4DDYA

Ctx-m-9 class a beta-lactamase complexed with compound 10
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
260
structure length
260
Chain Sequence
AVQQKLAALEKSSGGRLGVALIDTADNTQVLYRGDERFPMCSTSKVMAAAAVLKQSETQKQLLNQPVEIKPADLVNYNPIAEKHVNGTMTLAELSAAALQYSDNTAMNKLIAQLGGPGGVTAFARAIGDETFRLDRTEPTLNTAIPGDPRDTTTPRAMAQTLRQLTLGHALGETQRAQLVTWLKGNTTGAASIRAGLPTSWTAGDKTGSGDYGTTNDIAVIWPQGRAPLVLVTYFTQPQQNAESRRDVLASAARIIAEGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactamase
publication title Structure-Based Design of Potent and Ligand-Efficient Inhibitors of CTX-M Class A Beta-Lactamase
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase/hydrolase inhibitor
total genus 97
structure length 260
sequence length 260
chains with identical sequence B
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2012-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 4ddyA00
2QPNA 3GTCA 2PBYA 3HVFA 5E2FA 1PZPA 4OLDA 5CHJA 3O3VA 3ZGAB 4JF4A 2Y2HA 3UE1A 1IKGA 4A5RA 4WMCD 2QMIA 1W8YA 4N9KA 4OPRA 2XGNA 1ZKJA 4MBKA 4E3JA 1K57C 3VP1A 4N1HA 3W4QA 1Z6FA 3N7WA 3Q7ZA 5F1GA 2Q9NA 1DJAA 2P74A 4EBPA 4QY5A 3SH8A 1YLJA 2J9PA 2Y91A 4IVIA 5HARA 1HD8A 3MXRA 5EECA 4C75A 1ES3A 1BUEA 2XK1A 4RYEA 5GHXA 4GNUA 2HP5A 3ZNTA 4PM9A 1L2SA 5CHUA 2Y2JA 4IEDA 4DE2A 4LV2A 1BT5A 4UA7A 1K38A 4E6XA 5JYPA 3VFHA 4ZJ2A 4OPYA 4U0TA 1ZC2A 4XUZA 1KVMA 1SDEA 1CI9A 2WGWA 1NYYA 2VGKA 1ESIA 3IXBA 4JKTA 4OLGA 1MXOA 4S2JA 3GSGA 3SS4A 2HDSA 1XXMA 3IWOA 2ZQCA 3AGDA 4QY6A 5AQAA 3N6IA 3UN7A 4CPKA 5E2HA 3WRTA 3OPHA 3Q7VA 4N9LA 1MWUA 2WADA 5CERA 4DKIA 5D3OA 3PBRA 1BLCA 3Q82A 2WUQA 2VGJA 2BLSA 3PAEA 5FSRA 2ZLYA 3BFEA 4OQHA 4UHUA 2C6WB 3A3DA 1YQSA 2B5RA 3SS3A 3V39A 1MWSA 2ZQ9A 4IBRA 2WGVA 2X02A 5TFQA 2EFXA 2ZM8A 1M6KA 5CGSA 3UE3A 4BJPA 2RL3A 4K91A 5CXWA 4HESA 1ES2A 3BEBA 3SH9A 2J8YA 4DXCA 3V5MA 4EV4A 4MLLA 2XH9A 4RX2A 5CGWA 3UO9A 4P6BA 4PM6A 3FYZA 3A3FA 3VP2A 3AGEA 2P9VA 2ZQAA 5DVAA 1CK3A 3HREA 3OPRA 1K54C 3SOIA 4WYYA 4JBFA 5FATA 5U47A 4X6TA 4GD6A 4GDNA 4EBLA 2X71A 3OCNA 4WZ5C 1PWDA 1Y54A 1TEMA 5FASA 2ZJ9A 3M6BA 5E2GA 1K55C 5A91A 2IWDA 4P87A 4GZBA 5FQKA 4ZDXA 1KGGA 4R4RA 4OOLA 5HAPA 3ZG5A 1RGZA 1IYQA 3IF6A 4S2NC 3S1YA 2ZM0A 4GKUA 5GL9A 3UE0A 1I2SA 3Q1FA 4KG6A 2R9XA 1ES4A 3BFDA 5EVIA 1BLPA 5AQ7A 2XFSA 1BSGA 3VP4A 3GR2A 2Y4AA 5EVLA 4MNRA 1SDNA 3G2YA 4MEZA 1YLPA 1XGIA 1FCOA 3MZFA 1TDLA 1YLWA 3IHBA 3UPNA 1H8YA 1O7EA 1ZG4A 3W4PA 3ZG9B 1KDSA 3VSKA 1XA7A 3N8RA 5EUAA 5G18A 5EVID 4LENA 4S2MA 4WELA 1BZAA 4KZ4A 4QD4A 3EQVA 5FQIA 2PU4A 2Y2PA 4UA6A 2WK0A 3Q07A 4KZ3A 2ZQDA 3WS0A 1ES5A 1S0WA 4DDYA 4GOGA 1PI5A 2WYXA 3IT9A 2XDMA 2G2WA 1JWZA 3IF5A 1TDGA 3C7UA 3W4OA 3WWXA 4DF6A 1QMEA 3BECA 1JWPA 3D4FA 3MZEA 3PBSA 3P09A 4K0WA 4OQIA 4QU3A 4DRTA 4PM7A 4QB8A 1SHVA 5DF7A 1BLSA 1MPLA 4DE0A 1BTLA 2ZC3B 3VSLA 1I2WA 3MZDA 3JYIA 3O86A 4ZTKA 5FQJA 3ZG7B 1DJCA 3TSGA 2JBFA 4ZAMA 4JLFA 3WS5A 2H0TA 4WEJA 5FQMA 5GHYA 1U60A 4OONA 5HL1A 4R1GA 2CC1A 2H5SA 5M18A 1QMFA 1IYOA 1PYYA 1XGJA 3CJMA 4DE1A 2A49A 3N4IA 2WAFA 2XQZA 3NIAA 2GDNA 4FD8A 1MWRA 4KQRA 2OLVA 1KE0A 4KZAA 3HUNA 1GHIA 1JVJA 2RCXA 1W5DA 4E3KA 4L0LA 3FV7A 3MBZA 3BRMA 5E2EA 4S2OA 3LO7A 3HLCA 2WZXA 4OOYA 3GVBA 5FAPA 3IHAA 3HLFA 2A3UA 1GA0A 3BFGA 3ZCZA 2XLNA 1ONGA 2ZC5B 4ID4A 2Y2NA 4KG2A 5DTSA 5GLBA 1YT4A 1KDWA 2QZ6A 4LCLA 4PPRA 3PTEA 4MBHA 3HUOA 3BLMA 4HBTA 3DWZA 3UDFA 3BFFA 3HUMA 2R9WA 1W79A 1K56A 4FH4A 3TOIA 2WAEA 1H5XA 3MFDA 1K57A 3G32A 1OMEA 3RXXA 2EX9A 1SCWA 4KZ6A 3QNBA 2BG1A 1J9MA 3IH8A 3G35A 3DWKA 1PIOA 3MXSA 3NI9A 1PW1A 1HTZA 1I5QA 2XEPA 4U0XA 4BD0A 1E3UA 1K56D 1E4DA 1EI5A 3HLGA 3IXGA 3OPPA 3M2KA 5GLAA 5CRFA 2G2UA 3E2LA 3WS2A 5EPHA 4YINA 1M40A 4FSFA 1FQGA 4LV0A 1CEFA 1RP5A 4JXVA 3IH9A 5M1AA 3S4XA 1YLZA 2H0YA 4R3BA 4H8RA 4U3TA 1W7FA 3OCLA 2DCFA 4GDBA 3C4PA 1JWVA 1LHYA 1TVFA 2WKHA 3HL9A 2IWCA 1LI9A 3FKVA 2Y2KA 3LEZA 3SS5A 2J7VA 3ITBA 4YFMA 1WYCA 3NDGA 1LL9A 1WYBA 4D2OA 5FI2A 4PMAA 1FCMA 5F83A 2XD5A 4KQOA 3B3XA 5FAOA 2WZZA 4Y0UA 1S6RA 5EOOA 1XKZA 1VQQA 5F82A 2ZC7A 4BLMA 2ZQ8A 3LY4A 4GB7A 5GLDA 4M3KA 3UDIA 2XF3A 2Y2GA 1KGEA 3GQZA 5FQQA 4JXWA 1LL5A 4R4SA 4R3JA 1K54A 2JE5A 4Y0TA 1IYSA 1K25A 2WGWB 4WZ5A 5CEBA 2Y59A 2WGIA 4BL3A 4F94A 1JTDA 5A92A 5TGFA 5FDHA 1K55A 2ZC6B 4KZ5A 2DRWA 4OPQA 1NY0A 3VMAA 3IXDA 3Q7VB 3SH7A 2Z2LB 1YLYA 1FR6A 4KZ7A 5M19A 2JCHA 4S2NA 1NZUA 5KSHA 4FH2A 3NBLA 2Y2QA 2Y2LA 3DTMA 1GHMA 3PBQA 4JF5A 3P98A 4OPZA 4GD8A 1K6RA 4E3OA 4KZ9A 3UPOA 4S2LA 3I7JA 5CTMA 4OQ0A 3N8LA 3EQUA 3UDXA 4K0XA 4Y0OA 2ZD8A 1DY6A 1Q2PA 3BM6A 4RVAA 5DTKA 3ZVTA 1N9BA 5FA7A 1PI4A 3FWLA 4RX3A 5HX9A 2P9VB 2XR0A 2V20A 1XP4A 3M2JA 4KQQA 5DTTA 1YM1A 5AQBA 1YMXA 3NDEA 3G2ZA 4CJNA 3LCEA 4UAAA 3ZHHA 3UNWA 1EWZA 3A3IA 1MWTA 3C4OA 4X56A 3FKWA 3ZG0A 3WS1A 1YLTA 3ISGA 1CI8A 4ZBEA 4DXBA 2PU2A 1MKIA 4OH0A 5J8XA 3HLDA 2Q9MA 2C5WB 2WKEA 3HLEA 1E25A 4E3MA 1XA1A 4UA9A 4KZ8A 4XUXA 4E3NA 4O7DA 3IF6B 4GN2A 4IBXA 1KGFA 3OC2A 2J9OA 1L0FA 1G6AA 3O88A 3OPLA 1ERQA 5EOEA 5KMWA 5EVIB 3UY6A 4E3LA 2WKIA 4KG5A 1G68A 3IWIA 4HEFA 3IQAA 4B4ZA 2V2FF 1FSWA 2Y2MA 1GA9A 5IHVA 1NXYA 4Q8IA 3G30A 4OVDA 3Q81A 5HAIA 1HZOA 2EXBA 1XX2A 2EX2A 2Y55A 1L0DA 4DDSA 5CEDA 4LCMA 2EXAA 3OZHA 3V50A 3VOZA 4JPMA 4WM9A 1IEMA 3RXWA 3TG9A 1LLBA 3VFFA 4E3IA 5HAQA 5JYOA 4B88A 1AXBA 4P0MA 2ZM2A 3VP3A 2HDUA 5CGXA 5FAQA 3CMZA 4EQIA 4IVKA 1ERMA 4C3QA 3O87A 1L0GA 4JXGA 4N1XA 4ZJ3A 1MY8A 1W8QA 1RGYA 2XFTA 1L0EA 4FCFA 3ZFZA 3UPPA 1BLHA 3HLWA 1K6SA 1PWCA 3ITAA 5L2FA 4BL2A 3HBRA 1ONHA 1ESUA 2HDRA 4OOMA 5AQ9A 2I72A 3A3JA 4BD1A 4PM8A 5FI7A 4EUZA 4QJGA 1E3UD 2H10A 2Y2IA 1NYMA 2HP9A 2Y2OA 4KENB 1BULA 3PAGA 2V1ZA 4X55A 5CTNA 4RA7A 3ZDJA 1KE3A 5CHMA 5A90A 4XXRA 1NRFA 3NY4A 2HDQA 1CEGA 3ZVWA 3DW0A 3GMWA 3G4PA 4EBNA 5KZHA 5EE8A 1YMSA 2ZC4B 3IF6C 4LV3A 3C5AA 2EFUA 1PW8A 1EROA 3VP0A 4BENA 1ALQA 5E43A 4KZBA 1KE4A 1IYPA 3BFCA 3E2KA 3PBNA 1PZOA 5CECA 5EVIC 3WRZA 4LV1A 4N92A 4WEKA 2E8IA 1O07A 3C7VA 4S2IA 1JTGA 2IWBA 4OQGA 2JC7A 2DNSA 3M6HA 1N4OA 1FSYA 3QHYA 4Y7PA 3IXHA 3ZG8B 1PWGA 4JF6A 4PM5A 4C6YA 4QHCA 4OP5A 4P85A 3S22A 3NCKA 4X53A 3LY3A 4OP8A 1MBLA 1XPBA 3BLSA 5A93A 5I94A 3FZCA 2ZQ7A 3NC8A 4S2PA 4S2KA 1GCEA 3AGFA 5BOHA 4BQMA 4OKPA 3A3EA 4HBUA 1H8ZA 3RJUA 1FOFA 4WZ4A 3VOYA 5FI6A 1GHPA 3G34A 3PBOA 2ZMAA 1WE4A 2EX8A 5DF9A 2UWXA 5FQ9A 4E6WA 1KVLA 3WS4A 5TR7A 2HPBA 5F1FA 3N8SA 3MKFA 1NZOA 5DF8A 1FCNA 5KSCA 5HFOA 3CZDA 1Q2QA 3ZNYA 1NJ4A 2FFYA 4ZJ1A 3V3SA 2FFFB 4B4XA 4MBFA 2OSUA 1K4FA 1IKIA 4WBGA 2XD1A 4JXSA 1ZG6A 2HP6A 1C3BA 2X01A 4R0QA 3IWQA 4X69A 1HVBA 3QNCA 3W8KA 1IELA 4NETA 1VM1A 3GV9A 4X68A 1RCJA 4R23A 3HLBA 3V3RA 2Z2MB 1LI0A 3BYDA 3GRJA 5GLCA 5HW3A 1DJBA 5GHZA 4DE3A 3CG5A 4WMCA 3PBTA 4EWFA 4Z9QA 1SKFA 1K4EA 4NK3A 2OV5A 3MKEA 2EX6A 2OLUA 1FR1A 3G31A
chains in the Genus database with same CATH superfamily
4BBTA 1SZVA 3O3VA 1NWZA 3ZGAB 2GZAA 2VJWA 1W8YA 4N9KA 4OPRA 4E3JA 1K57C 3LIEA 4N1HA 3VP1A 3W4QA 4KQDA 1DJAA 3L7HA 4EBPA 4QY5A 3MXRA 2XK1A 3RTYA 4GNUA 5JYPA 3VFHA 1VETB 4B9OA 1SDEA 1CI9A 1NYYA 2VGKA 5K5BA 1TD5A 2HDSA 4MMNA 2ZQCA 3AGDA 3WRTA 3OPHA 3E0YA 4HQAA 3H7WA 3V39A 3A0RA 4BJPA 3K3DA 1P9WA 4DXCA 3P01A 4EV4A 2WKQA 3FYZA 3A3FA 3AGEA 1S4SA 5DVAA 1CK3A 3OPRA 1XJ4A 1PWDA 1Y54A 1TEMA 5FASA 3M6BA 1K55C 5A91A 4GZBA 5FQKA 4R4RA 4OOLA 5HAPA 2B02A 1ES4A 3BFDA 5EVIA 3C8CA 5HL6A 1BSGA 3MQOA 3G2YA 2OAP1 3T4OA 3IS2B 1TDLA 3IHBA 3UPNA 1O7EA 3W4PA 4LENA 1BZAA 3VE4A 5FQIA 2Y2PA 4KZ3A 2BASA 1ES5A 1S0WA 3IT9A 1TDGA 3W4OA 1QMEA 1JWPA 4DRTA 3PBSA 4HI4A 4PM7A 5DF7A 3IX3A 1I2WA 3ZG7B 4ZAMA 2H0TA 4WEJA 5J4EA 2D01A 4OONA 5HL1A 2H5SA 1QMFA 2A49A 3NIAA 4KQRA 4HJ4A 3MBZA 3BRMA 5E2EA 4S2OA 4F3LA 2WZXA 3E4QA 3BFGA 1IFQA 1ONGA 5GLBA 4R6LA 2QZ6A 4LCLA 2O9AA 2DMWA 1ACFA 4GHIA 3EWKA 1TS8A 4HH3A 1W79A 4H6JA 3DBAA 3RXXA 3IH8A 3G35A 5A8BA 3DWKA 1PIOA 1PW1A 1HTZA 5J7EA 4U0XA 1E3UA 1EI5A 4ME4A 3ZQ5A 4BWIA 2V0UA 1FQGA 4GS9B 1CEFA 4R3BA 2OWJA 3OCLA 1OT9A 2Q0OA 3C4PA 2CMNA 1JWVA 1LHYA 1TVFA 3HL9A 3UB8A 2Y2KA 3LEZA 1N9OA 4DMZA 3QP4A 4D2OA 1F98A 1FIKA 4PMAA 4HY8A 2WZZA 5EOOA 4ETXA 2ZC7A 1CF0A 2ZQ8A 1P9RA 1L3LA 2FH5A 1LL5A 1K54A 1XJ6A 2R78A 1K25A 4CLCA 5CEBA 2GJ3A 4KZ5A 3LR5A 1NY0A 3VMAA 3T12B 4DN0A 2Z2LB 5M19A 2JCHA 4S2NA 2V8FA 3H7WB 3LICA 1IOUA 2Y2LA 3PBQA 1MC0A 2W3HA 3UMDA 3N8LA 3UDXA 1Q2PA 4RVAA 1N9BA 3SZTA 3CPTA 2XR0A 4GLQA 1YMXA 5HZHA 1MWTA 3ZG0A 4ZBEA 4DXBA 1MKIA 3UB5P 3PHYA 4UA9A 4KZ8A 4E3NA 4GN2A 4EU0A 4YOFA 1X0OA 5DFYA 1OTEA 3OPLA 5EVIB 1G68A 3IQAA 3T50A 2Y2MA 1GA9A 1NXYA 4Q8IA 5L07A 4DDSA 4DJ2A 4B93A 4LCMA 5HDSA 3V50A 3VFFA 1Y28A 1NLYA 4FUWA 3D72A 2YKFA 2J80A 4ZJ3A 1BLHA 1K6SA 1OT6A 5L2FA 2LB9A 4BL2A 1ESUA 1TS7A 2HDRA 4OOMA 1BULA 3NULA 2PAVP 4G3WA 1KE3A 3ZVWA 3GMWA 4F3LB 1ODVA 4EBNA 3G6OA 4D60A 1YMSA 2ZC4B 2VV8A 4IJGA 4Y5FA 1PW8A 3VP0A 4EW7A 5E43A 4KZBA 2ZMVA 1IYPA 5EVIC 4N92A 4O8GA 2W3DA 2E8IA 4PHTA 4GHIB 2EWWA 1JTGA 2IWBA 3M6HA 1FSYA 3T1RA 3QHYA 4E04A 3IXHA 4H6JB 5HSQA 4JF6A 3LY3A 4OP8A 1MBLA 5C5KA 3AGFA 5BOHA 3T1SA 4OKPA 4NEED 3RJUA 4WZ4A 3VOYA 2NUTC 1GHPA 3HJIA 3PBOA 1KVLA 5F1FA 3N8SA 5KSCA 5HFOA 3CZDA 3ZNYA 3VV4A 4B4XA 4MBFA 2OSUA 2PD7A 2M7VA 3QNCA 1IELA 2VV7A 3HLBA 4R23A 2Z2MB 1DJBA 1JNUA 2AVXA 4IUHA 4XT2A 1N9NA 4MN6A 4HJ6A 3GTCA 4OLDA 4CLCB 1J3WA 3UE1A 1IKGA 2PDRA 4WMCD 1ZKJA 3Q7ZA 5F1GA 1UWPX 2P74A 4C75A 1BUEA 5GHXA 3ZNTA 4PM9A 5CHUA 4IEDA 4DE2A 4LV2A 3R7WA 1UWNX 4XUZA 1KVMA 2WGWA 3QP6A 1T1AA 3CPTB 4JKTA 4YWZA 3SS4A 4QY6A 3EEHA 1N9LA 3Q7VA 4N9LA 5DKLA 5CERA 5HPFA 5D3OA 1BLCA 2VGJA 3H82A 2BLSA 4LRYC 3A3DA 1YQSA 5TFQA 3MS6A 2ZM8A 1FILA 3TRCA 1T1CA 5CXWA 4HESA 1ES2A 3LR3A 1CQAA 2XH9A 4RX2A 4P6BA 2VZWA 2PBDP 1K54C 3SOIA 4WYYA 5FATA 5U47A 4X6TA 4GD6A 4CLCC 2VV6A 2ZJ9A 4P87A 4ZDXA 1VHMA 1RGZA 4S2NC 1OTAA 5GL9A 4EEPA 1BLPA 3VP4A 4MEZA 5HWVA 1XGIA 1H8YA 3N8RA 5MC7A 5EVID 4WELA 4KZ4A 4NG2A 4QD4A 2WK0A 2ZQDA 2WYXA 2XDMA 3IF5A 3GDIA 2OWHA 2Z6DA 4Y2FA 4DF6A 3BECA 3MZEA 4EESA 3FPWA 1MPLA 1BTLA 3MZDA 3O86A 1DJCA 3TSGA 4JLFA 5FEGA 5IU1A 2CC1A 1IYOA 3CJMA 3N4IA 4FD8A 1MWRA 3NHQA 1KE0A 1HLUP 3HUNA 1JVJA 2RCXA 5IT5A 3CUEA 3HLCA 4OOYA 1YPRA 3GVBA 5FAPA 1GSWA 3HLFA 4O0PA 1V9YA 2XLNA 3NOTC 4ID4A 5DTSA 1YT4A 1KDWA 1XFQA 4AFIA 3H9WA 4MBHA 3BLMA 4HBTA 3UDFA 3HUMA 2WAEA 3MFDA 2EX9A 3QNBA 1J9MA 2XA7M 5HDDA 4EQ1A 1F9IA 3MXSA 4WUJA 1D7EA 5EFWA 5FEFA 2JKRI 3CAXA 3OPPA 3M2KA 4WLAA 5GLAA 3BY9A 5CRFA 5L10A 2YKHA 5EPHA 1M40A 3BW6A 4FSFA 4JXVA 5M1AA 3FG8A 4XT2B 1W7FA 4ARZA 2QHKA 2DCFA 4NXEA 4GDBA 4Y17A 1LI9A 3PYPA 3SS5A 2W1TA 3CI6A 1WYCA 2WKPA 1YSPA 1LL9A 3F1PA 1T1BA 3KSGA 3T4QA 3PXPA 1NRJA 1S1YA 3LEQA 3S7OA 1VQQA 4X25A 3K2NA 3LY4A 1VB6A 5GLDA 2XF3A 2J3TD 2HJEA 1KGEA 3GQZA 1STZA 4JXWA 4R4SA 2QKPA 3R7WB 2JE5A 4Y0TA 2WGWB 4IHQA 4ZRRA 2JN7A 1JTDA 5A92A 5TGFA 4LRXC 1TS6A 2DRWA 4OPQA 3Q7VB 1YLYA 1FR6A 4KZ7A 5AJGA 3LGOA 3H82B 2W3EA 4HH2A 2Y2QA 4CLCD 1GHMA 4JF5A 3P98A 4E3OA 5CTMA 3UB7A 4OQ0A 4M4XA 3EQUA 2ZD8A 3F1NA 5DTKA 5FA7A 3FWLA 1OJ5A 3KX0X 4KQQA 2M7UA 4CJNA 3LCEA 3UNWA 3FKWA 1YLTA 4JGPA 1TF1A 2C5WB 3HLEA 5EVEA 4XUXA 4I39A 3UE6A 4IBXA 2J9OA 5HPIA 1L0FA 2W3FA 2EA9A 1LT0A 5AVEA 5EOEA 5KMWA 3UY6A 4EUVA 3G30A 4OVDA 5HAIA 2EXBA 3MR0A 4JPMA 4WM9A 4WL9A 5HAQA 3LFVA 1AXBA 4P0MA 2ZM2A 2L0WA 3VP3A 1V9ZA 4EQIA 4C3QA 4UQIM 1L0GA 1DP8A 3A0SA 3U2AA 2XFTA 1L0EA 2MJ6A 3HLWA 3LYXA 2PR5A 3HBRA 5AQ9A 4BD1A 4EUZA 4HP9A 3DTIA 2HP9A 3PAGA 3VOLA 5CHMA 1OTIA 4XXRA 1NRFA 2HDQA 1CEGA 2KX6A 2Z6CA 5KZHA 5EE8A 2V1BA 4LV3A 1D1JA 1AWIA 1ALQA 3HJKA 3BFCA 4LV1A 4WEKA 4EERA 3C7VA 1S66L 5F5YA 1OJGA 2JC7A 3BQ8A 4PM5A 5F6AA 3S22A 2VA0A 3BLSA 4HP4A 4LGWA 1FOFA 3G34A 1WE4A 3EGXC 2UWXA 5FQ9A 1NZOA 1Q2QA 4ARZB 2FFYA 4ZJ1A 3V3SA 4Y3IA 1F5MA 1C3BA 4R0QA 1HVBA 3F1PB 3W8KA 1KOUA 4EXOA 4WN5A 4R38A 1RCJA 3BYDA 3CUEC 5GLCA 2OAQ1 5HW3A 3U4LP 5GHZA 3NECA 4DE3A 3BQAA 4Z9QA 1OPXA 1FR1A 3G31A 4E6XA 5HWTA 3E98A 3HVFA 2ZMFA 1PZPA 5CHJA 2KDKA 1K0KA 1EW0A 4JF4A 1H8MA 2Y2HA 4A5RA 2ZOHA 2QMIA 3S7PA 2LB5A 2PHYA 4Q0HA 2V9AA 2J9PA 5HARA 4LLOB 1P97A 4JGQA 3T4TA 1BT5A 4UA7A 1K38A 4X1MA 3D9YA 5EM1A 4ZJ2A 4OPYA 3F1NB 3NOUC 4KUOA 3FPVA 5FL3A 3IXBA 4OLGA 1MXOA 1W63M 2QYBA 3EGDC 1XXMA 3IWOA 3N6IA 2VLGA 1LSWA 4DKIA 2WUQA 3PAEA 5FSRA 4OQHA 4UHUA 4R3AA 3SS3A 2B5RA 1MWSA 2X02A 2JKRM 4I3IA 1M6KA 5CGSA 2HV1A 2P08A 3V5MA 2EWVA 5CGWA 3UO9A 4L9GA 2P9VA 1LSVA 5DJUA 4GDNA 2X71A 3OCNA 1OTDA 1S67L 2PRFA 5E2GA 1KGGA 3ZG5A 4WF0A 3F1OA 2ZM0A 4HNBA 2HJ9C 2XA7S 2Y4AA 1XJ2A 1YLPA 1FCOA 3MZFA 3MFXA 3UB9A 1YLWA 1ZG4A 3ZG9B 1XA7A 5EUAA 4HJ3A 4I38A 1BYWA 4CLCE 2PU4A 4UA6A 3Q07A 3WS0A 4HIAA 1PI5A 3BWLA 2G2WA 2ZBBA 3WWXA 1PRQA 3D4FA 4K0WA 5DTTA 4OQIA 3MXQA 4QB8A 3TE8A 2ZC3B 3TJZC 3VSLA 4ZTKA 5FQJA 5FQMA 2K31A 4R1GA 5M18A 1Y4OA 1PYYA 3KYEA 5G4ZA 2Y8HA 2OLVA 5KIZA 2PD8A 2PT7A 3FV7A 3LO7A 3BY8A 2ZL1A 1GA0A 3ZCZA 2ZC5B 4Y13A 4PPRA 2J3WA 1Z09A 3PTEA 4MN5A 5DFXA 3HUOA 2P04A 2JKGA 3BFFA 3KYZA 2R9WA 4FH4A 1K56A 3TOIA 1H5XA 1OMEA 2E8JA 2VKSA 1SCWA 2BG1A 2JKTM 4G3VA 3NI9A 2XEPA 4MN7A 3IXGA 3HLGA 2W3GA 2P7JA 4RQ9A 2G2UA 3LR0A 5F68A 1RP5A 1YLZA 4H8RA 2H28A 4U3TA 4L9EA 2WKHA 3FKVA 4YFMA 3OBFA 5F83A 2XD5A 1H3QA 4KQOA 5FAOA 1S6RA 1XKZA 5F82A 4GCZA 4P6ZM 4M3KA 2Y2GA 1GSVA 3C38A 5FQQA 1YKDA 4R3JA 1IYSA 3V67A 4WZ5A 2Y59A 4F94A 4UQIS 2ZC6B 1TS0A 3IXDA 5KSHA 2PYRA 4FH2A 3NBLA 3DTMA 4GD8A 3KSHA 3LUQA 3ICYA 3UPOA 3I7JA 4Y0OA 3BM6A 3ZVTA 1PI4A 4G3KA 4RX3A 4PAUA 2P9VB 3KSFA 5HX9A 1XP4A 2FZ0A 3NDEA 4HOIA 1G6OA 1EWZA 3A3IA 5I5LA 3ISGA 3MF0A 3KSIA 4OH0A 3LIAA 3UB6A 4LPZA 4PKYG 3C30A 3HLDA 4QPRA 2Q9MA 2WKEA 1XA1A 3L9KA 4O7DA 2IA2A 2QWSA 1KGFA 3OC2A 3F1OB 4JGRA 1G6AA 1ERQA 2BTFP 4Z1WA 4KG5A 2V2FF 1FSWA 5IHVA 3JPUA 1HZOA 1XX2A 2Y55A 5CEDA 2B95A 3DTKA 2EXAA 3OZHA 3VOZA 1IEMA 3RXWA 1P0ZA 4E3IA 3T1XA 4B88A 2VGLM 3IBRA 2HDUA 3CMZA 1MZUA 3OOVA 4N1XA 1RGYA 2I9VA 1S1ZA 4FCFA 3ZFZA 3UPPA 3ITAA 4GW9A 2B18A 4BBVA 1ONHA 1F2KA 3A3JA 4PM8A 5FI7A 4QJGA 1E3UD 2Y2IA 1NYMA 4HHDA 2V1ZA 5IS1A 3CHWP 4NXFA 3ZDJA 5A90A 3NY4A 3T1QB 3G4PA 3BJNA 4NXBA 2NUPC 1DRMA 2ZL1B 2HF6A 3C5AA 3LI9A 4EETB 1KE4A 5CECA 1PZOA 3WRZA 5TBMA 1O07A 5DJTA 4S2IA 4OQGA 4L9FA 3EOIA 3LIFA 4Y7PA 3MSHA 2K7SA 2V8CA 4OP5A 4P85A 2ACGA 3NCKA 5HD5A 1XPBA 5A93A 5I94A 3FZCA 2ZQ7A 1G28A 4S2PA 5L09A 4BQMA 4HBUA 1H8ZA 4I3JA 1ZHHB 2ZMAA 2EX8A 5DF9A 4GJ4A 3RFBA 5TR7A 1H0MA 5L8MA 1NJ4A 2FFFB 3HCYA 1IKIA 2XD1A 1ZG6A 2HP6A 2X01A 3E4OA 3IWQA 2G7UA 2L1MA 3SW1A 3GV9A 1LL8A 4X68A 3T4LA 1LI0A 3GRJA 3B33A 2K2NA 3RH8B 3CG5A 2PYPA 3TW8A 1SKFA 1K4EA 4FOFA 2EX6A 2OLUA 4KG6A 5LBRA 2QPNA 2PBYA 5E2FA 5J3WA 1YAXA 2XGNA 4MBKA 2VEAA 1Z6FA 2JKTI 3N7WA 1VEUA 3QP8A 3ULFA 3E4PA 2O99A 2Q9NA 3SH8A 1YLJA 2Y91A 4IVIA 1HD8A 2JKFA 5EECA 2M1CA 3IX8A 1ES3A 2O9CA 4RYEA 2HP5A 5G4YA 1L2SA 2Y2JA 4U0TA 1ZC2A 1ESIA 4S2JA 3GSGA 5HD3A 3UN7A 4CPKA 5AQAA 5E2HA 3R4KA 4FTXA 1MWUA 2WADA 1NLZA 3PBRA 3Q82A 4IUKA 1T19A 2ZLYA 3BFEA 2D02A 2C6WB 2ZQ9A 4IBRA 2WGVA 2EFXA 3UE3A 2RL3A 4Y15A 4K91A 3LIDA 1T18A 3BEBA 5TJJA 3SH9A 2J8YA 4MLLA 3VP2A 4PM6A 2ZQAA 3HREA 4JBFA 2VK3A 3LR4A 4EBLA 4WZ5C 3MQQA 4I3AA 4LFUA 3LI8A 2IWDA 1IYQA 3IF6A 3T4KA 3S1YA 4GKUA 3UE0A 1I2SA 5HDCA 4YNRA 3Q1FA 2R9XA 5AQ7A 2GNXA 2XFSA 3GR2A 4MNRA 1SDNA 4LRZE 2JHEA 3IBJA 1KDSA 3VSKA 5G18A 4S2MA 3EQVA 2W1TB 2UV0E 3CWFA 4DDYA 1SKOA 4GOGA 3OLOA 1JWZA 3CLOA 1PFLA 3C7UA 4QU3A 3P09A 1SHVA 1BLSA 4DE0A 4BMWA 3JYIA 5TBMB 2JBFA 3WS5A 4P6ZS 5GHYA 1U60A 2QJ5A 3T4SA 1LSXA 1XGJA 4DE1A 2WAFA 2XQZA 2GDNA 2W27A 5DKKA 4ETZA 4KZAA 4R70A 1GHIA 4E3KA 1W5DA 4L0LA 3S7QA 3IHAA 2A3UA 2XRNA 4KG2A 2Y2NA 1CJFA 2A24A 2A2LA 3ZYTA 1W63Q 3DWZA 3KO6A 2WKRA 4ESPA 2XSSA 1K57A 3G32A 4KZ6A 3QP5A 1GSXA 1WA9A 3P7NA 2V1AA 4NKPA 1I5QA 3A0VA 2XROA 4BD0A 1K56D 1E4DA 3QP2A 1XFNA 3E2LA 3WS2A 1UGUA 4YINA 4LV0A 3IH9A 3S4XA 2QJ7A 4PKYA 2H0YA 2IWCA 3NJAA 2J7VA 3ITBA 3NDGA 2KOIA 4DJ3A 1WYBA 5CX7A 5FI2A 1FCMA 1VEUB 3KYQA 3B3XA 4Y0UA 3MJQA 4BLMA 4GB7A 4Q0JA 3UDIA 3IX4A 4MDZA 3JVVA 2O0YA 1OTBA 3B42A 1S4RA 4X1LA 2VGLS 5AVFA 3S7NA 2WGIA 4JGOA 4BL3A 3EEAA 2V0WA 5FDHA 1K55A 3SH7A 1NZUA 4Q0IA 2OOLA 4OPZA 1K6RA 2KLIA 4KZ9A 4S2LA 1VETA 5F69A 4K0XA 4O01A 1DY6A 2HGVA 4I5SA 2V20A 3M2JA 5AQBA 5EVLA 1YM1A 3G2ZA 2L4RA 4UAAA 3ZHHA 4X56A 3C4OA 3WS1A 1D06A 3GECA 1CI8A 2O9BA 2PU2A 5J8XA 3MQ0A 3C2WA 1E25A 4E3MA 3IF6B 3QP1A 4K08A 3D3OA 4KUKA 3O88A 4E3LA 2WKIA 3IWIA 4HEFA 4B4ZA 3PR6A 3Q81A 1MKMA 2EX2A 2INWA 1L0DA 3W2ZA 3TG9A 1LLBA 3DAVA 1A0KA 5JYOA 1SKOB 2HZ5A 5CGXA 5FAQA 4IVKA 2PR6A 1ERMA 3B47A 3O87A 4JXGA 5FDSA 1MY8A 1W8QA 3IS2A 1PWCA 2W1RA 1ZTUA 2I72A 1DP9A 2H10A 4KENB 2Y2OA 2ZOIA 1G5UA 4X55A 5CTNA 4RA7A 5EM0A 2J3TC 4BBUA 4UEYA 3DW0A 3IF6C 4BENA 2EFUA 3T4JA 1EROA 1PNEA 3PBNA 3E2KA 4II7A 2A24B 3UMEA 2DNSA 1N4OA 3LIBA 3ZG8B 1PWGA 3O5YA 4C6YA 4QHCA 4X53A 3VE3A 3NOPC 3NC8A 2GX5A 1YSQA 3DTEA 4S2KA 1GCEA 1DP6A 4MCWA 3A3EA 5FI6A 4E6WA 3MMHA 3WS4A 5EV0A 4EEUA 2HPBA 3MKFA 5DF8A 1FCNA 2VX8A 1XJ3A 4NXGA 1K4FA 2W0NA 3JVUA 4WBGA 4JXSA 4X69A 5HWWA 4NETA 1VM1A 3FC7A 3V3RA 4WMCA 3CITA 3PBTA 4QWOA 4EWFA 4GS9A 4NK3A 2Y79A 3MKEA 2OV5A 3K3CA 4CQHA
chains in the Genus database with same CATH topology
2QPNA 3GTCA 2PBYA 3HVFA 5E2FA 1PZPA 4OLDA 5CHJA 3O3VA 3ZGAB 4JF4A 2Y2HA 3UE1A 1IKGA 4A5RA 4WMCD 2QMIA 1W8YA 4N9KA 4OPRA 2XGNA 1ZKJA 4MBKA 4E3JA 1K57C 3VP1A 4N1HA 3W4QA 1Z6FA 3N7WA 3Q7ZA 5F1GA 2Q9NA 1DJAA 2P74A 4EBPA 4QY5A 3SH8A 1YLJA 2J9PA 2Y91A 4IVIA 5HARA 1HD8A 3MXRA 5EECA 4C75A 1ES3A 1BUEA 2XK1A 4RYEA 5GHXA 4GNUA 2HP5A 3ZNTA 4PM9A 1L2SA 5CHUA 2Y2JA 4IEDA 4DE2A 4LV2A 1BT5A 4UA7A 1K38A 4E6XA 5JYPA 3VFHA 4ZJ2A 4OPYA 4U0TA 1ZC2A 4XUZA 1KVMA 1SDEA 1CI9A 2WGWA 1NYYA 2VGKA 1ESIA 3IXBA 4JKTA 4OLGA 1MXOA 4S2JA 3GSGA 3SS4A 2HDSA 1XXMA 3IWOA 2ZQCA 3AGDA 4QY6A 5AQAA 3N6IA 3UN7A 4CPKA 5E2HA 3WRTA 3OPHA 3Q7VA 4N9LA 1MWUA 2WADA 5CERA 4DKIA 5D3OA 3PBRA 1BLCA 3Q82A 2WUQA 2VGJA 2BLSA 3PAEA 5FSRA 2ZLYA 3BFEA 4OQHA 4UHUA 2C6WB 3A3DA 1YQSA 2B5RA 3SS3A 3V39A 1MWSA 2ZQ9A 4IBRA 2WGVA 2X02A 5TFQA 2EFXA 2ZM8A 1M6KA 5CGSA 3UE3A 4BJPA 2RL3A 4K91A 5CXWA 4HESA 1ES2A 3BEBA 3SH9A 2J8YA 4DXCA 3V5MA 4EV4A 4MLLA 2XH9A 4RX2A 5CGWA 3UO9A 4P6BA 4PM6A 3FYZA 3A3FA 3VP2A 3AGEA 2P9VA 2ZQAA 5DVAA 1CK3A 3HREA 3OPRA 1K54C 3SOIA 4WYYA 4JBFA 5FATA 5U47A 4X6TA 4GD6A 4GDNA 4EBLA 2X71A 3OCNA 4WZ5C 1PWDA 1Y54A 1TEMA 5FASA 2ZJ9A 3M6BA 5E2GA 1K55C 5A91A 2IWDA 4P87A 4GZBA 5FQKA 4ZDXA 1KGGA 4R4RA 4OOLA 5HAPA 3ZG5A 1RGZA 1IYQA 3IF6A 4S2NC 3S1YA 2ZM0A 4GKUA 5GL9A 3UE0A 1I2SA 3Q1FA 4KG6A 2R9XA 1ES4A 3BFDA 5EVIA 1BLPA 5AQ7A 2XFSA 1BSGA 3VP4A 3GR2A 2Y4AA 5EVLA 4MNRA 1SDNA 3G2YA 4MEZA 1YLPA 1XGIA 1FCOA 3MZFA 1TDLA 1YLWA 3IHBA 3UPNA 1H8YA 1O7EA 1ZG4A 3W4PA 3ZG9B 1KDSA 3VSKA 1XA7A 3N8RA 5EUAA 5G18A 5EVID 4LENA 4S2MA 4WELA 1BZAA 4KZ4A 4QD4A 3EQVA 5FQIA 2PU4A 2Y2PA 4UA6A 2WK0A 3Q07A 4KZ3A 2ZQDA 3WS0A 1ES5A 1S0WA 4DDYA 4GOGA 1PI5A 2WYXA 3IT9A 2XDMA 2G2WA 1JWZA 3IF5A 1TDGA 3C7UA 3W4OA 3WWXA 4DF6A 1QMEA 3BECA 1JWPA 3D4FA 3MZEA 3PBSA 3P09A 4K0WA 4OQIA 4QU3A 4DRTA 4PM7A 4QB8A 1SHVA 5DF7A 1BLSA 1MPLA 4DE0A 1BTLA 2ZC3B 3VSLA 1I2WA 3MZDA 3JYIA 3O86A 4ZTKA 5FQJA 3ZG7B 1DJCA 3TSGA 2JBFA 4ZAMA 4JLFA 3WS5A 2H0TA 4WEJA 5FQMA 5GHYA 1U60A 4OONA 5HL1A 4R1GA 2CC1A 2H5SA 5M18A 1QMFA 1IYOA 1PYYA 1XGJA 3CJMA 4DE1A 2A49A 3N4IA 2WAFA 2XQZA 3NIAA 2GDNA 4FD8A 1MWRA 4KQRA 2OLVA 1KE0A 4KZAA 3HUNA 1GHIA 1JVJA 2RCXA 1W5DA 4E3KA 4L0LA 3FV7A 3MBZA 3BRMA 5E2EA 4S2OA 3LO7A 3HLCA 2WZXA 4OOYA 3GVBA 5FAPA 3IHAA 3HLFA 2A3UA 1GA0A 3BFGA 3ZCZA 2XLNA 1ONGA 2ZC5B 4ID4A 2Y2NA 4KG2A 5DTSA 5GLBA 1YT4A 1KDWA 2QZ6A 4LCLA 4PPRA 3PTEA 4MBHA 3HUOA 3BLMA 4HBTA 3DWZA 3UDFA 3BFFA 3HUMA 2R9WA 1W79A 1K56A 4FH4A 3TOIA 2WAEA 1H5XA 3MFDA 1K57A 3G32A 1OMEA 3RXXA 2EX9A 1SCWA 4KZ6A 3QNBA 2BG1A 1J9MA 3IH8A 3G35A 3DWKA 1PIOA 3MXSA 3NI9A 1PW1A 1HTZA 1I5QA 2XEPA 4U0XA 4BD0A 1E3UA 1K56D 1E4DA 1EI5A 3HLGA 3IXGA 3OPPA 3M2KA 5GLAA 5CRFA 2G2UA 3E2LA 3WS2A 5EPHA 4YINA 1M40A 4FSFA 1FQGA 4LV0A 1CEFA 1RP5A 4JXVA 3IH9A 5M1AA 3S4XA 1YLZA 2H0YA 4R3BA 4H8RA 4U3TA 1W7FA 3OCLA 2DCFA 4GDBA 3C4PA 1JWVA 1LHYA 1TVFA 2WKHA 3HL9A 2IWCA 1LI9A 3FKVA 2Y2KA 3LEZA 3SS5A 2J7VA 3ITBA 4YFMA 1WYCA 3NDGA 1LL9A 1WYBA 4D2OA 5FI2A 4PMAA 1FCMA 5F83A 2XD5A 4KQOA 3B3XA 5FAOA 2WZZA 4Y0UA 1S6RA 5EOOA 1XKZA 1VQQA 5F82A 2ZC7A 4BLMA 2ZQ8A 3LY4A 4GB7A 5GLDA 4M3KA 3UDIA 2XF3A 2Y2GA 1KGEA 3GQZA 5FQQA 4JXWA 1LL5A 4R4SA 4R3JA 1K54A 2JE5A 4Y0TA 1IYSA 1K25A 2WGWB 4WZ5A 5CEBA 2Y59A 2WGIA 4BL3A 4F94A 1JTDA 5A92A 5TGFA 5FDHA 1K55A 2ZC6B 4KZ5A 2DRWA 4OPQA 1NY0A 3VMAA 3IXDA 3Q7VB 3SH7A 2Z2LB 1YLYA 1FR6A 4KZ7A 5M19A 2JCHA 4S2NA 1NZUA 5KSHA 4FH2A 3NBLA 2Y2QA 2Y2LA 3DTMA 1GHMA 3PBQA 4JF5A 3P98A 4OPZA 4GD8A 1K6RA 4E3OA 4KZ9A 3UPOA 4S2LA 3I7JA 5CTMA 4OQ0A 3N8LA 3EQUA 3UDXA 4K0XA 4Y0OA 2ZD8A 1DY6A 1Q2PA 3BM6A 4RVAA 5DTKA 3ZVTA 1N9BA 5FA7A 1PI4A 3FWLA 4RX3A 5HX9A 2P9VB 2XR0A 2V20A 1XP4A 3M2JA 4KQQA 5DTTA 1YM1A 5AQBA 1YMXA 3NDEA 3G2ZA 4CJNA 3LCEA 4UAAA 3ZHHA 3UNWA 1EWZA 3A3IA 1MWTA 3C4OA 4X56A 3FKWA 3ZG0A 3WS1A 1YLTA 3ISGA 1CI8A 4ZBEA 4DXBA 2PU2A 1MKIA 4OH0A 5J8XA 3HLDA 2Q9MA 2C5WB 2WKEA 3HLEA 1E25A 4E3MA 1XA1A 4UA9A 4KZ8A 4XUXA 4E3NA 4O7DA 3IF6B 4GN2A 4IBXA 1KGFA 3OC2A 2J9OA 1L0FA 1G6AA 3O88A 3OPLA 1ERQA 5EOEA 5KMWA 5EVIB 3UY6A 4E3LA 2WKIA 4KG5A 1G68A 3IWIA 4HEFA 3IQAA 4B4ZA 2V2FF 1FSWA 2Y2MA 1GA9A 5IHVA 1NXYA 4Q8IA 3G30A 4OVDA 3Q81A 5HAIA 1HZOA 2EXBA 1XX2A 2EX2A 2Y55A 1L0DA 4DDSA 5CEDA 4LCMA 2EXAA 3OZHA 3V50A 3VOZA 4JPMA 4WM9A 1IEMA 3RXWA 3TG9A 1LLBA 3VFFA 4E3IA 5HAQA 5JYOA 4B88A 1AXBA 4P0MA 2ZM2A 3VP3A 2HDUA 5CGXA 5FAQA 3CMZA 4EQIA 4IVKA 1ERMA 4C3QA 3O87A 1L0GA 4JXGA 4N1XA 4ZJ3A 1MY8A 1W8QA 1RGYA 2XFTA 1L0EA 4FCFA 3ZFZA 3UPPA 1BLHA 3HLWA 1K6SA 1PWCA 3ITAA 5L2FA 4BL2A 3HBRA 1ONHA 1ESUA 2HDRA 4OOMA 5AQ9A 2I72A 3A3JA 4BD1A 4PM8A 5FI7A 4EUZA 4QJGA 1E3UD 2H10A 2Y2IA 1NYMA 2HP9A 2Y2OA 4KENB 1BULA 3PAGA 2V1ZA 4X55A 5CTNA 4RA7A 3ZDJA 1KE3A 5CHMA 5A90A 4XXRA 1NRFA 3NY4A 2HDQA 1CEGA 3ZVWA 3DW0A 3GMWA 3G4PA 4EBNA 5KZHA 5EE8A 1YMSA 2ZC4B 3IF6C 4LV3A 3C5AA 2EFUA 1PW8A 1EROA 3VP0A 4BENA 1ALQA 5E43A 4KZBA 1KE4A 1IYPA 3BFCA 3E2KA 3PBNA 1PZOA 5CECA 5EVIC 3WRZA 4LV1A 4N92A 4WEKA 2E8IA 1O07A 3C7VA 4S2IA 1JTGA 2IWBA 4OQGA 2JC7A 2DNSA 3M6HA 1N4OA 1FSYA 3QHYA 4Y7PA 3IXHA 3ZG8B 1PWGA 4JF6A 4PM5A 4C6YA 4QHCA 4OP5A 4P85A 3S22A 3NCKA 4X53A 3LY3A 4OP8A 1MBLA 1XPBA 3BLSA 5A93A 5I94A 3FZCA 2ZQ7A 3NC8A 4S2PA 4S2KA 1GCEA 3AGFA 5BOHA 4BQMA 4OKPA 3A3EA 4HBUA 1H8ZA 3RJUA 1FOFA 4WZ4A 3VOYA 5FI6A 1GHPA 3G34A 3PBOA 2ZMAA 1WE4A 2EX8A 5DF9A 2UWXA 5FQ9A 4E6WA 1KVLA 3WS4A 5TR7A 2HPBA 5F1FA 3N8SA 3MKFA 1NZOA 5DF8A 1FCNA 5KSCA 5HFOA 3CZDA 1Q2QA 3ZNYA 1NJ4A 2FFYA 4ZJ1A 3V3SA 2FFFB 4B4XA 4MBFA 2OSUA 1K4FA 1IKIA 4WBGA 2XD1A 4JXSA 1ZG6A 2HP6A 1C3BA 2X01A 4R0QA 3IWQA 4X69A 1HVBA 3QNCA 3W8KA 1IELA 4NETA 1VM1A 3GV9A 4X68A 1RCJA 4R23A 3HLBA 3V3RA 2Z2MB 1LI0A 3BYDA 3GRJA 5GLCA 5HW3A 1DJBA 5GHZA 4DE3A 3CG5A 4WMCA 3PBTA 4EWFA 4Z9QA 1SKFA 1K4EA 4NK3A 2OV5A 3MKEA 2EX6A 2OLUA 1FR1A 3G31A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QPN A;  3GTC A;  2PBY A;  3HVF A;  5E2F A;  1PZP A;  4OLD A;  5CHJ A;  3O3V A;  3ZGA B;  4JF4 A;  2Y2H A;  3UE1 A;  1IKG A;  4A5R A;  4WMC D;  2QMI A;  1W8Y A;  4N9K A;  4OPR A;  2XGN A;  1ZKJ A;  4MBK A;  4E3J A;  1K57 C;  3VP1 A;  4N1H A;  3W4Q A;  1Z6F A;  3N7W A;  3Q7Z A;  5F1G A;  2Q9N A;  1DJA A;  2P74 A;  4EBP A;  4QY5 A;  3SH8 A;  1YLJ A;  2J9P A;  2Y91 A;  4IVI A;  5HAR A;  1HD8 A;  3MXR A;  5EEC A;  4C75 A;  1ES3 A;  1BUE A;  2XK1 A;  4RYE A;  5GHX A;  4GNU A;  2HP5 A;  3ZNT A;  4PM9 A;  1L2S A;  5CHU A;  2Y2J A;  4IED A;  4DE2 A;  4LV2 A;  1BT5 A;  4UA7 A;  1K38 A;  4E6X A;  5JYP A;  3VFH A;  4ZJ2 A;  4OPY A;  4U0T A;  1ZC2 A;  4XUZ A;  1KVM A;  1SDE A;  1CI9 A;  2WGW A;  1NYY A;  2VGK A;  1ESI A;  3IXB A;  4JKT A;  4OLG A;  1MXO A;  4S2J A;  3GSG A;  3SS4 A;  2HDS A;  1XXM A;  3IWO A;  2ZQC A;  3AGD A;  4QY6 A;  5AQA A;  3N6I A;  3UN7 A;  4CPK A;  5E2H A;  3WRT A;  3OPH A;  3Q7V A;  4N9L A;  1MWU A;  2WAD A;  5CER A;  4DKI A;  5D3O A;  3PBR A;  1BLC A;  3Q82 A;  2WUQ A;  2VGJ A;  2BLS A;  3PAE A;  5FSR A;  2ZLY A;  3BFE A;  4OQH A;  4UHU A;  2C6W B;  3A3D A;  1YQS A;  2B5R A;  3SS3 A;  3V39 A;  1MWS A;  2ZQ9 A;  4IBR A;  2WGV A;  2X02 A;  5TFQ A;  2EFX A;  2ZM8 A;  1M6K A;  5CGS A;  3UE3 A;  4BJP A;  2RL3 A;  4K91 A;  5CXW A;  4HES A;  1ES2 A;  3BEB A;  3SH9 A;  2J8Y A;  4DXC A;  3V5M A;  4EV4 A;  4MLL A;  2XH9 A;  4RX2 A;  5CGW A;  3UO9 A;  4P6B A;  4PM6 A;  3FYZ A;  3A3F A;  3VP2 A;  3AGE A;  2P9V A;  2ZQA A;  5DVA A;  1CK3 A;  3HRE A;  3OPR A;  1K54 C;  3SOI A;  4WYY A;  4JBF A;  5FAT A;  5U47 A;  4X6T A;  4GD6 A;  4GDN A;  4EBL A;  2X71 A;  3OCN A;  4WZ5 C;  1PWD A;  1Y54 A;  1TEM A;  5FAS A;  2ZJ9 A;  3M6B A;  5E2G A;  1K55 C;  5A91 A;  2IWD A;  4P87 A;  4GZB A;  5FQK A;  4ZDX A;  1KGG A;  4R4R A;  4OOL A;  5HAP A;  3ZG5 A;  1RGZ A;  1IYQ A;  3IF6 A;  4S2N C;  3S1Y A;  2ZM0 A;  4GKU A;  5GL9 A;  3UE0 A;  1I2S A;  3Q1F A;  4KG6 A;  2R9X A;  1ES4 A;  3BFD A;  5EVI A;  1BLP A;  5AQ7 A;  2XFS A;  1BSG A;  3VP4 A;  3GR2 A;  2Y4A A;  5EVL A;  4MNR A;  1SDN A;  3G2Y A;  4MEZ A;  1YLP A;  1XGI A;  1FCO A;  3MZF A;  1TDL A;  1YLW A;  3IHB A;  3UPN A;  1H8Y A;  1O7E A;  1ZG4 A;  3W4P A;  3ZG9 B;  1KDS A;  3VSK A;  1XA7 A;  3N8R A;  5EUA A;  5G18 A;  5EVI D;  4LEN A;  4S2M A;  4WEL A;  1BZA A;  4KZ4 A;  4QD4 A;  3EQV A;  5FQI A;  2PU4 A;  2Y2P A;  4UA6 A;  2WK0 A;  3Q07 A;  4KZ3 A;  2ZQD A;  3WS0 A;  1ES5 A;  1S0W A;  4DDY A;  4GOG A;  1PI5 A;  2WYX A;  3IT9 A;  2XDM A;  2G2W A;  1JWZ A;  3IF5 A;  1TDG A;  3C7U A;  3W4O A;  3WWX A;  4DF6 A;  1QME A;  3BEC A;  1JWP A;  3D4F A;  3MZE A;  3PBS A;  3P09 A;  4K0W A;  4OQI A;  4QU3 A;  4DRT A;  4PM7 A;  4QB8 A;  1SHV A;  5DF7 A;  1BLS A;  1MPL A;  4DE0 A;  1BTL A;  2ZC3 B;  3VSL A;  1I2W A;  3MZD A;  3JYI A;  3O86 A;  4ZTK A;  5FQJ A;  3ZG7 B;  1DJC A;  3TSG A;  2JBF A;  4ZAM A;  4JLF A;  3WS5 A;  2H0T A;  4WEJ A;  5FQM A;  5GHY A;  1U60 A;  4OON A;  5HL1 A;  4R1G A;  2CC1 A;  2H5S A;  5M18 A;  1QMF A;  1IYO A;  1PYY A;  1XGJ A;  3CJM A;  4DE1 A;  2A49 A;  3N4I A;  2WAF A;  2XQZ A;  3NIA A;  2GDN A;  4FD8 A;  1MWR A;  4KQR A;  2OLV A;  1KE0 A;  4KZA A;  3HUN A;  1GHI A;  1JVJ A;  2RCX A;  1W5D A;  4E3K A;  4L0L A;  3FV7 A;  3MBZ A;  3BRM A;  5E2E A;  4S2O A;  3LO7 A;  3HLC A;  2WZX A;  4OOY A;  3GVB A;  5FAP A;  3IHA A;  3HLF A;  2A3U A;  1GA0 A;  3BFG A;  3ZCZ A;  2XLN A;  1ONG A;  2ZC5 B;  4ID4 A;  2Y2N A;  4KG2 A;  5DTS A;  5GLB A;  1YT4 A;  1KDW A;  2QZ6 A;  4LCL A;  4PPR A;  3PTE A;  4MBH A;  3HUO A;  3BLM A;  4HBT A;  3DWZ A;  3UDF A;  3BFF A;  3HUM A;  2R9W A;  1W79 A;  1K56 A;  4FH4 A;  3TOI A;  2WAE A;  1H5X A;  3MFD A;  1K57 A;  3G32 A;  1OME A;  3RXX A;  2EX9 A;  1SCW A;  4KZ6 A;  3QNB A;  2BG1 A;  1J9M A;  3IH8 A;  3G35 A;  3DWK A;  1PIO A;  3MXS A;  3NI9 A;  1PW1 A;  1HTZ A;  1I5Q A;  2XEP A;  4U0X A;  4BD0 A;  1E3U A;  1K56 D;  1E4D A;  1EI5 A;  3HLG A;  3IXG A;  3OPP A;  3M2K A;  5GLA A;  5CRF A;  2G2U A;  3E2L A;  3WS2 A;  5EPH A;  4YIN A;  1M40 A;  4FSF A;  1FQG A;  4LV0 A;  1CEF A;  1RP5 A;  4JXV A;  3IH9 A;  5M1A A;  3S4X A;  1YLZ A;  2H0Y A;  4R3B A;  4H8R A;  4U3T A;  1W7F A;  3OCL A;  2DCF A;  4GDB A;  3C4P A;  1JWV A;  1LHY A;  1TVF A;  2WKH A;  3HL9 A;  2IWC A;  1LI9 A;  3FKV A;  2Y2K A;  3LEZ A;  3SS5 A;  2J7V A;  3ITB A;  4YFM A;  1WYC A;  3NDG A;  1LL9 A;  1WYB A;  4D2O A;  5FI2 A;  4PMA A;  1FCM A;  5F83 A;  2XD5 A;  4KQO A;  3B3X A;  5FAO A;  2WZZ A;  4Y0U A;  1S6R A;  5EOO A;  1XKZ A;  1VQQ A;  5F82 A;  2ZC7 A;  4BLM A;  2ZQ8 A;  3LY4 A;  4GB7 A;  5GLD A;  4M3K A;  3UDI A;  2XF3 A;  2Y2G A;  1KGE A;  3GQZ A;  5FQQ A;  4JXW A;  1LL5 A;  4R4S A;  4R3J A;  1K54 A;  2JE5 A;  4Y0T A;  1IYS A;  1K25 A;  2WGW B;  4WZ5 A;  5CEB A;  2Y59 A;  2WGI A;  4BL3 A;  4F94 A;  1JTD A;  5A92 A;  5TGF A;  5FDH A;  1K55 A;  2ZC6 B;  4KZ5 A;  2DRW A;  4OPQ A;  1NY0 A;  3VMA A;  3IXD A;  3Q7V B;  3SH7 A;  2Z2L B;  1YLY A;  1FR6 A;  4KZ7 A;  5M19 A;  2JCH A;  4S2N A;  1NZU A;  5KSH A;  4FH2 A;  3NBL A;  2Y2Q A;  2Y2L A;  3DTM A;  1GHM A;  3PBQ A;  4JF5 A;  3P98 A;  4OPZ A;  4GD8 A;  1K6R A;  4E3O A;  4KZ9 A;  3UPO A;  4S2L A;  3I7J A;  5CTM A;  4OQ0 A;  3N8L A;  3EQU A;  3UDX A;  4K0X A;  4Y0O A;  2ZD8 A;  1DY6 A;  1Q2P A;  3BM6 A;  4RVA A;  5DTK A;  3ZVT A;  1N9B A;  5FA7 A;  1PI4 A;  3FWL A;  4RX3 A;  5HX9 A;  2P9V B;  2XR0 A;  2V20 A;  1XP4 A;  3M2J A;  4KQQ A;  5DTT A;  1YM1 A;  5AQB A;  1YMX A;  3NDE A;  3G2Z A;  4CJN A;  3LCE A;  4UAA A;  3ZHH A;  3UNW A;  1EWZ A;  3A3I A;  1MWT A;  3C4O A;  4X56 A;  3FKW A;  3ZG0 A;  3WS1 A;  1YLT A;  3ISG A;  1CI8 A;  4ZBE A;  4DXB A;  2PU2 A;  1MKI A;  4OH0 A;  5J8X A;  3HLD A;  2Q9M A;  2C5W B;  2WKE A;  3HLE A;  1E25 A;  4E3M A;  1XA1 A;  4UA9 A;  4KZ8 A;  4XUX A;  4E3N A;  4O7D A;  3IF6 B;  4GN2 A;  4IBX A;  1KGF A;  3OC2 A;  2J9O A;  1L0F A;  1G6A A;  3O88 A;  3OPL A;  1ERQ A;  5EOE A;  5KMW A;  5EVI B;  3UY6 A;  4E3L A;  2WKI A;  4KG5 A;  1G68 A;  3IWI A;  4HEF A;  3IQA A;  4B4Z A;  2V2F F;  1FSW A;  2Y2M A;  1GA9 A;  5IHV A;  1NXY A;  4Q8I A;  3G30 A;  4OVD A;  3Q81 A;  5HAI A;  1HZO A;  2EXB A;  1XX2 A;  2EX2 A;  2Y55 A;  1L0D A;  4DDS A;  5CED A;  4LCM A;  2EXA A;  3OZH A;  3V50 A;  3VOZ A;  4JPM A;  4WM9 A;  1IEM A;  3RXW A;  3TG9 A;  1LLB A;  3VFF A;  4E3I A;  5HAQ A;  5JYO A;  4B88 A;  1AXB A;  4P0M A;  2ZM2 A;  3VP3 A;  2HDU A;  5CGX A;  5FAQ A;  3CMZ A;  4EQI A;  4IVK A;  1ERM A;  4C3Q A;  3O87 A;  1L0G A;  4JXG A;  4N1X A;  4ZJ3 A;  1MY8 A;  1W8Q A;  1RGY A;  2XFT A;  1L0E A;  4FCF A;  3ZFZ A;  3UPP A;  1BLH A;  3HLW A;  1K6S A;  1PWC A;  3ITA A;  5L2F A;  4BL2 A;  3HBR A;  1ONH A;  1ESU A;  2HDR A;  4OOM A;  5AQ9 A;  2I72 A;  3A3J A;  4BD1 A;  4PM8 A;  5FI7 A;  4EUZ A;  4QJG A;  1E3U D;  2H10 A;  2Y2I A;  1NYM A;  2HP9 A;  2Y2O A;  4KEN B;  1BUL A;  3PAG A;  2V1Z A;  4X55 A;  5CTN A;  4RA7 A;  3ZDJ A;  1KE3 A;  5CHM A;  5A90 A;  4XXR A;  1NRF A;  3NY4 A;  2HDQ A;  1CEG A;  3ZVW A;  3DW0 A;  3GMW A;  3G4P A;  4EBN A;  5KZH A;  5EE8 A;  1YMS A;  2ZC4 B;  3IF6 C;  4LV3 A;  3C5A A;  2EFU A;  1PW8 A;  1ERO A;  3VP0 A;  4BEN A;  1ALQ A;  5E43 A;  4KZB A;  1KE4 A;  1IYP A;  3BFC A;  3E2K A;  3PBN A;  1PZO A;  5CEC A;  5EVI C;  3WRZ A;  4LV1 A;  4N92 A;  4WEK A;  2E8I A;  1O07 A;  3C7V A;  4S2I A;  1JTG A;  2IWB A;  4OQG A;  2JC7 A;  2DNS A;  3M6H A;  1N4O A;  1FSY A;  3QHY A;  4Y7P A;  3IXH A;  3ZG8 B;  1PWG A;  4JF6 A;  4PM5 A;  4C6Y A;  4QHC A;  4OP5 A;  4P85 A;  3S22 A;  3NCK A;  4X53 A;  3LY3 A;  4OP8 A;  1MBL A;  1XPB A;  3BLS A;  5A93 A;  5I94 A;  3FZC A;  2ZQ7 A;  3NC8 A;  4S2P A;  4S2K A;  1GCE A;  3AGF A;  5BOH A;  4BQM A;  4OKP A;  3A3E A;  4HBU A;  1H8Z A;  3RJU A;  1FOF A;  4WZ4 A;  3VOY A;  5FI6 A;  1GHP A;  3G34 A;  3PBO A;  2ZMA A;  1WE4 A;  2EX8 A;  5DF9 A;  2UWX A;  5FQ9 A;  4E6W A;  1KVL A;  3WS4 A;  5TR7 A;  2HPB A;  5F1F A;  3N8S A;  3MKF A;  1NZO A;  5DF8 A;  1FCN A;  5KSC A;  5HFO A;  3CZD A;  1Q2Q A;  3ZNY A;  1NJ4 A;  2FFY A;  4ZJ1 A;  3V3S A;  2FFF B;  4B4X A;  4MBF A;  2OSU A;  1K4F A;  1IKI A;  4WBG A;  2XD1 A;  4JXS A;  1ZG6 A;  2HP6 A;  1C3B A;  2X01 A;  4R0Q A;  3IWQ A;  4X69 A;  1HVB A;  3QNC A;  3W8K A;  1IEL A;  4NET A;  1VM1 A;  3GV9 A;  4X68 A;  1RCJ A;  4R23 A;  3HLB A;  3V3R A;  2Z2M B;  1LI0 A;  3BYD A;  3GRJ A;  5GLC A;  5HW3 A;  1DJB A;  5GHZ A;  4DE3 A;  3CG5 A;  4WMC A;  3PBT A;  4EWF A;  4Z9Q A;  1SKF A;  1K4E A;  4NK3 A;  2OV5 A;  3MKE A;  2EX6 A;  2OLU A;  1FR1 A;  3G31 A; 
#chains in the Genus database with same CATH topology
 4BBT A;  1SZV A;  3O3V A;  1NWZ A;  3ZGA B;  2GZA A;  2VJW A;  1W8Y A;  4N9K A;  4OPR A;  4E3J A;  1K57 C;  3LIE A;  4N1H A;  3VP1 A;  3W4Q A;  4KQD A;  1DJA A;  3L7H A;  4EBP A;  4QY5 A;  3MXR A;  2XK1 A;  3RTY A;  4GNU A;  5JYP A;  3VFH A;  1VET B;  4B9O A;  1SDE A;  1CI9 A;  1NYY A;  2VGK A;  5K5B A;  1TD5 A;  2HDS A;  4MMN A;  2ZQC A;  3AGD A;  3WRT A;  3OPH A;  3E0Y A;  4HQA A;  3H7W A;  3V39 A;  3A0R A;  4BJP A;  3K3D A;  1P9W A;  4DXC A;  3P01 A;  4EV4 A;  2WKQ A;  3FYZ A;  3A3F A;  3AGE A;  1S4S A;  5DVA A;  1CK3 A;  3OPR A;  1XJ4 A;  1PWD A;  1Y54 A;  1TEM A;  5FAS A;  3M6B A;  1K55 C;  5A91 A;  4GZB A;  5FQK A;  4R4R A;  4OOL A;  5HAP A;  2B02 A;  1ES4 A;  3BFD A;  5EVI A;  3C8C A;  5HL6 A;  1BSG A;  3MQO A;  3G2Y A;  2OAP 1;  3T4O A;  3IS2 B;  1TDL A;  3IHB A;  3UPN A;  1O7E A;  3W4P A;  4LEN A;  1BZA A;  3VE4 A;  5FQI A;  2Y2P A;  4KZ3 A;  2BAS A;  1ES5 A;  1S0W A;  3IT9 A;  1TDG A;  3W4O A;  1QME A;  1JWP A;  4DRT A;  3PBS A;  4HI4 A;  4PM7 A;  5DF7 A;  3IX3 A;  1I2W A;  3ZG7 B;  4ZAM A;  2H0T A;  4WEJ A;  5J4E A;  2D01 A;  4OON A;  5HL1 A;  2H5S A;  1QMF A;  2A49 A;  3NIA A;  4KQR A;  4HJ4 A;  3MBZ A;  3BRM A;  5E2E A;  4S2O A;  4F3L A;  2WZX A;  3E4Q A;  3BFG A;  1IFQ A;  1ONG A;  5GLB A;  4R6L A;  2QZ6 A;  4LCL A;  2O9A A;  2DMW A;  1ACF A;  4GHI A;  3EWK A;  1TS8 A;  4HH3 A;  1W79 A;  4H6J A;  3DBA A;  3RXX A;  3IH8 A;  3G35 A;  5A8B A;  3DWK A;  1PIO A;  1PW1 A;  1HTZ A;  5J7E A;  4U0X A;  1E3U A;  1EI5 A;  4ME4 A;  3ZQ5 A;  4BWI A;  2V0U A;  1FQG A;  4GS9 B;  1CEF A;  4R3B A;  2OWJ A;  3OCL A;  1OT9 A;  2Q0O A;  3C4P A;  2CMN A;  1JWV A;  1LHY A;  1TVF A;  3HL9 A;  3UB8 A;  2Y2K A;  3LEZ A;  1N9O A;  4DMZ A;  3QP4 A;  4D2O A;  1F98 A;  1FIK A;  4PMA A;  4HY8 A;  2WZZ A;  5EOO A;  4ETX A;  2ZC7 A;  1CF0 A;  2ZQ8 A;  1P9R A;  1L3L A;  2FH5 A;  1LL5 A;  1K54 A;  1XJ6 A;  2R78 A;  1K25 A;  4CLC A;  5CEB A;  2GJ3 A;  4KZ5 A;  3LR5 A;  1NY0 A;  3VMA A;  3T12 B;  4DN0 A;  2Z2L B;  5M19 A;  2JCH A;  4S2N A;  2V8F A;  3H7W B;  3LIC A;  1IOU A;  2Y2L A;  3PBQ A;  1MC0 A;  2W3H A;  3UMD A;  3N8L A;  3UDX A;  1Q2P A;  4RVA A;  1N9B A;  3SZT A;  3CPT A;  2XR0 A;  4GLQ A;  1YMX A;  5HZH A;  1MWT A;  3ZG0 A;  4ZBE A;  4DXB A;  1MKI A;  3UB5 P;  3PHY A;  4UA9 A;  4KZ8 A;  4E3N A;  4GN2 A;  4EU0 A;  4YOF A;  1X0O A;  5DFY A;  1OTE A;  3OPL A;  5EVI B;  1G68 A;  3IQA A;  3T50 A;  2Y2M A;  1GA9 A;  1NXY A;  4Q8I A;  5L07 A;  4DDS A;  4DJ2 A;  4B93 A;  4LCM A;  5HDS A;  3V50 A;  3VFF A;  1Y28 A;  1NLY A;  4FUW A;  3D72 A;  2YKF A;  2J80 A;  4ZJ3 A;  1BLH A;  1K6S A;  1OT6 A;  5L2F A;  2LB9 A;  4BL2 A;  1ESU A;  1TS7 A;  2HDR A;  4OOM A;  1BUL A;  3NUL A;  2PAV P;  4G3W A;  1KE3 A;  3ZVW A;  3GMW A;  4F3L B;  1ODV A;  4EBN A;  3G6O A;  4D60 A;  1YMS A;  2ZC4 B;  2VV8 A;  4IJG A;  4Y5F A;  1PW8 A;  3VP0 A;  4EW7 A;  5E43 A;  4KZB A;  2ZMV A;  1IYP A;  5EVI C;  4N92 A;  4O8G A;  2W3D A;  2E8I A;  4PHT A;  4GHI B;  2EWW A;  1JTG A;  2IWB A;  3M6H A;  1FSY A;  3T1R A;  3QHY A;  4E04 A;  3IXH A;  4H6J B;  5HSQ A;  4JF6 A;  3LY3 A;  4OP8 A;  1MBL A;  5C5K A;  3AGF A;  5BOH A;  3T1S A;  4OKP A;  4NEE D;  3RJU A;  4WZ4 A;  3VOY A;  2NUT C;  1GHP A;  3HJI A;  3PBO A;  1KVL A;  5F1F A;  3N8S A;  5KSC A;  5HFO A;  3CZD A;  3ZNY A;  3VV4 A;  4B4X A;  4MBF A;  2OSU A;  2PD7 A;  2M7V A;  3QNC A;  1IEL A;  2VV7 A;  3HLB A;  4R23 A;  2Z2M B;  1DJB A;  1JNU A;  2AVX A;  4IUH A;  4XT2 A;  1N9N A;  4MN6 A;  4HJ6 A;  3GTC A;  4OLD A;  4CLC B;  1J3W A;  3UE1 A;  1IKG A;  2PDR A;  4WMC D;  1ZKJ A;  3Q7Z A;  5F1G A;  1UWP X;  2P74 A;  4C75 A;  1BUE A;  5GHX A;  3ZNT A;  4PM9 A;  5CHU A;  4IED A;  4DE2 A;  4LV2 A;  3R7W A;  1UWN X;  4XUZ A;  1KVM A;  2WGW A;  3QP6 A;  1T1A A;  3CPT B;  4JKT A;  4YWZ A;  3SS4 A;  4QY6 A;  3EEH A;  1N9L A;  3Q7V A;  4N9L A;  5DKL A;  5CER A;  5HPF A;  5D3O A;  1BLC A;  2VGJ A;  3H82 A;  2BLS A;  4LRY C;  3A3D A;  1YQS A;  5TFQ A;  3MS6 A;  2ZM8 A;  1FIL A;  3TRC A;  1T1C A;  5CXW A;  4HES A;  1ES2 A;  3LR3 A;  1CQA A;  2XH9 A;  4RX2 A;  4P6B A;  2VZW A;  2PBD P;  1K54 C;  3SOI A;  4WYY A;  5FAT A;  5U47 A;  4X6T A;  4GD6 A;  4CLC C;  2VV6 A;  2ZJ9 A;  4P87 A;  4ZDX A;  1VHM A;  1RGZ A;  4S2N C;  1OTA A;  5GL9 A;  4EEP A;  1BLP A;  3VP4 A;  4MEZ A;  5HWV A;  1XGI A;  1H8Y A;  3N8R A;  5MC7 A;  5EVI D;  4WEL A;  4KZ4 A;  4NG2 A;  4QD4 A;  2WK0 A;  2ZQD A;  2WYX A;  2XDM A;  3IF5 A;  3GDI A;  2OWH A;  2Z6D A;  4Y2F A;  4DF6 A;  3BEC A;  3MZE A;  4EES A;  3FPW A;  1MPL A;  1BTL A;  3MZD A;  3O86 A;  1DJC A;  3TSG A;  4JLF A;  5FEG A;  5IU1 A;  2CC1 A;  1IYO A;  3CJM A;  3N4I A;  4FD8 A;  1MWR A;  3NHQ A;  1KE0 A;  1HLU P;  3HUN A;  1JVJ A;  2RCX A;  5IT5 A;  3CUE A;  3HLC A;  4OOY A;  1YPR A;  3GVB A;  5FAP A;  1GSW A;  3HLF A;  4O0P A;  1V9Y A;  2XLN A;  3NOT C;  4ID4 A;  5DTS A;  1YT4 A;  1KDW A;  1XFQ A;  4AFI A;  3H9W A;  4MBH A;  3BLM A;  4HBT A;  3UDF A;  3HUM A;  2WAE A;  3MFD A;  2EX9 A;  3QNB A;  1J9M A;  2XA7 M;  5HDD A;  4EQ1 A;  1F9I A;  3MXS A;  4WUJ A;  1D7E A;  5EFW A;  5FEF A;  2JKR I;  3CAX A;  3OPP A;  3M2K A;  4WLA A;  5GLA A;  3BY9 A;  5CRF A;  5L10 A;  2YKH A;  5EPH A;  1M40 A;  3BW6 A;  4FSF A;  4JXV A;  5M1A A;  3FG8 A;  4XT2 B;  1W7F A;  4ARZ A;  2QHK A;  2DCF A;  4NXE A;  4GDB A;  4Y17 A;  1LI9 A;  3PYP A;  3SS5 A;  2W1T A;  3CI6 A;  1WYC A;  2WKP A;  1YSP A;  1LL9 A;  3F1P A;  1T1B A;  3KSG A;  3T4Q A;  3PXP A;  1NRJ A;  1S1Y A;  3LEQ A;  3S7O A;  1VQQ A;  4X25 A;  3K2N A;  3LY4 A;  1VB6 A;  5GLD A;  2XF3 A;  2J3T D;  2HJE A;  1KGE A;  3GQZ A;  1STZ A;  4JXW A;  4R4S A;  2QKP A;  3R7W B;  2JE5 A;  4Y0T A;  2WGW B;  4IHQ A;  4ZRR A;  2JN7 A;  1JTD A;  5A92 A;  5TGF A;  4LRX C;  1TS6 A;  2DRW A;  4OPQ A;  3Q7V B;  1YLY A;  1FR6 A;  4KZ7 A;  5AJG A;  3LGO A;  3H82 B;  2W3E A;  4HH2 A;  2Y2Q A;  4CLC D;  1GHM A;  4JF5 A;  3P98 A;  4E3O A;  5CTM A;  3UB7 A;  4OQ0 A;  4M4X A;  3EQU A;  2ZD8 A;  3F1N A;  5DTK A;  5FA7 A;  3FWL A;  1OJ5 A;  3KX0 X;  4KQQ A;  2M7U A;  4CJN A;  3LCE A;  3UNW A;  3FKW A;  1YLT A;  4JGP A;  1TF1 A;  2C5W B;  3HLE A;  5EVE A;  4XUX A;  4I39 A;  3UE6 A;  4IBX A;  2J9O A;  5HPI A;  1L0F A;  2W3F A;  2EA9 A;  1LT0 A;  5AVE A;  5EOE A;  5KMW A;  3UY6 A;  4EUV A;  3G30 A;  4OVD A;  5HAI A;  2EXB A;  3MR0 A;  4JPM A;  4WM9 A;  4WL9 A;  5HAQ A;  3LFV A;  1AXB A;  4P0M A;  2ZM2 A;  2L0W A;  3VP3 A;  1V9Z A;  4EQI A;  4C3Q A;  4UQI M;  1L0G A;  1DP8 A;  3A0S A;  3U2A A;  2XFT A;  1L0E A;  2MJ6 A;  3HLW A;  3LYX A;  2PR5 A;  3HBR A;  5AQ9 A;  4BD1 A;  4EUZ A;  4HP9 A;  3DTI A;  2HP9 A;  3PAG A;  3VOL A;  5CHM A;  1OTI A;  4XXR A;  1NRF A;  2HDQ A;  1CEG A;  2KX6 A;  2Z6C A;  5KZH A;  5EE8 A;  2V1B A;  4LV3 A;  1D1J A;  1AWI A;  1ALQ A;  3HJK A;  3BFC A;  4LV1 A;  4WEK A;  4EER A;  3C7V A;  1S66 L;  5F5Y A;  1OJG A;  2JC7 A;  3BQ8 A;  4PM5 A;  5F6A A;  3S22 A;  2VA0 A;  3BLS A;  4HP4 A;  4LGW A;  1FOF A;  3G34 A;  1WE4 A;  3EGX C;  2UWX A;  5FQ9 A;  1NZO A;  1Q2Q A;  4ARZ B;  2FFY A;  4ZJ1 A;  3V3S A;  4Y3I A;  1F5M A;  1C3B A;  4R0Q A;  1HVB A;  3F1P B;  3W8K A;  1KOU A;  4EXO A;  4WN5 A;  4R38 A;  1RCJ A;  3BYD A;  3CUE C;  5GLC A;  2OAQ 1;  5HW3 A;  3U4L P;  5GHZ A;  3NEC A;  4DE3 A;  3BQA A;  4Z9Q A;  1OPX A;  1FR1 A;  3G31 A;  4E6X A;  5HWT A;  3E98 A;  3HVF A;  2ZMF A;  1PZP A;  5CHJ A;  2KDK A;  1K0K A;  1EW0 A;  4JF4 A;  1H8M A;  2Y2H A;  4A5R A;  2ZOH A;  2QMI A;  3S7P A;  2LB5 A;  2PHY A;  4Q0H A;  2V9A A;  2J9P A;  5HAR A;  4LLO B;  1P97 A;  4JGQ A;  3T4T A;  1BT5 A;  4UA7 A;  1K38 A;  4X1M A;  3D9Y A;  5EM1 A;  4ZJ2 A;  4OPY A;  3F1N B;  3NOU C;  4KUO A;  3FPV A;  5FL3 A;  3IXB A;  4OLG A;  1MXO A;  1W63 M;  2QYB A;  3EGD C;  1XXM A;  3IWO A;  3N6I A;  2VLG A;  1LSW A;  4DKI A;  2WUQ A;  3PAE A;  5FSR A;  4OQH A;  4UHU A;  4R3A A;  3SS3 A;  2B5R A;  1MWS A;  2X02 A;  2JKR M;  4I3I A;  1M6K A;  5CGS A;  2HV1 A;  2P08 A;  3V5M A;  2EWV A;  5CGW A;  3UO9 A;  4L9G A;  2P9V A;  1LSV A;  5DJU A;  4GDN A;  2X71 A;  3OCN A;  1OTD A;  1S67 L;  2PRF A;  5E2G A;  1KGG A;  3ZG5 A;  4WF0 A;  3F1O A;  2ZM0 A;  4HNB A;  2HJ9 C;  2XA7 S;  2Y4A A;  1XJ2 A;  1YLP A;  1FCO A;  3MZF A;  3MFX A;  3UB9 A;  1YLW A;  1ZG4 A;  3ZG9 B;  1XA7 A;  5EUA A;  4HJ3 A;  4I38 A;  1BYW A;  4CLC E;  2PU4 A;  4UA6 A;  3Q07 A;  3WS0 A;  4HIA A;  1PI5 A;  3BWL A;  2G2W A;  2ZBB A;  3WWX A;  1PRQ A;  3D4F A;  4K0W A;  5DTT A;  4OQI A;  3MXQ A;  4QB8 A;  3TE8 A;  2ZC3 B;  3TJZ C;  3VSL A;  4ZTK A;  5FQJ A;  5FQM A;  2K31 A;  4R1G A;  5M18 A;  1Y4O A;  1PYY A;  3KYE A;  5G4Z A;  2Y8H A;  2OLV A;  5KIZ A;  2PD8 A;  2PT7 A;  3FV7 A;  3LO7 A;  3BY8 A;  2ZL1 A;  1GA0 A;  3ZCZ A;  2ZC5 B;  4Y13 A;  4PPR A;  2J3W A;  1Z09 A;  3PTE A;  4MN5 A;  5DFX A;  3HUO A;  2P04 A;  2JKG A;  3BFF A;  3KYZ A;  2R9W A;  4FH4 A;  1K56 A;  3TOI A;  1H5X A;  1OME A;  2E8J A;  2VKS A;  1SCW A;  2BG1 A;  2JKT M;  4G3V A;  3NI9 A;  2XEP A;  4MN7 A;  3IXG A;  3HLG A;  2W3G A;  2P7J A;  4RQ9 A;  2G2U A;  3LR0 A;  5F68 A;  1RP5 A;  1YLZ A;  4H8R A;  2H28 A;  4U3T A;  4L9E A;  2WKH A;  3FKV A;  4YFM A;  3OBF A;  5F83 A;  2XD5 A;  1H3Q A;  4KQO A;  5FAO A;  1S6R A;  1XKZ A;  5F82 A;  4GCZ A;  4P6Z M;  4M3K A;  2Y2G A;  1GSV A;  3C38 A;  5FQQ A;  1YKD A;  4R3J A;  1IYS A;  3V67 A;  4WZ5 A;  2Y59 A;  4F94 A;  4UQI S;  2ZC6 B;  1TS0 A;  3IXD A;  5KSH A;  2PYR A;  4FH2 A;  3NBL A;  3DTM A;  4GD8 A;  3KSH A;  3LUQ A;  3ICY A;  3UPO A;  3I7J A;  4Y0O A;  3BM6 A;  3ZVT A;  1PI4 A;  4G3K A;  4RX3 A;  4PAU A;  2P9V B;  3KSF A;  5HX9 A;  1XP4 A;  2FZ0 A;  3NDE A;  4HOI A;  1G6O A;  1EWZ A;  3A3I A;  5I5L A;  3ISG A;  3MF0 A;  3KSI A;  4OH0 A;  3LIA A;  3UB6 A;  4LPZ A;  4PKY G;  3C30 A;  3HLD A;  4QPR A;  2Q9M A;  2WKE A;  1XA1 A;  3L9K A;  4O7D A;  2IA2 A;  2QWS A;  1KGF A;  3OC2 A;  3F1O B;  4JGR A;  1G6A A;  1ERQ A;  2BTF P;  4Z1W A;  4KG5 A;  2V2F F;  1FSW A;  5IHV A;  3JPU A;  1HZO A;  1XX2 A;  2Y55 A;  5CED A;  2B95 A;  3DTK A;  2EXA A;  3OZH A;  3VOZ A;  1IEM A;  3RXW A;  1P0Z A;  4E3I A;  3T1X A;  4B88 A;  2VGL M;  3IBR A;  2HDU A;  3CMZ A;  1MZU A;  3OOV A;  4N1X A;  1RGY A;  2I9V A;  1S1Z A;  4FCF A;  3ZFZ A;  3UPP A;  3ITA A;  4GW9 A;  2B18 A;  4BBV A;  1ONH A;  1F2K A;  3A3J A;  4PM8 A;  5FI7 A;  4QJG A;  1E3U D;  2Y2I A;  1NYM A;  4HHD A;  2V1Z A;  5IS1 A;  3CHW P;  4NXF A;  3ZDJ A;  5A90 A;  3NY4 A;  3T1Q B;  3G4P A;  3BJN A;  4NXB A;  2NUP C;  1DRM A;  2ZL1 B;  2HF6 A;  3C5A A;  3LI9 A;  4EET B;  1KE4 A;  5CEC A;  1PZO A;  3WRZ A;  5TBM A;  1O07 A;  5DJT A;  4S2I A;  4OQG A;  4L9F A;  3EOI A;  3LIF A;  4Y7P A;  3MSH A;  2K7S A;  2V8C A;  4OP5 A;  4P85 A;  2ACG A;  3NCK A;  5HD5 A;  1XPB A;  5A93 A;  5I94 A;  3FZC A;  2ZQ7 A;  1G28 A;  4S2P A;  5L09 A;  4BQM A;  4HBU A;  1H8Z A;  4I3J A;  1ZHH B;  2ZMA A;  2EX8 A;  5DF9 A;  4GJ4 A;  3RFB A;  5TR7 A;  1H0M A;  5L8M A;  1NJ4 A;  2FFF B;  3HCY A;  1IKI A;  2XD1 A;  1ZG6 A;  2HP6 A;  2X01 A;  3E4O A;  3IWQ A;  2G7U A;  2L1M A;  3SW1 A;  3GV9 A;  1LL8 A;  4X68 A;  3T4L A;  1LI0 A;  3GRJ A;  3B33 A;  2K2N A;  3RH8 B;  3CG5 A;  2PYP A;  3TW8 A;  1SKF A;  1K4E A;  4FOF A;  2EX6 A;  2OLU A;  4KG6 A;  5LBR A;  2QPN A;  2PBY A;  5E2F A;  5J3W A;  1YAX A;  2XGN A;  4MBK A;  2VEA A;  1Z6F A;  2JKT I;  3N7W A;  1VEU A;  3QP8 A;  3ULF A;  3E4P A;  2O99 A;  2Q9N A;  3SH8 A;  1YLJ A;  2Y91 A;  4IVI A;  1HD8 A;  2JKF A;  5EEC A;  2M1C A;  3IX8 A;  1ES3 A;  2O9C A;  4RYE A;  2HP5 A;  5G4Y A;  1L2S A;  2Y2J A;  4U0T A;  1ZC2 A;  1ESI A;  4S2J A;  3GSG A;  5HD3 A;  3UN7 A;  4CPK A;  5AQA A;  5E2H A;  3R4K A;  4FTX A;  1MWU A;  2WAD A;  1NLZ A;  3PBR A;  3Q82 A;  4IUK A;  1T19 A;  2ZLY A;  3BFE A;  2D02 A;  2C6W B;  2ZQ9 A;  4IBR A;  2WGV A;  2EFX A;  3UE3 A;  2RL3 A;  4Y15 A;  4K91 A;  3LID A;  1T18 A;  3BEB A;  5TJJ A;  3SH9 A;  2J8Y A;  4MLL A;  3VP2 A;  4PM6 A;  2ZQA A;  3HRE A;  4JBF A;  2VK3 A;  3LR4 A;  4EBL A;  4WZ5 C;  3MQQ A;  4I3A A;  4LFU A;  3LI8 A;  2IWD A;  1IYQ A;  3IF6 A;  3T4K A;  3S1Y A;  4GKU A;  3UE0 A;  1I2S A;  5HDC A;  4YNR A;  3Q1F A;  2R9X A;  5AQ7 A;  2GNX A;  2XFS A;  3GR2 A;  4MNR A;  1SDN A;  4LRZ E;  2JHE A;  3IBJ A;  1KDS A;  3VSK A;  5G18 A;  4S2M A;  3EQV A;  2W1T B;  2UV0 E;  3CWF A;  4DDY A;  1SKO A;  4GOG A;  3OLO A;  1JWZ A;  3CLO A;  1PFL A;  3C7U A;  4QU3 A;  3P09 A;  1SHV A;  1BLS A;  4DE0 A;  4BMW A;  3JYI A;  5TBM B;  2JBF A;  3WS5 A;  4P6Z S;  5GHY A;  1U60 A;  2QJ5 A;  3T4S A;  1LSX A;  1XGJ A;  4DE1 A;  2WAF A;  2XQZ A;  2GDN A;  2W27 A;  5DKK A;  4ETZ A;  4KZA A;  4R70 A;  1GHI A;  4E3K A;  1W5D A;  4L0L A;  3S7Q A;  3IHA A;  2A3U A;  2XRN A;  4KG2 A;  2Y2N A;  1CJF A;  2A24 A;  2A2L A;  3ZYT A;  1W63 Q;  3DWZ A;  3KO6 A;  2WKR A;  4ESP A;  2XSS A;  1K57 A;  3G32 A;  4KZ6 A;  3QP5 A;  1GSX A;  1WA9 A;  3P7N A;  2V1A A;  4NKP A;  1I5Q A;  3A0V A;  2XRO A;  4BD0 A;  1K56 D;  1E4D A;  3QP2 A;  1XFN A;  3E2L A;  3WS2 A;  1UGU A;  4YIN A;  4LV0 A;  3IH9 A;  3S4X A;  2QJ7 A;  4PKY A;  2H0Y A;  2IWC A;  3NJA A;  2J7V A;  3ITB A;  3NDG A;  2KOI A;  4DJ3 A;  1WYB A;  5CX7 A;  5FI2 A;  1FCM A;  1VEU B;  3KYQ A;  3B3X A;  4Y0U A;  3MJQ A;  4BLM A;  4GB7 A;  4Q0J A;  3UDI A;  3IX4 A;  4MDZ A;  3JVV A;  2O0Y A;  1OTB A;  3B42 A;  1S4R A;  4X1L A;  2VGL S;  5AVF A;  3S7N A;  2WGI A;  4JGO A;  4BL3 A;  3EEA A;  2V0W A;  5FDH A;  1K55 A;  3SH7 A;  1NZU A;  4Q0I A;  2OOL A;  4OPZ A;  1K6R A;  2KLI A;  4KZ9 A;  4S2L A;  1VET A;  5F69 A;  4K0X A;  4O01 A;  1DY6 A;  2HGV A;  4I5S A;  2V20 A;  3M2J A;  5AQB A;  5EVL A;  1YM1 A;  3G2Z A;  2L4R A;  4UAA A;  3ZHH A;  4X56 A;  3C4O A;  3WS1 A;  1D06 A;  3GEC A;  1CI8 A;  2O9B A;  2PU2 A;  5J8X A;  3MQ0 A;  3C2W A;  1E25 A;  4E3M A;  3IF6 B;  3QP1 A;  4K08 A;  3D3O A;  4KUK A;  3O88 A;  4E3L A;  2WKI A;  3IWI A;  4HEF A;  4B4Z A;  3PR6 A;  3Q81 A;  1MKM A;  2EX2 A;  2INW A;  1L0D A;  3W2Z A;  3TG9 A;  1LLB A;  3DAV A;  1A0K A;  5JYO A;  1SKO B;  2HZ5 A;  5CGX A;  5FAQ A;  4IVK A;  2PR6 A;  1ERM A;  3B47 A;  3O87 A;  4JXG A;  5FDS A;  1MY8 A;  1W8Q A;  3IS2 A;  1PWC A;  2W1R A;  1ZTU A;  2I72 A;  1DP9 A;  2H10 A;  4KEN B;  2Y2O A;  2ZOI A;  1G5U A;  4X55 A;  5CTN A;  4RA7 A;  5EM0 A;  2J3T C;  4BBU A;  4UEY A;  3DW0 A;  3IF6 C;  4BEN A;  2EFU A;  3T4J A;  1ERO A;  1PNE A;  3PBN A;  3E2K A;  4II7 A;  2A24 B;  3UME A;  2DNS A;  1N4O A;  3LIB A;  3ZG8 B;  1PWG A;  3O5Y A;  4C6Y A;  4QHC A;  4X53 A;  3VE3 A;  3NOP C;  3NC8 A;  2GX5 A;  1YSQ A;  3DTE A;  4S2K A;  1GCE A;  1DP6 A;  4MCW A;  3A3E A;  5FI6 A;  4E6W A;  3MMH A;  3WS4 A;  5EV0 A;  4EEU A;  2HPB A;  3MKF A;  5DF8 A;  1FCN A;  2VX8 A;  1XJ3 A;  4NXG A;  1K4F A;  2W0N A;  3JVU A;  4WBG A;  4JXS A;  4X69 A;  5HWW A;  4NET A;  1VM1 A;  3FC7 A;  3V3R A;  4WMC A;  3CIT A;  3PBT A;  4QWO A;  4EWF A;  4GS9 A;  4NK3 A;  2Y79 A;  3MKE A;  2OV5 A;  3K3C A;  4CQH A; 
#chains in the Genus database with same CATH homology
 2QPN A;  3GTC A;  2PBY A;  3HVF A;  5E2F A;  1PZP A;  4OLD A;  5CHJ A;  3O3V A;  3ZGA B;  4JF4 A;  2Y2H A;  3UE1 A;  1IKG A;  4A5R A;  4WMC D;  2QMI A;  1W8Y A;  4N9K A;  4OPR A;  2XGN A;  1ZKJ A;  4MBK A;  4E3J A;  1K57 C;  3VP1 A;  4N1H A;  3W4Q A;  1Z6F A;  3N7W A;  3Q7Z A;  5F1G A;  2Q9N A;  1DJA A;  2P74 A;  4EBP A;  4QY5 A;  3SH8 A;  1YLJ A;  2J9P A;  2Y91 A;  4IVI A;  5HAR A;  1HD8 A;  3MXR A;  5EEC A;  4C75 A;  1ES3 A;  1BUE A;  2XK1 A;  4RYE A;  5GHX A;  4GNU A;  2HP5 A;  3ZNT A;  4PM9 A;  1L2S A;  5CHU A;  2Y2J A;  4IED A;  4DE2 A;  4LV2 A;  1BT5 A;  4UA7 A;  1K38 A;  4E6X A;  5JYP A;  3VFH A;  4ZJ2 A;  4OPY A;  4U0T A;  1ZC2 A;  4XUZ A;  1KVM A;  1SDE A;  1CI9 A;  2WGW A;  1NYY A;  2VGK A;  1ESI A;  3IXB A;  4JKT A;  4OLG A;  1MXO A;  4S2J A;  3GSG A;  3SS4 A;  2HDS A;  1XXM A;  3IWO A;  2ZQC A;  3AGD A;  4QY6 A;  5AQA A;  3N6I A;  3UN7 A;  4CPK A;  5E2H A;  3WRT A;  3OPH A;  3Q7V A;  4N9L A;  1MWU A;  2WAD A;  5CER A;  4DKI A;  5D3O A;  3PBR A;  1BLC A;  3Q82 A;  2WUQ A;  2VGJ A;  2BLS A;  3PAE A;  5FSR A;  2ZLY A;  3BFE A;  4OQH A;  4UHU A;  2C6W B;  3A3D A;  1YQS A;  2B5R A;  3SS3 A;  3V39 A;  1MWS A;  2ZQ9 A;  4IBR A;  2WGV A;  2X02 A;  5TFQ A;  2EFX A;  2ZM8 A;  1M6K A;  5CGS A;  3UE3 A;  4BJP A;  2RL3 A;  4K91 A;  5CXW A;  4HES A;  1ES2 A;  3BEB A;  3SH9 A;  2J8Y A;  4DXC A;  3V5M A;  4EV4 A;  4MLL A;  2XH9 A;  4RX2 A;  5CGW A;  3UO9 A;  4P6B A;  4PM6 A;  3FYZ A;  3A3F A;  3VP2 A;  3AGE A;  2P9V A;  2ZQA A;  5DVA A;  1CK3 A;  3HRE A;  3OPR A;  1K54 C;  3SOI A;  4WYY A;  4JBF A;  5FAT A;  5U47 A;  4X6T A;  4GD6 A;  4GDN A;  4EBL A;  2X71 A;  3OCN A;  4WZ5 C;  1PWD A;  1Y54 A;  1TEM A;  5FAS A;  2ZJ9 A;  3M6B A;  5E2G A;  1K55 C;  5A91 A;  2IWD A;  4P87 A;  4GZB A;  5FQK A;  4ZDX A;  1KGG A;  4R4R A;  4OOL A;  5HAP A;  3ZG5 A;  1RGZ A;  1IYQ A;  3IF6 A;  4S2N C;  3S1Y A;  2ZM0 A;  4GKU A;  5GL9 A;  3UE0 A;  1I2S A;  3Q1F A;  4KG6 A;  2R9X A;  1ES4 A;  3BFD A;  5EVI A;  1BLP A;  5AQ7 A;  2XFS A;  1BSG A;  3VP4 A;  3GR2 A;  2Y4A A;  5EVL A;  4MNR A;  1SDN A;  3G2Y A;  4MEZ A;  1YLP A;  1XGI A;  1FCO A;  3MZF A;  1TDL A;  1YLW A;  3IHB A;  3UPN A;  1H8Y A;  1O7E A;  1ZG4 A;  3W4P A;  3ZG9 B;  1KDS A;  3VSK A;  1XA7 A;  3N8R A;  5EUA A;  5G18 A;  5EVI D;  4LEN A;  4S2M A;  4WEL A;  1BZA A;  4KZ4 A;  4QD4 A;  3EQV A;  5FQI A;  2PU4 A;  2Y2P A;  4UA6 A;  2WK0 A;  3Q07 A;  4KZ3 A;  2ZQD A;  3WS0 A;  1ES5 A;  1S0W A;  4DDY A;  4GOG A;  1PI5 A;  2WYX A;  3IT9 A;  2XDM A;  2G2W A;  1JWZ A;  3IF5 A;  1TDG A;  3C7U A;  3W4O A;  3WWX A;  4DF6 A;  1QME A;  3BEC A;  1JWP A;  3D4F A;  3MZE A;  3PBS A;  3P09 A;  4K0W A;  4OQI A;  4QU3 A;  4DRT A;  4PM7 A;  4QB8 A;  1SHV A;  5DF7 A;  1BLS A;  1MPL A;  4DE0 A;  1BTL A;  2ZC3 B;  3VSL A;  1I2W A;  3MZD A;  3JYI A;  3O86 A;  4ZTK A;  5FQJ A;  3ZG7 B;  1DJC A;  3TSG A;  2JBF A;  4ZAM A;  4JLF A;  3WS5 A;  2H0T A;  4WEJ A;  5FQM A;  5GHY A;  1U60 A;  4OON A;  5HL1 A;  4R1G A;  2CC1 A;  2H5S A;  5M18 A;  1QMF A;  1IYO A;  1PYY A;  1XGJ A;  3CJM A;  4DE1 A;  2A49 A;  3N4I A;  2WAF A;  2XQZ A;  3NIA A;  2GDN A;  4FD8 A;  1MWR A;  4KQR A;  2OLV A;  1KE0 A;  4KZA A;  3HUN A;  1GHI A;  1JVJ A;  2RCX A;  1W5D A;  4E3K A;  4L0L A;  3FV7 A;  3MBZ A;  3BRM A;  5E2E A;  4S2O A;  3LO7 A;  3HLC A;  2WZX A;  4OOY A;  3GVB A;  5FAP A;  3IHA A;  3HLF A;  2A3U A;  1GA0 A;  3BFG A;  3ZCZ A;  2XLN A;  1ONG A;  2ZC5 B;  4ID4 A;  2Y2N A;  4KG2 A;  5DTS A;  5GLB A;  1YT4 A;  1KDW A;  2QZ6 A;  4LCL A;  4PPR A;  3PTE A;  4MBH A;  3HUO A;  3BLM A;  4HBT A;  3DWZ A;  3UDF A;  3BFF A;  3HUM A;  2R9W A;  1W79 A;  1K56 A;  4FH4 A;  3TOI A;  2WAE A;  1H5X A;  3MFD A;  1K57 A;  3G32 A;  1OME A;  3RXX A;  2EX9 A;  1SCW A;  4KZ6 A;  3QNB A;  2BG1 A;  1J9M A;  3IH8 A;  3G35 A;  3DWK A;  1PIO A;  3MXS A;  3NI9 A;  1PW1 A;  1HTZ A;  1I5Q A;  2XEP A;  4U0X A;  4BD0 A;  1E3U A;  1K56 D;  1E4D A;  1EI5 A;  3HLG A;  3IXG A;  3OPP A;  3M2K A;  5GLA A;  5CRF A;  2G2U A;  3E2L A;  3WS2 A;  5EPH A;  4YIN A;  1M40 A;  4FSF A;  1FQG A;  4LV0 A;  1CEF A;  1RP5 A;  4JXV A;  3IH9 A;  5M1A A;  3S4X A;  1YLZ A;  2H0Y A;  4R3B A;  4H8R A;  4U3T A;  1W7F A;  3OCL A;  2DCF A;  4GDB A;  3C4P A;  1JWV A;  1LHY A;  1TVF A;  2WKH A;  3HL9 A;  2IWC A;  1LI9 A;  3FKV A;  2Y2K A;  3LEZ A;  3SS5 A;  2J7V A;  3ITB A;  4YFM A;  1WYC A;  3NDG A;  1LL9 A;  1WYB A;  4D2O A;  5FI2 A;  4PMA A;  1FCM A;  5F83 A;  2XD5 A;  4KQO A;  3B3X A;  5FAO A;  2WZZ A;  4Y0U A;  1S6R A;  5EOO A;  1XKZ A;  1VQQ A;  5F82 A;  2ZC7 A;  4BLM A;  2ZQ8 A;  3LY4 A;  4GB7 A;  5GLD A;  4M3K A;  3UDI A;  2XF3 A;  2Y2G A;  1KGE A;  3GQZ A;  5FQQ A;  4JXW A;  1LL5 A;  4R4S A;  4R3J A;  1K54 A;  2JE5 A;  4Y0T A;  1IYS A;  1K25 A;  2WGW B;  4WZ5 A;  5CEB A;  2Y59 A;  2WGI A;  4BL3 A;  4F94 A;  1JTD A;  5A92 A;  5TGF A;  5FDH A;  1K55 A;  2ZC6 B;  4KZ5 A;  2DRW A;  4OPQ A;  1NY0 A;  3VMA A;  3IXD A;  3Q7V B;  3SH7 A;  2Z2L B;  1YLY A;  1FR6 A;  4KZ7 A;  5M19 A;  2JCH A;  4S2N A;  1NZU A;  5KSH A;  4FH2 A;  3NBL A;  2Y2Q A;  2Y2L A;  3DTM A;  1GHM A;  3PBQ A;  4JF5 A;  3P98 A;  4OPZ A;  4GD8 A;  1K6R A;  4E3O A;  4KZ9 A;  3UPO A;  4S2L A;  3I7J A;  5CTM A;  4OQ0 A;  3N8L A;  3EQU A;  3UDX A;  4K0X A;  4Y0O A;  2ZD8 A;  1DY6 A;  1Q2P A;  3BM6 A;  4RVA A;  5DTK A;  3ZVT A;  1N9B A;  5FA7 A;  1PI4 A;  3FWL A;  4RX3 A;  5HX9 A;  2P9V B;  2XR0 A;  2V20 A;  1XP4 A;  3M2J A;  4KQQ A;  5DTT A;  1YM1 A;  5AQB A;  1YMX A;  3NDE A;  3G2Z A;  4CJN A;  3LCE A;  4UAA A;  3ZHH A;  3UNW A;  1EWZ A;  3A3I A;  1MWT A;  3C4O A;  4X56 A;  3FKW A;  3ZG0 A;  3WS1 A;  1YLT A;  3ISG A;  1CI8 A;  4ZBE A;  4DXB A;  2PU2 A;  1MKI A;  4OH0 A;  5J8X A;  3HLD A;  2Q9M A;  2C5W B;  2WKE A;  3HLE A;  1E25 A;  4E3M A;  1XA1 A;  4UA9 A;  4KZ8 A;  4XUX A;  4E3N A;  4O7D A;  3IF6 B;  4GN2 A;  4IBX A;  1KGF A;  3OC2 A;  2J9O A;  1L0F A;  1G6A A;  3O88 A;  3OPL A;  1ERQ A;  5EOE A;  5KMW A;  5EVI B;  3UY6 A;  4E3L A;  2WKI A;  4KG5 A;  1G68 A;  3IWI A;  4HEF A;  3IQA A;  4B4Z A;  2V2F F;  1FSW A;  2Y2M A;  1GA9 A;  5IHV A;  1NXY A;  4Q8I A;  3G30 A;  4OVD A;  3Q81 A;  5HAI A;  1HZO A;  2EXB A;  1XX2 A;  2EX2 A;  2Y55 A;  1L0D A;  4DDS A;  5CED A;  4LCM A;  2EXA A;  3OZH A;  3V50 A;  3VOZ A;  4JPM A;  4WM9 A;  1IEM A;  3RXW A;  3TG9 A;  1LLB A;  3VFF A;  4E3I A;  5HAQ A;  5JYO A;  4B88 A;  1AXB A;  4P0M A;  2ZM2 A;  3VP3 A;  2HDU A;  5CGX A;  5FAQ A;  3CMZ A;  4EQI A;  4IVK A;  1ERM A;  4C3Q A;  3O87 A;  1L0G A;  4JXG A;  4N1X A;  4ZJ3 A;  1MY8 A;  1W8Q A;  1RGY A;  2XFT A;  1L0E A;  4FCF A;  3ZFZ A;  3UPP A;  1BLH A;  3HLW A;  1K6S A;  1PWC A;  3ITA A;  5L2F A;  4BL2 A;  3HBR A;  1ONH A;  1ESU A;  2HDR A;  4OOM A;  5AQ9 A;  2I72 A;  3A3J A;  4BD1 A;  4PM8 A;  5FI7 A;  4EUZ A;  4QJG A;  1E3U D;  2H10 A;  2Y2I A;  1NYM A;  2HP9 A;  2Y2O A;  4KEN B;  1BUL A;  3PAG A;  2V1Z A;  4X55 A;  5CTN A;  4RA7 A;  3ZDJ A;  1KE3 A;  5CHM A;  5A90 A;  4XXR A;  1NRF A;  3NY4 A;  2HDQ A;  1CEG A;  3ZVW A;  3DW0 A;  3GMW A;  3G4P A;  4EBN A;  5KZH A;  5EE8 A;  1YMS A;  2ZC4 B;  3IF6 C;  4LV3 A;  3C5A A;  2EFU A;  1PW8 A;  1ERO A;  3VP0 A;  4BEN A;  1ALQ A;  5E43 A;  4KZB A;  1KE4 A;  1IYP A;  3BFC A;  3E2K A;  3PBN A;  1PZO A;  5CEC A;  5EVI C;  3WRZ A;  4LV1 A;  4N92 A;  4WEK A;  2E8I A;  1O07 A;  3C7V A;  4S2I A;  1JTG A;  2IWB A;  4OQG A;  2JC7 A;  2DNS A;  3M6H A;  1N4O A;  1FSY A;  3QHY A;  4Y7P A;  3IXH A;  3ZG8 B;  1PWG A;  4JF6 A;  4PM5 A;  4C6Y A;  4QHC A;  4OP5 A;  4P85 A;  3S22 A;  3NCK A;  4X53 A;  3LY3 A;  4OP8 A;  1MBL A;  1XPB A;  3BLS A;  5A93 A;  5I94 A;  3FZC A;  2ZQ7 A;  3NC8 A;  4S2P A;  4S2K A;  1GCE A;  3AGF A;  5BOH A;  4BQM A;  4OKP A;  3A3E A;  4HBU A;  1H8Z A;  3RJU A;  1FOF A;  4WZ4 A;  3VOY A;  5FI6 A;  1GHP A;  3G34 A;  3PBO A;  2ZMA A;  1WE4 A;  2EX8 A;  5DF9 A;  2UWX A;  5FQ9 A;  4E6W A;  1KVL A;  3WS4 A;  5TR7 A;  2HPB A;  5F1F A;  3N8S A;  3MKF A;  1NZO A;  5DF8 A;  1FCN A;  5KSC A;  5HFO A;  3CZD A;  1Q2Q A;  3ZNY A;  1NJ4 A;  2FFY A;  4ZJ1 A;  3V3S A;  2FFF B;  4B4X A;  4MBF A;  2OSU A;  1K4F A;  1IKI A;  4WBG A;  2XD1 A;  4JXS A;  1ZG6 A;  2HP6 A;  1C3B A;  2X01 A;  4R0Q A;  3IWQ A;  4X69 A;  1HVB A;  3QNC A;  3W8K A;  1IEL A;  4NET A;  1VM1 A;  3GV9 A;  4X68 A;  1RCJ A;  4R23 A;  3HLB A;  3V3R A;  2Z2M B;  1LI0 A;  3BYD A;  3GRJ A;  5GLC A;  5HW3 A;  1DJB A;  5GHZ A;  4DE3 A;  3CG5 A;  4WMC A;  3PBT A;  4EWF A;  4Z9Q A;  1SKF A;  1K4E A;  4NK3 A;  2OV5 A;  3MKE A;  2EX6 A;  2OLU A;  1FR1 A;  3G31 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...