4DDYA

Ctx-m-9 class a beta-lactamase complexed with compound 10
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
260
structure length
260
Chain Sequence
AVQQKLAALEKSSGGRLGVALIDTADNTQVLYRGDERFPMCSTSKVMAAAAVLKQSETQKQLLNQPVEIKPADLVNYNPIAEKHVNGTMTLAELSAAALQYSDNTAMNKLIAQLGGPGGVTAFARAIGDETFRLDRTEPTLNTAIPGDPRDTTTPRAMAQTLRQLTLGHALGETQRAQLVTWLKGNTTGAASIRAGLPTSWTAGDKTGSGDYGTTNDIAVIWPQGRAPLVLVTYFTQPQQNAESRRDVLASAARIIAEGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Beta-lactamase
publication title Structure-Based Design of Potent and Ligand-Efficient Inhibitors of CTX-M Class A Beta-Lactamase
pubmed doi rcsb
source organism Escherichia coli
total genus 97
structure length 260
sequence length 260
chains with identical sequence B
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2012-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 4ddyA00
3LEZA 5M18A 2IWDA 1MBLA 3CMZA 4XXRA 2I72A 2ZQCA 2HPBA 1MY8A 3N6IA 1K55A 4CPKA 1RGYA 4QD4A 4IVIA 4JBFA 1NYYA 4E3NA 5EUAA 4UA6A 5E2HA 4BD1A 1YMXA 3PBOA 4CJNA 3A3DA 3DWKA 3IWOA 1KDSA 4OOLA 2OLUA 5TFQA 3VMAA 1MWRA 3HLFA 5GLBA 1GA9A 4GN2A 5AQ7A 3IF6C 5GHZA 5HL1A 4JPMA 4PM8A 3HVFA 3MKEA 1S0WA 4QHCA 4S2LA 2C5WB 3RJUA 1MXOA 1IYSA 3D4FA 3FZCA 4XUXA 4R23A 1I5QA 1K56A 4KQOA 1LI0A 1ERMA 4DRTA 4DKIA 3IXDA 3ZVTA 2V1ZA 2ZM8A 4BL2A 1W5DA 2IWCA 3HL9A 3DWZA 2GDNA 4LV0A 3WWXA 4UAAA 2A3UA 3UPOA 1I2WA 2XK1A 3NDGA 1IKGA 1M40A 2OV5A 3SS5A 3CG5A 4WZ5C 2CC1A 2Y2HA 3OCNA 4PMAA 5E43A 3VP3A 4WMCD 2HDUA 2R9WA 3FV7A 3IF6A 5GHXA 2WUQA 3IWQA 3Q7ZA 4OH0A 4C75A 3UE3A 3WS1A 1L2SA 1N4OA 1E4DA 3MZEA 1H8YA 3Q81A 3MBZA 1ERQA 1L0GA 1K56D 3VP0A 3HLDA 4LENA 4ID4A 1SKFA 4K0XA 2Y2QA 3HLGA 1BLPA 2HP5A 5DF8A 5EE8A 3OC2A 4HBUA 5GHYA 2QPNA 1YLYA 4B88A 4WYYA 4ZJ2A 2J7VA 4OQHA 1ESIA 2ZD8A 1DY6A 3A3IA 4JXGA 3IXGA 1PI5A 2ZC6B 1YLPA 5CGSA 5A92A 4L0LA 1TDLA 3LCEA 4WZ5A 3G32A 4WEKA 1SCWA 5CHUA 5E2FA 3E2LA 3N8SA 4HESA 3W4PA 3ZGAB 3WS2A 4A5RA 5CEDA 1Z6FA 3N7WA 2HDRA 1YLZA 3Q82A 4KG2A 2G2WA 3HUNA 2WGWB 3MXRA 3TG9A 3ZDJA 1K38A 3NCKA 3IH8A 1KGGA 2WGVA 3ISGA 3PTEA 4IBRA 4P6BA 3GQZA 1ALQA 3UE1A 4PM5A 4B4XA 3N8LA 1E25A 3HREA 3NDEA 2UWXA 4KZ7A 3M2JA 3M6BA 4HEFA 1ES5A 5CERA 1PWCA 4QY6A 2Y2OA 4U3TA 4B4ZA 3G2YA 1RP5A 1KE4A 1EWZA 2B5RA 3UPNA 1U60A 1S6RA 4S2NA 3V39A 1XGIA 3LY4A 4KENB 1W7FA 5M1AA 3ZNTA 4GKUA 5CGXA 2R9XA 4N1XA 5HW3A 1WYCA 4IVKA 4LV3A 3MZDA 1JTGA 4NETA 1LL5A 1O07A 3PBRA 1Q2PA 5FATA 2G2UA 2Y2GA 3VP2A 4KZ8A 4Y0TA 1SDEA 3UNWA 1G68A 1WE4A 1FSYA 3O3VA 1ZG6A 3IXBA 1J9MA 4JF5A 4X56A 4RX3A 5F83A 4ZJ1A 4R4RA 4KG5A 1YLJA 4KZ5A 1H8ZA 4NK3A 4Y7PA 5M19A 1W8YA 3BFGA 4JKTA 3UDIA 2PU4A 4Y0UA 1TDGA 5JYOA 4OQ0A 4R0QA 5CTNA 1CI8A 1E3UD 3VP4A 3ZG8B 1C3BA 3UN7A 1PWGA 1FSWA 2HDSA 1TVFA 1BLHA 3CJMA 4X68A 3TOIA 4KZ6A 3SS4A 2P9VA 5KZHA 5FSRA 4GZBA 3HLCA 3ZFZA 2IWBA 3PBSA 1KGEA 4FCFA 3UE0A 4OP5A 3GSGA 2ZQ9A 3M6HA 4OLGA 3WRTA 4HBTA 2ZM0A 4UHUA 4BENA 3IWIA 1G6AA 3G2ZA 3BECA 4H8RA 1ZKJA 3Q7VA 5F1GA 2PBYA 2Y2KA 4JF6A 4ZAMA 3MZFA 3GMWA 3W4OA 4GB7A 4JF4A 5FDHA 1NJ4A 3G31A 1FCNA 4WZ4A 5KSCA 5JYPA 3N4IA 3PBNA 5EOEA 3V50A 4BLMA 5DTKA 3OPLA 4UA7A 3UDFA 3NBLA 1KDWA 3BFEA 4X69A 4IEDA 5CTMA 4KQQA 3IF5A 3O86A 1ESUA 2EX8A 4OKPA 3UY6A 1XA1A 4GNUA 4Y0OA 1ES4A 4OOMA 1W79A 2WKHA 4GDNA 4FD8A 5DVAA 4YINA 2ZLYA 2ZQDA 2Y91A 1FQGA 2P9VB 4KZ9A 2VGKA 5FQKA 3BRMA 5FAPA 4ZJ3A 1IELA 4JXWA 3O87A 2RL3A 1SHVA 2XDMA 2H0YA 4KZ3A 5TGFA 5F82A 5AQ9A 3WS0A 1FOFA 5FI2A 1OMEA 2Y2PA 3IT9A 4EUZA 3BFCA 3C5AA 3ZG0A 3HBRA 1BUEA 3ZCZA 1PI4A 4OPYA 1PWDA 2E8IA 4MBFA 4DE3A 5A93A 1DJBA 4S2JA 5GL9A 3IXHA 1KGFA 1PZPA 4S2NC 5HX9A 1FCMA 5FAQA 1BULA 4MBHA 1EI5A 1K25A 2EX6A 1GA0A 3V3SA 5GLDA 4S2KA 2Z2LB 3HLWA 3BFFA 5EVIC 2RCXA 4K0WA 2VGJA 5FQMA 2ZQ8A 1YT4A 4EV4A 4GD8A 4U0XA 2WADA 4ZDXA 3GTCA 4K91A 2Y2JA 3UPPA 2DRWA 1KVLA 3CZDA 1BZAA 1ONHA 3MFDA 3IF6B 1SDNA 4OP8A 4ZBEA 5HAPA 3AGDA 4S2OA 4N9KA 1FR6A 5EOOA 2WKIA 5CHMA 1XXMA 1GHIA 2QMIA 3GVBA 4JXVA 5KMWA 2XH9A 4X6TA 3LY3A 5DTTA 3TSGA 3RXWA 4DXBA 1LI9A 4MEZA 1DJCA 1WYBA 3HLBA 3IHAA 5I94A 5GLCA 1MWSA 3ZHHA 4EBLA 4LCLA 2XD5A 5EVIA 3VFHA 1QMFA 4DDSA 2ZJ9A 3DTMA 4OQGA 3VOYA 1VM1A 1YQSA 2ZQAA 4DF6A 1JTDA 3PAGA 1HTZA 3FYZA 3SH9A 1MKIA 1EROA 4OPQA 2Q9NA 1Q2QA 3PAEA 5HAIA 4P85A 3A3JA 4RX2A 1JWPA 1PZOA 5CRFA 1FCOA 1MWTA 4DE1A 5EECA 4JXSA 5HFOA 4MNRA 4GD6A 3I7JA 3M2KA 3AGEA 1HVBA 5U47A 3A3FA 4D2OA 3G34A 3MKFA 5TR7A 4GOGA 4QB8A 4WBGA 4DDYA 3EQVA 1W8QA 3C4PA 2JE5A 3DW0A 4BD0A 4FH4A 1HD8A 1QMEA 2H0TA 2X01A 2HP6A 4OONA 2ZC7A 4N92A 2BLSA 1ES2A 1JVJA 3NY4A 1BLSA 1XGJA 4IBXA 4WM9A 5EVID 5CGWA 4KZ4A 2FFYA 5EPHA 2EX9A 1H5XA 1YMSA 4BL3A 2WZXA 4LV1A 1IYOA 2J9PA 5DF7A 4ZTKA 4DE0A 2H10A 2XQZA 3FWLA 2ZC4B 3GRJA 5E2EA 2HP9A 4QU3A 1KVMA 3C7UA 5AQBA 3HUMA 5CXWA 2C6WB 1GHMA 1XA7A 2Y4AA 1BT5A 4PM9A 4Z9QA 5J8XA 2JC7A 1CEGA 2J9OA 4WELA 4OPRA 3FKVA 3BEBA 3V3RA 3NC8A 1HZOA 1K6SA 3IHBA 1XX2A 1RGZA 1LLBA 1YM1A 2JBFA 3P09A 4EBNA 4E3KA 1NXYA 3ITBA 4OVDA 2XFSA 4OLDA 5HARA 4X55A 3IQAA 1BSGA 4JLFA 2H5SA 1MPLA 2XR0A 3JYIA 3EQUA 4RYEA 4E6WA 1PIOA 4YFMA 4WMCA 4PM7A 3ZG9B 1K6RA 3OPHA 3VOZA 2ZC5B 5A90A 4MLLA 4Q8IA 5DF9A 3UO9A 3WS5A 1K4FA 2WKEA 3SH8A 4E3LA 4M3KA 1ONGA 1PYYA 1IEMA 4N9LA 3W8KA 3OPRA 2V2FF 1NZOA 1XKZA 5D3OA 5BOHA 4O7DA 4S2IA 5L2FA 3UDXA 1K4EA 3PBTA 1IYQA 2WZZA 2XF3A 2EX2A 2EXAA 1K54C 3G30A 5FQQA 4DE2A 1I2SA 2V20A 3ZG5A 1AXBA 1NY0A 2QZ6A 4BQMA 1JWZA 2WGWA 1VQQA 2XGNA 4E3JA 3OPPA 4GDBA 1BTLA 1IKIA 2WGIA 3QNCA 3Q7VB 3PBQA 3A3EA 4R1GA 4F94A 4DXCA 5F1FA 1ES3A 1ZC2A 4FSFA 4LV2A 4KZAA 4KQRA 4MBKA 3V5MA 5FASA 3NIAA 1ZG4A 5HAQA 3LO7A 4UA9A 3S4XA 2EFUA 4PM6A 3SH7A 1JWVA 3S1YA 2DCFA 1LL9A 2XFTA 3BFDA 2P74A 3B3XA 4RA7A 2WAEA 2PU2A 4WEJA 1N9BA 1K54A 2FFFB 3BYDA 4KG6A 5FQJA 5KSHA 3S22A 4XUZA 2WK0A 3BLSA 3QNBA 2X02A 3C7VA 5FQIA 1MWUA 3N8RA 1CEFA 2EXBA 1KE0A 5FA7A 1K57C 1Y54A 4E3OA 2WYXA 2A49A 2Y2LA 2Y2NA 1L0EA 1YLTA 3QHYA 1XP4A 2ZQ7A 3C4OA 1NZUA 1YLWA 4P87A 4R4SA 1NRFA 5CHJA 4C3QA 3NI9A 5GLAA 3HLEA 3BLMA 2Q9MA 3GR2A 3VFFA 3BM6A 2Z2MB 1FR1A 2HDQA 4R3JA 5FI7A 5CEBA 4R3BA 1M6KA 2WAFA 1GHPA 2ZC3B 5DTSA 3Q1FA 1NYMA 3GV9A 2Y2MA 3OCLA 2XLNA 3AGFA 4PPRA 4N1HA 3WS4A 5FAOA 4S2MA 3VSKA 2Y55A 4X53A 3VP1A 3RXXA 1K57A 1LHYA 4OOYA 1PW1A 5FQ9A 3O88A 2ZMAA 5IHVA 4RVAA 3OZHA 3ZNYA 3P98A 4KZBA 4QJGA 5FI6A 2XEPA 2EFXA 4P0MA 3ZG7B 2XD1A 3WRZA 4E3IA 1L0FA 2JCHA 2BG1A 4OPZA 2OLVA 2X71A 5G18A 5CECA 3VSLA 3E2KA 1E3UA 4C6YA 5A91A 3SOIA 1CI9A 3ZVWA 4BJPA 2J8YA 2DNSA 3IH9A 4U0TA 2OSUA 5EVLA 4EQIA 1BLCA 2Y2IA 1DJAA 1PW8A 1K55C 3ITAA 1CK3A 4EBPA 5E2GA 1TEMA 4OQIA 1KE3A 4FH2A 1XPBA 3SS3A 1RCJA 5EVIB 2Y59A 3G35A 4LCMA 3G4PA 4E6XA 4QY5A 4EWFA 1GCEA 3W4QA 1IYPA 2ZM2A 4E3MA 1L0DA 3MXSA 3HUOA 5AQAA 3Q07A 4S2PA 3FKWA 1O7EA
chains in the Genus database with same CATH superfamily
1T1CA 2IWDA 2HPBA 4CPKA 3UB9A 1F2KA 2VGLM 3IWOA 2V9AA 1TF1A 1VETB 1YKDA 1IYSA 3T1RA 2M1CA 4HOIA 4DRTA 4GLQA 2ZM8A 3DWZA 2H28A 2XK1A 2OV5A 2A2LA 2Y2HA 4WL9A 5TBMA 3VP3A 4WMCD 3IF6A 3FV7A 4LFUA 3Q7ZA 4O01A 3UE3A 3WS1A 1K56D 3VP0A 3HLDA 2Y2QA 3HLGA 4IUKA 3OC2A 3IX4A 2QPNA 1J3WA 4ZJ2A 2J7VA 3R4KA 2ZC6B 4L0LA 2M7VA 4WZ5A 3E2LA 5CX7A 5HZHA 3N7WA 2OAP1 3HUNA 2WKRA 3C30A 2PYRA 3IH8A 1F98A 4KZ7A 1ES5A 1PWCA 3NULA 4QY6A 2A24A 2B5RA 1EWZA 3V39A 3ZNTA 2R9XA 4N1XA 1WYCA 2ZMVA 3LR5A 1JTGA 1LL5A 3L9KA 1T18A 4Y0TA 3CPTB 3UNWA 3PR6A 2CMNA 1GSWA 1UWPX 1ZG6A 3O3VA 1J9MA 5F83A 4ZJ1A 4KZ5A 2JKTM 2O0YA 3CLOA 4Y0UA 4OQ0A 5CTNA 2A24B 3VV4A 1FSWA 2HDSA 1TVFA 3DTKA 5KZHA 3C38A 5FSRA 2IWBA 3PBSA 3UE0A 3GSGA 4OLGA 3M6HA 1SZVA 4L9GA 3IWIA 1Y4OA 2PBYA 4ZAMA 3W4OA 4GB7A 4GW9A 5FDHA 1NJ4A 1FCNA 1HLUP 4WZ4A 4BLMA 3UDFA 3NBLA 5HWVA 4IEDA 4KQQA 3O86A 5EM0A 4OKPA 3UY6A 3VOLA 3T4SA 4OOMA 1W79A 2WKHA 4GHIA 5DFYA 2H0YA 1OMEA 3KYEA 2EWVA 2KX6A 2VGLS 5A93A 3ICYA 5HX9A 3H9WA 1EI5A 2EX6A 3MF0A 4S2KA 3BFFA 4K0WA 3LGOA 5FQMA 1VEUA 2WADA 2Y2JA 3UPPA 3CZDA 5HAPA 3AGDA 4EESA 4N9KA 5EOOA 4Z1WA 4HI4A 5K5BA 4G3WA 4GHIB 1NLZA 2XH9A 3LY3A 1LI9A 3IHAA 3ZHHA 2XD5A 1QMFA 2ZJ9A 4OQGA 2JKRM 4QWOA 3HJKA 3SH9A 1EROA 3A3JA 5HFOA 4MNRA 4GD6A 3I7JA 3M2KA 3AGEA 1HVBA 5U47A 2PR6A 4HJ3A 4GOGA 5HPIA 3RH8B 3EQVA 3DW0A 4BD0A 1QMEA 2HP6A 4N92A 3NY4A 1ES2A 1BLSA 4KZ4A 3H7WA 3S7PA 4NKPA 2E8JA 4ZTKA 3BJNA 1KVMA 5AQBA 3HUMA 4PM9A 5J8XA 2JC7A 4CLCB 3BEBA 1XX2A 1RGZA 1YM1A 4H6JA 3QP1A 4JLFA 2XR0A 3CUEA 3UB6A 4G3VA 4YOFA 3KSHA 2OWJA 4KUOA 4I39A 3ZG9B 5G4ZA 4B93A 2UV0E 4R70A 4Q8IA 2W3FA 3H7WB 3WS5A 1K4FA 2WKEA 2VV7A 1IEMA 1G5UA 3NOPC 4JGOA 1NZOA 4ETZA 5HDCA 1IYQA 2JHEA 1LSXA 3G30A 2EXAA 5FQQA 4DE2A 1H8MA 1AXBA 2QZ6A 2WGWA 2GJ3A 2LB9A 3PBQA 5TJJA 3MFXA 5HDSA 4R1GA 2V8FA 4FSFA 4KZAA 1H0MA 2PYPA 3S4XA 4Y2FA 3GDIA 1JWVA 3BFDA 2KDKA 2P74A 1S1ZA 3PXPA 1DP8A 2PU2A 1N9BA 2OAQ1 1NRJA 2FFFB 3FPWA 5KSHA 3S22A 2ZOIA 4YNRA 5FQIA 1CEFA 1K57C 1A0KA 1XP4A 4R4SA 5C5KA 1NRFA 4O8GA 3NI9A 4LRXC 5GLAA 2Q9MA 3GR2A 1XJ6A 2Z2MB 1FR1A 5CEBA 4M4XA 3Q1FA 1NYMA 2ZL1B 3GV9A 2Y2MA 3BY8A 2O99A 1SKOA 4X53A 4HH3A 1P9RA 4RVAA 3OZHA 3P98A 4P0MA 3E4OA 3WRZA 4HJ6A 5F69A 2BG1A 5CECA 4Y13A 2WKPA 3D3OA 4I3JA 4LPZA 4Q0HA 4II7A 1K55C 3R7WA 3ITAA 5IU1A 1G6OA 1RCJA 2XROA 1TS7A 3G35A 3G4PA 4LCMA 2PD7A 1TS6A 5AQAA 3EOIA 4BMWA 4XXRA 1CJFA 2I72A 1D7EA 4QD4A 1NYYA 4CJNA 3A3DA 4OOLA 3K3DA 3VMAA 2KOIA 3OOVA 5AQ7A 5GHZA 1XJ2A 3HVFA 3FZCA 2AVXA 4XUXA 1K56A 4KQOA 1LI0A 1ERMA 1XFQA 2V1ZA 1W5DA 3HL9A 2GDNA 2ZBBA 3KO6A 4LV0A 3WWXA 4LRZE 5AJGA 2K2NA 3CG5A 5HWWA 2WUQA 1L2SA 2VK3A 1E4DA 3Q81A 2XRNA 1ERQA 3MBZA 1L0GA 4ID4A 1SKFA 2KLIA 4K0XA 4UEYA 1D1JA 4MN6A 2HP5A 4HBUA 5GHYA 3IX3A 1YLYA 2J80A 3QP6A 1ESIA 2ZD8A 3IXGA 1PI5A 3UMDA 3F1OA 3JPUA 1SCWA 5E2FA 3W4PA 1Z6FA 5FL3A 2Z6DA 1S67L 1N9NA 2V0UA 3TG9A 3QP2A 1K38A 3NCKA 3L7HA 4X25A 3PTEA 4P6BA 4NG2A 4PM5A 4UQIM 4B4XA 1E25A 3HREA 3NDEA 2UWXA 4Q0IA 3M2JA 3M6BA 3CI6A 3KYQA 2Y2OA 4U3TA 4B4ZA 3G2YA 3BWLA 1N9LA 1KE4A 1U60A 1S6RA 4S2NA 4KENB 5CGXA 4IVKA 2L4RA 5DKKA 3MZDA 1AWIA 3PBRA 3E4QA 1Q2PA 1SDEA 3QP8A 1S1YA 1G68A 1WE4A 5J7EA 4JF5A 1MKMA 4R4RA 4EUVA 4Y7PA 4JKTA 3UDIA 1TDGA 4HJ4A 5JYOA 4R0QA 1C3BA 4HH2A 1PWGA 3JVUA 3LIAA 2DMWA 1KGEA 3MS6A 4HBTA 3FC7A 4BENA 3T4TA 3G2ZA 3LIBA 3BECA 3Q7VA 2HJ9C 2J3TC 2XSSA 2OOLA 5G4YA 3MZFA 1WA9A 3F1NA 4EU0A 3PBNA 4B9OA 3OPLA 3BQ8A 2IA2A 4X69A 3LICA 5CTMA 4I3IA 1XA1A 1ES4A 5DVAA 2Y91A 1FQGA 5HWTA 5HD3A 3O87A 2RL3A 2XDMA 1FOFA 3IT9A 4EUZA 2B95A 2PDRA 2W0NA 4OPYA 4MBFA 4DE3A 3E4PA 3A0VA 1IFQA 4S2JA 5GL9A 3IXHA 4S2NC 5FAQA 1BULA 4MBHA 3E0YA 3F1NB 3HLWA 5EVIC 4U0XA 3UE6A 4ZDXA 2J3TD 1T19A 5TBMB 2DRWA 1KVLA 1BZAA 1ONHA 3IF6B 1SDNA 3V67A 4S2OA 1PNEA 2V8CA 3MQQA 2W1RA 1PFLA 5EVEA 3MMHA 1W63M 4MEZA 1DJCA 1WYBA 5I94A 5GLCA 4EBLA 4IJGA 1F9IA 3VE3A 3DTMA 1VM1A 1YQSA 2B18A 2ZQAA 2VLGA 1HTZA 3FYZA 1MKIA 2QWSA 1Q2QA 3PAEA 4P85A 4PAUA 1FCOA 1MWTA 1ZTUA 3T1SA 3EEAA 2GNXA 4LRYC 3IS2A 4D2OA 3G6OA 4DDYA 2NUPC 3C4PA 5HL6A 5MC7A 1HD8A 3IBJA 4OONA 4L9FA 2Y8HA 1JVJA 5EVID 1XGJA 4IBXA 2PD8A 5DKLA 2YKHA 4BL3A 2W1TA 4LV1A 5DF7A 1TS8A 2H10A 4Y17A 2ZC4B 2P04A 2C6WB 1GHMA 3NOTC 1BT5A 2W3GA 3OLOA 1HZOA 2D01A 1LLBA 2JBFA 1EW0A 1NXYA 3UMEA 1LSWA 1BSGA 3TW8A 2H5SA 3EQUA 4RYEA 4E6WA 1PIOA 3CAXA 3KSIA 3OPHA 3MSHA 4M3KA 1ONGA 3KSFA 2V2FF 1XKZA 5D3OA 4S2IA 2XF3A 1K54C 1I2SA 2V20A 4E3JA 4GDBA 2PR5A 1BTLA 2WGIA 4F94A 4DXCA 5F1FA 1ES3A 1ZHHB 2MJ6A 3NIAA 3LO7A 1UWNX 2DCFA 1LL9A 4R3AA 4RA7A 4XUZA 2X02A 1MC0A 1LSVA 4Q0JA 2WYXA 2A49A 2Y2LA 4JGRA 2Y2NA 3LI8A 4P87A 4C3QA 3HLEA 5EV0A 3QP5A 5IS1A 5FI7A 2WAFA 3OCLA 1Z09A 4S2MA 3VP1A 2VJWA 1XFNA 3RXXA 1K57A 1PW1A 4HY8A 1VEUB 4KZBA 4QJGA 5FI6A 2XEPA 4ZRRA 2JCHA 2OLVA 4R38A 3VSLA 1E3UA 1OJ5A 1GSXA 2W3HA 4NXBA 2J8YA 2DNSA 4U0TA 1BLCA 4R6LA 5E2GA 4ARZA 1XPBA 4MN7A 4FOFA 3LYXA 1H3QA 3KX0X 1T1BA 3W4QA 1IYPA 2ZM2A 1L0DA 3MXSA 4DJ3A 4S2PA 1TD5A 5AVFA 2ZQCA 1P97A 3FG8A 1MY8A 1K55A 4I38A 5EUAA 4UA6A 4E3NA 1YMXA 3DWKA 4PHTA 2P08A 3NJAA 2OLUA 5TFQA 1MWRA 3HLFA 1GA9A 2HGVA 5EM1A 3BW6A 4JPMA 3RFBA 4PM8A 3MKEA 4QHCA 4S2LA 2C5WB 2V0WA 1MXOA 3D4FA 4BBUA 4R23A 1I5QA 3LIFA 4DKIA 4HQAA 4GS9A 3ZVTA 2VV8A 3UPOA 1IKGA 3D72A 4H6JB 3OCNA 5E43A 2HDUA 4OH0A 4C75A 1N4OA 3MZEA 3P01A 4LENA 3DBAA 3DAVA 1BLPA 5DF8A 4WYYA 4OQHA 1YLPA 1FILA 4GS9B 1Y28A 3G32A 1GSVA 1VHMA 2G7UA 3ZGAB 3T4LA 3D9YA 4FTXA 1YLZA 1YSQA 3Q82A 4KG2A 2G2WA 2WGWB 5IT5A 1D06A 5F6AA 3ZDJA 2BASA 4CLCC 2WGVA 4IBRA 1ALQA 3UE1A 3N8LA 1YAXA 1P0ZA 1XGIA 3LY4A 1W7FA 5M1AA 5HW3A 1O07A 3A0RA 2G2UA 2M7UA 2Y2GA 3VP2A 3MR0A 3EWKA 1FSYA 2R78A 4NXGA 3IXBA 2QYBA 4KG5A 1YLJA 4NK3A 1P9WA 3K3CA 2JN7A 1W8YA 3BFGA 2PU4A 1SKOB 2J3WA 2ZOHA 1E3UD 3VP4A 1OTBA 3UN7A 1BLHA 4CLCD 4KZ6A 3SS4A 2P9VA 3ZYTA 2B02A 4FCFA 4LGWA 2D02A 3LI9A 5L8MA 2ZM0A 4UHUA 5LBRA 3R7WB 2HV1A 1G6AA 1ZKJA 4DMZA 4GJ4A 2Y2KA 3G31A 4ETXA 4F3LA 3S7QA 5JYPA 5DJTA 1KDWA 3BFEA 3SZTA 2EX8A 5J4EA 5FDSA 4Y0OA 3NOUC 5FEGA 4GDNA 4FD8A 4ME4A 2P9VB 4KZ9A 1UGUA 4ESPA 5FAPA 4ZJ3A 1IELA 4JXWA 5F82A 1F5MA 3WS0A 1FIKA 5FI2A 4L9EA 2GZAA 5EFWA 3UB8A 1BUEA 1BYWA 1PI4A 2E8IA 3F1PA 1V9YA 3E98A 4HP4A 5HD5A 5HPFA 1KGFA 1PZPA 1FCMA 4F3LB 1XJ3A 2Z2LB 2RCXA 3MQOA 4X1LA 1YT4A 4EV4A 4EEUA 4GD8A 4K91A 3VE4A 4OP8A 3S7OA 4PKYA 2JKGA 3OBFA 1FR6A 2W3DA 3RTYA 1GHIA 2QMIA 5KMWA 3TSGA 4DXBA 5KIZA 3HLBA 3TJZC 4LCLA 5EVIA 3VFHA 4HHDA 4AFIA 3VOYA 4HP9A 3F1PB 1CQAA 3LIEA 4DF6A 3PAGA 4OPQA 3EGDC 4YWZA 2Q9NA 3F1OB 1DP9A 5HAIA 4RX2A 1JWPA 1PZOA 1S4SA 1JNUA 4BWIA 3EGXC 3A3FA 5TR7A 5HSQA 4QB8A 4WBGA 1DP6A 1W8QA 2VV6A 4FH4A 2X01A 2BLSA 3C2WA 4WM9A 5EPHA 1VETA 2EX9A 1H5XA 2K7SA 3UB7A 3W2ZA 2WZXA 1IYOA 4DE0A 2XQZA 3FWLA 5E2EA 2HP9A 4QU3A 5CXWA 3GECA 2J9OA 4OPRA 3FKVA 3V3RA 3TE8A 4EBNA 3P09A 4E3KA 3ITBA 4OVDA 2XFSA 4OLDA 3T1QB 5HARA 4WF0A 4YFMA 3T4OA 4PM7A 1K6RA 4JGPA 3HCYA 3VOZA 4BBTA 2ZC5B 1YPRA 4MLLA 5A90A 3PYPA 5L07A 4E3LA 5L09A 4N9LA 3OPRA 5BOHA 1ACFA 4KQDA 1K4EA 3PBTA 1OPXA 4EETB 1NY0A 4BQMA 3T4QA 2XGNA 2PAVP 1IKIA 5HDDA 3QNCA 3Q7VB 2VEAA 3A3EA 4MCWA 3K2NA 4KQRA 4MBKA 3V5MA 5FASA 4UA9A 2EFUA 2ZMFA 3SH7A 3S1YA 3B3XA 2WAEA 4WEJA 1K54A 4KG6A 3BLSA 3N8RA 2EXBA 1KE0A 4Y15A 4E3OA 3CPTA 1W63Q 3QHYA 3C4OA 1NZUA 1YLWA 5CHJA 3BLMA 3NHQA 4XT2A 1OTEA 1KOUA 2HDQA 2ZC3B 3AGFA 4PPRA 3WS4A 3VSKA 3CHWP 1LHYA 4OOYA 5FQ9A 1V9ZA 3DTIA 2ZMAA 5IHVA 2Q0OA 2EFXA 3ZG7B 2XD1A 4E04A 3PHYA 1ODVA 4Y3IA 4OPZA 3E2KA 3SOIA 5AVEA 3ZVWA 4DJ2A 4BJPA 3IH9A 5EVLA 2GX5A 4IHQA 2Y2IA 1DJAA 1PW8A 1STZA 5FEFA 4NEED 1KE3A 4FH2A 4XT2B 2VX8A 4EEPA 1XJ4A 4DN0A 4UQIS 3EEHA 3T1XA 4P6ZM 1GCEA 2XA7M 1L3LA 3HUOA 3LEZA 5M18A 2JKTI 1MBLA 3CMZA 3IS2B 3N6IA 1RGYA 4IVIA 4JBFA 5E2HA 4BD1A 3PBOA 1KDSA 5GLBA 4GN2A 5HL1A 3IF6C 1S0WA 3RJUA 2W1TB 2O9BA 1S66L 3IXDA 2W27A 4BL2A 5A8BA 2IWCA 5DFXA 1OTDA 4UAAA 4O0PA 2A3UA 1I2WA 3NDGA 1M40A 3SS5A 1CF0A 3NECA 3LIDA 4WZ5C 1NWZA 2CC1A 4PMAA 3CWFA 5GHXA 2R9WA 3IWQA 3LR3A 1H8YA 4I3AA 3LR4A 5EE8A 4B88A 2QHKA 3A3IA 5CGSA 1DY6A 4GCZA 4JXGA 4G3KA 5A92A 1TDLA 3LCEA 4WN5A 4WEKA 3KSGA 2K31A 5CHUA 3N8SA 4HESA 4A5RA 4EERA 3WS2A 5CEDA 2HDRA 3MXRA 4WLAA 3P7NA 1KGGA 3ISGA 3GQZA 2L0WA 4EW7A 1OT9A 5CERA 2JKFA 3MJQA 4HEFA 3U4LP 3MQ0A 2FZ0A 1RP5A 3UPNA 4CQHA 4GKUA 4LLOB 4LV3A 2VKSA 3BY9A 3IBRA 4NETA 5FATA 3BQAA 4KZ8A 3MXQA 4CLCA 1OTIA 1LL8A 4EXOA 4X56A 2JKRI 4RX3A 2L1MA 4X1MA 4MDZA 1H8ZA 4JGQA 3QP4A 5M19A 4WUJA 4KUKA 2HZ5A 3IX8A 1CI8A 1YSPA 3ZG8B 3SW1A 1NLYA 3CJMA 4X68A 3TOIA 4HIAA 4GZBA 2Y79A 3HLCA 3ZFZA 4OP5A 2ZQ9A 3WRTA 1OT6A 4ARZB 4H8RA 3T4KA 5F1GA 2PBDP 4JF6A 2EA9A 3GMWA 4JF4A 2QJ5A 3T4JA 5KSCA 3N4IA 5EOEA 2O9CA 3V50A 5DTKA 3B42A 4UA7A 5F68A 3IF5A 1ESUA 4GNUA 4P6ZS 2XA7S 5L10A 4YINA 2ZLYA 2ZQDA 2VGKA 5FQKA 3BRMA 3S7NA 1SHVA 4KZ3A 4FUWA 5TGFA 2OWHA 5AQ9A 2Y2PA 2P7JA 3BFCA 3C5AA 3ZG0A 5F5YA 3HBRA 3ZCZA 1PWDA 1DJBA 2ZL1A 2WKQA 4I5SA 1N9OA 1K25A 1GA0A 3V3SA 5GLDA 2VGJA 2VA0A 2ZQ8A 3GTCA 3MFDA 4ZBEA 4PKYG 3KYZA 3ULFA 2WKIA 5CHMA 4NXFA 1XXMA 3O5YA 3GVBA 4JXVA 4X6TA 5DTTA 3RXWA 1X0OA 3FPVA 1MWSA 1OJGA 3ZQ5A 2VZWA 1S4RA 2LB5A 4DDSA 1MZUA 1VB6A 1JTDA 4HNBA 1TS0A 5CRFA 2EWWA 4DE1A 5EECA 4JXSA 4Y5FA 2FH5A 3G34A 3MKFA 2JE5A 3LFVA 2H0TA 2ZC7A 5CGWA 2FFYA 4K08A 3CUEC 1YMSA 2O9AA 1LT0A 2J9PA 2NUTC 3GRJA 3C7UA 1XA7A 2Y4AA 3UB5P 4Z9QA 4BBVA 2YKFA 1CEGA 4WELA 3H82A 3NC8A 1K6SA 3IHBA 3LEQA 2BTFP 4X55A 3IQAA 1MPLA 3JYIA 4WMCA 2ACGA 5DF9A 3A0SA 3UO9A 3SH8A 1PYYA 3LR0A 3W8KA 1PRQA 4O7DA 5L2FA 3UDXA 2Z6CA 2WZZA 2EX2A 1IOUA 2V1BA 3LUQA 3ZG5A 3U2AA 4IUHA 1JWZA 3CITA 1VQQA 3H82B 3OPPA 2HJEA 3HJIA 1ZC2A 4LV2A 5HAQA 1ZG4A 4EQ1A 4PM6A 2W3EA 2XFTA 3B47A 2QJ7A 3BYDA 5FQJA 2WK0A 3QNBA 3C7VA 1MWUA 5FA7A 2PRFA 1Y54A 1K0KA 4NXEA 1L0EA 1YLTA 2PT7A 2ZQ7A 4QPRA 2HF6A 1O7EA 2I9VA 3VFFA 3BM6A 4R3JA 4R3BA 1M6KA 1GHPA 5DTSA 4RQ9A 3JVVA 2XLNA 4N1HA 5FAOA 2Y55A 3T50A 4MMNA 5DJUA 3O88A 5J3WA 3ZNYA 1OTAA 3B33A 1G28A 4CLCE 3DTEA 4E3IA 1L0FA 1T1AA 5G18A 2X71A 4C6YA 5A91A 1CI9A 3C8CA 2OSUA 4EQIA 4D60A 3T12B 5I5LA 1CK3A 4EBPA 1TEMA 4OQIA 3SS3A 2QKPA 5EVIB 1DRMA 2Y59A 4E6XA 4QY5A 4EWFA 2PHYA 3TRCA 2INWA 4MN5A 4E3MA 3Q07A 3FKWA 2V1AA
chains in the Genus database with same CATH topology
3LEZA 5M18A 2IWDA 1MBLA 3CMZA 4XXRA 2I72A 2ZQCA 2HPBA 1MY8A 3N6IA 1K55A 4CPKA 1RGYA 4QD4A 4IVIA 4JBFA 1NYYA 4E3NA 5EUAA 4UA6A 5E2HA 4BD1A 1YMXA 3PBOA 4CJNA 3A3DA 3DWKA 3IWOA 1KDSA 4OOLA 2OLUA 5TFQA 3VMAA 1MWRA 3HLFA 5GLBA 1GA9A 4GN2A 5AQ7A 3IF6C 5GHZA 5HL1A 4JPMA 4PM8A 3HVFA 3MKEA 1S0WA 4QHCA 4S2LA 2C5WB 3RJUA 1MXOA 1IYSA 3D4FA 3FZCA 4XUXA 4R23A 1I5QA 1K56A 4KQOA 1LI0A 1ERMA 4DRTA 4DKIA 3IXDA 3ZVTA 2V1ZA 2ZM8A 4BL2A 1W5DA 2IWCA 3HL9A 3DWZA 2GDNA 4LV0A 3WWXA 4UAAA 2A3UA 3UPOA 1I2WA 2XK1A 3NDGA 1IKGA 1M40A 2OV5A 3SS5A 3CG5A 4WZ5C 2CC1A 2Y2HA 3OCNA 4PMAA 5E43A 3VP3A 4WMCD 2HDUA 2R9WA 3FV7A 3IF6A 5GHXA 2WUQA 3IWQA 3Q7ZA 4OH0A 4C75A 3UE3A 3WS1A 1L2SA 1N4OA 1E4DA 3MZEA 1H8YA 3Q81A 3MBZA 1ERQA 1L0GA 1K56D 3VP0A 3HLDA 4LENA 4ID4A 1SKFA 4K0XA 2Y2QA 3HLGA 1BLPA 2HP5A 5DF8A 5EE8A 3OC2A 4HBUA 5GHYA 2QPNA 1YLYA 4B88A 4WYYA 4ZJ2A 2J7VA 4OQHA 1ESIA 2ZD8A 1DY6A 3A3IA 4JXGA 3IXGA 1PI5A 2ZC6B 1YLPA 5CGSA 5A92A 4L0LA 1TDLA 3LCEA 4WZ5A 3G32A 4WEKA 1SCWA 5CHUA 5E2FA 3E2LA 3N8SA 4HESA 3W4PA 3ZGAB 3WS2A 4A5RA 5CEDA 1Z6FA 3N7WA 2HDRA 1YLZA 3Q82A 4KG2A 2G2WA 3HUNA 2WGWB 3MXRA 3TG9A 3ZDJA 1K38A 3NCKA 3IH8A 1KGGA 2WGVA 3ISGA 3PTEA 4IBRA 4P6BA 3GQZA 1ALQA 3UE1A 4PM5A 4B4XA 3N8LA 1E25A 3HREA 3NDEA 2UWXA 4KZ7A 3M2JA 3M6BA 4HEFA 1ES5A 5CERA 1PWCA 4QY6A 2Y2OA 4U3TA 4B4ZA 3G2YA 1RP5A 1KE4A 1EWZA 2B5RA 3UPNA 1U60A 1S6RA 4S2NA 3V39A 1XGIA 3LY4A 4KENB 1W7FA 5M1AA 3ZNTA 4GKUA 5CGXA 2R9XA 4N1XA 5HW3A 1WYCA 4IVKA 4LV3A 3MZDA 1JTGA 4NETA 1LL5A 1O07A 3PBRA 1Q2PA 5FATA 2G2UA 2Y2GA 3VP2A 4KZ8A 4Y0TA 1SDEA 3UNWA 1G68A 1WE4A 1FSYA 3O3VA 1ZG6A 3IXBA 1J9MA 4JF5A 4X56A 4RX3A 5F83A 4ZJ1A 4R4RA 4KG5A 1YLJA 4KZ5A 1H8ZA 4NK3A 4Y7PA 5M19A 1W8YA 3BFGA 4JKTA 3UDIA 2PU4A 4Y0UA 1TDGA 5JYOA 4OQ0A 4R0QA 5CTNA 1CI8A 1E3UD 3VP4A 3ZG8B 1C3BA 3UN7A 1PWGA 1FSWA 2HDSA 1TVFA 1BLHA 3CJMA 4X68A 3TOIA 4KZ6A 3SS4A 2P9VA 5KZHA 5FSRA 4GZBA 3HLCA 3ZFZA 2IWBA 3PBSA 1KGEA 4FCFA 3UE0A 4OP5A 3GSGA 2ZQ9A 3M6HA 4OLGA 3WRTA 4HBTA 2ZM0A 4UHUA 4BENA 3IWIA 1G6AA 3G2ZA 3BECA 4H8RA 1ZKJA 3Q7VA 5F1GA 2PBYA 2Y2KA 4JF6A 4ZAMA 3MZFA 3GMWA 3W4OA 4GB7A 4JF4A 5FDHA 1NJ4A 3G31A 1FCNA 4WZ4A 5KSCA 5JYPA 3N4IA 3PBNA 5EOEA 3V50A 4BLMA 5DTKA 3OPLA 4UA7A 3UDFA 3NBLA 1KDWA 3BFEA 4X69A 4IEDA 5CTMA 4KQQA 3IF5A 3O86A 1ESUA 2EX8A 4OKPA 3UY6A 1XA1A 4GNUA 4Y0OA 1ES4A 4OOMA 1W79A 2WKHA 4GDNA 4FD8A 5DVAA 4YINA 2ZLYA 2ZQDA 2Y91A 1FQGA 2P9VB 4KZ9A 2VGKA 5FQKA 3BRMA 5FAPA 4ZJ3A 1IELA 4JXWA 3O87A 2RL3A 1SHVA 2XDMA 2H0YA 4KZ3A 5TGFA 5F82A 5AQ9A 3WS0A 1FOFA 5FI2A 1OMEA 2Y2PA 3IT9A 4EUZA 3BFCA 3C5AA 3ZG0A 3HBRA 1BUEA 3ZCZA 1PI4A 4OPYA 1PWDA 2E8IA 4MBFA 4DE3A 5A93A 1DJBA 4S2JA 5GL9A 3IXHA 1KGFA 1PZPA 4S2NC 5HX9A 1FCMA 5FAQA 1BULA 4MBHA 1EI5A 1K25A 2EX6A 1GA0A 3V3SA 5GLDA 4S2KA 2Z2LB 3HLWA 3BFFA 5EVIC 2RCXA 4K0WA 2VGJA 5FQMA 2ZQ8A 1YT4A 4EV4A 4GD8A 4U0XA 2WADA 4ZDXA 3GTCA 4K91A 2Y2JA 3UPPA 2DRWA 1KVLA 3CZDA 1BZAA 1ONHA 3MFDA 3IF6B 1SDNA 4OP8A 4ZBEA 5HAPA 3AGDA 4S2OA 4N9KA 1FR6A 5EOOA 2WKIA 5CHMA 1XXMA 1GHIA 2QMIA 3GVBA 4JXVA 5KMWA 2XH9A 4X6TA 3LY3A 5DTTA 3TSGA 3RXWA 4DXBA 1LI9A 4MEZA 1DJCA 1WYBA 3HLBA 3IHAA 5I94A 5GLCA 1MWSA 3ZHHA 4EBLA 4LCLA 2XD5A 5EVIA 3VFHA 1QMFA 4DDSA 2ZJ9A 3DTMA 4OQGA 3VOYA 1VM1A 1YQSA 2ZQAA 4DF6A 1JTDA 3PAGA 1HTZA 3FYZA 3SH9A 1MKIA 1EROA 4OPQA 2Q9NA 1Q2QA 3PAEA 5HAIA 4P85A 3A3JA 4RX2A 1JWPA 1PZOA 5CRFA 1FCOA 1MWTA 4DE1A 5EECA 4JXSA 5HFOA 4MNRA 4GD6A 3I7JA 3M2KA 3AGEA 1HVBA 5U47A 3A3FA 4D2OA 3G34A 3MKFA 5TR7A 4GOGA 4QB8A 4WBGA 4DDYA 3EQVA 1W8QA 3C4PA 2JE5A 3DW0A 4BD0A 4FH4A 1HD8A 1QMEA 2H0TA 2X01A 2HP6A 4OONA 2ZC7A 4N92A 2BLSA 1ES2A 1JVJA 3NY4A 1BLSA 1XGJA 4IBXA 4WM9A 5EVID 5CGWA 4KZ4A 2FFYA 5EPHA 2EX9A 1H5XA 1YMSA 4BL3A 2WZXA 4LV1A 1IYOA 2J9PA 5DF7A 4ZTKA 4DE0A 2H10A 2XQZA 3FWLA 2ZC4B 3GRJA 5E2EA 2HP9A 4QU3A 1KVMA 3C7UA 5AQBA 3HUMA 5CXWA 2C6WB 1GHMA 1XA7A 2Y4AA 1BT5A 4PM9A 4Z9QA 5J8XA 2JC7A 1CEGA 2J9OA 4WELA 4OPRA 3FKVA 3BEBA 3V3RA 3NC8A 1HZOA 1K6SA 3IHBA 1XX2A 1RGZA 1LLBA 1YM1A 2JBFA 3P09A 4EBNA 4E3KA 1NXYA 3ITBA 4OVDA 2XFSA 4OLDA 5HARA 4X55A 3IQAA 1BSGA 4JLFA 2H5SA 1MPLA 2XR0A 3JYIA 3EQUA 4RYEA 4E6WA 1PIOA 4YFMA 4WMCA 4PM7A 3ZG9B 1K6RA 3OPHA 3VOZA 2ZC5B 5A90A 4MLLA 4Q8IA 5DF9A 3UO9A 3WS5A 1K4FA 2WKEA 3SH8A 4E3LA 4M3KA 1ONGA 1PYYA 1IEMA 4N9LA 3W8KA 3OPRA 2V2FF 1NZOA 1XKZA 5D3OA 5BOHA 4O7DA 4S2IA 5L2FA 3UDXA 1K4EA 3PBTA 1IYQA 2WZZA 2XF3A 2EX2A 2EXAA 1K54C 3G30A 5FQQA 4DE2A 1I2SA 2V20A 3ZG5A 1AXBA 1NY0A 2QZ6A 4BQMA 1JWZA 2WGWA 1VQQA 2XGNA 4E3JA 3OPPA 4GDBA 1BTLA 1IKIA 2WGIA 3QNCA 3Q7VB 3PBQA 3A3EA 4R1GA 4F94A 4DXCA 5F1FA 1ES3A 1ZC2A 4FSFA 4LV2A 4KZAA 4KQRA 4MBKA 3V5MA 5FASA 3NIAA 1ZG4A 5HAQA 3LO7A 4UA9A 3S4XA 2EFUA 4PM6A 3SH7A 1JWVA 3S1YA 2DCFA 1LL9A 2XFTA 3BFDA 2P74A 3B3XA 4RA7A 2WAEA 2PU2A 4WEJA 1N9BA 1K54A 2FFFB 3BYDA 4KG6A 5FQJA 5KSHA 3S22A 4XUZA 2WK0A 3BLSA 3QNBA 2X02A 3C7VA 5FQIA 1MWUA 3N8RA 1CEFA 2EXBA 1KE0A 5FA7A 1K57C 1Y54A 4E3OA 2WYXA 2A49A 2Y2LA 2Y2NA 1L0EA 1YLTA 3QHYA 1XP4A 2ZQ7A 3C4OA 1NZUA 1YLWA 4P87A 4R4SA 1NRFA 5CHJA 4C3QA 3NI9A 5GLAA 3HLEA 3BLMA 2Q9MA 3GR2A 3VFFA 3BM6A 2Z2MB 1FR1A 2HDQA 4R3JA 5FI7A 5CEBA 4R3BA 1M6KA 2WAFA 1GHPA 2ZC3B 5DTSA 3Q1FA 1NYMA 3GV9A 2Y2MA 3OCLA 2XLNA 3AGFA 4PPRA 4N1HA 3WS4A 5FAOA 4S2MA 3VSKA 2Y55A 4X53A 3VP1A 3RXXA 1K57A 1LHYA 4OOYA 1PW1A 5FQ9A 3O88A 2ZMAA 5IHVA 4RVAA 3OZHA 3ZNYA 3P98A 4KZBA 4QJGA 5FI6A 2XEPA 2EFXA 4P0MA 3ZG7B 2XD1A 3WRZA 4E3IA 1L0FA 2JCHA 2BG1A 4OPZA 2OLVA 2X71A 5G18A 5CECA 3VSLA 3E2KA 1E3UA 4C6YA 5A91A 3SOIA 1CI9A 3ZVWA 4BJPA 2J8YA 2DNSA 3IH9A 4U0TA 2OSUA 5EVLA 4EQIA 1BLCA 2Y2IA 1DJAA 1PW8A 1K55C 3ITAA 1CK3A 4EBPA 5E2GA 1TEMA 4OQIA 1KE3A 4FH2A 1XPBA 3SS3A 1RCJA 5EVIB 2Y59A 3G35A 4LCMA 3G4PA 4E6XA 4QY5A 4EWFA 1GCEA 3W4QA 1IYPA 2ZM2A 4E3MA 1L0DA 3MXSA 3HUOA 5AQAA 3Q07A 4S2PA 3FKWA 1O7EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LEZ A;  5M18 A;  2IWD A;  1MBL A;  3CMZ A;  4XXR A;  2I72 A;  2ZQC A;  2HPB A;  1MY8 A;  3N6I A;  1K55 A;  4CPK A;  1RGY A;  4QD4 A;  4IVI A;  4JBF A;  1NYY A;  4E3N A;  5EUA A;  4UA6 A;  5E2H A;  4BD1 A;  1YMX A;  3PBO A;  4CJN A;  3A3D A;  3DWK A;  3IWO A;  1KDS A;  4OOL A;  2OLU A;  5TFQ A;  3VMA A;  1MWR A;  3HLF A;  5GLB A;  1GA9 A;  4GN2 A;  5AQ7 A;  3IF6 C;  5GHZ A;  5HL1 A;  4JPM A;  4PM8 A;  3HVF A;  3MKE A;  1S0W A;  4QHC A;  4S2L A;  2C5W B;  3RJU A;  1MXO A;  1IYS A;  3D4F A;  3FZC A;  4XUX A;  4R23 A;  1I5Q A;  1K56 A;  4KQO A;  1LI0 A;  1ERM A;  4DRT A;  4DKI A;  3IXD A;  3ZVT A;  2V1Z A;  2ZM8 A;  4BL2 A;  1W5D A;  2IWC A;  3HL9 A;  3DWZ A;  2GDN A;  4LV0 A;  3WWX A;  4UAA A;  2A3U A;  3UPO A;  1I2W A;  2XK1 A;  3NDG A;  1IKG A;  1M40 A;  2OV5 A;  3SS5 A;  3CG5 A;  4WZ5 C;  2CC1 A;  2Y2H A;  3OCN A;  4PMA A;  5E43 A;  3VP3 A;  4WMC D;  2HDU A;  2R9W A;  3FV7 A;  3IF6 A;  5GHX A;  2WUQ A;  3IWQ A;  3Q7Z A;  4OH0 A;  4C75 A;  3UE3 A;  3WS1 A;  1L2S A;  1N4O A;  1E4D A;  3MZE A;  1H8Y A;  3Q81 A;  3MBZ A;  1ERQ A;  1L0G A;  1K56 D;  3VP0 A;  3HLD A;  4LEN A;  4ID4 A;  1SKF A;  4K0X A;  2Y2Q A;  3HLG A;  1BLP A;  2HP5 A;  5DF8 A;  5EE8 A;  3OC2 A;  4HBU A;  5GHY A;  2QPN A;  1YLY A;  4B88 A;  4WYY A;  4ZJ2 A;  2J7V A;  4OQH A;  1ESI A;  2ZD8 A;  1DY6 A;  3A3I A;  4JXG A;  3IXG A;  1PI5 A;  2ZC6 B;  1YLP A;  5CGS A;  5A92 A;  4L0L A;  1TDL A;  3LCE A;  4WZ5 A;  3G32 A;  4WEK A;  1SCW A;  5CHU A;  5E2F A;  3E2L A;  3N8S A;  4HES A;  3W4P A;  3ZGA B;  3WS2 A;  4A5R A;  5CED A;  1Z6F A;  3N7W A;  2HDR A;  1YLZ A;  3Q82 A;  4KG2 A;  2G2W A;  3HUN A;  2WGW B;  3MXR A;  3TG9 A;  3ZDJ A;  1K38 A;  3NCK A;  3IH8 A;  1KGG A;  2WGV A;  3ISG A;  3PTE A;  4IBR A;  4P6B A;  3GQZ A;  1ALQ A;  3UE1 A;  4PM5 A;  4B4X A;  3N8L A;  1E25 A;  3HRE A;  3NDE A;  2UWX A;  4KZ7 A;  3M2J A;  3M6B A;  4HEF A;  1ES5 A;  5CER A;  1PWC A;  4QY6 A;  2Y2O A;  4U3T A;  4B4Z A;  3G2Y A;  1RP5 A;  1KE4 A;  1EWZ A;  2B5R A;  3UPN A;  1U60 A;  1S6R A;  4S2N A;  3V39 A;  1XGI A;  3LY4 A;  4KEN B;  1W7F A;  5M1A A;  3ZNT A;  4GKU A;  5CGX A;  2R9X A;  4N1X A;  5HW3 A;  1WYC A;  4IVK A;  4LV3 A;  3MZD A;  1JTG A;  4NET A;  1LL5 A;  1O07 A;  3PBR A;  1Q2P A;  5FAT A;  2G2U A;  2Y2G A;  3VP2 A;  4KZ8 A;  4Y0T A;  1SDE A;  3UNW A;  1G68 A;  1WE4 A;  1FSY A;  3O3V A;  1ZG6 A;  3IXB A;  1J9M A;  4JF5 A;  4X56 A;  4RX3 A;  5F83 A;  4ZJ1 A;  4R4R A;  4KG5 A;  1YLJ A;  4KZ5 A;  1H8Z A;  4NK3 A;  4Y7P A;  5M19 A;  1W8Y A;  3BFG A;  4JKT A;  3UDI A;  2PU4 A;  4Y0U A;  1TDG A;  5JYO A;  4OQ0 A;  4R0Q A;  5CTN A;  1CI8 A;  1E3U D;  3VP4 A;  3ZG8 B;  1C3B A;  3UN7 A;  1PWG A;  1FSW A;  2HDS A;  1TVF A;  1BLH A;  3CJM A;  4X68 A;  3TOI A;  4KZ6 A;  3SS4 A;  2P9V A;  5KZH A;  5FSR A;  4GZB A;  3HLC A;  3ZFZ A;  2IWB A;  3PBS A;  1KGE A;  4FCF A;  3UE0 A;  4OP5 A;  3GSG A;  2ZQ9 A;  3M6H A;  4OLG A;  3WRT A;  4HBT A;  2ZM0 A;  4UHU A;  4BEN A;  3IWI A;  1G6A A;  3G2Z A;  3BEC A;  4H8R A;  1ZKJ A;  3Q7V A;  5F1G A;  2PBY A;  2Y2K A;  4JF6 A;  4ZAM A;  3MZF A;  3GMW A;  3W4O A;  4GB7 A;  4JF4 A;  5FDH A;  1NJ4 A;  3G31 A;  1FCN A;  4WZ4 A;  5KSC A;  5JYP A;  3N4I A;  3PBN A;  5EOE A;  3V50 A;  4BLM A;  5DTK A;  3OPL A;  4UA7 A;  3UDF A;  3NBL A;  1KDW A;  3BFE A;  4X69 A;  4IED A;  5CTM A;  4KQQ A;  3IF5 A;  3O86 A;  1ESU A;  2EX8 A;  4OKP A;  3UY6 A;  1XA1 A;  4GNU A;  4Y0O A;  1ES4 A;  4OOM A;  1W79 A;  2WKH A;  4GDN A;  4FD8 A;  5DVA A;  4YIN A;  2ZLY A;  2ZQD A;  2Y91 A;  1FQG A;  2P9V B;  4KZ9 A;  2VGK A;  5FQK A;  3BRM A;  5FAP A;  4ZJ3 A;  1IEL A;  4JXW A;  3O87 A;  2RL3 A;  1SHV A;  2XDM A;  2H0Y A;  4KZ3 A;  5TGF A;  5F82 A;  5AQ9 A;  3WS0 A;  1FOF A;  5FI2 A;  1OME A;  2Y2P A;  3IT9 A;  4EUZ A;  3BFC A;  3C5A A;  3ZG0 A;  3HBR A;  1BUE A;  3ZCZ A;  1PI4 A;  4OPY A;  1PWD A;  2E8I A;  4MBF A;  4DE3 A;  5A93 A;  1DJB A;  4S2J A;  5GL9 A;  3IXH A;  1KGF A;  1PZP A;  4S2N C;  5HX9 A;  1FCM A;  5FAQ A;  1BUL A;  4MBH A;  1EI5 A;  1K25 A;  2EX6 A;  1GA0 A;  3V3S A;  5GLD A;  4S2K A;  2Z2L B;  3HLW A;  3BFF A;  5EVI C;  2RCX A;  4K0W A;  2VGJ A;  5FQM A;  2ZQ8 A;  1YT4 A;  4EV4 A;  4GD8 A;  4U0X A;  2WAD A;  4ZDX A;  3GTC A;  4K91 A;  2Y2J A;  3UPP A;  2DRW A;  1KVL A;  3CZD A;  1BZA A;  1ONH A;  3MFD A;  3IF6 B;  1SDN A;  4OP8 A;  4ZBE A;  5HAP A;  3AGD A;  4S2O A;  4N9K A;  1FR6 A;  5EOO A;  2WKI A;  5CHM A;  1XXM A;  1GHI A;  2QMI A;  3GVB A;  4JXV A;  5KMW A;  2XH9 A;  4X6T A;  3LY3 A;  5DTT A;  3TSG A;  3RXW A;  4DXB A;  1LI9 A;  4MEZ A;  1DJC A;  1WYB A;  3HLB A;  3IHA A;  5I94 A;  5GLC A;  1MWS A;  3ZHH A;  4EBL A;  4LCL A;  2XD5 A;  5EVI A;  3VFH A;  1QMF A;  4DDS A;  2ZJ9 A;  3DTM A;  4OQG A;  3VOY A;  1VM1 A;  1YQS A;  2ZQA A;  4DF6 A;  1JTD A;  3PAG A;  1HTZ A;  3FYZ A;  3SH9 A;  1MKI A;  1ERO A;  4OPQ A;  2Q9N A;  1Q2Q A;  3PAE A;  5HAI A;  4P85 A;  3A3J A;  4RX2 A;  1JWP A;  1PZO A;  5CRF A;  1FCO A;  1MWT A;  4DE1 A;  5EEC A;  4JXS A;  5HFO A;  4MNR A;  4GD6 A;  3I7J A;  3M2K A;  3AGE A;  1HVB A;  5U47 A;  3A3F A;  4D2O A;  3G34 A;  3MKF A;  5TR7 A;  4GOG A;  4QB8 A;  4WBG A;  4DDY A;  3EQV A;  1W8Q A;  3C4P A;  2JE5 A;  3DW0 A;  4BD0 A;  4FH4 A;  1HD8 A;  1QME A;  2H0T A;  2X01 A;  2HP6 A;  4OON A;  2ZC7 A;  4N92 A;  2BLS A;  1ES2 A;  1JVJ A;  3NY4 A;  1BLS A;  1XGJ A;  4IBX A;  4WM9 A;  5EVI D;  5CGW A;  4KZ4 A;  2FFY A;  5EPH A;  2EX9 A;  1H5X A;  1YMS A;  4BL3 A;  2WZX A;  4LV1 A;  1IYO A;  2J9P A;  5DF7 A;  4ZTK A;  4DE0 A;  2H10 A;  2XQZ A;  3FWL A;  2ZC4 B;  3GRJ A;  5E2E A;  2HP9 A;  4QU3 A;  1KVM A;  3C7U A;  5AQB A;  3HUM A;  5CXW A;  2C6W B;  1GHM A;  1XA7 A;  2Y4A A;  1BT5 A;  4PM9 A;  4Z9Q A;  5J8X A;  2JC7 A;  1CEG A;  2J9O A;  4WEL A;  4OPR A;  3FKV A;  3BEB A;  3V3R A;  3NC8 A;  1HZO A;  1K6S A;  3IHB A;  1XX2 A;  1RGZ A;  1LLB A;  1YM1 A;  2JBF A;  3P09 A;  4EBN A;  4E3K A;  1NXY A;  3ITB A;  4OVD A;  2XFS A;  4OLD A;  5HAR A;  4X55 A;  3IQA A;  1BSG A;  4JLF A;  2H5S A;  1MPL A;  2XR0 A;  3JYI A;  3EQU A;  4RYE A;  4E6W A;  1PIO A;  4YFM A;  4WMC A;  4PM7 A;  3ZG9 B;  1K6R A;  3OPH A;  3VOZ A;  2ZC5 B;  5A90 A;  4MLL A;  4Q8I A;  5DF9 A;  3UO9 A;  3WS5 A;  1K4F A;  2WKE A;  3SH8 A;  4E3L A;  4M3K A;  1ONG A;  1PYY A;  1IEM A;  4N9L A;  3W8K A;  3OPR A;  2V2F F;  1NZO A;  1XKZ A;  5D3O A;  5BOH A;  4O7D A;  4S2I A;  5L2F A;  3UDX A;  1K4E A;  3PBT A;  1IYQ A;  2WZZ A;  2XF3 A;  2EX2 A;  2EXA A;  1K54 C;  3G30 A;  5FQQ A;  4DE2 A;  1I2S A;  2V20 A;  3ZG5 A;  1AXB A;  1NY0 A;  2QZ6 A;  4BQM A;  1JWZ A;  2WGW A;  1VQQ A;  2XGN A;  4E3J A;  3OPP A;  4GDB A;  1BTL A;  1IKI A;  2WGI A;  3QNC A;  3Q7V B;  3PBQ A;  3A3E A;  4R1G A;  4F94 A;  4DXC A;  5F1F A;  1ES3 A;  1ZC2 A;  4FSF A;  4LV2 A;  4KZA A;  4KQR A;  4MBK A;  3V5M A;  5FAS A;  3NIA A;  1ZG4 A;  5HAQ A;  3LO7 A;  4UA9 A;  3S4X A;  2EFU A;  4PM6 A;  3SH7 A;  1JWV A;  3S1Y A;  2DCF A;  1LL9 A;  2XFT A;  3BFD A;  2P74 A;  3B3X A;  4RA7 A;  2WAE A;  2PU2 A;  4WEJ A;  1N9B A;  1K54 A;  2FFF B;  3BYD A;  4KG6 A;  5FQJ A;  5KSH A;  3S22 A;  4XUZ A;  2WK0 A;  3BLS A;  3QNB A;  2X02 A;  3C7V A;  5FQI A;  1MWU A;  3N8R A;  1CEF A;  2EXB A;  1KE0 A;  5FA7 A;  1K57 C;  1Y54 A;  4E3O A;  2WYX A;  2A49 A;  2Y2L A;  2Y2N A;  1L0E A;  1YLT A;  3QHY A;  1XP4 A;  2ZQ7 A;  3C4O A;  1NZU A;  1YLW A;  4P87 A;  4R4S A;  1NRF A;  5CHJ A;  4C3Q A;  3NI9 A;  5GLA A;  3HLE A;  3BLM A;  2Q9M A;  3GR2 A;  3VFF A;  3BM6 A;  2Z2M B;  1FR1 A;  2HDQ A;  4R3J A;  5FI7 A;  5CEB A;  4R3B A;  1M6K A;  2WAF A;  1GHP A;  2ZC3 B;  5DTS A;  3Q1F A;  1NYM A;  3GV9 A;  2Y2M A;  3OCL A;  2XLN A;  3AGF A;  4PPR A;  4N1H A;  3WS4 A;  5FAO A;  4S2M A;  3VSK A;  2Y55 A;  4X53 A;  3VP1 A;  3RXX A;  1K57 A;  1LHY A;  4OOY A;  1PW1 A;  5FQ9 A;  3O88 A;  2ZMA A;  5IHV A;  4RVA A;  3OZH A;  3ZNY A;  3P98 A;  4KZB A;  4QJG A;  5FI6 A;  2XEP A;  2EFX A;  4P0M A;  3ZG7 B;  2XD1 A;  3WRZ A;  4E3I A;  1L0F A;  2JCH A;  2BG1 A;  4OPZ A;  2OLV A;  2X71 A;  5G18 A;  5CEC A;  3VSL A;  3E2K A;  1E3U A;  4C6Y A;  5A91 A;  3SOI A;  1CI9 A;  3ZVW A;  4BJP A;  2J8Y A;  2DNS A;  3IH9 A;  4U0T A;  2OSU A;  5EVL A;  4EQI A;  1BLC A;  2Y2I A;  1DJA A;  1PW8 A;  1K55 C;  3ITA A;  1CK3 A;  4EBP A;  5E2G A;  1TEM A;  4OQI A;  1KE3 A;  4FH2 A;  1XPB A;  3SS3 A;  1RCJ A;  5EVI B;  2Y59 A;  3G35 A;  4LCM A;  3G4P A;  4E6X A;  4QY5 A;  4EWF A;  1GCE A;  3W4Q A;  1IYP A;  2ZM2 A;  4E3M A;  1L0D A;  3MXS A;  3HUO A;  5AQA A;  3Q07 A;  4S2P A;  3FKW A;  1O7E A; 
#chains in the Genus database with same CATH topology
 1T1C A;  2IWD A;  2HPB A;  4CPK A;  3UB9 A;  1F2K A;  2VGL M;  3IWO A;  2V9A A;  1TF1 A;  1VET B;  1YKD A;  1IYS A;  3T1R A;  2M1C A;  4HOI A;  4DRT A;  4GLQ A;  2ZM8 A;  3DWZ A;  2H28 A;  2XK1 A;  2OV5 A;  2A2L A;  2Y2H A;  4WL9 A;  5TBM A;  3VP3 A;  4WMC D;  3IF6 A;  3FV7 A;  4LFU A;  3Q7Z A;  4O01 A;  3UE3 A;  3WS1 A;  1K56 D;  3VP0 A;  3HLD A;  2Y2Q A;  3HLG A;  4IUK A;  3OC2 A;  3IX4 A;  2QPN A;  1J3W A;  4ZJ2 A;  2J7V A;  3R4K A;  2ZC6 B;  4L0L A;  2M7V A;  4WZ5 A;  3E2L A;  5CX7 A;  5HZH A;  3N7W A;  2OAP 1;  3HUN A;  2WKR A;  3C30 A;  2PYR A;  3IH8 A;  1F98 A;  4KZ7 A;  1ES5 A;  1PWC A;  3NUL A;  4QY6 A;  2A24 A;  2B5R A;  1EWZ A;  3V39 A;  3ZNT A;  2R9X A;  4N1X A;  1WYC A;  2ZMV A;  3LR5 A;  1JTG A;  1LL5 A;  3L9K A;  1T18 A;  4Y0T A;  3CPT B;  3UNW A;  3PR6 A;  2CMN A;  1GSW A;  1UWP X;  1ZG6 A;  3O3V A;  1J9M A;  5F83 A;  4ZJ1 A;  4KZ5 A;  2JKT M;  2O0Y A;  3CLO A;  4Y0U A;  4OQ0 A;  5CTN A;  2A24 B;  3VV4 A;  1FSW A;  2HDS A;  1TVF A;  3DTK A;  5KZH A;  3C38 A;  5FSR A;  2IWB A;  3PBS A;  3UE0 A;  3GSG A;  4OLG A;  3M6H A;  1SZV A;  4L9G A;  3IWI A;  1Y4O A;  2PBY A;  4ZAM A;  3W4O A;  4GB7 A;  4GW9 A;  5FDH A;  1NJ4 A;  1FCN A;  1HLU P;  4WZ4 A;  4BLM A;  3UDF A;  3NBL A;  5HWV A;  4IED A;  4KQQ A;  3O86 A;  5EM0 A;  4OKP A;  3UY6 A;  3VOL A;  3T4S A;  4OOM A;  1W79 A;  2WKH A;  4GHI A;  5DFY A;  2H0Y A;  1OME A;  3KYE A;  2EWV A;  2KX6 A;  2VGL S;  5A93 A;  3ICY A;  5HX9 A;  3H9W A;  1EI5 A;  2EX6 A;  3MF0 A;  4S2K A;  3BFF A;  4K0W A;  3LGO A;  5FQM A;  1VEU A;  2WAD A;  2Y2J A;  3UPP A;  3CZD A;  5HAP A;  3AGD A;  4EES A;  4N9K A;  5EOO A;  4Z1W A;  4HI4 A;  5K5B A;  4G3W A;  4GHI B;  1NLZ A;  2XH9 A;  3LY3 A;  1LI9 A;  3IHA A;  3ZHH A;  2XD5 A;  1QMF A;  2ZJ9 A;  4OQG A;  2JKR M;  4QWO A;  3HJK A;  3SH9 A;  1ERO A;  3A3J A;  5HFO A;  4MNR A;  4GD6 A;  3I7J A;  3M2K A;  3AGE A;  1HVB A;  5U47 A;  2PR6 A;  4HJ3 A;  4GOG A;  5HPI A;  3RH8 B;  3EQV A;  3DW0 A;  4BD0 A;  1QME A;  2HP6 A;  4N92 A;  3NY4 A;  1ES2 A;  1BLS A;  4KZ4 A;  3H7W A;  3S7P A;  4NKP A;  2E8J A;  4ZTK A;  3BJN A;  1KVM A;  5AQB A;  3HUM A;  4PM9 A;  5J8X A;  2JC7 A;  4CLC B;  3BEB A;  1XX2 A;  1RGZ A;  1YM1 A;  4H6J A;  3QP1 A;  4JLF A;  2XR0 A;  3CUE A;  3UB6 A;  4G3V A;  4YOF A;  3KSH A;  2OWJ A;  4KUO A;  4I39 A;  3ZG9 B;  5G4Z A;  4B93 A;  2UV0 E;  4R70 A;  4Q8I A;  2W3F A;  3H7W B;  3WS5 A;  1K4F A;  2WKE A;  2VV7 A;  1IEM A;  1G5U A;  3NOP C;  4JGO A;  1NZO A;  4ETZ A;  5HDC A;  1IYQ A;  2JHE A;  1LSX A;  3G30 A;  2EXA A;  5FQQ A;  4DE2 A;  1H8M A;  1AXB A;  2QZ6 A;  2WGW A;  2GJ3 A;  2LB9 A;  3PBQ A;  5TJJ A;  3MFX A;  5HDS A;  4R1G A;  2V8F A;  4FSF A;  4KZA A;  1H0M A;  2PYP A;  3S4X A;  4Y2F A;  3GDI A;  1JWV A;  3BFD A;  2KDK A;  2P74 A;  1S1Z A;  3PXP A;  1DP8 A;  2PU2 A;  1N9B A;  2OAQ 1;  1NRJ A;  2FFF B;  3FPW A;  5KSH A;  3S22 A;  2ZOI A;  4YNR A;  5FQI A;  1CEF A;  1K57 C;  1A0K A;  1XP4 A;  4R4S A;  5C5K A;  1NRF A;  4O8G A;  3NI9 A;  4LRX C;  5GLA A;  2Q9M A;  3GR2 A;  1XJ6 A;  2Z2M B;  1FR1 A;  5CEB A;  4M4X A;  3Q1F A;  1NYM A;  2ZL1 B;  3GV9 A;  2Y2M A;  3BY8 A;  2O99 A;  1SKO A;  4X53 A;  4HH3 A;  1P9R A;  4RVA A;  3OZH A;  3P98 A;  4P0M A;  3E4O A;  3WRZ A;  4HJ6 A;  5F69 A;  2BG1 A;  5CEC A;  4Y13 A;  2WKP A;  3D3O A;  4I3J A;  4LPZ A;  4Q0H A;  4II7 A;  1K55 C;  3R7W A;  3ITA A;  5IU1 A;  1G6O A;  1RCJ A;  2XRO A;  1TS7 A;  3G35 A;  3G4P A;  4LCM A;  2PD7 A;  1TS6 A;  5AQA A;  3EOI A;  4BMW A;  4XXR A;  1CJF A;  2I72 A;  1D7E A;  4QD4 A;  1NYY A;  4CJN A;  3A3D A;  4OOL A;  3K3D A;  3VMA A;  2KOI A;  3OOV A;  5AQ7 A;  5GHZ A;  1XJ2 A;  3HVF A;  3FZC A;  2AVX A;  4XUX A;  1K56 A;  4KQO A;  1LI0 A;  1ERM A;  1XFQ A;  2V1Z A;  1W5D A;  3HL9 A;  2GDN A;  2ZBB A;  3KO6 A;  4LV0 A;  3WWX A;  4LRZ E;  5AJG A;  2K2N A;  3CG5 A;  5HWW A;  2WUQ A;  1L2S A;  2VK3 A;  1E4D A;  3Q81 A;  2XRN A;  1ERQ A;  3MBZ A;  1L0G A;  4ID4 A;  1SKF A;  2KLI A;  4K0X A;  4UEY A;  1D1J A;  4MN6 A;  2HP5 A;  4HBU A;  5GHY A;  3IX3 A;  1YLY A;  2J80 A;  3QP6 A;  1ESI A;  2ZD8 A;  3IXG A;  1PI5 A;  3UMD A;  3F1O A;  3JPU A;  1SCW A;  5E2F A;  3W4P A;  1Z6F A;  5FL3 A;  2Z6D A;  1S67 L;  1N9N A;  2V0U A;  3TG9 A;  3QP2 A;  1K38 A;  3NCK A;  3L7H A;  4X25 A;  3PTE A;  4P6B A;  4NG2 A;  4PM5 A;  4UQI M;  4B4X A;  1E25 A;  3HRE A;  3NDE A;  2UWX A;  4Q0I A;  3M2J A;  3M6B A;  3CI6 A;  3KYQ A;  2Y2O A;  4U3T A;  4B4Z A;  3G2Y A;  3BWL A;  1N9L A;  1KE4 A;  1U60 A;  1S6R A;  4S2N A;  4KEN B;  5CGX A;  4IVK A;  2L4R A;  5DKK A;  3MZD A;  1AWI A;  3PBR A;  3E4Q A;  1Q2P A;  1SDE A;  3QP8 A;  1S1Y A;  1G68 A;  1WE4 A;  5J7E A;  4JF5 A;  1MKM A;  4R4R A;  4EUV A;  4Y7P A;  4JKT A;  3UDI A;  1TDG A;  4HJ4 A;  5JYO A;  4R0Q A;  1C3B A;  4HH2 A;  1PWG A;  3JVU A;  3LIA A;  2DMW A;  1KGE A;  3MS6 A;  4HBT A;  3FC7 A;  4BEN A;  3T4T A;  3G2Z A;  3LIB A;  3BEC A;  3Q7V A;  2HJ9 C;  2J3T C;  2XSS A;  2OOL A;  5G4Y A;  3MZF A;  1WA9 A;  3F1N A;  4EU0 A;  3PBN A;  4B9O A;  3OPL A;  3BQ8 A;  2IA2 A;  4X69 A;  3LIC A;  5CTM A;  4I3I A;  1XA1 A;  1ES4 A;  5DVA A;  2Y91 A;  1FQG A;  5HWT A;  5HD3 A;  3O87 A;  2RL3 A;  2XDM A;  1FOF A;  3IT9 A;  4EUZ A;  2B95 A;  2PDR A;  2W0N A;  4OPY A;  4MBF A;  4DE3 A;  3E4P A;  3A0V A;  1IFQ A;  4S2J A;  5GL9 A;  3IXH A;  4S2N C;  5FAQ A;  1BUL A;  4MBH A;  3E0Y A;  3F1N B;  3HLW A;  5EVI C;  4U0X A;  3UE6 A;  4ZDX A;  2J3T D;  1T19 A;  5TBM B;  2DRW A;  1KVL A;  1BZA A;  1ONH A;  3IF6 B;  1SDN A;  3V67 A;  4S2O A;  1PNE A;  2V8C A;  3MQQ A;  2W1R A;  1PFL A;  5EVE A;  3MMH A;  1W63 M;  4MEZ A;  1DJC A;  1WYB A;  5I94 A;  5GLC A;  4EBL A;  4IJG A;  1F9I A;  3VE3 A;  3DTM A;  1VM1 A;  1YQS A;  2B18 A;  2ZQA A;  2VLG A;  1HTZ A;  3FYZ A;  1MKI A;  2QWS A;  1Q2Q A;  3PAE A;  4P85 A;  4PAU A;  1FCO A;  1MWT A;  1ZTU A;  3T1S A;  3EEA A;  2GNX A;  4LRY C;  3IS2 A;  4D2O A;  3G6O A;  4DDY A;  2NUP C;  3C4P A;  5HL6 A;  5MC7 A;  1HD8 A;  3IBJ A;  4OON A;  4L9F A;  2Y8H A;  1JVJ A;  5EVI D;  1XGJ A;  4IBX A;  2PD8 A;  5DKL A;  2YKH A;  4BL3 A;  2W1T A;  4LV1 A;  5DF7 A;  1TS8 A;  2H10 A;  4Y17 A;  2ZC4 B;  2P04 A;  2C6W B;  1GHM A;  3NOT C;  1BT5 A;  2W3G A;  3OLO A;  1HZO A;  2D01 A;  1LLB A;  2JBF A;  1EW0 A;  1NXY A;  3UME A;  1LSW A;  1BSG A;  3TW8 A;  2H5S A;  3EQU A;  4RYE A;  4E6W A;  1PIO A;  3CAX A;  3KSI A;  3OPH A;  3MSH A;  4M3K A;  1ONG A;  3KSF A;  2V2F F;  1XKZ A;  5D3O A;  4S2I A;  2XF3 A;  1K54 C;  1I2S A;  2V20 A;  4E3J A;  4GDB A;  2PR5 A;  1BTL A;  2WGI A;  4F94 A;  4DXC A;  5F1F A;  1ES3 A;  1ZHH B;  2MJ6 A;  3NIA A;  3LO7 A;  1UWN X;  2DCF A;  1LL9 A;  4R3A A;  4RA7 A;  4XUZ A;  2X02 A;  1MC0 A;  1LSV A;  4Q0J A;  2WYX A;  2A49 A;  2Y2L A;  4JGR A;  2Y2N A;  3LI8 A;  4P87 A;  4C3Q A;  3HLE A;  5EV0 A;  3QP5 A;  5IS1 A;  5FI7 A;  2WAF A;  3OCL A;  1Z09 A;  4S2M A;  3VP1 A;  2VJW A;  1XFN A;  3RXX A;  1K57 A;  1PW1 A;  4HY8 A;  1VEU B;  4KZB A;  4QJG A;  5FI6 A;  2XEP A;  4ZRR A;  2JCH A;  2OLV A;  4R38 A;  3VSL A;  1E3U A;  1OJ5 A;  1GSX A;  2W3H A;  4NXB A;  2J8Y A;  2DNS A;  4U0T A;  1BLC A;  4R6L A;  5E2G A;  4ARZ A;  1XPB A;  4MN7 A;  4FOF A;  3LYX A;  1H3Q A;  3KX0 X;  1T1B A;  3W4Q A;  1IYP A;  2ZM2 A;  1L0D A;  3MXS A;  4DJ3 A;  4S2P A;  1TD5 A;  5AVF A;  2ZQC A;  1P97 A;  3FG8 A;  1MY8 A;  1K55 A;  4I38 A;  5EUA A;  4UA6 A;  4E3N A;  1YMX A;  3DWK A;  4PHT A;  2P08 A;  3NJA A;  2OLU A;  5TFQ A;  1MWR A;  3HLF A;  1GA9 A;  2HGV A;  5EM1 A;  3BW6 A;  4JPM A;  3RFB A;  4PM8 A;  3MKE A;  4QHC A;  4S2L A;  2C5W B;  2V0W A;  1MXO A;  3D4F A;  4BBU A;  4R23 A;  1I5Q A;  3LIF A;  4DKI A;  4HQA A;  4GS9 A;  3ZVT A;  2VV8 A;  3UPO A;  1IKG A;  3D72 A;  4H6J B;  3OCN A;  5E43 A;  2HDU A;  4OH0 A;  4C75 A;  1N4O A;  3MZE A;  3P01 A;  4LEN A;  3DBA A;  3DAV A;  1BLP A;  5DF8 A;  4WYY A;  4OQH A;  1YLP A;  1FIL A;  4GS9 B;  1Y28 A;  3G32 A;  1GSV A;  1VHM A;  2G7U A;  3ZGA B;  3T4L A;  3D9Y A;  4FTX A;  1YLZ A;  1YSQ A;  3Q82 A;  4KG2 A;  2G2W A;  2WGW B;  5IT5 A;  1D06 A;  5F6A A;  3ZDJ A;  2BAS A;  4CLC C;  2WGV A;  4IBR A;  1ALQ A;  3UE1 A;  3N8L A;  1YAX A;  1P0Z A;  1XGI A;  3LY4 A;  1W7F A;  5M1A A;  5HW3 A;  1O07 A;  3A0R A;  2G2U A;  2M7U A;  2Y2G A;  3VP2 A;  3MR0 A;  3EWK A;  1FSY A;  2R78 A;  4NXG A;  3IXB A;  2QYB A;  4KG5 A;  1YLJ A;  4NK3 A;  1P9W A;  3K3C A;  2JN7 A;  1W8Y A;  3BFG A;  2PU4 A;  1SKO B;  2J3W A;  2ZOH A;  1E3U D;  3VP4 A;  1OTB A;  3UN7 A;  1BLH A;  4CLC D;  4KZ6 A;  3SS4 A;  2P9V A;  3ZYT A;  2B02 A;  4FCF A;  4LGW A;  2D02 A;  3LI9 A;  5L8M A;  2ZM0 A;  4UHU A;  5LBR A;  3R7W B;  2HV1 A;  1G6A A;  1ZKJ A;  4DMZ A;  4GJ4 A;  2Y2K A;  3G31 A;  4ETX A;  4F3L A;  3S7Q A;  5JYP A;  5DJT A;  1KDW A;  3BFE A;  3SZT A;  2EX8 A;  5J4E A;  5FDS A;  4Y0O A;  3NOU C;  5FEG A;  4GDN A;  4FD8 A;  4ME4 A;  2P9V B;  4KZ9 A;  1UGU A;  4ESP A;  5FAP A;  4ZJ3 A;  1IEL A;  4JXW A;  5F82 A;  1F5M A;  3WS0 A;  1FIK A;  5FI2 A;  4L9E A;  2GZA A;  5EFW A;  3UB8 A;  1BUE A;  1BYW A;  1PI4 A;  2E8I A;  3F1P A;  1V9Y A;  3E98 A;  4HP4 A;  5HD5 A;  5HPF A;  1KGF A;  1PZP A;  1FCM A;  4F3L B;  1XJ3 A;  2Z2L B;  2RCX A;  3MQO A;  4X1L A;  1YT4 A;  4EV4 A;  4EEU A;  4GD8 A;  4K91 A;  3VE4 A;  4OP8 A;  3S7O A;  4PKY A;  2JKG A;  3OBF A;  1FR6 A;  2W3D A;  3RTY A;  1GHI A;  2QMI A;  5KMW A;  3TSG A;  4DXB A;  5KIZ A;  3HLB A;  3TJZ C;  4LCL A;  5EVI A;  3VFH A;  4HHD A;  4AFI A;  3VOY A;  4HP9 A;  3F1P B;  1CQA A;  3LIE A;  4DF6 A;  3PAG A;  4OPQ A;  3EGD C;  4YWZ A;  2Q9N A;  3F1O B;  1DP9 A;  5HAI A;  4RX2 A;  1JWP A;  1PZO A;  1S4S A;  1JNU A;  4BWI A;  3EGX C;  3A3F A;  5TR7 A;  5HSQ A;  4QB8 A;  4WBG A;  1DP6 A;  1W8Q A;  2VV6 A;  4FH4 A;  2X01 A;  2BLS A;  3C2W A;  4WM9 A;  5EPH A;  1VET A;  2EX9 A;  1H5X A;  2K7S A;  3UB7 A;  3W2Z A;  2WZX A;  1IYO A;  4DE0 A;  2XQZ A;  3FWL A;  5E2E A;  2HP9 A;  4QU3 A;  5CXW A;  3GEC A;  2J9O A;  4OPR A;  3FKV A;  3V3R A;  3TE8 A;  4EBN A;  3P09 A;  4E3K A;  3ITB A;  4OVD A;  2XFS A;  4OLD A;  3T1Q B;  5HAR A;  4WF0 A;  4YFM A;  3T4O A;  4PM7 A;  1K6R A;  4JGP A;  3HCY A;  3VOZ A;  4BBT A;  2ZC5 B;  1YPR A;  4MLL A;  5A90 A;  3PYP A;  5L07 A;  4E3L A;  5L09 A;  4N9L A;  3OPR A;  5BOH A;  1ACF A;  4KQD A;  1K4E A;  3PBT A;  1OPX A;  4EET B;  1NY0 A;  4BQM A;  3T4Q A;  2XGN A;  2PAV P;  1IKI A;  5HDD A;  3QNC A;  3Q7V B;  2VEA A;  3A3E A;  4MCW A;  3K2N A;  4KQR A;  4MBK A;  3V5M A;  5FAS A;  4UA9 A;  2EFU A;  2ZMF A;  3SH7 A;  3S1Y A;  3B3X A;  2WAE A;  4WEJ A;  1K54 A;  4KG6 A;  3BLS A;  3N8R A;  2EXB A;  1KE0 A;  4Y15 A;  4E3O A;  3CPT A;  1W63 Q;  3QHY A;  3C4O A;  1NZU A;  1YLW A;  5CHJ A;  3BLM A;  3NHQ A;  4XT2 A;  1OTE A;  1KOU A;  2HDQ A;  2ZC3 B;  3AGF A;  4PPR A;  3WS4 A;  3VSK A;  3CHW P;  1LHY A;  4OOY A;  5FQ9 A;  1V9Z A;  3DTI A;  2ZMA A;  5IHV A;  2Q0O A;  2EFX A;  3ZG7 B;  2XD1 A;  4E04 A;  3PHY A;  1ODV A;  4Y3I A;  4OPZ A;  3E2K A;  3SOI A;  5AVE A;  3ZVW A;  4DJ2 A;  4BJP A;  3IH9 A;  5EVL A;  2GX5 A;  4IHQ A;  2Y2I A;  1DJA A;  1PW8 A;  1STZ A;  5FEF A;  4NEE D;  1KE3 A;  4FH2 A;  4XT2 B;  2VX8 A;  4EEP A;  1XJ4 A;  4DN0 A;  4UQI S;  3EEH A;  3T1X A;  4P6Z M;  1GCE A;  2XA7 M;  1L3L A;  3HUO A;  3LEZ A;  5M18 A;  2JKT I;  1MBL A;  3CMZ A;  3IS2 B;  3N6I A;  1RGY A;  4IVI A;  4JBF A;  5E2H A;  4BD1 A;  3PBO A;  1KDS A;  5GLB A;  4GN2 A;  5HL1 A;  3IF6 C;  1S0W A;  3RJU A;  2W1T B;  2O9B A;  1S66 L;  3IXD A;  2W27 A;  4BL2 A;  5A8B A;  2IWC A;  5DFX A;  1OTD A;  4UAA A;  4O0P A;  2A3U A;  1I2W A;  3NDG A;  1M40 A;  3SS5 A;  1CF0 A;  3NEC A;  3LID A;  4WZ5 C;  1NWZ A;  2CC1 A;  4PMA A;  3CWF A;  5GHX A;  2R9W A;  3IWQ A;  3LR3 A;  1H8Y A;  4I3A A;  3LR4 A;  5EE8 A;  4B88 A;  2QHK A;  3A3I A;  5CGS A;  1DY6 A;  4GCZ A;  4JXG A;  4G3K A;  5A92 A;  1TDL A;  3LCE A;  4WN5 A;  4WEK A;  3KSG A;  2K31 A;  5CHU A;  3N8S A;  4HES A;  4A5R A;  4EER A;  3WS2 A;  5CED A;  2HDR A;  3MXR A;  4WLA A;  3P7N A;  1KGG A;  3ISG A;  3GQZ A;  2L0W A;  4EW7 A;  1OT9 A;  5CER A;  2JKF A;  3MJQ A;  4HEF A;  3U4L P;  3MQ0 A;  2FZ0 A;  1RP5 A;  3UPN A;  4CQH A;  4GKU A;  4LLO B;  4LV3 A;  2VKS A;  3BY9 A;  3IBR A;  4NET A;  5FAT A;  3BQA A;  4KZ8 A;  3MXQ A;  4CLC A;  1OTI A;  1LL8 A;  4EXO A;  4X56 A;  2JKR I;  4RX3 A;  2L1M A;  4X1M A;  4MDZ A;  1H8Z A;  4JGQ A;  3QP4 A;  5M19 A;  4WUJ A;  4KUK A;  2HZ5 A;  3IX8 A;  1CI8 A;  1YSP A;  3ZG8 B;  3SW1 A;  1NLY A;  3CJM A;  4X68 A;  3TOI A;  4HIA A;  4GZB A;  2Y79 A;  3HLC A;  3ZFZ A;  4OP5 A;  2ZQ9 A;  3WRT A;  1OT6 A;  4ARZ B;  4H8R A;  3T4K A;  5F1G A;  2PBD P;  4JF6 A;  2EA9 A;  3GMW A;  4JF4 A;  2QJ5 A;  3T4J A;  5KSC A;  3N4I A;  5EOE A;  2O9C A;  3V50 A;  5DTK A;  3B42 A;  4UA7 A;  5F68 A;  3IF5 A;  1ESU A;  4GNU A;  4P6Z S;  2XA7 S;  5L10 A;  4YIN A;  2ZLY A;  2ZQD A;  2VGK A;  5FQK A;  3BRM A;  3S7N A;  1SHV A;  4KZ3 A;  4FUW A;  5TGF A;  2OWH A;  5AQ9 A;  2Y2P A;  2P7J A;  3BFC A;  3C5A A;  3ZG0 A;  5F5Y A;  3HBR A;  3ZCZ A;  1PWD A;  1DJB A;  2ZL1 A;  2WKQ A;  4I5S A;  1N9O A;  1K25 A;  1GA0 A;  3V3S A;  5GLD A;  2VGJ A;  2VA0 A;  2ZQ8 A;  3GTC A;  3MFD A;  4ZBE A;  4PKY G;  3KYZ A;  3ULF A;  2WKI A;  5CHM A;  4NXF A;  1XXM A;  3O5Y A;  3GVB A;  4JXV A;  4X6T A;  5DTT A;  3RXW A;  1X0O A;  3FPV A;  1MWS A;  1OJG A;  3ZQ5 A;  2VZW A;  1S4R A;  2LB5 A;  4DDS A;  1MZU A;  1VB6 A;  1JTD A;  4HNB A;  1TS0 A;  5CRF A;  2EWW A;  4DE1 A;  5EEC A;  4JXS A;  4Y5F A;  2FH5 A;  3G34 A;  3MKF A;  2JE5 A;  3LFV A;  2H0T A;  2ZC7 A;  5CGW A;  2FFY A;  4K08 A;  3CUE C;  1YMS A;  2O9A A;  1LT0 A;  2J9P A;  2NUT C;  3GRJ A;  3C7U A;  1XA7 A;  2Y4A A;  3UB5 P;  4Z9Q A;  4BBV A;  2YKF A;  1CEG A;  4WEL A;  3H82 A;  3NC8 A;  1K6S A;  3IHB A;  3LEQ A;  2BTF P;  4X55 A;  3IQA A;  1MPL A;  3JYI A;  4WMC A;  2ACG A;  5DF9 A;  3A0S A;  3UO9 A;  3SH8 A;  1PYY A;  3LR0 A;  3W8K A;  1PRQ A;  4O7D A;  5L2F A;  3UDX A;  2Z6C A;  2WZZ A;  2EX2 A;  1IOU A;  2V1B A;  3LUQ A;  3ZG5 A;  3U2A A;  4IUH A;  1JWZ A;  3CIT A;  1VQQ A;  3H82 B;  3OPP A;  2HJE A;  3HJI A;  1ZC2 A;  4LV2 A;  5HAQ A;  1ZG4 A;  4EQ1 A;  4PM6 A;  2W3E A;  2XFT A;  3B47 A;  2QJ7 A;  3BYD A;  5FQJ A;  2WK0 A;  3QNB A;  3C7V A;  1MWU A;  5FA7 A;  2PRF A;  1Y54 A;  1K0K A;  4NXE A;  1L0E A;  1YLT A;  2PT7 A;  2ZQ7 A;  4QPR A;  2HF6 A;  1O7E A;  2I9V A;  3VFF A;  3BM6 A;  4R3J A;  4R3B A;  1M6K A;  1GHP A;  5DTS A;  4RQ9 A;  3JVV A;  2XLN A;  4N1H A;  5FAO A;  2Y55 A;  3T50 A;  4MMN A;  5DJU A;  3O88 A;  5J3W A;  3ZNY A;  1OTA A;  3B33 A;  1G28 A;  4CLC E;  3DTE A;  4E3I A;  1L0F A;  1T1A A;  5G18 A;  2X71 A;  4C6Y A;  5A91 A;  1CI9 A;  3C8C A;  2OSU A;  4EQI A;  4D60 A;  3T12 B;  5I5L A;  1CK3 A;  4EBP A;  1TEM A;  4OQI A;  3SS3 A;  2QKP A;  5EVI B;  1DRM A;  2Y59 A;  4E6X A;  4QY5 A;  4EWF A;  2PHY A;  3TRC A;  2INW A;  4MN5 A;  4E3M A;  3Q07 A;  3FKW A;  2V1A A; 
#chains in the Genus database with same CATH homology
 3LEZ A;  5M18 A;  2IWD A;  1MBL A;  3CMZ A;  4XXR A;  2I72 A;  2ZQC A;  2HPB A;  1MY8 A;  3N6I A;  1K55 A;  4CPK A;  1RGY A;  4QD4 A;  4IVI A;  4JBF A;  1NYY A;  4E3N A;  5EUA A;  4UA6 A;  5E2H A;  4BD1 A;  1YMX A;  3PBO A;  4CJN A;  3A3D A;  3DWK A;  3IWO A;  1KDS A;  4OOL A;  2OLU A;  5TFQ A;  3VMA A;  1MWR A;  3HLF A;  5GLB A;  1GA9 A;  4GN2 A;  5AQ7 A;  3IF6 C;  5GHZ A;  5HL1 A;  4JPM A;  4PM8 A;  3HVF A;  3MKE A;  1S0W A;  4QHC A;  4S2L A;  2C5W B;  3RJU A;  1MXO A;  1IYS A;  3D4F A;  3FZC A;  4XUX A;  4R23 A;  1I5Q A;  1K56 A;  4KQO A;  1LI0 A;  1ERM A;  4DRT A;  4DKI A;  3IXD A;  3ZVT A;  2V1Z A;  2ZM8 A;  4BL2 A;  1W5D A;  2IWC A;  3HL9 A;  3DWZ A;  2GDN A;  4LV0 A;  3WWX A;  4UAA A;  2A3U A;  3UPO A;  1I2W A;  2XK1 A;  3NDG A;  1IKG A;  1M40 A;  2OV5 A;  3SS5 A;  3CG5 A;  4WZ5 C;  2CC1 A;  2Y2H A;  3OCN A;  4PMA A;  5E43 A;  3VP3 A;  4WMC D;  2HDU A;  2R9W A;  3FV7 A;  3IF6 A;  5GHX A;  2WUQ A;  3IWQ A;  3Q7Z A;  4OH0 A;  4C75 A;  3UE3 A;  3WS1 A;  1L2S A;  1N4O A;  1E4D A;  3MZE A;  1H8Y A;  3Q81 A;  3MBZ A;  1ERQ A;  1L0G A;  1K56 D;  3VP0 A;  3HLD A;  4LEN A;  4ID4 A;  1SKF A;  4K0X A;  2Y2Q A;  3HLG A;  1BLP A;  2HP5 A;  5DF8 A;  5EE8 A;  3OC2 A;  4HBU A;  5GHY A;  2QPN A;  1YLY A;  4B88 A;  4WYY A;  4ZJ2 A;  2J7V A;  4OQH A;  1ESI A;  2ZD8 A;  1DY6 A;  3A3I A;  4JXG A;  3IXG A;  1PI5 A;  2ZC6 B;  1YLP A;  5CGS A;  5A92 A;  4L0L A;  1TDL A;  3LCE A;  4WZ5 A;  3G32 A;  4WEK A;  1SCW A;  5CHU A;  5E2F A;  3E2L A;  3N8S A;  4HES A;  3W4P A;  3ZGA B;  3WS2 A;  4A5R A;  5CED A;  1Z6F A;  3N7W A;  2HDR A;  1YLZ A;  3Q82 A;  4KG2 A;  2G2W A;  3HUN A;  2WGW B;  3MXR A;  3TG9 A;  3ZDJ A;  1K38 A;  3NCK A;  3IH8 A;  1KGG A;  2WGV A;  3ISG A;  3PTE A;  4IBR A;  4P6B A;  3GQZ A;  1ALQ A;  3UE1 A;  4PM5 A;  4B4X A;  3N8L A;  1E25 A;  3HRE A;  3NDE A;  2UWX A;  4KZ7 A;  3M2J A;  3M6B A;  4HEF A;  1ES5 A;  5CER A;  1PWC A;  4QY6 A;  2Y2O A;  4U3T A;  4B4Z A;  3G2Y A;  1RP5 A;  1KE4 A;  1EWZ A;  2B5R A;  3UPN A;  1U60 A;  1S6R A;  4S2N A;  3V39 A;  1XGI A;  3LY4 A;  4KEN B;  1W7F A;  5M1A A;  3ZNT A;  4GKU A;  5CGX A;  2R9X A;  4N1X A;  5HW3 A;  1WYC A;  4IVK A;  4LV3 A;  3MZD A;  1JTG A;  4NET A;  1LL5 A;  1O07 A;  3PBR A;  1Q2P A;  5FAT A;  2G2U A;  2Y2G A;  3VP2 A;  4KZ8 A;  4Y0T A;  1SDE A;  3UNW A;  1G68 A;  1WE4 A;  1FSY A;  3O3V A;  1ZG6 A;  3IXB A;  1J9M A;  4JF5 A;  4X56 A;  4RX3 A;  5F83 A;  4ZJ1 A;  4R4R A;  4KG5 A;  1YLJ A;  4KZ5 A;  1H8Z A;  4NK3 A;  4Y7P A;  5M19 A;  1W8Y A;  3BFG A;  4JKT A;  3UDI A;  2PU4 A;  4Y0U A;  1TDG A;  5JYO A;  4OQ0 A;  4R0Q A;  5CTN A;  1CI8 A;  1E3U D;  3VP4 A;  3ZG8 B;  1C3B A;  3UN7 A;  1PWG A;  1FSW A;  2HDS A;  1TVF A;  1BLH A;  3CJM A;  4X68 A;  3TOI A;  4KZ6 A;  3SS4 A;  2P9V A;  5KZH A;  5FSR A;  4GZB A;  3HLC A;  3ZFZ A;  2IWB A;  3PBS A;  1KGE A;  4FCF A;  3UE0 A;  4OP5 A;  3GSG A;  2ZQ9 A;  3M6H A;  4OLG A;  3WRT A;  4HBT A;  2ZM0 A;  4UHU A;  4BEN A;  3IWI A;  1G6A A;  3G2Z A;  3BEC A;  4H8R A;  1ZKJ A;  3Q7V A;  5F1G A;  2PBY A;  2Y2K A;  4JF6 A;  4ZAM A;  3MZF A;  3GMW A;  3W4O A;  4GB7 A;  4JF4 A;  5FDH A;  1NJ4 A;  3G31 A;  1FCN A;  4WZ4 A;  5KSC A;  5JYP A;  3N4I A;  3PBN A;  5EOE A;  3V50 A;  4BLM A;  5DTK A;  3OPL A;  4UA7 A;  3UDF A;  3NBL A;  1KDW A;  3BFE A;  4X69 A;  4IED A;  5CTM A;  4KQQ A;  3IF5 A;  3O86 A;  1ESU A;  2EX8 A;  4OKP A;  3UY6 A;  1XA1 A;  4GNU A;  4Y0O A;  1ES4 A;  4OOM A;  1W79 A;  2WKH A;  4GDN A;  4FD8 A;  5DVA A;  4YIN A;  2ZLY A;  2ZQD A;  2Y91 A;  1FQG A;  2P9V B;  4KZ9 A;  2VGK A;  5FQK A;  3BRM A;  5FAP A;  4ZJ3 A;  1IEL A;  4JXW A;  3O87 A;  2RL3 A;  1SHV A;  2XDM A;  2H0Y A;  4KZ3 A;  5TGF A;  5F82 A;  5AQ9 A;  3WS0 A;  1FOF A;  5FI2 A;  1OME A;  2Y2P A;  3IT9 A;  4EUZ A;  3BFC A;  3C5A A;  3ZG0 A;  3HBR A;  1BUE A;  3ZCZ A;  1PI4 A;  4OPY A;  1PWD A;  2E8I A;  4MBF A;  4DE3 A;  5A93 A;  1DJB A;  4S2J A;  5GL9 A;  3IXH A;  1KGF A;  1PZP A;  4S2N C;  5HX9 A;  1FCM A;  5FAQ A;  1BUL A;  4MBH A;  1EI5 A;  1K25 A;  2EX6 A;  1GA0 A;  3V3S A;  5GLD A;  4S2K A;  2Z2L B;  3HLW A;  3BFF A;  5EVI C;  2RCX A;  4K0W A;  2VGJ A;  5FQM A;  2ZQ8 A;  1YT4 A;  4EV4 A;  4GD8 A;  4U0X A;  2WAD A;  4ZDX A;  3GTC A;  4K91 A;  2Y2J A;  3UPP A;  2DRW A;  1KVL A;  3CZD A;  1BZA A;  1ONH A;  3MFD A;  3IF6 B;  1SDN A;  4OP8 A;  4ZBE A;  5HAP A;  3AGD A;  4S2O A;  4N9K A;  1FR6 A;  5EOO A;  2WKI A;  5CHM A;  1XXM A;  1GHI A;  2QMI A;  3GVB A;  4JXV A;  5KMW A;  2XH9 A;  4X6T A;  3LY3 A;  5DTT A;  3TSG A;  3RXW A;  4DXB A;  1LI9 A;  4MEZ A;  1DJC A;  1WYB A;  3HLB A;  3IHA A;  5I94 A;  5GLC A;  1MWS A;  3ZHH A;  4EBL A;  4LCL A;  2XD5 A;  5EVI A;  3VFH A;  1QMF A;  4DDS A;  2ZJ9 A;  3DTM A;  4OQG A;  3VOY A;  1VM1 A;  1YQS A;  2ZQA A;  4DF6 A;  1JTD A;  3PAG A;  1HTZ A;  3FYZ A;  3SH9 A;  1MKI A;  1ERO A;  4OPQ A;  2Q9N A;  1Q2Q A;  3PAE A;  5HAI A;  4P85 A;  3A3J A;  4RX2 A;  1JWP A;  1PZO A;  5CRF A;  1FCO A;  1MWT A;  4DE1 A;  5EEC A;  4JXS A;  5HFO A;  4MNR A;  4GD6 A;  3I7J A;  3M2K A;  3AGE A;  1HVB A;  5U47 A;  3A3F A;  4D2O A;  3G34 A;  3MKF A;  5TR7 A;  4GOG A;  4QB8 A;  4WBG A;  4DDY A;  3EQV A;  1W8Q A;  3C4P A;  2JE5 A;  3DW0 A;  4BD0 A;  4FH4 A;  1HD8 A;  1QME A;  2H0T A;  2X01 A;  2HP6 A;  4OON A;  2ZC7 A;  4N92 A;  2BLS A;  1ES2 A;  1JVJ A;  3NY4 A;  1BLS A;  1XGJ A;  4IBX A;  4WM9 A;  5EVI D;  5CGW A;  4KZ4 A;  2FFY A;  5EPH A;  2EX9 A;  1H5X A;  1YMS A;  4BL3 A;  2WZX A;  4LV1 A;  1IYO A;  2J9P A;  5DF7 A;  4ZTK A;  4DE0 A;  2H10 A;  2XQZ A;  3FWL A;  2ZC4 B;  3GRJ A;  5E2E A;  2HP9 A;  4QU3 A;  1KVM A;  3C7U A;  5AQB A;  3HUM A;  5CXW A;  2C6W B;  1GHM A;  1XA7 A;  2Y4A A;  1BT5 A;  4PM9 A;  4Z9Q A;  5J8X A;  2JC7 A;  1CEG A;  2J9O A;  4WEL A;  4OPR A;  3FKV A;  3BEB A;  3V3R A;  3NC8 A;  1HZO A;  1K6S A;  3IHB A;  1XX2 A;  1RGZ A;  1LLB A;  1YM1 A;  2JBF A;  3P09 A;  4EBN A;  4E3K A;  1NXY A;  3ITB A;  4OVD A;  2XFS A;  4OLD A;  5HAR A;  4X55 A;  3IQA A;  1BSG A;  4JLF A;  2H5S A;  1MPL A;  2XR0 A;  3JYI A;  3EQU A;  4RYE A;  4E6W A;  1PIO A;  4YFM A;  4WMC A;  4PM7 A;  3ZG9 B;  1K6R A;  3OPH A;  3VOZ A;  2ZC5 B;  5A90 A;  4MLL A;  4Q8I A;  5DF9 A;  3UO9 A;  3WS5 A;  1K4F A;  2WKE A;  3SH8 A;  4E3L A;  4M3K A;  1ONG A;  1PYY A;  1IEM A;  4N9L A;  3W8K A;  3OPR A;  2V2F F;  1NZO A;  1XKZ A;  5D3O A;  5BOH A;  4O7D A;  4S2I A;  5L2F A;  3UDX A;  1K4E A;  3PBT A;  1IYQ A;  2WZZ A;  2XF3 A;  2EX2 A;  2EXA A;  1K54 C;  3G30 A;  5FQQ A;  4DE2 A;  1I2S A;  2V20 A;  3ZG5 A;  1AXB A;  1NY0 A;  2QZ6 A;  4BQM A;  1JWZ A;  2WGW A;  1VQQ A;  2XGN A;  4E3J A;  3OPP A;  4GDB A;  1BTL A;  1IKI A;  2WGI A;  3QNC A;  3Q7V B;  3PBQ A;  3A3E A;  4R1G A;  4F94 A;  4DXC A;  5F1F A;  1ES3 A;  1ZC2 A;  4FSF A;  4LV2 A;  4KZA A;  4KQR A;  4MBK A;  3V5M A;  5FAS A;  3NIA A;  1ZG4 A;  5HAQ A;  3LO7 A;  4UA9 A;  3S4X A;  2EFU A;  4PM6 A;  3SH7 A;  1JWV A;  3S1Y A;  2DCF A;  1LL9 A;  2XFT A;  3BFD A;  2P74 A;  3B3X A;  4RA7 A;  2WAE A;  2PU2 A;  4WEJ A;  1N9B A;  1K54 A;  2FFF B;  3BYD A;  4KG6 A;  5FQJ A;  5KSH A;  3S22 A;  4XUZ A;  2WK0 A;  3BLS A;  3QNB A;  2X02 A;  3C7V A;  5FQI A;  1MWU A;  3N8R A;  1CEF A;  2EXB A;  1KE0 A;  5FA7 A;  1K57 C;  1Y54 A;  4E3O A;  2WYX A;  2A49 A;  2Y2L A;  2Y2N A;  1L0E A;  1YLT A;  3QHY A;  1XP4 A;  2ZQ7 A;  3C4O A;  1NZU A;  1YLW A;  4P87 A;  4R4S A;  1NRF A;  5CHJ A;  4C3Q A;  3NI9 A;  5GLA A;  3HLE A;  3BLM A;  2Q9M A;  3GR2 A;  3VFF A;  3BM6 A;  2Z2M B;  1FR1 A;  2HDQ A;  4R3J A;  5FI7 A;  5CEB A;  4R3B A;  1M6K A;  2WAF A;  1GHP A;  2ZC3 B;  5DTS A;  3Q1F A;  1NYM A;  3GV9 A;  2Y2M A;  3OCL A;  2XLN A;  3AGF A;  4PPR A;  4N1H A;  3WS4 A;  5FAO A;  4S2M A;  3VSK A;  2Y55 A;  4X53 A;  3VP1 A;  3RXX A;  1K57 A;  1LHY A;  4OOY A;  1PW1 A;  5FQ9 A;  3O88 A;  2ZMA A;  5IHV A;  4RVA A;  3OZH A;  3ZNY A;  3P98 A;  4KZB A;  4QJG A;  5FI6 A;  2XEP A;  2EFX A;  4P0M A;  3ZG7 B;  2XD1 A;  3WRZ A;  4E3I A;  1L0F A;  2JCH A;  2BG1 A;  4OPZ A;  2OLV A;  2X71 A;  5G18 A;  5CEC A;  3VSL A;  3E2K A;  1E3U A;  4C6Y A;  5A91 A;  3SOI A;  1CI9 A;  3ZVW A;  4BJP A;  2J8Y A;  2DNS A;  3IH9 A;  4U0T A;  2OSU A;  5EVL A;  4EQI A;  1BLC A;  2Y2I A;  1DJA A;  1PW8 A;  1K55 C;  3ITA A;  1CK3 A;  4EBP A;  5E2G A;  1TEM A;  4OQI A;  1KE3 A;  4FH2 A;  1XPB A;  3SS3 A;  1RCJ A;  5EVI B;  2Y59 A;  3G35 A;  4LCM A;  3G4P A;  4E6X A;  4QY5 A;  4EWF A;  1GCE A;  3W4Q A;  1IYP A;  2ZM2 A;  4E3M A;  1L0D A;  3MXS A;  3HUO A;  5AQA A;  3Q07 A;  4S2P A;  3FKW A;  1O7E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...