1F98A

Crystal structure of the photoactive yellow protein mutant t50v
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
125
structure length
125
Chain Sequence
MEHVAFGSEDIENTLAKMDDGQLDGLAFGAIQLDGDGNILQYNAAEGDIVGRDPKQVIGKNFFKDVAPCTDSPEFYGKFKEGVASGNLNTMFEYTFDYQMTPTKVKVHMKKALSGDSYWVFVKRV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords PHOTOACTIVE YELLOW PROTEIN
publication title Coupling of hydrogen bonding to chromophore conformation and function in photoactive yellow protein.
pubmed doi rcsb
source organism Halorhodospira halophila
total genus 32
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2000-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00989 PAS PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 1f98A00
2PR5A 3BY8A 1OJ5A 5F5YA 4HH2A 1LSWA 3LUQA 3LI8A 4B9OA 3UMDA 1LL8A 4WLAA 3H82B 1XJ4A 4GS9A 3P7NA 2WKRA 4RQ9A 2BASA 3UE6A 2D02A 3RTYA 1S66L 1XJ6A 4LLOB 3ULFA 1G28A 2JHEA 4L9GA 3VE4A 1P97A 1V9ZA 4R3AA 1DP8A 2Z6DA 1ODVA 3MFXA 2W27A 3BWLA 5HDSA 4JGPA 3VOLA 5DKKA 2CMNA 5TBMB 5HDCA 5HD3A 3F1NA 2YKHA 1S1YA 3E4OA 4GW9A 1OTAA 3H82A 3LIAA 2D01A 4EQ1A 5G4ZA 4HH3A 1KOUA 3LIBA 3NHQA 5AVFA 2GJ3A 3BY9A 4GCZA 1D06A 1TS0A 3KX0X 3MJQA 4L9EA 2V0WA 5G4YA 5TBMA 2Z6CA 1Y28A 3CAXA 1TS8A 4HJ6A 4K08A 3UB8A 1TS7A 3B33A 4HJ4A 4WL9A 3MQOA 5F69A 4R70A 5KIZA 3ICYA 4E04A 2R78A 4R38A 2A24B 3LICA 3ZQ5A 1UGUA 1JNUA 5J4EA 4HP9A 4EXOA 3CLOA 3MR0A 4PKYA 2V1BA 2L4RA 3IBRA 1OJGA 2PDRA 2QHKA 1VB6A 4HI4A 2B02A 3OLOA 4DJ2A 3RH8B 2INWA 5HSQA 4EEUA 1DRMA 2ZBBA 2M1CA 3FG8A 4LRZE 2JN7A 1DP9A 2VLGA 2V1AA 2A24A 3UB7A 3K3CA 1D7EA 4WF0A 1GSWA 4NXEA 4HIAA 1T1BA 3HJKA 1XJ3A 5DKLA 4LPZA 4LRYC 4L9FA 4I3JA 3LI9A 4LRXC 4R6LA 3G6OA 2V0UA 4JGRA 3K3DA 4BBUA 4F3LB 3PHYA 2W0NA 3UB9A 3C2WA 1XJ2A 2VV6A 2KX6A 4MN6A 4JGQA 4HJ3A 4HP4A 3GDIA 1V9YA 4DJ3A 1OTBA 3LIEA 2PR6A 2OOLA 4HNBA 2PYRA 3T50A 1T1AA 3IS2B 2QWSA 4PKYG 4XT2B 2H28A 5I5LA 4HOIA 5F68A 4GHIB 2QJ7A 1S67L 3F1PB 3HJIA 2WKPA 1OT6A 3A0RA 1DP6A 1EW0A 1GSXA 2ZOIA 4KQDA 4F3LA 2QKPA 2I9VA 4JGOA 1N9NA 2P7JA 4GS9B 4NXGA 1F9IA 2PHYA 1OTDA 4EERA 1UWPX 2HV1A 4I3IA 2PD8A 5EFWA 1XFNA 4EESA 4BBVA 3F1OB 4I39A 3IS2A 4XT2A 3VE3A 4HY8A 4M4XA 4NXBA 4GHIA 2QJ5A 3F1PA 5DJTA 2OWHA 1T19A 1N9LA 5HD5A 3LIFA 1WA9A 5HDDA 2ZOHA 3NJAA 1UWNX 3E4PA 4EW7A 4WUJA 1GSVA 4HQAA 5J7EA 1OTIA 5HWVA 2V9AA 1TS6A 1LSXA 3E4QA 3FC7A 5HWWA 5IU1A 3CWFA 1N9OA 2K7SA 1F98A 4I38A 3UMEA 1OTEA 3MXQA 4I3AA 4KUKA 3F1OA 2J80A 4EEPA 1S1ZA 5DJUA 3LIDA 4YWZA 4KUOA 3SW1A 4H6JB 1LT0A 2L0WA 5A8BA 2OWJA 5J3WA 1P0ZA 3H7WB 5F6AA 1OT9A 2VV7A 3UB6A 1NWZA 3EEHA 2PYPA 2VV8A 4HHDA 3MQQA 5HZHA 2WKQA 1T1CA 2YKFA 3H9WA 3LYXA 3GECA 4NXFA 3C8CA 3PYPA 4EETB 5AVEA 1X0OA 4MN5A 1S4RA 1XFQA 4I5SA 3A0SA 4H6JA 3NOPC 1MZUA 4BBTA 2KDKA 1T18A 3H7WA 4WN5A 1S4SA 2L1MA 5HWTA 5IS1A 2VEAA 1BYWA 3NOUC 3A0VA 2EA9A 3NOTC 3EWKA 3D72A 1LSVA 2PD7A 3F1NB
chains in the Genus database with same CATH superfamily
2PBDP 2PR5A 4BMWA 1HZOA 1LSWA 1NZUA 3WS2A 3BRMA 2ZM2A 3UMDA 3SZTA 4WLAA 4RVAA 4GS9A 3P7NA 2BASA 1S66L 2EFUA 1IEMA 4LLOB 4EU0A 1G28A 3N8SA 4X55A 2AVXA 2C6WB 1SCWA 2DRWA 1DP8A 3MFXA 3BWLA 4LV2A 4E3LA 3R4KA 3VMAA 4MBHA 3ZG5A 3MS6A 2B95A 5CEBA 4OONA 4UA9A 2UWXA 1YLJA 2Y2IA 5AQ9A 3IT9A 2OLVA 4KG6A 5DF8A 4BL2A 1MKMA 2Z2MB 4BD0A 2WKHA 2I72A 4ZAMA 2EX6A 2P74A 1RP5A 1YLZA 3MXRA 4FD8A 3WRZA 3V3SA 4E3JA 4DE3A 2BG1A 2Q0OA 1CI8A 4PM8A 5FQ9A 4BQMA 3T1RA 4GCZA 4JKTA 2IA2A 5DF9A 1MPLA 1TS0A 4O0PA 2ZQAA 1YAXA 3GQZA 4L9EA 4ZBEA 4ZJ3A 5L10A 4PM6A 1Y28A 4BL3A 4HJ6A 4LFUA 3UB8A 1K57A 1ONHA 1XA1A 1Q2QA 3V5MA 4S2NA 2Q9MA 3E98A 2V8CA 1KGFA 3B33A 3T4QA 1S6RA 1FIKA 5CXWA 5FI2A 4PHTA 2ZC5B 4YNRA 3ZQ5A 1NLZA 1H8MA 3PBRA 1TEMA 4BENA 1JNUA 1DY6A 2WGVA 2VKSA 4CLCB 3CLOA 4PM5A 4JF4A 1BTLA 3G30A 1L0EA 2X02A 4Y7PA 3RXWA 1YLTA 4G3VA 2L4RA 4IBXA 1K54C 1OJGA 4Y13A 4P6ZM 4NG2A 2QHKA 3TSGA 4HI4A 4F94A 2B02A 4U0TA 3E2LA 1Y54A 3L7HA 4JPMA 2INWA 3UE3A 2ZBBA 3OCLA 5JYOA 1MBLA 4LCMA 3BLMA 4ETXA 1DP9A 2VLGA 2QZ6A 4ARZA 1NZOA 1RCJA 3O88A 1BSGA 1WYBA 2A24A 3UB7A 5FDHA 3A3JA 3T1SA 3UPNA 1J9MA 4G3KA 5AJGA 3GMWA 4HIAA 5DKLA 1PZPA 4RYEA 2DNSA 1ONGA 4UA7A 3CHWP 4UEYA 1MWSA 3G6OA 2Y2OA 3PBQA 4BBUA 4F3LB 2W0NA 2X01A 2ZLYA 4NK3A 1OPXA 3S7NA 4PAUA 1JWPA 2P04A 5KSHA 3LY3A 4EBNA 5EVLA 2IWCA 4DJ3A 4S2JA 3EGXC 4HNBA 1K56A 4H8RA 2EX9A 4MN7A 4XT2B 4LV1A 3TOIA 5G18A 5I5LA 1XX2A 3LY4A 3BQAA 3ZDJA 4ID4A 3OZHA 4R1GA 4MCWA 4ZJ2A 2Y2JA 4RA7A 4JF6A 1KDSA 2P7JA 2O9CA 1N9BA 3VP1A 4S2PA 2EFXA 2W3GA 4MBKA 5EFWA 5CEDA 1W7FA 1XFNA 1Z09A 3HLCA 3UDIA 1VEUA 4BBVA 1BUEA 3IS2A 3V67A 5FEFA 4R4SA 1AXBA 1FILA 4QHCA 3UDFA 3ITBA 4HY8A 4M4XA 4P87A 2QJ5A 4N9LA 3RFBA 4DE1A 1T19A 3BFCA 4WELA 4BWIA 3IF6C 3LIFA 3NJAA 1KGGA 1U60A 1VHMA 3HUMA 3RXXA 3ZG8B 2QYBA 4LV3A 5E2FA 3ZNYA 4DKIA 5A92A 4WUJA 1GSVA 5J7EA 1WE4A 5HWVA 3FC7A 4P0MA 5HWWA 2ZQ8A 5IU1A 1IYPA 3NCKA 3UMEA 1F98A 3C4OA 4KUKA 5EE8A 1E3UD 3LIDA 4KUOA 3SW1A 3WS0A 3HLEA 3VOZA 1LT0A 2L0WA 2HDSA 2X71A 5J3WA 3T4LA 1P0ZA 3R7WB 2VV7A 3C30A 3EQUA 3ZG0A 1BLPA 1YLYA 2WK0A 3EEHA 4GD8A 2J8YA 4WM9A 4HHDA 3MQQA 4GDNA 2RL3A 3DTMA 3BFEA 2FFFB 1PW8A 1Y4OA 1LI0A 3G2ZA 1PRQA 4WZ5C 3FPVA 3Q7VB 5DTSA 5EVID 3NC8A 2FFYA 3QNCA 2PT7A 3ZG7B 4WYYA 5GLCA 4MN5A 1XFQA 3A0SA 4H6JA 1L0GA 4MDZA 4QPRA 2VJWA 2HDUA 3H7WA 4LENA 2J3WA 1S4SA 3B42A 4P6ZS 3C7VA 5EOEA 5EM0A 2VEAA 3T4JA 3NOUC 2ZC4B 5AQ7A 3T1XA 3QP6A 3JVUA 1LL9A 4QWOA 4KZAA 2XRNA 2OAQ1 3F1NB 3CUEC 4WZ4A 5GLAA 4GB7A 2DCFA 1GHIA 3LR4A 2ZL1B 3ISGA 4HH2A 3S7PA 3LUQA 4RX3A 5E43A 2H0YA 4KZ5A 1MKIA 2V2FF 4E3NA 1DJBA 3H82B 4OH0A 5E2EA 1XJ4A 4E6WA 4O8GA 4RQ9A 4MMNA 3UE6A 2D02A 1IYOA 3FWLA 5L07A 3RTYA 3AGDA 1XJ6A 1W63Q 3QP2A 3ULFA 5HL1A 4K91A 5F1GA 2ZQ7A 3TRCA 2OV5A 3UN7A 1YT4A 4C75A 2CMNA 5TBMB 3W4PA 1FCOA 5HD3A 2Y79A 2XEPA 3HUOA 3LEZA 3OBFA 5M19A 1KVMA 1YSPA 4UHUA 4U0XA 5G4ZA 1KOUA 4II7A 3MQ0A 4OOLA 4Z1WA 3NHQA 2Y91A 1JWVA 5U47A 1EI5A 2J3TD 2XQZA 3GRJA 2HF6A 1J3WA 4KZBA 3BM6A 2XLNA 1D06A 2J7VA 4GD6A 3N8RA 4ESPA 3KX0X 5GHZA 3MJQA 5CGSA 2A49A 4UA6A 2Z6CA 1FSWA 1PW1A 2A2LA 1DJAA 5F1FA 2WKIA 4WL9A 4R70A 3B3XA 2B5RA 3ICYA 4ME4A 5KSCA 5LBRA 3HL9A 1CEGA 1H8ZA 1IKGA 1LI9A 5CECA 5AQAA 4U3TA 3P09A 2J9PA 5DTTA 4CQHA 2NUPC 5FI7A 5J4EA 2W1RA 2JKGA 2KOIA 3LFVA 4PKYA 5E2GA 1OMEA 2V1BA 4OQHA 3KO6A 4RX2A 4OOYA 3DBAA 4P6BA 3OPPA 4DJ2A 3MZDA 3HBRA 3KYQA 2GDNA 2Y2MA 3E2KA 4GN2A 5HSQA 4EEUA 5A93A 2G2UA 1DRMA 3FKWA 4O7DA 1VQQA 3N4IA 3FG8A 1M40A 5HL6A 1NXYA 3B47A 1RGZA 2OAP1 2JN7A 3IX4A 3ZGAB 2W1TB 2O0YA 3GR2A 3FZCA 1G5UA 3CMZA 3K3CA 1D7EA 4WF0A 4WZ5A 1O7EA 4CLCA 1MC0A 3PBSA 5CHJA 2PU2A 4LRYC 2GZAA 3IF6B 4L9FA 3JPUA 1I5QA 4I3JA 4LRXC 5IHVA 4R6LA 2V0UA 2XK1A 5HFOA 3UB9A 3C2WA 4GJ4A 2K2NA 2XH9A 4P85A 4YFMA 4CLCE 4JGQA 4OPRA 3A3DA 3UNWA 2G2WA 4HP4A 3LIEA 1NYYA 2OOLA 4LV0A 3VOYA 2PYRA 3CUEA 4PKYG 1XA7A 3D3OA 3U4LP 3E0YA 1PIOA 1K38A 4GHIB 4KZ8A 3ITAA 3W4QA 1YQSA 1ES3A 2WKPA 3LCEA 2VGJA 4OQIA 4B4ZA 4KQDA 4S2IA 4F3LA 2WYXA 5EPHA 4KG5A 4FTXA 4Y3IA 4GS9B 3M6HA 2PHYA 5HX9A 1ZHHB 1MWTA 1ZKJA 4KQOA 3TW8A 4I3IA 2PD8A 4OP5A 4ZTKA 4EESA 3LR0A 3DWKA 5I94A 2ZC7A 2C5WB 1SKFA 4I39A 2Y8HA 3C5AA 5FSRA 1CF0A 3BJNA 3FV7A 4XT2A 4WMCA 3AGEA 1K56D 4NXBA 1PWDA 5FQKA 5GHYA 5DJTA 5KZHA 1BLCA 1N9LA 4OPYA 3VP2A 1WA9A 3EGDC 2EX2A 4X1MA 3QP1A 4ETZA 1UWNX 4KZ6A 1BULA 1CEFA 5FAQA 3D4FA 4DRTA 2BLSA 4DDSA 2EXBA 4HQAA 5FATA 2V9AA 1YLPA 3T4OA 3P98A 2K7SA 4I38A 2VGLM 3MBZA 1JTDA 3MXQA 2HGVA 1KDWA 4K0XA 2WGWB 4EBPA 3PBOA 2OWJA 1YMXA 4O01A 5DFYA 3DTKA 1L0DA 3AGFA 1OT9A 1SKOB 4L0LA 1PWGA 5F82A 1H3QA 2DMWA 2PYPA 1Z6FA 1ES4A 3PBNA 4ZDXA 2JKRM 5HZHA 1PYYA 3TG9A 3HLBA 5TFQA 2JE5A 1P9RA 3LEQA 3PBTA 3A3IA 3MKFA 3ZFZA 5EVIC 5GLBA 3QHYA 3SH9A 3H9WA 3LYXA 3MKEA 2GX5A 2Y4AA 1EROA 3M2JA 3PYPA 4PPRA 3CITA 5TR7A 1LLBA 3IXGA 2FZ0A 4I5SA 3WRTA 3G34A 4MBFA 3IXBA 1STZA 1T18A 3R7WA 2EWWA 3MMHA 1ES2A 1YM1A 5HWTA 2ZQCA 3SH8A 5M1AA 2IWBA 4BLMA 2EA9A 3OOVA 4OP8A 3EWKA 4MNRA 3D72A 4MLLA 1VETB 3Q7VA 3FKVA 2JKRI 5FQJA 1KVLA 5F5YA 4R0QA 3S22A 3LI8A 4B9OA 3K2NA 1LL8A 4IVIA 2LB5A 3O87A 2O9BA 5CERA 3CJMA 2P08A 4E3KA 1IYSA 1H0MA 2JHEA 1QMFA 1NRJA 3VE4A 2PU4A 2Z6DA 4ZJ1A 1ODVA 1FCMA 3T4TA 4JGPA 4OOMA 3VOLA 5CGWA 3A3FA 5DKKA 2EX8A 2XD5A 5DF7A 3OPHA 3CZDA 2M7VA 3F1NA 2XFTA 4IUKA 3VFHA 1TDLA 3M2KA 1K4EA 2YKHA 1S1YA 2ZL1A 3WS4A 2E8JA 2FH5A 3E4OA 4GW9A 1OTAA 4IVKA 3H82A 2R9WA 3V3RA 4HH3A 2ZMVA 3LO7A 5AVFA 2W3FA 2GJ3A 3DAVA 3BY9A 3IWQA 4BJPA 3DWZA 3UDXA 1K54A 2HPBA 4QB8A 5HPIA 3OCNA 4QU3A 4D60A 2HDQA 1YSQA 2W3DA 3HLFA 2V0WA 5G4YA 5DFXA 2JKTI 5TBMA 3T1QB 5D3OA 3V39A 4X56A 1JWZA 4JBFA 1TS8A 4K08A 4PM7A 5L8MA 3UY6A 3LGOA 4K0WA 4QJGA 3KSGA 3KSHA 4HJ4A 3MQOA 2O9AA 3QP4A 5F69A 3GV9A 2G7UA 3PXPA 3BEBA 4EQIA 4N1HA 4DE2A 2ZC6B 4R38A 3LICA 3ZHHA 3PAGA 2M7UA 1PZOA 2CC1A 3T4SA 5EOOA 1F5MA 1SHVA 1HD8A 3CPTB 3G35A 3HUNA 3MR0A 4Y0UA 3S7OA 1XXMA 3UO9A 3IBRA 3WWXA 1IFQA 2WZXA 2PDRA 5CGXA 1VB6A 1L3LA 1FSYA 3OLOA 2P9VB 3RH8B 2Y2PA 2VGLS 1K57C 4OKPA 1K0KA 2M1CA 4OPZA 4S2NC 2OLUA 1BLSA 3OPLA 5FI6A 3N7WA 3CG5A 1TVFA 5FAOA 4QY5A 1NY0A 1K25A 4NXEA 2HP9A 2XFSA 1GA9A 2Y2LA 1T1BA 1XPBA 3Q81A 1HTZA 5MC7A 2XR0A 4Y5FA 1YKDA 3G31A 4FOFA 4NETA 5HAQA 5DTKA 1K55C 1L2SA 5IT5A 5GHXA 3K3DA 1KGEA 3IH9A 2XA7M 2HP6A 4X1LA 1XJ2A 2VV6A 5F83A 2ZQ9A 1CJFA 4X69A 5FQIA 4IBRA 2W1TA 3LR3A 4NKPA 3IHBA 5FQQA 2MJ6A 5EV0A 1YLWA 4IHQA 5CTMA 1SDEA 3U2AA 4KG2A 1T1AA 4QY6A 1H5XA 1RGYA 2QWSA 1FR6A 5DVAA 3S7QA 4OPQA 4Q0IA 2H28A 3BFGA 3Q7ZA 4R4RA 5J8XA 4HOIA 5F68A 3N8LA 3IF6A 3O86A 4IJGA 2Y2NA 1S67L 2ZJ9A 3F1PB 4CLCD 3A0RA 1EW0A 4EUVA 1GSXA 5FDSA 2QKPA 1FR1A 4KENB 4R23A 2EXAA 1EWZA 1LHYA 4XUXA 3QP5A 3IH8A 5EVIB 4S2KA 3G2YA 1ES5A 4EERA 3BYDA 3W8KA 2HV1A 4YOFA 4Y0OA 2QMIA 3F1OB 3IHAA 4OLGA 4GOGA 2WAEA 4Y0TA 5BOHA 3T4KA 3IQAA 5JYPA 3IBJA 1H8YA 2Y2GA 4GHIA 2ZQDA 4XUZA 3C7UA 2OWHA 4GZBA 4KZ9A 4R3BA 5HDDA 1TDGA 4MEZA 4KZ3A 2UV0E 3IX8A 3NECA 4OVDA 2Y2QA 3E4PA 4E6XA 1K6SA 4PM9A 2PAVP 3BLSA 4Y15A 1IKIA 3HLDA 3IWOA 4WEJA 4EW7A 3LR5A 3EQVA 4NEED 3NIAA 1TS6A 3MFDA 3E4QA 3IF5A 3SS3A 4DDYA 4HBTA 1OTEA 4HEFA 4I3AA 1BLHA 1F2KA 4EEPA 3UB5P 4Q8IA 1S1ZA 5A8BA 1ZG4A 5HPFA 2VGKA 1KE3A 4Y2FA 2LB9A 1DJCA 4LGWA 3UB6A 4WMCD 1NWZA 2IWDA 2GNXA 2XDMA 2VZWA 1ZC2A 4JF5A 2VV8A 1D1JA 3MSHA 2H10A 5E2HA 5HW3A 1I2WA 2WKQA 3M6BA 2HZ5A 2WKEA 4X68A 4X53A 3W2ZA 3Q82A 3ZVWA 2YKFA 3GECA 4EBLA 4Z9QA 3PR6A 5FA7A 4NXFA 1JVJA 1YMSA 3MF0A 5KMWA 5HAPA 3ZVTA 3Q1FA 2VA0A 4EETB 3O5YA 4KQRA 4M3KA 3EEAA 1NLYA 1X0OA 3IXDA 5AVEA 5AQBA 3C38A 5EM1A 2WGWA 3CI6A 3GSGA 5CHMA 4DMZA 2V1ZA 4KQQA 4FSFA 4BBTA 2KDKA 1SKOA 3KYZA 4UQIM 5EUAA 2XSSA 4Q0JA 3D9YA 2HP5A 4KZ4A 2E8IA 3A0VA 3A3EA 4HBUA 4FUWA 3VP0A 1XGIA 3BFFA 1ALQA 3NOTC 5C5KA 4B4XA 1XKZA 1LSVA 3MZEA 3SOIA 3OPRA 2HJ9C 1GHMA 5L2FA 1K55A 3BY8A 3WS5A 2ZMFA 3I7JA 4Y17A 1BT5A 1OJ5A 2V8FA 3C4PA 4JXSA 3ZCZA 1S0WA 1E25A 2WZZA 3G32A 3SS5A 1M6KA 2WKRA 1HVBA 1IYQA 3UPOA 3PAEA 2Y2HA 3T12B 2H0TA 1CQAA 1MWUA 4L9GA 2XA7S 1P97A 1V9ZA 4R3AA 1C3BA 4WBGA 2W27A 2ZM0A 5HDSA 5TGFA 1ZTUA 1G6OA 1SDNA 1GCEA 1PFLA 4FH2A 1ERQA 4OQGA 4FH4A 1VETA 5HDCA 2K31A 4N9KA 2VK3A 2JC7A 3Q07A 4DF6A 3LIAA 2D01A 4EQ1A 5CTNA 2JKFA 3LIBA 4JLFA 2ZD8A 4GNUA 4CPKA 2QPNA 3L9KA 3JVVA 3HLGA 4N1XA 1FCNA 1O07A 3S4XA 5FAPA 1MXOA 4KZ7A 3NDGA 2NUTC 1E4DA 3N6IA 4G3WA 1W8YA 4S2LA 2PRFA 1ESUA 3VSLA 1FOFA 3CAXA 3W4OA 1G68A 1W8QA 3KSFA 4E3OA 5CRFA 1TS7A 2EWVA 5KIZA 4E04A 4XXRA 4A5RA 4ARZB 4B88A 2R78A 2A24B 1L0FA 4DN0A 1UGUA 4HP9A 1XGJA 4EXOA 3KYEA 2ACGA 1CI9A 1W79A 3GVBA 3VP3A 3TE8A 2WUQA 4D2OA 3NI9A 2Y55A 4C6YA 3NY4A 2JKTM 1NRFA 4AFIA 3HLWA 4LRZE 2Y59A 5CHUA 2V1AA 3SS4A 4CJNA 1Q2PA 3ZG9B 4LCLA 5GLDA 4S2OA 1GSWA 3FYZA 4DXCA 2XROA 3VFFA 2VX8A 3CPTA 1NYMA 3HJKA 1XJ3A 1JTGA 4DE0A 4LPZA 5A90A 3LI9A 5FQMA 2P9VA 4JGRA 1I2SA 3RJUA 2JCHA 3FPWA 4OLDA 3SH7A 5EECA 1W5DA 3PHYA 2J3TC 5TJJA 4EV4A 1TF1A 2KX6A 3BW6A 3WS1A 3JYIA 4HESA 3BQ8A 3KSIA 4MN6A 5A91A 3EOIA 1VM1A 3HVFA 4HJ3A 3GDIA 1V9YA 4E3MA 1OTBA 1HLUP 4N92A 2PR6A 4OQ0A 1VEUB 3S1YA 3T50A 1SZVA 3GTCA 3IS2B 4UQIS 3DTEA 3G4PA 5M18A 4CLCC 2XD1A 3P01A 1WYCA 4B93A 1ESIA 2QJ7A 3MZFA 2XF3A 4EUZA 3HJIA 3NBLA 4UAAA 1OT6A 4QD4A 3PTEA 1DP6A 4JXWA 2ZOIA 3IXHA 1PI5A 2O99A 2I9VA 4JGOA 4GKUA 1N9NA 4YINA 3ZYTA 1MWRA 4NXGA 3BECA 4R3JA 1F9IA 1AWIA 5GL9A 3VSKA 1OTDA 1UWPX 5EVEA 1E3UA 2WADA 2A3UA 3UE1A 1P9WA 1KE0A 2WAFA 2W3HA 3ZNTA 1CK3A 2J9OA 2Q9NA 3VE3A 2XGNA 5HAIA 2R9XA 1IELA 1PWCA 3F1PA 1TD5A 4EWFA 4X25A 5HD5A 2B18A 2ZOHA 3DW0A 3NDEA 1FQGA 3TJZC 4PMAA 5EVIA 3NULA 4X6TA 2JBFA 1ACFA 1IOUA 3DTIA 4BD1A 1BZAA 1OTIA 3HCYA 1LSXA 2WGIA 2PBYA 1G6AA 3CWFA 2W3EA 1N9OA 3F1OA 2J80A 3UPPA 5DJUA 4JXGA 4YWZA 1K4FA 5FEGA 3VV4A 4IUHA 4H6JB 4S2MA 4JXVA 1ZG6A 3H7WB 5F6AA 1GA0A 1W63M 3VP4A 1GHPA 2V20A 2HDRA 3UE0A 5HARA 2HJEA 2ZC3B 3IX3A 1T1CA 3BFDA 3IWIA 5CX7A 3QP8A 3MXSA 2Y2KA 2ZMAA 3C8CA 3HREA 2RCXA 4GDBA 1PNEA 4FCFA 4Q0HA 4DXBA 4E3IA 1K6RA 1S4RA 2Z2LB 1A0KA 4IEDA 3V50A 5FL3A 4C3QA 1KE4A 3QNBA 1QMEA 3NOPC 1MZUA 2ZM8A 1PI4A 4GLQA 1NJ4A 5FASA 4WN5A 2H5SA 2KLIA 2L1MA 2OSUA 1LL5A 5IS1A 5K5BA 1BYWA 1ERMA 1YPRA 1XP4A 5L09A 3O3VA 4ZRRA 3OC2A 2BTFP 1N4OA 4WEKA 2PD7A 1MY8A
chains in the Genus database with same CATH topology
2PR5A 3BY8A 2JKRI 2ZMFA 3LR4A 4BMWA 1OJ5A 5F5YA 4HH2A 1LSWA 3LUQA 3S7PA 3LI8A 4B9OA 3UMDA 3K2NA 1LL8A 4WLAA 3H82B 1XJ4A 4GS9A 3P7NA 2WKRA 4O8GA 4RQ9A 2BASA 4MMNA 3UE6A 2D02A 3RTYA 2LB5A 1S66L 2O9BA 1XJ6A 1W63Q 4LLOB 2P08A 3ULFA 4EU0A 1G28A 2JHEA 1NRJA 4L9GA 3VE4A 2XA7S 1P97A 1V9ZA 4R3AA 1DP8A 2Z6DA 1ODVA 3TRCA 3MFXA 2W27A 3BWLA 5HDSA 3T4TA 4JGPA 4OOMA 3R4KA 3VOLA 1ZTUA 1G6OA 5DKKA 2CMNA 5TBMB 2M7VA 5HDCA 5HD3A 3F1NA 2Y79A 4IUKA 2K31A 2YKHA 1S1YA 3OBFA 1MKMA 1YSPA 2FH5A 3E4OA 4GW9A 1OTAA 3H82A 3LIAA 2D01A 4EQ1A 5G4ZA 4HH3A 1KOUA 3LIBA 2ZMVA 4II7A 3MQ0A 4OOLA 4Z1WA 3NHQA 5AVFA 3JVVA 2J3TD 2W3FA 2HF6A 2GJ3A 3BY9A 4BJPA 4GCZA 2NUTC 5HPIA 1D06A 3OCNA 2IA2A 5DF9A 4G3WA 1TS0A 4O0PA 2W3DA 1YSQA 1YAXA 3KX0X 3MJQA 4L9EA 2V0WA 5G4YA 5DFXA 2JKTI 5TBMA 2Z6CA 1Y28A 3CAXA 1TS8A 4HJ6A 4K08A 5L8MA 3KSFA 3UB8A 2A2LA 3E98A 3KSGA 1TS7A 2EWVA 3B33A 3KSHA 4HJ4A 4WL9A 3T4QA 3MQOA 2O9AA 5F69A 4R70A 5KIZA 3ICYA 4E04A 2G7UA 3PXPA 4ME4A 5LBRA 4ARZB 2R78A 4PHTA 4R38A 2A24B 3LICA 4YNRA 3ZQ5A 2M7UA 1NLZA 1H8MA 3PBRA 4CQHA 2NUPC 4DN0A 1UGUA 1JNUA 3T4SA 5J4EA 4HP9A 2VKSA 2W1RA 3CLOA 4CLCB 4EXOA 1F5MA 2KOIA 3MR0A 3LFVA 4PKYA 2V1BA 4G3VA 2L4RA 3S7OA 3TE8A 3KO6A 3IBRA 3DBAA 1OJGA 1IFQA 4P6ZM 2PDRA 2QHKA 1VB6A 4HI4A 2B02A 3OLOA 4DJ2A 3KYQA 3RH8B 2INWA 5HSQA 4EEUA 3UE3A 2VGLS 1DRMA 2JKTM 2ZBBA 3OCLA 2M1CA 3FG8A 5HL6A 3B47A 2OAP1 4AFIA 4LRZE 2JN7A 4ETXA 1DP9A 2VLGA 2V1AA 4ARZA 2W1TB 2O0YA 2A24A 3UB7A 3K3CA 1D7EA 4WF0A 1GSWA 2XROA 4NXEA 4G3KA 5AJGA 2VX8A 4HIAA 4CLCA 1T1BA 1MC0A 3HJKA 1XJ3A 5DKLA 3PBSA 5MC7A 4Y5FA 4LPZA 1YKDA 4FOFA 4LRYC 2GZAA 4UEYA 4L9FA 4I3JA 3LI9A 4LRXC 4R6LA 3G6OA 2V0UA 5IT5A 4JGRA 3K3DA 3PBQA 4BBUA 4F3LB 3FPWA 2XA7M 3PHYA 2W0NA 2J3TC 3UB9A 5TJJA 3C2WA 4GJ4A 1XJ2A 2VV6A 2KX6A 1TF1A 1OPXA 3BW6A 2K2NA 3S7NA 4PAUA 3BQ8A 3KSIA 4MN6A 4CLCE 2P04A 4JGQA 3EOIA 2W1TA 3LR3A 5KSHA 4HJ3A 4HP4A 4NKPA 3GDIA 2MJ6A 1V9YA 4DJ3A 1OTBA 3LIEA 4IHQA 2PR6A 2OOLA 3EGXC 3U2AA 4HNBA 2PYRA 3T50A 1T1AA 3IS2B 4UQIS 3CUEA 2QWSA 4PKYG 4MN7A 3S7QA 3D3OA 4XT2B 4Q0IA 3E0YA 2H28A 5I5LA 4HOIA 4CLCC 3BQAA 5F68A 3P01A 4GHIB 4B93A 2QJ7A 4IJGA 4CLCD 1S67L 3F1PB 3HJIA 2WKPA 1OT6A 3A0RA 4MCWA 1DP6A 1EW0A 4EUVA 1GSXA 2ZOIA 4KQDA 4F3LA 2QKPA 2O99A 2I9VA 4JGOA 1N9NA 3ZYTA 4Y3IA 2P7JA 4GS9B 2O9CA 4NXGA 1F9IA 2PHYA 1OTDA 1ZHHB 4EERA 1UWPX 4KQOA 2W3GA 3TW8A 2HV1A 4I3IA 4YOFA 2PD8A 5EFWA 1XFNA 4EESA 3LR0A 1P9WA 4BBVA 3F1OB 2W3HA 4I39A 2Y8HA 3IS2A 3V67A 3BJNA 4XT2A 3VE3A 3T4KA 4HY8A 3IBJA 4M4XA 4NXBA 4GHIA 2QJ5A 3F1PA 5DJTA 1TD5A 2OWHA 3RFBA 1T19A 1N9LA 4WELA 5HD5A 2B18A 4BWIA 3LIFA 1WA9A 3EGDC 5HDDA 2ZOHA 3NJAA 1VHMA 4ETZA 1UWNX 3E4PA 2QYBA 2PD7A 3TJZC 4WEJA 4EW7A 3LR5A 1IOUA 4WUJA 3EQVA 4NEED 1GSVA 4HQAA 5J7EA 1OTIA 3HCYA 5HWVA 2V9AA 1TS6A 1LSXA 3E4QA 3FC7A 5HWWA 5IU1A 3CWFA 3T4OA 2W3EA 1N9OA 2K7SA 1F98A 2VGLM 4I38A 1OTEA 3MXQA 4I3AA 2HGVA 3UMEA 4KUKA 3F1OA 2J80A 4EEPA 1S1ZA 5DJUA 3LIDA 4YWZA 4KUOA 3SW1A 3VV4A 4IUHA 4H6JB 1LT0A 2L0WA 5A8BA 3PBOA 2OWJA 4O01A 5DFYA 5J3WA 3T4LA 5HPFA 1P0ZA 3R7WB 4Y2FA 2LB9A 3H7WB 5F6AA 1OT9A 2VV7A 4L0LA 3C30A 3EQUA 3UB6A 1H3QA 1NWZA 2DMWA 2GNXA 3EEHA 2PYPA 1W63M 3PBNA 2VZWA 2VV8A 2JKRM 3MQQA 4HHDA 5HZHA 2HJEA 2WKQA 1T1CA 1P9RA 3PBTA 3W2ZA 2YKFA 5CX7A 3H9WA 3LYXA 3GECA 3PR6A 3FPVA 4NXFA 3MF0A 3C8CA 2GX5A 2PT7A 3PYPA 4Q0HA 2VA0A 3CITA 4EETB 3O5YA 3EEAA 1NLYA 1X0OA 5AVEA 4MN5A 1S4RA 1XFQA 2FZ0A 3C38A 4I5SA 3A0SA 3CI6A 5FL3A 4H6JA 4DMZA 1STZA 3NOPC 1MZUA 4MDZA 4FSFA 4BBTA 2KDKA 4GLQA 4QPRA 1T18A 2VJWA 3R7WA 2EWWA 3H7WA 4WN5A 3MMHA 2J3WA 3KYZA 1S4SA 3B42A 4UQIM 4P6ZS 2XSSA 2KLIA 2L1MA 4Q0JA 5HWTA 5IS1A 2VEAA 5K5BA 3T4JA 1BYWA 3NOUC 3A0VA 2EA9A 3JVUA 4ZRRA 3NOTC 3OOVA 5C5KA 3EWKA 3D72A 3OC2A 2XRNA 1LSVA 4WEKA 2OAQ1 3F1NB 3CUEC 2HJ9C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PR5 A;  3BY8 A;  1OJ5 A;  5F5Y A;  4HH2 A;  1LSW A;  3LUQ A;  3LI8 A;  4B9O A;  3UMD A;  1LL8 A;  4WLA A;  3H82 B;  1XJ4 A;  4GS9 A;  3P7N A;  2WKR A;  4RQ9 A;  2BAS A;  3UE6 A;  2D02 A;  3RTY A;  1S66 L;  1XJ6 A;  4LLO B;  3ULF A;  1G28 A;  2JHE A;  4L9G A;  3VE4 A;  1P97 A;  1V9Z A;  4R3A A;  1DP8 A;  2Z6D A;  1ODV A;  3MFX A;  2W27 A;  3BWL A;  5HDS A;  4JGP A;  3VOL A;  5DKK A;  2CMN A;  5TBM B;  5HDC A;  5HD3 A;  3F1N A;  2YKH A;  1S1Y A;  3E4O A;  4GW9 A;  1OTA A;  3H82 A;  3LIA A;  2D01 A;  4EQ1 A;  5G4Z A;  4HH3 A;  1KOU A;  3LIB A;  3NHQ A;  5AVF A;  2GJ3 A;  3BY9 A;  4GCZ A;  1D06 A;  1TS0 A;  3KX0 X;  3MJQ A;  4L9E A;  2V0W A;  5G4Y A;  5TBM A;  2Z6C A;  1Y28 A;  3CAX A;  1TS8 A;  4HJ6 A;  4K08 A;  3UB8 A;  1TS7 A;  3B33 A;  4HJ4 A;  4WL9 A;  3MQO A;  5F69 A;  4R70 A;  5KIZ A;  3ICY A;  4E04 A;  2R78 A;  4R38 A;  2A24 B;  3LIC A;  3ZQ5 A;  1UGU A;  1JNU A;  5J4E A;  4HP9 A;  4EXO A;  3CLO A;  3MR0 A;  4PKY A;  2V1B A;  2L4R A;  3IBR A;  1OJG A;  2PDR A;  2QHK A;  1VB6 A;  4HI4 A;  2B02 A;  3OLO A;  4DJ2 A;  3RH8 B;  2INW A;  5HSQ A;  4EEU A;  1DRM A;  2ZBB A;  2M1C A;  3FG8 A;  4LRZ E;  2JN7 A;  1DP9 A;  2VLG A;  2V1A A;  2A24 A;  3UB7 A;  3K3C A;  1D7E A;  4WF0 A;  1GSW A;  4NXE A;  4HIA A;  1T1B A;  3HJK A;  1XJ3 A;  5DKL A;  4LPZ A;  4LRY C;  4L9F A;  4I3J A;  3LI9 A;  4LRX C;  4R6L A;  3G6O A;  2V0U A;  4JGR A;  3K3D A;  4BBU A;  4F3L B;  3PHY A;  2W0N A;  3UB9 A;  3C2W A;  1XJ2 A;  2VV6 A;  2KX6 A;  4MN6 A;  4JGQ A;  4HJ3 A;  4HP4 A;  3GDI A;  1V9Y A;  4DJ3 A;  1OTB A;  3LIE A;  2PR6 A;  2OOL A;  4HNB A;  2PYR A;  3T50 A;  1T1A A;  3IS2 B;  2QWS A;  4PKY G;  4XT2 B;  2H28 A;  5I5L A;  4HOI A;  5F68 A;  4GHI B;  2QJ7 A;  1S67 L;  3F1P B;  3HJI A;  2WKP A;  1OT6 A;  3A0R A;  1DP6 A;  1EW0 A;  1GSX A;  2ZOI A;  4KQD A;  4F3L A;  2QKP A;  2I9V A;  4JGO A;  1N9N A;  2P7J A;  4GS9 B;  4NXG A;  1F9I A;  2PHY A;  1OTD A;  4EER A;  1UWP X;  2HV1 A;  4I3I A;  2PD8 A;  5EFW A;  1XFN A;  4EES A;  4BBV A;  3F1O B;  4I39 A;  3IS2 A;  4XT2 A;  3VE3 A;  4HY8 A;  4M4X A;  4NXB A;  4GHI A;  2QJ5 A;  3F1P A;  5DJT A;  2OWH A;  1T19 A;  1N9L A;  5HD5 A;  3LIF A;  1WA9 A;  5HDD A;  2ZOH A;  3NJA A;  1UWN X;  3E4P A;  4EW7 A;  4WUJ A;  1GSV A;  4HQA A;  5J7E A;  1OTI A;  5HWV A;  2V9A A;  1TS6 A;  1LSX A;  3E4Q A;  3FC7 A;  5HWW A;  5IU1 A;  3CWF A;  1N9O A;  2K7S A;  1F98 A;  4I38 A;  3UME A;  1OTE A;  3MXQ A;  4I3A A;  4KUK A;  3F1O A;  2J80 A;  4EEP A;  1S1Z A;  5DJU A;  3LID A;  4YWZ A;  4KUO A;  3SW1 A;  4H6J B;  1LT0 A;  2L0W A;  5A8B A;  2OWJ A;  5J3W A;  1P0Z A;  3H7W B;  5F6A A;  1OT9 A;  2VV7 A;  3UB6 A;  1NWZ A;  3EEH A;  2PYP A;  2VV8 A;  4HHD A;  3MQQ A;  5HZH A;  2WKQ A;  1T1C A;  2YKF A;  3H9W A;  3LYX A;  3GEC A;  4NXF A;  3C8C A;  3PYP A;  4EET B;  5AVE A;  1X0O A;  4MN5 A;  1S4R A;  1XFQ A;  4I5S A;  3A0S A;  4H6J A;  3NOP C;  1MZU A;  4BBT A;  2KDK A;  1T18 A;  3H7W A;  4WN5 A;  1S4S A;  2L1M A;  5HWT A;  5IS1 A;  2VEA A;  1BYW A;  3NOU C;  3A0V A;  2EA9 A;  3NOT C;  3EWK A;  3D72 A;  1LSV A;  2PD7 A;  3F1N B; 
#chains in the Genus database with same CATH topology
 2PBD P;  2PR5 A;  4BMW A;  1HZO A;  1LSW A;  1NZU A;  3WS2 A;  3BRM A;  2ZM2 A;  3UMD A;  3SZT A;  4WLA A;  4RVA A;  4GS9 A;  3P7N A;  2BAS A;  1S66 L;  2EFU A;  1IEM A;  4LLO B;  4EU0 A;  1G28 A;  3N8S A;  4X55 A;  2AVX A;  2C6W B;  1SCW A;  2DRW A;  1DP8 A;  3MFX A;  3BWL A;  4LV2 A;  4E3L A;  3R4K A;  3VMA A;  4MBH A;  3ZG5 A;  3MS6 A;  2B95 A;  5CEB A;  4OON A;  4UA9 A;  2UWX A;  1YLJ A;  2Y2I A;  5AQ9 A;  3IT9 A;  2OLV A;  4KG6 A;  5DF8 A;  4BL2 A;  1MKM A;  2Z2M B;  4BD0 A;  2WKH A;  2I72 A;  4ZAM A;  2EX6 A;  2P74 A;  1RP5 A;  1YLZ A;  3MXR A;  4FD8 A;  3WRZ A;  3V3S A;  4E3J A;  4DE3 A;  2BG1 A;  2Q0O A;  1CI8 A;  4PM8 A;  5FQ9 A;  4BQM A;  3T1R A;  4GCZ A;  4JKT A;  2IA2 A;  5DF9 A;  1MPL A;  1TS0 A;  4O0P A;  2ZQA A;  1YAX A;  3GQZ A;  4L9E A;  4ZBE A;  4ZJ3 A;  5L10 A;  4PM6 A;  1Y28 A;  4BL3 A;  4HJ6 A;  4LFU A;  3UB8 A;  1K57 A;  1ONH A;  1XA1 A;  1Q2Q A;  3V5M A;  4S2N A;  2Q9M A;  3E98 A;  2V8C A;  1KGF A;  3B33 A;  3T4Q A;  1S6R A;  1FIK A;  5CXW A;  5FI2 A;  4PHT A;  2ZC5 B;  4YNR A;  3ZQ5 A;  1NLZ A;  1H8M A;  3PBR A;  1TEM A;  4BEN A;  1JNU A;  1DY6 A;  2WGV A;  2VKS A;  4CLC B;  3CLO A;  4PM5 A;  4JF4 A;  1BTL A;  3G30 A;  1L0E A;  2X02 A;  4Y7P A;  3RXW A;  1YLT A;  4G3V A;  2L4R A;  4IBX A;  1K54 C;  1OJG A;  4Y13 A;  4P6Z M;  4NG2 A;  2QHK A;  3TSG A;  4HI4 A;  4F94 A;  2B02 A;  4U0T A;  3E2L A;  1Y54 A;  3L7H A;  4JPM A;  2INW A;  3UE3 A;  2ZBB A;  3OCL A;  5JYO A;  1MBL A;  4LCM A;  3BLM A;  4ETX A;  1DP9 A;  2VLG A;  2QZ6 A;  4ARZ A;  1NZO A;  1RCJ A;  3O88 A;  1BSG A;  1WYB A;  2A24 A;  3UB7 A;  5FDH A;  3A3J A;  3T1S A;  3UPN A;  1J9M A;  4G3K A;  5AJG A;  3GMW A;  4HIA A;  5DKL A;  1PZP A;  4RYE A;  2DNS A;  1ONG A;  4UA7 A;  3CHW P;  4UEY A;  1MWS A;  3G6O A;  2Y2O A;  3PBQ A;  4BBU A;  4F3L B;  2W0N A;  2X01 A;  2ZLY A;  4NK3 A;  1OPX A;  3S7N A;  4PAU A;  1JWP A;  2P04 A;  5KSH A;  3LY3 A;  4EBN A;  5EVL A;  2IWC A;  4DJ3 A;  4S2J A;  3EGX C;  4HNB A;  1K56 A;  4H8R A;  2EX9 A;  4MN7 A;  4XT2 B;  4LV1 A;  3TOI A;  5G18 A;  5I5L A;  1XX2 A;  3LY4 A;  3BQA A;  3ZDJ A;  4ID4 A;  3OZH A;  4R1G A;  4MCW A;  4ZJ2 A;  2Y2J A;  4RA7 A;  4JF6 A;  1KDS A;  2P7J A;  2O9C A;  1N9B A;  3VP1 A;  4S2P A;  2EFX A;  2W3G A;  4MBK A;  5EFW A;  5CED A;  1W7F A;  1XFN A;  1Z09 A;  3HLC A;  3UDI A;  1VEU A;  4BBV A;  1BUE A;  3IS2 A;  3V67 A;  5FEF A;  4R4S A;  1AXB A;  1FIL A;  4QHC A;  3UDF A;  3ITB A;  4HY8 A;  4M4X A;  4P87 A;  2QJ5 A;  4N9L A;  3RFB A;  4DE1 A;  1T19 A;  3BFC A;  4WEL A;  4BWI A;  3IF6 C;  3LIF A;  3NJA A;  1KGG A;  1U60 A;  1VHM A;  3HUM A;  3RXX A;  3ZG8 B;  2QYB A;  4LV3 A;  5E2F A;  3ZNY A;  4DKI A;  5A92 A;  4WUJ A;  1GSV A;  5J7E A;  1WE4 A;  5HWV A;  3FC7 A;  4P0M A;  5HWW A;  2ZQ8 A;  5IU1 A;  1IYP A;  3NCK A;  3UME A;  1F98 A;  3C4O A;  4KUK A;  5EE8 A;  1E3U D;  3LID A;  4KUO A;  3SW1 A;  3WS0 A;  3HLE A;  3VOZ A;  1LT0 A;  2L0W A;  2HDS A;  2X71 A;  5J3W A;  3T4L A;  1P0Z A;  3R7W B;  2VV7 A;  3C30 A;  3EQU A;  3ZG0 A;  1BLP A;  1YLY A;  2WK0 A;  3EEH A;  4GD8 A;  2J8Y A;  4WM9 A;  4HHD A;  3MQQ A;  4GDN A;  2RL3 A;  3DTM A;  3BFE A;  2FFF B;  1PW8 A;  1Y4O A;  1LI0 A;  3G2Z A;  1PRQ A;  4WZ5 C;  3FPV A;  3Q7V B;  5DTS A;  5EVI D;  3NC8 A;  2FFY A;  3QNC A;  2PT7 A;  3ZG7 B;  4WYY A;  5GLC A;  4MN5 A;  1XFQ A;  3A0S A;  4H6J A;  1L0G A;  4MDZ A;  4QPR A;  2VJW A;  2HDU A;  3H7W A;  4LEN A;  2J3W A;  1S4S A;  3B42 A;  4P6Z S;  3C7V A;  5EOE A;  5EM0 A;  2VEA A;  3T4J A;  3NOU C;  2ZC4 B;  5AQ7 A;  3T1X A;  3QP6 A;  3JVU A;  1LL9 A;  4QWO A;  4KZA A;  2XRN A;  2OAQ 1;  3F1N B;  3CUE C;  4WZ4 A;  5GLA A;  4GB7 A;  2DCF A;  1GHI A;  3LR4 A;  2ZL1 B;  3ISG A;  4HH2 A;  3S7P A;  3LUQ A;  4RX3 A;  5E43 A;  2H0Y A;  4KZ5 A;  1MKI A;  2V2F F;  4E3N A;  1DJB A;  3H82 B;  4OH0 A;  5E2E A;  1XJ4 A;  4E6W A;  4O8G A;  4RQ9 A;  4MMN A;  3UE6 A;  2D02 A;  1IYO A;  3FWL A;  5L07 A;  3RTY A;  3AGD A;  1XJ6 A;  1W63 Q;  3QP2 A;  3ULF A;  5HL1 A;  4K91 A;  5F1G A;  2ZQ7 A;  3TRC A;  2OV5 A;  3UN7 A;  1YT4 A;  4C75 A;  2CMN A;  5TBM B;  3W4P A;  1FCO A;  5HD3 A;  2Y79 A;  2XEP A;  3HUO A;  3LEZ A;  3OBF A;  5M19 A;  1KVM A;  1YSP A;  4UHU A;  4U0X A;  5G4Z A;  1KOU A;  4II7 A;  3MQ0 A;  4OOL A;  4Z1W A;  3NHQ A;  2Y91 A;  1JWV A;  5U47 A;  1EI5 A;  2J3T D;  2XQZ A;  3GRJ A;  2HF6 A;  1J3W A;  4KZB A;  3BM6 A;  2XLN A;  1D06 A;  2J7V A;  4GD6 A;  3N8R A;  4ESP A;  3KX0 X;  5GHZ A;  3MJQ A;  5CGS A;  2A49 A;  4UA6 A;  2Z6C A;  1FSW A;  1PW1 A;  2A2L A;  1DJA A;  5F1F A;  2WKI A;  4WL9 A;  4R70 A;  3B3X A;  2B5R A;  3ICY A;  4ME4 A;  5KSC A;  5LBR A;  3HL9 A;  1CEG A;  1H8Z A;  1IKG A;  1LI9 A;  5CEC A;  5AQA A;  4U3T A;  3P09 A;  2J9P A;  5DTT A;  4CQH A;  2NUP C;  5FI7 A;  5J4E A;  2W1R A;  2JKG A;  2KOI A;  3LFV A;  4PKY A;  5E2G A;  1OME A;  2V1B A;  4OQH A;  3KO6 A;  4RX2 A;  4OOY A;  3DBA A;  4P6B A;  3OPP A;  4DJ2 A;  3MZD A;  3HBR A;  3KYQ A;  2GDN A;  2Y2M A;  3E2K A;  4GN2 A;  5HSQ A;  4EEU A;  5A93 A;  2G2U A;  1DRM A;  3FKW A;  4O7D A;  1VQQ A;  3N4I A;  3FG8 A;  1M40 A;  5HL6 A;  1NXY A;  3B47 A;  1RGZ A;  2OAP 1;  2JN7 A;  3IX4 A;  3ZGA B;  2W1T B;  2O0Y A;  3GR2 A;  3FZC A;  1G5U A;  3CMZ A;  3K3C A;  1D7E A;  4WF0 A;  4WZ5 A;  1O7E A;  4CLC A;  1MC0 A;  3PBS A;  5CHJ A;  2PU2 A;  4LRY C;  2GZA A;  3IF6 B;  4L9F A;  3JPU A;  1I5Q A;  4I3J A;  4LRX C;  5IHV A;  4R6L A;  2V0U A;  2XK1 A;  5HFO A;  3UB9 A;  3C2W A;  4GJ4 A;  2K2N A;  2XH9 A;  4P85 A;  4YFM A;  4CLC E;  4JGQ A;  4OPR A;  3A3D A;  3UNW A;  2G2W A;  4HP4 A;  3LIE A;  1NYY A;  2OOL A;  4LV0 A;  3VOY A;  2PYR A;  3CUE A;  4PKY G;  1XA7 A;  3D3O A;  3U4L P;  3E0Y A;  1PIO A;  1K38 A;  4GHI B;  4KZ8 A;  3ITA A;  3W4Q A;  1YQS A;  1ES3 A;  2WKP A;  3LCE A;  2VGJ A;  4OQI A;  4B4Z A;  4KQD A;  4S2I A;  4F3L A;  2WYX A;  5EPH A;  4KG5 A;  4FTX A;  4Y3I A;  4GS9 B;  3M6H A;  2PHY A;  5HX9 A;  1ZHH B;  1MWT A;  1ZKJ A;  4KQO A;  3TW8 A;  4I3I A;  2PD8 A;  4OP5 A;  4ZTK A;  4EES A;  3LR0 A;  3DWK A;  5I94 A;  2ZC7 A;  2C5W B;  1SKF A;  4I39 A;  2Y8H A;  3C5A A;  5FSR A;  1CF0 A;  3BJN A;  3FV7 A;  4XT2 A;  4WMC A;  3AGE A;  1K56 D;  4NXB A;  1PWD A;  5FQK A;  5GHY A;  5DJT A;  5KZH A;  1BLC A;  1N9L A;  4OPY A;  3VP2 A;  1WA9 A;  3EGD C;  2EX2 A;  4X1M A;  3QP1 A;  4ETZ A;  1UWN X;  4KZ6 A;  1BUL A;  1CEF A;  5FAQ A;  3D4F A;  4DRT A;  2BLS A;  4DDS A;  2EXB A;  4HQA A;  5FAT A;  2V9A A;  1YLP A;  3T4O A;  3P98 A;  2K7S A;  4I38 A;  2VGL M;  3MBZ A;  1JTD A;  3MXQ A;  2HGV A;  1KDW A;  4K0X A;  2WGW B;  4EBP A;  3PBO A;  2OWJ A;  1YMX A;  4O01 A;  5DFY A;  3DTK A;  1L0D A;  3AGF A;  1OT9 A;  1SKO B;  4L0L A;  1PWG A;  5F82 A;  1H3Q A;  2DMW A;  2PYP A;  1Z6F A;  1ES4 A;  3PBN A;  4ZDX A;  2JKR M;  5HZH A;  1PYY A;  3TG9 A;  3HLB A;  5TFQ A;  2JE5 A;  1P9R A;  3LEQ A;  3PBT A;  3A3I A;  3MKF A;  3ZFZ A;  5EVI C;  5GLB A;  3QHY A;  3SH9 A;  3H9W A;  3LYX A;  3MKE A;  2GX5 A;  2Y4A A;  1ERO A;  3M2J A;  3PYP A;  4PPR A;  3CIT A;  5TR7 A;  1LLB A;  3IXG A;  2FZ0 A;  4I5S A;  3WRT A;  3G34 A;  4MBF A;  3IXB A;  1STZ A;  1T18 A;  3R7W A;  2EWW A;  3MMH A;  1ES2 A;  1YM1 A;  5HWT A;  2ZQC A;  3SH8 A;  5M1A A;  2IWB A;  4BLM A;  2EA9 A;  3OOV A;  4OP8 A;  3EWK A;  4MNR A;  3D72 A;  4MLL A;  1VET B;  3Q7V A;  3FKV A;  2JKR I;  5FQJ A;  1KVL A;  5F5Y A;  4R0Q A;  3S22 A;  3LI8 A;  4B9O A;  3K2N A;  1LL8 A;  4IVI A;  2LB5 A;  3O87 A;  2O9B A;  5CER A;  3CJM A;  2P08 A;  4E3K A;  1IYS A;  1H0M A;  2JHE A;  1QMF A;  1NRJ A;  3VE4 A;  2PU4 A;  2Z6D A;  4ZJ1 A;  1ODV A;  1FCM A;  3T4T A;  4JGP A;  4OOM A;  3VOL A;  5CGW A;  3A3F A;  5DKK A;  2EX8 A;  2XD5 A;  5DF7 A;  3OPH A;  3CZD A;  2M7V A;  3F1N A;  2XFT A;  4IUK A;  3VFH A;  1TDL A;  3M2K A;  1K4E A;  2YKH A;  1S1Y A;  2ZL1 A;  3WS4 A;  2E8J A;  2FH5 A;  3E4O A;  4GW9 A;  1OTA A;  4IVK A;  3H82 A;  2R9W A;  3V3R A;  4HH3 A;  2ZMV A;  3LO7 A;  5AVF A;  2W3F A;  2GJ3 A;  3DAV A;  3BY9 A;  3IWQ A;  4BJP A;  3DWZ A;  3UDX A;  1K54 A;  2HPB A;  4QB8 A;  5HPI A;  3OCN A;  4QU3 A;  4D60 A;  2HDQ A;  1YSQ A;  2W3D A;  3HLF A;  2V0W A;  5G4Y A;  5DFX A;  2JKT I;  5TBM A;  3T1Q B;  5D3O A;  3V39 A;  4X56 A;  1JWZ A;  4JBF A;  1TS8 A;  4K08 A;  4PM7 A;  5L8M A;  3UY6 A;  3LGO A;  4K0W A;  4QJG A;  3KSG A;  3KSH A;  4HJ4 A;  3MQO A;  2O9A A;  3QP4 A;  5F69 A;  3GV9 A;  2G7U A;  3PXP A;  3BEB A;  4EQI A;  4N1H A;  4DE2 A;  2ZC6 B;  4R38 A;  3LIC A;  3ZHH A;  3PAG A;  2M7U A;  1PZO A;  2CC1 A;  3T4S A;  5EOO A;  1F5M A;  1SHV A;  1HD8 A;  3CPT B;  3G35 A;  3HUN A;  3MR0 A;  4Y0U A;  3S7O A;  1XXM A;  3UO9 A;  3IBR A;  3WWX A;  1IFQ A;  2WZX A;  2PDR A;  5CGX A;  1VB6 A;  1L3L A;  1FSY A;  3OLO A;  2P9V B;  3RH8 B;  2Y2P A;  2VGL S;  1K57 C;  4OKP A;  1K0K A;  2M1C A;  4OPZ A;  4S2N C;  2OLU A;  1BLS A;  3OPL A;  5FI6 A;  3N7W A;  3CG5 A;  1TVF A;  5FAO A;  4QY5 A;  1NY0 A;  1K25 A;  4NXE A;  2HP9 A;  2XFS A;  1GA9 A;  2Y2L A;  1T1B A;  1XPB A;  3Q81 A;  1HTZ A;  5MC7 A;  2XR0 A;  4Y5F A;  1YKD A;  3G31 A;  4FOF A;  4NET A;  5HAQ A;  5DTK A;  1K55 C;  1L2S A;  5IT5 A;  5GHX A;  3K3D A;  1KGE A;  3IH9 A;  2XA7 M;  2HP6 A;  4X1L A;  1XJ2 A;  2VV6 A;  5F83 A;  2ZQ9 A;  1CJF A;  4X69 A;  5FQI A;  4IBR A;  2W1T A;  3LR3 A;  4NKP A;  3IHB A;  5FQQ A;  2MJ6 A;  5EV0 A;  1YLW A;  4IHQ A;  5CTM A;  1SDE A;  3U2A A;  4KG2 A;  1T1A A;  4QY6 A;  1H5X A;  1RGY A;  2QWS A;  1FR6 A;  5DVA A;  3S7Q A;  4OPQ A;  4Q0I A;  2H28 A;  3BFG A;  3Q7Z A;  4R4R A;  5J8X A;  4HOI A;  5F68 A;  3N8L A;  3IF6 A;  3O86 A;  4IJG A;  2Y2N A;  1S67 L;  2ZJ9 A;  3F1P B;  4CLC D;  3A0R A;  1EW0 A;  4EUV A;  1GSX A;  5FDS A;  2QKP A;  1FR1 A;  4KEN B;  4R23 A;  2EXA A;  1EWZ A;  1LHY A;  4XUX A;  3QP5 A;  3IH8 A;  5EVI B;  4S2K A;  3G2Y A;  1ES5 A;  4EER A;  3BYD A;  3W8K A;  2HV1 A;  4YOF A;  4Y0O A;  2QMI A;  3F1O B;  3IHA A;  4OLG A;  4GOG A;  2WAE A;  4Y0T A;  5BOH A;  3T4K A;  3IQA A;  5JYP A;  3IBJ A;  1H8Y A;  2Y2G A;  4GHI A;  2ZQD A;  4XUZ A;  3C7U A;  2OWH A;  4GZB A;  4KZ9 A;  4R3B A;  5HDD A;  1TDG A;  4MEZ A;  4KZ3 A;  2UV0 E;  3IX8 A;  3NEC A;  4OVD A;  2Y2Q A;  3E4P A;  4E6X A;  1K6S A;  4PM9 A;  2PAV P;  3BLS A;  4Y15 A;  1IKI A;  3HLD A;  3IWO A;  4WEJ A;  4EW7 A;  3LR5 A;  3EQV A;  4NEE D;  3NIA A;  1TS6 A;  3MFD A;  3E4Q A;  3IF5 A;  3SS3 A;  4DDY A;  4HBT A;  1OTE A;  4HEF A;  4I3A A;  1BLH A;  1F2K A;  4EEP A;  3UB5 P;  4Q8I A;  1S1Z A;  5A8B A;  1ZG4 A;  5HPF A;  2VGK A;  1KE3 A;  4Y2F A;  2LB9 A;  1DJC A;  4LGW A;  3UB6 A;  4WMC D;  1NWZ A;  2IWD A;  2GNX A;  2XDM A;  2VZW A;  1ZC2 A;  4JF5 A;  2VV8 A;  1D1J A;  3MSH A;  2H10 A;  5E2H A;  5HW3 A;  1I2W A;  2WKQ A;  3M6B A;  2HZ5 A;  2WKE A;  4X68 A;  4X53 A;  3W2Z A;  3Q82 A;  3ZVW A;  2YKF A;  3GEC A;  4EBL A;  4Z9Q A;  3PR6 A;  5FA7 A;  4NXF A;  1JVJ A;  1YMS A;  3MF0 A;  5KMW A;  5HAP A;  3ZVT A;  3Q1F A;  2VA0 A;  4EET B;  3O5Y A;  4KQR A;  4M3K A;  3EEA A;  1NLY A;  1X0O A;  3IXD A;  5AVE A;  5AQB A;  3C38 A;  5EM1 A;  2WGW A;  3CI6 A;  3GSG A;  5CHM A;  4DMZ A;  2V1Z A;  4KQQ A;  4FSF A;  4BBT A;  2KDK A;  1SKO A;  3KYZ A;  4UQI M;  5EUA A;  2XSS A;  4Q0J A;  3D9Y A;  2HP5 A;  4KZ4 A;  2E8I A;  3A0V A;  3A3E A;  4HBU A;  4FUW A;  3VP0 A;  1XGI A;  3BFF A;  1ALQ A;  3NOT C;  5C5K A;  4B4X A;  1XKZ A;  1LSV A;  3MZE A;  3SOI A;  3OPR A;  2HJ9 C;  1GHM A;  5L2F A;  1K55 A;  3BY8 A;  3WS5 A;  2ZMF A;  3I7J A;  4Y17 A;  1BT5 A;  1OJ5 A;  2V8F A;  3C4P A;  4JXS A;  3ZCZ A;  1S0W A;  1E25 A;  2WZZ A;  3G32 A;  3SS5 A;  1M6K A;  2WKR A;  1HVB A;  1IYQ A;  3UPO A;  3PAE A;  2Y2H A;  3T12 B;  2H0T A;  1CQA A;  1MWU A;  4L9G A;  2XA7 S;  1P97 A;  1V9Z A;  4R3A A;  1C3B A;  4WBG A;  2W27 A;  2ZM0 A;  5HDS A;  5TGF A;  1ZTU A;  1G6O A;  1SDN A;  1GCE A;  1PFL A;  4FH2 A;  1ERQ A;  4OQG A;  4FH4 A;  1VET A;  5HDC A;  2K31 A;  4N9K A;  2VK3 A;  2JC7 A;  3Q07 A;  4DF6 A;  3LIA A;  2D01 A;  4EQ1 A;  5CTN A;  2JKF A;  3LIB A;  4JLF A;  2ZD8 A;  4GNU A;  4CPK A;  2QPN A;  3L9K A;  3JVV A;  3HLG A;  4N1X A;  1FCN A;  1O07 A;  3S4X A;  5FAP A;  1MXO A;  4KZ7 A;  3NDG A;  2NUT C;  1E4D A;  3N6I A;  4G3W A;  1W8Y A;  4S2L A;  2PRF A;  1ESU A;  3VSL A;  1FOF A;  3CAX A;  3W4O A;  1G68 A;  1W8Q A;  3KSF A;  4E3O A;  5CRF A;  1TS7 A;  2EWV A;  5KIZ A;  4E04 A;  4XXR A;  4A5R A;  4ARZ B;  4B88 A;  2R78 A;  2A24 B;  1L0F A;  4DN0 A;  1UGU A;  4HP9 A;  1XGJ A;  4EXO A;  3KYE A;  2ACG A;  1CI9 A;  1W79 A;  3GVB A;  3VP3 A;  3TE8 A;  2WUQ A;  4D2O A;  3NI9 A;  2Y55 A;  4C6Y A;  3NY4 A;  2JKT M;  1NRF A;  4AFI A;  3HLW A;  4LRZ E;  2Y59 A;  5CHU A;  2V1A A;  3SS4 A;  4CJN A;  1Q2P A;  3ZG9 B;  4LCL A;  5GLD A;  4S2O A;  1GSW A;  3FYZ A;  4DXC A;  2XRO A;  3VFF A;  2VX8 A;  3CPT A;  1NYM A;  3HJK A;  1XJ3 A;  1JTG A;  4DE0 A;  4LPZ A;  5A90 A;  3LI9 A;  5FQM A;  2P9V A;  4JGR A;  1I2S A;  3RJU A;  2JCH A;  3FPW A;  4OLD A;  3SH7 A;  5EEC A;  1W5D A;  3PHY A;  2J3T C;  5TJJ A;  4EV4 A;  1TF1 A;  2KX6 A;  3BW6 A;  3WS1 A;  3JYI A;  4HES A;  3BQ8 A;  3KSI A;  4MN6 A;  5A91 A;  3EOI A;  1VM1 A;  3HVF A;  4HJ3 A;  3GDI A;  1V9Y A;  4E3M A;  1OTB A;  1HLU P;  4N92 A;  2PR6 A;  4OQ0 A;  1VEU B;  3S1Y A;  3T50 A;  1SZV A;  3GTC A;  3IS2 B;  4UQI S;  3DTE A;  3G4P A;  5M18 A;  4CLC C;  2XD1 A;  3P01 A;  1WYC A;  4B93 A;  1ESI A;  2QJ7 A;  3MZF A;  2XF3 A;  4EUZ A;  3HJI A;  3NBL A;  4UAA A;  1OT6 A;  4QD4 A;  3PTE A;  1DP6 A;  4JXW A;  2ZOI A;  3IXH A;  1PI5 A;  2O99 A;  2I9V A;  4JGO A;  4GKU A;  1N9N A;  4YIN A;  3ZYT A;  1MWR A;  4NXG A;  3BEC A;  4R3J A;  1F9I A;  1AWI A;  5GL9 A;  3VSK A;  1OTD A;  1UWP X;  5EVE A;  1E3U A;  2WAD A;  2A3U A;  3UE1 A;  1P9W A;  1KE0 A;  2WAF A;  2W3H A;  3ZNT A;  1CK3 A;  2J9O A;  2Q9N A;  3VE3 A;  2XGN A;  5HAI A;  2R9X A;  1IEL A;  1PWC A;  3F1P A;  1TD5 A;  4EWF A;  4X25 A;  5HD5 A;  2B18 A;  2ZOH A;  3DW0 A;  3NDE A;  1FQG A;  3TJZ C;  4PMA A;  5EVI A;  3NUL A;  4X6T A;  2JBF A;  1ACF A;  1IOU A;  3DTI A;  4BD1 A;  1BZA A;  1OTI A;  3HCY A;  1LSX A;  2WGI A;  2PBY A;  1G6A A;  3CWF A;  2W3E A;  1N9O A;  3F1O A;  2J80 A;  3UPP A;  5DJU A;  4JXG A;  4YWZ A;  1K4F A;  5FEG A;  3VV4 A;  4IUH A;  4H6J B;  4S2M A;  4JXV A;  1ZG6 A;  3H7W B;  5F6A A;  1GA0 A;  1W63 M;  3VP4 A;  1GHP A;  2V20 A;  2HDR A;  3UE0 A;  5HAR A;  2HJE A;  2ZC3 B;  3IX3 A;  1T1C A;  3BFD A;  3IWI A;  5CX7 A;  3QP8 A;  3MXS A;  2Y2K A;  2ZMA A;  3C8C A;  3HRE A;  2RCX A;  4GDB A;  1PNE A;  4FCF A;  4Q0H A;  4DXB A;  4E3I A;  1K6R A;  1S4R A;  2Z2L B;  1A0K A;  4IED A;  3V50 A;  5FL3 A;  4C3Q A;  1KE4 A;  3QNB A;  1QME A;  3NOP C;  1MZU A;  2ZM8 A;  1PI4 A;  4GLQ A;  1NJ4 A;  5FAS A;  4WN5 A;  2H5S A;  2KLI A;  2L1M A;  2OSU A;  1LL5 A;  5IS1 A;  5K5B A;  1BYW A;  1ERM A;  1YPR A;  1XP4 A;  5L09 A;  3O3V A;  4ZRR A;  3OC2 A;  2BTF P;  1N4O A;  4WEK A;  2PD7 A;  1MY8 A; 
#chains in the Genus database with same CATH homology
 2PR5 A;  3BY8 A;  2JKR I;  2ZMF A;  3LR4 A;  4BMW A;  1OJ5 A;  5F5Y A;  4HH2 A;  1LSW A;  3LUQ A;  3S7P A;  3LI8 A;  4B9O A;  3UMD A;  3K2N A;  1LL8 A;  4WLA A;  3H82 B;  1XJ4 A;  4GS9 A;  3P7N A;  2WKR A;  4O8G A;  4RQ9 A;  2BAS A;  4MMN A;  3UE6 A;  2D02 A;  3RTY A;  2LB5 A;  1S66 L;  2O9B A;  1XJ6 A;  1W63 Q;  4LLO B;  2P08 A;  3ULF A;  4EU0 A;  1G28 A;  2JHE A;  1NRJ A;  4L9G A;  3VE4 A;  2XA7 S;  1P97 A;  1V9Z A;  4R3A A;  1DP8 A;  2Z6D A;  1ODV A;  3TRC A;  3MFX A;  2W27 A;  3BWL A;  5HDS A;  3T4T A;  4JGP A;  4OOM A;  3R4K A;  3VOL A;  1ZTU A;  1G6O A;  5DKK A;  2CMN A;  5TBM B;  2M7V A;  5HDC A;  5HD3 A;  3F1N A;  2Y79 A;  4IUK A;  2K31 A;  2YKH A;  1S1Y A;  3OBF A;  1MKM A;  1YSP A;  2FH5 A;  3E4O A;  4GW9 A;  1OTA A;  3H82 A;  3LIA A;  2D01 A;  4EQ1 A;  5G4Z A;  4HH3 A;  1KOU A;  3LIB A;  2ZMV A;  4II7 A;  3MQ0 A;  4OOL A;  4Z1W A;  3NHQ A;  5AVF A;  3JVV A;  2J3T D;  2W3F A;  2HF6 A;  2GJ3 A;  3BY9 A;  4BJP A;  4GCZ A;  2NUT C;  5HPI A;  1D06 A;  3OCN A;  2IA2 A;  5DF9 A;  4G3W A;  1TS0 A;  4O0P A;  2W3D A;  1YSQ A;  1YAX A;  3KX0 X;  3MJQ A;  4L9E A;  2V0W A;  5G4Y A;  5DFX A;  2JKT I;  5TBM A;  2Z6C A;  1Y28 A;  3CAX A;  1TS8 A;  4HJ6 A;  4K08 A;  5L8M A;  3KSF A;  3UB8 A;  2A2L A;  3E98 A;  3KSG A;  1TS7 A;  2EWV A;  3B33 A;  3KSH A;  4HJ4 A;  4WL9 A;  3T4Q A;  3MQO A;  2O9A A;  5F69 A;  4R70 A;  5KIZ A;  3ICY A;  4E04 A;  2G7U A;  3PXP A;  4ME4 A;  5LBR A;  4ARZ B;  2R78 A;  4PHT A;  4R38 A;  2A24 B;  3LIC A;  4YNR A;  3ZQ5 A;  2M7U A;  1NLZ A;  1H8M A;  3PBR A;  4CQH A;  2NUP C;  4DN0 A;  1UGU A;  1JNU A;  3T4S A;  5J4E A;  4HP9 A;  2VKS A;  2W1R A;  3CLO A;  4CLC B;  4EXO A;  1F5M A;  2KOI A;  3MR0 A;  3LFV A;  4PKY A;  2V1B A;  4G3V A;  2L4R A;  3S7O A;  3TE8 A;  3KO6 A;  3IBR A;  3DBA A;  1OJG A;  1IFQ A;  4P6Z M;  2PDR A;  2QHK A;  1VB6 A;  4HI4 A;  2B02 A;  3OLO A;  4DJ2 A;  3KYQ A;  3RH8 B;  2INW A;  5HSQ A;  4EEU A;  3UE3 A;  2VGL S;  1DRM A;  2JKT M;  2ZBB A;  3OCL A;  2M1C A;  3FG8 A;  5HL6 A;  3B47 A;  2OAP 1;  4AFI A;  4LRZ E;  2JN7 A;  4ETX A;  1DP9 A;  2VLG A;  2V1A A;  4ARZ A;  2W1T B;  2O0Y A;  2A24 A;  3UB7 A;  3K3C A;  1D7E A;  4WF0 A;  1GSW A;  2XRO A;  4NXE A;  4G3K A;  5AJG A;  2VX8 A;  4HIA A;  4CLC A;  1T1B A;  1MC0 A;  3HJK A;  1XJ3 A;  5DKL A;  3PBS A;  5MC7 A;  4Y5F A;  4LPZ A;  1YKD A;  4FOF A;  4LRY C;  2GZA A;  4UEY A;  4L9F A;  4I3J A;  3LI9 A;  4LRX C;  4R6L A;  3G6O A;  2V0U A;  5IT5 A;  4JGR A;  3K3D A;  3PBQ A;  4BBU A;  4F3L B;  3FPW A;  2XA7 M;  3PHY A;  2W0N A;  2J3T C;  3UB9 A;  5TJJ A;  3C2W A;  4GJ4 A;  1XJ2 A;  2VV6 A;  2KX6 A;  1TF1 A;  1OPX A;  3BW6 A;  2K2N A;  3S7N A;  4PAU A;  3BQ8 A;  3KSI A;  4MN6 A;  4CLC E;  2P04 A;  4JGQ A;  3EOI A;  2W1T A;  3LR3 A;  5KSH A;  4HJ3 A;  4HP4 A;  4NKP A;  3GDI A;  2MJ6 A;  1V9Y A;  4DJ3 A;  1OTB A;  3LIE A;  4IHQ A;  2PR6 A;  2OOL A;  3EGX C;  3U2A A;  4HNB A;  2PYR A;  3T50 A;  1T1A A;  3IS2 B;  4UQI S;  3CUE A;  2QWS A;  4PKY G;  4MN7 A;  3S7Q A;  3D3O A;  4XT2 B;  4Q0I A;  3E0Y A;  2H28 A;  5I5L A;  4HOI A;  4CLC C;  3BQA A;  5F68 A;  3P01 A;  4GHI B;  4B93 A;  2QJ7 A;  4IJG A;  4CLC D;  1S67 L;  3F1P B;  3HJI A;  2WKP A;  1OT6 A;  3A0R A;  4MCW A;  1DP6 A;  1EW0 A;  4EUV A;  1GSX A;  2ZOI A;  4KQD A;  4F3L A;  2QKP A;  2O99 A;  2I9V A;  4JGO A;  1N9N A;  3ZYT A;  4Y3I A;  2P7J A;  4GS9 B;  2O9C A;  4NXG A;  1F9I A;  2PHY A;  1OTD A;  1ZHH B;  4EER A;  1UWP X;  4KQO A;  2W3G A;  3TW8 A;  2HV1 A;  4I3I A;  4YOF A;  2PD8 A;  5EFW A;  1XFN A;  4EES A;  3LR0 A;  1P9W A;  4BBV A;  3F1O B;  2W3H A;  4I39 A;  2Y8H A;  3IS2 A;  3V67 A;  3BJN A;  4XT2 A;  3VE3 A;  3T4K A;  4HY8 A;  3IBJ A;  4M4X A;  4NXB A;  4GHI A;  2QJ5 A;  3F1P A;  5DJT A;  1TD5 A;  2OWH A;  3RFB A;  1T19 A;  1N9L A;  4WEL A;  5HD5 A;  2B18 A;  4BWI A;  3LIF A;  1WA9 A;  3EGD C;  5HDD A;  2ZOH A;  3NJA A;  1VHM A;  4ETZ A;  1UWN X;  3E4P A;  2QYB A;  2PD7 A;  3TJZ C;  4WEJ A;  4EW7 A;  3LR5 A;  1IOU A;  4WUJ A;  3EQV A;  4NEE D;  1GSV A;  4HQA A;  5J7E A;  1OTI A;  3HCY A;  5HWV A;  2V9A A;  1TS6 A;  1LSX A;  3E4Q A;  3FC7 A;  5HWW A;  5IU1 A;  3CWF A;  3T4O A;  2W3E A;  1N9O A;  2K7S A;  1F98 A;  2VGL M;  4I38 A;  1OTE A;  3MXQ A;  4I3A A;  2HGV A;  3UME A;  4KUK A;  3F1O A;  2J80 A;  4EEP A;  1S1Z A;  5DJU A;  3LID A;  4YWZ A;  4KUO A;  3SW1 A;  3VV4 A;  4IUH A;  4H6J B;  1LT0 A;  2L0W A;  5A8B A;  3PBO A;  2OWJ A;  4O01 A;  5DFY A;  5J3W A;  3T4L A;  5HPF A;  1P0Z A;  3R7W B;  4Y2F A;  2LB9 A;  3H7W B;  5F6A A;  1OT9 A;  2VV7 A;  4L0L A;  3C30 A;  3EQU A;  3UB6 A;  1H3Q A;  1NWZ A;  2DMW A;  2GNX A;  3EEH A;  2PYP A;  1W63 M;  3PBN A;  2VZW A;  2VV8 A;  2JKR M;  3MQQ A;  4HHD A;  5HZH A;  2HJE A;  2WKQ A;  1T1C A;  1P9R A;  3PBT A;  3W2Z A;  2YKF A;  5CX7 A;  3H9W A;  3LYX A;  3GEC A;  3PR6 A;  3FPV A;  4NXF A;  3MF0 A;  3C8C A;  2GX5 A;  2PT7 A;  3PYP A;  4Q0H A;  2VA0 A;  3CIT A;  4EET B;  3O5Y A;  3EEA A;  1NLY A;  1X0O A;  5AVE A;  4MN5 A;  1S4R A;  1XFQ A;  2FZ0 A;  3C38 A;  4I5S A;  3A0S A;  3CI6 A;  5FL3 A;  4H6J A;  4DMZ A;  1STZ A;  3NOP C;  1MZU A;  4MDZ A;  4FSF A;  4BBT A;  2KDK A;  4GLQ A;  4QPR A;  1T18 A;  2VJW A;  3R7W A;  2EWW A;  3H7W A;  4WN5 A;  3MMH A;  2J3W A;  3KYZ A;  1S4S A;  3B42 A;  4UQI M;  4P6Z S;  2XSS A;  2KLI A;  2L1M A;  4Q0J A;  5HWT A;  5IS1 A;  2VEA A;  5K5B A;  3T4J A;  1BYW A;  3NOU C;  3A0V A;  2EA9 A;  3JVU A;  4ZRR A;  3NOT C;  3OOV A;  5C5K A;  3EWK A;  3D72 A;  3OC2 A;  2XRN A;  1LSV A;  4WEK A;  2OAQ 1;  3F1N B;  3CUE C;  2HJ9 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...