z6DA 1D1JA 2PU4A 3BWLA 2ZL1A 4I3IA 5FASA 1K0KA 3PBNA 3FWLA 2ZL1B 4JGPA 3HUNA 3UMDA 3MBZA 2HJEA 2ZQDA 3S1YA 1S4SA 3RXXA 3NDEA 3H82A 1KE0A 1NJ4A 1F9IA 1H8MA 3MZFA 1K6SA 3PTEA 1PW8A 2GX5A 5FEFA 1IYOA 2PD7A 5CHUA 4ME4A 3CLOA 4QY5A 1TDLA 5G4ZA 3T4JA 2HGVA 4JGQA 3PYPA 4FH4A 4O8GA 4R6LA 1BSGA 3UNWA 1PI4A 2XDMA 4ZDXA 3ZVWA 3GDIA 2QJ5A 3BM6A 4Y0OA 3DWZA 2GJ3A 3KX0X 1JWVA 2WKPA 1XP4A 5A91A 3TE8A 3VE4A 4GW9A 2IWBA 3DAVA 4OPZA 3T1RA 4KUKA 4CJNA 3BFDA 3EWKA 4EBPA 1IYQA 3BY9A 4N9KA 1H0MA 1ES5A 4GD6A 3OCNA 1FCMA 1EROA 1UWNX 4K08A 3IWIA 4PKYG 3PBOA 3C4PA 2ZQ8A 1OTBA 3NI9A 3BFGA 2CC1A 4JGOA 1N4OA 1NRFA 3ZNYA 3FPWA 3OPRA 1L0GA 4UAAA 1NY0A 5CEBA 3U4LP 2HDRA 4OVDA 4E3NA 4IEDA 3C7UA 2JKGA 2R9WA 3VSKA 1SKOA 4XUXA 1LL9A 2B02A 4MEZA 1F5MA 2HDSA 2Y55A 1SKOB 2OV5A 2Y2NA 2OSUA 4KENB 5FI7A 2ZC7A 1K54C 2WZXA 3D3OA 5CEDA 2B95A 1GSVA 4YINA 1PFLA 2P9VA 1PW1A 1SDNA 1VB6A 2P9VB 1YKDA 2GDNA 5TFQA 4HQAA 3HJIA 2HP6A 2Y2PA 4OKPA 2NUPC 2J3WA 3GSGA 5L8MA 2W1RA 3BW6A 2XD5A 1NLZA 2O0YA 1XJ4A 1HVBA 3UE6A 5E2EA 1PIOA 3F1PA 2FH5A 2PT7A 4DMZA 4KQOA 1XGJA 4ZJ3A 4X55A 1DJAA 3F1PB 4H8RA 5HD3A 2B5RA 3MR0A 4KQDA 5J3WA 3PBTA 4F94A 4GNUA 1YM1A 3IBJA 5GLBA 2WZZA 3OLOA 4R4RA 4OOYA 4H6JA 5JYPA 1DP6A 4QY6A 1O07A 3NOPC 2DNSA 5EPHA 1S66L 3RFBA 5EUAA 1WA9A 2XEPA 3DTEA 2WGWA 4MBKA 4X1MA 4KG2A 3MMHA 4KZ9A 2WGWB 2KOIA 1UWPX 1FQGA 2PBDP 3UN7A 1S6RA 3TRCA 3SW1A 4L9GA 4Q0JA 1YLPA 3LR5A 4ZRRA 5CRFA 2QMIA 1ZC2A 1BYWA 5C5KA 5EOOA 3ZG5A 3N8RA 3HCYA 4ARZB 1I2WA 2Y91A 2EXBA 3LEZA 4PM6A 3N7WA 3Q07A 3VOYA 1YLWA 4B4XA 1FOFA 1S1YA 1MZUA 5A92A 4NXEA 4CLCB 3CPTA 2J7VA 5M1AA 3MF0A 3CPTB 1TS7A 1CJFA 4BQMA 4OOLA 5DVAA 2ZLYA 4OLDA 4Y5FA 1DP9A 4KZ8A 3CITA 1YLJA 3C38A 2K2NA 1WYBA 1JVJA 1KGGA 4OH0A 2JBFA 2ZBBA 2PU2A 2WKQA 2OLUA 3D72A 4QHCA 2IWDA 3FYZA 2J80A 2M7UA 3A3IA 2VLGA 4IBRA 4Z1WA 1SZVA 3SH8A 5IHVA 3LEQA 3CJMA 3IX8A 2XR0A 3W4QA 3MS6A 5HL1A 1SDEA 4LRXC 1G5UA 5HFOA 3M2JA 3G31A 1FR6A 4JKTA 1U60A 2W3FA 2E8JA 1IEMA 1W7FA 4R38A 1BLCA 1OT9A 4ESPA 4LV1A 4JXWA 4EERA 2Y2LA 2OWJA 4DE3A 2X71A 1K56D 1NYMA 2ZM0A 2J9PA 3G34A 3A3FA 3CWFA 3JVUA 2EFUA 2J8YA 3KSIA 4LPZA 3EOIA 3LY4A 2H0TA 4BMWA 3G4PA 4WM9A 3C30A 4GCZA 2BASA 2WGIA 4BBUA 1JTGA 2V9AA 3ZQ5A 1MC0A 2LB5A 3ISGA 3LUQA 1ZTUA 4KZ4A 4EEPA 1TS0A 3LIAA 4B4ZA 3MJQA 1J3WA 1W63Q 1D7EA 5FQJA 1E3UD 5BOHA 2E8IA 3UB5P 4X69A 1YAXA 4WYYA 3S4XA 2UWXA 1LL5A 4O0PA 3VV4A 4LV3A 4C6YA 4EW7A 4GZBA 3BQAA 3LI8A 3TOIA 4E3KA 5FQMA 2PYPA 3WS5A 1T19A 2EX9A 2XD1A 3UMEA 2O9AA 5I94A 2H5SA 2OWHA 4E3JA 2EX2A 3C2WA 4JGRA 2HDQA 5MC7A 4B88A 4HJ3A 4R0QA 4OPYA 1M6KA 1NYYA 1VM1A 2WADA 5FI2A 3P7NA 3WS2A 5HWTA 4B9OA 2P7JA 3SH9A 3QP8A 1GHMA 2JKTI 4ZJ1A 3Q7ZA 3BFCA 2K31A 3PHYA 1N9LA 1O7EA 2DMWA 4HIAA 3O86A 3VP1A 4E3OA 1TVFA 1IYSA 2UV0E 2I72A 5DKKA 4U3TA 3E4PA 2WKHA 1BUEA 4S2LA 5M18A 4KZAA 3ZGAB 3VP3A 3UY6A 4A5RA 4HOIA 4EESA 5E2FA 4S2MA 3BJNA 3B47A 5CGWA 2Y2OA 2KLIA 2J3TC 5J7EA 1D06A 1RP5A 3PBQA 4Z9QA 2PDRA 3BECA 3NY4A 2PHYA 1NXYA 5L07A 4BWIA 1BT5A 3T1QB 5FAQA 2BLSA 2EFXA 4YWZA 2V1BA 4N92A 3LGOA 5GHXA 4PPRA 3O87A 4R3AA 5AVEA 3IF6B 5FQIA 1K55C 1TS6A 3VE3A 3BFFA 3Q7VA 5TJJA 3EEAA 1LI0A 4FH2A 4D2OA 2Y79A 3Q7VB 5F6AA 1NZUA 4YOFA 1GHIA 1LSVA 1XXMA 3D4FA 3O3VA 3SOIA 4S2JA 2Y8HA 2XROA 3B33A 2ZJ9A 5FA7A 3IWOA 3BEBA 3DTKA 3C7VA 3A3DA 2O99A 4I5SA 2INWA 3H9WA 4CLCC 3V39A 2EX6A 1FIKA 2W0NA 1NZOA 4D60A 1KVMA 1IOUA 2VV8A 3UO9A 3W2ZA 1Y54A 3C4OA 2Y59A 3S7QA 3QHYA 2Y4AA 1JTDA 4WF0A 1HZOA 4RX3A 1KVLA 4BL2A 5F5YA 4S2KA 3IQAA 1RGYA 3FPVA 3UPOA 4MLLA 4OPRA 4WZ4A 2JC7A 5HSQA 2V1AA 4MMNA 1XPBA 2WAFA 1PZPA 4DXCA 4P6ZS 1BLSA 5A8BA 4JF5A 1SHVA 2QWSA 3Q81A 1GSXA 3BRMA 4Y7PA 3IHBA 1GHPA 4CPKA 5HX9A 5GLDA 2KDKA 3K3DA 3ZFZA 4IUKA 1DJBA 3VFHA 1FCNA 3EGXC 3G32A 2HZ5A 3O5YA 1ERMA 1IYPA 5CECA 3T50A 4NEED 4JBFA 3A3JA 4X6TA 1Y28A 2V8CA 5GHYA 3MQQA 1OTEA 3GV9A 2BTFP 2FFFB 3OPLA 1LSXA 1ES4A 1NRJA 2Q9MA 1XA1A 1YT4A 3LICA 1P97A 2H0YA 1CEGA 4CQHA 3GRJA 5DF8A 4B93A 4GJ4A 1YMXA 5F69A 2W3EA 1Z09A 2Y2GA 3ZYTA 1VETA 1FR1A 1LI9A 1E25A 2WAEA 3HREA 1VETB 1EWZA 5AQAA 4X56A 4II7A 3P09A 2VZWA 3T1SA 2OLVA 3UB9A 4HH2A 3B3XA 3KYZA 2WYXA 3IHAA 4EXOA 3UB7A 4QD4A 4ZAMA 1ONHA 2QZ6A 3NOUC 1KDWA 1PZOA 3MFDA 2G7UA 4JXGA 4Y15A 3ZG7B 4S2NC 1FCOA 2XA7M 2Z2LB 4UA7A 4WEJA 1JNUA 2HP5A 4WMCA 5EVID 4E6WA 4DKIA 3FKWA 1K55A 3E98A 1WYCA 3A3EA 4Q8IA 2QHKA 2HJ9C 2P74A 5HAPA 3QP4A 1STZA 2ZM8A 4HBUA 3B42A 1MXOA 3M6BA 4N1HA 3N8LA 5KSCA 3GTCA 3ZG0A 1XA7A 4ARZA 3UPNA 2JKRM 2ZC4B 3NC8A 3KSHA 2Y2JA 3PBRA 1BLHA 1XJ3A 1V9YA 4KZ5A 4NK3A 5DKLA 3T1XA 1MWUA 5GLAA 2H28A 3N4IA 4CLCA 3LFVA 3HLDA 1MY8A 3VMAA 4P85A 5FI6A 3UPPA 3S7OA 5DJTA 4UA9A 1H8YA 1KOUA 1K38A 2RCXA 1XX2A 3MQOA 1L0EA 5FDHA 1ACFA 2QJ7A 2VGLM 3IF6C 5IT5A 4S2IA 5CGSA 2WKRA 2ZOHA 4IBXA 2A49A 3RH8B 4K0XA 2A24A 4DE2A 5FL3A 5HZHA 4M4XA 1N9NA 2WUQA 2A24B 4EBLA 2ZMAA 3EEHA 4WELA 5J8XA 3QNBA 3IXHA 1LSWA 1K4EA 5EE8A 4NETA 4QB8A 2WGVA 3PAGA 3PR6A 5HWVA 2ZOIA 5CTNA 3SH7A 1P9WA 4Q0HA 1ES2A 4LV0A 1Z6FA 5IU1A 3SZTA 1NLYA 3VOZA 5DTSA 1OTIA 4KZ6A 3IWQA 3N6IA 3AGFA 4XT2A 4N1XA 3M6HA 4DRTA 4LENA 4FTXA 4YNRA 3UB6A 4XT2B 3JPUA 1L2SA 2ZC3B 1ALQA 2V0WA 4HESA 4MN5A 1MKIA 2Y2IA 3T4TA 2LB9A 3OC2A 2V0UA 4P6BA 1H8ZA 1YLTA 4OQIA 3IH8A 5A93A 4EETB 2W27A 4BENA 3I7JA 4RA7A 3LI9A 4KQQA 4DF6A 3A0VA 4LLOB 1OTDA 5DF7A 4ZBEA 1MBLA 5LBRA 2CMNA 3R4KA 1PRQA 4EBNA 5G18A 5GLCA 1K6RA 4WL9A 1M40A 5A90A 5F1FA 3HBRA 5FQKA 1YQSA 1TEMA 4Y13A 2VV7A 3A0SA 2W3DA 3EGDC 3NECA 1ESIA 1CF0A 1QMEA 2DRWA 4R3BA 3HUMA 5L2FA 3AGEA 3NOTC 3HLFA 4I38A 3T4QA 3VP2A 4KG6A 2C5WB 4PM7A 4Y0TA 3G2YA 3QP6A 4JXVA 1CQAA 1ZG4A 4E3LA 1KDSA 5AVFA 3WRTA 4DJ3A 1HTZA 4LRYC 3HVFA 3L7HA 2OAQ1 3IXDA 5CTMA 4RVAA 3NCKA
chains in the Genus database with same CATH topology
3IWOA 1SDNA 1N9BA 3BEBA 1XGIA 3C7VA 3Q1FA 3CZDA 2P9VB 3A3DA 5M19A 3VP0A 2GDNA 5TFQA 1Q2PA 4GOGA 3MZEA 3OPPA 5GHZA 4E3IA 2HP6A 2Y2PA 4FCFA 3V39A 1W8YA 1ONGA 2EX6A 4OKPA 4S2NA 3ZCZA 4PM9A 1PWCA 4OPQA 3GSGA 5EOEA 5FATA 1DJCA 2XD5A 1NZOA 5DTKA 3C5AA 1ZG6A 2Y2MA 3ITAA 5F1GA 1HVBA 3ZDJA 1K25A 1KVMA 4S2OA 3UO9A 5HAQA 1Y54A 3IF5A 4R4SA 5E2EA 3C4OA 2Y59A 2JE5A 1PIOA 3QHYA 4R23A 2Y4AA 4GD8A 4GDNA 3ZVTA 4KQOA 4IVKA 1JTDA 3G2ZA 1HZOA 1LLBA 1XGJA 4WMCD 1AXBA 4RX3A 4ZJ3A 1KVLA 1DJAA 4X55A 4BL2A 4EUZA 1RCJA 4C3QA 4S2KA 4OQHA 3IQAA 1PWGA 1RGYA 4H8RA 2B5RA 5TGFA 1YLYA 3HLGA 3UPOA 2JCHA 3UE3A 3DW0A 4BD1A 2WK0A 4MLLA 4OPRA 4WZ4A 2DCFA 2JC7A 3PBTA 4EQIA 4F94A 4GNUA 1YM1A 4QU3A 5GLBA 5GL9A 1W8QA 3HL9A 2WZZA 3UE0A 4GKUA 4R4RA 3Q82A 1XPBA 4OOYA 2WAFA 4OOMA 5JYPA 1KGEA 1PZPA 4QY6A 4UHUA 3W8KA 4QJGA 4DXCA 2EX8A 1BLSA 1O07A 5FAOA 2DNSA 4JF5A 3M2KA 1SHVA 3P98A 5EPHA 3Q81A 5EUAA 3BRMA 3SS4A 2XEPA 2Z2MB 2R9XA 4JPMA 4Y7PA 3IHBA 2ZD8A 4M3KA 1GHPA 4CPKA 5HX9A 2WGWA 4MBKA 4RYEA 4KG2A 3BLSA 2WKIA 5HARA 4WEKA 5GLDA 1HD8A 1PW1A 1EI5A 2V1ZA 5HAIA 4KZ9A 4OP5A 5AQ7A 2WGWB 3ZFZA 1DJBA 3N8SA 1FQGA 1KE4A 1S0WA 3FZCA 4JXSA 3CG5A 3G30A 3IF6A 1S6RA 5E2GA 4ZJ2A 3UN7A 3VFHA 1YLPA 2EXAA 1FCNA 2BG1A 1SKFA 2FFYA 3G32A 4GN2A 4LCMA 4OQ0A 4OQGA 5CRFA 1ERMA 1IYPA 5CECA 2QMIA 1ZC2A 1K54A 3NDGA 4UA6A 4WZ5C 4ID4A 4K91A 3MZDA 4JBFA 3A3JA 5EOOA 4X6TA 3ZG5A 4FD8A 3N8RA 1Q2QA 5KMWA 5GHYA 1JWZA 1I2WA 1I5QA 2ZM2A 2Y91A 3GV9A 5CERA 2EXBA 3LEZA 5AQ9A 4PM6A 3N7WA 3Q07A 1FSWA 2FFFB 4S2PA 3VOYA 3OPLA 4HEFA 1YLWA 5FSRA 4B4XA 5FAPA 1FOFA 4KZBA 1ES4A 1IKGA 3IH9A 5AQBA 2Q9MA 5A92A 1XA1A 4E3MA 1YT4A 3RJUA 1BTLA 5EVIC 3VSLA 2J7VA 5M1AA 2H0YA 1CEGA 1K57A 4BL3A 4X53A 4X68A 3GRJA 5DF8A 3SS3A 1YMXA 4XXRA 2Y2GA 4BQMA 4OOLA 5DVAA 2ZLYA 3NBLA 1FR1A 1MWSA 4OLDA 1LI9A 1E25A 2ZQ7A 2WAEA 3HREA 5F83A 2XGNA 4KZ8A 1YLJA 1KE3A 4OP8A 1EWZA 5AQAA 3ZG8B 1WYBA 4X56A 3IXGA 1SCWA 1L0FA 1JVJA 1YMSA 1LHYA 3UDXA 1KGGA 4OH0A 3BLMA 4PMAA 4LCLA 2JBFA 3P09A 4JLFA 2PU2A 4DE0A 2G2UA 1IKIA 2OLUA 4KG5A 2OLVA 4QHCA 2IWDA 2VGJA 3FYZA 2XK1A 3B3XA 2WYXA 3RXWA 1QMFA 3IHAA 3A3IA 3FV7A 2XH9A 1PYYA 4IBRA 3IT9A 2X02A 1BZAA 4QD4A 5E43A 3SH8A 5IHVA 4IVIA 4ZAMA 3MKEA 1ONHA 3O88A 2ZC6B 3CJMA 2QZ6A 2ZQAA 1KDWA 1PZOA 1G6AA 3MFDA 1GCEA 1E4DA 4LV2A 2XR0A 4JXGA 3W4QA 1CI8A 1SDEA 4JF4A 3WS4A 3WRZA 5CHJA 4EWFA 3ZG7B 1FSYA 4HBTA 1FCOA 4S2NC 5HFOA 2Y2HA 2Z2LB 3M2JA 1K4FA 3DWKA 3G31A 4Y0UA 3WWXA 4UA7A 1FR6A 4JKTA 1W5DA 1U60A 4WEJA 2HP5A 2V20A 4WMCA 1IEMA 5EVID 1W7FA 4DKIA 4E6WA 3FKWA 4BJPA 4YFMA 1BLCA 1CEFA 4WZ5A 4U0XA 1K55A 4LV1A 4JXWA 1ZKJA 1WYCA 3S22A 4BD0A 2Y2LA 3A3EA 4DE3A 2X71A 3MXSA 4Q8IA 3BYDA 1K56D 1NYMA 5FQQA 1KGFA 2ZM0A 4R1GA 2J9PA 1IELA 2P74A 5HAPA 4PM5A 4L0LA 1MWRA 3ZHHA 2Q9NA 3G34A 3A3FA 2ZM8A 4HBUA 3E2LA 5EVLA 1MXOA 2EFUA 3M6BA 4N1HA 3N8LA 2J8YA 5DTTA 5KSCA 3GTCA 3VFFA 3ZG0A 1XA7A 3LY4A 3ITBA 1YLZA 1ESUA 2H0TA 4KZ7A 5HW3A 3PBSA 2RL3A 2HPBA 2ZC4B 3G4PA 3HLCA 4WM9A 5EVIA 4WBGA 3UPNA 2QPNA 3GR2A 3NC8A 3LCEA 2A3UA 2WGIA 2Y2JA 3PBRA 3MKFA 1BLHA 1MPLA 1JTGA 4KZ5A 4JF6A 1H5XA 5EVIB 1OMEA 3ISGA 4NK3A 3JYIA 5TR7A 4KZ4A 3HLBA 1DY6A 3IXBA 4DE1A 4KZ3A 3MXRA 4B4ZA 4GDBA 1GA0A 1MWUA 3HLEA 3TSGA 5FQJA 5GLAA 3N4IA 3HLDA 1E3UD 1MY8A 4ZTKA 3VMAA 5U47A 5BOHA 4P85A 3ZNTA 3E2KA 1TDGA 2E8IA 1ERQA 4O7DA 5FI6A 3UPPA 3OPHA 4UA9A 5DF9A 1H8YA 1I2SA 4DDYA 4X69A 1K38A 1CI9A 5FQ9A 4WYYA 5D3OA 2RCXA 3S4XA 1PWDA 1XX2A 5FDHA 1L0EA 2UWXA 1LL5A 3UE1A 3IF6C 3VP4A 4S2IA 3V5MA 4LV3A 4C6YA 5CGSA 4GZBA 2PU4A 3TOIA 2J9OA 3LO7A 4IBXA 4E3KA 5FASA 5FQMA 2A49A 4K0XA 3WS5A 3GQZA 3PBNA 5CGXA 4DE2A 3FWLA 3WS1A 2EX9A 2XD1A 5I94A 3HUNA 4K0WA 5CXWA 4OLGA 2WUQA 2ZQ9A 4EBLA 3MBZA 4C75A 2ZMAA 2H5SA 2ZQDA 1MWTA 4MBHA 2IWCA 4WELA 3S1YA 1JWPA 4E3JA 4DXBA 3QNBA 3RXXA 3IXHA 5J8XA 2EX2A 3EQUA 3NDEA 3V3SA 1K4EA 5EE8A 2HDQA 4NETA 1KE0A 1NJ4A 4B88A 3PAEA 4QB8A 2WGVA 3MZFA 1K6SA 2X01A 3PAGA 3PTEA 1G68A 4R0QA 1PW8A 4OPYA 1M6KA 1NYYA 5CTNA 1VM1A 3SH7A 4EV4A 1IYOA 2HDUA 2WADA 3BFEA 5FI2A 1ES2A 3WS2A 4LV0A 4MNRA 2C6WB 2XF3A 3DTMA 5CHUA 1K57C 4QY5A 1TDLA 1Z6FA 3LY3A 3VOZA 5DTSA 3SH9A 4KZ6A 3SS5A 3IWQA 1GHMA 3NIAA 3N6IA 4ZJ1A 3ZG9B 3Q7ZA 3AGFA 3BFCA 2WKEA 4FH4A 3CMZA 3UNWA 2ZQCA 1BSGA 1PI4A 4OONA 4N1XA 1L0DA 1BULA 4U0TA 1O7EA 2XDMA 4ZDXA 3M6HA 3ZVWA 2VGKA 3HUOA 3O86A 3VP1A 2XFTA 4LENA 4DRTA 4E3OA 3BM6A 1TVFA 1IYSA 1J9MA 4Y0OA 2XLNA 3DWZA 1L2SA 2I72A 2ZC3B 1JWVA 2XFSA 1ALQA 1PI5A 3FKVA 1VQQA 3QNCA 1CK3A 4RX2A 2Y2QA 4P0MA 4U3TA 4HESA 3TG9A 1XP4A 1MKIA 1XKZA 2Y2IA 3HLWA 5A91A 4P87A 3OC2A 2WKHA 1BUEA 4S2LA 5M18A 4KZAA 3ZGAB 2XQZA 2Y2KA 2IWBA 3VP3A 3UY6A 3V50A 4OPZA 4P6BA 4A5RA 3OCLA 5E2FA 4DDSA 1H8ZA 4S2MA 4CJNA 3BFDA 1YLTA 4OQIA 3IH8A 5A93A 4EBPA 1IYQA 4N9KA 4BENA 3I7JA 5CGWA 1ES5A 2Y2OA 4GD6A 3OCNA 4RA7A 1FCMA 1EROA 2HP9A 4KQQA 3V3RA 4BLMA 1W79A 4DF6A 1RP5A 4GB7A 3PBQA 4Z9QA 3IWIA 3BECA 5CHMA 3WS0A 3PBOA 3NY4A 5DF7A 4ZBEA 4MBFA 3C4PA 1MBLA 1NXYA 2ZQ8A 1ES3A 3NI9A 1BT5A 4EBNA 3BFGA 5F82A 2CC1A 5FAQA 2BLSA 1N4OA 1NRFA 2EFXA 3OZHA 5G18A 1K6RA 5GLCA 3ZNYA 3W4OA 4XUZA 3OPRA 1L0GA 4N92A 4UAAA 1M40A 1NY0A 4N9LA 4PM8A 5A90A 5F1FA 3HBRA 5JYOA 5FQKA 5GHXA 1K56A 1YQSA 4PPRA 5CEBA 1TEMA 3O87A 3EQVA 4R3JA 2HDRA 1ESIA 4OVDA 3IF6B 1QMEA 5FQIA 4E3NA 1K55C 4IEDA 3C7UA 3VSKA 2R9WA 3UDIA 2DRWA 4R3BA 3HUMA 4XUXA 5L2FA 3AGEA 4KQRA 3HLFA 1LL9A 4MEZA 2HDSA 3BFFA 3Q7VA 2Y55A 1BLPA 2V2FF 3VP2A 1LI0A 4E6XA 4FH2A 5KZHA 4KG6A 2OV5A 4D2OA 2Y2NA 1WE4A 2C5WB 4PM7A 2OSUA 5E2HA 3AGDA 3Q7VB 4Y0TA 1C3BA 3G2YA 4KENB 1NZUA 5KSHA 5FI7A 2ZC7A 4JXVA 5HL1A 2PBYA 1ZG4A 5EECA 4E3LA 1KDSA 1K54C 2G2WA 3WRTA 1GHIA 1GA9A 2WZXA 3GVBA 1HTZA 2H10A 4FSFA 3UDFA 3W4PA 5CEDA 1XXMA 3D4FA 3GMWA 3O3VA 3HVFA 2ZC5B 4S2JA 4YINA 3SOIA 3IXDA 2P9VA 3G35A 5CTMA 4RVAA 3NCKA 1E3UA 2ZJ9A 5FA7A 1RGZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IWO A;  1SDN A;  1N9B A;  3BEB A;  1XGI A;  3C7V A;  3Q1F A;  3CZD A;  2P9V B;  3A3D A;  5M19 A;  3VP0 A;  2GDN A;  5TFQ A;  1Q2P A;  4GOG A;  3MZE A;  3OPP A;  5GHZ A;  4E3I A;  2HP6 A;  2Y2P A;  4FCF A;  3V39 A;  1W8Y A;  1ONG A;  2EX6 A;  4OKP A;  4S2N A;  3ZCZ A;  4PM9 A;  1PWC A;  4OPQ A;  3GSG A;  5EOE A;  5FAT A;  1DJC A;  2XD5 A;  1NZO A;  5DTK A;  3C5A A;  1ZG6 A;  2Y2M A;  3ITA A;  5F1G A;  1HVB A;  3ZDJ A;  1K25 A;  1KVM A;  4S2O A;  3UO9 A;  5HAQ A;  1Y54 A;  3IF5 A;  4R4S A;  5E2E A;  3C4O A;  2Y59 A;  2JE5 A;  1PIO A;  3QHY A;  4R23 A;  2Y4A A;  4GD8 A;  4GDN A;  3ZVT A;  4KQO A;  4IVK A;  1JTD A;  3G2Z A;  1HZO A;  1LLB A;  1XGJ A;  4WMC D;  1AXB A;  4RX3 A;  4ZJ3 A;  1KVL A;  1DJA A;  4X55 A;  4BL2 A;  4EUZ A;  1RCJ A;  4C3Q A;  4S2K A;  4OQH A;  3IQA A;  1PWG A;  1RGY A;  4H8R A;  2B5R A;  5TGF A;  1YLY A;  3HLG A;  3UPO A;  2JCH A;  3UE3 A;  3DW0 A;  4BD1 A;  2WK0 A;  4MLL A;  4OPR A;  4WZ4 A;  2DCF A;  2JC7 A;  3PBT A;  4EQI A;  4F94 A;  4GNU A;  1YM1 A;  4QU3 A;  5GLB A;  5GL9 A;  1W8Q A;  3HL9 A;  2WZZ A;  3UE0 A;  4GKU A;  4R4R A;  3Q82 A;  1XPB A;  4OOY A;  2WAF A;  4OOM A;  5JYP A;  1KGE A;  1PZP A;  4QY6 A;  4UHU A;  3W8K A;  4QJG A;  4DXC A;  2EX8 A;  1BLS A;  1O07 A;  5FAO A;  2DNS A;  4JF5 A;  3M2K A;  1SHV A;  3P98 A;  5EPH A;  3Q81 A;  5EUA A;  3BRM A;  3SS4 A;  2XEP A;  2Z2M B;  2R9X A;  4JPM A;  4Y7P A;  3IHB A;  2ZD8 A;  4M3K A;  1GHP A;  4CPK A;  5HX9 A;  2WGW A;  4MBK A;  4RYE A;  4KG2 A;  3BLS A;  2WKI A;  5HAR A;  4WEK A;  5GLD A;  1HD8 A;  1PW1 A;  1EI5 A;  2V1Z A;  5HAI A;  4KZ9 A;  4OP5 A;  5AQ7 A;  2WGW B;  3ZFZ A;  1DJB A;  3N8S A;  1FQG A;  1KE4 A;  1S0W A;  3FZC A;  4JXS A;  3CG5 A;  3G30 A;  3IF6 A;  1S6R A;  5E2G A;  4ZJ2 A;  3UN7 A;  3VFH A;  1YLP A;  2EXA A;  1FCN A;  2BG1 A;  1SKF A;  2FFY A;  3G32 A;  4GN2 A;  4LCM A;  4OQ0 A;  4OQG A;  5CRF A;  1ERM A;  1IYP A;  5CEC A;  2QMI A;  1ZC2 A;  1K54 A;  3NDG A;  4UA6 A;  4WZ5 C;  4ID4 A;  4K91 A;  3MZD A;  4JBF A;  3A3J A;  5EOO A;  4X6T A;  3ZG5 A;  4FD8 A;  3N8R A;  1Q2Q A;  5KMW A;  5GHY A;  1JWZ A;  1I2W A;  1I5Q A;  2ZM2 A;  2Y91 A;  3GV9 A;  5CER A;  2EXB A;  3LEZ A;  5AQ9 A;  4PM6 A;  3N7W A;  3Q07 A;  1FSW A;  2FFF B;  4S2P A;  3VOY A;  3OPL A;  4HEF A;  1YLW A;  5FSR A;  4B4X A;  5FAP A;  1FOF A;  4KZB A;  1ES4 A;  1IKG A;  3IH9 A;  5AQB A;  2Q9M A;  5A92 A;  1XA1 A;  4E3M A;  1YT4 A;  3RJU A;  1BTL A;  5EVI C;  3VSL A;  2J7V A;  5M1A A;  2H0Y A;  1CEG A;  1K57 A;  4BL3 A;  4X53 A;  4X68 A;  3GRJ A;  5DF8 A;  3SS3 A;  1YMX A;  4XXR A;  2Y2G A;  4BQM A;  4OOL A;  5DVA A;  2ZLY A;  3NBL A;  1FR1 A;  1MWS A;  4OLD A;  1LI9 A;  1E25 A;  2ZQ7 A;  2WAE A;  3HRE A;  5F83 A;  2XGN A;  4KZ8 A;  1YLJ A;  1KE3 A;  4OP8 A;  1EWZ A;  5AQA A;  3ZG8 B;  1WYB A;  4X56 A;  3IXG A;  1SCW A;  1L0F A;  1JVJ A;  1YMS A;  1LHY A;  3UDX A;  1KGG A;  4OH0 A;  3BLM A;  4PMA A;  4LCL A;  2JBF A;  3P09 A;  4JLF A;  2PU2 A;  4DE0 A;  2G2U A;  1IKI A;  2OLU A;  4KG5 A;  2OLV A;  4QHC A;  2IWD A;  2VGJ A;  3FYZ A;  2XK1 A;  3B3X A;  2WYX A;  3RXW A;  1QMF A;  3IHA A;  3A3I A;  3FV7 A;  2XH9 A;  1PYY A;  4IBR A;  3IT9 A;  2X02 A;  1BZA A;  4QD4 A;  5E43 A;  3SH8 A;  5IHV A;  4IVI A;  4ZAM A;  3MKE A;  1ONH A;  3O88 A;  2ZC6 B;  3CJM A;  2QZ6 A;  2ZQA A;  1KDW A;  1PZO A;  1G6A A;  3MFD A;  1GCE A;  1E4D A;  4LV2 A;  2XR0 A;  4JXG A;  3W4Q A;  1CI8 A;  1SDE A;  4JF4 A;  3WS4 A;  3WRZ A;  5CHJ A;  4EWF A;  3ZG7 B;  1FSY A;  4HBT A;  1FCO A;  4S2N C;  5HFO A;  2Y2H A;  2Z2L B;  3M2J A;  1K4F A;  3DWK A;  3G31 A;  4Y0U A;  3WWX A;  4UA7 A;  1FR6 A;  4JKT A;  1W5D A;  1U60 A;  4WEJ A;  2HP5 A;  2V20 A;  4WMC A;  1IEM A;  5EVI D;  1W7F A;  4DKI A;  4E6W A;  3FKW A;  4BJP A;  4YFM A;  1BLC A;  1CEF A;  4WZ5 A;  4U0X A;  1K55 A;  4LV1 A;  4JXW A;  1ZKJ A;  1WYC A;  3S22 A;  4BD0 A;  2Y2L A;  3A3E A;  4DE3 A;  2X71 A;  3MXS A;  4Q8I A;  3BYD A;  1K56 D;  1NYM A;  5FQQ A;  1KGF A;  2ZM0 A;  4R1G A;  2J9P A;  1IEL A;  2P74 A;  5HAP A;  4PM5 A;  4L0L A;  1MWR A;  3ZHH A;  2Q9N A;  3G34 A;  3A3F A;  2ZM8 A;  4HBU A;  3E2L A;  5EVL A;  1MXO A;  2EFU A;  3M6B A;  4N1H A;  3N8L A;  2J8Y A;  5DTT A;  5KSC A;  3GTC A;  3VFF A;  3ZG0 A;  1XA7 A;  3LY4 A;  3ITB A;  1YLZ A;  1ESU A;  2H0T A;  4KZ7 A;  5HW3 A;  3PBS A;  2RL3 A;  2HPB A;  2ZC4 B;  3G4P A;  3HLC A;  4WM9 A;  5EVI A;  4WBG A;  3UPN A;  2QPN A;  3GR2 A;  3NC8 A;  3LCE A;  2A3U A;  2WGI A;  2Y2J A;  3PBR A;  3MKF A;  1BLH A;  1MPL A;  1JTG A;  4KZ5 A;  4JF6 A;  1H5X A;  5EVI B;  1OME A;  3ISG A;  4NK3 A;  3JYI A;  5TR7 A;  4KZ4 A;  3HLB A;  1DY6 A;  3IXB A;  4DE1 A;  4KZ3 A;  3MXR A;  4B4Z A;  4GDB A;  1GA0 A;  1MWU A;  3HLE A;  3TSG A;  5FQJ A;  5GLA A;  3N4I A;  3HLD A;  1E3U D;  1MY8 A;  4ZTK A;  3VMA A;  5U47 A;  5BOH A;  4P85 A;  3ZNT A;  3E2K A;  1TDG A;  2E8I A;  1ERQ A;  4O7D A;  5FI6 A;  3UPP A;  3OPH A;  4UA9 A;  5DF9 A;  1H8Y A;  1I2S A;  4DDY A;  4X69 A;  1K38 A;  1CI9 A;  5FQ9 A;  4WYY A;  5D3O A;  2RCX A;  3S4X A;  1PWD A;  1XX2 A;  5FDH A;  1L0E A;  2UWX A;  1LL5 A;  3UE1 A;  3IF6 C;  3VP4 A;  4S2I A;  3V5M A;  4LV3 A;  4C6Y A;  5CGS A;  4GZB A;  2PU4 A;  3TOI A;  2J9O A;  3LO7 A;  4IBX A;  4E3K A;  5FAS A;  5FQM A;  2A49 A;  4K0X A;  3WS5 A;  3GQZ A;  3PBN A;  5CGX A;  4DE2 A;  3FWL A;  3WS1 A;  2EX9 A;  2XD1 A;  5I94 A;  3HUN A;  4K0W A;  5CXW A;  4OLG A;  2WUQ A;  2ZQ9 A;  4EBL A;  3MBZ A;  4C75 A;  2ZMA A;  2H5S A;  2ZQD A;  1MWT A;  4MBH A;  2IWC A;  4WEL A;  3S1Y A;  1JWP A;  4E3J A;  4DXB A;  3QNB A;  3RXX A;  3IXH A;  5J8X A;  2EX2 A;  3EQU A;  3NDE A;  3V3S A;  1K4E A;  5EE8 A;  2HDQ A;  4NET A;  1KE0 A;  1NJ4 A;  4B88 A;  3PAE A;  4QB8 A;  2WGV A;  3MZF A;  1K6S A;  2X01 A;  3PAG A;  3PTE A;  1G68 A;  4R0Q A;  1PW8 A;  4OPY A;  1M6K A;  1NYY A;  5CTN A;  1VM1 A;  3SH7 A;  4EV4 A;  1IYO A;  2HDU A;  2WAD A;  3BFE A;  5FI2 A;  1ES2 A;  3WS2 A;  4LV0 A;  4MNR A;  2C6W B;  2XF3 A;  3DTM A;  5CHU A;  1K57 C;  4QY5 A;  1TDL A;  1Z6F A;  3LY3 A;  3VOZ A;  5DTS A;  3SH9 A;  4KZ6 A;  3SS5 A;  3IWQ A;  1GHM A;  3NIA A;  3N6I A;  4ZJ1 A;  3ZG9 B;  3Q7Z A;  3AGF A;  3BFC A;  2WKE A;  4FH4 A;  3CMZ A;  3UNW A;  2ZQC A;  1BSG A;  1PI4 A;  4OON A;  4N1X A;  1L0D A;  1BUL A;  4U0T A;  1O7E A;  2XDM A;  4ZDX A;  3M6H A;  3ZVW A;  2VGK A;  3HUO A;  3O86 A;  3VP1 A;  2XFT A;  4LEN A;  4DRT A;  4E3O A;  3BM6 A;  1TVF A;  1IYS A;  1J9M A;  4Y0O A;  2XLN A;  3DWZ A;  1L2S A;  2I72 A;  2ZC3 B;  1JWV A;  2XFS A;  1ALQ A;  1PI5 A;  3FKV A;  1VQQ A;  3QNC A;  1CK3 A;  4RX2 A;  2Y2Q A;  4P0M A;  4U3T A;  4HES A;  3TG9 A;  1XP4 A;  1MKI A;  1XKZ A;  2Y2I A;  3HLW A;  5A91 A;  4P87 A;  3OC2 A;  2WKH A;  1BUE A;  4S2L A;  5M18 A;  4KZA A;  3ZGA B;  2XQZ A;  2Y2K A;  2IWB A;  3VP3 A;  3UY6 A;  3V50 A;  4OPZ A;  4P6B A;  4A5R A;  3OCL A;  5E2F A;  4DDS A;  1H8Z A;  4S2M A;  4CJN A;  3BFD A;  1YLT A;  4OQI A;  3IH8 A;  5A93 A;  4EBP A;  1IYQ A;  4N9K A;  4BEN A;  3I7J A;  5CGW A;  1ES5 A;  2Y2O A;  4GD6 A;  3OCN A;  4RA7 A;  1FCM A;  1ERO A;  2HP9 A;  4KQQ A;  3V3R A;  4BLM A;  1W79 A;  4DF6 A;  1RP5 A;  4GB7 A;  3PBQ A;  4Z9Q A;  3IWI A;  3BEC A;  5CHM A;  3WS0 A;  3PBO A;  3NY4 A;  5DF7 A;  4ZBE A;  4MBF A;  3C4P A;  1MBL A;  1NXY A;  2ZQ8 A;  1ES3 A;  3NI9 A;  1BT5 A;  4EBN A;  3BFG A;  5F82 A;  2CC1 A;  5FAQ A;  2BLS A;  1N4O A;  1NRF A;  2EFX A;  3OZH A;  5G18 A;  1K6R A;  5GLC A;  3ZNY A;  3W4O A;  4XUZ A;  3OPR A;  1L0G A;  4N92 A;  4UAA A;  1M40 A;  1NY0 A;  4N9L A;  4PM8 A;  5A90 A;  5F1F A;  3HBR A;  5JYO A;  5FQK A;  5GHX A;  1K56 A;  1YQS A;  4PPR A;  5CEB A;  1TEM A;  3O87 A;  3EQV A;  4R3J A;  2HDR A;  1ESI A;  4OVD A;  3IF6 B;  1QME A;  5FQI A;  4E3N A;  1K55 C;  4IED A;  3C7U A;  3VSK A;  2R9W A;  3UDI A;  2DRW A;  4R3B A;  3HUM A;  4XUX A;  5L2F A;  3AGE A;  4KQR A;  3HLF A;  1LL9 A;  4MEZ A;  2HDS A;  3BFF A;  3Q7V A;  2Y55 A;  1BLP A;  2V2F F;  3VP2 A;  1LI0 A;  4E6X A;  4FH2 A;  5KZH A;  4KG6 A;  2OV5 A;  4D2O A;  2Y2N A;  1WE4 A;  2C5W B;  4PM7 A;  2OSU A;  5E2H A;  3AGD A;  3Q7V B;  4Y0T A;  1C3B A;  3G2Y A;  4KEN B;  1NZU A;  5KSH A;  5FI7 A;  2ZC7 A;  4JXV A;  5HL1 A;  2PBY A;  1ZG4 A;  5EEC A;  4E3L A;  1KDS A;  1K54 C;  2G2W A;  3WRT A;  1GHI A;  1GA9 A;  2WZX A;  3GVB A;  1HTZ A;  2H10 A;  4FSF A;  3UDF A;  3W4P A;  5CED A;  1XXM A;  3D4F A;  3GMW A;  3O3V A;  3HVF A;  2ZC5 B;  4S2J A;  4YIN A;  3SOI A;  3IXD A;  2P9V A;  3G35 A;  5CTM A;  4RVA A;  3NCK A;  1E3U A;  2ZJ9 A;  5FA7 A;  1RGZ A; 
#chains in the Genus database with same CATH topology
 1N9B A;  3DBA A;  1N9O A;  1XJ6 A;  1XGI A;  3CZD A;  4I3J A;  3VP0 A;  1Q2P A;  4GOG A;  4E3I A;  2KX6 A;  1YPR A;  4S2N A;  4PM9 A;  2M7V A;  5EOE A;  5FAT A;  1T1B A;  2Y2M A;  4HI4 A;  5HAQ A;  3IF5 A;  1DP8 A;  4R4S A;  4E04 A;  2JE5 A;  4R23 A;  2JKF A;  3G2Z A;  2YKH A;  4QWO A;  5L10 A;  1AXB A;  3T4S A;  3LIE A;  5DFX A;  1RCJ A;  4C3Q A;  3NHQ A;  1PWG A;  1L3L A;  5I5L A;  1YLY A;  2JCH A;  3UE3 A;  3DW0 A;  4BD1 A;  5EVE A;  4QU3 A;  3HL9 A;  3UE0 A;  1KGE A;  4QJG A;  4UHU A;  2EX8 A;  3KSG A;  2IA2 A;  3M2K A;  3P98 A;  2PR6 A;  2Z2M B;  2R9X A;  4AFI A;  2ZD8 A;  5HL6 A;  3JVV A;  3CAX A;  4RYE A;  3BLS A;  2VEA A;  2WKI A;  4WEK A;  3ICY A;  1HD8 A;  1EI5 A;  2V1Z A;  5HAI A;  4DJ2 A;  4X25 A;  4OP5 A;  5AQ7 A;  3LR3 A;  3N8S A;  1KE4 A;  4JXS A;  3FZC A;  3CG5 A;  3G30 A;  3IF6 A;  5E2G A;  2P08 A;  4ID4 A;  4K91 A;  4WN5 A;  2L4R A;  3QP5 A;  4GS9 A;  4UQI S;  3GEC A;  1Q2Q A;  4KUO A;  4GS9 B;  1T1C A;  1VEU A;  2ZM2 A;  4S2P A;  4HEF A;  5FEG A;  1VEU B;  4KZB A;  2PAV P;  3F1N A;  1IKG A;  2R78 A;  3DTI A;  4EUV A;  3RJU A;  1BTL A;  3F1N B;  3TW8 A;  4F3L A;  4BL3 A;  3E4O A;  2HV1 A;  3SS3 A;  4XXR A;  2JN7 A;  3UB8 A;  4RQ9 A;  2EA9 A;  2Z6C A;  4F3L B;  2O9B A;  1MWS A;  3H7W A;  5L09 A;  3QP2 A;  2XGN A;  3KSF A;  2VKS A;  3IX4 A;  3TJZ C;  3H7W B;  4OP8 A;  3ZG8 B;  2A2L A;  2GZA A;  1L0F A;  1YMS A;  1LHY A;  3UDX A;  2M1C A;  3BLM A;  1OJG A;  4PMA A;  3E0Y A;  1YSP A;  4DE0 A;  2NUT C;  3LIB A;  1Y4O A;  1VHM A;  1PNE A;  3C8C A;  2XK1 A;  4O01 A;  5EM1 A;  3H82 B;  3RXW A;  1QMF A;  2VX8 A;  3FV7 A;  4I39 A;  2XH9 A;  1PYY A;  5G4Y A;  3S7P A;  2ZMV A;  1DRM A;  1BZA A;  4FOF A;  3MKE A;  4LGW A;  3O88 A;  4WLA A;  2W3H A;  2ZC6 B;  2ZQA A;  2EWW A;  3IS2 A;  1GCE A;  4LV2 A;  4EWF A;  1CI8 A;  3WS4 A;  5CHJ A;  4NXB A;  4HBT A;  3T4K A;  4EU0 A;  3DWK A;  3IS2 B;  4Y0U A;  3WWX A;  3PXP A;  3G6O A;  2V20 A;  5AJG A;  3R7W A;  4WUJ A;  4BJP A;  4YFM A;  1CEF A;  4WZ5 A;  4U0X A;  5KIZ A;  2JKR I;  1ZKJ A;  3LR4 A;  3IX3 A;  3R7W B;  3MXS A;  3BYD A;  2JKT M;  4FUW A;  4EQ1 A;  4PM5 A;  1ODV A;  2GNX A;  3E2L A;  5EVL A;  2Q0O A;  5DTT A;  5J4E A;  4DN0 A;  3VFF A;  4KZ7 A;  5HW3 A;  2EWV A;  3ULF A;  3HLC A;  1YSQ A;  5EVI A;  4WBG A;  3GR2 A;  2A3U A;  3MKF A;  1MPL A;  4JF6 A;  2YKF A;  3OOV A;  5EVI B;  1OME A;  5TR7 A;  3JYI A;  1DY6 A;  3CUE A;  4HH3 A;  4PHT A;  4DE1 A;  4KZ3 A;  3TSG A;  5EFW A;  3OBF A;  3BY8 A;  1ERQ A;  3OPH A;  5DF9 A;  4PKY A;  4IJG A;  5FQ9 A;  1PWD A;  2QKP A;  3VP4 A;  2HF6 A;  1S4R A;  4NKP A;  3LIF A;  2J9O A;  3LO7 A;  1T1A A;  3GQZ A;  5CGX A;  2PD8 A;  3WS1 A;  1F2K A;  4K0W A;  5CXW A;  4OLG A;  2VA0 A;  5HWW A;  3MQ0 A;  2ZQ9 A;  1IFQ A;  4C75 A;  1MWT A;  4MBH A;  2IWC A;  4DXB A;  1JWP A;  3EQU A;  3V3S A;  1OPX A;  3PAE A;  2OOL A;  2X01 A;  1G68 A;  4EV4 A;  2HDU A;  3BFE A;  5DJU A;  4MNR A;  2C6W B;  2XF3 A;  3DTM A;  1K57 C;  2K7S A;  3LY3 A;  3SS5 A;  3NIA A;  3U2A A;  4G3W A;  3K3C A;  3ZG9 B;  2WKE A;  1TS8 A;  3CMZ A;  1EW0 A;  2ZQC A;  4OON A;  1L0D A;  1BUL A;  4NXF A;  4U0T A;  2W3G A;  2VJW A;  2VGK A;  3HUO A;  3E4Q A;  3MSH A;  2XFT A;  1J9M A;  5HPF A;  2XLN A;  1G28 A;  1G6O A;  2XFS A;  1PI5 A;  3FKV A;  1VQQ A;  3QNC A;  1CK3 A;  4RX2 A;  2Y2Q A;  4P0M A;  3TG9 A;  1OT6 A;  4ETZ A;  1XKZ A;  3HLW A;  2XSS A;  4P87 A;  2B18 A;  2XQZ A;  2Y2K A;  3V50 A;  3OCL A;  4QPR A;  4DDS A;  4MN7 A;  2D01 A;  4BBV A;  4H6J B;  5HDS A;  5K5B A;  2HP9 A;  5HDC A;  3V3R A;  4BLM A;  1W79 A;  4GB7 A;  1H3Q A;  5FDS A;  5CHM A;  3WS0 A;  3S7N A;  4MBF A;  4Q0I A;  1ES3 A;  5F82 A;  3OZH A;  3W4O A;  4XUZ A;  3MXQ A;  3LR0 A;  4N9L A;  4PM8 A;  1K56 A;  3L9K A;  3EQV A;  4R3J A;  3QP1 A;  2D02 A;  2W1T A;  4HJ6 A;  3UDI A;  5EV0 A;  4KQR A;  2XRN A;  2OAP 1;  1BLP A;  2V2F F;  2W1T B;  2V8F A;  4E6X A;  5KZH A;  1WE4 A;  2L1M A;  5E2H A;  3AGD A;  1C3B A;  5KSH A;  1X0O A;  2PBY A;  2P04 A;  1T18 A;  5EEC A;  1FIL A;  2G2W A;  1GA9 A;  3GVB A;  2H10 A;  4FSF A;  3UDF A;  3W4P A;  3HJK A;  4I3A A;  3GMW A;  2ZC5 B;  4HY8 A;  3G35 A;  4GHI A;  1E3U A;  5JYO A;  2XA7 S;  2L0W A;  1RGZ A;  1GSW A;  3Q1F A;  5M19 A;  4GHI B;  4PAU A;  5GHZ A;  3MZE A;  3OPP A;  4FCF A;  1W8Y A;  1ONG A;  4GLQ A;  3ZCZ A;  2J3T D;  1PWC A;  4OPQ A;  1DJC A;  2QYB A;  1LL8 A;  4HP9 A;  3D9Y A;  4IUH A;  3C5A A;  5DTK A;  1ZG6 A;  3ITA A;  5F1G A;  3ZDJ A;  1K25 A;  4S2O A;  5HD5 A;  4GD8 A;  4GDN A;  3ZVT A;  1S67 L;  2PYR A;  4IVK A;  5CX7 A;  4WMC D;  1LLB A;  4EUZ A;  4HJ4 A;  1S1Z A;  4HHD A;  4OQH A;  5TGF A;  3HLG A;  5TBM A;  3KYE A;  2WK0 A;  2DCF A;  3CI6 A;  4EQI A;  3P01 A;  5TBM B;  5GL9 A;  1W8Q A;  1TF1 A;  4GKU A;  3Q82 A;  2PR5 A;  4OOM A;  3W8K A;  4MCW A;  5FAO A;  1P0Z A;  3F1O A;  4R70 A;  4Y3I A;  3SS4 A;  4JPM A;  4M3K A;  1LT0 A;  2VGL S;  3F1O B;  5HAR A;  1AWI A;  1XFN A;  2ACG A;  4CLC D;  1A0K A;  3RTY A;  1S0W A;  5EM0 A;  4ZJ2 A;  2EXA A;  2BG1 A;  1OTA A;  1SKF A;  2FFY A;  4GN2 A;  4LCM A;  4OQ0 A;  4OQG A;  2PRF A;  4X1L A;  5F68 A;  1K54 A;  3NDG A;  4UA6 A;  4WZ5 C;  3MZD A;  4FD8 A;  4MDZ A;  5HDD A;  5KMW A;  1JWZ A;  1I5Q A;  3IBR A;  5CER A;  5AQ9 A;  4ETX A;  1FSW A;  4HNB A;  5FSR A;  5FAP A;  5HPI A;  3IH9 A;  5AQB A;  1OJ5 A;  4E3M A;  2JHE A;  4MN6 A;  2FZ0 A;  5EVI C;  3VSL A;  4BBT A;  1K57 A;  4X53 A;  4X68 A;  3KYQ A;  3BQ8 A;  3CUE C;  5DFY A;  3NBL A;  2MJ6 A;  2VV6 A;  2ZQ7 A;  5F83 A;  4Y2F A;  1W63 M;  4G3K A;  1KE3 A;  3VOL A;  3MFX A;  3IXG A;  1SCW A;  3NUL A;  3CHW P;  1MKM A;  1P9R A;  4LCL A;  3FG8 A;  4JLF A;  3K2N A;  2G2U A;  4UQI M;  1IKI A;  3T4L A;  4KG5 A;  4NG2 A;  4NXG A;  4CLC E;  2VGJ A;  2ZMF A;  1NWZ A;  1ZHH B;  3IT9 A;  3LID A;  2X02 A;  5E43 A;  4IVI A;  3A0R A;  3KO6 A;  4UEY A;  1G6A A;  1V9Z A;  1E4D A;  3V67 A;  3T4O A;  4JF4 A;  3WRZ A;  1FSY A;  2Y2H A;  1K4F A;  1W5D A;  3T12 B;  1UGU A;  4LFU A;  4L9E A;  3S22 A;  4BD0 A;  4IHQ A;  5FQQ A;  1KGF A;  4R1G A;  1IEL A;  4L0L A;  1MWR A;  3ZHH A;  2Q9N A;  4G3V A;  3NJA A;  3ITB A;  1YLZ A;  1ESU A;  4Y17 A;  2AVX A;  3PBS A;  2RL3 A;  2HPB A;  2QPN A;  3LCE A;  4EEU A;  1H5X A;  2O9C A;  3HLB A;  3IXB A;  1XJ2 A;  1TD5 A;  3MXR A;  4GDB A;  1GA0 A;  3HLE A;  1HLU P;  1F98 A;  4ZTK A;  4P6Z M;  4HP4 A;  5U47 A;  3ZNT A;  3E2K A;  1TDG A;  4L9F A;  1XFQ A;  4O7D A;  3FC7 A;  1I2S A;  4DDY A;  3LYX A;  1CI9 A;  5D3O A;  5IS1 A;  3UE1 A;  2VK3 A;  2I9V A;  4LRZ E;  3V5M A;  2Z6D A;  1D1J A;  2PU4 A;  3BWL A;  2ZL1 A;  4I3I A;  5FAS A;  1K0K A;  3PBN A;  3FWL A;  2ZL1 B;  4JGP A;  3HUN A;  3UMD A;  3MBZ A;  2HJE A;  2ZQD A;  3S1Y A;  1S4S A;  3RXX A;  3NDE A;  3H82 A;  1KE0 A;  1NJ4 A;  1F9I A;  1H8M A;  3MZF A;  1K6S A;  3PTE A;  1PW8 A;  2GX5 A;  5FEF A;  1IYO A;  2PD7 A;  5CHU A;  4ME4 A;  3CLO A;  4QY5 A;  1TDL A;  5G4Z A;  3T4J A;  2HGV A;  4JGQ A;  3PYP A;  4FH4 A;  4O8G A;  4R6L A;  1BSG A;  3UNW A;  1PI4 A;  2XDM A;  4ZDX A;  3ZVW A;  3GDI A;  2QJ5 A;  3BM6 A;  4Y0O A;  3DWZ A;  2GJ3 A;  3KX0 X;  1JWV A;  2WKP A;  1XP4 A;  5A91 A;  3TE8 A;  3VE4 A;  4GW9 A;  2IWB A;  3DAV A;  4OPZ A;  3T1R A;  4KUK A;  4CJN A;  3BFD A;  3EWK A;  4EBP A;  1IYQ A;  3BY9 A;  4N9K A;  1H0M A;  1ES5 A;  4GD6 A;  3OCN A;  1FCM A;  1ERO A;  1UWN X;  4K08 A;  3IWI A;  4PKY G;  3PBO A;  3C4P A;  2ZQ8 A;  1OTB A;  3NI9 A;  3BFG A;  2CC1 A;  4JGO A;  1N4O A;  1NRF A;  3ZNY A;  3FPW A;  3OPR A;  1L0G A;  4UAA A;  1NY0 A;  5CEB A;  3U4L P;  2HDR A;  4OVD A;  4E3N A;  4IED A;  3C7U A;  2JKG A;  2R9W A;  3VSK A;  1SKO A;  4XUX A;  1LL9 A;  2B02 A;  4MEZ A;  1F5M A;  2HDS A;  2Y55 A;  1SKO B;  2OV5 A;  2Y2N A;  2OSU A;  4KEN B;  5FI7 A;  2ZC7 A;  1K54 C;  2WZX A;  3D3O A;  5CED A;  2B95 A;  1GSV A;  4YIN A;  1PFL A;  2P9V A;  1PW1 A;  1SDN A;  1VB6 A;  2P9V B;  1YKD A;  2GDN A;  5TFQ A;  4HQA A;  3HJI A;  2HP6 A;  2Y2P A;  4OKP A;  2NUP C;  2J3W A;  3GSG A;  5L8M A;  2W1R A;  3BW6 A;  2XD5 A;  1NLZ A;  2O0Y A;  1XJ4 A;  1HVB A;  3UE6 A;  5E2E A;  1PIO A;  3F1P A;  2FH5 A;  2PT7 A;  4DMZ A;  4KQO A;  1XGJ A;  4ZJ3 A;  4X55 A;  1DJA A;  3F1P B;  4H8R A;  5HD3 A;  2B5R A;  3MR0 A;  4KQD A;  5J3W A;  3PBT A;  4F94 A;  4GNU A;  1YM1 A;  3IBJ A;  5GLB A;  2WZZ A;  3OLO A;  4R4R A;  4OOY A;  4H6J A;  5JYP A;  1DP6 A;  4QY6 A;  1O07 A;  3NOP C;  2DNS A;  5EPH A;  1S66 L;  3RFB A;  5EUA A;  1WA9 A;  2XEP A;  3DTE A;  2WGW A;  4MBK A;  4X1M A;  4KG2 A;  3MMH A;  4KZ9 A;  2WGW B;  2KOI A;  1UWP X;  1FQG A;  2PBD P;  3UN7 A;  1S6R A;  3TRC A;  3SW1 A;  4L9G A;  4Q0J A;  1YLP A;  3LR5 A;  4ZRR A;  5CRF A;  2QMI A;  1ZC2 A;  1BYW A;  5C5K A;  5EOO A;  3ZG5 A;  3N8R A;  3HCY A;  4ARZ B;  1I2W A;  2Y91 A;  2EXB A;  3LEZ A;  4PM6 A;  3N7W A;  3Q07 A;  3VOY A;  1YLW A;  4B4X A;  1FOF A;  1S1Y A;  1MZU A;  5A92 A;  4NXE A;  4CLC B;  3CPT A;  2J7V A;  5M1A A;  3MF0 A;  3CPT B;  1TS7 A;  1CJF A;  4BQM A;  4OOL A;  5DVA A;  2ZLY A;  4OLD A;  4Y5F A;  1DP9 A;  4KZ8 A;  3CIT A;  1YLJ A;  3C38 A;  2K2N A;  1WYB A;  1JVJ A;  1KGG A;  4OH0 A;  2JBF A;  2ZBB A;  2PU2 A;  2WKQ A;  2OLU A;  3D72 A;  4QHC A;  2IWD A;  3FYZ A;  2J80 A;  2M7U A;  3A3I A;  2VLG A;  4IBR A;  4Z1W A;  1SZV A;  3SH8 A;  5IHV A;  3LEQ A;  3CJM A;  3IX8 A;  2XR0 A;  3W4Q A;  3MS6 A;  5HL1 A;  1SDE A;  4LRX C;  1G5U A;  5HFO A;  3M2J A;  3G31 A;  1FR6 A;  4JKT A;  1U60 A;  2W3F A;  2E8J A;  1IEM A;  1W7F A;  4R38 A;  1BLC A;  1OT9 A;  4ESP A;  4LV1 A;  4JXW A;  4EER A;  2Y2L A;  2OWJ A;  4DE3 A;  2X71 A;  1K56 D;  1NYM A;  2ZM0 A;  2J9P A;  3G34 A;  3A3F A;  3CWF A;  3JVU A;  2EFU A;  2J8Y A;  3KSI A;  4LPZ A;  3EOI A;  3LY4 A;  2H0T A;  4BMW A;  3G4P A;  4WM9 A;  3C30 A;  4GCZ A;  2BAS A;  2WGI A;  4BBU A;  1JTG A;  2V9A A;  3ZQ5 A;  1MC0 A;  2LB5 A;  3ISG A;  3LUQ A;  1ZTU A;  4KZ4 A;  4EEP A;  1TS0 A;  3LIA A;  4B4Z A;  3MJQ A;  1J3W A;  1W63 Q;  1D7E A;  5FQJ A;  1E3U D;  5BOH A;  2E8I A;  3UB5 P;  4X69 A;  1YAX A;  4WYY A;  3S4X A;  2UWX A;  1LL5 A;  4O0P A;  3VV4 A;  4LV3 A;  4C6Y A;  4EW7 A;  4GZB A;  3BQA A;  3LI8 A;  3TOI A;  4E3K A;  5FQM A;  2PYP A;  3WS5 A;  1T19 A;  2EX9 A;  2XD1 A;  3UME A;  2O9A A;  5I94 A;  2H5S A;  2OWH A;  4E3J A;  2EX2 A;  3C2W A;  4JGR A;  2HDQ A;  5MC7 A;  4B88 A;  4HJ3 A;  4R0Q A;  4OPY A;  1M6K A;  1NYY A;  1VM1 A;  2WAD A;  5FI2 A;  3P7N A;  3WS2 A;  5HWT A;  4B9O A;  2P7J A;  3SH9 A;  3QP8 A;  1GHM A;  2JKT I;  4ZJ1 A;  3Q7Z A;  3BFC A;  2K31 A;  3PHY A;  1N9L A;  1O7E A;  2DMW A;  4HIA A;  3O86 A;  3VP1 A;  4E3O A;  1TVF A;  1IYS A;  2UV0 E;  2I72 A;  5DKK A;  4U3T A;  3E4P A;  2WKH A;  1BUE A;  4S2L A;  5M18 A;  4KZA A;  3ZGA B;  3VP3 A;  3UY6 A;  4A5R A;  4HOI A;  4EES A;  5E2F A;  4S2M A;  3BJN A;  3B47 A;  5CGW A;  2Y2O A;  2KLI A;  2J3T C;  5J7E A;  1D06 A;  1RP5 A;  3PBQ A;  4Z9Q A;  2PDR A;  3BEC A;  3NY4 A;  2PHY A;  1NXY A;  5L07 A;  4BWI A;  1BT5 A;  3T1Q B;  5FAQ A;  2BLS A;  2EFX A;  4YWZ A;  2V1B A;  4N92 A;  3LGO A;  5GHX A;  4PPR A;  3O87 A;  4R3A A;  5AVE A;  3IF6 B;  5FQI A;  1K55 C;  1TS6 A;  3VE3 A;  3BFF A;  3Q7V A;  5TJJ A;  3EEA A;  1LI0 A;  4FH2 A;  4D2O A;  2Y79 A;  3Q7V B;  5F6A A;  1NZU A;  4YOF A;  1GHI A;  1LSV A;  1XXM A;  3D4F A;  3O3V A;  3SOI A;  4S2J A;  2Y8H A;  2XRO A;  3B33 A;  2ZJ9 A;  5FA7 A;  3IWO A;  3BEB A;  3DTK A;  3C7V A;  3A3D A;  2O99 A;  4I5S A;  2INW A;  3H9W A;  4CLC C;  3V39 A;  2EX6 A;  1FIK A;  2W0N A;  1NZO A;  4D60 A;  1KVM A;  1IOU A;  2VV8 A;  3UO9 A;  3W2Z A;  1Y54 A;  3C4O A;  2Y59 A;  3S7Q A;  3QHY A;  2Y4A A;  1JTD A;  4WF0 A;  1HZO A;  4RX3 A;  1KVL A;  4BL2 A;  5F5Y A;  4S2K A;  3IQA A;  1RGY A;  3FPV A;  3UPO A;  4MLL A;  4OPR A;  4WZ4 A;  2JC7 A;  5HSQ A;  2V1A A;  4MMN A;  1XPB A;  2WAF A;  1PZP A;  4DXC A;  4P6Z S;  1BLS A;  5A8B A;  4JF5 A;  1SHV A;  2QWS A;  3Q81 A;  1GSX A;  3BRM A;  4Y7P A;  3IHB A;  1GHP A;  4CPK A;  5HX9 A;  5GLD A;  2KDK A;  3K3D A;  3ZFZ A;  4IUK A;  1DJB A;  3VFH A;  1FCN A;  3EGX C;  3G32 A;  2HZ5 A;  3O5Y A;  1ERM A;  1IYP A;  5CEC A;  3T50 A;  4NEE D;  4JBF A;  3A3J A;  4X6T A;  1Y28 A;  2V8C A;  5GHY A;  3MQQ A;  1OTE A;  3GV9 A;  2BTF P;  2FFF B;  3OPL A;  1LSX A;  1ES4 A;  1NRJ A;  2Q9M A;  1XA1 A;  1YT4 A;  3LIC A;  1P97 A;  2H0Y A;  1CEG A;  4CQH A;  3GRJ A;  5DF8 A;  4B93 A;  4GJ4 A;  1YMX A;  5F69 A;  2W3E A;  1Z09 A;  2Y2G A;  3ZYT A;  1VET A;  1FR1 A;  1LI9 A;  1E25 A;  2WAE A;  3HRE A;  1VET B;  1EWZ A;  5AQA A;  4X56 A;  4II7 A;  3P09 A;  2VZW A;  3T1S A;  2OLV A;  3UB9 A;  4HH2 A;  3B3X A;  3KYZ A;  2WYX A;  3IHA A;  4EXO A;  3UB7 A;  4QD4 A;  4ZAM A;  1ONH A;  2QZ6 A;  3NOU C;  1KDW A;  1PZO A;  3MFD A;  2G7U A;  4JXG A;  4Y15 A;  3ZG7 B;  4S2N C;  1FCO A;  2XA7 M;  2Z2L B;  4UA7 A;  4WEJ A;  1JNU A;  2HP5 A;  4WMC A;  5EVI D;  4E6W A;  4DKI A;  3FKW A;  1K55 A;  3E98 A;  1WYC A;  3A3E A;  4Q8I A;  2QHK A;  2HJ9 C;  2P74 A;  5HAP A;  3QP4 A;  1STZ A;  2ZM8 A;  4HBU A;  3B42 A;  1MXO A;  3M6B A;  4N1H A;  3N8L A;  5KSC A;  3GTC A;  3ZG0 A;  1XA7 A;  4ARZ A;  3UPN A;  2JKR M;  2ZC4 B;  3NC8 A;  3KSH A;  2Y2J A;  3PBR A;  1BLH A;  1XJ3 A;  1V9Y A;  4KZ5 A;  4NK3 A;  5DKL A;  3T1X A;  1MWU A;  5GLA A;  2H28 A;  3N4I A;  4CLC A;  3LFV A;  3HLD A;  1MY8 A;  3VMA A;  4P85 A;  5FI6 A;  3UPP A;  3S7O A;  5DJT A;  4UA9 A;  1H8Y A;  1KOU A;  1K38 A;  2RCX A;  1XX2 A;  3MQO A;  1L0E A;  5FDH A;  1ACF A;  2QJ7 A;  2VGL M;  3IF6 C;  5IT5 A;  4S2I A;  5CGS A;  2WKR A;  2ZOH A;  4IBX A;  2A49 A;  3RH8 B;  4K0X A;  2A24 A;  4DE2 A;  5FL3 A;  5HZH A;  4M4X A;  1N9N A;  2WUQ A;  2A24 B;  4EBL A;  2ZMA A;  3EEH A;  4WEL A;  5J8X A;  3QNB A;  3IXH A;  1LSW A;  1K4E A;  5EE8 A;  4NET A;  4QB8 A;  2WGV A;  3PAG A;  3PR6 A;  5HWV A;  2ZOI A;  5CTN A;  3SH7 A;  1P9W A;  4Q0H A;  1ES2 A;  4LV0 A;  1Z6F A;  5IU1 A;  3SZT A;  1NLY A;  3VOZ A;  5DTS A;  1OTI A;  4KZ6 A;  3IWQ A;  3N6I A;  3AGF A;  4XT2 A;  4N1X A;  3M6H A;  4DRT A;  4LEN A;  4FTX A;  4YNR A;  3UB6 A;  4XT2 B;  3JPU A;  1L2S A;  2ZC3 B;  1ALQ A;  2V0W A;  4HES A;  4MN5 A;  1MKI A;  2Y2I A;  3T4T A;  2LB9 A;  3OC2 A;  2V0U A;  4P6B A;  1H8Z A;  1YLT A;  4OQI A;  3IH8 A;  5A93 A;  4EET B;  2W27 A;  4BEN A;  3I7J A;  4RA7 A;  3LI9 A;  4KQQ A;  4DF6 A;  3A0V A;  4LLO B;  1OTD A;  5DF7 A;  4ZBE A;  1MBL A;  5LBR A;  2CMN A;  3R4K A;  1PRQ A;  4EBN A;  5G18 A;  5GLC A;  1K6R A;  4WL9 A;  1M40 A;  5A90 A;  5F1F A;  3HBR A;  5FQK A;  1YQS A;  1TEM A;  4Y13 A;  2VV7 A;  3A0S A;  2W3D A;  3EGD C;  3NEC A;  1ESI A;  1CF0 A;  1QME A;  2DRW A;  4R3B A;  3HUM A;  5L2F A;  3AGE A;  3NOT C;  3HLF A;  4I38 A;  3T4Q A;  3VP2 A;  4KG6 A;  2C5W B;  4PM7 A;  4Y0T A;  3G2Y A;  3QP6 A;  4JXV A;  1CQA A;  1ZG4 A;  4E3L A;  1KDS A;  5AVF A;  3WRT A;  4DJ3 A;  1HTZ A;  4LRY C;  3HVF A;  3L7H A;  2OAQ 1;  3IXD A;  5CTM A;  4RVA A;  3NCK A; 
#chains in the Genus database with same CATH homology
 3IWO A;  1SDN A;  1N9B A;  3BEB A;  1XGI A;  3C7V A;  3Q1F A;  3CZD A;  2P9V B;  3A3D A;  5M19 A;  3VP0 A;  2GDN A;  5TFQ A;  1Q2P A;  4GOG A;  3MZE A;  3OPP A;  5GHZ A;  4E3I A;  2HP6 A;  2Y2P A;  4FCF A;  3V39 A;  1W8Y A;  1ONG A;  2EX6 A;  4OKP A;  4S2N A;  3ZCZ A;  4PM9 A;  1PWC A;  4OPQ A;  3GSG A;  5EOE A;  5FAT A;  1DJC A;  2XD5 A;  1NZO A;  5DTK A;  3C5A A;  1ZG6 A;  2Y2M A;  3ITA A;  5F1G A;  1HVB A;  3ZDJ A;  1K25 A;  1KVM A;  4S2O A;  3UO9 A;  5HAQ A;  1Y54 A;  3IF5 A;  4R4S A;  5E2E A;  3C4O A;  2Y59 A;  2JE5 A;  1PIO A;  3QHY A;  4R23 A;  2Y4A A;  4GD8 A;  4GDN A;  3ZVT A;  4KQO A;  4IVK A;  1JTD A;  3G2Z A;  1HZO A;  1LLB A;  1XGJ A;  4WMC D;  1AXB A;  4RX3 A;  4ZJ3 A;  1KVL A;  1DJA A;  4X55 A;  4BL2 A;  4EUZ A;  1RCJ A;  4C3Q A;  4S2K A;  4OQH A;  3IQA A;  1PWG A;  1RGY A;  4H8R A;  2B5R A;  5TGF A;  1YLY A;  3HLG A;  3UPO A;  2JCH A;  3UE3 A;  3DW0 A;  4BD1 A;  2WK0 A;  4MLL A;  4OPR A;  4WZ4 A;  2DCF A;  2JC7 A;  3PBT A;  4EQI A;  4F94 A;  4GNU A;  1YM1 A;  4QU3 A;  5GLB A;  5GL9 A;  1W8Q A;  3HL9 A;  2WZZ A;  3UE0 A;  4GKU A;  4R4R A;  3Q82 A;  1XPB A;  4OOY A;  2WAF A;  4OOM A;  5JYP A;  1KGE A;  1PZP A;  4QY6 A;  4UHU A;  3W8K A;  4QJG A;  4DXC A;  2EX8 A;  1BLS A;  1O07 A;  5FAO A;  2DNS A;  4JF5 A;  3M2K A;  1SHV A;  3P98 A;  5EPH A;  3Q81 A;  5EUA A;  3BRM A;  3SS4 A;  2XEP A;  2Z2M B;  2R9X A;  4JPM A;  4Y7P A;  3IHB A;  2ZD8 A;  4M3K A;  1GHP A;  4CPK A;  5HX9 A;  2WGW A;  4MBK A;  4RYE A;  4KG2 A;  3BLS A;  2WKI A;  5HAR A;  4WEK A;  5GLD A;  1HD8 A;  1PW1 A;  1EI5 A;  2V1Z A;  5HAI A;  4KZ9 A;  4OP5 A;  5AQ7 A;  2WGW B;  3ZFZ A;  1DJB A;  3N8S A;  1FQG A;  1KE4 A;  1S0W A;  3FZC A;  4JXS A;  3CG5 A;  3G30 A;  3IF6 A;  1S6R A;  5E2G A;  4ZJ2 A;  3UN7 A;  3VFH A;  1YLP A;  2EXA A;  1FCN A;  2BG1 A;  1SKF A;  2FFY A;  3G32 A;  4GN2 A;  4LCM A;  4OQ0 A;  4OQG A;  5CRF A;  1ERM A;  1IYP A;  5CEC A;  2QMI A;  1ZC2 A;  1K54 A;  3NDG A;  4UA6 A;  4WZ5 C;  4ID4 A;  4K91 A;  3MZD A;  4JBF A;  3A3J A;  5EOO A;  4X6T A;  3ZG5 A;  4FD8 A;  3N8R A;  1Q2Q A;  5KMW A;  5GHY A;  1JWZ A;  1I2W A;  1I5Q A;  2ZM2 A;  2Y91 A;  3GV9 A;  5CER A;  2EXB A;  3LEZ A;  5AQ9 A;  4PM6 A;  3N7W A;  3Q07 A;  1FSW A;  2FFF B;  4S2P A;  3VOY A;  3OPL A;  4HEF A;  1YLW A;  5FSR A;  4B4X A;  5FAP A;  1FOF A;  4KZB A;  1ES4 A;  1IKG A;  3IH9 A;  5AQB A;  2Q9M A;  5A92 A;  1XA1 A;  4E3M A;  1YT4 A;  3RJU A;  1BTL A;  5EVI C;  3VSL A;  2J7V A;  5M1A A;  2H0Y A;  1CEG A;  1K57 A;  4BL3 A;  4X53 A;  4X68 A;  3GRJ A;  5DF8 A;  3SS3 A;  1YMX A;  4XXR A;  2Y2G A;  4BQM A;  4OOL A;  5DVA A;  2ZLY A;  3NBL A;  1FR1 A;  1MWS A;  4OLD A;  1LI9 A;  1E25 A;  2ZQ7 A;  2WAE A;  3HRE A;  5F83 A;  2XGN A;  4KZ8 A;  1YLJ A;  1KE3 A;  4OP8 A;  1EWZ A;  5AQA A;  3ZG8 B;  1WYB A;  4X56 A;  3IXG A;  1SCW A;  1L0F A;  1JVJ A;  1YMS A;  1LHY A;  3UDX A;  1KGG A;  4OH0 A;  3BLM A;  4PMA A;  4LCL A;  2JBF A;  3P09 A;  4JLF A;  2PU2 A;  4DE0 A;  2G2U A;  1IKI A;  2OLU A;  4KG5 A;  2OLV A;  4QHC A;  2IWD A;  2VGJ A;  3FYZ A;  2XK1 A;  3B3X A;  2WYX A;  3RXW A;  1QMF A;  3IHA A;  3A3I A;  3FV7 A;  2XH9 A;  1PYY A;  4IBR A;  3IT9 A;  2X02 A;  1BZA A;  4QD4 A;  5E43 A;  3SH8 A;  5IHV A;  4IVI A;  4ZAM A;  3MKE A;  1ONH A;  3O88 A;  2ZC6 B;  3CJM A;  2QZ6 A;  2ZQA A;  1KDW A;  1PZO A;  1G6A A;  3MFD A;  1GCE A;  1E4D A;  4LV2 A;  2XR0 A;  4JXG A;  3W4Q A;  1CI8 A;  1SDE A;  4JF4 A;  3WS4 A;  3WRZ A;  5CHJ A;  4EWF A;  3ZG7 B;  1FSY A;  4HBT A;  1FCO A;  4S2N C;  5HFO A;  2Y2H A;  2Z2L B;  3M2J A;  1K4F A;  3DWK A;  3G31 A;  4Y0U A;  3WWX A;  4UA7 A;  1FR6 A;  4JKT A;  1W5D A;  1U60 A;  4WEJ A;  2HP5 A;  2V20 A;  4WMC A;  1IEM A;  5EVI D;  1W7F A;  4DKI A;  4E6W A;  3FKW A;  4BJP A;  4YFM A;  1BLC A;  1CEF A;  4WZ5 A;  4U0X A;  1K55 A;  4LV1 A;  4JXW A;  1ZKJ A;  1WYC A;  3S22 A;  4BD0 A;  2Y2L A;  3A3E A;  4DE3 A;  2X71 A;  3MXS A;  4Q8I A;  3BYD A;  1K56 D;  1NYM A;  5FQQ A;  1KGF A;  2ZM0 A;  4R1G A;  2J9P A;  1IEL A;  2P74 A;  5HAP A;  4PM5 A;  4L0L A;  1MWR A;  3ZHH A;  2Q9N A;  3G34 A;  3A3F A;  2ZM8 A;  4HBU A;  3E2L A;  5EVL A;  1MXO A;  2EFU A;  3M6B A;  4N1H A;  3N8L A;  2J8Y A;  5DTT A;  5KSC A;  3GTC A;  3VFF A;  3ZG0 A;  1XA7 A;  3LY4 A;  3ITB A;  1YLZ A;  1ESU A;  2H0T A;  4KZ7 A;  5HW3 A;  3PBS A;  2RL3 A;  2HPB A;  2ZC4 B;  3G4P A;  3HLC A;  4WM9 A;  5EVI A;  4WBG A;  3UPN A;  2QPN A;  3GR2 A;  3NC8 A;  3LCE A;  2A3U A;  2WGI A;  2Y2J A;  3PBR A;  3MKF A;  1BLH A;  1MPL A;  1JTG A;  4KZ5 A;  4JF6 A;  1H5X A;  5EVI B;  1OME A;  3ISG A;  4NK3 A;  3JYI A;  5TR7 A;  4KZ4 A;  3HLB A;  1DY6 A;  3IXB A;  4DE1 A;  4KZ3 A;  3MXR A;  4B4Z A;  4GDB A;  1GA0 A;  1MWU A;  3HLE A;  3TSG A;  5FQJ A;  5GLA A;  3N4I A;  3HLD A;  1E3U D;  1MY8 A;  4ZTK A;  3VMA A;  5U47 A;  5BOH A;  4P85 A;  3ZNT A;  3E2K A;  1TDG A;  2E8I A;  1ERQ A;  4O7D A;  5FI6 A;  3UPP A;  3OPH A;  4UA9 A;  5DF9 A;  1H8Y A;  1I2S A;  4DDY A;  4X69 A;  1K38 A;  1CI9 A;  5FQ9 A;  4WYY A;  5D3O A;  2RCX A;  3S4X A;  1PWD A;  1XX2 A;  5FDH A;  1L0E A;  2UWX A;  1LL5 A;  3UE1 A;  3IF6 C;  3VP4 A;  4S2I A;  3V5M A;  4LV3 A;  4C6Y A;  5CGS A;  4GZB A;  2PU4 A;  3TOI A;  2J9O A;  3LO7 A;  4IBX A;  4E3K A;  5FAS A;  5FQM A;  2A49 A;  4K0X A;  3WS5 A;  3GQZ A;  3PBN A;  5CGX A;  4DE2 A;  3FWL A;  3WS1 A;  2EX9 A;  2XD1 A;  5I94 A;  3HUN A;  4K0W A;  5CXW A;  4OLG A;  2WUQ A;  2ZQ9 A;  4EBL A;  3MBZ A;  4C75 A;  2ZMA A;  2H5S A;  2ZQD A;  1MWT A;  4MBH A;  2IWC A;  4WEL A;  3S1Y A;  1JWP A;  4E3J A;  4DXB A;  3QNB A;  3RXX A;  3IXH A;  5J8X A;  2EX2 A;  3EQU A;  3NDE A;  3V3S A;  1K4E A;  5EE8 A;  2HDQ A;  4NET A;  1KE0 A;  1NJ4 A;  4B88 A;  3PAE A;  4QB8 A;  2WGV A;  3MZF A;  1K6S A;  2X01 A;  3PAG A;  3PTE A;  1G68 A;  4R0Q A;  1PW8 A;  4OPY A;  1M6K A;  1NYY A;  5CTN A;  1VM1 A;  3SH7 A;  4EV4 A;  1IYO A;  2HDU A;  2WAD A;  3BFE A;  5FI2 A;  1ES2 A;  3WS2 A;  4LV0 A;  4MNR A;  2C6W B;  2XF3 A;  3DTM A;  5CHU A;  1K57 C;  4QY5 A;  1TDL A;  1Z6F A;  3LY3 A;  3VOZ A;  5DTS A;  3SH9 A;  4KZ6 A;  3SS5 A;  3IWQ A;  1GHM A;  3NIA A;  3N6I A;  4ZJ1 A;  3ZG9 B;  3Q7Z A;  3AGF A;  3BFC A;  2WKE A;  4FH4 A;  3CMZ A;  3UNW A;  2ZQC A;  1BSG A;  1PI4 A;  4OON A;  4N1X A;  1L0D A;  1BUL A;  4U0T A;  1O7E A;  2XDM A;  4ZDX A;  3M6H A;  3ZVW A;  2VGK A;  3HUO A;  3O86 A;  3VP1 A;  2XFT A;  4LEN A;  4DRT A;  4E3O A;  3BM6 A;  1TVF A;  1IYS A;  1J9M A;  4Y0O A;  2XLN A;  3DWZ A;  1L2S A;  2I72 A;  2ZC3 B;  1JWV A;  2XFS A;  1ALQ A;  1PI5 A;  3FKV A;  1VQQ A;  3QNC A;  1CK3 A;  4RX2 A;  2Y2Q A;  4P0M A;  4U3T A;  4HES A;  3TG9 A;  1XP4 A;  1MKI A;  1XKZ A;  2Y2I A;  3HLW A;  5A91 A;  4P87 A;  3OC2 A;  2WKH A;  1BUE A;  4S2L A;  5M18 A;  4KZA A;  3ZGA B;  2XQZ A;  2Y2K A;  2IWB A;  3VP3 A;  3UY6 A;  3V50 A;  4OPZ A;  4P6B A;  4A5R A;  3OCL A;  5E2F A;  4DDS A;  1H8Z A;  4S2M A;  4CJN A;  3BFD A;  1YLT A;  4OQI A;  3IH8 A;  5A93 A;  4EBP A;  1IYQ A;  4N9K A;  4BEN A;  3I7J A;  5CGW A;  1ES5 A;  2Y2O A;  4GD6 A;  3OCN A;  4RA7 A;  1FCM A;  1ERO A;  2HP9 A;  4KQQ A;  3V3R A;  4BLM A;  1W79 A;  4DF6 A;  1RP5 A;  4GB7 A;  3PBQ A;  4Z9Q A;  3IWI A;  3BEC A;  5CHM A;  3WS0 A;  3PBO A;  3NY4 A;  5DF7 A;  4ZBE A;  4MBF A;  3C4P A;  1MBL A;  1NXY A;  2ZQ8 A;  1ES3 A;  3NI9 A;  1BT5 A;  4EBN A;  3BFG A;  5F82 A;  2CC1 A;  5FAQ A;  2BLS A;  1N4O A;  1NRF A;  2EFX A;  3OZH A;  5G18 A;  1K6R A;  5GLC A;  3ZNY A;  3W4O A;  4XUZ A;  3OPR A;  1L0G A;  4N92 A;  4UAA A;  1M40 A;  1NY0 A;  4N9L A;  4PM8 A;  5A90 A;  5F1F A;  3HBR A;  5JYO A;  5FQK A;  5GHX A;  1K56 A;  1YQS A;  4PPR A;  5CEB A;  1TEM A;  3O87 A;  3EQV A;  4R3J A;  2HDR A;  1ESI A;  4OVD A;  3IF6 B;  1QME A;  5FQI A;  4E3N A;  1K55 C;  4IED A;  3C7U A;  3VSK A;  2R9W A;  3UDI A;  2DRW A;  4R3B A;  3HUM A;  4XUX A;  5L2F A;  3AGE A;  4KQR A;  3HLF A;  1LL9 A;  4MEZ A;  2HDS A;  3BFF A;  3Q7V A;  2Y55 A;  1BLP A;  2V2F F;  3VP2 A;  1LI0 A;  4E6X A;  4FH2 A;  5KZH A;  4KG6 A;  2OV5 A;  4D2O A;  2Y2N A;  1WE4 A;  2C5W B;  4PM7 A;  2OSU A;  5E2H A;  3AGD A;  3Q7V B;  4Y0T A;  1C3B A;  3G2Y A;  4KEN B;  1NZU A;  5KSH A;  5FI7 A;  2ZC7 A;  4JXV A;  5HL1 A;  2PBY A;  1ZG4 A;  5EEC A;  4E3L A;  1KDS A;  1K54 C;  2G2W A;  3WRT A;  1GHI A;  1GA9 A;  2WZX A;  3GVB A;  1HTZ A;  2H10 A;  4FSF A;  3UDF A;  3W4P A;  5CED A;  1XXM A;  3D4F A;  3GMW A;  3O3V A;  3HVF A;  2ZC5 B;  4S2J A;  4YIN A;  3SOI A;  3IXD A;  2P9V A;  3G35 A;  5CTM A;  4RVA A;  3NCK A;  1E3U A;  2ZJ9 A;  5FA7 A;  1RGZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...