1F98A

Crystal structure of the photoactive yellow protein mutant t50v
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
125
structure length
125
Chain Sequence
b'MEHVAFGSEDIENTLAKMDDGQLDGLAFGAIQLDGDGNILQYNAAEGDIVGRDPKQVIGKNFFKDVAPCTDSPEFYGKFKEGVASGNLNTMFEYTFDYQMTPTKVKVHMKKALSGDSYWVFVKRV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PHOTOACTIVE YELLOW PROTEIN
publication title Coupling of hydrogen bonding to chromophore conformation and function in photoactive yellow protein.
pubmed doi rcsb
source organism Halorhodospira halophila
molecule tags Signaling protein
total genus 32
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2000-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00989 PAS PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 1f98A00
3OLOA 1N9OA 3F1OA 3MQOA 1TS7A 3LIBA 4M4XA 5F5YA 2Z6DA 1UWNX 4EERA 1S1YA 5J3WA 2CMNA 1S1ZA 5DKKA 3F1PA 3T50A 3LIDA 1T1CA 2EA9A 4I3JA 3D72A 4WN5A 2VV7A 5HDCA 4K08A 1S4RA 3ICYA 4R38A 1OTBA 3EEHA 5F69A 4LRYC 2OWHA 3CAXA 1F9IA 3H82A 1OTDA 4BBTA 4DJ3A 1N9NA 4JGRA 1UWPX 3HJKA 5HSQA 2HV1A 4BBUA 2L1MA 3E4PA 1DP9A 1OTIA 1OJGA 4HJ6A 2WKRA 4XT2A 1LSVA 3E4QA 3HJIA 3MR0A 2QJ7A 3F1PB 4HIAA 4LPZA 4HJ4A 2ZOHA 1VB6A 1T18A 3BWLA 4WLAA 2V1BA 1GSVA 4I3IA 3C2WA 3BY9A 5KIZA 3LUQA 4KQDA 1Y28A 2YKHA 4EETB 1LL8A 3H9WA 3H82B 4I3AA 3C8CA 3MJQA 4B9OA 3G6OA 2PR5A 4YWZA 3LI8A 5I5LA 1NWZA 2PYRA 2I9VA 2Z6CA 4WUJA 2ZBBA 1DRMA 3EWKA 3A0SA 5HWVA 4HY8A 2R78A 1LT0A 3IBRA 1X0OA 3VE3A 3E4OA 4XT2B 1TS0A 4E04A 1V9YA 2VV6A 3NOTC 3MQQA 3UB9A 1OJ5A 3RH8B 1T19A 2J80A 2ZOIA 5G4ZA 1T1AA 3LYXA 3NJAA 3KX0X 4EESA 4LRXC 4GW9A 1OT6A 1F98A 1OTAA 2D02A 2OWJA 2WKPA 4R70A 5HD5A 3UMEA 3RTYA 1T1BA 5IU1A 2QKPA 4MN5A 1XJ2A 1S67L 3MXQA 5J4EA 2PD7A 1GSXA 1D06A 4HOIA 4KUOA 2V0UA 1WA9A 3FG8A 5HZHA 5DJUA 2VV8A 4NXEA 4I5SA 2YKFA 5F68A 4JGOA 3A0VA 5G4YA 2QWSA 4HH2A 1ODVA 1V9ZA 4HJ3A 4HHDA 2OOLA 1XJ3A 3B33A 4HP4A 4PKYA 1KOUA 4HQAA 3ULFA 5A8BA 3FC7A 5DKLA 5HDDA 1TS6A 3NHQA 1GSWA 1XJ4A 4HH3A 4L9FA 4HNBA 1S4SA 4EQ1A 3MFXA 4EW7A 2P7JA 1P0ZA 5J7EA 2D01A 3GDIA 2L0WA 1G28A 3UB8A 5HD3A 2VLGA 3UB6A 3F1NA 3VOLA 1OT9A 2PDRA 3LI9A 1LSWA 1S66L 2K7SA 3H7WA 1OTEA 1LSXA 3NOPC 4I39A 4L9EA 3PHYA 3UMDA 4GS9A 1P97A 2W0NA 4LRZE 4L9GA 4H6JA 4NXFA 3PYPA 1DP6A 2PYPA 1BYWA 3LICA 1UGUA 2VEAA 1TS8A 2GJ3A 4F3LA 3A0RA 2QJ5A 4GCZA 4PKYG 5F6AA 2INWA 3GECA 2H28A 3CLOA 2WKQA 1XJ6A 1XFNA 4HI4A 2KX6A 1XFQA 1MZUA 4NXGA 4DJ2A 4JGPA 3LIFA 2A24A 5EFWA 4GHIA 5AVEA 3BY8A 5AVFA 4RQ9A 3CWFA 2PHYA 3F1NB 5TBMB 2BASA 3IS2A 3LIAA 4WL9A 5HDSA 4R3AA 4KUKA 3H7WB 3F1OB 5IS1A 4BBVA 5HWWA 1D7EA 4GS9B 1DP8A 4R6LA 2JHEA 2L4RA 4H6JB 3LIEA 3UB7A 2PR6A 4I38A 4F3LB 3NOUC 4WF0A 3K3CA 2W27A 2B02A 3UE6A 3P7NA 4MN6A 1JNUA 4JGQA 2V0WA 2V9AA 4EEUA 2A24B 1N9LA 3K3DA 2KDKA 4GHIB 4EXOA 4EEPA 4HP9A 4LLOB 5DJTA 4NXBA 2JN7A 5HWTA 3SW1A 5TBMA 2M1CA 3VE4A 3ZQ5A 1EW0A 3IS2B 2PD8A 2QHKA 2V1AA
chains in the Genus database with same CATH superfamily
4QPRA 3HLFA 1SKFA 4O01A 1KE3A 3D9YA 3EOIA 4Y5FA 3UDIA 1Q2PA 3T50A 1L0EA 1GA9A 1TF1A 2DCFA 1ERMA 1IFQA 2EA9A 1L0GA 5KSHA 1NYYA 1S4RA 4R38A 2B18A 4NEED 2WKEA 5L09A 1OTBA 3IX8A 4MNRA 5F69A 4E3IA 3IXBA 3CAXA 4OPQA 5TGFA 4JF4A 1KE4A 2HPBA 2EX2A 2Y4AA 1OTDA 5FDHA 3WS4A 4DE3A 3FWLA 4DJ3A 1PW1A 4JGRA 4HBTA 2PT7A 1UWPX 1YLWA 4MBFA 1EROA 4O8GA 5HSQA 4MCWA 3U2AA 2Z2MB 2J7VA 5EUAA 3R4KA 1OTIA 3HLEA 2WKRA 1MWTA 4E3JA 4KQQA 1STZA 1RCJA 2RCXA 2QJ7A 3F1PB 2VGLS 3A3DA 2ZOHA 1SDEA 4WLAA 1FSYA 1CI8A 1S0WA 4S2MA 3LEQA 3LUQA 4KQDA 1Y28A 4EUVA 2C5WB 2XD1A 3H9WA 1W63Q 4JLFA 4X53A 3V3SA 3C8CA 4Q0IA 4L0LA 3NIAA 5I5LA 4S2IA 1NWZA 5FI2A 4YNRA 4S2LA 4JKTA 2W3GA 2X01A 2Z6CA 3OPLA 2O9BA 2P08A 3TE8A 2EFUA 2W1RA 5HWVA 4UQIS 1PI5A 2VJWA 2V2FF 3KSIA 4ETXA 2H5SA 4XT2B 1TS0A 4E04A 3T4JA 3W8KA 1V9YA 2WGWA 1VETB 1YLPA 3CI6A 3NOTC 4JXSA 4DN0A 3S7PA 2BTFP 5U47A 3DBAA 2HP6A 3T1XA 1IOUA 1OJ5A 3RH8B 1XA1A 2MJ6A 1K25A 3Q1FA 4XUZA 5FEGA 3NJAA 3TG9A 3KX0X 3JPUA 4BMWA 3SS5A 1F2KA 4Y0OA 1PWGA 1SDNA 3L7HA 4R3JA 5K5BA 1ALQA 1F98A 2V1ZA 3IHAA 3VSLA 5A90A 5E2EA 2QKPA 3BLSA 4OP5A 1MKIA 2EXAA 4U3TA 1YMSA 3MXQA 2LB5A 3HBRA 1FCMA 1GSXA 1L0DA 3BYDA 4BLMA 3VFFA 4OLGA 4GD6A 5TR7A 2Y8HA 4WEJA 2XH9A 4B93A 3DW0A 2Z2LB 5E43A 4JGOA 2XFSA 4MN7A 1YSPA 2J9OA 2WAEA 3IWIA 1E3UA 3FPWA 2ZQCA 1ZC2A 4MDZA 1J3WA 2ZC7A 3P01A 1K57A 3DTMA 4IBRA 1ODVA 4HJ3A 5CGWA 1GHMA 3ZYTA 4D60A 2C6WB 1YPRA 2JKGA 2WKIA 1XJ3A 2BG1A 4G3VA 3FKVA 3B33A 1NJ4A 1H8ZA 2XDMA 2H0TA 2Y55A 3UE1A 2QYBA 1Y54A 3CUEC 4YOFA 5A8BA 4KG2A 4OQ0A 3LR5A 2JKRM 3K2NA 5DKLA 4Q8IA 4BENA 5IT5A 3BM6A 4S2NA 5F1GA 4E3LA 2ZQ8A 5EV0A 2HJEA 3NHQA 1GSWA 2KOIA 4PM7A 4HH3A 4HNBA 5AQ9A 5FSRA 3G31A 5HAIA 3N6IA 4S2KA 1FCNA 3WRZA 1BT5A 4OOMA 3MFXA 1K4EA 2ACGA 1W5DA 5DVAA 1P0ZA 5CECA 4Y17A 5FAQA 5EVLA 2D01A 4OONA 1G28A 5D3OA 3MXSA 5DTTA 3CG5A 1OT9A 4LV0A 3NC8A 1K38A 3O86A 3MFDA 2K7SA 3H7WA 1GA0A 3WRTA 3PHYA 5GL9A 4UAAA 4EBNA 4C75A 3DTKA 2W0NA 4LCMA 1QMFA 3DTIA 4L9GA 1K56A 1BSGA 4R23A 1XGIA 3PYPA 1W8YA 3IWOA 2JKTI 3LY3A 3LICA 1N4OA 3MXRA 3CPTA 2VEAA 1ZHHB 3A0RA 4GCZA 4PKYG 5KZHA 2H28A 3CLOA 2A2LA 2WKQA 1XJ6A 1TDLA 1K4FA 2KX6A 1XFQA 4NG2A 4NXGA 3Q7VA 4JGPA 3LIFA 4LGWA 1HZOA 5JYOA 3AGFA 4E3MA 5E2HA 3N8SA 1SKOA 3PBRA 3UNWA 1I2WA 5DTSA 5TBMB 2P9VA 2BASA 4ZJ2A 1SHVA 4CLCA 5HDSA 4DRTA 2DMWA 1SZVA 2WGVA 4ESPA 5IS1A 4BBVA 3U4LP 4WBGA 1ES3A 5HPFA 2LB9A 1NLYA 4DDYA 3N7WA 3HVFA 4R4SA 4B88A 1JTDA 4R1GA 3L9KA 2Y2JA 4F3LB 3GR2A 4PM6A 1A0KA 3W4QA 5FASA 4A5RA 3K3CA 5FL3A 5CTMA 3SS3A 3UE6A 1LI0A 2VGJA 1KGGA 4MN6A 1ESIA 4ETZA 3WS5A 3G4PA 2A24B 3ZNYA 4GHIB 2ZL1A 4WM9A 5DJTA 2JN7A 5HWTA 5TBMA 3VE4A 3ZQ5A 3ZG7B 3IS2B 3Q82A 2V1AA 3Q07A 3OLOA 3MQOA 3LIBA 4M4XA 3MKEA 3NDEA 4OVDA 2W3EA 3EQVA 4EERA 3V50A 5J3WA 5DKKA 1K55C 2VGLM 1RGZA 3BJNA 3C30A 4ARZB 4IVKA 1T1CA 4WYYA 2OLVA 1LL5A 1MBLA 2W3DA 2ZLYA 5EVIA 4I3JA 4RVAA 1PWDA 3ITBA 2WYXA 4IVIA 2HJ9C 2WZXA 3ICYA 4OP8A 2WK0A 3KSFA 3EEHA 3FYZA 3SH7A 1IYSA 2VK3A 1LLBA 3H82A 4Y7PA 4BBTA 2Y2LA 4Q0JA 3ZHHA 4O0PA 3OCLA 4UQIM 1BLHA 2Y91A 3TOIA 3ZCZA 4HJ6A 1NXYA 4DDSA 2J3WA 4QU3A 2UWXA 3S7QA 3T1SA 3GV9A 4Y0TA 1LSVA 4N1HA 3E4QA 4GDBA 2O9CA 2PBDP 3M6HA 3A3IA 4QJGA 5EM0A 1MKMA 1VB6A 5CHMA 4HESA 1T18A 4QB8A 3BWLA 3CMZA 3MKFA 4U0TA 4PAUA 1PZOA 3LO7A 1H8YA 1YQSA 1M40A 2YKHA 2ZC6B 4OQIA 4X68A 3ISGA 4BQMA 5FA7A 1K54A 1LHYA 4WELA 3IF5A 2JKRI 4OQGA 4I3AA 1VEUA 3MJQA 4KZ3A 5CGSA 4B9OA 2J8YA 2PR5A 2XGNA 4ZAMA 1K57C 1W63M 1L0FA 1IKGA 3BW6A 5M19A 2PU4A 3PAGA 3BFCA 3N4IA 2ZBBA 3EWKA 3A0SA 3PBQA 2GNXA 1X0OA 3VE3A 5DTKA 3VV4A 4PM5A 3V67A 2WZZA 2Y2IA 4HEFA 1K0KA 4X1LA 1ZTUA 2VX8A 4KENB 4P6BA 4S2NC 2JKTM 1L2SA 3CJMA 1IEMA 3A3EA 5LBRA 1DY6A 3W2ZA 3VP4A 3UO9A 4GW9A 4EBPA 1OT6A 4OOYA 2D02A 2ZC5B 3T1QB 3DTEA 5HD5A 5F1FA 5EPHA 1XJ2A 1MWUA 1YLYA 1PWCA 1S67L 3G35A 4GNUA 4X69A 2EX6A 3UN7A 1GCEA 1D06A 3A3JA 4CQHA 4C3QA 1Y4OA 3FG8A 5GLBA 3PTEA 5CHJA 5EOEA 5HZHA 4JPMA 2W1TA 4PM9A 4I5SA 3HUNA 3NY4A 5HARA 2CC1A 3AGDA 3R7WA 4WMCD 3O3VA 4C6YA 5C5KA 2WGWB 1V9ZA 3NI9A 4DE2A 4JF5A 2XQZA 1TVFA 2PAVP 3D3OA 3PXPA 2XROA 3ZG5A 2HP9A 5TJJA 5DFYA 4FH4A 3IXHA 3PBSA 3NBLA 2RL3A 3OC2A 3MZEA 3QNCA 3KSHA 3GTCA 4X55A 4ZRRA 1AWIA 1HD8A 5CHUA 2HDQA 4DE0A 3V39A 4X6TA 2G2WA 3KSGA 1H0MA 5J8XA 3PBOA 1XJ4A 3W4PA 5A93A 2OSUA 3Q7ZA 3IX3A 3WS1A 1N9BA 4CLCC 2Y2KA 3NCKA 4EQ1A 3TJZC 2P7JA 4KZ4A 1WYBA 2XD5A 3FZCA 5E2GA 4WZ5C 1K56D 1FR1A 2ZMAA 3GDIA 2L0WA 3QP8A 3UB8A 3F1NA 3JYIA 3LI9A 1LSWA 1Z09A 2HDSA 4PHTA 1JVJA 3RXWA 4X56A 3QHYA 3NOPC 4I39A 3EQUA 4L9EA 2XFTA 5L07A 1ACFA 4LCLA 2GX5A 2Y2HA 4GS9A 3MZDA 2XRNA 4ME4A 4LRZE 2V8FA 3S4XA 4H6JA 3CHWP 1M6KA 1DP6A 4S2OA 4N92A 3VP2A 4CPKA 3BQ8A 5F6AA 2WKHA 4U0XA 4RYEA 5AJGA 4PMAA 2DNSA 1YSQA 3IH8A 4HI4A 2X71A 2UV0E 2PBYA 5EVEA 2EX9A 4JF6A 1E4DA 3BY8A 5AVFA 2H10A 4E6WA 3ZG8B 3NDGA 2J3TC 1PYYA 5EVIC 3QP1A 3LIAA 4WL9A 4EQIA 3H7WB 3OPHA 5KMWA 3B3XA 4X1MA 3C7UA 3M2JA 3IXDA 3UDFA 3KO6A 4R6LA 1I5QA 1MC0A 2JHEA 4GD8A 4IEDA 4KQOA 2PU2A 4UEYA 3IWQA 1YLJA 3CPTB 1CEFA 5CTNA 1ESUA 2XF3A 3LGOA 3O88A 2JBFA 4ZDXA 2W27A 4JBFA 1DJBA 3P7NA 1JNUA 4KZ7A 3O5YA 4JGQA 1ES2A 3Q7VB 4N9KA 1ZG6A 2FH5A 4EXOA 3C38A 1RP5A 1GHPA 3BRMA 4LV1A 1K6SA 1SKOB 2J3TD 3T12B 2ZQDA 3GQZA 1YAXA 4NXBA 3SW1A 5M18A 2HDRA 2FFYA 2P9VB 5A91A 4MMNA 2QHKA 4CLCB 1N9OA 1TS7A 4KG6A 2W3HA 4O7DA 1NYMA 2Z6DA 2ZC4B 3WWXA 2OV5A 3ZGAB 1KVLA 2M7VA 3SH9A 5HAPA 4GB7A 2CMNA 1NRFA 5FATA 4UHUA 1K54C 3IXGA 3LIDA 3IT9A 2W3FA 1BZAA 3CZDA 2I72A 5MC7A 2GZAA 2O9AA 4ZTKA 5FI7A 1PIOA 3VMAA 4UA9A 1Q2QA 1KDSA 2VV7A 2A3UA 4IUKA 2Y2NA 2IWBA 3ZG0A 5E2FA 3BECA 2EWVA 1H3QA 4DXCA 1FILA 1C3BA 2ZM2A 1N9NA 2Y2GA 5BOHA 4YFMA 2ZL1B 3EGDC 3HJKA 4MLLA 4QY5A 3O87A 1HVBA 5AQBA 5EM1A 2P74A 3E4PA 5CEDA 1DP9A 1OJGA 4DE1A 5DF8A 2B5RA 3GRJA 1ONHA 1XA7A 3HJIA 3EEAA 3IX4A 4HIAA 2B95A 3BFDA 3OCNA 4HJ4A 3QP5A 2AVXA 2NUTC 5EVIB 3UB5P 2V1BA 1GSVA 2O0YA 4I3IA 2WGIA 4QD4A 5EE8A 3G32A 3WS0A 5KIZA 3C5AA 4ZBEA 1KGFA 4EETB 1LL8A 2DRWA 4DF6A 3KYQA 3H82B 2XLNA 1J9MA 3GVBA 3G6OA 3LI8A 4K0XA 1VM1A 5FDSA 2PYRA 1PFLA 2G7UA 3P09A 2I9VA 2XEPA 1DRMA 3V3RA 4KZ6A 3RFBA 4HY8A 4FH2A 3IBRA 3E4OA 2VKSA 3B42A 5AQAA 3BFEA 2QPNA 3OBFA 2VV6A 3V5MA 2R9XA 3MQQA 3UDXA 2ZQ7A 4G3WA 3UB9A 3DWKA 2J80A 2ZOIA 3T4QA 3LYXA 5KSCA 4EESA 1NRJA 3UE3A 2IWDA 3PR6A 1DJCA 1BULA 2OWJA 1ZG4A 3UMEA 1NLZA 2P04A 4QWOA 4DMZA 4CJNA 3RTYA 2XK1A 5IU1A 3ZDJA 4MN5A 3DAVA 4N9LA 1LL9A 2ZQ9A 1VEUB 4OPZA 5DF9A 4EBLA 1ES5A 2PD7A 3BQAA 1IKIA 3B47A 2HGVA 4KUOA 4BL2A 3MSHA 5HFOA 3CUEA 4NXEA 5DF7A 5F68A 1Z6FA 1JWZA 1FR6A 1PNEA 5G4YA 3D4FA 1BLPA 3HUOA 4HH2A 1WE4A 2O99A 3LCEA 3G2YA 3SS4A 2HF6A 4P6ZS 4HHDA 4QHCA 1TDGA 3T1RA 1XPBA 4KG5A 4HP4A 4PKYA 5CRFA 3BFFA 3UE0A 1H8MA 1BUEA 1KOUA 4GZBA 1SCWA 1NZUA 3ULFA 4B4ZA 2E8JA 3FC7A 1MXOA 3MMHA 5CXWA 1CI9A 3HL9A 3TRCA 1TS6A 3ZG9B 1KVMA 2EX8A 1HTZA 2Q9MA 1KGEA 2W1TB 3VOZA 3VP3A 3ITAA 3KYZA 1S6RA 4Y0UA 4EW7A 1JTGA 2V20A 3R7WB 5J7EA 4E3NA 4P0MA 5HD3A 1W7FA 3VOLA 4K0WA 4XXRA 4KZBA 4G3KA 3S22A 3M6BA 1P9WA 1S66L 1OTEA 1LSXA 1QMEA 4JXGA 1G6OA 2K31A 3UPPA 2G2UA 2V8CA 1MWSA 4KQRA 4NXFA 4R0QA 1E3UD 1DJAA 3HLBA 1BYWA 1PW8A 1UGUA 1ZKJA 4N1XA 5CERA 2GJ3A 5FQQA 2INWA 3GECA 5HX9A 4ZJ3A 1H5XA 1XFNA 4DXBA 3MZFA 2VZWA 4QY6A 5AVEA 3IF6A 2WUQA 2ZMVA 1TEMA 4RQ9A 3MBZA 3CWFA 1W8QA 3F1NB 2J9PA 3W4OA 1PI4A 4KUKA 3F1OB 2EXBA 5HWWA 5FQKA 1D7EA 4GS9B 1NZOA 1FSWA 3EGXC 3HLDA 1PRQA 4H6JB 4FSFA 4F94A 4H8RA 3NULA 2X02A 4FTXA 3C7VA 5IHVA 1K6RA 3A3FA 2E8IA 5GLDA 1O07A 2ZM0A 5HL6A 2Y2QA 1W79A 4WF0A 4OPYA 1K55A 3S7OA 1D1JA 3QP2A 4KZ9A 5FAPA 3OPPA 3P98A 5AQ7A 2V9AA 1N9LA 4P87A 3K3DA 3S1YA 4OH0A 3JVUA 4RX2A 4LLOB 3FKWA 5JYPA 2M1CA 3LFVA 4NETA 2PD8A 4KZAA 3F1OA 1IYOA 5F5YA 1VQQA 5I94A 3E2KA 2IWCA 4DKIA 3TSGA 1UWNX 4ID4A 1S1YA 3SH8A 1S1ZA 1AXBA 3SZTA 4OKPA 3F1PA 4PPRA 4FD8A 1XKZA 4UA7A 5HPIA 4II7A 1GHIA 3GMWA 1FQGA 3E2LA 1ERQA 3D72A 5L8MA 4WN5A 5HDCA 4K08A 4E3KA 4GDNA 4LRYC 3MF0A 1VHMA 4LV2A 2OWHA 4MBHA 4CLCD 3AGEA 4EV4A 2HDUA 3FV7A 4EWFA 1F9IA 5TFQA 2Q0OA 1U60A 3BLMA 3BEBA 4IBXA 1FCOA 4R4RA 3RJUA 5FQ9A 3PBTA 4IJGA 1FOFA 2HV1A 4LFUA 2XR0A 3M2KA 4BBUA 3OPRA 2WADA 2L1MA 3C4OA 2EWWA 2ZC3B 4XT2A 4FUWA 3BFGA 1VETA 4Q0HA 4Z1WA 3KYEA 3MR0A 4FCFA 5FQMA 4LPZA 4LENA 1E25A 3HLWA 4S2PA 5GLCA 5HW3A 3I7JA 4BWIA 3C2WA 3UPOA 3BY9A 3ZFZA 2GDNA 1XXMA 3VOYA 3SOIA 4WMCA 3FPVA 4OPRA 3IH9A 1OMEA 5G18A 1YT4A 4NK3A 4Y15A 2R9WA 1MY8A 4YWZA 4XUXA 2HZ5A 4Y2FA 5FAOA 3LR0A 2ZQAA 3TW8A 3HLGA 4WUJA 2VA0A 2VGKA 1IYPA 2IA2A 4UA6A 2ZJ9A 2H0YA 5EVID 2R78A 1LT0A 4BD1A 5GHYA 1XX2A 5F82A 1XGJA 2ZM8A 1JWVA 4P6ZM 4GKUA 3T4KA 4KZ5A 2JC7A 1T19A 1EWZA 1EI5A 5G4ZA 1T1AA 3HUMA 5GLAA 3OZHA 4RA7A 3G2ZA 4OLDA 3VFHA 4LRXC 2Y2OA 2OAQ1 1G68A 4IUHA 5F83A 1OTAA 4Y13A 3MQ0A 1NY0A 4MEZA 2WKPA 5CX7A 4HBUA 4R70A 1T1BA 3LR4A 5J4EA 3ZVWA 3WS2A 4HOIA 2V0UA 1WA9A 2K2NA 4R3BA 4EU0A 3UY6A 5DJUA 3ZNTA 3T4SA 2VV8A 2XA7M 1RGYA 4D2OA 5CEBA 2YKFA 4WEKA 3A0VA 3N8LA 4CLCE 2QWSA 5L2FA 1ES4A 1F5MA 4RX3A 3E0YA 2OOLA 3JVVA 2ZD8A 4AFIA 4LV3A 1G6AA 2Y2MA 4GN2A 1YLZA 1KDWA 1BTLA 3OOVA 4WZ5A 4HQAA 1CQAA 3Q81A 1YM1A 3C4PA 1MPLA 4EUZA 5HDDA 1YKDA 4E6XA 5L10A 2JCHA 1JWPA 1CK3A 1FIKA 3IF6C 3IQAA 3G34A 4JXWA 4L9FA 1S4SA 3S7NA 5M1AA 3NECA 5EECA 1CJFA 5EOOA 1P9RA 3UPNA 2ZMFA 4GLQA 4OQHA 3VP0A 1I2SA 3N8RA 4PM8A 3DWZA 2VLGA 3UB6A 2WAFA 2PDRA 5HAQA 4GOGA 4BD0A 1ONGA 3HLCA 3QNBA 5FQJA 4ZJ1A 1HLUP 1LI9A 2FFFB 4E3OA 1XP4A 1KE0A 3UMDA 3QP6A 4JXVA 4K91A 4KZ8A 2NUPC 2HP5A 4Z9QA 1IYQA 2Q9NA 2Y79A 1P97A 2KLIA 2PYPA 1MWRA 2JKFA 3VP1A 2BLSA 1TS8A 2A49A 3ZVTA 4F3LA 2JE5A 2QJ5A 3LEZA 2OLUA 3T4LA 5CGXA 3E98A 3HCYA 2FZ0A 3HREA 4GJ4A 1MZUA 2XSSA 4DJ2A 2A24A 4M3KA 5EFWA 5FI6A 4GHIA 4YINA 3QP4A 1CF0A 5HL1A 5FEFA 1IELA 2PHYA 4FOFA 4S2JA 3T4OA 1G5UA 3IS2A 5FQIA 4WZ4A 4R3AA 1YMXA 5DFXA 1TD5A 5A92A 1DP8A 3LR3A 4X25A 1YLTA 4BL3A 4B4XA 4ARZA 2L4RA 3LIEA 3PAEA 3UB7A 2QZ6A 5GHZA 3LY4A 2PR6A 4I38A 2Y59A 3RXXA 3GSGA 3NOUC 1CEGA 3CITA 3T4TA 4OOLA 3G30A 2OAP1 1L3LA 2XA7S 2B02A 3IBJA 3VSKA 1WYCA 1BLSA 1O7EA 1PZPA 4Y3IA 2V0WA 2M7UA 4EEUA 2KDKA 5GHXA 1BLCA 3PBNA 4EEPA 3IF6B 2Y2PA 4HP9A 4MBKA 1OPXA 2PRFA 3IHBA 2QMIA 1EW0A 3MS6A 4NKPA 4BJPA 4IHQA 4P85A 2EFXA
chains in the Genus database with same CATH topology
4CLCB 3OLOA 1N9OA 3F1OA 3MQOA 1TS7A 3LIBA 4M4XA 4QPRA 5F5YA 2W3HA 2Z6DA 4O01A 3EOIA 2M7VA 1UWNX 2W3EA 3EQVA 4Y5FA 4EERA 1S1YA 5J3WA 2CMNA 1S1ZA 5DKKA 2VGLM 3BJNA 3C30A 3F1PA 4ARZB 3T50A 3LIDA 2W3FA 1T1CA 5HPIA 4II7A 1TF1A 2GZAA 5MC7A 1IFQA 2O9AA 2W3DA 2EA9A 4I3JA 5KSHA 3D72A 2HJ9C 5L8MA 4WN5A 2VV7A 5HDCA 4K08A 1S4RA 3ICYA 4R38A 2B18A 4NEED 4IUKA 1OTBA 3KSFA 3EEHA 5F69A 4LRYC 3MF0A 1VHMA 2OWHA 3CAXA 4CLCD 2EWVA 1F9IA 1H3QA 3H82A 1OTDA 4BBTA 4DJ3A 1N9NA 4JGRA 2PT7A 1UWPX 3EGDC 4Q0JA 3HJKA 4O8GA 3PBTA 3OCLA 4IJGA 4O0PA 5HSQA 4MCWA 4UQIM 3U2AA 2HV1A 3R4KA 4BBUA 2L1MA 3E4PA 1DP9A 1OTIA 1OJGA 2EWWA 4HJ6A 2WKRA 4XT2A 2J3WA 3S7QA 4Q0HA 1LSVA 1STZA 4Z1WA 3E4QA 3HJIA 3EEAA 2O9CA 3MR0A 2QJ7A 3F1PB 4HIAA 4LPZA 2VGLS 3OCNA 4HJ4A 2ZOHA 1MKMA 1VB6A 2NUTC 1T18A 3BWLA 4WLAA 2V1BA 1GSVA 2O0YA 4I3IA 4BWIA 3C2WA 3BY9A 4PAUA 5KIZA 3LUQA 4KQDA 1Y28A 2YKHA 3FPVA 4EUVA 4EETB 1LL8A 4WELA 2JKRI 3H9WA 1W63Q 3KYQA 3H82B 4I3AA 3C8CA 3MJQA 4B9OA 4Q0IA 3G6OA 2PR5A 4YWZA 4L0LA 3LI8A 5I5LA 4Y2FA 1NWZA 1W63M 2PYRA 4YNRA 3BW6A 3LR0A 2G7UA 3TW8A 2W3GA 2I9VA 2Z6CA 4WUJA 2VA0A 2ZBBA 2O9BA 1DRMA 2P08A 2IA2A 3EWKA 3TE8A 3A0SA 2W1RA 3RFBA 5HWVA 4HY8A 4UQIS 2R78A 1LT0A 3PBQA 3IBRA 2GNXA 1X0OA 3VE3A 2VJWA 3E4OA 3VV4A 2VKSA 3KSIA 4ETXA 3B42A 4XT2B 1TS0A 4E04A 3T4JA 1V9YA 3OBFA 2VV6A 3CI6A 3V67A 3NOTC 4DN0A 3S7PA 4P6ZM 3MQQA 3DBAA 4G3WA 3UB9A 3T4KA 1IOUA 1OJ5A 3RH8B 1T19A 1ZTUA 2VX8A 2MJ6A 2J80A 2ZOIA 5G4ZA 2JKTM 3T4QA 1T1AA 3LYXA 3NJAA 5LBRA 3KX0X 4EESA 1NRJA 3W2ZA 4BMWA 4LRXC 2OAQ1 4GW9A 3UE3A 4IUHA 1OT6A 5K5BA 1F98A 1OTAA 2D02A 3PR6A 3MQ0A 2OWJA 2WKPA 5CX7A 4R70A 5HD5A 3UMEA 1NLZA 2P04A 4DMZA 1T1BA 2QKPA 5IU1A 3RTYA 1XJ2A 4MN5A 1S67L 3LR4A 5DF9A 3MXQA 2LB5A 5J4EA 2PD7A 3BQAA 1GSXA 1D06A 4HOIA 3B47A 4CQHA 2HGVA 4KUOA 2V0UA 1WA9A 2K2NA 2Y8HA 4WEJA 4EU0A 4B93A 3FG8A 5HZHA 5DJUA 3T4SA 2VV8A 2XA7M 3CUEA 4NXEA 2W1TA 4I5SA 2YKFA 5F68A 4JGOA 4MN7A 1YSPA 4WEKA 3A0VA 5G4YA 3FPWA 4BJPA 4CLCE 2QWSA 4HH2A 4MDZA 3R7WA 2O99A 3P01A 5C5KA 1ODVA 1V9ZA 2HF6A 4HJ3A 1F5MA 4P6ZS 3ZYTA 3E0YA 4HHDA 2OOLA 3JVVA 3D3OA 4AFIA 3PXPA 2XROA 1XJ3A 4G3VA 5TJJA 3B33A 5DFYA 3PBSA 4HP4A 4PKYA 2QYBA 1H8MA 1KOUA 3OC2A 3OOVA 3CUEC 4YOFA 4HQAA 3ULFA 5A8BA 3KSHA 4ZRRA 3FC7A 3LR5A 2JKRM 3K2NA 5DKLA 3MMHA 5IT5A 5HDDA 1YKDA 3TRCA 2HJEA 1TS6A 3KSGA 3NHQA 1GSWA 2KOIA 3PBOA 1XJ4A 4HH3A 4L9FA 4HNBA 1S4SA 3S7NA 2W1TB 4CLCC 3KYZA 4EQ1A 4OOMA 3MFXA 4EW7A 3TJZC 1P9RA 2P7JA 2ZMFA 3R7WB 1P0ZA 4GLQA 5J7EA 2D01A 3GDIA 2L0WA 1G28A 2VLGA 5HD3A 3UB8A 3UB6A 3F1NA 3VOLA 1OT9A 2PDRA 3LI9A 1LSWA 4G3KA 4PHTA 1P9WA 1S66L 2K7SA 3H7WA 1OTEA 1LSXA 3NOPC 4I39A 1G6OA 2K31A 3EQUA 4L9EA 3PHYA 3UMDA 2GX5A 4GS9A 2NUPC 2Y79A 2XRNA 1P97A 4ME4A 2W0NA 4LRZE 4L9GA 4H6JA 2KLIA 4NXFA 3PYPA 1DP6A 2PYPA 2JKTI 1BYWA 4IHQA 3LICA 1UGUA 2VEAA 1TS8A 1ZHHB 2GJ3A 4F3LA 3A0RA 2QJ5A 4GCZA 4PKYG 3BQ8A 5F6AA 2INWA 3GECA 3T4LA 2H28A 3CLOA 2A2LA 3E98A 5AJGA 2WKQA 1XJ6A 1YSQA 1XFNA 4HI4A 3HCYA 2FZ0A 2KX6A 1XFQA 4GJ4A 1MZUA 2XSSA 4NXGA 4DJ2A 4JGPA 3LIFA 4MMNA 2A24A 5EFWA 2VZWA 4GHIA 5AVEA 2ZMVA 3BY8A 5AVFA 4RQ9A 3CWFA 3PBRA 2J3TC 2PHYA 4FOFA 3T4OA 3F1NB 5TBMB 2BASA 3IS2A 3LIAA 4WL9A 5HDSA 4CLCA 2DMWA 4R3AA 4KUKA 3H7WB 3F1OB 5DFXA 5IS1A 4BBVA 1TD5A 5HWWA 1D7EA 4GS9B 3KO6A 1DP8A 5HPFA 4R6LA 3LR3A 1MC0A 2LB9A 1NLYA 3EGXC 4ARZA 2JHEA 2L4RA 4H6JB 3LIEA 4FSFA 3UB7A 4KQOA 4UEYA 2PR6A 4I38A 4F3LB 3NOUC 5HL6A 3CITA 3T4TA 4OOLA 4WF0A 2OAP1 3K3CA 5FL3A 2XA7S 3S7OA 2W27A 2B02A 3IBJA 3UE6A 3P7NA 4MN6A 1JNUA 3O5YA 4JGQA 4ETZA 4Y3IA 2V0WA 2V9AA 2M7UA 4EEUA 2A24B 1N9LA 3K3DA 2KDKA 4GHIB 2FH5A 4EXOA 3PBNA 4EEPA 3C38A 3JVUA 4HP9A 1OPXA 2J3TD 4LLOB 1YAXA 5DJTA 4NXBA 2JN7A 5HWTA 3SW1A 5TBMA 2M1CA 3LFVA 3VE4A 3ZQ5A 1EW0A 4NKPA 3IS2B 2PD8A 2QHKA 2V1AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OLO A;  1N9O A;  3F1O A;  3MQO A;  1TS7 A;  3LIB A;  4M4X A;  5F5Y A;  2Z6D A;  1UWN X;  4EER A;  1S1Y A;  5J3W A;  2CMN A;  1S1Z A;  5DKK A;  3F1P A;  3T50 A;  3LID A;  1T1C A;  2EA9 A;  4I3J A;  3D72 A;  4WN5 A;  2VV7 A;  5HDC A;  4K08 A;  1S4R A;  3ICY A;  4R38 A;  1OTB A;  3EEH A;  5F69 A;  4LRY C;  2OWH A;  3CAX A;  1F9I A;  3H82 A;  1OTD A;  4BBT A;  4DJ3 A;  1N9N A;  4JGR A;  1UWP X;  3HJK A;  5HSQ A;  2HV1 A;  4BBU A;  2L1M A;  3E4P A;  1DP9 A;  1OTI A;  1OJG A;  4HJ6 A;  2WKR A;  4XT2 A;  1LSV A;  3E4Q A;  3HJI A;  3MR0 A;  2QJ7 A;  3F1P B;  4HIA A;  4LPZ A;  4HJ4 A;  2ZOH A;  1VB6 A;  1T18 A;  3BWL A;  4WLA A;  2V1B A;  1GSV A;  4I3I A;  3C2W A;  3BY9 A;  5KIZ A;  3LUQ A;  4KQD A;  1Y28 A;  2YKH A;  4EET B;  1LL8 A;  3H9W A;  3H82 B;  4I3A A;  3C8C A;  3MJQ A;  4B9O A;  3G6O A;  2PR5 A;  4YWZ A;  3LI8 A;  5I5L A;  1NWZ A;  2PYR A;  2I9V A;  2Z6C A;  4WUJ A;  2ZBB A;  1DRM A;  3EWK A;  3A0S A;  5HWV A;  4HY8 A;  2R78 A;  1LT0 A;  3IBR A;  1X0O A;  3VE3 A;  3E4O A;  4XT2 B;  1TS0 A;  4E04 A;  1V9Y A;  2VV6 A;  3NOT C;  3MQQ A;  3UB9 A;  1OJ5 A;  3RH8 B;  1T19 A;  2J80 A;  2ZOI A;  5G4Z A;  1T1A A;  3LYX A;  3NJA A;  3KX0 X;  4EES A;  4LRX C;  4GW9 A;  1OT6 A;  1F98 A;  1OTA A;  2D02 A;  2OWJ A;  2WKP A;  4R70 A;  5HD5 A;  3UME A;  3RTY A;  1T1B A;  5IU1 A;  2QKP A;  4MN5 A;  1XJ2 A;  1S67 L;  3MXQ A;  5J4E A;  2PD7 A;  1GSX A;  1D06 A;  4HOI A;  4KUO A;  2V0U A;  1WA9 A;  3FG8 A;  5HZH A;  5DJU A;  2VV8 A;  4NXE A;  4I5S A;  2YKF A;  5F68 A;  4JGO A;  3A0V A;  5G4Y A;  2QWS A;  4HH2 A;  1ODV A;  1V9Z A;  4HJ3 A;  4HHD A;  2OOL A;  1XJ3 A;  3B33 A;  4HP4 A;  4PKY A;  1KOU A;  4HQA A;  3ULF A;  5A8B A;  3FC7 A;  5DKL A;  5HDD A;  1TS6 A;  3NHQ A;  1GSW A;  1XJ4 A;  4HH3 A;  4L9F A;  4HNB A;  1S4S A;  4EQ1 A;  3MFX A;  4EW7 A;  2P7J A;  1P0Z A;  5J7E A;  2D01 A;  3GDI A;  2L0W A;  1G28 A;  3UB8 A;  5HD3 A;  2VLG A;  3UB6 A;  3F1N A;  3VOL A;  1OT9 A;  2PDR A;  3LI9 A;  1LSW A;  1S66 L;  2K7S A;  3H7W A;  1OTE A;  1LSX A;  3NOP C;  4I39 A;  4L9E A;  3PHY A;  3UMD A;  4GS9 A;  1P97 A;  2W0N A;  4LRZ E;  4L9G A;  4H6J A;  4NXF A;  3PYP A;  1DP6 A;  2PYP A;  1BYW A;  3LIC A;  1UGU A;  2VEA A;  1TS8 A;  2GJ3 A;  4F3L A;  3A0R A;  2QJ5 A;  4GCZ A;  4PKY G;  5F6A A;  2INW A;  3GEC A;  2H28 A;  3CLO A;  2WKQ A;  1XJ6 A;  1XFN A;  4HI4 A;  2KX6 A;  1XFQ A;  1MZU A;  4NXG A;  4DJ2 A;  4JGP A;  3LIF A;  2A24 A;  5EFW A;  4GHI A;  5AVE A;  3BY8 A;  5AVF A;  4RQ9 A;  3CWF A;  2PHY A;  3F1N B;  5TBM B;  2BAS A;  3IS2 A;  3LIA A;  4WL9 A;  5HDS A;  4R3A A;  4KUK A;  3H7W B;  3F1O B;  5IS1 A;  4BBV A;  5HWW A;  1D7E A;  4GS9 B;  1DP8 A;  4R6L A;  2JHE A;  2L4R A;  4H6J B;  3LIE A;  3UB7 A;  2PR6 A;  4I38 A;  4F3L B;  3NOU C;  4WF0 A;  3K3C A;  2W27 A;  2B02 A;  3UE6 A;  3P7N A;  4MN6 A;  1JNU A;  4JGQ A;  2V0W A;  2V9A A;  4EEU A;  2A24 B;  1N9L A;  3K3D A;  2KDK A;  4GHI B;  4EXO A;  4EEP A;  4HP9 A;  4LLO B;  5DJT A;  4NXB A;  2JN7 A;  5HWT A;  3SW1 A;  5TBM A;  2M1C A;  3VE4 A;  3ZQ5 A;  1EW0 A;  3IS2 B;  2PD8 A;  2QHK A;  2V1A A; 
#chains in the Genus database with same CATH topology
 4QPR A;  3HLF A;  1SKF A;  4O01 A;  1KE3 A;  3D9Y A;  3EOI A;  4Y5F A;  3UDI A;  1Q2P A;  3T50 A;  1L0E A;  1GA9 A;  1TF1 A;  2DCF A;  1ERM A;  1IFQ A;  2EA9 A;  1L0G A;  5KSH A;  1NYY A;  1S4R A;  4R38 A;  2B18 A;  4NEE D;  2WKE A;  5L09 A;  1OTB A;  3IX8 A;  4MNR A;  5F69 A;  4E3I A;  3IXB A;  3CAX A;  4OPQ A;  5TGF A;  4JF4 A;  1KE4 A;  2HPB A;  2EX2 A;  2Y4A A;  1OTD A;  5FDH A;  3WS4 A;  4DE3 A;  3FWL A;  4DJ3 A;  1PW1 A;  4JGR A;  4HBT A;  2PT7 A;  1UWP X;  1YLW A;  4MBF A;  1ERO A;  4O8G A;  5HSQ A;  4MCW A;  3U2A A;  2Z2M B;  2J7V A;  5EUA A;  3R4K A;  1OTI A;  3HLE A;  2WKR A;  1MWT A;  4E3J A;  4KQQ A;  1STZ A;  1RCJ A;  2RCX A;  2QJ7 A;  3F1P B;  2VGL S;  3A3D A;  2ZOH A;  1SDE A;  4WLA A;  1FSY A;  1CI8 A;  1S0W A;  4S2M A;  3LEQ A;  3LUQ A;  4KQD A;  1Y28 A;  4EUV A;  2C5W B;  2XD1 A;  3H9W A;  1W63 Q;  4JLF A;  4X53 A;  3V3S A;  3C8C A;  4Q0I A;  4L0L A;  3NIA A;  5I5L A;  4S2I A;  1NWZ A;  5FI2 A;  4YNR A;  4S2L A;  4JKT A;  2W3G A;  2X01 A;  2Z6C A;  3OPL A;  2O9B A;  2P08 A;  3TE8 A;  2EFU A;  2W1R A;  5HWV A;  4UQI S;  1PI5 A;  2VJW A;  2V2F F;  3KSI A;  4ETX A;  2H5S A;  4XT2 B;  1TS0 A;  4E04 A;  3T4J A;  3W8K A;  1V9Y A;  2WGW A;  1VET B;  1YLP A;  3CI6 A;  3NOT C;  4JXS A;  4DN0 A;  3S7P A;  2BTF P;  5U47 A;  3DBA A;  2HP6 A;  3T1X A;  1IOU A;  1OJ5 A;  3RH8 B;  1XA1 A;  2MJ6 A;  1K25 A;  3Q1F A;  4XUZ A;  5FEG A;  3NJA A;  3TG9 A;  3KX0 X;  3JPU A;  4BMW A;  3SS5 A;  1F2K A;  4Y0O A;  1PWG A;  1SDN A;  3L7H A;  4R3J A;  5K5B A;  1ALQ A;  1F98 A;  2V1Z A;  3IHA A;  3VSL A;  5A90 A;  5E2E A;  2QKP A;  3BLS A;  4OP5 A;  1MKI A;  2EXA A;  4U3T A;  1YMS A;  3MXQ A;  2LB5 A;  3HBR A;  1FCM A;  1GSX A;  1L0D A;  3BYD A;  4BLM A;  3VFF A;  4OLG A;  4GD6 A;  5TR7 A;  2Y8H A;  4WEJ A;  2XH9 A;  4B93 A;  3DW0 A;  2Z2L B;  5E43 A;  4JGO A;  2XFS A;  4MN7 A;  1YSP A;  2J9O A;  2WAE A;  3IWI A;  1E3U A;  3FPW A;  2ZQC A;  1ZC2 A;  4MDZ A;  1J3W A;  2ZC7 A;  3P01 A;  1K57 A;  3DTM A;  4IBR A;  1ODV A;  4HJ3 A;  5CGW A;  1GHM A;  3ZYT A;  4D60 A;  2C6W B;  1YPR A;  2JKG A;  2WKI A;  1XJ3 A;  2BG1 A;  4G3V A;  3FKV A;  3B33 A;  1NJ4 A;  1H8Z A;  2XDM A;  2H0T A;  2Y55 A;  3UE1 A;  2QYB A;  1Y54 A;  3CUE C;  4YOF A;  5A8B A;  4KG2 A;  4OQ0 A;  3LR5 A;  2JKR M;  3K2N A;  5DKL A;  4Q8I A;  4BEN A;  5IT5 A;  3BM6 A;  4S2N A;  5F1G A;  4E3L A;  2ZQ8 A;  5EV0 A;  2HJE A;  3NHQ A;  1GSW A;  2KOI A;  4PM7 A;  4HH3 A;  4HNB A;  5AQ9 A;  5FSR A;  3G31 A;  5HAI A;  3N6I A;  4S2K A;  1FCN A;  3WRZ A;  1BT5 A;  4OOM A;  3MFX A;  1K4E A;  2ACG A;  1W5D A;  5DVA A;  1P0Z A;  5CEC A;  4Y17 A;  5FAQ A;  5EVL A;  2D01 A;  4OON A;  1G28 A;  5D3O A;  3MXS A;  5DTT A;  3CG5 A;  1OT9 A;  4LV0 A;  3NC8 A;  1K38 A;  3O86 A;  3MFD A;  2K7S A;  3H7W A;  1GA0 A;  3WRT A;  3PHY A;  5GL9 A;  4UAA A;  4EBN A;  4C75 A;  3DTK A;  2W0N A;  4LCM A;  1QMF A;  3DTI A;  4L9G A;  1K56 A;  1BSG A;  4R23 A;  1XGI A;  3PYP A;  1W8Y A;  3IWO A;  2JKT I;  3LY3 A;  3LIC A;  1N4O A;  3MXR A;  3CPT A;  2VEA A;  1ZHH B;  3A0R A;  4GCZ A;  4PKY G;  5KZH A;  2H28 A;  3CLO A;  2A2L A;  2WKQ A;  1XJ6 A;  1TDL A;  1K4F A;  2KX6 A;  1XFQ A;  4NG2 A;  4NXG A;  3Q7V A;  4JGP A;  3LIF A;  4LGW A;  1HZO A;  5JYO A;  3AGF A;  4E3M A;  5E2H A;  3N8S A;  1SKO A;  3PBR A;  3UNW A;  1I2W A;  5DTS A;  5TBM B;  2P9V A;  2BAS A;  4ZJ2 A;  1SHV A;  4CLC A;  5HDS A;  4DRT A;  2DMW A;  1SZV A;  2WGV A;  4ESP A;  5IS1 A;  4BBV A;  3U4L P;  4WBG A;  1ES3 A;  5HPF A;  2LB9 A;  1NLY A;  4DDY A;  3N7W A;  3HVF A;  4R4S A;  4B88 A;  1JTD A;  4R1G A;  3L9K A;  2Y2J A;  4F3L B;  3GR2 A;  4PM6 A;  1A0K A;  3W4Q A;  5FAS A;  4A5R A;  3K3C A;  5FL3 A;  5CTM A;  3SS3 A;  3UE6 A;  1LI0 A;  2VGJ A;  1KGG A;  4MN6 A;  1ESI A;  4ETZ A;  3WS5 A;  3G4P A;  2A24 B;  3ZNY A;  4GHI B;  2ZL1 A;  4WM9 A;  5DJT A;  2JN7 A;  5HWT A;  5TBM A;  3VE4 A;  3ZQ5 A;  3ZG7 B;  3IS2 B;  3Q82 A;  2V1A A;  3Q07 A;  3OLO A;  3MQO A;  3LIB A;  4M4X A;  3MKE A;  3NDE A;  4OVD A;  2W3E A;  3EQV A;  4EER A;  3V50 A;  5J3W A;  5DKK A;  1K55 C;  2VGL M;  1RGZ A;  3BJN A;  3C30 A;  4ARZ B;  4IVK A;  1T1C A;  4WYY A;  2OLV A;  1LL5 A;  1MBL A;  2W3D A;  2ZLY A;  5EVI A;  4I3J A;  4RVA A;  1PWD A;  3ITB A;  2WYX A;  4IVI A;  2HJ9 C;  2WZX A;  3ICY A;  4OP8 A;  2WK0 A;  3KSF A;  3EEH A;  3FYZ A;  3SH7 A;  1IYS A;  2VK3 A;  1LLB A;  3H82 A;  4Y7P A;  4BBT A;  2Y2L A;  4Q0J A;  3ZHH A;  4O0P A;  3OCL A;  4UQI M;  1BLH A;  2Y91 A;  3TOI A;  3ZCZ A;  4HJ6 A;  1NXY A;  4DDS A;  2J3W A;  4QU3 A;  2UWX A;  3S7Q A;  3T1S A;  3GV9 A;  4Y0T A;  1LSV A;  4N1H A;  3E4Q A;  4GDB A;  2O9C A;  2PBD P;  3M6H A;  3A3I A;  4QJG A;  5EM0 A;  1MKM A;  1VB6 A;  5CHM A;  4HES A;  1T18 A;  4QB8 A;  3BWL A;  3CMZ A;  3MKF A;  4U0T A;  4PAU A;  1PZO A;  3LO7 A;  1H8Y A;  1YQS A;  1M40 A;  2YKH A;  2ZC6 B;  4OQI A;  4X68 A;  3ISG A;  4BQM A;  5FA7 A;  1K54 A;  1LHY A;  4WEL A;  3IF5 A;  2JKR I;  4OQG A;  4I3A A;  1VEU A;  3MJQ A;  4KZ3 A;  5CGS A;  4B9O A;  2J8Y A;  2PR5 A;  2XGN A;  4ZAM A;  1K57 C;  1W63 M;  1L0F A;  1IKG A;  3BW6 A;  5M19 A;  2PU4 A;  3PAG A;  3BFC A;  3N4I A;  2ZBB A;  3EWK A;  3A0S A;  3PBQ A;  2GNX A;  1X0O A;  3VE3 A;  5DTK A;  3VV4 A;  4PM5 A;  3V67 A;  2WZZ A;  2Y2I A;  4HEF A;  1K0K A;  4X1L A;  1ZTU A;  2VX8 A;  4KEN B;  4P6B A;  4S2N C;  2JKT M;  1L2S A;  3CJM A;  1IEM A;  3A3E A;  5LBR A;  1DY6 A;  3W2Z A;  3VP4 A;  3UO9 A;  4GW9 A;  4EBP A;  1OT6 A;  4OOY A;  2D02 A;  2ZC5 B;  3T1Q B;  3DTE A;  5HD5 A;  5F1F A;  5EPH A;  1XJ2 A;  1MWU A;  1YLY A;  1PWC A;  1S67 L;  3G35 A;  4GNU A;  4X69 A;  2EX6 A;  3UN7 A;  1GCE A;  1D06 A;  3A3J A;  4CQH A;  4C3Q A;  1Y4O A;  3FG8 A;  5GLB A;  3PTE A;  5CHJ A;  5EOE A;  5HZH A;  4JPM A;  2W1T A;  4PM9 A;  4I5S A;  3HUN A;  3NY4 A;  5HAR A;  2CC1 A;  3AGD A;  3R7W A;  4WMC D;  3O3V A;  4C6Y A;  5C5K A;  2WGW B;  1V9Z A;  3NI9 A;  4DE2 A;  4JF5 A;  2XQZ A;  1TVF A;  2PAV P;  3D3O A;  3PXP A;  2XRO A;  3ZG5 A;  2HP9 A;  5TJJ A;  5DFY A;  4FH4 A;  3IXH A;  3PBS A;  3NBL A;  2RL3 A;  3OC2 A;  3MZE A;  3QNC A;  3KSH A;  3GTC A;  4X55 A;  4ZRR A;  1AWI A;  1HD8 A;  5CHU A;  2HDQ A;  4DE0 A;  3V39 A;  4X6T A;  2G2W A;  3KSG A;  1H0M A;  5J8X A;  3PBO A;  1XJ4 A;  3W4P A;  5A93 A;  2OSU A;  3Q7Z A;  3IX3 A;  3WS1 A;  1N9B A;  4CLC C;  2Y2K A;  3NCK A;  4EQ1 A;  3TJZ C;  2P7J A;  4KZ4 A;  1WYB A;  2XD5 A;  3FZC A;  5E2G A;  4WZ5 C;  1K56 D;  1FR1 A;  2ZMA A;  3GDI A;  2L0W A;  3QP8 A;  3UB8 A;  3F1N A;  3JYI A;  3LI9 A;  1LSW A;  1Z09 A;  2HDS A;  4PHT A;  1JVJ A;  3RXW A;  4X56 A;  3QHY A;  3NOP C;  4I39 A;  3EQU A;  4L9E A;  2XFT A;  5L07 A;  1ACF A;  4LCL A;  2GX5 A;  2Y2H A;  4GS9 A;  3MZD A;  2XRN A;  4ME4 A;  4LRZ E;  2V8F A;  3S4X A;  4H6J A;  3CHW P;  1M6K A;  1DP6 A;  4S2O A;  4N92 A;  3VP2 A;  4CPK A;  3BQ8 A;  5F6A A;  2WKH A;  4U0X A;  4RYE A;  5AJG A;  4PMA A;  2DNS A;  1YSQ A;  3IH8 A;  4HI4 A;  2X71 A;  2UV0 E;  2PBY A;  5EVE A;  2EX9 A;  4JF6 A;  1E4D A;  3BY8 A;  5AVF A;  2H10 A;  4E6W A;  3ZG8 B;  3NDG A;  2J3T C;  1PYY A;  5EVI C;  3QP1 A;  3LIA A;  4WL9 A;  4EQI A;  3H7W B;  3OPH A;  5KMW A;  3B3X A;  4X1M A;  3C7U A;  3M2J A;  3IXD A;  3UDF A;  3KO6 A;  4R6L A;  1I5Q A;  1MC0 A;  2JHE A;  4GD8 A;  4IED A;  4KQO A;  2PU2 A;  4UEY A;  3IWQ A;  1YLJ A;  3CPT B;  1CEF A;  5CTN A;  1ESU A;  2XF3 A;  3LGO A;  3O88 A;  2JBF A;  4ZDX A;  2W27 A;  4JBF A;  1DJB A;  3P7N A;  1JNU A;  4KZ7 A;  3O5Y A;  4JGQ A;  1ES2 A;  3Q7V B;  4N9K A;  1ZG6 A;  2FH5 A;  4EXO A;  3C38 A;  1RP5 A;  1GHP A;  3BRM A;  4LV1 A;  1K6S A;  1SKO B;  2J3T D;  3T12 B;  2ZQD A;  3GQZ A;  1YAX A;  4NXB A;  3SW1 A;  5M18 A;  2HDR A;  2FFY A;  2P9V B;  5A91 A;  4MMN A;  2QHK A;  4CLC B;  1N9O A;  1TS7 A;  4KG6 A;  2W3H A;  4O7D A;  1NYM A;  2Z6D A;  2ZC4 B;  3WWX A;  2OV5 A;  3ZGA B;  1KVL A;  2M7V A;  3SH9 A;  5HAP A;  4GB7 A;  2CMN A;  1NRF A;  5FAT A;  4UHU A;  1K54 C;  3IXG A;  3LID A;  3IT9 A;  2W3F A;  1BZA A;  3CZD A;  2I72 A;  5MC7 A;  2GZA A;  2O9A A;  4ZTK A;  5FI7 A;  1PIO A;  3VMA A;  4UA9 A;  1Q2Q A;  1KDS A;  2VV7 A;  2A3U A;  4IUK A;  2Y2N A;  2IWB A;  3ZG0 A;  5E2F A;  3BEC A;  2EWV A;  1H3Q A;  4DXC A;  1FIL A;  1C3B A;  2ZM2 A;  1N9N A;  2Y2G A;  5BOH A;  4YFM A;  2ZL1 B;  3EGD C;  3HJK A;  4MLL A;  4QY5 A;  3O87 A;  1HVB A;  5AQB A;  5EM1 A;  2P74 A;  3E4P A;  5CED A;  1DP9 A;  1OJG A;  4DE1 A;  5DF8 A;  2B5R A;  3GRJ A;  1ONH A;  1XA7 A;  3HJI A;  3EEA A;  3IX4 A;  4HIA A;  2B95 A;  3BFD A;  3OCN A;  4HJ4 A;  3QP5 A;  2AVX A;  2NUT C;  5EVI B;  3UB5 P;  2V1B A;  1GSV A;  2O0Y A;  4I3I A;  2WGI A;  4QD4 A;  5EE8 A;  3G32 A;  3WS0 A;  5KIZ A;  3C5A A;  4ZBE A;  1KGF A;  4EET B;  1LL8 A;  2DRW A;  4DF6 A;  3KYQ A;  3H82 B;  2XLN A;  1J9M A;  3GVB A;  3G6O A;  3LI8 A;  4K0X A;  1VM1 A;  5FDS A;  2PYR A;  1PFL A;  2G7U A;  3P09 A;  2I9V A;  2XEP A;  1DRM A;  3V3R A;  4KZ6 A;  3RFB A;  4HY8 A;  4FH2 A;  3IBR A;  3E4O A;  2VKS A;  3B42 A;  5AQA A;  3BFE A;  2QPN A;  3OBF A;  2VV6 A;  3V5M A;  2R9X A;  3MQQ A;  3UDX A;  2ZQ7 A;  4G3W A;  3UB9 A;  3DWK A;  2J80 A;  2ZOI A;  3T4Q A;  3LYX A;  5KSC A;  4EES A;  1NRJ A;  3UE3 A;  2IWD A;  3PR6 A;  1DJC A;  1BUL A;  2OWJ A;  1ZG4 A;  3UME A;  1NLZ A;  2P04 A;  4QWO A;  4DMZ A;  4CJN A;  3RTY A;  2XK1 A;  5IU1 A;  3ZDJ A;  4MN5 A;  3DAV A;  4N9L A;  1LL9 A;  2ZQ9 A;  1VEU B;  4OPZ A;  5DF9 A;  4EBL A;  1ES5 A;  2PD7 A;  3BQA A;  1IKI A;  3B47 A;  2HGV A;  4KUO A;  4BL2 A;  3MSH A;  5HFO A;  3CUE A;  4NXE A;  5DF7 A;  5F68 A;  1Z6F A;  1JWZ A;  1FR6 A;  1PNE A;  5G4Y A;  3D4F A;  1BLP A;  3HUO A;  4HH2 A;  1WE4 A;  2O99 A;  3LCE A;  3G2Y A;  3SS4 A;  2HF6 A;  4P6Z S;  4HHD A;  4QHC A;  1TDG A;  3T1R A;  1XPB A;  4KG5 A;  4HP4 A;  4PKY A;  5CRF A;  3BFF A;  3UE0 A;  1H8M A;  1BUE A;  1KOU A;  4GZB A;  1SCW A;  1NZU A;  3ULF A;  4B4Z A;  2E8J A;  3FC7 A;  1MXO A;  3MMH A;  5CXW A;  1CI9 A;  3HL9 A;  3TRC A;  1TS6 A;  3ZG9 B;  1KVM A;  2EX8 A;  1HTZ A;  2Q9M A;  1KGE A;  2W1T B;  3VOZ A;  3VP3 A;  3ITA A;  3KYZ A;  1S6R A;  4Y0U A;  4EW7 A;  1JTG A;  2V20 A;  3R7W B;  5J7E A;  4E3N A;  4P0M A;  5HD3 A;  1W7F A;  3VOL A;  4K0W A;  4XXR A;  4KZB A;  4G3K A;  3S22 A;  3M6B A;  1P9W A;  1S66 L;  1OTE A;  1LSX A;  1QME A;  4JXG A;  1G6O A;  2K31 A;  3UPP A;  2G2U A;  2V8C A;  1MWS A;  4KQR A;  4NXF A;  4R0Q A;  1E3U D;  1DJA A;  3HLB A;  1BYW A;  1PW8 A;  1UGU A;  1ZKJ A;  4N1X A;  5CER A;  2GJ3 A;  5FQQ A;  2INW A;  3GEC A;  5HX9 A;  4ZJ3 A;  1H5X A;  1XFN A;  4DXB A;  3MZF A;  2VZW A;  4QY6 A;  5AVE A;  3IF6 A;  2WUQ A;  2ZMV A;  1TEM A;  4RQ9 A;  3MBZ A;  3CWF A;  1W8Q A;  3F1N B;  2J9P A;  3W4O A;  1PI4 A;  4KUK A;  3F1O B;  2EXB A;  5HWW A;  5FQK A;  1D7E A;  4GS9 B;  1NZO A;  1FSW A;  3EGX C;  3HLD A;  1PRQ A;  4H6J B;  4FSF A;  4F94 A;  4H8R A;  3NUL A;  2X02 A;  4FTX A;  3C7V A;  5IHV A;  1K6R A;  3A3F A;  2E8I A;  5GLD A;  1O07 A;  2ZM0 A;  5HL6 A;  2Y2Q A;  1W79 A;  4WF0 A;  4OPY A;  1K55 A;  3S7O A;  1D1J A;  3QP2 A;  4KZ9 A;  5FAP A;  3OPP A;  3P98 A;  5AQ7 A;  2V9A A;  1N9L A;  4P87 A;  3K3D A;  3S1Y A;  4OH0 A;  3JVU A;  4RX2 A;  4LLO B;  3FKW A;  5JYP A;  2M1C A;  3LFV A;  4NET A;  2PD8 A;  4KZA A;  3F1O A;  1IYO A;  5F5Y A;  1VQQ A;  5I94 A;  3E2K A;  2IWC A;  4DKI A;  3TSG A;  1UWN X;  4ID4 A;  1S1Y A;  3SH8 A;  1S1Z A;  1AXB A;  3SZT A;  4OKP A;  3F1P A;  4PPR A;  4FD8 A;  1XKZ A;  4UA7 A;  5HPI A;  4II7 A;  1GHI A;  3GMW A;  1FQG A;  3E2L A;  1ERQ A;  3D72 A;  5L8M A;  4WN5 A;  5HDC A;  4K08 A;  4E3K A;  4GDN A;  4LRY C;  3MF0 A;  1VHM A;  4LV2 A;  2OWH A;  4MBH A;  4CLC D;  3AGE A;  4EV4 A;  2HDU A;  3FV7 A;  4EWF A;  1F9I A;  5TFQ A;  2Q0O A;  1U60 A;  3BLM A;  3BEB A;  4IBX A;  1FCO A;  4R4R A;  3RJU A;  5FQ9 A;  3PBT A;  4IJG A;  1FOF A;  2HV1 A;  4LFU A;  2XR0 A;  3M2K A;  4BBU A;  3OPR A;  2WAD A;  2L1M A;  3C4O A;  2EWW A;  2ZC3 B;  4XT2 A;  4FUW A;  3BFG A;  1VET A;  4Q0H A;  4Z1W A;  3KYE A;  3MR0 A;  4FCF A;  5FQM A;  4LPZ A;  4LEN A;  1E25 A;  3HLW A;  4S2P A;  5GLC A;  5HW3 A;  3I7J A;  4BWI A;  3C2W A;  3UPO A;  3BY9 A;  3ZFZ A;  2GDN A;  1XXM A;  3VOY A;  3SOI A;  4WMC A;  3FPV A;  4OPR A;  3IH9 A;  1OME A;  5G18 A;  1YT4 A;  4NK3 A;  4Y15 A;  2R9W A;  1MY8 A;  4YWZ A;  4XUX A;  2HZ5 A;  4Y2F A;  5FAO A;  3LR0 A;  2ZQA A;  3TW8 A;  3HLG A;  4WUJ A;  2VA0 A;  2VGK A;  1IYP A;  2IA2 A;  4UA6 A;  2ZJ9 A;  2H0Y A;  5EVI D;  2R78 A;  1LT0 A;  4BD1 A;  5GHY A;  1XX2 A;  5F82 A;  1XGJ A;  2ZM8 A;  1JWV A;  4P6Z M;  4GKU A;  3T4K A;  4KZ5 A;  2JC7 A;  1T19 A;  1EWZ A;  1EI5 A;  5G4Z A;  1T1A A;  3HUM A;  5GLA A;  3OZH A;  4RA7 A;  3G2Z A;  4OLD A;  3VFH A;  4LRX C;  2Y2O A;  2OAQ 1;  1G68 A;  4IUH A;  5F83 A;  1OTA A;  4Y13 A;  3MQ0 A;  1NY0 A;  4MEZ A;  2WKP A;  5CX7 A;  4HBU A;  4R70 A;  1T1B A;  3LR4 A;  5J4E A;  3ZVW A;  3WS2 A;  4HOI A;  2V0U A;  1WA9 A;  2K2N A;  4R3B A;  4EU0 A;  3UY6 A;  5DJU A;  3ZNT A;  3T4S A;  2VV8 A;  2XA7 M;  1RGY A;  4D2O A;  5CEB A;  2YKF A;  4WEK A;  3A0V A;  3N8L A;  4CLC E;  2QWS A;  5L2F A;  1ES4 A;  1F5M A;  4RX3 A;  3E0Y A;  2OOL A;  3JVV A;  2ZD8 A;  4AFI A;  4LV3 A;  1G6A A;  2Y2M A;  4GN2 A;  1YLZ A;  1KDW A;  1BTL A;  3OOV A;  4WZ5 A;  4HQA A;  1CQA A;  3Q81 A;  1YM1 A;  3C4P A;  1MPL A;  4EUZ A;  5HDD A;  1YKD A;  4E6X A;  5L10 A;  2JCH A;  1JWP A;  1CK3 A;  1FIK A;  3IF6 C;  3IQA A;  3G34 A;  4JXW A;  4L9F A;  1S4S A;  3S7N A;  5M1A A;  3NEC A;  5EEC A;  1CJF A;  5EOO A;  1P9R A;  3UPN A;  2ZMF A;  4GLQ A;  4OQH A;  3VP0 A;  1I2S A;  3N8R A;  4PM8 A;  3DWZ A;  2VLG A;  3UB6 A;  2WAF A;  2PDR A;  5HAQ A;  4GOG A;  4BD0 A;  1ONG A;  3HLC A;  3QNB A;  5FQJ A;  4ZJ1 A;  1HLU P;  1LI9 A;  2FFF B;  4E3O A;  1XP4 A;  1KE0 A;  3UMD A;  3QP6 A;  4JXV A;  4K91 A;  4KZ8 A;  2NUP C;  2HP5 A;  4Z9Q A;  1IYQ A;  2Q9N A;  2Y79 A;  1P97 A;  2KLI A;  2PYP A;  1MWR A;  2JKF A;  3VP1 A;  2BLS A;  1TS8 A;  2A49 A;  3ZVT A;  4F3L A;  2JE5 A;  2QJ5 A;  3LEZ A;  2OLU A;  3T4L A;  5CGX A;  3E98 A;  3HCY A;  2FZ0 A;  3HRE A;  4GJ4 A;  1MZU A;  2XSS A;  4DJ2 A;  2A24 A;  4M3K A;  5EFW A;  5FI6 A;  4GHI A;  4YIN A;  3QP4 A;  1CF0 A;  5HL1 A;  5FEF A;  1IEL A;  2PHY A;  4FOF A;  4S2J A;  3T4O A;  1G5U A;  3IS2 A;  5FQI A;  4WZ4 A;  4R3A A;  1YMX A;  5DFX A;  1TD5 A;  5A92 A;  1DP8 A;  3LR3 A;  4X25 A;  1YLT A;  4BL3 A;  4B4X A;  4ARZ A;  2L4R A;  3LIE A;  3PAE A;  3UB7 A;  2QZ6 A;  5GHZ A;  3LY4 A;  2PR6 A;  4I38 A;  2Y59 A;  3RXX A;  3GSG A;  3NOU C;  1CEG A;  3CIT A;  3T4T A;  4OOL A;  3G30 A;  2OAP 1;  1L3L A;  2XA7 S;  2B02 A;  3IBJ A;  3VSK A;  1WYC A;  1BLS A;  1O7E A;  1PZP A;  4Y3I A;  2V0W A;  2M7U A;  4EEU A;  2KDK A;  5GHX A;  1BLC A;  3PBN A;  4EEP A;  3IF6 B;  2Y2P A;  4HP9 A;  4MBK A;  1OPX A;  2PRF A;  3IHB A;  2QMI A;  1EW0 A;  3MS6 A;  4NKP A;  4BJP A;  4IHQ A;  4P85 A;  2EFX A; 
#chains in the Genus database with same CATH homology
 4CLC B;  3OLO A;  1N9O A;  3F1O A;  3MQO A;  1TS7 A;  3LIB A;  4M4X A;  4QPR A;  5F5Y A;  2W3H A;  2Z6D A;  4O01 A;  3EOI A;  2M7V A;  1UWN X;  2W3E A;  3EQV A;  4Y5F A;  4EER A;  1S1Y A;  5J3W A;  2CMN A;  1S1Z A;  5DKK A;  2VGL M;  3BJN A;  3C30 A;  3F1P A;  4ARZ B;  3T50 A;  3LID A;  2W3F A;  1T1C A;  5HPI A;  4II7 A;  1TF1 A;  2GZA A;  5MC7 A;  1IFQ A;  2O9A A;  2W3D A;  2EA9 A;  4I3J A;  5KSH A;  3D72 A;  2HJ9 C;  5L8M A;  4WN5 A;  2VV7 A;  5HDC A;  4K08 A;  1S4R A;  3ICY A;  4R38 A;  2B18 A;  4NEE D;  4IUK A;  1OTB A;  3KSF A;  3EEH A;  5F69 A;  4LRY C;  3MF0 A;  1VHM A;  2OWH A;  3CAX A;  4CLC D;  2EWV A;  1F9I A;  1H3Q A;  3H82 A;  1OTD A;  4BBT A;  4DJ3 A;  1N9N A;  4JGR A;  2PT7 A;  1UWP X;  3EGD C;  4Q0J A;  3HJK A;  4O8G A;  3PBT A;  3OCL A;  4IJG A;  4O0P A;  5HSQ A;  4MCW A;  4UQI M;  3U2A A;  2HV1 A;  3R4K A;  4BBU A;  2L1M A;  3E4P A;  1DP9 A;  1OTI A;  1OJG A;  2EWW A;  4HJ6 A;  2WKR A;  4XT2 A;  2J3W A;  3S7Q A;  4Q0H A;  1LSV A;  1STZ A;  4Z1W A;  3E4Q A;  3HJI A;  3EEA A;  2O9C A;  3MR0 A;  2QJ7 A;  3F1P B;  4HIA A;  4LPZ A;  2VGL S;  3OCN A;  4HJ4 A;  2ZOH A;  1MKM A;  1VB6 A;  2NUT C;  1T18 A;  3BWL A;  4WLA A;  2V1B A;  1GSV A;  2O0Y A;  4I3I A;  4BWI A;  3C2W A;  3BY9 A;  4PAU A;  5KIZ A;  3LUQ A;  4KQD A;  1Y28 A;  2YKH A;  3FPV A;  4EUV A;  4EET B;  1LL8 A;  4WEL A;  2JKR I;  3H9W A;  1W63 Q;  3KYQ A;  3H82 B;  4I3A A;  3C8C A;  3MJQ A;  4B9O A;  4Q0I A;  3G6O A;  2PR5 A;  4YWZ A;  4L0L A;  3LI8 A;  5I5L A;  4Y2F A;  1NWZ A;  1W63 M;  2PYR A;  4YNR A;  3BW6 A;  3LR0 A;  2G7U A;  3TW8 A;  2W3G A;  2I9V A;  2Z6C A;  4WUJ A;  2VA0 A;  2ZBB A;  2O9B A;  1DRM A;  2P08 A;  2IA2 A;  3EWK A;  3TE8 A;  3A0S A;  2W1R A;  3RFB A;  5HWV A;  4HY8 A;  4UQI S;  2R78 A;  1LT0 A;  3PBQ A;  3IBR A;  2GNX A;  1X0O A;  3VE3 A;  2VJW A;  3E4O A;  3VV4 A;  2VKS A;  3KSI A;  4ETX A;  3B42 A;  4XT2 B;  1TS0 A;  4E04 A;  3T4J A;  1V9Y A;  3OBF A;  2VV6 A;  3CI6 A;  3V67 A;  3NOT C;  4DN0 A;  3S7P A;  4P6Z M;  3MQQ A;  3DBA A;  4G3W A;  3UB9 A;  3T4K A;  1IOU A;  1OJ5 A;  3RH8 B;  1T19 A;  1ZTU A;  2VX8 A;  2MJ6 A;  2J80 A;  2ZOI A;  5G4Z A;  2JKT M;  3T4Q A;  1T1A A;  3LYX A;  3NJA A;  5LBR A;  3KX0 X;  4EES A;  1NRJ A;  3W2Z A;  4BMW A;  4LRX C;  2OAQ 1;  4GW9 A;  3UE3 A;  4IUH A;  1OT6 A;  5K5B A;  1F98 A;  1OTA A;  2D02 A;  3PR6 A;  3MQ0 A;  2OWJ A;  2WKP A;  5CX7 A;  4R70 A;  5HD5 A;  3UME A;  1NLZ A;  2P04 A;  4DMZ A;  1T1B A;  2QKP A;  5IU1 A;  3RTY A;  1XJ2 A;  4MN5 A;  1S67 L;  3LR4 A;  5DF9 A;  3MXQ A;  2LB5 A;  5J4E A;  2PD7 A;  3BQA A;  1GSX A;  1D06 A;  4HOI A;  3B47 A;  4CQH A;  2HGV A;  4KUO A;  2V0U A;  1WA9 A;  2K2N A;  2Y8H A;  4WEJ A;  4EU0 A;  4B93 A;  3FG8 A;  5HZH A;  5DJU A;  3T4S A;  2VV8 A;  2XA7 M;  3CUE A;  4NXE A;  2W1T A;  4I5S A;  2YKF A;  5F68 A;  4JGO A;  4MN7 A;  1YSP A;  4WEK A;  3A0V A;  5G4Y A;  3FPW A;  4BJP A;  4CLC E;  2QWS A;  4HH2 A;  4MDZ A;  3R7W A;  2O99 A;  3P01 A;  5C5K A;  1ODV A;  1V9Z A;  2HF6 A;  4HJ3 A;  1F5M A;  4P6Z S;  3ZYT A;  3E0Y A;  4HHD A;  2OOL A;  3JVV A;  3D3O A;  4AFI A;  3PXP A;  2XRO A;  1XJ3 A;  4G3V A;  5TJJ A;  3B33 A;  5DFY A;  3PBS A;  4HP4 A;  4PKY A;  2QYB A;  1H8M A;  1KOU A;  3OC2 A;  3OOV A;  3CUE C;  4YOF A;  4HQA A;  3ULF A;  5A8B A;  3KSH A;  4ZRR A;  3FC7 A;  3LR5 A;  2JKR M;  3K2N A;  5DKL A;  3MMH A;  5IT5 A;  5HDD A;  1YKD A;  3TRC A;  2HJE A;  1TS6 A;  3KSG A;  3NHQ A;  1GSW A;  2KOI A;  3PBO A;  1XJ4 A;  4HH3 A;  4L9F A;  4HNB A;  1S4S A;  3S7N A;  2W1T B;  4CLC C;  3KYZ A;  4EQ1 A;  4OOM A;  3MFX A;  4EW7 A;  3TJZ C;  1P9R A;  2P7J A;  2ZMF A;  3R7W B;  1P0Z A;  4GLQ A;  5J7E A;  2D01 A;  3GDI A;  2L0W A;  1G28 A;  2VLG A;  5HD3 A;  3UB8 A;  3UB6 A;  3F1N A;  3VOL A;  1OT9 A;  2PDR A;  3LI9 A;  1LSW A;  4G3K A;  4PHT A;  1P9W A;  1S66 L;  2K7S A;  3H7W A;  1OTE A;  1LSX A;  3NOP C;  4I39 A;  1G6O A;  2K31 A;  3EQU A;  4L9E A;  3PHY A;  3UMD A;  2GX5 A;  4GS9 A;  2NUP C;  2Y79 A;  2XRN A;  1P97 A;  4ME4 A;  2W0N A;  4LRZ E;  4L9G A;  4H6J A;  2KLI A;  4NXF A;  3PYP A;  1DP6 A;  2PYP A;  2JKT I;  1BYW A;  4IHQ A;  3LIC A;  1UGU A;  2VEA A;  1TS8 A;  1ZHH B;  2GJ3 A;  4F3L A;  3A0R A;  2QJ5 A;  4GCZ A;  4PKY G;  3BQ8 A;  5F6A A;  2INW A;  3GEC A;  3T4L A;  2H28 A;  3CLO A;  2A2L A;  3E98 A;  5AJG A;  2WKQ A;  1XJ6 A;  1YSQ A;  1XFN A;  4HI4 A;  3HCY A;  2FZ0 A;  2KX6 A;  1XFQ A;  4GJ4 A;  1MZU A;  2XSS A;  4NXG A;  4DJ2 A;  4JGP A;  3LIF A;  4MMN A;  2A24 A;  5EFW A;  2VZW A;  4GHI A;  5AVE A;  2ZMV A;  3BY8 A;  5AVF A;  4RQ9 A;  3CWF A;  3PBR A;  2J3T C;  2PHY A;  4FOF A;  3T4O A;  3F1N B;  5TBM B;  2BAS A;  3IS2 A;  3LIA A;  4WL9 A;  5HDS A;  4CLC A;  2DMW A;  4R3A A;  4KUK A;  3H7W B;  3F1O B;  5DFX A;  5IS1 A;  4BBV A;  1TD5 A;  5HWW A;  1D7E A;  4GS9 B;  3KO6 A;  1DP8 A;  5HPF A;  4R6L A;  3LR3 A;  1MC0 A;  2LB9 A;  1NLY A;  3EGX C;  4ARZ A;  2JHE A;  2L4R A;  4H6J B;  3LIE A;  4FSF A;  3UB7 A;  4KQO A;  4UEY A;  2PR6 A;  4I38 A;  4F3L B;  3NOU C;  5HL6 A;  3CIT A;  3T4T A;  4OOL A;  4WF0 A;  2OAP 1;  3K3C A;  5FL3 A;  2XA7 S;  3S7O A;  2W27 A;  2B02 A;  3IBJ A;  3UE6 A;  3P7N A;  4MN6 A;  1JNU A;  3O5Y A;  4JGQ A;  4ETZ A;  4Y3I A;  2V0W A;  2V9A A;  2M7U A;  4EEU A;  2A24 B;  1N9L A;  3K3D A;  2KDK A;  4GHI B;  2FH5 A;  4EXO A;  3PBN A;  4EEP A;  3C38 A;  3JVU A;  4HP9 A;  1OPX A;  2J3T D;  4LLO B;  1YAX A;  5DJT A;  4NXB A;  2JN7 A;  5HWT A;  3SW1 A;  5TBM A;  2M1C A;  3LFV A;  3VE4 A;  3ZQ5 A;  1EW0 A;  4NKP A;  3IS2 B;  2PD8 A;  2QHK A;  2V1A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...