3P98A

The crystal structure of the extended spectrum beta-lactamase tem-72 reveals inhibition by citrate
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
263
structure length
263
Chain Sequence
HPETLVKVKDAEDKLGARVGYIELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRWEPELNEAIPNDERDTTTPAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGASKRGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactamase TEM-72
publication title Structure of the extended-spectrum [beta]-lactamase TEM-72 inhibited by citrate
pubmed doi rcsb
source organism Morganella morganii
molecule tags Hydrolase
total genus 99
structure length 263
sequence length 263
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-10-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 3p98A00
3PBOA 4ZJ1A 3VMAA 2EX2A 1IKGA 1ZG4A 3G34A 3LO7A 2Z2MB 4KQRA 1E4DA 4FH4A 2XD5A 2ZC7A 3GVBA 3WS0A 1NZUA 5KZHA 4OP5A 2HP9A 1NZOA 2DCFA 1I2WA 4R0QA 3HLGA 1KDSA 4MBKA 3M2JA 1VQQA 3PBTA 5FQKA 5HARA 4DKIA 4DF6A 1JTGA 1JWPA 3A3IA 3C5AA 3NY4A 1LL5A 1ZG6A 2QPNA 1PW1A 5CGXA 1DJAA 2DNSA 1VM1A 3BM6A 3E2KA 4JXVA 4EBNA 1LI9A 3IHAA 4GDNA 5DF7A 3LEZA 4S2KA 5CHUA 5FAPA 3NDGA 1IEMA 4S2NC 3CG5A 1IYPA 4OONA 4R3JA 1ZKJA 1G6AA 4FSFA 5CXWA 4JXSA 1K57C 3Q7ZA 4S2LA 2PBYA 2XLNA 3N6IA 5GLBA 3ZG9B 1HZOA 2WADA 2XF3A 2EX6A 3BRMA 2Q9MA 4GOGA 2EXAA 4S2PA 2ZQAA 3BLSA 3HLEA 4R3BA 5KSCA 2HP5A 2P74A 1QMFA 2WKEA 5EOEA 3IWOA 3ZDJA 4Y7PA 3DTMA 1K55C 3WRZA 4UA6A 3S22A 1TVFA 3GTCA 4IVKA 1PYYA 1XA1A 3P09A 5CERA 4C75A 2JC7A 1KDWA 1NRFA 2C6WB 4OQ0A 4OVDA 1YQSA 1LI0A 5FSRA 3FKWA 4KZ8A 2ZC5B 4R1GA 3VP2A 4JBFA 4YINA 5GLAA 4X68A 3M6HA 3OPPA 4Y0OA 1BTLA 4OPZA 1G68A 3W4OA 1KE0A 3AGFA 3N7WA 1IKIA 2Y2KA 3O87A 2PU4A 2X02A 4MBFA 1MY8A 4BLMA 2QZ6A 1E3UA 3WRTA 4XUXA 1EROA 1NY0A 5EPHA 5DTKA 1C3BA 4GD6A 3HLCA 5CRFA 1PWCA 4WZ4A 5TGFA 3QNCA 2ZQDA 2V1ZA 4LV1A 1CI8A 3M2KA 4KZ3A 4IBXA 2R9WA 1JTDA 3G2ZA 4K91A 4LV3A 1IYQA 4PM6A 1YLTA 4XUZA 3V3SA 4PM7A 5FDHA 4B4XA 5E2HA 3BFEA 3N4IA 1XA7A 4OPRA 4WMCA 5EVIA 5EVLA 1MKIA 3DWZA 4K0XA 4OOYA 5HX9A 5A90A 5HAQA 4R4RA 2DRWA 3VP3A 1CK3A 4BD1A 5GL9A 3V3RA 1DJCA 4GDBA 3EQVA 5FQMA 3WS2A 5EE8A 3BFCA 2HDSA 5CTNA 1NYMA 3PBRA 2OLVA 3BECA 3W8KA 3MBZA 4PM5A 1WE4A 3HLBA 1BUEA 1XGJA 2XFTA 1E3UD 1ZC2A 4QD4A 3VP1A 1ERMA 3ITBA 1FCMA 4KZ5A 5CTMA 3JYIA 3GMWA 3Q7VA 1YLJA 1XX2A 1HVBA 3SOIA 4BENA 4WZ5C 2ZM2A 1GHIA 3NDEA 4X53A 4JPMA 2E8IA 3WS1A 1J9MA 1KVMA 3NCKA 2Y2MA 3CJMA 4KENB 5HW3A 2WK0A 5E2EA 1YT4A 4OOLA 3MZDA 1SCWA 3GQZA 2EX9A 3IWIA 1RP5A 1Z6FA 5FAOA 5E2GA 2ZC4B 1I5QA 3IH8A 4OH0A 5GHZA 2P9VB 4RA7A 4WMCD 5EVID 3UDFA 1M6KA 1O7EA 1XPBA 2Y91A 4N92A 4EWFA 4OLDA 4PM8A 5IHVA 5HAIA 3ZVTA 3C4PA 3IXHA 1ONHA 4PPRA 5CEDA 1K54C 2HDQA 4KZ9A 5FQJA 5I94A 1W5DA 1W8YA 2OLUA 4GN2A 4MLLA 2H10A 3G4PA 1W79A 4WYYA 3SS4A 3A3FA 2IWDA 3FKVA 3VOYA 1FCOA 1GHMA 3ZFZA 3MKEA 5M19A 4QB8A 3Q81A 4B88A 1BSGA 4EBPA 3GSGA 4E3OA 3MZEA 5FI6A 4FH2A 5GHXA 1XKZA 4JKTA 3I7JA 3HLDA 3PBQA 1NXYA 3C7UA 2Y2PA 1FSWA 1YLZA 5L2FA 2XDMA 5FASA 3LY4A 5CECA 5CGWA 3OCLA 1ES2A 4Y0UA 3OC2A 2FFYA 3ZNYA 1DY6A 2Y59A 4HBTA 5EOOA 3N8SA 3BFDA 4FCFA 2ZC3B 4E3LA 2WZZA 4S2OA 4Z9QA 1GCEA 2ZM0A 3MXSA 1ESUA 1IYOA 5EUAA 4LCLA 2ZQCA 4LCMA 3A3EA 3BEBA 2OV5A 4CPKA 4S2MA 3ZCZA 5TFQA 4N1HA 3S4XA 1FCNA 4HBUA 1K57A 1GHPA 4NETA 2I72A 4P6BA 1K4EA 4OPYA 5U47A 2BG1A 5EECA 3Q82A 2A49A 2B5RA 4R4SA 1PI4A 1ALQA 3PBSA 5J8XA 5GHYA 3IF5A 4RX3A 3VOZA 2CC1A 2Y2GA 5F83A 2WGIA 4CJNA 2WGWB 1PI5A 5DF8A 1YMSA 4E3KA 2Y2IA 3UO9A 1FR6A 1MBLA 2WGWA 3AGDA 4UA9A 3VFHA 4E3JA 3IF6B 3QNBA 3UDIA 1ERQA 2WAFA 3G2YA 3O88A 4ZTKA 5F1FA 3IF6A 1YLPA 4IEDA 1ES4A 3MXRA 4HESA 4JF5A 5F1GA 1IYSA 5AQ9A 2RL3A 1MWRA 2H0YA 1L0FA 4N1XA 4OQHA 1KE4A 4D2OA 3HLFA 3HUMA 1L2SA 1YLWA 4F94A 4N9LA 2ZC6B 3VP0A 4OPQA 4JLFA 4DXCA 4L0LA 1L0GA 1KVLA 3HBRA 4RYEA 3ZHHA 1JVJA 5FA7A 4DE1A 3GV9A 3RJUA 4KG5A 4KZBA 2J9PA 3NI9A 1OMEA 3OZHA 5KSHA 3OPHA 5CHJA 1N9BA 1GA0A 4MBHA 4WM9A 3W4QA 5HAPA 3UE3A 3C7VA 3PBNA 3UN7A 4PMAA 4BL3A 2G2UA 1SKFA 4OQIA 5JYOA 1ES3A 1BLSA 1Q2QA 5EVIC 1MWUA 1L0EA 3C4OA 3CMZA 1K56A 3HREA 1KE3A 3GR2A 4QHCA 4GZBA 1XXMA 4U0XA 3DWKA 3FYZA 3HLWA 4ZAMA 1RGYA 3PAEA 4YFMA 3DW0A 1PWDA 2XQZA 5FI7A 3ZGAB 4RVAA 5TR7A 1YM1A 4M3KA 3UY6A 2Q9NA 3VSKA 4C6YA 3OPLA 5AQAA 5M18A 3Q1FA 1MXOA 1KGFA 3S1YA 4KG6A 5KMWA 3D4FA 5FATA 2XH9A 3NIAA 4WBGA 3HUOA 1BZAA 2WGVA 5G18A 1XP4A 4E3NA 2Y2QA 2X01A 5FAQA 4GNUA 5HL1A 2VGKA 1EI5A 1FSYA 4KQOA 4OP8A 4S2JA 4HEFA 3B3XA 4P0MA 2J9OA 1WYBA 4U0TA 4WEKA 4UHUA 2ZM8A 1BLHA 3O3VA 3V5MA 2Y2OA 2P9VA 4X56A 1NYYA 1YLYA 3IXDA 4DDYA 3LY3A 5CEBA 5DVAA 5F82A 3HVFA 3IXBA 1TDGA 5E43A 3MKFA 2IWBA 4UAAA 1K56D 3SS3A 3UE0A 3UPOA 1O07A 1FQGA 2GDNA 1K6SA 4S2IA 4Q8IA 3BFFA 1BULA 2ZQ8A 2Z2LB 3IH9A 2V20A 1TEMA 1FOFA 3RXXA 2XR0A 2XFSA 1L0DA 1QMEA 5FI2A 3AGEA 3OCNA 4JF4A 4EUZA 3M6BA 3PTEA 2JCHA 4EQIA 3ISGA 1ESIA 4NK3A 1KGGA 3UNWA 2ZMAA 2HPBA 3OPRA 5A93A 3IT9A 2ZQ7A 4QJGA 3VP4A 3ZG7B 2X71A 4Y0TA 5JYPA 1CEFA 4KZ6A 1JWZA 4ZJ2A 4BQMA 1ONGA 3Q07A 5CHMA 4EV4A 1JWVA 3N8RA 3IWQA 2G2WA 4JXGA 4GB7A 2A3UA 2EFXA 1SDNA 2WAEA 4P85A 4E3MA 1RGZA 1U60A 4IBRA 4X55A 4A5RA 4PM9A 1SHVA 2WZXA 1WYCA 1TDLA 1H8YA 4R23A 2HP6A 4OLGA 4S2NA 1YMXA 2EXBA 5BOHA 4KZ7A 1N4OA 5GLCA 4BL2A 4BD0A 3VFFA 3P98A 2H5SA 1LHYA 1H8ZA 5FQIA 2HDUA 5DF9A 1Y54A 2Y2LA 3VSLA 2ZLYA 1S6RA 3FZCA 5GLDA 3MFDA 2Y2HA 2XD1A 1K55A 1K38A 1PW8A 4DDSA 5A91A 1HD8A 3SH9A 1K6RA 3WWXA 3NBLA 3ZNTA 3NC8A 3ZG8B 4UA7A 3G31A 3G30A 1W8QA 1LLBA 1SDEA 4QU3A 3TOIA 5AQBA 2VGJA 3BLMA 3A3DA 1Q2PA 4LV2A 2ZD8A 1M40A 4KQQA 3LCEA 5D3OA 2Y2JA 2IWCA 4KG2A 5FQ9A 3IF6C 4DE3A 2C5WB 3O86A 4U3TA 3QHYA 2Y4AA 3N8LA 2V2FF 2ZQ9A 1BT5A 2J7VA 4X69A 4MNRA 4MEZA 1PZPA 1MWSA 4OOMA 5DTSA 2QMIA 2UWXA 3ZG0A 1CEGA 1HTZA 5CGSA 3V50A 4GKUA 2Y2NA 3CZDA 4P87A 5AQ7A 4KZAA 5FQQA 4H8RA 4E6XA 3RXWA 1NJ4A 4ZJ3A 4OKPA 3G35A 4OQGA 4BJPA 4JXWA 3PAGA 1S0WA 1PIOA 2H0TA 1FR1A 4GD8A 2J8YA 2EX8A 2FFFB 1K4FA 4XXRA 4N9KA 4IVIA 4X6TA 1BLPA 4ZBEA 4QY5A 1PZOA 3A3JA 4E6WA 1W7FA 4JF6A 3TSGA 2BLSA 3WS5A 1DJBA 5M1AA 5EVIB 4B4ZA 4DE2A 4ID4A 2ZJ9A 3ITAA 2RCXA 2HDRA 2WKIA 4QY6A 1GA9A 1IELA 4FD8A 3TG9A 1CI9A 2JE5A 2OSUA 2WKHA 3E2LA 3HL9A 1MPLA 1EWZA 3GRJA 3UPPA 1XGIA 5A92A 3EQUA 3MZFA 4LV0A 4E3IA 2Y55A 3WS4A 4C3QA 3FWLA 1I2SA 4WZ5A 1BLCA 3G32A 1PWGA 3IXGA 3Q7VB 3BYDA 4DE0A 3W4PA 4WELA 4KZ4A 3SS5A 5E2FA 4LENA 5HFOA 2PU2A 4K0WA 1RCJA 2JBFA 3UE1A 4EBLA 3HUNA 3SH7A 1K25A 1AXBA 4O7DA 3ZG5A 2XK1A 1E25A 4WEJA 3FV7A 4DXBA 3ZVWA 3UPNA 3UDXA 2R9XA 3IHBA 2WYXA 1H5XA 1ES5A 2EFUA 3SH8A 3V39A 5DTTA 4ZDXA 1KGEA 1MWTA 3BFGA 4RX2A 4DRTA 1K54A 2XEPA 3IQAA 2WUQA 2XGNA 1LL9A
chains in the Genus database with same CATH superfamily
4BWIA 2EX2A 1IKGA 4NXBA 1NLZA 1VEUB 4Y15A 1S4RA 1UWNX 4R0QA 4EXOA 5DKKA 4R70A 5AJGA 2GZAA 4DKIA 4DF6A 1JTGA 2W3GA 4Y2FA 1LL5A 2GJ3A 4NEED 2QPNA 4P6ZM 5CGXA 1P9WA 4CLCB 4GDNA 5DF7A 3LEZA 2V0UA 1IYPA 1ZKJA 1T1AA 4MN6A 2XLNA 3N6IA 3ZG9B 2EX6A 4NXEA 3HLEA 4R3BA 5EOEA 2WKEA 3IWOA 2DMWA 3DTMA 4Y7PA 3DTIA 1TS0A 1TVFA 3GTCA 4IVKA 1KDWA 2C6WB 4EUVA 1BYWA 3PYPA 1YQSA 5FSRA 3FKWA 4KZ8A 4Y13A 2ZC5B 2WKPA 1T1BA 3ZYTA 4X68A 1Y28A 4Y0OA 1G68A 3AGFA 3N7WA 2JKRM 2X02A 4BLMA 3T4QA 4CLCD 1EROA 2BTFP 4GD6A 1G5UA 2B95A 1NRJA 4LV1A 1G28A 4IBXA 3IX4A 4LV3A 1YLTA 4LRZE 5FDHA 3BFEA 4HHDA 3C2WA 4K0XA 5HX9A 5A90A 4NXFA 4R4RA 3IS2B 5AVFA 1CJFA 3VE4A 2W1RA 2XFTA 1E3UD 3NOTC 3VP1A 5CTMA 2UV0E 5HPIA 4X53A 1J9MA 5E2EA 4QWOA 1RP5A 2Z6DA 3MQ0A 5GHZA 2P9VB 3MR0A 3UDFA 3ZVTA 3P7NA 1ONHA 4GN2A 5HL6A 1W79A 3SS4A 3A3FA 1FCOA 3MKEA 3TJZC 1K0KA 2ZMVA 1BSGA 3T4TA 2J80A 3MZEA 5GHXA 1XKZA 3HLDA 2VZWA 1NXYA 4BBUA 2Y2PA 1FSWA 2KOIA 1ES2A 2HZ5A 4Y0UA 3OC2A 3ZNYA 1DY6A 4KUKA 4FCFA 4Z9QA 1ESUA 4LCLA 2HF6A 2VLGA 4LCMA 4I39A 4UQIS 4AFIA 5TFQA 4N1HA 1FCNA 4HBUA 4B93A 2I72A 3E98A 4P6BA 4OPYA 2XROA 5U47A 3Q82A 4JGOA 2A49A 2W27A 5G4ZA 1PI4A 5GHYA 3UB7A 1VETB 5L07A 1OTDA 4L9GA 2WGWB 1YAXA 3IF6B 3QNBA 1DP9A 3O88A 3G2YA 5F1FA 4IEDA 1ES4A 4X1MA 4D2OA 3HLFA 3R4KA 3T4SA 3DTKA 1KVLA 3ZHHA 3RJUA 4KZBA 3NI9A 4Z1WA 3OPHA 3P01A 1GA0A 1N9OA 5HAPA 3C7VA 5JYOA 3UN7A 4BL3A 2PT7A 1ES3A 3S7PA 1BLSA 3IS2A 1K56A 1XXMA 3HLWA 4YFMA 3DW0A 4Q0IA 4RVAA 2NUPC 1YM1A 2BASA 2Q9NA 4NXGA 4QPRA 1KGFA 4WBGA 2X01A 3IX8A 3VE3A 2VGKA 4OP8A 2ZMFA 3K2NA 2I9VA 3CI6A 2JKGA 4HJ4A 2ZM8A 3F1PA 3O3VA 3QP4A 2VV8A 3V5MA 2P9VA 1VHMA 4PKYA 4BBVA 3IXDA 3KSIA 4DDYA 4G3WA 1MC0A 4R38A 3LGOA 4YNRA 5C5KA 1O07A 1K6SA 2ZQ8A 2PHYA 1FOFA 3RXXA 5TBMA 4L9FA 4H6JB 1FIKA 4E04A 1XFQA 3OCNA 4UEYA 4EUZA 3PTEA 2JCHA 1KGGA 2ZMAA 3OPRA 4Y0TA 1JWZA 1OTAA 4BQMA 5CHMA 4EV4A 3N8RA 3IWQA 1WA9A 1SDNA 4P85A 5TJJA 4A5RA 4PM9A 1SHVA 2WZXA 1TDLA 3U4LP 4I5SA 4OLGA 4S2NA 2EXBA 4KZ7A 1N4OA 4BL2A 3RH8B 4EETB 1LHYA 5DF9A 4ZRRA 3FZCA 2R78A 2Y2HA 1PW8A 1OTBA 4DDSA 2O9CA 2INWA 3SH9A 1K6RA 5EM1A 3H82A 3MQQA 3G31A 2J3TD 3KSHA 5AQBA 2VGJA 2IWCA 2QYBA 4U3TA 3N8LA 2V2FF 2ZQ9A 1MWSA 4OOMA 5DTSA 2UWXA 3CZDA 3UB5P 4P87A 4KZAA 3EEHA 4Q0HA 1S0WA 1PIOA 2HGVA 3O5YA 1OJGA 4X6TA 4ZBEA 4QY5A 4NG2A 4JF6A 3TSGA 5M1AA 5EVIB 1SKOB 2K7SA 4ID4A 1D1JA 1GA9A 3G6OA 2OSUA 5HWVA 5EV0A 1EWZA 5HD3A 4ARZA 3MZFA 3D3OA 4C3QA 5DJTA 4WZ5A 1BLCA 3G32A 3Q7VB 2XSSA 4GW9A 4KZ4A 5HFOA 1F5MA 3SH7A 3LFVA 3S7NA 2OOLA 3ZG5A 2XK1A 2K31A 1E25A 4WEJA 3UB8A 3FV7A 4DXBA 2ZBBA 2WYXA 1H5XA 1ES5A 2EFUA 1KGEA 4RX2A 4I3JA 3MKFA 3UMDA 3PBOA 4R6LA 2A2LA 3G34A 1ZTUA 3MQOA 4OP5A 2HP9A 5F68A 5J7EA 3KYQA 3LIDA 4MBKA 3M2JA 1VQQA 4MDZA 5HWTA 4Y17A 1JWPA 3A3IA 3SZTA 2GX5A 1VM1A 3E2KA 1LI9A 3IHAA 5FAPA 3DAVA 4R3JA 3T4LA 1OTIA 1K57C 3Q7ZA 4S2LA 2HJ9C 2XF3A 4GOGA 2EXAA 2P74A 3ZDJA 5DJUA 2OAP1 2JC7A 4OVDA 4DN0A 4I38A 3D72A 4YINA 4BBTA 1BTLA 4OPZA 5HWWA 2V1AA 3W4OA 1KE0A 1S1ZA 3O87A 4MBFA 2QZ6A 4JGRA 4G3VA 1C3BA 3HLCA 2QJ7A 3M2KA 3T1RA 3G2ZA 3MS6A 3LIFA 4PM7A 4B4XA 4HY8A 4WUJA 4OPRA 4WMCA 1SKOA 5EVIA 3BWLA 4OOYA 3HCYA 2DRWA 3VP3A 5GL9A 5K5BA 3QP6A 2QHKA 3WS2A 1V9ZA 5CTNA 1VB6A 3MBZA 4PM5A 1WE4A 1ZC2A 4QD4A 1FILA 3ITBA 1FCMA 3Q7VA 1YLJA 3W2ZA 2E8IA 1KVMA 2Y2MA 5FDSA 4XT2B 2ZOHA 1T1CA 5E2GA 1I5QA 4RA7A 1O7EA 2EWWA 2Y91A 4EWFA 4PM8A 5IHVA 2HV1A 5CEDA 1K54C 2HDQA 4KZ9A 1W5DA 1W8YA 4MLLA 2H10A 2V9AA 1GHMA 4QB8A 3GSGA 4E3OA 3CITA 4JKTA 2V8CA 1KOUA 5L2FA 5FASA 5CECA 5HZHA 2FFYA 2VV6A 2Y59A 5EOOA 3N8SA 5FEGA 4HIAA 1CQAA 4CLCC 4ESPA 4HQAA 2ZM0A 2B18A 3BEBA 3CPTA 2OV5A 4CPKA 3T4JA 3ZCZA 3S4XA 2W3FA 4HJ6A 1K57A 2WKQA 2JKFA 4JGQA 1K4EA 5J8XA 1ALQA 2P7JA 2E8JA 4RX3A 2M7VA 2WGIA 2KDKA 2QKPA 1PI5A 5DF8A 4CJNA 1YMSA 2PRFA 4E3KA 4UA9A 1MBLA 3VFHA 4E3JA 4Y3IA 3TRCA 1OTEA 5F1GA 4JF5A 1L0FA 2W1TA 3UE6A 1L2SA 1YLWA 2ZC6B 3VP0A 3HBRA 4X25A 3B47A 1JVJA 4HOIA 2VGLM 5FA7A 1S4SA 1TD5A 3GV9A 4KG5A 5EM0A 3OZHA 5KSHA 3NOPC 3W4QA 1H0MA 3S7OA 3MXQA 2G2UA 1NWZA 1Q2QA 1XJ4A 2B02A 3GR2A 3DWKA 3FYZA 4ZAMA 3V67A 1OT9A 5TR7A 5J4EA 5M18A 4EESA 2O99A 1BZAA 5G18A 2M7UA 5HL1A 1FSYA 4KQOA 1G6OA 1ZHHB 3F1PB 4WEKA 4XT2A 3LIAA 2Y2OA 4X56A 1NYYA 5HPFA 5F82A 3IXBA 2IWBA 1K56D 2JKTM 1H8MA 2GDNA 3VV4A 3T50A 2Z2LB 1GSVA 5TBMB 3FPWA 4KQDA 4GHIB 1L0DA 3AGEA 3ISGA 2JKRI 3T1SA 2PAVP 4CQHA 5IU1A 1TF1A 2G7UA 3IT9A 1CEFA 4ZJ2A 2Y8HA 1EW0A 5L8MA 2ZL1A 1LL8A 2EFXA 1T18A 4E3MA 3HJIA 3LR4A 4HJ3A 3R7WB 1YMXA 5BOHA 1OJ5A 1N9LA 5GLCA 3L7HA 4WN5A 4HH2A 3RTYA 1MKMA 4EERA 2Y79A 5EFWA 2ZLYA 5HDDA 5GLDA 2IA2A 3MFDA 3H82B 1Q2PA 4LV2A 1J3WA 3LCEA 5D3OA 2Y2JA 4KG2A 3LR5A 3IF6C 5FQ9A 3QHYA 1IFQA 3C30A 1BT5A 4MEZA 3PHYA 2QMIA 3ZG0A 3FPVA 4DMZA 4GKUA 5AQ7A 5FQQA 4E6XA 4ZJ3A 3G35A 4BJPA 3PAGA 3ZQ5A 3EGDC 2FFFB 4XXRA 3A0VA 4N9KA 4LFUA 5KIZA 4E6WA 4ETZA 2BLSA 1DJBA 2HDRA 1IELA 4HI4A 1DP8A 1CI9A 2JE5A 4ARZB 3UPPA 1V9YA 4WL9A 4E3IA 4GS9A 3FWLA 1PWGA 3LR0A 4DE0A 4DJ3A 1Y4OA 3SS5A 1HLUP 4LENA 5FL3A 1RCJA 4EBLA 2O0YA 4KUOA 1STZA 3BQ8A 3UDXA 3IHBA 3V39A 4ZDXA 4DRTA 2XEPA 3CUEC 1SDEA 1YSQA 4P6ZS 5DFXA 3VMAA 4NKPA 4GHIA 2Z2MB 1E4DA 2XD5A 2ZC7A 3GVBA 3WS0A 5KZHA 2L1MA 2DCFA 1I2WA 3HLGA 4LGWA 1KDSA 3PBTA 2J3TC 2H28A 3CWFA 1PW1A 3QP1A 3R7WA 4EBNA 3BY8A 5CHUA 4S2KA 1IEMA 3CG5A 1G6AA 4FSFA 5CXWA 4JXSA 2PBYA 5GLBA 3IBRA 3LEQA 4HP4A 3LI8A 4S2PA 2ZQAA 3BLSA 5KSCA 2HP5A 1QMFA 2VX8A 1K55C 3WRZA 3S22A 3SW1A 4IHQA 2JHEA 1PYYA 3P09A 4OQ0A 5F5YA 1LI0A 3TE8A 5GLAA 2PD7A 3M6HA 2GNXA 1TS7A 1MY8A 2XRNA 3BW6A 1NY0A 5DTKA 1PWCA 3KX0X 3QNCA 3UB9A 4IUHA 3BY9A 1A0KA 1IYQA 4PM6A 3C38A 3V3SA 5E2HA 3N4IA 2QJ5A 1F98A 3MJQA 1MKIA 3DWZA 4EW7A 5HAQA 2XA7M 1CK3A 3V3RA 3OLOA 4GDBA 3EEAA 5EE8A 3BFCA 2HDSA 3PBRA 2LB5A 2OLVA 2Q0OA 3BECA 1BUEA 1ERMA 3JYIA 1D06A 3A0RA 3SOIA 3NDEA 4JPMA 2M1CA 3CJMA 4PAUA 1NLYA 4OOLA 3IWIA 2W3DA 2Z6CA 2ZC4B 3IH8A 4OH0A 1TS8A 4WMCD 5EVID 3EOIA 1M6KA 3MMHA 1XPBA 3MFXA 4N92A 5HAIA 3IX3A 5I94A 2OLUA 3LUQA 3A0SA 2IWDA 3FKVA 3VOYA 5M19A 4F3LA 3H7WA 5AVEA 3NECA 2VJWA 2XDMA 3JPUA 4FUWA 3OCLA 5HSQA 2FH5A 3BFDA 4E3LA 4S2OA 3PXPA 3CPTB 5EUAA 3VOLA 4NETA 1T19A 4R4SA 2Y2GA 4D60A 4YWZA 1FR6A 3AGDA 5A8BA 3LR3A 3UDIA 2WAFA 4ZTKA 4HESA 3MXRA 2W1TB 1MWRA 2H0YA 1KE4A 4N9LA 1YPRA 4OPQA 4JLFA 2ACGA 4RYEA 3NULA 1PFLA 2CMNA 3F1OB 3E4OA 1LSXA 5CHJA 1N9BA 3ICYA 2WKRA 3PBNA 3DBAA 4QHCA 1KE3A 3HREA 4U0XA 1RGYA 3PAEA 5HDCA 5FI7A 1PWDA 2XQZA 3F1NA 3ZGAB 3UY6A 3VSKA 1MXOA 4KG6A 4O01A 3D4FA 1S66L 3HUOA 2WGVA 2Y2QA 5FAQA 3B33A 2A24B 2W3EA 4HEFA 3B3XA 4R3AA 4P0MA 1WYBA 4U0TA 1MZUA 4UHUA 1YKDA 3LY3A 5DVAA 2PYRA 4ME4A 1TDGA 1UWPX 4UAAA 3UE0A 1FQGA 4S2IA 3IH9A 2V20A 4MCWA 4Y5FA 1XJ3A 2XFSA 3L9KA 1QMEA 5FI2A 4JF4A 4EQIA 4RQ9A 1ESIA 4NK3A 1SZVA 5A93A 2ZQ7A 4II7A 3Q07A 2ZL1B 1JWVA 2G2WA 4HP9A 4GB7A 2WAEA 3TW8A 4IBRA 5FEFA 1WYCA 3T1QB 1H8YA 5HDSA 2HP6A 4BD0A 3VFFA 2Y2LA 3VSLA 3BJNA 4MMNA 2XD1A 1K38A 1ACFA 3WWXA 1HD8A 3ZNTA 4FOFA 1CF0A 3NC8A 4UA7A 3G30A 1W8QA 3U2AA 2YKFA 3BLMA 3KYEA 3A3DA 1M40A 4KQQA 4GJ4A 2C5WB 2Y4AA 1L3LA 4MN7A 4X69A 4MNRA 1PZPA 1GSXA 1CEGA 5CGSA 2XA7S 3F1OA 4EEPA 4IUKA 4OKPA 4JXWA 1DRMA 3UB6A 2H0TA 1FR1A 2EX8A 4WLAA 1K4FA 4IVIA 3A3JA 1W7FA 3WS5A 3KYZA 4DE2A 2ZJ9A 5CX7A 2RCXA 3FG8A 1D7EA 4FD8A 3TG9A 1DP6A 2WKHA 3HL9A 4GS9B 2A24A 3GRJA 5A92A 4JGPA 4LV0A 2Y55A 1OPXA 3WS4A 5F69A 2FZ0A 1H3QA 3BYDA 3W4PA 4WELA 4LLOB 4PHTA 2JBFA 4O7DA 1TS6A 2O9AA 4HNBA 3ZVWA 2R9XA 3LI9A 3SH8A 5DTTA 1MWTA 2D01A 2V0WA 1K54A 2AVXA 2WUQA 5EECA 2XGNA 1LL9A 4ZJ1A 2PBDP 3K3CA 2P04A 4EU0A 1ZG4A 3LO7A 4KQRA 4FH4A 4X1LA 1NZUA 1VEUA 2OAQ1 1NZOA 2K2NA 3JVUA 4G3KA 4DJ2A 3UMEA 1OT6A 5FQKA 5HARA 3T4KA 3CAXA 3NY4A 3C5AA 2L0WA 1ZG6A 1DJAA 2VA0A 3GECA 2DNSA 3BM6A 3KSFA 4JXVA 1YSPA 2KLIA 4CLCA 3NDGA 4S2NC 4OONA 1W63M 1HZOA 2WADA 4K08A 3BRMA 2Q9MA 2VV7A 4UA6A 5CERA 1XA1A 4C75A 1NRFA 5L10A 4M4XA 3E0YA 1ODVA 4R1GA 3VP2A 4JBFA 3OPPA 1IKIA 2Y2KA 2PU4A 1E3UA 3WRTA 4XUXA 5EPHA 2VEAA 4O8GA 5CRFA 4WZ4A 1XJ6A 5TGFA 2ZQDA 3KSGA 2V1ZA 1CI8A 4KZ3A 2R9WA 1JTDA 2JKTI 4K91A 4XUZA 2PDRA 1XA7A 5EVLA 2VK3A 1AWIA 4BD1A 1PNEA 3EWKA 1DJCA 1XFNA 3EQVA 5FQMA 5LBRA 5I5LA 2O9BA 3LIEA 1NYMA 1P9RA 3W8KA 3HLBA 1XGJA 3LIBA 4KZ5A 3GMWA 3KO6A 5DKLA 1XX2A 1HVBA 4BENA 4WZ5C 2ZM2A 1GHIA 3WS1A 2EWVA 3NCKA 2EA9A 4EEUA 4KENB 5HW3A 2J3WA 2WK0A 1YT4A 3MZDA 1SCWA 3GQZA 2EX9A 1Z6FA 2W0NA 5FAOA 5MC7A 4OLDA 1S1YA 3C4PA 1Z09A 3IXHA 4PPRA 2NUTC 5FQJA 3JVVA 1X0OA 3G4PA 4F3LB 4WYYA 3H7WB 3ZFZA 3Q81A 2MJ6A 4B88A 4LRYC 4EBPA 1N9NA 3OOVA 1LSWA 5FI6A 4FH2A 3I7JA 3PBQA 3C7UA 2VKSA 1YLZA 3LY4A 5CGWA 3NJAA 4Q0JA 4HBTA 3QP8A 3K3DA 2ZC3B 2WZZA 1GCEA 3MXSA 2V1BA 1IYOA 2ZQCA 3A3EA 3D9YA 4S2MA 4LPZA 1GHPA 3MSHA 2BG1A 2B5RA 3EGXC 3PBSA 4YOFA 3IF5A 3E4QA 3VOZA 2CC1A 2VGLS 5F83A 1VETA 5F6AA 2Y2IA 3UO9A 2WGWA 1ERQA 4I3AA 3IF6A 1YLPA 3NOUC 1IYSA 5AQ9A 2RL3A 1LSVA 2OWJA 1P97A 4N1XA 4OQHA 1PRQA 1XJ2A 3HUMA 4F94A 4DXCA 4L0LA 1L0GA 4LRXC 4DE1A 4GLQA 2J9PA 1OMEA 1F2KA 4IJGA 4FTXA 4MBHA 4WM9A 3T12B 3UE3A 1UGUA 4PMAA 1GSWA 1SKFA 4OQIA 5EVIC 1MWUA 1L0EA 3C4OA 3CMZA 3GDIA 4GZBA 3CHWP 3F1NB 4M3KA 4C6YA 4B9OA 3OPLA 5AQAA 3H9WA 3Q1FA 3S1YA 5KMWA 5FATA 2XH9A 3NIAA 1XP4A 4E3NA 4GNUA 2W3HA 1EI5A 4S2JA 2J9OA 1P0ZA 3T1XA 3QP5A 3RFBA 1BLHA 2HJEA 1YLYA 3B42A 3LICA 5CEBA 3HVFA 1JNUA 5E43A 4ETXA 4CLCE 3SS3A 2PYPA 3UPOA 4Q8IA 3CUEA 3BFFA 1BULA 3MF0A 4HH3A 1TEMA 3IBJA 2PR6A 2D02A 2XR0A 5HD5A 4H6JA 3HJKA 3M6BA 2QWSA 3NHQA 3T4OA 2YKHA 3UNWA 2HPBA 4BMWA 4QJGA 3VP4A 3ZG7B 2X71A 5JYPA 4KZ6A 1ONGA 1LT0A 4JXGA 2A3UA 3CLOA 1RGZA 1U60A 4X55A 2PR5A 1S67L 4R23A 2LB9A 4L9EA 3P98A 2H5SA 4EQ1A 4I3IA 5FQIA 1H8ZA 2HDUA 1F9IA 1Y54A 4PKYG 1S6RA 1K55A 5A91A 3NBLA 3ZG8B 4O0PA 4UQIM 1LLBA 4QU3A 3TOIA 2ZD8A 5IT5A 5J3WA 3QP2A 3FC7A 3E4PA 5DFYA 4DE3A 3O86A 2J7VA 3C8CA 1HTZA 2L4RA 3V50A 2Y2NA 4H8RA 3RXWA 1NJ4A 3DTEA 4OQGA 5EVEA 4GD8A 2J8YA 2PD8A 4MN5A 1BLPA 1PZOA 3BQAA 5G4YA 4B4ZA 3S7QA 5L09A 3ITAA 2WKIA 4QY6A 3E2LA 1MPLA 2ZOIA 3ULFA 1XGIA 3EQUA 2KX6A 1I2SA 3IXGA 4GCZA 2V8FA 2JN7A 5E2FA 2PU2A 4K0WA 3UE1A 3HUNA 1IOUA 1K25A 1W63Q 1AXBA 2OWHA 3LYXA 3PR6A 5IS1A 3UPNA 4WF0A 3OBFA 3BFGA 3IQAA 2P08A
chains in the Genus database with same CATH topology
3PBOA 4ZJ1A 3VMAA 2EX2A 1IKGA 1ZG4A 3G34A 3LO7A 2Z2MB 4KQRA 1E4DA 4FH4A 2XD5A 2ZC7A 3GVBA 3WS0A 1NZUA 5KZHA 4OP5A 2HP9A 1NZOA 2DCFA 1I2WA 4R0QA 3HLGA 1KDSA 4MBKA 3M2JA 1VQQA 3PBTA 5FQKA 5HARA 4DKIA 4DF6A 1JTGA 1JWPA 3A3IA 3C5AA 3NY4A 1LL5A 1ZG6A 2QPNA 1PW1A 5CGXA 1DJAA 2DNSA 1VM1A 3BM6A 3E2KA 4JXVA 4EBNA 1LI9A 3IHAA 4GDNA 5DF7A 3LEZA 4S2KA 5CHUA 5FAPA 3NDGA 1IEMA 4S2NC 3CG5A 1IYPA 4OONA 4R3JA 1ZKJA 1G6AA 4FSFA 5CXWA 4JXSA 1K57C 3Q7ZA 4S2LA 2PBYA 2XLNA 3N6IA 5GLBA 3ZG9B 1HZOA 2WADA 2XF3A 2EX6A 3BRMA 2Q9MA 4GOGA 2EXAA 4S2PA 2ZQAA 3BLSA 3HLEA 4R3BA 5KSCA 2HP5A 2P74A 1QMFA 2WKEA 5EOEA 3IWOA 3ZDJA 4Y7PA 3DTMA 1K55C 3WRZA 4UA6A 3S22A 1TVFA 3GTCA 4IVKA 1PYYA 1XA1A 3P09A 5CERA 4C75A 2JC7A 1KDWA 1NRFA 2C6WB 4OQ0A 4OVDA 1YQSA 1LI0A 5FSRA 3FKWA 4KZ8A 2ZC5B 4R1GA 3VP2A 4JBFA 4YINA 5GLAA 4X68A 3M6HA 3OPPA 4Y0OA 1BTLA 4OPZA 1G68A 3W4OA 1KE0A 3AGFA 3N7WA 1IKIA 2Y2KA 3O87A 2PU4A 2X02A 4MBFA 1MY8A 4BLMA 2QZ6A 1E3UA 3WRTA 4XUXA 1EROA 1NY0A 5EPHA 5DTKA 1C3BA 4GD6A 3HLCA 5CRFA 1PWCA 4WZ4A 5TGFA 3QNCA 2ZQDA 2V1ZA 4LV1A 1CI8A 3M2KA 4KZ3A 4IBXA 2R9WA 1JTDA 3G2ZA 4K91A 4LV3A 1IYQA 4PM6A 1YLTA 4XUZA 3V3SA 4PM7A 5FDHA 4B4XA 5E2HA 3BFEA 3N4IA 1XA7A 4OPRA 4WMCA 5EVIA 5EVLA 1MKIA 3DWZA 4K0XA 4OOYA 5HX9A 5A90A 5HAQA 4R4RA 2DRWA 3VP3A 1CK3A 4BD1A 5GL9A 3V3RA 1DJCA 4GDBA 3EQVA 5FQMA 3WS2A 5EE8A 3BFCA 2HDSA 5CTNA 1NYMA 3PBRA 2OLVA 3BECA 3W8KA 3MBZA 4PM5A 1WE4A 3HLBA 1BUEA 1XGJA 2XFTA 1E3UD 1ZC2A 4QD4A 3VP1A 1ERMA 3ITBA 1FCMA 4KZ5A 5CTMA 3JYIA 3GMWA 3Q7VA 1YLJA 1XX2A 1HVBA 3SOIA 4BENA 4WZ5C 2ZM2A 1GHIA 3NDEA 4X53A 4JPMA 2E8IA 3WS1A 1J9MA 1KVMA 3NCKA 2Y2MA 3CJMA 4KENB 5HW3A 2WK0A 5E2EA 1YT4A 4OOLA 3MZDA 1SCWA 3GQZA 2EX9A 3IWIA 1RP5A 1Z6FA 5FAOA 5E2GA 2ZC4B 1I5QA 3IH8A 4OH0A 5GHZA 2P9VB 4RA7A 4WMCD 5EVID 3UDFA 1M6KA 1O7EA 1XPBA 2Y91A 4N92A 4EWFA 4OLDA 4PM8A 5IHVA 5HAIA 3ZVTA 3C4PA 3IXHA 1ONHA 4PPRA 5CEDA 1K54C 2HDQA 4KZ9A 5FQJA 5I94A 1W5DA 1W8YA 2OLUA 4GN2A 4MLLA 2H10A 3G4PA 1W79A 4WYYA 3SS4A 3A3FA 2IWDA 3FKVA 3VOYA 1FCOA 1GHMA 3ZFZA 3MKEA 5M19A 4QB8A 3Q81A 4B88A 1BSGA 4EBPA 3GSGA 4E3OA 3MZEA 5FI6A 4FH2A 5GHXA 1XKZA 4JKTA 3I7JA 3HLDA 3PBQA 1NXYA 3C7UA 2Y2PA 1FSWA 1YLZA 5L2FA 2XDMA 5FASA 3LY4A 5CECA 5CGWA 3OCLA 1ES2A 4Y0UA 3OC2A 2FFYA 3ZNYA 1DY6A 2Y59A 4HBTA 5EOOA 3N8SA 3BFDA 4FCFA 2ZC3B 4E3LA 2WZZA 4S2OA 4Z9QA 1GCEA 2ZM0A 3MXSA 1ESUA 1IYOA 5EUAA 4LCLA 2ZQCA 4LCMA 3A3EA 3BEBA 2OV5A 4CPKA 4S2MA 3ZCZA 5TFQA 4N1HA 3S4XA 1FCNA 4HBUA 1K57A 1GHPA 4NETA 2I72A 4P6BA 1K4EA 4OPYA 5U47A 2BG1A 5EECA 3Q82A 2A49A 2B5RA 4R4SA 1PI4A 1ALQA 3PBSA 5J8XA 5GHYA 3IF5A 4RX3A 3VOZA 2CC1A 2Y2GA 5F83A 2WGIA 4CJNA 2WGWB 1PI5A 5DF8A 1YMSA 4E3KA 2Y2IA 3UO9A 1FR6A 1MBLA 2WGWA 3AGDA 4UA9A 3VFHA 4E3JA 3IF6B 3QNBA 3UDIA 1ERQA 2WAFA 3G2YA 3O88A 4ZTKA 5F1FA 3IF6A 1YLPA 4IEDA 1ES4A 3MXRA 4HESA 4JF5A 5F1GA 1IYSA 5AQ9A 2RL3A 1MWRA 2H0YA 1L0FA 4N1XA 4OQHA 1KE4A 4D2OA 3HLFA 3HUMA 1L2SA 1YLWA 4F94A 4N9LA 2ZC6B 3VP0A 4OPQA 4JLFA 4DXCA 4L0LA 1L0GA 1KVLA 3HBRA 4RYEA 3ZHHA 1JVJA 5FA7A 4DE1A 3GV9A 3RJUA 4KG5A 4KZBA 2J9PA 3NI9A 1OMEA 3OZHA 5KSHA 3OPHA 5CHJA 1N9BA 1GA0A 4MBHA 4WM9A 3W4QA 5HAPA 3UE3A 3C7VA 3PBNA 3UN7A 4PMAA 4BL3A 2G2UA 1SKFA 4OQIA 5JYOA 1ES3A 1BLSA 1Q2QA 5EVIC 1MWUA 1L0EA 3C4OA 3CMZA 1K56A 3HREA 1KE3A 3GR2A 4QHCA 4GZBA 1XXMA 4U0XA 3DWKA 3FYZA 3HLWA 4ZAMA 1RGYA 3PAEA 4YFMA 3DW0A 1PWDA 2XQZA 5FI7A 3ZGAB 4RVAA 5TR7A 1YM1A 4M3KA 3UY6A 2Q9NA 3VSKA 4C6YA 3OPLA 5AQAA 5M18A 3Q1FA 1MXOA 1KGFA 3S1YA 4KG6A 5KMWA 3D4FA 5FATA 2XH9A 3NIAA 4WBGA 3HUOA 1BZAA 2WGVA 5G18A 1XP4A 4E3NA 2Y2QA 2X01A 5FAQA 4GNUA 5HL1A 2VGKA 1EI5A 1FSYA 4KQOA 4OP8A 4S2JA 4HEFA 3B3XA 4P0MA 2J9OA 1WYBA 4U0TA 4WEKA 4UHUA 2ZM8A 1BLHA 3O3VA 3V5MA 2Y2OA 2P9VA 4X56A 1NYYA 1YLYA 3IXDA 4DDYA 3LY3A 5CEBA 5DVAA 5F82A 3HVFA 3IXBA 1TDGA 5E43A 3MKFA 2IWBA 4UAAA 1K56D 3SS3A 3UE0A 3UPOA 1O07A 1FQGA 2GDNA 1K6SA 4S2IA 4Q8IA 3BFFA 1BULA 2ZQ8A 2Z2LB 3IH9A 2V20A 1TEMA 1FOFA 3RXXA 2XR0A 2XFSA 1L0DA 1QMEA 5FI2A 3AGEA 3OCNA 4JF4A 4EUZA 3M6BA 3PTEA 2JCHA 4EQIA 3ISGA 1ESIA 4NK3A 1KGGA 3UNWA 2ZMAA 2HPBA 3OPRA 5A93A 3IT9A 2ZQ7A 4QJGA 3VP4A 3ZG7B 2X71A 4Y0TA 5JYPA 1CEFA 4KZ6A 1JWZA 4ZJ2A 4BQMA 1ONGA 3Q07A 5CHMA 4EV4A 1JWVA 3N8RA 3IWQA 2G2WA 4JXGA 4GB7A 2A3UA 2EFXA 1SDNA 2WAEA 4P85A 4E3MA 1RGZA 1U60A 4IBRA 4X55A 4A5RA 4PM9A 1SHVA 2WZXA 1WYCA 1TDLA 1H8YA 4R23A 2HP6A 4OLGA 4S2NA 1YMXA 2EXBA 5BOHA 4KZ7A 1N4OA 5GLCA 4BL2A 4BD0A 3VFFA 3P98A 2H5SA 1LHYA 1H8ZA 5FQIA 2HDUA 5DF9A 1Y54A 2Y2LA 3VSLA 2ZLYA 1S6RA 3FZCA 5GLDA 3MFDA 2Y2HA 2XD1A 1K55A 1K38A 1PW8A 4DDSA 5A91A 1HD8A 3SH9A 1K6RA 3WWXA 3NBLA 3ZNTA 3NC8A 3ZG8B 4UA7A 3G31A 3G30A 1W8QA 1LLBA 1SDEA 4QU3A 3TOIA 5AQBA 2VGJA 3BLMA 3A3DA 1Q2PA 4LV2A 2ZD8A 1M40A 4KQQA 3LCEA 5D3OA 2Y2JA 2IWCA 4KG2A 5FQ9A 3IF6C 4DE3A 2C5WB 3O86A 4U3TA 3QHYA 2Y4AA 3N8LA 2V2FF 2ZQ9A 1BT5A 2J7VA 4X69A 4MNRA 4MEZA 1PZPA 1MWSA 4OOMA 5DTSA 2QMIA 2UWXA 3ZG0A 1CEGA 1HTZA 5CGSA 3V50A 4GKUA 2Y2NA 3CZDA 4P87A 5AQ7A 4KZAA 5FQQA 4H8RA 4E6XA 3RXWA 1NJ4A 4ZJ3A 4OKPA 3G35A 4OQGA 4BJPA 4JXWA 3PAGA 1S0WA 1PIOA 2H0TA 1FR1A 4GD8A 2J8YA 2EX8A 2FFFB 1K4FA 4XXRA 4N9KA 4IVIA 4X6TA 1BLPA 4ZBEA 4QY5A 1PZOA 3A3JA 4E6WA 1W7FA 4JF6A 3TSGA 2BLSA 3WS5A 1DJBA 5M1AA 5EVIB 4B4ZA 4DE2A 4ID4A 2ZJ9A 3ITAA 2RCXA 2HDRA 2WKIA 4QY6A 1GA9A 1IELA 4FD8A 3TG9A 1CI9A 2JE5A 2OSUA 2WKHA 3E2LA 3HL9A 1MPLA 1EWZA 3GRJA 3UPPA 1XGIA 5A92A 3EQUA 3MZFA 4LV0A 4E3IA 2Y55A 3WS4A 4C3QA 3FWLA 1I2SA 4WZ5A 1BLCA 3G32A 1PWGA 3IXGA 3Q7VB 3BYDA 4DE0A 3W4PA 4WELA 4KZ4A 3SS5A 5E2FA 4LENA 5HFOA 2PU2A 4K0WA 1RCJA 2JBFA 3UE1A 4EBLA 3HUNA 3SH7A 1K25A 1AXBA 4O7DA 3ZG5A 2XK1A 1E25A 4WEJA 3FV7A 4DXBA 3ZVWA 3UPNA 3UDXA 2R9XA 3IHBA 2WYXA 1H5XA 1ES5A 2EFUA 3SH8A 3V39A 5DTTA 4ZDXA 1KGEA 1MWTA 3BFGA 4RX2A 4DRTA 1K54A 2XEPA 3IQAA 2WUQA 2XGNA 1LL9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PBO A;  4ZJ1 A;  3VMA A;  2EX2 A;  1IKG A;  1ZG4 A;  3G34 A;  3LO7 A;  2Z2M B;  4KQR A;  1E4D A;  4FH4 A;  2XD5 A;  2ZC7 A;  3GVB A;  3WS0 A;  1NZU A;  5KZH A;  4OP5 A;  2HP9 A;  1NZO A;  2DCF A;  1I2W A;  4R0Q A;  3HLG A;  1KDS A;  4MBK A;  3M2J A;  1VQQ A;  3PBT A;  5FQK A;  5HAR A;  4DKI A;  4DF6 A;  1JTG A;  1JWP A;  3A3I A;  3C5A A;  3NY4 A;  1LL5 A;  1ZG6 A;  2QPN A;  1PW1 A;  5CGX A;  1DJA A;  2DNS A;  1VM1 A;  3BM6 A;  3E2K A;  4JXV A;  4EBN A;  1LI9 A;  3IHA A;  4GDN A;  5DF7 A;  3LEZ A;  4S2K A;  5CHU A;  5FAP A;  3NDG A;  1IEM A;  4S2N C;  3CG5 A;  1IYP A;  4OON A;  4R3J A;  1ZKJ A;  1G6A A;  4FSF A;  5CXW A;  4JXS A;  1K57 C;  3Q7Z A;  4S2L A;  2PBY A;  2XLN A;  3N6I A;  5GLB A;  3ZG9 B;  1HZO A;  2WAD A;  2XF3 A;  2EX6 A;  3BRM A;  2Q9M A;  4GOG A;  2EXA A;  4S2P A;  2ZQA A;  3BLS A;  3HLE A;  4R3B A;  5KSC A;  2HP5 A;  2P74 A;  1QMF A;  2WKE A;  5EOE A;  3IWO A;  3ZDJ A;  4Y7P A;  3DTM A;  1K55 C;  3WRZ A;  4UA6 A;  3S22 A;  1TVF A;  3GTC A;  4IVK A;  1PYY A;  1XA1 A;  3P09 A;  5CER A;  4C75 A;  2JC7 A;  1KDW A;  1NRF A;  2C6W B;  4OQ0 A;  4OVD A;  1YQS A;  1LI0 A;  5FSR A;  3FKW A;  4KZ8 A;  2ZC5 B;  4R1G A;  3VP2 A;  4JBF A;  4YIN A;  5GLA A;  4X68 A;  3M6H A;  3OPP A;  4Y0O A;  1BTL A;  4OPZ A;  1G68 A;  3W4O A;  1KE0 A;  3AGF A;  3N7W A;  1IKI A;  2Y2K A;  3O87 A;  2PU4 A;  2X02 A;  4MBF A;  1MY8 A;  4BLM A;  2QZ6 A;  1E3U A;  3WRT A;  4XUX A;  1ERO A;  1NY0 A;  5EPH A;  5DTK A;  1C3B A;  4GD6 A;  3HLC A;  5CRF A;  1PWC A;  4WZ4 A;  5TGF A;  3QNC A;  2ZQD A;  2V1Z A;  4LV1 A;  1CI8 A;  3M2K A;  4KZ3 A;  4IBX A;  2R9W A;  1JTD A;  3G2Z A;  4K91 A;  4LV3 A;  1IYQ A;  4PM6 A;  1YLT A;  4XUZ A;  3V3S A;  4PM7 A;  5FDH A;  4B4X A;  5E2H A;  3BFE A;  3N4I A;  1XA7 A;  4OPR A;  4WMC A;  5EVI A;  5EVL A;  1MKI A;  3DWZ A;  4K0X A;  4OOY A;  5HX9 A;  5A90 A;  5HAQ A;  4R4R A;  2DRW A;  3VP3 A;  1CK3 A;  4BD1 A;  5GL9 A;  3V3R A;  1DJC A;  4GDB A;  3EQV A;  5FQM A;  3WS2 A;  5EE8 A;  3BFC A;  2HDS A;  5CTN A;  1NYM A;  3PBR A;  2OLV A;  3BEC A;  3W8K A;  3MBZ A;  4PM5 A;  1WE4 A;  3HLB A;  1BUE A;  1XGJ A;  2XFT A;  1E3U D;  1ZC2 A;  4QD4 A;  3VP1 A;  1ERM A;  3ITB A;  1FCM A;  4KZ5 A;  5CTM A;  3JYI A;  3GMW A;  3Q7V A;  1YLJ A;  1XX2 A;  1HVB A;  3SOI A;  4BEN A;  4WZ5 C;  2ZM2 A;  1GHI A;  3NDE A;  4X53 A;  4JPM A;  2E8I A;  3WS1 A;  1J9M A;  1KVM A;  3NCK A;  2Y2M A;  3CJM A;  4KEN B;  5HW3 A;  2WK0 A;  5E2E A;  1YT4 A;  4OOL A;  3MZD A;  1SCW A;  3GQZ A;  2EX9 A;  3IWI A;  1RP5 A;  1Z6F A;  5FAO A;  5E2G A;  2ZC4 B;  1I5Q A;  3IH8 A;  4OH0 A;  5GHZ A;  2P9V B;  4RA7 A;  4WMC D;  5EVI D;  3UDF A;  1M6K A;  1O7E A;  1XPB A;  2Y91 A;  4N92 A;  4EWF A;  4OLD A;  4PM8 A;  5IHV A;  5HAI A;  3ZVT A;  3C4P A;  3IXH A;  1ONH A;  4PPR A;  5CED A;  1K54 C;  2HDQ A;  4KZ9 A;  5FQJ A;  5I94 A;  1W5D A;  1W8Y A;  2OLU A;  4GN2 A;  4MLL A;  2H10 A;  3G4P A;  1W79 A;  4WYY A;  3SS4 A;  3A3F A;  2IWD A;  3FKV A;  3VOY A;  1FCO A;  1GHM A;  3ZFZ A;  3MKE A;  5M19 A;  4QB8 A;  3Q81 A;  4B88 A;  1BSG A;  4EBP A;  3GSG A;  4E3O A;  3MZE A;  5FI6 A;  4FH2 A;  5GHX A;  1XKZ A;  4JKT A;  3I7J A;  3HLD A;  3PBQ A;  1NXY A;  3C7U A;  2Y2P A;  1FSW A;  1YLZ A;  5L2F A;  2XDM A;  5FAS A;  3LY4 A;  5CEC A;  5CGW A;  3OCL A;  1ES2 A;  4Y0U A;  3OC2 A;  2FFY A;  3ZNY A;  1DY6 A;  2Y59 A;  4HBT A;  5EOO A;  3N8S A;  3BFD A;  4FCF A;  2ZC3 B;  4E3L A;  2WZZ A;  4S2O A;  4Z9Q A;  1GCE A;  2ZM0 A;  3MXS A;  1ESU A;  1IYO A;  5EUA A;  4LCL A;  2ZQC A;  4LCM A;  3A3E A;  3BEB A;  2OV5 A;  4CPK A;  4S2M A;  3ZCZ A;  5TFQ A;  4N1H A;  3S4X A;  1FCN A;  4HBU A;  1K57 A;  1GHP A;  4NET A;  2I72 A;  4P6B A;  1K4E A;  4OPY A;  5U47 A;  2BG1 A;  5EEC A;  3Q82 A;  2A49 A;  2B5R A;  4R4S A;  1PI4 A;  1ALQ A;  3PBS A;  5J8X A;  5GHY A;  3IF5 A;  4RX3 A;  3VOZ A;  2CC1 A;  2Y2G A;  5F83 A;  2WGI A;  4CJN A;  2WGW B;  1PI5 A;  5DF8 A;  1YMS A;  4E3K A;  2Y2I A;  3UO9 A;  1FR6 A;  1MBL A;  2WGW A;  3AGD A;  4UA9 A;  3VFH A;  4E3J A;  3IF6 B;  3QNB A;  3UDI A;  1ERQ A;  2WAF A;  3G2Y A;  3O88 A;  4ZTK A;  5F1F A;  3IF6 A;  1YLP A;  4IED A;  1ES4 A;  3MXR A;  4HES A;  4JF5 A;  5F1G A;  1IYS A;  5AQ9 A;  2RL3 A;  1MWR A;  2H0Y A;  1L0F A;  4N1X A;  4OQH A;  1KE4 A;  4D2O A;  3HLF A;  3HUM A;  1L2S A;  1YLW A;  4F94 A;  4N9L A;  2ZC6 B;  3VP0 A;  4OPQ A;  4JLF A;  4DXC A;  4L0L A;  1L0G A;  1KVL A;  3HBR A;  4RYE A;  3ZHH A;  1JVJ A;  5FA7 A;  4DE1 A;  3GV9 A;  3RJU A;  4KG5 A;  4KZB A;  2J9P A;  3NI9 A;  1OME A;  3OZH A;  5KSH A;  3OPH A;  5CHJ A;  1N9B A;  1GA0 A;  4MBH A;  4WM9 A;  3W4Q A;  5HAP A;  3UE3 A;  3C7V A;  3PBN A;  3UN7 A;  4PMA A;  4BL3 A;  2G2U A;  1SKF A;  4OQI A;  5JYO A;  1ES3 A;  1BLS A;  1Q2Q A;  5EVI C;  1MWU A;  1L0E A;  3C4O A;  3CMZ A;  1K56 A;  3HRE A;  1KE3 A;  3GR2 A;  4QHC A;  4GZB A;  1XXM A;  4U0X A;  3DWK A;  3FYZ A;  3HLW A;  4ZAM A;  1RGY A;  3PAE A;  4YFM A;  3DW0 A;  1PWD A;  2XQZ A;  5FI7 A;  3ZGA B;  4RVA A;  5TR7 A;  1YM1 A;  4M3K A;  3UY6 A;  2Q9N A;  3VSK A;  4C6Y A;  3OPL A;  5AQA A;  5M18 A;  3Q1F A;  1MXO A;  1KGF A;  3S1Y A;  4KG6 A;  5KMW A;  3D4F A;  5FAT A;  2XH9 A;  3NIA A;  4WBG A;  3HUO A;  1BZA A;  2WGV A;  5G18 A;  1XP4 A;  4E3N A;  2Y2Q A;  2X01 A;  5FAQ A;  4GNU A;  5HL1 A;  2VGK A;  1EI5 A;  1FSY A;  4KQO A;  4OP8 A;  4S2J A;  4HEF A;  3B3X A;  4P0M A;  2J9O A;  1WYB A;  4U0T A;  4WEK A;  4UHU A;  2ZM8 A;  1BLH A;  3O3V A;  3V5M A;  2Y2O A;  2P9V A;  4X56 A;  1NYY A;  1YLY A;  3IXD A;  4DDY A;  3LY3 A;  5CEB A;  5DVA A;  5F82 A;  3HVF A;  3IXB A;  1TDG A;  5E43 A;  3MKF A;  2IWB A;  4UAA A;  1K56 D;  3SS3 A;  3UE0 A;  3UPO A;  1O07 A;  1FQG A;  2GDN A;  1K6S A;  4S2I A;  4Q8I A;  3BFF A;  1BUL A;  2ZQ8 A;  2Z2L B;  3IH9 A;  2V20 A;  1TEM A;  1FOF A;  3RXX A;  2XR0 A;  2XFS A;  1L0D A;  1QME A;  5FI2 A;  3AGE A;  3OCN A;  4JF4 A;  4EUZ A;  3M6B A;  3PTE A;  2JCH A;  4EQI A;  3ISG A;  1ESI A;  4NK3 A;  1KGG A;  3UNW A;  2ZMA A;  2HPB A;  3OPR A;  5A93 A;  3IT9 A;  2ZQ7 A;  4QJG A;  3VP4 A;  3ZG7 B;  2X71 A;  4Y0T A;  5JYP A;  1CEF A;  4KZ6 A;  1JWZ A;  4ZJ2 A;  4BQM A;  1ONG A;  3Q07 A;  5CHM A;  4EV4 A;  1JWV A;  3N8R A;  3IWQ A;  2G2W A;  4JXG A;  4GB7 A;  2A3U A;  2EFX A;  1SDN A;  2WAE A;  4P85 A;  4E3M A;  1RGZ A;  1U60 A;  4IBR A;  4X55 A;  4A5R A;  4PM9 A;  1SHV A;  2WZX A;  1WYC A;  1TDL A;  1H8Y A;  4R23 A;  2HP6 A;  4OLG A;  4S2N A;  1YMX A;  2EXB A;  5BOH A;  4KZ7 A;  1N4O A;  5GLC A;  4BL2 A;  4BD0 A;  3VFF A;  3P98 A;  2H5S A;  1LHY A;  1H8Z A;  5FQI A;  2HDU A;  5DF9 A;  1Y54 A;  2Y2L A;  3VSL A;  2ZLY A;  1S6R A;  3FZC A;  5GLD A;  3MFD A;  2Y2H A;  2XD1 A;  1K55 A;  1K38 A;  1PW8 A;  4DDS A;  5A91 A;  1HD8 A;  3SH9 A;  1K6R A;  3WWX A;  3NBL A;  3ZNT A;  3NC8 A;  3ZG8 B;  4UA7 A;  3G31 A;  3G30 A;  1W8Q A;  1LLB A;  1SDE A;  4QU3 A;  3TOI A;  5AQB A;  2VGJ A;  3BLM A;  3A3D A;  1Q2P A;  4LV2 A;  2ZD8 A;  1M40 A;  4KQQ A;  3LCE A;  5D3O A;  2Y2J A;  2IWC A;  4KG2 A;  5FQ9 A;  3IF6 C;  4DE3 A;  2C5W B;  3O86 A;  4U3T A;  3QHY A;  2Y4A A;  3N8L A;  2V2F F;  2ZQ9 A;  1BT5 A;  2J7V A;  4X69 A;  4MNR A;  4MEZ A;  1PZP A;  1MWS A;  4OOM A;  5DTS A;  2QMI A;  2UWX A;  3ZG0 A;  1CEG A;  1HTZ A;  5CGS A;  3V50 A;  4GKU A;  2Y2N A;  3CZD A;  4P87 A;  5AQ7 A;  4KZA A;  5FQQ A;  4H8R A;  4E6X A;  3RXW A;  1NJ4 A;  4ZJ3 A;  4OKP A;  3G35 A;  4OQG A;  4BJP A;  4JXW A;  3PAG A;  1S0W A;  1PIO A;  2H0T A;  1FR1 A;  4GD8 A;  2J8Y A;  2EX8 A;  2FFF B;  1K4F A;  4XXR A;  4N9K A;  4IVI A;  4X6T A;  1BLP A;  4ZBE A;  4QY5 A;  1PZO A;  3A3J A;  4E6W A;  1W7F A;  4JF6 A;  3TSG A;  2BLS A;  3WS5 A;  1DJB A;  5M1A A;  5EVI B;  4B4Z A;  4DE2 A;  4ID4 A;  2ZJ9 A;  3ITA A;  2RCX A;  2HDR A;  2WKI A;  4QY6 A;  1GA9 A;  1IEL A;  4FD8 A;  3TG9 A;  1CI9 A;  2JE5 A;  2OSU A;  2WKH A;  3E2L A;  3HL9 A;  1MPL A;  1EWZ A;  3GRJ A;  3UPP A;  1XGI A;  5A92 A;  3EQU A;  3MZF A;  4LV0 A;  4E3I A;  2Y55 A;  3WS4 A;  4C3Q A;  3FWL A;  1I2S A;  4WZ5 A;  1BLC A;  3G32 A;  1PWG A;  3IXG A;  3Q7V B;  3BYD A;  4DE0 A;  3W4P A;  4WEL A;  4KZ4 A;  3SS5 A;  5E2F A;  4LEN A;  5HFO A;  2PU2 A;  4K0W A;  1RCJ A;  2JBF A;  3UE1 A;  4EBL A;  3HUN A;  3SH7 A;  1K25 A;  1AXB A;  4O7D A;  3ZG5 A;  2XK1 A;  1E25 A;  4WEJ A;  3FV7 A;  4DXB A;  3ZVW A;  3UPN A;  3UDX A;  2R9X A;  3IHB A;  2WYX A;  1H5X A;  1ES5 A;  2EFU A;  3SH8 A;  3V39 A;  5DTT A;  4ZDX A;  1KGE A;  1MWT A;  3BFG A;  4RX2 A;  4DRT A;  1K54 A;  2XEP A;  3IQA A;  2WUQ A;  2XGN A;  1LL9 A; 
#chains in the Genus database with same CATH topology
 4BWI A;  2EX2 A;  1IKG A;  4NXB A;  1NLZ A;  1VEU B;  4Y15 A;  1S4R A;  1UWN X;  4R0Q A;  4EXO A;  5DKK A;  4R70 A;  5AJG A;  2GZA A;  4DKI A;  4DF6 A;  1JTG A;  2W3G A;  4Y2F A;  1LL5 A;  2GJ3 A;  4NEE D;  2QPN A;  4P6Z M;  5CGX A;  1P9W A;  4CLC B;  4GDN A;  5DF7 A;  3LEZ A;  2V0U A;  1IYP A;  1ZKJ A;  1T1A A;  4MN6 A;  2XLN A;  3N6I A;  3ZG9 B;  2EX6 A;  4NXE A;  3HLE A;  4R3B A;  5EOE A;  2WKE A;  3IWO A;  2DMW A;  3DTM A;  4Y7P A;  3DTI A;  1TS0 A;  1TVF A;  3GTC A;  4IVK A;  1KDW A;  2C6W B;  4EUV A;  1BYW A;  3PYP A;  1YQS A;  5FSR A;  3FKW A;  4KZ8 A;  4Y13 A;  2ZC5 B;  2WKP A;  1T1B A;  3ZYT A;  4X68 A;  1Y28 A;  4Y0O A;  1G68 A;  3AGF A;  3N7W A;  2JKR M;  2X02 A;  4BLM A;  3T4Q A;  4CLC D;  1ERO A;  2BTF P;  4GD6 A;  1G5U A;  2B95 A;  1NRJ A;  4LV1 A;  1G28 A;  4IBX A;  3IX4 A;  4LV3 A;  1YLT A;  4LRZ E;  5FDH A;  3BFE A;  4HHD A;  3C2W A;  4K0X A;  5HX9 A;  5A90 A;  4NXF A;  4R4R A;  3IS2 B;  5AVF A;  1CJF A;  3VE4 A;  2W1R A;  2XFT A;  1E3U D;  3NOT C;  3VP1 A;  5CTM A;  2UV0 E;  5HPI A;  4X53 A;  1J9M A;  5E2E A;  4QWO A;  1RP5 A;  2Z6D A;  3MQ0 A;  5GHZ A;  2P9V B;  3MR0 A;  3UDF A;  3ZVT A;  3P7N A;  1ONH A;  4GN2 A;  5HL6 A;  1W79 A;  3SS4 A;  3A3F A;  1FCO A;  3MKE A;  3TJZ C;  1K0K A;  2ZMV A;  1BSG A;  3T4T A;  2J80 A;  3MZE A;  5GHX A;  1XKZ A;  3HLD A;  2VZW A;  1NXY A;  4BBU A;  2Y2P A;  1FSW A;  2KOI A;  1ES2 A;  2HZ5 A;  4Y0U A;  3OC2 A;  3ZNY A;  1DY6 A;  4KUK A;  4FCF A;  4Z9Q A;  1ESU A;  4LCL A;  2HF6 A;  2VLG A;  4LCM A;  4I39 A;  4UQI S;  4AFI A;  5TFQ A;  4N1H A;  1FCN A;  4HBU A;  4B93 A;  2I72 A;  3E98 A;  4P6B A;  4OPY A;  2XRO A;  5U47 A;  3Q82 A;  4JGO A;  2A49 A;  2W27 A;  5G4Z A;  1PI4 A;  5GHY A;  3UB7 A;  1VET B;  5L07 A;  1OTD A;  4L9G A;  2WGW B;  1YAX A;  3IF6 B;  3QNB A;  1DP9 A;  3O88 A;  3G2Y A;  5F1F A;  4IED A;  1ES4 A;  4X1M A;  4D2O A;  3HLF A;  3R4K A;  3T4S A;  3DTK A;  1KVL A;  3ZHH A;  3RJU A;  4KZB A;  3NI9 A;  4Z1W A;  3OPH A;  3P01 A;  1GA0 A;  1N9O A;  5HAP A;  3C7V A;  5JYO A;  3UN7 A;  4BL3 A;  2PT7 A;  1ES3 A;  3S7P A;  1BLS A;  3IS2 A;  1K56 A;  1XXM A;  3HLW A;  4YFM A;  3DW0 A;  4Q0I A;  4RVA A;  2NUP C;  1YM1 A;  2BAS A;  2Q9N A;  4NXG A;  4QPR A;  1KGF A;  4WBG A;  2X01 A;  3IX8 A;  3VE3 A;  2VGK A;  4OP8 A;  2ZMF A;  3K2N A;  2I9V A;  3CI6 A;  2JKG A;  4HJ4 A;  2ZM8 A;  3F1P A;  3O3V A;  3QP4 A;  2VV8 A;  3V5M A;  2P9V A;  1VHM A;  4PKY A;  4BBV A;  3IXD A;  3KSI A;  4DDY A;  4G3W A;  1MC0 A;  4R38 A;  3LGO A;  4YNR A;  5C5K A;  1O07 A;  1K6S A;  2ZQ8 A;  2PHY A;  1FOF A;  3RXX A;  5TBM A;  4L9F A;  4H6J B;  1FIK A;  4E04 A;  1XFQ A;  3OCN A;  4UEY A;  4EUZ A;  3PTE A;  2JCH A;  1KGG A;  2ZMA A;  3OPR A;  4Y0T A;  1JWZ A;  1OTA A;  4BQM A;  5CHM A;  4EV4 A;  3N8R A;  3IWQ A;  1WA9 A;  1SDN A;  4P85 A;  5TJJ A;  4A5R A;  4PM9 A;  1SHV A;  2WZX A;  1TDL A;  3U4L P;  4I5S A;  4OLG A;  4S2N A;  2EXB A;  4KZ7 A;  1N4O A;  4BL2 A;  3RH8 B;  4EET B;  1LHY A;  5DF9 A;  4ZRR A;  3FZC A;  2R78 A;  2Y2H A;  1PW8 A;  1OTB A;  4DDS A;  2O9C A;  2INW A;  3SH9 A;  1K6R A;  5EM1 A;  3H82 A;  3MQQ A;  3G31 A;  2J3T D;  3KSH A;  5AQB A;  2VGJ A;  2IWC A;  2QYB A;  4U3T A;  3N8L A;  2V2F F;  2ZQ9 A;  1MWS A;  4OOM A;  5DTS A;  2UWX A;  3CZD A;  3UB5 P;  4P87 A;  4KZA A;  3EEH A;  4Q0H A;  1S0W A;  1PIO A;  2HGV A;  3O5Y A;  1OJG A;  4X6T A;  4ZBE A;  4QY5 A;  4NG2 A;  4JF6 A;  3TSG A;  5M1A A;  5EVI B;  1SKO B;  2K7S A;  4ID4 A;  1D1J A;  1GA9 A;  3G6O A;  2OSU A;  5HWV A;  5EV0 A;  1EWZ A;  5HD3 A;  4ARZ A;  3MZF A;  3D3O A;  4C3Q A;  5DJT A;  4WZ5 A;  1BLC A;  3G32 A;  3Q7V B;  2XSS A;  4GW9 A;  4KZ4 A;  5HFO A;  1F5M A;  3SH7 A;  3LFV A;  3S7N A;  2OOL A;  3ZG5 A;  2XK1 A;  2K31 A;  1E25 A;  4WEJ A;  3UB8 A;  3FV7 A;  4DXB A;  2ZBB A;  2WYX A;  1H5X A;  1ES5 A;  2EFU A;  1KGE A;  4RX2 A;  4I3J A;  3MKF A;  3UMD A;  3PBO A;  4R6L A;  2A2L A;  3G34 A;  1ZTU A;  3MQO A;  4OP5 A;  2HP9 A;  5F68 A;  5J7E A;  3KYQ A;  3LID A;  4MBK A;  3M2J A;  1VQQ A;  4MDZ A;  5HWT A;  4Y17 A;  1JWP A;  3A3I A;  3SZT A;  2GX5 A;  1VM1 A;  3E2K A;  1LI9 A;  3IHA A;  5FAP A;  3DAV A;  4R3J A;  3T4L A;  1OTI A;  1K57 C;  3Q7Z A;  4S2L A;  2HJ9 C;  2XF3 A;  4GOG A;  2EXA A;  2P74 A;  3ZDJ A;  5DJU A;  2OAP 1;  2JC7 A;  4OVD A;  4DN0 A;  4I38 A;  3D72 A;  4YIN A;  4BBT A;  1BTL A;  4OPZ A;  5HWW A;  2V1A A;  3W4O A;  1KE0 A;  1S1Z A;  3O87 A;  4MBF A;  2QZ6 A;  4JGR A;  4G3V A;  1C3B A;  3HLC A;  2QJ7 A;  3M2K A;  3T1R A;  3G2Z A;  3MS6 A;  3LIF A;  4PM7 A;  4B4X A;  4HY8 A;  4WUJ A;  4OPR A;  4WMC A;  1SKO A;  5EVI A;  3BWL A;  4OOY A;  3HCY A;  2DRW A;  3VP3 A;  5GL9 A;  5K5B A;  3QP6 A;  2QHK A;  3WS2 A;  1V9Z A;  5CTN A;  1VB6 A;  3MBZ A;  4PM5 A;  1WE4 A;  1ZC2 A;  4QD4 A;  1FIL A;  3ITB A;  1FCM A;  3Q7V A;  1YLJ A;  3W2Z A;  2E8I A;  1KVM A;  2Y2M A;  5FDS A;  4XT2 B;  2ZOH A;  1T1C A;  5E2G A;  1I5Q A;  4RA7 A;  1O7E A;  2EWW A;  2Y91 A;  4EWF A;  4PM8 A;  5IHV A;  2HV1 A;  5CED A;  1K54 C;  2HDQ A;  4KZ9 A;  1W5D A;  1W8Y A;  4MLL A;  2H10 A;  2V9A A;  1GHM A;  4QB8 A;  3GSG A;  4E3O A;  3CIT A;  4JKT A;  2V8C A;  1KOU A;  5L2F A;  5FAS A;  5CEC A;  5HZH A;  2FFY A;  2VV6 A;  2Y59 A;  5EOO A;  3N8S A;  5FEG A;  4HIA A;  1CQA A;  4CLC C;  4ESP A;  4HQA A;  2ZM0 A;  2B18 A;  3BEB A;  3CPT A;  2OV5 A;  4CPK A;  3T4J A;  3ZCZ A;  3S4X A;  2W3F A;  4HJ6 A;  1K57 A;  2WKQ A;  2JKF A;  4JGQ A;  1K4E A;  5J8X A;  1ALQ A;  2P7J A;  2E8J A;  4RX3 A;  2M7V A;  2WGI A;  2KDK A;  2QKP A;  1PI5 A;  5DF8 A;  4CJN A;  1YMS A;  2PRF A;  4E3K A;  4UA9 A;  1MBL A;  3VFH A;  4E3J A;  4Y3I A;  3TRC A;  1OTE A;  5F1G A;  4JF5 A;  1L0F A;  2W1T A;  3UE6 A;  1L2S A;  1YLW A;  2ZC6 B;  3VP0 A;  3HBR A;  4X25 A;  3B47 A;  1JVJ A;  4HOI A;  2VGL M;  5FA7 A;  1S4S A;  1TD5 A;  3GV9 A;  4KG5 A;  5EM0 A;  3OZH A;  5KSH A;  3NOP C;  3W4Q A;  1H0M A;  3S7O A;  3MXQ A;  2G2U A;  1NWZ A;  1Q2Q A;  1XJ4 A;  2B02 A;  3GR2 A;  3DWK A;  3FYZ A;  4ZAM A;  3V67 A;  1OT9 A;  5TR7 A;  5J4E A;  5M18 A;  4EES A;  2O99 A;  1BZA A;  5G18 A;  2M7U A;  5HL1 A;  1FSY A;  4KQO A;  1G6O A;  1ZHH B;  3F1P B;  4WEK A;  4XT2 A;  3LIA A;  2Y2O A;  4X56 A;  1NYY A;  5HPF A;  5F82 A;  3IXB A;  2IWB A;  1K56 D;  2JKT M;  1H8M A;  2GDN A;  3VV4 A;  3T50 A;  2Z2L B;  1GSV A;  5TBM B;  3FPW A;  4KQD A;  4GHI B;  1L0D A;  3AGE A;  3ISG A;  2JKR I;  3T1S A;  2PAV P;  4CQH A;  5IU1 A;  1TF1 A;  2G7U A;  3IT9 A;  1CEF A;  4ZJ2 A;  2Y8H A;  1EW0 A;  5L8M A;  2ZL1 A;  1LL8 A;  2EFX A;  1T18 A;  4E3M A;  3HJI A;  3LR4 A;  4HJ3 A;  3R7W B;  1YMX A;  5BOH A;  1OJ5 A;  1N9L A;  5GLC A;  3L7H A;  4WN5 A;  4HH2 A;  3RTY A;  1MKM A;  4EER A;  2Y79 A;  5EFW A;  2ZLY A;  5HDD A;  5GLD A;  2IA2 A;  3MFD A;  3H82 B;  1Q2P A;  4LV2 A;  1J3W A;  3LCE A;  5D3O A;  2Y2J A;  4KG2 A;  3LR5 A;  3IF6 C;  5FQ9 A;  3QHY A;  1IFQ A;  3C30 A;  1BT5 A;  4MEZ A;  3PHY A;  2QMI A;  3ZG0 A;  3FPV A;  4DMZ A;  4GKU A;  5AQ7 A;  5FQQ A;  4E6X A;  4ZJ3 A;  3G35 A;  4BJP A;  3PAG A;  3ZQ5 A;  3EGD C;  2FFF B;  4XXR A;  3A0V A;  4N9K A;  4LFU A;  5KIZ A;  4E6W A;  4ETZ A;  2BLS A;  1DJB A;  2HDR A;  1IEL A;  4HI4 A;  1DP8 A;  1CI9 A;  2JE5 A;  4ARZ B;  3UPP A;  1V9Y A;  4WL9 A;  4E3I A;  4GS9 A;  3FWL A;  1PWG A;  3LR0 A;  4DE0 A;  4DJ3 A;  1Y4O A;  3SS5 A;  1HLU P;  4LEN A;  5FL3 A;  1RCJ A;  4EBL A;  2O0Y A;  4KUO A;  1STZ A;  3BQ8 A;  3UDX A;  3IHB A;  3V39 A;  4ZDX A;  4DRT A;  2XEP A;  3CUE C;  1SDE A;  1YSQ A;  4P6Z S;  5DFX A;  3VMA A;  4NKP A;  4GHI A;  2Z2M B;  1E4D A;  2XD5 A;  2ZC7 A;  3GVB A;  3WS0 A;  5KZH A;  2L1M A;  2DCF A;  1I2W A;  3HLG A;  4LGW A;  1KDS A;  3PBT A;  2J3T C;  2H28 A;  3CWF A;  1PW1 A;  3QP1 A;  3R7W A;  4EBN A;  3BY8 A;  5CHU A;  4S2K A;  1IEM A;  3CG5 A;  1G6A A;  4FSF A;  5CXW A;  4JXS A;  2PBY A;  5GLB A;  3IBR A;  3LEQ A;  4HP4 A;  3LI8 A;  4S2P A;  2ZQA A;  3BLS A;  5KSC A;  2HP5 A;  1QMF A;  2VX8 A;  1K55 C;  3WRZ A;  3S22 A;  3SW1 A;  4IHQ A;  2JHE A;  1PYY A;  3P09 A;  4OQ0 A;  5F5Y A;  1LI0 A;  3TE8 A;  5GLA A;  2PD7 A;  3M6H A;  2GNX A;  1TS7 A;  1MY8 A;  2XRN A;  3BW6 A;  1NY0 A;  5DTK A;  1PWC A;  3KX0 X;  3QNC A;  3UB9 A;  4IUH A;  3BY9 A;  1A0K A;  1IYQ A;  4PM6 A;  3C38 A;  3V3S A;  5E2H A;  3N4I A;  2QJ5 A;  1F98 A;  3MJQ A;  1MKI A;  3DWZ A;  4EW7 A;  5HAQ A;  2XA7 M;  1CK3 A;  3V3R A;  3OLO A;  4GDB A;  3EEA A;  5EE8 A;  3BFC A;  2HDS A;  3PBR A;  2LB5 A;  2OLV A;  2Q0O A;  3BEC A;  1BUE A;  1ERM A;  3JYI A;  1D06 A;  3A0R A;  3SOI A;  3NDE A;  4JPM A;  2M1C A;  3CJM A;  4PAU A;  1NLY A;  4OOL A;  3IWI A;  2W3D A;  2Z6C A;  2ZC4 B;  3IH8 A;  4OH0 A;  1TS8 A;  4WMC D;  5EVI D;  3EOI A;  1M6K A;  3MMH A;  1XPB A;  3MFX A;  4N92 A;  5HAI A;  3IX3 A;  5I94 A;  2OLU A;  3LUQ A;  3A0S A;  2IWD A;  3FKV A;  3VOY A;  5M19 A;  4F3L A;  3H7W A;  5AVE A;  3NEC A;  2VJW A;  2XDM A;  3JPU A;  4FUW A;  3OCL A;  5HSQ A;  2FH5 A;  3BFD A;  4E3L A;  4S2O A;  3PXP A;  3CPT B;  5EUA A;  3VOL A;  4NET A;  1T19 A;  4R4S A;  2Y2G A;  4D60 A;  4YWZ A;  1FR6 A;  3AGD A;  5A8B A;  3LR3 A;  3UDI A;  2WAF A;  4ZTK A;  4HES A;  3MXR A;  2W1T B;  1MWR A;  2H0Y A;  1KE4 A;  4N9L A;  1YPR A;  4OPQ A;  4JLF A;  2ACG A;  4RYE A;  3NUL A;  1PFL A;  2CMN A;  3F1O B;  3E4O A;  1LSX A;  5CHJ A;  1N9B A;  3ICY A;  2WKR A;  3PBN A;  3DBA A;  4QHC A;  1KE3 A;  3HRE A;  4U0X A;  1RGY A;  3PAE A;  5HDC A;  5FI7 A;  1PWD A;  2XQZ A;  3F1N A;  3ZGA B;  3UY6 A;  3VSK A;  1MXO A;  4KG6 A;  4O01 A;  3D4F A;  1S66 L;  3HUO A;  2WGV A;  2Y2Q A;  5FAQ A;  3B33 A;  2A24 B;  2W3E A;  4HEF A;  3B3X A;  4R3A A;  4P0M A;  1WYB A;  4U0T A;  1MZU A;  4UHU A;  1YKD A;  3LY3 A;  5DVA A;  2PYR A;  4ME4 A;  1TDG A;  1UWP X;  4UAA A;  3UE0 A;  1FQG A;  4S2I A;  3IH9 A;  2V20 A;  4MCW A;  4Y5F A;  1XJ3 A;  2XFS A;  3L9K A;  1QME A;  5FI2 A;  4JF4 A;  4EQI A;  4RQ9 A;  1ESI A;  4NK3 A;  1SZV A;  5A93 A;  2ZQ7 A;  4II7 A;  3Q07 A;  2ZL1 B;  1JWV A;  2G2W A;  4HP9 A;  4GB7 A;  2WAE A;  3TW8 A;  4IBR A;  5FEF A;  1WYC A;  3T1Q B;  1H8Y A;  5HDS A;  2HP6 A;  4BD0 A;  3VFF A;  2Y2L A;  3VSL A;  3BJN A;  4MMN A;  2XD1 A;  1K38 A;  1ACF A;  3WWX A;  1HD8 A;  3ZNT A;  4FOF A;  1CF0 A;  3NC8 A;  4UA7 A;  3G30 A;  1W8Q A;  3U2A A;  2YKF A;  3BLM A;  3KYE A;  3A3D A;  1M40 A;  4KQQ A;  4GJ4 A;  2C5W B;  2Y4A A;  1L3L A;  4MN7 A;  4X69 A;  4MNR A;  1PZP A;  1GSX A;  1CEG A;  5CGS A;  2XA7 S;  3F1O A;  4EEP A;  4IUK A;  4OKP A;  4JXW A;  1DRM A;  3UB6 A;  2H0T A;  1FR1 A;  2EX8 A;  4WLA A;  1K4F A;  4IVI A;  3A3J A;  1W7F A;  3WS5 A;  3KYZ A;  4DE2 A;  2ZJ9 A;  5CX7 A;  2RCX A;  3FG8 A;  1D7E A;  4FD8 A;  3TG9 A;  1DP6 A;  2WKH A;  3HL9 A;  4GS9 B;  2A24 A;  3GRJ A;  5A92 A;  4JGP A;  4LV0 A;  2Y55 A;  1OPX A;  3WS4 A;  5F69 A;  2FZ0 A;  1H3Q A;  3BYD A;  3W4P A;  4WEL A;  4LLO B;  4PHT A;  2JBF A;  4O7D A;  1TS6 A;  2O9A A;  4HNB A;  3ZVW A;  2R9X A;  3LI9 A;  3SH8 A;  5DTT A;  1MWT A;  2D01 A;  2V0W A;  1K54 A;  2AVX A;  2WUQ A;  5EEC A;  2XGN A;  1LL9 A;  4ZJ1 A;  2PBD P;  3K3C A;  2P04 A;  4EU0 A;  1ZG4 A;  3LO7 A;  4KQR A;  4FH4 A;  4X1L A;  1NZU A;  1VEU A;  2OAQ 1;  1NZO A;  2K2N A;  3JVU A;  4G3K A;  4DJ2 A;  3UME A;  1OT6 A;  5FQK A;  5HAR A;  3T4K A;  3CAX A;  3NY4 A;  3C5A A;  2L0W A;  1ZG6 A;  1DJA A;  2VA0 A;  3GEC A;  2DNS A;  3BM6 A;  3KSF A;  4JXV A;  1YSP A;  2KLI A;  4CLC A;  3NDG A;  4S2N C;  4OON A;  1W63 M;  1HZO A;  2WAD A;  4K08 A;  3BRM A;  2Q9M A;  2VV7 A;  4UA6 A;  5CER A;  1XA1 A;  4C75 A;  1NRF A;  5L10 A;  4M4X A;  3E0Y A;  1ODV A;  4R1G A;  3VP2 A;  4JBF A;  3OPP A;  1IKI A;  2Y2K A;  2PU4 A;  1E3U A;  3WRT A;  4XUX A;  5EPH A;  2VEA A;  4O8G A;  5CRF A;  4WZ4 A;  1XJ6 A;  5TGF A;  2ZQD A;  3KSG A;  2V1Z A;  1CI8 A;  4KZ3 A;  2R9W A;  1JTD A;  2JKT I;  4K91 A;  4XUZ A;  2PDR A;  1XA7 A;  5EVL A;  2VK3 A;  1AWI A;  4BD1 A;  1PNE A;  3EWK A;  1DJC A;  1XFN A;  3EQV A;  5FQM A;  5LBR A;  5I5L A;  2O9B A;  3LIE A;  1NYM A;  1P9R A;  3W8K A;  3HLB A;  1XGJ A;  3LIB A;  4KZ5 A;  3GMW A;  3KO6 A;  5DKL A;  1XX2 A;  1HVB A;  4BEN A;  4WZ5 C;  2ZM2 A;  1GHI A;  3WS1 A;  2EWV A;  3NCK A;  2EA9 A;  4EEU A;  4KEN B;  5HW3 A;  2J3W A;  2WK0 A;  1YT4 A;  3MZD A;  1SCW A;  3GQZ A;  2EX9 A;  1Z6F A;  2W0N A;  5FAO A;  5MC7 A;  4OLD A;  1S1Y A;  3C4P A;  1Z09 A;  3IXH A;  4PPR A;  2NUT C;  5FQJ A;  3JVV A;  1X0O A;  3G4P A;  4F3L B;  4WYY A;  3H7W B;  3ZFZ A;  3Q81 A;  2MJ6 A;  4B88 A;  4LRY C;  4EBP A;  1N9N A;  3OOV A;  1LSW A;  5FI6 A;  4FH2 A;  3I7J A;  3PBQ A;  3C7U A;  2VKS A;  1YLZ A;  3LY4 A;  5CGW A;  3NJA A;  4Q0J A;  4HBT A;  3QP8 A;  3K3D A;  2ZC3 B;  2WZZ A;  1GCE A;  3MXS A;  2V1B A;  1IYO A;  2ZQC A;  3A3E A;  3D9Y A;  4S2M A;  4LPZ A;  1GHP A;  3MSH A;  2BG1 A;  2B5R A;  3EGX C;  3PBS A;  4YOF A;  3IF5 A;  3E4Q A;  3VOZ A;  2CC1 A;  2VGL S;  5F83 A;  1VET A;  5F6A A;  2Y2I A;  3UO9 A;  2WGW A;  1ERQ A;  4I3A A;  3IF6 A;  1YLP A;  3NOU C;  1IYS A;  5AQ9 A;  2RL3 A;  1LSV A;  2OWJ A;  1P97 A;  4N1X A;  4OQH A;  1PRQ A;  1XJ2 A;  3HUM A;  4F94 A;  4DXC A;  4L0L A;  1L0G A;  4LRX C;  4DE1 A;  4GLQ A;  2J9P A;  1OME A;  1F2K A;  4IJG A;  4FTX A;  4MBH A;  4WM9 A;  3T12 B;  3UE3 A;  1UGU A;  4PMA A;  1GSW A;  1SKF A;  4OQI A;  5EVI C;  1MWU A;  1L0E A;  3C4O A;  3CMZ A;  3GDI A;  4GZB A;  3CHW P;  3F1N B;  4M3K A;  4C6Y A;  4B9O A;  3OPL A;  5AQA A;  3H9W A;  3Q1F A;  3S1Y A;  5KMW A;  5FAT A;  2XH9 A;  3NIA A;  1XP4 A;  4E3N A;  4GNU A;  2W3H A;  1EI5 A;  4S2J A;  2J9O A;  1P0Z A;  3T1X A;  3QP5 A;  3RFB A;  1BLH A;  2HJE A;  1YLY A;  3B42 A;  3LIC A;  5CEB A;  3HVF A;  1JNU A;  5E43 A;  4ETX A;  4CLC E;  3SS3 A;  2PYP A;  3UPO A;  4Q8I A;  3CUE A;  3BFF A;  1BUL A;  3MF0 A;  4HH3 A;  1TEM A;  3IBJ A;  2PR6 A;  2D02 A;  2XR0 A;  5HD5 A;  4H6J A;  3HJK A;  3M6B A;  2QWS A;  3NHQ A;  3T4O A;  2YKH A;  3UNW A;  2HPB A;  4BMW A;  4QJG A;  3VP4 A;  3ZG7 B;  2X71 A;  5JYP A;  4KZ6 A;  1ONG A;  1LT0 A;  4JXG A;  2A3U A;  3CLO A;  1RGZ A;  1U60 A;  4X55 A;  2PR5 A;  1S67 L;  4R23 A;  2LB9 A;  4L9E A;  3P98 A;  2H5S A;  4EQ1 A;  4I3I A;  5FQI A;  1H8Z A;  2HDU A;  1F9I A;  1Y54 A;  4PKY G;  1S6R A;  1K55 A;  5A91 A;  3NBL A;  3ZG8 B;  4O0P A;  4UQI M;  1LLB A;  4QU3 A;  3TOI A;  2ZD8 A;  5IT5 A;  5J3W A;  3QP2 A;  3FC7 A;  3E4P A;  5DFY A;  4DE3 A;  3O86 A;  2J7V A;  3C8C A;  1HTZ A;  2L4R A;  3V50 A;  2Y2N A;  4H8R A;  3RXW A;  1NJ4 A;  3DTE A;  4OQG A;  5EVE A;  4GD8 A;  2J8Y A;  2PD8 A;  4MN5 A;  1BLP A;  1PZO A;  3BQA A;  5G4Y A;  4B4Z A;  3S7Q A;  5L09 A;  3ITA A;  2WKI A;  4QY6 A;  3E2L A;  1MPL A;  2ZOI A;  3ULF A;  1XGI A;  3EQU A;  2KX6 A;  1I2S A;  3IXG A;  4GCZ A;  2V8F A;  2JN7 A;  5E2F A;  2PU2 A;  4K0W A;  3UE1 A;  3HUN A;  1IOU A;  1K25 A;  1W63 Q;  1AXB A;  2OWH A;  3LYX A;  3PR6 A;  5IS1 A;  3UPN A;  4WF0 A;  3OBF A;  3BFG A;  3IQA A;  2P08 A; 
#chains in the Genus database with same CATH homology
 3PBO A;  4ZJ1 A;  3VMA A;  2EX2 A;  1IKG A;  1ZG4 A;  3G34 A;  3LO7 A;  2Z2M B;  4KQR A;  1E4D A;  4FH4 A;  2XD5 A;  2ZC7 A;  3GVB A;  3WS0 A;  1NZU A;  5KZH A;  4OP5 A;  2HP9 A;  1NZO A;  2DCF A;  1I2W A;  4R0Q A;  3HLG A;  1KDS A;  4MBK A;  3M2J A;  1VQQ A;  3PBT A;  5FQK A;  5HAR A;  4DKI A;  4DF6 A;  1JTG A;  1JWP A;  3A3I A;  3C5A A;  3NY4 A;  1LL5 A;  1ZG6 A;  2QPN A;  1PW1 A;  5CGX A;  1DJA A;  2DNS A;  1VM1 A;  3BM6 A;  3E2K A;  4JXV A;  4EBN A;  1LI9 A;  3IHA A;  4GDN A;  5DF7 A;  3LEZ A;  4S2K A;  5CHU A;  5FAP A;  3NDG A;  1IEM A;  4S2N C;  3CG5 A;  1IYP A;  4OON A;  4R3J A;  1ZKJ A;  1G6A A;  4FSF A;  5CXW A;  4JXS A;  1K57 C;  3Q7Z A;  4S2L A;  2PBY A;  2XLN A;  3N6I A;  5GLB A;  3ZG9 B;  1HZO A;  2WAD A;  2XF3 A;  2EX6 A;  3BRM A;  2Q9M A;  4GOG A;  2EXA A;  4S2P A;  2ZQA A;  3BLS A;  3HLE A;  4R3B A;  5KSC A;  2HP5 A;  2P74 A;  1QMF A;  2WKE A;  5EOE A;  3IWO A;  3ZDJ A;  4Y7P A;  3DTM A;  1K55 C;  3WRZ A;  4UA6 A;  3S22 A;  1TVF A;  3GTC A;  4IVK A;  1PYY A;  1XA1 A;  3P09 A;  5CER A;  4C75 A;  2JC7 A;  1KDW A;  1NRF A;  2C6W B;  4OQ0 A;  4OVD A;  1YQS A;  1LI0 A;  5FSR A;  3FKW A;  4KZ8 A;  2ZC5 B;  4R1G A;  3VP2 A;  4JBF A;  4YIN A;  5GLA A;  4X68 A;  3M6H A;  3OPP A;  4Y0O A;  1BTL A;  4OPZ A;  1G68 A;  3W4O A;  1KE0 A;  3AGF A;  3N7W A;  1IKI A;  2Y2K A;  3O87 A;  2PU4 A;  2X02 A;  4MBF A;  1MY8 A;  4BLM A;  2QZ6 A;  1E3U A;  3WRT A;  4XUX A;  1ERO A;  1NY0 A;  5EPH A;  5DTK A;  1C3B A;  4GD6 A;  3HLC A;  5CRF A;  1PWC A;  4WZ4 A;  5TGF A;  3QNC A;  2ZQD A;  2V1Z A;  4LV1 A;  1CI8 A;  3M2K A;  4KZ3 A;  4IBX A;  2R9W A;  1JTD A;  3G2Z A;  4K91 A;  4LV3 A;  1IYQ A;  4PM6 A;  1YLT A;  4XUZ A;  3V3S A;  4PM7 A;  5FDH A;  4B4X A;  5E2H A;  3BFE A;  3N4I A;  1XA7 A;  4OPR A;  4WMC A;  5EVI A;  5EVL A;  1MKI A;  3DWZ A;  4K0X A;  4OOY A;  5HX9 A;  5A90 A;  5HAQ A;  4R4R A;  2DRW A;  3VP3 A;  1CK3 A;  4BD1 A;  5GL9 A;  3V3R A;  1DJC A;  4GDB A;  3EQV A;  5FQM A;  3WS2 A;  5EE8 A;  3BFC A;  2HDS A;  5CTN A;  1NYM A;  3PBR A;  2OLV A;  3BEC A;  3W8K A;  3MBZ A;  4PM5 A;  1WE4 A;  3HLB A;  1BUE A;  1XGJ A;  2XFT A;  1E3U D;  1ZC2 A;  4QD4 A;  3VP1 A;  1ERM A;  3ITB A;  1FCM A;  4KZ5 A;  5CTM A;  3JYI A;  3GMW A;  3Q7V A;  1YLJ A;  1XX2 A;  1HVB A;  3SOI A;  4BEN A;  4WZ5 C;  2ZM2 A;  1GHI A;  3NDE A;  4X53 A;  4JPM A;  2E8I A;  3WS1 A;  1J9M A;  1KVM A;  3NCK A;  2Y2M A;  3CJM A;  4KEN B;  5HW3 A;  2WK0 A;  5E2E A;  1YT4 A;  4OOL A;  3MZD A;  1SCW A;  3GQZ A;  2EX9 A;  3IWI A;  1RP5 A;  1Z6F A;  5FAO A;  5E2G A;  2ZC4 B;  1I5Q A;  3IH8 A;  4OH0 A;  5GHZ A;  2P9V B;  4RA7 A;  4WMC D;  5EVI D;  3UDF A;  1M6K A;  1O7E A;  1XPB A;  2Y91 A;  4N92 A;  4EWF A;  4OLD A;  4PM8 A;  5IHV A;  5HAI A;  3ZVT A;  3C4P A;  3IXH A;  1ONH A;  4PPR A;  5CED A;  1K54 C;  2HDQ A;  4KZ9 A;  5FQJ A;  5I94 A;  1W5D A;  1W8Y A;  2OLU A;  4GN2 A;  4MLL A;  2H10 A;  3G4P A;  1W79 A;  4WYY A;  3SS4 A;  3A3F A;  2IWD A;  3FKV A;  3VOY A;  1FCO A;  1GHM A;  3ZFZ A;  3MKE A;  5M19 A;  4QB8 A;  3Q81 A;  4B88 A;  1BSG A;  4EBP A;  3GSG A;  4E3O A;  3MZE A;  5FI6 A;  4FH2 A;  5GHX A;  1XKZ A;  4JKT A;  3I7J A;  3HLD A;  3PBQ A;  1NXY A;  3C7U A;  2Y2P A;  1FSW A;  1YLZ A;  5L2F A;  2XDM A;  5FAS A;  3LY4 A;  5CEC A;  5CGW A;  3OCL A;  1ES2 A;  4Y0U A;  3OC2 A;  2FFY A;  3ZNY A;  1DY6 A;  2Y59 A;  4HBT A;  5EOO A;  3N8S A;  3BFD A;  4FCF A;  2ZC3 B;  4E3L A;  2WZZ A;  4S2O A;  4Z9Q A;  1GCE A;  2ZM0 A;  3MXS A;  1ESU A;  1IYO A;  5EUA A;  4LCL A;  2ZQC A;  4LCM A;  3A3E A;  3BEB A;  2OV5 A;  4CPK A;  4S2M A;  3ZCZ A;  5TFQ A;  4N1H A;  3S4X A;  1FCN A;  4HBU A;  1K57 A;  1GHP A;  4NET A;  2I72 A;  4P6B A;  1K4E A;  4OPY A;  5U47 A;  2BG1 A;  5EEC A;  3Q82 A;  2A49 A;  2B5R A;  4R4S A;  1PI4 A;  1ALQ A;  3PBS A;  5J8X A;  5GHY A;  3IF5 A;  4RX3 A;  3VOZ A;  2CC1 A;  2Y2G A;  5F83 A;  2WGI A;  4CJN A;  2WGW B;  1PI5 A;  5DF8 A;  1YMS A;  4E3K A;  2Y2I A;  3UO9 A;  1FR6 A;  1MBL A;  2WGW A;  3AGD A;  4UA9 A;  3VFH A;  4E3J A;  3IF6 B;  3QNB A;  3UDI A;  1ERQ A;  2WAF A;  3G2Y A;  3O88 A;  4ZTK A;  5F1F A;  3IF6 A;  1YLP A;  4IED A;  1ES4 A;  3MXR A;  4HES A;  4JF5 A;  5F1G A;  1IYS A;  5AQ9 A;  2RL3 A;  1MWR A;  2H0Y A;  1L0F A;  4N1X A;  4OQH A;  1KE4 A;  4D2O A;  3HLF A;  3HUM A;  1L2S A;  1YLW A;  4F94 A;  4N9L A;  2ZC6 B;  3VP0 A;  4OPQ A;  4JLF A;  4DXC A;  4L0L A;  1L0G A;  1KVL A;  3HBR A;  4RYE A;  3ZHH A;  1JVJ A;  5FA7 A;  4DE1 A;  3GV9 A;  3RJU A;  4KG5 A;  4KZB A;  2J9P A;  3NI9 A;  1OME A;  3OZH A;  5KSH A;  3OPH A;  5CHJ A;  1N9B A;  1GA0 A;  4MBH A;  4WM9 A;  3W4Q A;  5HAP A;  3UE3 A;  3C7V A;  3PBN A;  3UN7 A;  4PMA A;  4BL3 A;  2G2U A;  1SKF A;  4OQI A;  5JYO A;  1ES3 A;  1BLS A;  1Q2Q A;  5EVI C;  1MWU A;  1L0E A;  3C4O A;  3CMZ A;  1K56 A;  3HRE A;  1KE3 A;  3GR2 A;  4QHC A;  4GZB A;  1XXM A;  4U0X A;  3DWK A;  3FYZ A;  3HLW A;  4ZAM A;  1RGY A;  3PAE A;  4YFM A;  3DW0 A;  1PWD A;  2XQZ A;  5FI7 A;  3ZGA B;  4RVA A;  5TR7 A;  1YM1 A;  4M3K A;  3UY6 A;  2Q9N A;  3VSK A;  4C6Y A;  3OPL A;  5AQA A;  5M18 A;  3Q1F A;  1MXO A;  1KGF A;  3S1Y A;  4KG6 A;  5KMW A;  3D4F A;  5FAT A;  2XH9 A;  3NIA A;  4WBG A;  3HUO A;  1BZA A;  2WGV A;  5G18 A;  1XP4 A;  4E3N A;  2Y2Q A;  2X01 A;  5FAQ A;  4GNU A;  5HL1 A;  2VGK A;  1EI5 A;  1FSY A;  4KQO A;  4OP8 A;  4S2J A;  4HEF A;  3B3X A;  4P0M A;  2J9O A;  1WYB A;  4U0T A;  4WEK A;  4UHU A;  2ZM8 A;  1BLH A;  3O3V A;  3V5M A;  2Y2O A;  2P9V A;  4X56 A;  1NYY A;  1YLY A;  3IXD A;  4DDY A;  3LY3 A;  5CEB A;  5DVA A;  5F82 A;  3HVF A;  3IXB A;  1TDG A;  5E43 A;  3MKF A;  2IWB A;  4UAA A;  1K56 D;  3SS3 A;  3UE0 A;  3UPO A;  1O07 A;  1FQG A;  2GDN A;  1K6S A;  4S2I A;  4Q8I A;  3BFF A;  1BUL A;  2ZQ8 A;  2Z2L B;  3IH9 A;  2V20 A;  1TEM A;  1FOF A;  3RXX A;  2XR0 A;  2XFS A;  1L0D A;  1QME A;  5FI2 A;  3AGE A;  3OCN A;  4JF4 A;  4EUZ A;  3M6B A;  3PTE A;  2JCH A;  4EQI A;  3ISG A;  1ESI A;  4NK3 A;  1KGG A;  3UNW A;  2ZMA A;  2HPB A;  3OPR A;  5A93 A;  3IT9 A;  2ZQ7 A;  4QJG A;  3VP4 A;  3ZG7 B;  2X71 A;  4Y0T A;  5JYP A;  1CEF A;  4KZ6 A;  1JWZ A;  4ZJ2 A;  4BQM A;  1ONG A;  3Q07 A;  5CHM A;  4EV4 A;  1JWV A;  3N8R A;  3IWQ A;  2G2W A;  4JXG A;  4GB7 A;  2A3U A;  2EFX A;  1SDN A;  2WAE A;  4P85 A;  4E3M A;  1RGZ A;  1U60 A;  4IBR A;  4X55 A;  4A5R A;  4PM9 A;  1SHV A;  2WZX A;  1WYC A;  1TDL A;  1H8Y A;  4R23 A;  2HP6 A;  4OLG A;  4S2N A;  1YMX A;  2EXB A;  5BOH A;  4KZ7 A;  1N4O A;  5GLC A;  4BL2 A;  4BD0 A;  3VFF A;  3P98 A;  2H5S A;  1LHY A;  1H8Z A;  5FQI A;  2HDU A;  5DF9 A;  1Y54 A;  2Y2L A;  3VSL A;  2ZLY A;  1S6R A;  3FZC A;  5GLD A;  3MFD A;  2Y2H A;  2XD1 A;  1K55 A;  1K38 A;  1PW8 A;  4DDS A;  5A91 A;  1HD8 A;  3SH9 A;  1K6R A;  3WWX A;  3NBL A;  3ZNT A;  3NC8 A;  3ZG8 B;  4UA7 A;  3G31 A;  3G30 A;  1W8Q A;  1LLB A;  1SDE A;  4QU3 A;  3TOI A;  5AQB A;  2VGJ A;  3BLM A;  3A3D A;  1Q2P A;  4LV2 A;  2ZD8 A;  1M40 A;  4KQQ A;  3LCE A;  5D3O A;  2Y2J A;  2IWC A;  4KG2 A;  5FQ9 A;  3IF6 C;  4DE3 A;  2C5W B;  3O86 A;  4U3T A;  3QHY A;  2Y4A A;  3N8L A;  2V2F F;  2ZQ9 A;  1BT5 A;  2J7V A;  4X69 A;  4MNR A;  4MEZ A;  1PZP A;  1MWS A;  4OOM A;  5DTS A;  2QMI A;  2UWX A;  3ZG0 A;  1CEG A;  1HTZ A;  5CGS A;  3V50 A;  4GKU A;  2Y2N A;  3CZD A;  4P87 A;  5AQ7 A;  4KZA A;  5FQQ A;  4H8R A;  4E6X A;  3RXW A;  1NJ4 A;  4ZJ3 A;  4OKP A;  3G35 A;  4OQG A;  4BJP A;  4JXW A;  3PAG A;  1S0W A;  1PIO A;  2H0T A;  1FR1 A;  4GD8 A;  2J8Y A;  2EX8 A;  2FFF B;  1K4F A;  4XXR A;  4N9K A;  4IVI A;  4X6T A;  1BLP A;  4ZBE A;  4QY5 A;  1PZO A;  3A3J A;  4E6W A;  1W7F A;  4JF6 A;  3TSG A;  2BLS A;  3WS5 A;  1DJB A;  5M1A A;  5EVI B;  4B4Z A;  4DE2 A;  4ID4 A;  2ZJ9 A;  3ITA A;  2RCX A;  2HDR A;  2WKI A;  4QY6 A;  1GA9 A;  1IEL A;  4FD8 A;  3TG9 A;  1CI9 A;  2JE5 A;  2OSU A;  2WKH A;  3E2L A;  3HL9 A;  1MPL A;  1EWZ A;  3GRJ A;  3UPP A;  1XGI A;  5A92 A;  3EQU A;  3MZF A;  4LV0 A;  4E3I A;  2Y55 A;  3WS4 A;  4C3Q A;  3FWL A;  1I2S A;  4WZ5 A;  1BLC A;  3G32 A;  1PWG A;  3IXG A;  3Q7V B;  3BYD A;  4DE0 A;  3W4P A;  4WEL A;  4KZ4 A;  3SS5 A;  5E2F A;  4LEN A;  5HFO A;  2PU2 A;  4K0W A;  1RCJ A;  2JBF A;  3UE1 A;  4EBL A;  3HUN A;  3SH7 A;  1K25 A;  1AXB A;  4O7D A;  3ZG5 A;  2XK1 A;  1E25 A;  4WEJ A;  3FV7 A;  4DXB A;  3ZVW A;  3UPN A;  3UDX A;  2R9X A;  3IHB A;  2WYX A;  1H5X A;  1ES5 A;  2EFU A;  3SH8 A;  3V39 A;  5DTT A;  4ZDX A;  1KGE A;  1MWT A;  3BFG A;  4RX2 A;  4DRT A;  1K54 A;  2XEP A;  3IQA A;  2WUQ A;  2XGN A;  1LL9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...