1F98A

Crystal structure of the photoactive yellow protein mutant t50v
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
125
structure length
125
Chain Sequence
MEHVAFGSEDIENTLAKMDDGQLDGLAFGAIQLDGDGNILQYNAAEGDIVGRDPKQVIGKNFFKDVAPCTDSPEFYGKFKEGVASGNLNTMFEYTFDYQMTPTKVKVHMKKALSGDSYWVFVKRV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PHOTOACTIVE YELLOW PROTEIN
publication title Coupling of hydrogen bonding to chromophore conformation and function in photoactive yellow protein.
pubmed doi rcsb
source organism Halorhodospira halophila
molecule tags Signaling protein
total genus 32
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2000-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00989 PAS PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 1f98A00
3CLOA 4GHIB 1TS6A 3C8CA 2PD7A 2QWSA 5DKKA 2H28A 4HJ4A 4BBTA 2Z6CA 4L9FA 1UGUA 2PHYA 4LLOB 3C2WA 1MZUA 5A8BA 4GS9B 3B33A 1T1CA 2ZBBA 4HP4A 4M4XA 1VB6A 3FC7A 3KX0X 4EETB 2W27A 3UMDA 4KUKA 2K7SA 2EA9A 3LI9A 2B02A 1S1ZA 2W0NA 2PDRA 4GCZA 4EW7A 4WN5A 4HH3A 3EEHA 3H82A 4LRXC 1DRMA 1G28A 2ZOIA 3LIAA 4KQDA 1TS0A 3UB7A 1P97A 2KX6A 2VV6A 2I9VA 4JGPA 1LSXA 1GSWA 3F1NA 4HJ6A 2JHEA 1F9IA 3UE6A 4HNBA 3MFXA 3E4PA 3LUQA 5F69A 4I39A 5J4EA 3ZQ5A 1N9LA 1V9YA 2QHKA 1F98A 1TS8A 3E4OA 5G4ZA 2BASA 1T19A 4EXOA 5F6AA 5HDCA 4YWZA 5AVEA 5DJTA 3MQQA 3CAXA 2A24A 5IS1A 2JN7A 3F1NB 3UB9A 1UWNX 5HZHA 1KOUA 2OWHA 4H6JA 4R38A 5HWTA 1DP6A 3NOTC 4HY8A 3F1OA 1V9ZA 1OTEA 4E04A 5HD5A 2WKQA 3HJIA 3VE3A 4WL9A 1P0ZA 5TBMA 2R78A 2PYRA 4I5SA 4HI4A 5DKLA 3MQOA 1XJ4A 3UB6A 2VLGA 2PYPA 3NOPC 5IU1A 2A24B 3GECA 2V0UA 4L9EA 3ICYA 1T18A 2INWA 4H6JB 1Y28A 5F5YA 2HV1A 4DJ3A 2L0WA 3IBRA 3F1OB 2OWJA 3LIBA 5TBMB 3F1PA 3BY8A 4KUOA 5HDSA 3GDIA 2V1BA 3IS2A 3EWKA 2D01A 2GJ3A 3H7WA 3LIFA 3G6OA 3NOUC 1XJ6A 2M1CA 1XJ2A 4NXFA 1OT9A 3T50A 5F68A 2QJ7A 3LIEA 5HWVA 3MXQA 3VOLA 3PHYA 4HP9A 4MN6A 4I3JA 1X0OA 2V9AA 4EERA 1OTDA 1T1AA 3A0SA 4EQ1A 4F3LA 1UWPX 3F1PB 2WKRA 4I38A 2L1MA 1LT0A 4HQAA 4BBUA 2D02A 3IS2B 5J3WA 3UMEA 3H7WB 1TS7A 4PKYG 1D06A 4JGOA 3CWFA 3K3DA 3NHQA 1S1YA 4WF0A 3LI8A 2L4RA 2WKPA 1D7EA 1WA9A 4XT2A 3LYXA 4R3AA 3RH8B 4HJ3A 4F3LB 4I3AA 3P7NA 4LRYC 5I5LA 2Z6DA 1OT6A 1S67L 5AVFA 5HSQA 4WLAA 4MN5A 4R70A 2PD8A 4GW9A 3BY9A 4I3IA 4EEPA 1NWZA 1LSVA 1GSVA 1S66L 3OLOA 4BBVA 2VV7A 4HH2A 4K08A 3D72A 4RQ9A 5HWWA 1XFNA 3PYPA 3A0RA 3E4QA 4R6LA 3RTYA 4XT2B 5KIZA 3UB8A 3ULFA 4L9GA 3A0VA 1OJ5A 1XFQA 2PR5A 1S4SA 3SW1A 2OOLA 1OTBA 4NXGA 3H9WA 1DP8A 1GSXA 4B9OA 2V1AA 4PKYA 3VE4A 5HDDA 3BWLA 4EEUA 1LL8A 4HOIA 2CMNA 2PR6A 1T1BA 2KDKA 5G4YA 2YKHA 4EESA 3NJAA 4JGQA 5DJUA 2J80A 1JNUA 3HJKA 2ZOHA 2YKFA 2VEAA 3K3CA 3MR0A 4NXBA 5HD3A 2V0WA 1EW0A 1BYWA 1OTAA 1ODVA 1N9NA 2QJ5A 3H82B 4DJ2A 3MJQA 5J7EA 4GHIA 3FG8A 1OJGA 3LIDA 1LSWA 1N9OA 4JGRA 5EFWA 3LICA 4NXEA 1OTIA 4GS9A 1DP9A 1XJ3A 4LRZE 1S4RA 2P7JA 4HIAA 2QKPA 4LPZA 4HHDA 2VV8A 4WUJA
chains in the Genus database with same CATH superfamily
3W4PA 1YSPA 2JKGA 2ZMFA 4OOLA 3E2KA 1SZVA 4OQ0A 5HPFA 2OV5A 4R23A 2Y55A 4L9FA 1N4OA 1MZUA 2J8YA 1T1CA 1KVMA 3OPRA 3R7WA 4Y7PA 3KX0X 4MDZA 4DE0A 4EETB 2V8FA 4KUKA 4YFMA 1PNEA 4IVIA 3UDXA 2B02A 2W0NA 5F1FA 3IF6A 2XH9A 2XLNA 3RJUA 4UA6A 3FKVA 3H82A 2VZWA 2XFSA 5L09A 5M19A 4Y13A 4FCFA 4H8RA 2Y2GA 1CI8A 3CZDA 1P97A 4DXBA 5DTKA 2KX6A 4IUHA 2RL3A 4IEDA 4RX2A 5FATA 3AGEA 1IYQA 4RYEA 2JHEA 4EU0A 3C38A 3VOZA 5L10A 3MFXA 2Q9NA 3PBQA 3LUQA 3WS1A 1YQSA 4I39A 3OCLA 1FCMA 1G68A 1S6RA 1O7EA 5J4EA 4CLCC 2J9PA 3O5YA 1TS8A 4P6ZS 3QNCA 4PM7A 2KOIA 3FKWA 3Q7VB 1A0KA 1DY6A 1FR6A 2HP5A 4KG5A 1XXMA 2Y59A 3IF5A 4CLCD 3IX4A 2A24A 5IS1A 2JN7A 1Q2PA 3MS6A 1KOUA 5FI2A 1TDGA 5CRFA 3N4IA 5FQIA 3LR3A 1VQQA 4BD0A 2OSUA 5EVEA 1E3UA 2WGWB 5AQ7A 3HJIA 2VA0A 1QMFA 4WM9A 2HP9A 5TBMA 2Y2JA 2H10A 1PWGA 2GDNA 2J3TC 1XA7A 3B47A 5DKLA 1ONHA 4EWFA 2Y2IA 1XJ4A 2VLGA 4GDBA 4S2MA 4G3KA 4MBHA 2ZMAA 5GL9A 1F5MA 4FUWA 3GV9A 2WUQA 2DCFA 2DMWA 3G4PA 2ZQCA 4H6JB 4PHTA 2O9BA 2IA2A 3IX3A 1MPLA 2HV1A 3LFVA 3SS3A 3KSGA 3IBRA 1BLCA 1G6OA 3CUEA 3ZG7B 5HW3A 1LL9A 3GMWA 1FQGA 1W8YA 2O0YA 3MSHA 2P9VA 3Q7ZA 1W5DA 4QHCA 3BY8A 4IJGA 2A2LA 3GDIA 3IS2A 3JYIA 3EWKA 2D01A 2Y4AA 4DE1A 2XD5A 3ZHHA 3LIFA 5AQ9A 3TOIA 1RGYA 2M7VA 3NOUC 3MBZA 5FAOA 2G7UA 3TW8A 4KZ8A 2ZQDA 3NDGA 1W63Q 1YT4A 3LIEA 5HWVA 1K54A 3G32A 3MXQA 2Q0OA 3C7VA 2R9WA 4HP9A 5E43A 4ME4A 4I3JA 5TR7A 2M7UA 4B4XA 4BWIA 4ZJ2A 2L1MA 4UQIM 3HREA 5FQ9A 1ACFA 5J3WA 4WEJA 3H7WB 4X55A 4PPRA 4ARZB 2NUTC 3IT9A 3CI6A 1K57A 1ES5A 2GZAA 3A3EA 1WA9A 2XSSA 5FSRA 1ZKJA 3FZCA 1ZC2A 4R3AA 3RH8B 4WZ5C 4IUKA 1RP5A 1H5XA 2HZ5A 2ZM0A 4KG2A 1VETB 5F82A 3TG9A 3P7NA 1L3LA 3DAVA 5D3OA 4LRYC 5I5LA 1WYCA 5HSQA 1TF1A 4WLAA 3KSHA 3SS5A 1LL5A 5A93A 4L0LA 1TDLA 3T1QB 3HL9A 2MJ6A 4GDNA 4OQGA 4BBVA 2VV7A 4HH2A 3U4LP 3PBRA 3D72A 1KE0A 5HX9A 4RQ9A 3ZFZA 1EROA 1XFNA 3EOIA 2W1RA 3DTMA 3RTYA 5KIZA 3FWLA 3CPTB 4S2LA 5FI6A 3KYZA 2I72A 2PR5A 4UEYA 1YAXA 2OOLA 3E2LA 4GKUA 4XUZA 1OTBA 2PBYA 3H9WA 4Q0JA 1GSXA 2WAFA 4DDSA 1FILA 3BYDA 2V1AA 4PKYA 2JKFA 4PM9A 3VE4A 3BWLA 5DFXA 5TJJA 2CMNA 1T1BA 4NEED 2YKHA 5DTSA 5EV0A 3NJAA 4ZRRA 5KZHA 5DJUA 2J80A 1JNUA 3HJKA 3VMAA 3PBTA 2YKFA 4X53A 3IWOA 1GHPA 1XKZA 4NXBA 3DTIA 2W3DA 4QY5A 2V0WA 1EW0A 5CEDA 2PT7A 1OTAA 1OPXA 1IFQA 3GQZA 1MWTA 5KMWA 4IHQA 4LCLA 1YMXA 4YNRA 2VGLM 1YPRA 2EFUA 4JXGA 1N9OA 3W4QA 4CLCB 1SCWA 1TVFA 4QWOA 5FEGA 4KQQA 2OLVA 4ZJ1A 4Y2FA 3PAGA 3DWZA 4NXEA 1GA0A 4JXSA 1OTIA 5L8MA 1NYMA 5CHMA 1DP9A 1TEMA 5EVID 4G3WA 4E3LA 4LFUA 3C5AA 4OOMA 3VFFA 4Y0TA 4JF5A 4S2NC 1I2SA 5J8XA 4FSFA 5MC7A 5F83A 1PWCA 5CECA 4UA7A 3CLOA 2DNSA 4KENB 1IELA 1TS6A 5FDSA 5L07A 1ZHHB 2H28A 2KLIA 1S0WA 4OPYA 5JYOA 2UV0E 1UGUA 1BTLA 3VP2A 3WS5A 2ZC6B 1FSYA 4Q0IA 2ACGA 4U0XA 1MWRA 3B33A 3M2JA 3G35A 1VB6A 1XP4A 4DDYA 2ZC7A 2W27A 3BLMA 2EA9A 1ZTUA 1C3BA 1S1ZA 3IXGA 1NY0A 3FPWA 1TD5A 4HH3A 1NRJA 2Y2QA 3CITA 4D2OA 3UPNA 1DRMA 2K31A 4OPRA 1IYPA 4GJ4A 2XA7M 1XX2A 3T1SA 3Q7VA 1VEUA 3UB7A 5F1GA 3CHWP 4OH0A 4Q8IA 3G31A 3WS4A 4HJ6A 1EWZA 2OLUA 4BL3A 2WYXA 3UE6A 4O01A 2E8IA 3WS2A 3D4FA 5HAPA 4PMAA 2ZQ9A 5F69A 1YLZA 2Y8HA 2JKRM 3JVVA 3D9YA 4BJPA 4KQRA 4IBXA 3OCNA 4YOFA 3ZQ5A 1N9LA 1PI5A 2EX8A 2QHKA 5IT5A 2EXBA 1GHIA 4FH2A 3TE8A 3WRTA 3Q07A 2XRNA 1E25A 1T19A 3MF0A 3O86A 1MKIA 3UE3A 1U60A 1D1JA 4DF6A 4UQIS 5HZHA 2Z2MB 4JBFA 4H6JA 5HWTA 4GOGA 2RCXA 3OPHA 4HY8A 5E2GA 2C6WB 3W4OA 4MLLA 1L0EA 5FI7A 3T4OA 3V5MA 3VE3A 1P0ZA 3NI9A 2VK3A 3ZYTA 3MQOA 3A3FA 3UB6A 2EX6A 1HVBA 4R3JA 2X71A 4P87A 3ZCZA 4JF6A 5FAPA 3GECA 2V0UA 4KZAA 2NUPC 1KE3A 2INWA 1Y28A 2JKTI 4ZAMA 2PBDP 4DJ3A 2L0WA 5CGWA 3F1OB 1W63M 4LV2A 1K4EA 4F94A 3PBNA 4D60A 2XQZA 4CQHA 3DWKA 4KUOA 4KZ5A 4KZ7A 3BRMA 5EPHA 2V1BA 3H7WA 3UDFA 1G6AA 4ARZA 1IOUA 3MKFA 4DKIA 2GNXA 1G5UA 1DJAA 2H0YA 2FFYA 2ZQ7A 3CUEC 1ERQA 3S7NA 3T4QA 3T50A 4PM6A 5F68A 3IQAA 2JCHA 4HESA 5IHVA 3V39A 3A3IA 3AGFA 3S7PA 4X6TA 3BLSA 1X0OA 1FR1A 4P6BA 4EERA 1OTDA 3LO7A 1UWPX 1VETA 3F1PB 3L7HA 3KYEA 2LB5A 4OLDA 4OPZA 4LV1A 4ETXA 3UMEA 3VP0A 1TS7A 3IXDA 4S2OA 2ZQAA 1BSGA 3G34A 3CWFA 1F2KA 3VP1A 1JTGA 5K5BA 2WGIA 2WKPA 4OOYA 4BENA 3M6HA 4QY6A 4XXRA 1GA9A 2HDUA 2ZLYA 2XEPA 3B3XA 4S2IA 1CI9A 3CPTA 5EM0A 5L2FA 2XF3A 4OPQA 3UB5P 4Y5FA 1K38A 2VGLS 2H5SA 2Z6DA 1K6SA 1K0KA 5AVFA 1KGFA 2WKHA 1HLUP 2W1TB 3MFDA 2VGJA 3U2AA 1XGJA 4R70A 3MZDA 3BEBA 3AGDA 4I3IA 3BFDA 2A3UA 2AVXA 3NIAA 5CEBA 1RCJA 4K08A 2XGNA 3QP2A 4AFIA 3PYPA 3A0RA 3EQVA 3E4QA 4LENA 1K6RA 1AWIA 3M2KA 3ULFA 4S2PA 3DBAA 3HLBA 4RA7A 2BLSA 1XFQA 1KVLA 1H0MA 4NXGA 5FEFA 2ZL1B 2Q9MA 1YLPA 3VFHA 3RXWA 1PYYA 4LGWA 4E3MA 2ZMVA 3RFBA 4JLFA 1E4DA 5FASA 1BT5A 4HBUA 2Y91A 3HUMA 4EEUA 5FQQA 4CLCA 4GLQA 3S7QA 3NULA 3R7WB 3IXHA 1Z6FA 2VEAA 3UPOA 2XA7S 1MWUA 3S1YA 3MR0A 5HD3A 3DTEA 3FYZA 1BYWA 1BUEA 2XDMA 2E8JA 3Q82A 1N9NA 4II7A 3MMHA 5DTTA 3T4LA 3H82B 4DJ2A 1NJ4A 3FG8A 5CERA 5HL6A 1P9WA 1STZA 2B5RA 5KSHA 3N6IA 3T4SA 3JPUA 3LICA 2HPBA 2ZD8A 4C3QA 3BFEA 1SKOB 4ETZA 5A92A 1XJ3A 4FD8A 5EUAA 4CLCE 3M6BA 1HD8A 5GLAA 1J3WA 4HIAA 4B88A 5EM1A 2HJEA 1DJCA 3QP1A 5CHUA 1CJFA 2FFFB 3HBRA 3SOIA 3ZNTA 3EGDC 4JPMA 3BFGA 3NECA 2J3WA 4IVKA 1N9BA 3HUOA 3RXXA 2PRFA 3GSGA 4LCMA 2XR0A 3QP6A 4GHIB 1PFLA 2PD7A 2QWSA 4B4ZA 2V1ZA 4EBPA 2WADA 4Y0UA 1GCEA 4BBTA 2HGVA 4OKPA 1YLYA 2PHYA 4LLOB 3C2WA 1KGGA 5A8BA 4GS9B 3TRCA 5U47A 4NETA 4GNUA 2ZBBA 4HP4A 3CJMA 5EOEA 1ESUA 4KZ9A 3MKEA 3UMDA 1K55A 1H8MA 1ES4A 4KZBA 4OQHA 4E3IA 1MY8A 3BFCA 4N9KA 4FH4A 1ESIA 4MMNA 2X01A 3BQAA 4XUXA 2PDRA 4MN7A 4EQIA 3BQ8A 4GCZA 4EW7A 3BFFA 4WN5A 3EEHA 1H3QA 2VKSA 4LRXC 3ZDJA 3T12B 4O7DA 4R3BA 3NBLA 2HDQA 1TS0A 1FOFA 3EQUA 5AQAA 4KZ6A 4X56A 5FQMA 5EOOA 4P6ZM 3IWQA 4R4SA 2XD1A 1F9IA 3SS4A 5DF8A 3E4PA 1AXBA 4UA9A 4EBLA 5EVIC 3S22A 3HUNA 3C4OA 3O3VA 5CGSA 3B42A 1F98A 3E4OA 3T4TA 3LR5A 3CMZA 1WE4A 5G4ZA 4EXOA 3P09A 4WZ5A 5F6AA 3KO6A 5HDCA 2Y2LA 3JVUA 5AVEA 5DJTA 2FH5A 3IHAA 3CAXA 4JXVA 2O9CA 1LI9A 3UB9A 3F1NB 3ITBA 1PZPA 3IBJA 1GHMA 1L0GA 1M40A 3BJNA 2OWHA 2V2FF 4R38A 1DP6A 2W3FA 3GR2A 3NOTC 3GTCA 3DW0A 1W7FA 5BOHA 1NZOA 3F1OA 1OTEA 4E04A 3UPPA 3HCYA 3R4KA 5HD5A 4U3TA 3NCKA 4QD4A 3MZFA 3L9KA 4KZ4A 1SDNA 4I5SA 3VV4A 3UN7A 1K25A 2Y2KA 3QNBA 5HARA 4WELA 1JWVA 4LV3A 3UO9A 2PYPA 1XA1A 3P98A 3NOPC 1SHVA 4GB7A 1JWPA 3ZG5A 3SH7A 2XK1A 4L9EA 4OLGA 3UE1A 4CJNA 5F5YA 1FSWA 4B93A 3HLFA 3F1PA 3N7WA 3EGXC 5AJGA 3FPVA 5HDSA 1K56A 5FQJA 3WRZA 4C6YA 3OOVA 3BM6A 5GLDA 5FQKA 1Y4OA 3LY4A 4ZJ3A 4GD6A 3G6OA 1XJ6A 2ZC4B 4UAAA 1XJ2A 3IF6C 4NXFA 4QU3A 3V3SA 1OT9A 5FAQA 3C30A 2QJ7A 2GX5A 1PI4A 2QMIA 3SH9A 1K4FA 4IBRA 3LY3A 4X1LA 3TJZC 2HP6A 3N8LA 4MN6A 4E3NA 2JBFA 1T1AA 3A0SA 2WGWA 4EQ1A 2V20A 4WEKA 2WKRA 4DN0A 4WMCA 4R0QA 1LT0A 4HQAA 2B18A 2D02A 2UWXA 4NG2A 1VHMA 4PKYG 3IH9A 4U0TA 4JGOA 5DF7A 3K3DA 2EX9A 1L2SA 3NHQA 2PU4A 3LI8A 4S2NA 1D7EA 3PAEA 4N1XA 3PBSA 3ZNYA 4X25A 4DE3A 1IYSA 2XROA 4F3LB 4I3AA 5AQBA 3V50A 2EX2A 3T1XA 3P01A 3T1RA 2ZL1A 5HPIA 2WZZA 2JKRI 3HLCA 4GW9A 2ZC5B 3EEAA 4EEPA 1NWZA 1MKMA 5FDHA 1NRFA 1GSVA 2Z2LB 3OLOA 1ES3A 2HDRA 4EBNA 3FV7A 2ZM8A 1CEFA 1CF0A 2HDSA 4R6LA 4XT2B 2VJWA 4Y0OA 1Y54A 1OJ5A 4GD8A 4DXCA 1S4SA 3SW1A 3C4PA 5KSCA 3C7UA 1E3UD 3BECA 2WGVA 4P0MA 4KG6A 3ZVWA 2PAVP 3HLGA 2VGKA 2G2WA 1CEGA 4JXWA 5EVLA 2EFXA 2JC7A 4K0XA 3T4KA 1LL8A 2FZ0A 4HOIA 1JWZA 3NDEA 5G4YA 1SKOA 1MBLA 4MBKA 3OPPA 4JGQA 2ZOHA 1RGZA 4OP5A 2O9AA 3PR6A 1MC0A 3QHYA 4E6XA 1YMSA 3HVFA 5JYPA 3OC2A 1NYYA 3A3DA 3MXRA 1K54C 2QJ5A 2OAQ1 3MJQA 5J7EA 4DMZA 4GHIA 1H8YA 1OJGA 3ZG8B 1I5QA 4JGRA 1JVJA 5EVIB 5EFWA 1VEUB 5GHXA 3W2ZA 2QZ6A 1EI5A 3I7JA 2O99A 4FTXA 4GS9A 2P04A 2HJ9C 4E3JA 4NK3A 2QKPA 1DJBA 4LPZA 3KSIA 1KE4A 3K2NA 4R1GA 1K57C 2IWDA 5I94A 3GVBA 1O07A 1PW1A 2VV8A 4WUJA 4N9LA 3IXBA 1OMEA 1L0FA 2G2UA 3C8CA 1HTZA 5G18A 1I2WA 5DKKA 3ITAA 3IH8A 4HJ4A 2Z6CA 2C5WB 3LGOA 4Z1WA 2Y2HA 1MXOA 4M4XA 3FC7A 5EECA 1NLZA 4QB8A 4ZBEA 5DVAA 2P08A 2K7SA 2ZM2A 2J3TD 4BQMA 3LI9A 5C5KA 1BLSA 2BG1A 3V67A 4EUVA 4ESPA 4QPRA 4DE2A 4BMWA 2WZXA 1G28A 4FOFA 3G2YA 2ZOIA 3LIAA 4KQDA 2QPNA 5GLBA 3VP4A 3PTEA 3VP3A 3UY6A 1FCNA 1K55C 2VV6A 2I9VA 4R4RA 1PIOA 1FCOA 1YM1A 4JGPA 1LSXA 1VM1A 4O8GA 5FL3A 1GSWA 3F1NA 1WYBA 4ZDXA 2WK0A 3OPLA 4HNBA 4Y3IA 2H0TA 3N8SA 5CX7A 1ONGA 2IWCA 3IF6B 2J9OA 5HAQA 1V9YA 2EWVA 2WKEA 2X02A 1YLJA 1M6KA 2BASA 4MNRA 3WS0A 1BLHA 4YWZA 2WKIA 1LLBA 5E2EA 3Q81A 5E2HA 3MQQA 1YLWA 1QMEA 4K91A 1UWNX 3LR0A 3N8RA 2Y2OA 3WWXA 5LBRA 1PW8A 1YKDA 4OONA 1V9ZA 2Y2PA 2WKQA 4GN2A 1ZG6A 4WL9A 4N1HA 2R78A 4ID4A 5EE8A 2PYRA 1NLYA 1HZOA 4HI4A 3VOYA 3NY4A 4MEZA 1SDEA 4OQIA 3HLDA 4BLMA 3G30A 2V8CA 5HL1A 2JE5A 5IU1A 2A24B 4P85A 3ICYA 4MCWA 1T18A 5DF9A 4DRTA 2Y2NA 3V3RA 3QP5A 1IYOA 5CTNA 1IKGA 4KZ3A 3KSFA 4RX3A 1IKIA 2OWJA 4M3KA 3LIBA 5TBMB 2ZQ8A 1XGIA 2Y2MA 4GZBA 3SH8A 3IWIA 3PXPA 4X1MA 3ISGA 2GJ3A 1Z09A 1KGEA 2B95A 3BW6A 3QP8A 4OP8A 2M1CA 1BZAA 4PM8A 4S2JA 1J9MA 2W3HA 3VOLA 2W3EA 4E3KA 1LI0A 3PHYA 1P9RA 1FIKA 5HFOA 4WYYA 3UE0A 1SKFA 3HLWA 2P74A 2V9AA 2OAP1 4MBFA 4BD1A 4F3LA 2P9VB 3A3JA 4I38A 3MQ0A 4OVDA 2LB9A 4JKTA 5GLCA 2EWWA 2QYBA 3IHBA 4Z9QA 4BBUA 1CK3A 5DFYA 3UNWA 3IS2B 2PU2A 3UDIA 1W8QA 2A49A 4QJGA 3W8KA 1D06A 5CTMA 3OZHA 1K56D 5E2FA 1S1YA 4WF0A 1Q2QA 2L4RA 1XPBA 5GHYA 4XT2A 3LYXA 4C75A 3TSGA 4HJ3A 4WZ4A 1ERMA 4Q0HA 2Y79A 4RVAA 1H8ZA 3IX8A 2VX8A 1OT6A 1S67L 1YLTA 2XFTA 4MN5A 1KDWA 4X68A 2PD8A 4WMCD 3BY9A 4Y17A 4E3OA 5CXWA 1LSVA 3ZG9B 1S66L 1KDSA 3Q1FA 3E98A 3MZEA 5HWWA 1LHYA 3G2ZA 3VSKA 1ES2A 5A91A 2J7VA 1PRQA 5A90A 3UB8A 3SZTA 4Y15A 4L9GA 3A0VA 1IEMA 1NZUA 3S4XA 2ZJ9A 2R9XA 4JF4A 2ZC3B 1DP8A 4N92A 4B9OA 3DTKA 4X69A 3T4JA 3LR4A 1ZG4A 4EV4A 1MWSA 1L0DA 1W79A 3CG5A 4WBGA 5HDDA 3GRJA 3E0YA 5TGFA 3LEZA 4YINA 3QP4A 3D3OA 3O87A 4NKPA 5CGXA 5EVIA 4S2KA 2PR6A 2KDKA 4EESA 3O88A 4ZTKA 4O0PA 3ZG0A 5CHJA 3MXSA 4KQOA 1NXYA 2DRWA 5HAIA 3K3CA 5TFQA 4EUZA 1BLPA 1BULA 5M18A 3PBOA 1ALQA 4HBTA 1PZOA 2W1TA 1ODVA 4E6WA 2WAEA 3OBFA 3LEQA 2BTFP 2K2NA 5M1AA 5FA7A 4G3VA 4A5RA 1JTDA 3KYQA 5GHZA 3LIDA 1LSWA 4HEFA 2IWBA 2JKTM 2CC1A 4LV0A 3HLEA 2W3GA 4PAUA 3S7OA 2EXAA 3NC8A 3VSLA 1PWDA 4PM5A 4LRZE 3ZVTA 1S4RA 2P7JA 4BL2A 3LCEA 1YSQA 2HF6A 4CPKA 4UHUA 1CQAA 4K0WA 4HHDA 3ZGAB
chains in the Genus database with same CATH topology
3CLOA 1YSPA 4GHIB 1TS6A 3C8CA 2ZMFA 4OOLA 2PD7A 1ZHHB 2QWSA 5DKKA 2H28A 5HPFA 2KLIA 4HJ4A 4BBTA 2Z6CA 4L9FA 1UGUA 2HGVA 2PHYA 4LLOB 3C2WA 1MZUA 5A8BA 4Q0IA 4Z1WA 4GS9B 3TRCA 3B33A 1T1CA 2ZBBA 4HP4A 4M4XA 3R7WA 1VB6A 3FC7A 3KX0X 1NLZA 4MDZA 4EETB 2W27A 3UMDA 4KUKA 2P08A 2K7SA 1H8MA 2J3TD 2EA9A 1ZTUA 3LI9A 5C5KA 2B02A 4MMNA 1S1ZA 2W0NA 3BQAA 2PDRA 4MN7A 3BQ8A 3FPWA 4GCZA 4EW7A 3V67A 4EUVA 1TD5A 4QPRA 4WN5A 4HH3A 3EEHA 1NRJA 3CITA 3H82A 1H3QA 2VZWA 2VKSA 4LRXC 1DRMA 2K31A 4BMWA 1G28A 4GJ4A 2XA7M 4FOFA 2ZOIA 3LIAA 4KQDA 1TS0A 3UB7A 3EQUA 1P97A 2KX6A 2VV6A 2I9VA 4JGPA 4IUHA 1LSXA 4P6ZM 4O8GA 5FL3A 1GSWA 3F1NA 4HJ6A 2JHEA 4EU0A 1F9IA 3C38A 3UE6A 4HNBA 4Y3IA 4O01A 3MFXA 3E4PA 3PBQA 3LUQA 5F69A 5CX7A 4I39A 2Y8HA 2JKRM 3JVVA 4BJPA 3OCLA 5J4EA 3OCNA 4CLCC 4YOFA 3ZQ5A 1N9LA 1V9YA 2QHKA 3B42A 1F98A 1TS8A 2EWVA 3O5YA 4P6ZS 5IT5A 3E4OA 3T4TA 3TE8A 3LR5A 5G4ZA 2XRNA 2BASA 1T19A 4EXOA 3MF0A 5F6AA 2KOIA 3KO6A 5HDCA 4YWZA 3JVUA 5AVEA 5DJTA 2FH5A 3MQQA 3CAXA 2O9CA 3UE3A 4CLCD 2A24A 5IS1A 2JN7A 3F1NB 3UB9A 1UWNX 4UQIS 5HZHA 3IBJA 1KOUA 3BJNA 3LR0A 2OWHA 4H6JA 4R38A 5HWTA 1DP6A 2W3FA 3LR3A 3NOTC 4HY8A 5LBRA 3F1OA 1YKDA 1V9ZA 1OTEA 4E04A 3HCYA 3R4KA 5HD5A 2WKQA 3T4OA 3HJIA 2VA0A 3VE3A 4WL9A 1P0ZA 5TBMA 2R78A 2PYRA 4I5SA 1NLYA 3VV4A 4HI4A 2J3TC 3B47A 3ZYTA 5DKLA 4WELA 3MQOA 1XJ4A 3UB6A 2VLGA 2PYPA 4G3KA 3NOPC 5IU1A 1F5MA 2A24B 3GECA 2DMWA 2V0UA 4L9EA 3ICYA 4MCWA 2NUPC 1T18A 5DF9A 2INWA 4H6JB 1Y28A 2JKTI 4PHTA 5F5YA 2O9BA 2IA2A 2HV1A 3LFVA 4DJ3A 4B93A 2L0WA 3IBRA 3KSGA 3F1OB 1W63M 1G6OA 3KSFA 3CUEA 2OWJA 3PBNA 2O0YA 3LIBA 5TBMB 3F1PA 4CQHA 3EGXC 3BY8A 4KUOA 5AJGA 3FPVA 5HDSA 4IJGA 3PXPA 2A2LA 3GDIA 2V1BA 3IS2A 3OOVA 3EWKA 2D01A 2GJ3A 3H7WA 4ARZA 1IOUA 3BW6A 2GNXA 3LIFA 2M7VA 3G6OA 3NOUC 1XJ6A 2G7UA 1XJ2A 2M1CA 3TW8A 4NXFA 3CUEC 3S7NA 1OT9A 3T4QA 3T50A 2W3HA 5F68A 1W63Q 3C30A 2QJ7A 2GX5A 3LIEA 5HWVA 3MXQA 3VOLA 2W3EA 3PHYA 4HP9A 1P9RA 3TJZC 4MN6A 3S7PA 4ME4A 4I3JA 1X0OA 2V9AA 4EERA 1OTDA 1T1AA 2OAP1 3A0SA 2M7UA 4EQ1A 4F3LA 1UWPX 4BWIA 3F1PB 4WEKA 2WKRA 4DN0A 4I38A 2L1MA 2LB5A 4UQIM 3MQ0A 1LT0A 2LB9A 2EWWA 2QYBA 4HQAA 4BBUA 4ETXA 2B18A 5DFYA 2D02A 3IS2B 5J3WA 3UMEA 4WEJA 3H7WB 1TS7A 1VHMA 4PKYG 1D06A 4ARZB 4JGOA 2NUTC 3CWFA 3K3DA 5K5BA 3NHQA 1S1YA 3CI6A 4WF0A 3LI8A 2L4RA 2WKPA 2GZAA 1D7EA 1WA9A 2XSSA 4XT2A 3PBSA 3LYXA 4R3AA 3RH8B 4IUKA 2XROA 4HJ3A 4F3LB 4I3AA 4Q0HA 3P7NA 4Y5FA 4LRYC 2Y79A 5I5LA 2VGLS 2VX8A 2Z6DA 1OT6A 3P01A 1S67L 5AVFA 5HSQA 1TF1A 4WLAA 3KSHA 5HPIA 4MN5A 2W1TB 3U2AA 4R70A 2PD8A 2JKRI 4GW9A 4L0LA 3BY9A 3EEAA 4I3IA 4EEPA 1NWZA 1MKMA 1LSVA 2MJ6A 1GSVA 1S66L 3OLOA 4BBVA 2VV7A 4HH2A 4K08A 3PBRA 3D72A 4RQ9A 3E98A 5HWWA 3EOIA 1XFNA 4AFIA 3PYPA 3A0RA 2W1RA 3EQVA 3E4QA 4R6LA 3RTYA 4XT2B 5KIZA 2VJWA 3UB8A 3ULFA 4L9GA 3A0VA 3DBAA 1OJ5A 1XFQA 3KYZA 2PR5A 4UEYA 1YAXA 1S4SA 3SW1A 2OOLA 1OTBA 4NXGA 3H9WA 1DP8A 4Q0JA 1GSXA 4B9OA 3T4JA 2ZMVA 3RFBA 3LR4A 2V1AA 4PKYA 3VE4A 5HDDA 3E0YA 3BWLA 4EEUA 3D3OA 4NKPA 3T4KA 5DFXA 1LL8A 5TJJA 2FZ0A 4CLCA 4HOIA 4GLQA 2CMNA 2PR6A 1T1BA 2KDKA 4NEED 5G4YA 3S7QA 2YKHA 4EESA 3NJAA 4ZRRA 4JGQA 5DJUA 2J80A 4O0PA 1JNUA 3HJKA 2ZOHA 3R7WB 2O9AA 3PR6A 3PBTA 2YKFA 1MC0A 2VEAA 4KQOA 2XA7S 3K3CA 3MR0A 4NXBA 2W3DA 3PBOA 5HD3A 2V0WA 1EW0A 2PT7A 1BYWA 3OC2A 2W1TA 1OTAA 1OPXA 1ODVA 1IFQA 3OBFA 1N9NA 4II7A 3MMHA 2K2NA 2QJ5A 3T4LA 2OAQ1 3H82B 3MJQA 4IHQA 4DJ2A 5J7EA 4G3VA 4DMZA 3KYQA 4GHIA 3FG8A 4YNRA 2VGLM 1OJGA 3LIDA 5HL6A 1P9WA 1STZA 5KSHA 1LSWA 1N9OA 2JKTM 4JGRA 3T4SA 5EFWA 4CLCB 2W3GA 3LICA 4PAUA 3W2ZA 4Y2FA 3S7OA 4NXEA 4ETZA 1OTIA 2O99A 4GS9A 5L8MA 1DP9A 1XJ3A 4CLCE 4LRZE 2P04A 2HJ9C 1S4RA 2P7JA 4HIAA 2QKPA 2HJEA 4LPZA 1YSQA 3KSIA 4G3WA 2HF6A 3EGDC 3K2NA 4OOMA 2J3WA 4FSFA 5MC7A 4HHDA 2VV8A 4WUJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CLO A;  4GHI B;  1TS6 A;  3C8C A;  2PD7 A;  2QWS A;  5DKK A;  2H28 A;  4HJ4 A;  4BBT A;  2Z6C A;  4L9F A;  1UGU A;  2PHY A;  4LLO B;  3C2W A;  1MZU A;  5A8B A;  4GS9 B;  3B33 A;  1T1C A;  2ZBB A;  4HP4 A;  4M4X A;  1VB6 A;  3FC7 A;  3KX0 X;  4EET B;  2W27 A;  3UMD A;  4KUK A;  2K7S A;  2EA9 A;  3LI9 A;  2B02 A;  1S1Z A;  2W0N A;  2PDR A;  4GCZ A;  4EW7 A;  4WN5 A;  4HH3 A;  3EEH A;  3H82 A;  4LRX C;  1DRM A;  1G28 A;  2ZOI A;  3LIA A;  4KQD A;  1TS0 A;  3UB7 A;  1P97 A;  2KX6 A;  2VV6 A;  2I9V A;  4JGP A;  1LSX A;  1GSW A;  3F1N A;  4HJ6 A;  2JHE A;  1F9I A;  3UE6 A;  4HNB A;  3MFX A;  3E4P A;  3LUQ A;  5F69 A;  4I39 A;  5J4E A;  3ZQ5 A;  1N9L A;  1V9Y A;  2QHK A;  1F98 A;  1TS8 A;  3E4O A;  5G4Z A;  2BAS A;  1T19 A;  4EXO A;  5F6A A;  5HDC A;  4YWZ A;  5AVE A;  5DJT A;  3MQQ A;  3CAX A;  2A24 A;  5IS1 A;  2JN7 A;  3F1N B;  3UB9 A;  1UWN X;  5HZH A;  1KOU A;  2OWH A;  4H6J A;  4R38 A;  5HWT A;  1DP6 A;  3NOT C;  4HY8 A;  3F1O A;  1V9Z A;  1OTE A;  4E04 A;  5HD5 A;  2WKQ A;  3HJI A;  3VE3 A;  4WL9 A;  1P0Z A;  5TBM A;  2R78 A;  2PYR A;  4I5S A;  4HI4 A;  5DKL A;  3MQO A;  1XJ4 A;  3UB6 A;  2VLG A;  2PYP A;  3NOP C;  5IU1 A;  2A24 B;  3GEC A;  2V0U A;  4L9E A;  3ICY A;  1T18 A;  2INW A;  4H6J B;  1Y28 A;  5F5Y A;  2HV1 A;  4DJ3 A;  2L0W A;  3IBR A;  3F1O B;  2OWJ A;  3LIB A;  5TBM B;  3F1P A;  3BY8 A;  4KUO A;  5HDS A;  3GDI A;  2V1B A;  3IS2 A;  3EWK A;  2D01 A;  2GJ3 A;  3H7W A;  3LIF A;  3G6O A;  3NOU C;  1XJ6 A;  2M1C A;  1XJ2 A;  4NXF A;  1OT9 A;  3T50 A;  5F68 A;  2QJ7 A;  3LIE A;  5HWV A;  3MXQ A;  3VOL A;  3PHY A;  4HP9 A;  4MN6 A;  4I3J A;  1X0O A;  2V9A A;  4EER A;  1OTD A;  1T1A A;  3A0S A;  4EQ1 A;  4F3L A;  1UWP X;  3F1P B;  2WKR A;  4I38 A;  2L1M A;  1LT0 A;  4HQA A;  4BBU A;  2D02 A;  3IS2 B;  5J3W A;  3UME A;  3H7W B;  1TS7 A;  4PKY G;  1D06 A;  4JGO A;  3CWF A;  3K3D A;  3NHQ A;  1S1Y A;  4WF0 A;  3LI8 A;  2L4R A;  2WKP A;  1D7E A;  1WA9 A;  4XT2 A;  3LYX A;  4R3A A;  3RH8 B;  4HJ3 A;  4F3L B;  4I3A A;  3P7N A;  4LRY C;  5I5L A;  2Z6D A;  1OT6 A;  1S67 L;  5AVF A;  5HSQ A;  4WLA A;  4MN5 A;  4R70 A;  2PD8 A;  4GW9 A;  3BY9 A;  4I3I A;  4EEP A;  1NWZ A;  1LSV A;  1GSV A;  1S66 L;  3OLO A;  4BBV A;  2VV7 A;  4HH2 A;  4K08 A;  3D72 A;  4RQ9 A;  5HWW A;  1XFN A;  3PYP A;  3A0R A;  3E4Q A;  4R6L A;  3RTY A;  4XT2 B;  5KIZ A;  3UB8 A;  3ULF A;  4L9G A;  3A0V A;  1OJ5 A;  1XFQ A;  2PR5 A;  1S4S A;  3SW1 A;  2OOL A;  1OTB A;  4NXG A;  3H9W A;  1DP8 A;  1GSX A;  4B9O A;  2V1A A;  4PKY A;  3VE4 A;  5HDD A;  3BWL A;  4EEU A;  1LL8 A;  4HOI A;  2CMN A;  2PR6 A;  1T1B A;  2KDK A;  5G4Y A;  2YKH A;  4EES A;  3NJA A;  4JGQ A;  5DJU A;  2J80 A;  1JNU A;  3HJK A;  2ZOH A;  2YKF A;  2VEA A;  3K3C A;  3MR0 A;  4NXB A;  5HD3 A;  2V0W A;  1EW0 A;  1BYW A;  1OTA A;  1ODV A;  1N9N A;  2QJ5 A;  3H82 B;  4DJ2 A;  3MJQ A;  5J7E A;  4GHI A;  3FG8 A;  1OJG A;  3LID A;  1LSW A;  1N9O A;  4JGR A;  5EFW A;  3LIC A;  4NXE A;  1OTI A;  4GS9 A;  1DP9 A;  1XJ3 A;  4LRZ E;  1S4R A;  2P7J A;  4HIA A;  2QKP A;  4LPZ A;  4HHD A;  2VV8 A;  4WUJ A; 
#chains in the Genus database with same CATH topology
 3W4P A;  1YSP A;  2JKG A;  2ZMF A;  4OOL A;  3E2K A;  1SZV A;  4OQ0 A;  5HPF A;  2OV5 A;  4R23 A;  2Y55 A;  4L9F A;  1N4O A;  1MZU A;  2J8Y A;  1T1C A;  1KVM A;  3OPR A;  3R7W A;  4Y7P A;  3KX0 X;  4MDZ A;  4DE0 A;  4EET B;  2V8F A;  4KUK A;  4YFM A;  1PNE A;  4IVI A;  3UDX A;  2B02 A;  2W0N A;  5F1F A;  3IF6 A;  2XH9 A;  2XLN A;  3RJU A;  4UA6 A;  3FKV A;  3H82 A;  2VZW A;  2XFS A;  5L09 A;  5M19 A;  4Y13 A;  4FCF A;  4H8R A;  2Y2G A;  1CI8 A;  3CZD A;  1P97 A;  4DXB A;  5DTK A;  2KX6 A;  4IUH A;  2RL3 A;  4IED A;  4RX2 A;  5FAT A;  3AGE A;  1IYQ A;  4RYE A;  2JHE A;  4EU0 A;  3C38 A;  3VOZ A;  5L10 A;  3MFX A;  2Q9N A;  3PBQ A;  3LUQ A;  3WS1 A;  1YQS A;  4I39 A;  3OCL A;  1FCM A;  1G68 A;  1S6R A;  1O7E A;  5J4E A;  4CLC C;  2J9P A;  3O5Y A;  1TS8 A;  4P6Z S;  3QNC A;  4PM7 A;  2KOI A;  3FKW A;  3Q7V B;  1A0K A;  1DY6 A;  1FR6 A;  2HP5 A;  4KG5 A;  1XXM A;  2Y59 A;  3IF5 A;  4CLC D;  3IX4 A;  2A24 A;  5IS1 A;  2JN7 A;  1Q2P A;  3MS6 A;  1KOU A;  5FI2 A;  1TDG A;  5CRF A;  3N4I A;  5FQI A;  3LR3 A;  1VQQ A;  4BD0 A;  2OSU A;  5EVE A;  1E3U A;  2WGW B;  5AQ7 A;  3HJI A;  2VA0 A;  1QMF A;  4WM9 A;  2HP9 A;  5TBM A;  2Y2J A;  2H10 A;  1PWG A;  2GDN A;  2J3T C;  1XA7 A;  3B47 A;  5DKL A;  1ONH A;  4EWF A;  2Y2I A;  1XJ4 A;  2VLG A;  4GDB A;  4S2M A;  4G3K A;  4MBH A;  2ZMA A;  5GL9 A;  1F5M A;  4FUW A;  3GV9 A;  2WUQ A;  2DCF A;  2DMW A;  3G4P A;  2ZQC A;  4H6J B;  4PHT A;  2O9B A;  2IA2 A;  3IX3 A;  1MPL A;  2HV1 A;  3LFV A;  3SS3 A;  3KSG A;  3IBR A;  1BLC A;  1G6O A;  3CUE A;  3ZG7 B;  5HW3 A;  1LL9 A;  3GMW A;  1FQG A;  1W8Y A;  2O0Y A;  3MSH A;  2P9V A;  3Q7Z A;  1W5D A;  4QHC A;  3BY8 A;  4IJG A;  2A2L A;  3GDI A;  3IS2 A;  3JYI A;  3EWK A;  2D01 A;  2Y4A A;  4DE1 A;  2XD5 A;  3ZHH A;  3LIF A;  5AQ9 A;  3TOI A;  1RGY A;  2M7V A;  3NOU C;  3MBZ A;  5FAO A;  2G7U A;  3TW8 A;  4KZ8 A;  2ZQD A;  3NDG A;  1W63 Q;  1YT4 A;  3LIE A;  5HWV A;  1K54 A;  3G32 A;  3MXQ A;  2Q0O A;  3C7V A;  2R9W A;  4HP9 A;  5E43 A;  4ME4 A;  4I3J A;  5TR7 A;  2M7U A;  4B4X A;  4BWI A;  4ZJ2 A;  2L1M A;  4UQI M;  3HRE A;  5FQ9 A;  1ACF A;  5J3W A;  4WEJ A;  3H7W B;  4X55 A;  4PPR A;  4ARZ B;  2NUT C;  3IT9 A;  3CI6 A;  1K57 A;  1ES5 A;  2GZA A;  3A3E A;  1WA9 A;  2XSS A;  5FSR A;  1ZKJ A;  3FZC A;  1ZC2 A;  4R3A A;  3RH8 B;  4WZ5 C;  4IUK A;  1RP5 A;  1H5X A;  2HZ5 A;  2ZM0 A;  4KG2 A;  1VET B;  5F82 A;  3TG9 A;  3P7N A;  1L3L A;  3DAV A;  5D3O A;  4LRY C;  5I5L A;  1WYC A;  5HSQ A;  1TF1 A;  4WLA A;  3KSH A;  3SS5 A;  1LL5 A;  5A93 A;  4L0L A;  1TDL A;  3T1Q B;  3HL9 A;  2MJ6 A;  4GDN A;  4OQG A;  4BBV A;  2VV7 A;  4HH2 A;  3U4L P;  3PBR A;  3D72 A;  1KE0 A;  5HX9 A;  4RQ9 A;  3ZFZ A;  1ERO A;  1XFN A;  3EOI A;  2W1R A;  3DTM A;  3RTY A;  5KIZ A;  3FWL A;  3CPT B;  4S2L A;  5FI6 A;  3KYZ A;  2I72 A;  2PR5 A;  4UEY A;  1YAX A;  2OOL A;  3E2L A;  4GKU A;  4XUZ A;  1OTB A;  2PBY A;  3H9W A;  4Q0J A;  1GSX A;  2WAF A;  4DDS A;  1FIL A;  3BYD A;  2V1A A;  4PKY A;  2JKF A;  4PM9 A;  3VE4 A;  3BWL A;  5DFX A;  5TJJ A;  2CMN A;  1T1B A;  4NEE D;  2YKH A;  5DTS A;  5EV0 A;  3NJA A;  4ZRR A;  5KZH A;  5DJU A;  2J80 A;  1JNU A;  3HJK A;  3VMA A;  3PBT A;  2YKF A;  4X53 A;  3IWO A;  1GHP A;  1XKZ A;  4NXB A;  3DTI A;  2W3D A;  4QY5 A;  2V0W A;  1EW0 A;  5CED A;  2PT7 A;  1OTA A;  1OPX A;  1IFQ A;  3GQZ A;  1MWT A;  5KMW A;  4IHQ A;  4LCL A;  1YMX A;  4YNR A;  2VGL M;  1YPR A;  2EFU A;  4JXG A;  1N9O A;  3W4Q A;  4CLC B;  1SCW A;  1TVF A;  4QWO A;  5FEG A;  4KQQ A;  2OLV A;  4ZJ1 A;  4Y2F A;  3PAG A;  3DWZ A;  4NXE A;  1GA0 A;  4JXS A;  1OTI A;  5L8M A;  1NYM A;  5CHM A;  1DP9 A;  1TEM A;  5EVI D;  4G3W A;  4E3L A;  4LFU A;  3C5A A;  4OOM A;  3VFF A;  4Y0T A;  4JF5 A;  4S2N C;  1I2S A;  5J8X A;  4FSF A;  5MC7 A;  5F83 A;  1PWC A;  5CEC A;  4UA7 A;  3CLO A;  2DNS A;  4KEN B;  1IEL A;  1TS6 A;  5FDS A;  5L07 A;  1ZHH B;  2H28 A;  2KLI A;  1S0W A;  4OPY A;  5JYO A;  2UV0 E;  1UGU A;  1BTL A;  3VP2 A;  3WS5 A;  2ZC6 B;  1FSY A;  4Q0I A;  2ACG A;  4U0X A;  1MWR A;  3B33 A;  3M2J A;  3G35 A;  1VB6 A;  1XP4 A;  4DDY A;  2ZC7 A;  2W27 A;  3BLM A;  2EA9 A;  1ZTU A;  1C3B A;  1S1Z A;  3IXG A;  1NY0 A;  3FPW A;  1TD5 A;  4HH3 A;  1NRJ A;  2Y2Q A;  3CIT A;  4D2O A;  3UPN A;  1DRM A;  2K31 A;  4OPR A;  1IYP A;  4GJ4 A;  2XA7 M;  1XX2 A;  3T1S A;  3Q7V A;  1VEU A;  3UB7 A;  5F1G A;  3CHW P;  4OH0 A;  4Q8I A;  3G31 A;  3WS4 A;  4HJ6 A;  1EWZ A;  2OLU A;  4BL3 A;  2WYX A;  3UE6 A;  4O01 A;  2E8I A;  3WS2 A;  3D4F A;  5HAP A;  4PMA A;  2ZQ9 A;  5F69 A;  1YLZ A;  2Y8H A;  2JKR M;  3JVV A;  3D9Y A;  4BJP A;  4KQR A;  4IBX A;  3OCN A;  4YOF A;  3ZQ5 A;  1N9L A;  1PI5 A;  2EX8 A;  2QHK A;  5IT5 A;  2EXB A;  1GHI A;  4FH2 A;  3TE8 A;  3WRT A;  3Q07 A;  2XRN A;  1E25 A;  1T19 A;  3MF0 A;  3O86 A;  1MKI A;  3UE3 A;  1U60 A;  1D1J A;  4DF6 A;  4UQI S;  5HZH A;  2Z2M B;  4JBF A;  4H6J A;  5HWT A;  4GOG A;  2RCX A;  3OPH A;  4HY8 A;  5E2G A;  2C6W B;  3W4O A;  4MLL A;  1L0E A;  5FI7 A;  3T4O A;  3V5M A;  3VE3 A;  1P0Z A;  3NI9 A;  2VK3 A;  3ZYT A;  3MQO A;  3A3F A;  3UB6 A;  2EX6 A;  1HVB A;  4R3J A;  2X71 A;  4P87 A;  3ZCZ A;  4JF6 A;  5FAP A;  3GEC A;  2V0U A;  4KZA A;  2NUP C;  1KE3 A;  2INW A;  1Y28 A;  2JKT I;  4ZAM A;  2PBD P;  4DJ3 A;  2L0W A;  5CGW A;  3F1O B;  1W63 M;  4LV2 A;  1K4E A;  4F94 A;  3PBN A;  4D60 A;  2XQZ A;  4CQH A;  3DWK A;  4KUO A;  4KZ5 A;  4KZ7 A;  3BRM A;  5EPH A;  2V1B A;  3H7W A;  3UDF A;  1G6A A;  4ARZ A;  1IOU A;  3MKF A;  4DKI A;  2GNX A;  1G5U A;  1DJA A;  2H0Y A;  2FFY A;  2ZQ7 A;  3CUE C;  1ERQ A;  3S7N A;  3T4Q A;  3T50 A;  4PM6 A;  5F68 A;  3IQA A;  2JCH A;  4HES A;  5IHV A;  3V39 A;  3A3I A;  3AGF A;  3S7P A;  4X6T A;  3BLS A;  1X0O A;  1FR1 A;  4P6B A;  4EER A;  1OTD A;  3LO7 A;  1UWP X;  1VET A;  3F1P B;  3L7H A;  3KYE A;  2LB5 A;  4OLD A;  4OPZ A;  4LV1 A;  4ETX A;  3UME A;  3VP0 A;  1TS7 A;  3IXD A;  4S2O A;  2ZQA A;  1BSG A;  3G34 A;  3CWF A;  1F2K A;  3VP1 A;  1JTG A;  5K5B A;  2WGI A;  2WKP A;  4OOY A;  4BEN A;  3M6H A;  4QY6 A;  4XXR A;  1GA9 A;  2HDU A;  2ZLY A;  2XEP A;  3B3X A;  4S2I A;  1CI9 A;  3CPT A;  5EM0 A;  5L2F A;  2XF3 A;  4OPQ A;  3UB5 P;  4Y5F A;  1K38 A;  2VGL S;  2H5S A;  2Z6D A;  1K6S A;  1K0K A;  5AVF A;  1KGF A;  2WKH A;  1HLU P;  2W1T B;  3MFD A;  2VGJ A;  3U2A A;  1XGJ A;  4R70 A;  3MZD A;  3BEB A;  3AGD A;  4I3I A;  3BFD A;  2A3U A;  2AVX A;  3NIA A;  5CEB A;  1RCJ A;  4K08 A;  2XGN A;  3QP2 A;  4AFI A;  3PYP A;  3A0R A;  3EQV A;  3E4Q A;  4LEN A;  1K6R A;  1AWI A;  3M2K A;  3ULF A;  4S2P A;  3DBA A;  3HLB A;  4RA7 A;  2BLS A;  1XFQ A;  1KVL A;  1H0M A;  4NXG A;  5FEF A;  2ZL1 B;  2Q9M A;  1YLP A;  3VFH A;  3RXW A;  1PYY A;  4LGW A;  4E3M A;  2ZMV A;  3RFB A;  4JLF A;  1E4D A;  5FAS A;  1BT5 A;  4HBU A;  2Y91 A;  3HUM A;  4EEU A;  5FQQ A;  4CLC A;  4GLQ A;  3S7Q A;  3NUL A;  3R7W B;  3IXH A;  1Z6F A;  2VEA A;  3UPO A;  2XA7 S;  1MWU A;  3S1Y A;  3MR0 A;  5HD3 A;  3DTE A;  3FYZ A;  1BYW A;  1BUE A;  2XDM A;  2E8J A;  3Q82 A;  1N9N A;  4II7 A;  3MMH A;  5DTT A;  3T4L A;  3H82 B;  4DJ2 A;  1NJ4 A;  3FG8 A;  5CER A;  5HL6 A;  1P9W A;  1STZ A;  2B5R A;  5KSH A;  3N6I A;  3T4S A;  3JPU A;  3LIC A;  2HPB A;  2ZD8 A;  4C3Q A;  3BFE A;  1SKO B;  4ETZ A;  5A92 A;  1XJ3 A;  4FD8 A;  5EUA A;  4CLC E;  3M6B A;  1HD8 A;  5GLA A;  1J3W A;  4HIA A;  4B88 A;  5EM1 A;  2HJE A;  1DJC A;  3QP1 A;  5CHU A;  1CJF A;  2FFF B;  3HBR A;  3SOI A;  3ZNT A;  3EGD C;  4JPM A;  3BFG A;  3NEC A;  2J3W A;  4IVK A;  1N9B A;  3HUO A;  3RXX A;  2PRF A;  3GSG A;  4LCM A;  2XR0 A;  3QP6 A;  4GHI B;  1PFL A;  2PD7 A;  2QWS A;  4B4Z A;  2V1Z A;  4EBP A;  2WAD A;  4Y0U A;  1GCE A;  4BBT A;  2HGV A;  4OKP A;  1YLY A;  2PHY A;  4LLO B;  3C2W A;  1KGG A;  5A8B A;  4GS9 B;  3TRC A;  5U47 A;  4NET A;  4GNU A;  2ZBB A;  4HP4 A;  3CJM A;  5EOE A;  1ESU A;  4KZ9 A;  3MKE A;  3UMD A;  1K55 A;  1H8M A;  1ES4 A;  4KZB A;  4OQH A;  4E3I A;  1MY8 A;  3BFC A;  4N9K A;  4FH4 A;  1ESI A;  4MMN A;  2X01 A;  3BQA A;  4XUX A;  2PDR A;  4MN7 A;  4EQI A;  3BQ8 A;  4GCZ A;  4EW7 A;  3BFF A;  4WN5 A;  3EEH A;  1H3Q A;  2VKS A;  4LRX C;  3ZDJ A;  3T12 B;  4O7D A;  4R3B A;  3NBL A;  2HDQ A;  1TS0 A;  1FOF A;  3EQU A;  5AQA A;  4KZ6 A;  4X56 A;  5FQM A;  5EOO A;  4P6Z M;  3IWQ A;  4R4S A;  2XD1 A;  1F9I A;  3SS4 A;  5DF8 A;  3E4P A;  1AXB A;  4UA9 A;  4EBL A;  5EVI C;  3S22 A;  3HUN A;  3C4O A;  3O3V A;  5CGS A;  3B42 A;  1F98 A;  3E4O A;  3T4T A;  3LR5 A;  3CMZ A;  1WE4 A;  5G4Z A;  4EXO A;  3P09 A;  4WZ5 A;  5F6A A;  3KO6 A;  5HDC A;  2Y2L A;  3JVU A;  5AVE A;  5DJT A;  2FH5 A;  3IHA A;  3CAX A;  4JXV A;  2O9C A;  1LI9 A;  3UB9 A;  3F1N B;  3ITB A;  1PZP A;  3IBJ A;  1GHM A;  1L0G A;  1M40 A;  3BJN A;  2OWH A;  2V2F F;  4R38 A;  1DP6 A;  2W3F A;  3GR2 A;  3NOT C;  3GTC A;  3DW0 A;  1W7F A;  5BOH A;  1NZO A;  3F1O A;  1OTE A;  4E04 A;  3UPP A;  3HCY A;  3R4K A;  5HD5 A;  4U3T A;  3NCK A;  4QD4 A;  3MZF A;  3L9K A;  4KZ4 A;  1SDN A;  4I5S A;  3VV4 A;  3UN7 A;  1K25 A;  2Y2K A;  3QNB A;  5HAR A;  4WEL A;  1JWV A;  4LV3 A;  3UO9 A;  2PYP A;  1XA1 A;  3P98 A;  3NOP C;  1SHV A;  4GB7 A;  1JWP A;  3ZG5 A;  3SH7 A;  2XK1 A;  4L9E A;  4OLG A;  3UE1 A;  4CJN A;  5F5Y A;  1FSW A;  4B93 A;  3HLF A;  3F1P A;  3N7W A;  3EGX C;  5AJG A;  3FPV A;  5HDS A;  1K56 A;  5FQJ A;  3WRZ A;  4C6Y A;  3OOV A;  3BM6 A;  5GLD A;  5FQK A;  1Y4O A;  3LY4 A;  4ZJ3 A;  4GD6 A;  3G6O A;  1XJ6 A;  2ZC4 B;  4UAA A;  1XJ2 A;  3IF6 C;  4NXF A;  4QU3 A;  3V3S A;  1OT9 A;  5FAQ A;  3C30 A;  2QJ7 A;  2GX5 A;  1PI4 A;  2QMI A;  3SH9 A;  1K4F A;  4IBR A;  3LY3 A;  4X1L A;  3TJZ C;  2HP6 A;  3N8L A;  4MN6 A;  4E3N A;  2JBF A;  1T1A A;  3A0S A;  2WGW A;  4EQ1 A;  2V20 A;  4WEK A;  2WKR A;  4DN0 A;  4WMC A;  4R0Q A;  1LT0 A;  4HQA A;  2B18 A;  2D02 A;  2UWX A;  4NG2 A;  1VHM A;  4PKY G;  3IH9 A;  4U0T A;  4JGO A;  5DF7 A;  3K3D A;  2EX9 A;  1L2S A;  3NHQ A;  2PU4 A;  3LI8 A;  4S2N A;  1D7E A;  3PAE A;  4N1X A;  3PBS A;  3ZNY A;  4X25 A;  4DE3 A;  1IYS A;  2XRO A;  4F3L B;  4I3A A;  5AQB A;  3V50 A;  2EX2 A;  3T1X A;  3P01 A;  3T1R A;  2ZL1 A;  5HPI A;  2WZZ A;  2JKR I;  3HLC A;  4GW9 A;  2ZC5 B;  3EEA A;  4EEP A;  1NWZ A;  1MKM A;  5FDH A;  1NRF A;  1GSV A;  2Z2L B;  3OLO A;  1ES3 A;  2HDR A;  4EBN A;  3FV7 A;  2ZM8 A;  1CEF A;  1CF0 A;  2HDS A;  4R6L A;  4XT2 B;  2VJW A;  4Y0O A;  1Y54 A;  1OJ5 A;  4GD8 A;  4DXC A;  1S4S A;  3SW1 A;  3C4P A;  5KSC A;  3C7U A;  1E3U D;  3BEC A;  2WGV A;  4P0M A;  4KG6 A;  3ZVW A;  2PAV P;  3HLG A;  2VGK A;  2G2W A;  1CEG A;  4JXW A;  5EVL A;  2EFX A;  2JC7 A;  4K0X A;  3T4K A;  1LL8 A;  2FZ0 A;  4HOI A;  1JWZ A;  3NDE A;  5G4Y A;  1SKO A;  1MBL A;  4MBK A;  3OPP A;  4JGQ A;  2ZOH A;  1RGZ A;  4OP5 A;  2O9A A;  3PR6 A;  1MC0 A;  3QHY A;  4E6X A;  1YMS A;  3HVF A;  5JYP A;  3OC2 A;  1NYY A;  3A3D A;  3MXR A;  1K54 C;  2QJ5 A;  2OAQ 1;  3MJQ A;  5J7E A;  4DMZ A;  4GHI A;  1H8Y A;  1OJG A;  3ZG8 B;  1I5Q A;  4JGR A;  1JVJ A;  5EVI B;  5EFW A;  1VEU B;  5GHX A;  3W2Z A;  2QZ6 A;  1EI5 A;  3I7J A;  2O99 A;  4FTX A;  4GS9 A;  2P04 A;  2HJ9 C;  4E3J A;  4NK3 A;  2QKP A;  1DJB A;  4LPZ A;  3KSI A;  1KE4 A;  3K2N A;  4R1G A;  1K57 C;  2IWD A;  5I94 A;  3GVB A;  1O07 A;  1PW1 A;  2VV8 A;  4WUJ A;  4N9L A;  3IXB A;  1OME A;  1L0F A;  2G2U A;  3C8C A;  1HTZ A;  5G18 A;  1I2W A;  5DKK A;  3ITA A;  3IH8 A;  4HJ4 A;  2Z6C A;  2C5W B;  3LGO A;  4Z1W A;  2Y2H A;  1MXO A;  4M4X A;  3FC7 A;  5EEC A;  1NLZ A;  4QB8 A;  4ZBE A;  5DVA A;  2P08 A;  2K7S A;  2ZM2 A;  2J3T D;  4BQM A;  3LI9 A;  5C5K A;  1BLS A;  2BG1 A;  3V67 A;  4EUV A;  4ESP A;  4QPR A;  4DE2 A;  4BMW A;  2WZX A;  1G28 A;  4FOF A;  3G2Y A;  2ZOI A;  3LIA A;  4KQD A;  2QPN A;  5GLB A;  3VP4 A;  3PTE A;  3VP3 A;  3UY6 A;  1FCN A;  1K55 C;  2VV6 A;  2I9V A;  4R4R A;  1PIO A;  1FCO A;  1YM1 A;  4JGP A;  1LSX A;  1VM1 A;  4O8G A;  5FL3 A;  1GSW A;  3F1N A;  1WYB A;  4ZDX A;  2WK0 A;  3OPL A;  4HNB A;  4Y3I A;  2H0T A;  3N8S A;  5CX7 A;  1ONG A;  2IWC A;  3IF6 B;  2J9O A;  5HAQ A;  1V9Y A;  2EWV A;  2WKE A;  2X02 A;  1YLJ A;  1M6K A;  2BAS A;  4MNR A;  3WS0 A;  1BLH A;  4YWZ A;  2WKI A;  1LLB A;  5E2E A;  3Q81 A;  5E2H A;  3MQQ A;  1YLW A;  1QME A;  4K91 A;  1UWN X;  3LR0 A;  3N8R A;  2Y2O A;  3WWX A;  5LBR A;  1PW8 A;  1YKD A;  4OON A;  1V9Z A;  2Y2P A;  2WKQ A;  4GN2 A;  1ZG6 A;  4WL9 A;  4N1H A;  2R78 A;  4ID4 A;  5EE8 A;  2PYR A;  1NLY A;  1HZO A;  4HI4 A;  3VOY A;  3NY4 A;  4MEZ A;  1SDE A;  4OQI A;  3HLD A;  4BLM A;  3G30 A;  2V8C A;  5HL1 A;  2JE5 A;  5IU1 A;  2A24 B;  4P85 A;  3ICY A;  4MCW A;  1T18 A;  5DF9 A;  4DRT A;  2Y2N A;  3V3R A;  3QP5 A;  1IYO A;  5CTN A;  1IKG A;  4KZ3 A;  3KSF A;  4RX3 A;  1IKI A;  2OWJ A;  4M3K A;  3LIB A;  5TBM B;  2ZQ8 A;  1XGI A;  2Y2M A;  4GZB A;  3SH8 A;  3IWI A;  3PXP A;  4X1M A;  3ISG A;  2GJ3 A;  1Z09 A;  1KGE A;  2B95 A;  3BW6 A;  3QP8 A;  4OP8 A;  2M1C A;  1BZA A;  4PM8 A;  4S2J A;  1J9M A;  2W3H A;  3VOL A;  2W3E A;  4E3K A;  1LI0 A;  3PHY A;  1P9R A;  1FIK A;  5HFO A;  4WYY A;  3UE0 A;  1SKF A;  3HLW A;  2P74 A;  2V9A A;  2OAP 1;  4MBF A;  4BD1 A;  4F3L A;  2P9V B;  3A3J A;  4I38 A;  3MQ0 A;  4OVD A;  2LB9 A;  4JKT A;  5GLC A;  2EWW A;  2QYB A;  3IHB A;  4Z9Q A;  4BBU A;  1CK3 A;  5DFY A;  3UNW A;  3IS2 B;  2PU2 A;  3UDI A;  1W8Q A;  2A49 A;  4QJG A;  3W8K A;  1D06 A;  5CTM A;  3OZH A;  1K56 D;  5E2F A;  1S1Y A;  4WF0 A;  1Q2Q A;  2L4R A;  1XPB A;  5GHY A;  4XT2 A;  3LYX A;  4C75 A;  3TSG A;  4HJ3 A;  4WZ4 A;  1ERM A;  4Q0H A;  2Y79 A;  4RVA A;  1H8Z A;  3IX8 A;  2VX8 A;  1OT6 A;  1S67 L;  1YLT A;  2XFT A;  4MN5 A;  1KDW A;  4X68 A;  2PD8 A;  4WMC D;  3BY9 A;  4Y17 A;  4E3O A;  5CXW A;  1LSV A;  3ZG9 B;  1S66 L;  1KDS A;  3Q1F A;  3E98 A;  3MZE A;  5HWW A;  1LHY A;  3G2Z A;  3VSK A;  1ES2 A;  5A91 A;  2J7V A;  1PRQ A;  5A90 A;  3UB8 A;  3SZT A;  4Y15 A;  4L9G A;  3A0V A;  1IEM A;  1NZU A;  3S4X A;  2ZJ9 A;  2R9X A;  4JF4 A;  2ZC3 B;  1DP8 A;  4N92 A;  4B9O A;  3DTK A;  4X69 A;  3T4J A;  3LR4 A;  1ZG4 A;  4EV4 A;  1MWS A;  1L0D A;  1W79 A;  3CG5 A;  4WBG A;  5HDD A;  3GRJ A;  3E0Y A;  5TGF A;  3LEZ A;  4YIN A;  3QP4 A;  3D3O A;  3O87 A;  4NKP A;  5CGX A;  5EVI A;  4S2K A;  2PR6 A;  2KDK A;  4EES A;  3O88 A;  4ZTK A;  4O0P A;  3ZG0 A;  5CHJ A;  3MXS A;  4KQO A;  1NXY A;  2DRW A;  5HAI A;  3K3C A;  5TFQ A;  4EUZ A;  1BLP A;  1BUL A;  5M18 A;  3PBO A;  1ALQ A;  4HBT A;  1PZO A;  2W1T A;  1ODV A;  4E6W A;  2WAE A;  3OBF A;  3LEQ A;  2BTF P;  2K2N A;  5M1A A;  5FA7 A;  4G3V A;  4A5R A;  1JTD A;  3KYQ A;  5GHZ A;  3LID A;  1LSW A;  4HEF A;  2IWB A;  2JKT M;  2CC1 A;  4LV0 A;  3HLE A;  2W3G A;  4PAU A;  3S7O A;  2EXA A;  3NC8 A;  3VSL A;  1PWD A;  4PM5 A;  4LRZ E;  3ZVT A;  1S4R A;  2P7J A;  4BL2 A;  3LCE A;  1YSQ A;  2HF6 A;  4CPK A;  4UHU A;  1CQA A;  4K0W A;  4HHD A;  3ZGA B; 
#chains in the Genus database with same CATH homology
 3CLO A;  1YSP A;  4GHI B;  1TS6 A;  3C8C A;  2ZMF A;  4OOL A;  2PD7 A;  1ZHH B;  2QWS A;  5DKK A;  2H28 A;  5HPF A;  2KLI A;  4HJ4 A;  4BBT A;  2Z6C A;  4L9F A;  1UGU A;  2HGV A;  2PHY A;  4LLO B;  3C2W A;  1MZU A;  5A8B A;  4Q0I A;  4Z1W A;  4GS9 B;  3TRC A;  3B33 A;  1T1C A;  2ZBB A;  4HP4 A;  4M4X A;  3R7W A;  1VB6 A;  3FC7 A;  3KX0 X;  1NLZ A;  4MDZ A;  4EET B;  2W27 A;  3UMD A;  4KUK A;  2P08 A;  2K7S A;  1H8M A;  2J3T D;  2EA9 A;  1ZTU A;  3LI9 A;  5C5K A;  2B02 A;  4MMN A;  1S1Z A;  2W0N A;  3BQA A;  2PDR A;  4MN7 A;  3BQ8 A;  3FPW A;  4GCZ A;  4EW7 A;  3V67 A;  4EUV A;  1TD5 A;  4QPR A;  4WN5 A;  4HH3 A;  3EEH A;  1NRJ A;  3CIT A;  3H82 A;  1H3Q A;  2VZW A;  2VKS A;  4LRX C;  1DRM A;  2K31 A;  4BMW A;  1G28 A;  4GJ4 A;  2XA7 M;  4FOF A;  2ZOI A;  3LIA A;  4KQD A;  1TS0 A;  3UB7 A;  3EQU A;  1P97 A;  2KX6 A;  2VV6 A;  2I9V A;  4JGP A;  4IUH A;  1LSX A;  4P6Z M;  4O8G A;  5FL3 A;  1GSW A;  3F1N A;  4HJ6 A;  2JHE A;  4EU0 A;  1F9I A;  3C38 A;  3UE6 A;  4HNB A;  4Y3I A;  4O01 A;  3MFX A;  3E4P A;  3PBQ A;  3LUQ A;  5F69 A;  5CX7 A;  4I39 A;  2Y8H A;  2JKR M;  3JVV A;  4BJP A;  3OCL A;  5J4E A;  3OCN A;  4CLC C;  4YOF A;  3ZQ5 A;  1N9L A;  1V9Y A;  2QHK A;  3B42 A;  1F98 A;  1TS8 A;  2EWV A;  3O5Y A;  4P6Z S;  5IT5 A;  3E4O A;  3T4T A;  3TE8 A;  3LR5 A;  5G4Z A;  2XRN A;  2BAS A;  1T19 A;  4EXO A;  3MF0 A;  5F6A A;  2KOI A;  3KO6 A;  5HDC A;  4YWZ A;  3JVU A;  5AVE A;  5DJT A;  2FH5 A;  3MQQ A;  3CAX A;  2O9C A;  3UE3 A;  4CLC D;  2A24 A;  5IS1 A;  2JN7 A;  3F1N B;  3UB9 A;  1UWN X;  4UQI S;  5HZH A;  3IBJ A;  1KOU A;  3BJN A;  3LR0 A;  2OWH A;  4H6J A;  4R38 A;  5HWT A;  1DP6 A;  2W3F A;  3LR3 A;  3NOT C;  4HY8 A;  5LBR A;  3F1O A;  1YKD A;  1V9Z A;  1OTE A;  4E04 A;  3HCY A;  3R4K A;  5HD5 A;  2WKQ A;  3T4O A;  3HJI A;  2VA0 A;  3VE3 A;  4WL9 A;  1P0Z A;  5TBM A;  2R78 A;  2PYR A;  4I5S A;  1NLY A;  3VV4 A;  4HI4 A;  2J3T C;  3B47 A;  3ZYT A;  5DKL A;  4WEL A;  3MQO A;  1XJ4 A;  3UB6 A;  2VLG A;  2PYP A;  4G3K A;  3NOP C;  5IU1 A;  1F5M A;  2A24 B;  3GEC A;  2DMW A;  2V0U A;  4L9E A;  3ICY A;  4MCW A;  2NUP C;  1T18 A;  5DF9 A;  2INW A;  4H6J B;  1Y28 A;  2JKT I;  4PHT A;  5F5Y A;  2O9B A;  2IA2 A;  2HV1 A;  3LFV A;  4DJ3 A;  4B93 A;  2L0W A;  3IBR A;  3KSG A;  3F1O B;  1W63 M;  1G6O A;  3KSF A;  3CUE A;  2OWJ A;  3PBN A;  2O0Y A;  3LIB A;  5TBM B;  3F1P A;  4CQH A;  3EGX C;  3BY8 A;  4KUO A;  5AJG A;  3FPV A;  5HDS A;  4IJG A;  3PXP A;  2A2L A;  3GDI A;  2V1B A;  3IS2 A;  3OOV A;  3EWK A;  2D01 A;  2GJ3 A;  3H7W A;  4ARZ A;  1IOU A;  3BW6 A;  2GNX A;  3LIF A;  2M7V A;  3G6O A;  3NOU C;  1XJ6 A;  2G7U A;  1XJ2 A;  2M1C A;  3TW8 A;  4NXF A;  3CUE C;  3S7N A;  1OT9 A;  3T4Q A;  3T50 A;  2W3H A;  5F68 A;  1W63 Q;  3C30 A;  2QJ7 A;  2GX5 A;  3LIE A;  5HWV A;  3MXQ A;  3VOL A;  2W3E A;  3PHY A;  4HP9 A;  1P9R A;  3TJZ C;  4MN6 A;  3S7P A;  4ME4 A;  4I3J A;  1X0O A;  2V9A A;  4EER A;  1OTD A;  1T1A A;  2OAP 1;  3A0S A;  2M7U A;  4EQ1 A;  4F3L A;  1UWP X;  4BWI A;  3F1P B;  4WEK A;  2WKR A;  4DN0 A;  4I38 A;  2L1M A;  2LB5 A;  4UQI M;  3MQ0 A;  1LT0 A;  2LB9 A;  2EWW A;  2QYB A;  4HQA A;  4BBU A;  4ETX A;  2B18 A;  5DFY A;  2D02 A;  3IS2 B;  5J3W A;  3UME A;  4WEJ A;  3H7W B;  1TS7 A;  1VHM A;  4PKY G;  1D06 A;  4ARZ B;  4JGO A;  2NUT C;  3CWF A;  3K3D A;  5K5B A;  3NHQ A;  1S1Y A;  3CI6 A;  4WF0 A;  3LI8 A;  2L4R A;  2WKP A;  2GZA A;  1D7E A;  1WA9 A;  2XSS A;  4XT2 A;  3PBS A;  3LYX A;  4R3A A;  3RH8 B;  4IUK A;  2XRO A;  4HJ3 A;  4F3L B;  4I3A A;  4Q0H A;  3P7N A;  4Y5F A;  4LRY C;  2Y79 A;  5I5L A;  2VGL S;  2VX8 A;  2Z6D A;  1OT6 A;  3P01 A;  1S67 L;  5AVF A;  5HSQ A;  1TF1 A;  4WLA A;  3KSH A;  5HPI A;  4MN5 A;  2W1T B;  3U2A A;  4R70 A;  2PD8 A;  2JKR I;  4GW9 A;  4L0L A;  3BY9 A;  3EEA A;  4I3I A;  4EEP A;  1NWZ A;  1MKM A;  1LSV A;  2MJ6 A;  1GSV A;  1S66 L;  3OLO A;  4BBV A;  2VV7 A;  4HH2 A;  4K08 A;  3PBR A;  3D72 A;  4RQ9 A;  3E98 A;  5HWW A;  3EOI A;  1XFN A;  4AFI A;  3PYP A;  3A0R A;  2W1R A;  3EQV A;  3E4Q A;  4R6L A;  3RTY A;  4XT2 B;  5KIZ A;  2VJW A;  3UB8 A;  3ULF A;  4L9G A;  3A0V A;  3DBA A;  1OJ5 A;  1XFQ A;  3KYZ A;  2PR5 A;  4UEY A;  1YAX A;  1S4S A;  3SW1 A;  2OOL A;  1OTB A;  4NXG A;  3H9W A;  1DP8 A;  4Q0J A;  1GSX A;  4B9O A;  3T4J A;  2ZMV A;  3RFB A;  3LR4 A;  2V1A A;  4PKY A;  3VE4 A;  5HDD A;  3E0Y A;  3BWL A;  4EEU A;  3D3O A;  4NKP A;  3T4K A;  5DFX A;  1LL8 A;  5TJJ A;  2FZ0 A;  4CLC A;  4HOI A;  4GLQ A;  2CMN A;  2PR6 A;  1T1B A;  2KDK A;  4NEE D;  5G4Y A;  3S7Q A;  2YKH A;  4EES A;  3NJA A;  4ZRR A;  4JGQ A;  5DJU A;  2J80 A;  4O0P A;  1JNU A;  3HJK A;  2ZOH A;  3R7W B;  2O9A A;  3PR6 A;  3PBT A;  2YKF A;  1MC0 A;  2VEA A;  4KQO A;  2XA7 S;  3K3C A;  3MR0 A;  4NXB A;  2W3D A;  3PBO A;  5HD3 A;  2V0W A;  1EW0 A;  2PT7 A;  1BYW A;  3OC2 A;  2W1T A;  1OTA A;  1OPX A;  1ODV A;  1IFQ A;  3OBF A;  1N9N A;  4II7 A;  3MMH A;  2K2N A;  2QJ5 A;  3T4L A;  2OAQ 1;  3H82 B;  3MJQ A;  4IHQ A;  4DJ2 A;  5J7E A;  4G3V A;  4DMZ A;  3KYQ A;  4GHI A;  3FG8 A;  4YNR A;  2VGL M;  1OJG A;  3LID A;  5HL6 A;  1P9W A;  1STZ A;  5KSH A;  1LSW A;  1N9O A;  2JKT M;  4JGR A;  3T4S A;  5EFW A;  4CLC B;  2W3G A;  3LIC A;  4PAU A;  3W2Z A;  4Y2F A;  3S7O A;  4NXE A;  4ETZ A;  1OTI A;  2O99 A;  4GS9 A;  5L8M A;  1DP9 A;  1XJ3 A;  4CLC E;  4LRZ E;  2P04 A;  2HJ9 C;  1S4R A;  2P7J A;  4HIA A;  2QKP A;  2HJE A;  4LPZ A;  1YSQ A;  3KSI A;  4G3W A;  2HF6 A;  3EGD C;  3K2N A;  4OOM A;  2J3W A;  4FSF A;  5MC7 A;  4HHD A;  2VV8 A;  4WUJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...