2PR6A

Structural basis for light-dependent signaling in the dimeric lov photosensor ytva (light structure)
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
128
structure length
128
Chain Sequence
LDHVRVGVVITDPALEDNPIVYVNQGFVQMTGYETEEILGKNCRFLQGKHTDPAEVDNIRTALQNKEPVTVQIQNYKKDGTMFWNELNIDPMEIEDKTYFVGIQNDITKQKEYEKLLEDSLTEITALS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Flavoprotein, signaling protein
molecule keywords Blue-light photoreceptor
publication title Structural Basis for Light-dependent Signaling in the Dimeric LOV Domain of the Photosensor YtvA.
pubmed doi rcsb
source organism Bacillus subtilis
total genus 42
structure length 128
sequence length 128
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13426 PAS_9 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2pr6A00
4LRXC 5A8BA 3C2WA 1S1YA 5AVFA 3GDIA 1T1CA 2VV7A 4RQ9A 2PD7A 1OTEA 5HZHA 5G4YA 1T1BA 3UB9A 1LSWA 4MN6A 5HWTA 3BWLA 1S4RA 4H6JA 2R78A 3P7NA 4PKYA 3UMDA 1OJGA 1OT9A 4HOIA 1XFQA 2JN7A 3ULFA 2V0WA 1T18A 2JHEA 1DRMA 3H7WB 4YWZA 3RTYA 3VE3A 2K7SA 1V9ZA 1T19A 3NOTC 2J80A 4GS9B 1F98A 4JGQA 3UB8A 3CWFA 2OWJA 4EEUA 4LRYC 1MZUA 5HDSA 3H7WA 3IS2B 2Z6CA 4I3AA 4HP9A 3E4QA 1D7EA 2I9VA 5AVEA 4EEPA 4PKYG 3H9WA 3LIEA 2V1AA 4EETB 4HP4A 4EW7A 1GSWA 4GS9A 4HJ4A 4LRZE 3K3CA 5F68A 4M4XA 3FG8A 4EQ1A 4HY8A 5DKLA 1WA9A 4WLAA 1ODVA 2QJ7A 3IS2A 5DJTA 5HDCA 1JNUA 4NXBA 2PR5A 3LIDA 4L9EA 1F9IA 1S1ZA 2L4RA 2VV6A 1XFNA 3LIBA 1NWZA 1UWPX 4NXGA 4BBTA 2PYPA 4MN5A 5IS1A 4EESA 4HHDA 1GSVA 1OTAA 2W0NA 2VV8A 1GSXA 1UGUA 3LI8A 2V9AA 4WUJA 2PYRA 4HNBA 1VB6A 3H82A 1G28A 4HQAA 1P97A 3ICYA 1DP8A 1DP6A 5DKKA 1D06A 4I5SA 5KIZA 1UWNX 3MXQA 4HJ3A 2L1MA 2ZOIA 5HD5A 4WL9A 2VEAA 1KOUA 4KQDA 4HH2A 3RH8B 4BBUA 2L0WA 2P7JA 1N9NA 2PD8A 3BY9A 5HWWA 3LIAA 3PHYA 3VOLA 3CLOA 2WKRA 3MFXA 2WKQA 1OTBA 3PYPA 4EXOA 1S4SA 3UE6A 1TS7A 3C8CA 2ZOHA 3ZQ5A 1TS8A 4HJ6A 2INWA 2A24A 3MR0A 2QKPA 4XT2B 1LL8A 3UMEA 1N9LA 2HV1A 2PR6A 3LYXA 3HJIA 3HJKA 5HSQA 2KX6A 3FC7A 3K3DA 5IU1A 3D72A 3H82B 4LPZA 3F1NB 4R6LA 3OLOA 1XJ4A 5HD3A 1BYWA 3MJQA 2YKHA 4XT2A 1OTDA 1TS0A 2KDKA 2D01A 5J3WA 3GECA 4KUKA 2W27A 4JGPA 1Y28A 4DJ3A 1OT6A 5J4EA 4WF0A 4I39A 3F1NA 4L9GA 3F1PA 2YKFA 4WN5A 5G4ZA 1XJ3A 4F3LA 3LI9A 4HI4A 3B33A 4JGRA 2WKPA 2V1BA 1S66L 3UB6A 1OTIA 5TBMA 4EERA 4NXEA 4GHIB 5DJUA 3BY8A 4NXFA 2GJ3A 2V0UA 2H28A 2A24B 3A0VA 2EA9A 4R70A 2QJ5A 2PHYA 1T1AA 1EW0A 2CMNA 4GW9A 4GCZA 3MQQA 5F69A 1X0OA 3A0SA 3SW1A 1TS6A 4LLOB 5F6AA 1OJ5A 1LSXA 4E04A 1XJ6A 5HDDA 4GHIA 3F1OB 2OWHA 3UB7A 1XJ2A 1V9YA 3LIFA 3E4OA 4R3AA 3E4PA 2M1CA 3NJAA 3MQOA 1S67L 1LT0A 4I3JA 5I5LA 5F5YA 4I3IA 2QHKA 3NOUC 2VLGA 3KX0X 4R38A 4K08A 2OOLA 3LUQA 4DJ2A 5EFWA 3NHQA 1LSVA 4L9FA 4KUOA 3T50A 5J7EA 3F1PB 1P0ZA 4HIAA 3NOPC 4JGOA 2ZBBA 5HWVA 3EEHA 1DP9A 2QWSA 3F1OA 3G6OA 2B02A 3A0RA 4F3LB 3CAXA 4B9OA 4H6JB 1N9OA 3VE4A 2BASA 2PDRA 5TBMB 2Z6DA 4I38A 4BBVA 2D02A 3IBRA 3EWKA 3LICA 4HH3A
chains in the Genus database with same CATH superfamily
4G3KA 4LRXC 3OOVA 4BMWA 3BEBA 2ZC4B 4RQ9A 2PD7A 4DRTA 1FSWA 5E2EA 1T1BA 1H8YA 3UB9A 3T1SA 1LSWA 2ZLYA 3T12B 4XUXA 3TG9A 4H6JA 4PM8A 2R78A 1OT9A 4X56A 3ZG0A 3O87A 2EXBA 1IOUA 3ULFA 3L7HA 4MN7A 1MWTA 3C30A 2V0WA 2JHEA 1ZKJA 3P09A 3SS4A 3V5MA 1SZVA 3NY4A 1XXMA 3MZDA 3QHYA 1FCOA 1YLZA 4DN0A 3VE3A 1WE4A 1T19A 1N9BA 1YMXA 3KSHA 2J80A 1ERQA 3MFDA 4JGQA 4CLCA 4NG2A 4DKIA 3UB8A 3CWFA 2J8YA 2OWJA 5CERA 1YLWA 3MS6A 2XR0A 3H7WA 3IS2B 3SOIA 1XGJA 4S2PA 3R7WB 4MCWA 4R3JA 4YNRA 4OVDA 4KENB 2EXAA 4PM6A 2VA0A 2LB5A 3H9WA 1IYQA 1ONGA 4CLCE 4EETB 3UY6A 1Z6FA 4HP4A 1GSWA 2ZQ7A 4GS9A 4P6ZS 4HJ4A 2BTFP 3NULA 2Y59A 4JXWA 1KGEA 4R1GA 1TF1A 1KGGA 3G34A 2QJ7A 3GRJA 4OQIA 2RCXA 4GOGA 3RFBA 5HDCA 3KYQA 3PAGA 3LIDA 3S7QA 1O07A 4L9EA 1TVFA 4Y13A 4IBXA 1H8MA 4OONA 4QB8A 3B47A 3D4FA 2JKRM 3ZG5A 4BBTA 2ACGA 3CHWP 1HZOA 3N8RA 1IKGA 1JWVA 4JXGA 1J3WA 3EEAA 5EOEA 2ZC3B 5KSHA 1SDNA 5J8XA 1UGUA 5FI2A 3PBOA 2V9AA 4B93A 1TEMA 2PYRA 2XH9A 1VB6A 2NUTC 4HQAA 2XQZA 4YOFA 1DP8A 4HBUA 3IQAA 5FQQA 2VZWA 3DW0A 3LR5A 5EM1A 2Y2HA 3MSHA 1ESUA 5KIZA 4ID4A 4HJ3A 1K6RA 5GHXA 1W79A 2WZZA 1DJBA 5HD5A 2E8JA 4KQDA 3RH8B 2JC7A 4BBUA 2XLNA 2L0WA 5HAQA 3LIAA 2RL3A 4C3QA 2V2FF 3VOLA 2WGWA 1OPXA 1IKIA 4H8RA 1IYOA 1FCMA 4EBNA 3MFXA 3ZDJA 4MBKA 2EX8A 5JYOA 1OTBA 4E3NA 1BTLA 3UE6A 3BQ8A 1I2SA 1L0GA 1TS8A 3EGXC 1FOFA 1GA0A 2O9BA 2Z2LB 1TD5A 2P9VB 4E6WA 4L0LA 2ZQ8A 5TJJA 3IH9A 1PZPA 2WGIA 4JPMA 4Y5FA 2KX6A 3K3DA 4X69A 1K57A 1SDEA 1O7EA 2EX2A 4WZ5C 2WZXA 3DBAA 1BUEA 3QP4A 3MJQA 4WYYA 1W63M 3W8KA 4XT2A 1BZAA 4BD1A 2CC1A 2D01A 1ZHHB 2Y2GA 4EUVA 1YQSA 2G7UA 4KUKA 2W27A 3FKWA 3IBJA 4DJ3A 4DF6A 3HLEA 2PBYA 4WMCA 1J9MA 3CPTB 3ITBA 1MY8A 1ERMA 3IF6A 2WK0A 4R4RA 2XD1A 5G18A 4MEZA 3CZDA 4Q0IA 3T1XA 2EFXA 1XJ3A 3LO7A 1BULA 4C75A 4O01A 2WKHA 3C5AA 3LI9A 3UPPA 3B33A 4RVAA 1MPLA 1VETB 1OTIA 2J9OA 3PBSA 5TBMA 4EERA 4NXEA 1HTZA 2DCFA 4NXFA 2ZQCA 2A24B 4R70A 1KGFA 1T1AA 4OPZA 4QWOA 5DFXA 3ZFZA 3LEZA 2CMNA 2R9XA 1X0OA 3SW1A 4P6BA 3CJMA 1OJ5A 3PBNA 1L0DA 3SS5A 1GHPA 5CX7A 1Q2PA 3PXPA 1Z09A 1FIKA 3F1OB 4EBLA 1XPBA 4R3AA 2KOIA 3S7OA 4HESA 3NJAA 3MQOA 2W1TA 3UE0A 3T4JA 1JTGA 5EVEA 5F5YA 5MC7A 1YLTA 3VMAA 5GHZA 5DFYA 4U3TA 5EPHA 3KX0X 5JYPA 1YAXA 3BQAA 3T1QB 5F83A 3R4KA 1LSVA 1ES5A 4LV3A 3GR2A 3WS4A 3A3DA 3JVUA 1DP9A 2QWSA 5EVIA 1EWZA 1YSPA 4B9OA 4E3OA 3MZFA 3R7WA 3S22A 1N9OA 1VQQA 4AFIA 2PDRA 1JVJA 2XA7S 3LFVA 3HLCA 4KZBA 3LICA 4M3KA 3M2JA 2ZQAA 4QU3A 3CUEA 1S1YA 4OPRA 5AVFA 2QYBA 3IWOA 2JCHA 1G68A 2VV7A 4X55A 1U60A 2ZC7A 3T4LA 3ZNTA 4X1MA 5FEGA 3S7PA 3A3JA 2EX9A 4MN6A 1XKZA 2KLIA 5FI6A 4PKYA 3UMDA 1LL9A 1OJGA 3PTEA 2JN7A 3DAVA 3MXRA 5L2FA 2AVXA 5FQKA 4MLLA 4II7A 1VEUB 2W3HA 4OLGA 1K6SA 3Q7VA 2JKGA 2WADA 4R4SA 3ZHHA 4S2KA 3IF5A 4GKUA 3VFFA 1SKOB 4YWZA 3RTYA 4N9LA 4OQHA 1E3UD 3W4PA 4ZTKA 2K7SA 5AJGA 4IBRA 1FSYA 4OP8A 2NUPC 1LI0A 3I7JA 1K55A 2GNXA 5EVLA 1MZUA 4XUZA 4S2IA 2Z6CA 4I3AA 4HP9A 4JLFA 2HGVA 1PNEA 1D7EA 4EEPA 4X68A 4EQIA 3V39A 4FH4A 3C7UA 3LIEA 2Y2KA 4BL3A 4BENA 4R0QA 4LRZE 5F68A 4DMZA 3HUMA 4HBTA 3S1YA 4EQ1A 4HY8A 1WA9A 3VFHA 1ODVA 1CI8A 1G5UA 2X71A 4GD8A 5F82A 3T4KA 2PU4A 1EROA 2B95A 4IUKA 1NYYA 4OOLA 2XROA 3G4PA 5FDHA 2WUQA 3JVVA 5HARA 1S1ZA 2VV6A 3OPRA 1YM1A 1PW8A 1NWZA 3ZG8B 1L2SA 4NXGA 3QP2A 5IS1A 3DWKA 1RGZA 3TSGA 4HHDA 5K5BA 2VGJA 1GSVA 1OTAA 2P9VA 2W0NA 5CHJA 4ETXA 1GSXA 2J3TD 3B3XA 3FPWA 3UPOA 3MF0A 4HNBA 3U2AA 3CI6A 5EOOA 5CECA 3N7WA 5DKKA 4Q0JA 1XP4A 3BRMA 2GZAA 4KZ7A 1MWSA 3BFEA 3N4IA 2J3TC 4ZJ1A 3OPPA 5HFOA 3BJNA 4OQ0A 2QMIA 2VEAA 1KOUA 4QJGA 3HLBA 1DJAA 5DTTA 4BQMA 2P7JA 4JF4A 5BOHA 3MKEA 1EI5A 3SZTA 3EQUA 4MBHA 3E98A 4GB7A 3NBLA 3OPLA 4ARZB 4CLCD 2WKRA 3MZEA 4RX3A 4QHCA 5HX9A 2Y2MA 1ALQA 4D2OA 1Q2QA 1N4OA 5FQJA 2Y2JA 1YKDA 4EWFA 5HL1A 1FR1A 2B18A 2ZOHA 3UDIA 4HJ6A 3ITAA 3W4QA 2P04A 2A24A 2W3FA 3WRZA 1LHYA 1LL8A 4ZDXA 3MKFA 4Z9QA 2H0TA 4CLCC 4UA6A 2A3UA 2G2WA 2PR6A 2J9PA 3LYXA 2B5RA 3HJIA 5A92A 5HSQA 4KZAA 1W5DA 3D72A 2XF3A 4LPZA 3EQVA 3F1NB 3V3RA 3OLOA 4GZBA 2ZM8A 2W1RA 4K91A 1BYWA 5FATA 3OC2A 2ZMVA 3WS1A 3BLMA 5HAIA 5CEDA 3G2ZA 5DTSA 1OTDA 1TS0A 2FFFB 3BYDA 5F1FA 3GQZA 1W7FA 3UNWA 3GECA 3S7NA 4LGWA 2A49A 4JGPA 1K56A 1P9WA 5IT5A 3V3SA 4P87A 3Q07A 4P0MA 5J4EA 1PWGA 3HUOA 4I39A 5A90A 4FSFA 4L9GA 4S2MA 3FPVA 3FWLA 3LR4A 2JE5A 5CGWA 1H5XA 5CGXA 3U4LP 4HI4A 3O5YA 1PWDA 2QPNA 3VP4A 4GNUA 1ESIA 4IHQA 4E6XA 4GHIB 4GN2A 2OLUA 3ZGAB 4WM9A 5DJUA 2PBDP 2ZD8A 3BY8A 2GJ3A 4F94A 5FEFA 3A0VA 5EUAA 2HJ9C 2EA9A 3HLWA 3UO9A 3C7VA 3C4OA 1QMFA 4GW9A 3MQQA 1K38A 5F69A 2ZQ9A 1S0WA 1XGIA 1QMEA 4LLOB 5F6AA 1BSGA 4BL2A 5FL3A 4E3IA 1XJ6A 5F1GA 4ZBEA 3ZCZA 3SH9A 2OWHA 5D3OA 1GHMA 2GDNA 3DWZA 2HZ5A 3E4PA 4GLQA 4PM7A 3V67A 3ZYTA 4WZ5A 1ZC2A 2J7VA 3LCEA 3ZG9B 2HP9A 1JWZA 1AWIA 4B4ZA 3FKVA 1SKOA 4GJ4A 1K4EA 4GDNA 4K08A 2OOLA 3LUQA 2UV0E 4DJ2A 1JTDA 4CPKA 4L9FA 5HAPA 3T50A 3F1PB 1K54C 4MMNA 5AQBA 3HUNA 3IWIA 4F3LB 3SH8A 3CAXA 2HJEA 1IYPA 5FA7A 2Y4AA 3FV7A 5CXWA 4H6JB 3KSFA 3VE4A 4N9KA 3BLSA 1C3BA 1IEMA 2HP6A 2ZL1A 4BBVA 4S2NC 2D02A 3EWKA 1IELA 4R23A 5GLAA 4X25A 1H8ZA 3DTEA 1HVBA 4GDBA 1NZUA 2ZMFA 2Q0OA 1K57C 4WMCD 4NETA 3QP6A 5HZHA 3B42A 3M6BA 5G4YA 5AQ7A 3A3IA 3KO6A 5CHUA 2HF6A 4OOYA 2W3EA 5HWTA 1YT4A 4ZAMA 1RGYA 4CLCB 4HOIA 5EECA 2VK3A 3G2YA 5FQIA 1CF0A 3UPNA 2VGLM 1DY6A 2PT7A 4LCMA 1DRMA 2WGVA 3H7WB 4UQIM 3GMWA 3VP0A 4BLMA 2XDMA 5DVAA 3G31A 3CMZA 3OPHA 4UEYA 2XD5A 5EM0A 4Y15A 2XGNA 5CEBA 1V9ZA 1KDWA 4ETZA 1YSQA 3TRCA 4GS9B 4LFUA 4IUHA 4Q0HA 5L10A 4NK3A 1FILA 1SKFA 5E2FA 4LRYC 1XA7A 5HDSA 3GSGA 5C5KA 1MBLA 3UDXA 3E4QA 3M2KA 1M40A 1E4DA 4DE3A 3HLGA 4KG5A 5KMWA 3UE1A 5FQ9A 1YLJA 1F5MA 3HBRA 4DXBA 2OLVA 4IVIA 3TOIA 4EW7A 1DJCA 2H5SA 2JKFA 3K3CA 1PW1A 4M4XA 3FG8A 2PRFA 5DKLA 3QP5A 4OP5A 3ZG7B 3IS2A 2BLSA 1JNUA 2JKRI 3VSLA 3D3OA 1BLHA 2PR5A 5EVID 3Q82A 3BM6A 4FH2A 5FDSA 5M1AA 1F9IA 1ES3A 2L4RA 3LIBA 3AGEA 1XA1A 2PYPA 3BW6A 4RX2A 5CTMA 4MN5A 2ZM2A 4EESA 3GV9A 4DXCA 2R9WA 5E43A 4ZRRA 1Y4OA 1BLSA 2VV8A 3IXGA 1YPRA 2VJWA 4Q8IA 2HDSA 5EVIC 3IX4A 1G6AA 2FFYA 2H0YA 4DDSA 4IVKA 3PR6A 4S2JA 4Z1WA 2HDRA 2V1ZA 3KSGA 3ZVTA 5AQ9A 2X01A 4JXVA 2WKIA 1VHMA 3WS0A 1KE3A 2VGKA 2WGWB 3WWXA 2HP5A 2C5WB 1ACFA 3KSIA 4I5SA 1XX2A 1Y54A 5M19A 2Z2MB 4OKPA 5DF8A 1UWNX 3MXQA 2Y2NA 2WYXA 3CITA 4QY5A 3ISGA 1W8QA 3QNCA 1N9NA 3S4XA 1VM1A 5KZHA 3SH7A 3BY9A 4UAAA 4EBPA 4CQHA 4KQRA 4FCFA 3ZVWA 2C6WB 3CLOA 1LI9A 4WELA 2DNSA 1NXYA 3LEQA 5FAOA 2WKQA 4WBGA 1PWCA 1FQGA 1SHVA 4Y2FA 3ZQ5A 4WEKA 2INWA 3MR0A 4XT2B 3IHAA 3EGDC 4EUZA 1N9LA 4KZ3A 4LV2A 1E25A 2HV1A 3T1RA 3HJKA 1MKIA 3GVBA 3H82B 1ES2A 3QNBA 4R6LA 1KVLA 4KZ4A 1XJ4A 5HW3A 2WAFA 4S2LA 5U47A 3A3FA 4MDZA 5E2HA 2YKHA 1F2KA 1JWPA 2LB9A 5FSRA 2QZ6A 1G6OA 2Y79A 5FASA 2KDKA 2PAVP 3CG5A 3G30A 1NLYA 4UHUA 5J3WA 3BFCA 1ES4A 5TGFA 1HD8A 1Y28A 2GX5A 3LR3A 3WS5A 2Q9MA 4GD6A 4WF0A 3F1PA 4Y3IA 4WN5A 5GLCA 3O88A 1PI4A 5G4ZA 1K25A 4F3LA 2V8CA 3LY3A 4ZJ2A 5KSCA 4ME4A 3MBZA 3NIAA 4YINA 2OV5A 2WKPA 3W4OA 2V1BA 4WZ4A 1S66L 3UB6A 3AGFA 1NYMA 2IWCA 3W2ZA 1D1JA 3CPTA 4DDYA 3LGOA 5GLBA 2V20A 4LV1A 2W1TB 3IWQA 2PHYA 3WS2A 2M7UA 3Q7ZA 3MMHA 5CRFA 1EW0A 3MXSA 4Y7PA 1W63Q 1MKMA 5HPFA 5L07A 1CI9A 1TS6A 4B4XA 1LSXA 4E04A 1CQAA 3HVFA 1BLPA 4LENA 1VETA 5EVIB 1XJ2A 4C6YA 4WEJA 3LIFA 3E4OA 4Y17A 2M1CA 5TFQA 3QP1A 4BWIA 3NI9A 2FZ0A 1S67L 4LV0A 1GCEA 4E3MA 3E2LA 5L09A 4MBFA 1NJ4A 4OPYA 5EFWA 4X1LA 1PFLA 4O0PA 3O86A 4G3VA 4KUOA 5J7EA 1P0ZA 4JGOA 3NOPC 2ZBBA 4IEDA 1BT5A 4RYEA 5HWVA 3F1OA 2B02A 3FYZA 1KVMA 3A0RA 3RJUA 4RA7A 1WYBA 4PM5A 5A91A 2JKTI 4DE2A 1HLUP 2BASA 5AQAA 4FOFA 1PRQA 4I38A 1GA9A 3ZNYA 3V50A 1L0EA 1WYCA 3Q7VB 5A8BA 3C2WA 4FD8A 2Y8HA 1K56D 3GDIA 4O7DA 4FUWA 1T1CA 1OTEA 5FAPA 2XK1A 2ZC6B 3T4OA 2WAEA 4EV4A 4KZ9A 4JXSA 3Q81A 3UB5P 5FAQA 3VP3A 3BWLA 1S4RA 2JBFA 2Y2IA 3PBQA 5E2GA 3P7NA 3IHBA 2FH5A 4XXRA 1XFQA 4KZ8A 2HPBA 4K0WA 2HDUA 2ZQDA 3LY4A 1T18A 4NEED 4P6ZM 3OCNA 2O9CA 2Y2PA 2PU2A 4N92A 3LR0A 2X02A 1CJFA 2Y55A 1STZA 4FTXA 4UA9A 2XEPA 4X6TA 3P98A 1BLCA 3G35A 3NOTC 3PAEA 1YLYA 2VX8A 1S6RA 1F98A 1GHIA 3HREA 2DMWA 3IXBA 4KQQA 4EEUA 1PI5A 1NZOA 1PYYA 1VEUA 1KE4A 2EX6A 4PM9A 2H10A 3T4QA 4E3JA 1K54A 1H0MA 5FQMA 2I9VA 5AVEA 4PKYG 5TR7A 1FR6A 1ZTUA 3IXDA 1MXOA 1IFQA 4KG2A 5CHMA 1CK3A 2V1AA 2O99A 3IXHA 4G3WA 2VGLS 2EWVA 4KZ6A 5HPIA 4Y0UA 2I72A 4UQIS 2XRNA 2M7VA 4PHTA 5EV0A 1FCNA 3AGDA 5GL9A 1MC0A 4S2NA 3M6HA 4WLAA 5GLDA 2WKEA 4DE1A 5DJTA 1TDGA 5L8MA 4NXBA 1A0KA 1IYSA 5A93A 3PBRA 2Y91A 2O9AA 2K2NA 5DF7A 3E2KA 3N6IA 1XFNA 3NDGA 3OCLA 3KYEA 1LLBA 1UWPX 3WRTA 4OLDA 1YMSA 4O8GA 2V8FA 4BJPA 4HEFA 1K4FA 3LI8A 4JF6A 3UE3A 4WUJA 2OAP1 3MQ0A 5DF9A 3H82A 1G28A 1P97A 1H3QA 3ICYA 2XFSA 3UN7A 1DP6A 4DE0A 5DTKA 1L0FA 1D06A 1RP5A 5LBRA 2Q9NA 3T4TA 5I94A 3IF6C 5FI7A 2L1MA 5CGSA 3DTKA 4ESPA 1LL5A 3QP8A 2ZOIA 1M6KA 4WL9A 3EOIA 4HH2A 2PD8A 5HL6A 3C4PA 2W3GA 5HWWA 3VP1A 3PHYA 1MWRA 1NY0A 5CTNA 3HLDA 1TDLA 4Y0OA 4KQOA 2IA2A 2ZJ9A 1CEFA 2P74A 3A3EA 2K31A 4Y0TA 3PYPA 3VOYA 4EU0A 4EXOA 1S4SA 2ZC5B 4R3BA 1I5QA 1TS7A 3C8CA 4KG6A 5EE8A 1K0KA 2QKPA 3UMEA 3G32A 3UDFA 3HLFA 3IX3A 4PMAA 4ARZA 3GTCA 3VV4A 1OMEA 4N1HA 4OQGA 3FC7A 5IU1A 1I2WA 2O0YA 2OSUA 2XFTA 3C38A 5HD3A 4BD0A 4QPRA 1P9RA 1AXBA 4CJNA 3E0YA 4JBFA 3IH8A 3P01A 4UA7A 2UWXA 3N8SA 4NKPA 3L9KA 3T4SA 3TE8A 5M18A 4OPQA 1OT6A 1ZG4A 3KYZA 4JF5A 1ZG6A 4E3KA 2JKTM 1NRJA 4MNRA 3F1NA 4IJGA 4KZ5A 3N8LA 2YKFA 2G2UA 4JKTA 4A5RA 1PIOA 1L3LA 3TW8A 3NECA 4LCLA 4D60A 1YLPA 3CUEC 4JGRA 3NCKA 1KDSA 4OOMA 3NC8A 3NDEA 4OH0A 2ZMAA 3VP2A 1NRFA 2Y2OA 2V0UA 4YFMA 2H28A 2XSSA 3FZCA 3OZHA 1MWUA 5IHVA 3DTIA 1E3UA 2E8IA 2QJ5A 5GHYA 2OAQ1 3BFFA 2IWBA 1PZOA 3SS3A 3K2NA 2P08A 4P85A 4GCZA 3JPUA 4N1XA 2MJ6A 3OBFA 3A0SA 1RCJA 2XA7M 3RXWA 3O3VA 2VKSA 2HDQA 5HDDA 1W8YA 4GHIA 4E3LA 3UB7A 4ZJ3A 1V9YA 3Q1FA 4PAUA 4S2OA 2A2LA 1SCWA 1CEGA 1LT0A 4I3JA 5I5LA 4QY6A 3BFDA 4I3IA 1K55C 2ZL1B 2QHKA 4K0XA 3NOUC 2VLGA 4R38A 2DRWA 3D9YA 3VSKA 1KE0A 3NHQA 3HCYA 2J3WA 3IF6B 4U0XA 2BG1A 4HIAA 4B88A 3EEHA 3G6OA 3IX8A 2IWDA 1ONHA 4PPRA 2EFUA 3IT9A 3DTMA 3VOZA 3PBTA 2Y2LA 3BECA 2ZM0A 3RXXA 2W3DA 4U0TA 5TBMB 3JYIA 2Y2QA 2Z6DA 3HL9A 3IBRA 3BFGA 2EWWA 1NLZA 4X53A 4QD4A 3TJZC 4HH3A
chains in the Genus database with same CATH topology
4G3KA 4LRXC 3CUEA 5A8BA 3C2WA 3OOVA 1S1YA 5AVFA 2QYBA 4BMWA 2Y8HA 3GDIA 2ZMFA 1T1CA 2VV7A 4RQ9A 2PD7A 1OTEA 3T4LA 3T4OA 3B42A 5G4YA 5HZHA 3KO6A 1T1BA 2HF6A 2W3EA 3S7PA 3UB9A 1LSWA 4MN6A 5HWTA 3BWLA 1S4RA 2KLIA 3PBQA 4H6JA 2R78A 3P7NA 4PKYA 2FH5A 1OJGA 3UMDA 1OT9A 4HOIA 4CLCB 1XFQA 2JN7A 1IOUA 3ULFA 4MN7A 2VGLM 3C30A 2V0WA 1T18A 2PT7A 2JHEA 1DRMA 4NEED 4P6ZM 4UQIM 3H7WB 3OCNA 4II7A 2W3HA 2O9CA 3LR0A 4UEYA 4YWZA 3RTYA 1STZA 4DN0A 3VE3A 2K7SA 5AJGA 1V9ZA 1T19A 4ETZA 1YSQA 3KSHA 3NOTC 2J80A 2NUPC 3TRCA 4GS9B 2VX8A 1F98A 4JGQA 4CLCA 4IUHA 3UB8A 2DMWA 3CWFA 4Q0HA 2GNXA 2OWJA 4EEUA 4LRYC 1MZUA 5HDSA 5C5KA 3H7WA 3IS2B 2Z6CA 4I3AA 4HP9A 3E4QA 3R7WB 4MCWA 3T4QA 2HGVA 1D7EA 4YNRA 2I9VA 5AVEA 4EEPA 4PKYG 1ZTUA 2VA0A 2LB5A 1F5MA 1IFQA 3H9WA 3LIEA 2V1AA 4CLCE 2O99A 4G3WA 4EETB 2VGLS 2EWVA 5HPIA 4HP4A 4EW7A 1GSWA 4GS9A 4P6ZS 4UQIS 2XRNA 4HJ4A 4LRZE 2M7VA 3K3CA 5F68A 4DMZA 4M4XA 3FG8A 4PHTA 4EQ1A 4HY8A 1MC0A 5DKLA 1WA9A 1TF1A 4WLAA 1ODVA 2QJ7A 3T4KA 3IS2A 3RFBA 5DJTA 5HDCA 1JNUA 4IUKA 5L8MA 2JKRI 3KYQA 3D3OA 4NXBA 2PR5A 3LIDA 3S7QA 4L9EA 4OOLA 3PBRA 2XROA 3JVVA 2O9AA 1F9IA 2K2NA 1S1ZA 2L4RA 1H8MA 2VV6A 1XFNA 3B47A 3LIBA 3OCLA 1NWZA 2JKRM 1UWPX 4NXGA 4BBTA 2PYPA 3BW6A 4MN5A 5IS1A 4EESA 4HHDA 5K5BA 4ZRRA 1GSVA 1OTAA 2W0NA 2VV8A 2VJWA 3EEAA 4O8GA 4BJPA 4ETXA 5KSHA 1GSXA 2J3TD 1UGUA 3LI8A 3FPWA 3PBOA 2V9AA 3UE3A 4WUJA 4B93A 3MF0A 2OAP1 2PYRA 4HNBA 3MQ0A 3U2AA 1VB6A 3CI6A 1G28A 3H82A 5DF9A 2NUTC 4HQAA 3PR6A 4Z1WA 1P97A 4YOFA 3KSGA 1H3QA 3ICYA 1DP8A 1VHMA 2VZWA 1DP6A 3LR5A 5DKKA 4Q0JA 3KSIA 1D06A 2GZAA 4I5SA 5LBRA 3T4TA 5KIZA 2J3TC 1UWNX 3MXQA 4HJ3A 3BJNA 2L1MA 2ZOIA 5HD5A 4WL9A 2VEAA 3CITA 1KOUA 3EOIA 4KQDA 4HH2A 3RH8B 4BBUA 2L0WA 2P7JA 1N9NA 2PD8A 5HL6A 2W3GA 3BY9A 3LIAA 5HWWA 4CQHA 3PHYA 3EQUA 3VOLA 3E98A 1OPXA 3CLOA 4ARZB 4CLCD 2WKRA 4WELA 3MFXA 4KQOA 2WKQA 2IA2A 1OTBA 2K31A 3PYPA 4EU0A 4EXOA 1S4SA 3UE6A 3BQ8A 1YKDA 1TS7A 3C8CA 2ZOHA 2B18A 4Y2FA 3ZQ5A 1TS8A 4HJ6A 4WEKA 2INWA 2P04A 2A24A 2W3FA 2QKPA 3MR0A 3EGXC 4XT2B 1LL8A 3UMEA 3EGDC 1N9LA 2O9BA 4CLCC 1TD5A 4L0LA 2HV1A 5TJJA 2PR6A 4ARZA 3LYXA 3HJIA 3HJKA 3VV4A 5HSQA 4Y5FA 2KX6A 3FC7A 3K3DA 5IU1A 3D72A 3H82B 4LPZA 3EQVA 3F1NB 4R6LA 2O0YA 3OLOA 1XJ4A 3C38A 3DBAA 2W1RA 5HD3A 1BYWA 4QPRA 3OC2A 1P9RA 2ZMVA 4MDZA 3MJQA 2YKHA 1W63M 3E0YA 4XT2A 2LB9A 1OTDA 1TS0A 1G6OA 2Y79A 2KDKA 3P01A 2D01A 1NLYA 1ZHHB 5J3WA 3GECA 4NKPA 4EUVA 3S7NA 2G7UA 4KUKA 2W27A 4JGPA 3IBJA 1Y28A 4DJ3A 1P9WA 5IT5A 3T4SA 3TE8A 2GX5A 3LR3A 1OT6A 5J4EA 3KYZA 4WF0A 4I39A 2JKTM 1NRJA 3F1NA 4FSFA 4IJGA 4L9GA 3F1PA 4Y3IA 2YKFA 4WN5A 3FPVA 3LR4A 4Q0IA 5G4ZA 1XJ3A 3TW8A 4F3LA 4O01A 3CUEC 3LI9A 4ME4A 4HI4A 3B33A 3O5YA 4JGRA 2WKPA 2V1BA 1S66L 3UB6A 1OTIA 4IHQA 3PBSA 5TBMA 4OOMA 4EERA 4NXEA 4GHIB 5DJUA 3W2ZA 3BY8A 4NXFA 2GJ3A 2V0UA 2H28A 2A24B 2XSSA 3A0VA 2HJ9C 2EA9A 4R70A 2W1TB 2QJ5A 2PHYA 1T1AA 2M7UA 3MMHA 2OAQ1 1EW0A 5DFXA 3K2NA 2P08A 2CMNA 4GW9A 4GCZA 3MQQA 5F69A 1W63Q 2MJ6A 3OBFA 1MKMA 1X0OA 3A0SA 5HPFA 3SW1A 1TS6A 4LLOB 5F6AA 1OJ5A 3PBNA 1LSXA 4E04A 2XA7M 5FL3A 5CX7A 2VKSA 1XJ6A 3PXPA 5HDDA 4GHIA 3F1OB 2OWHA 3UB7A 1XJ2A 1V9YA 4WEJA 3LIFA 3E4OA 4R3AA 3E4PA 4GLQA 4PAUA 2KOIA 3S7OA 2M1CA 4BWIA 3NJAA 2A2LA 2W1TA 2FZ0A 1S67L 1LT0A 3MQOA 4I3JA 5I5LA 3V67A 3ZYTA 3T4JA 5F5YA 4I3IA 5MC7A 2QHKA 4GJ4A 3NOUC 2VLGA 5DFYA 3KX0X 4R38A 4K08A 2OOLA 1YAXA 3BQAA 3LUQA 3R4KA 4DJ2A 5EFWA 3NHQA 4O0PA 1LSVA 4G3VA 3HCYA 4L9FA 4KUOA 2J3WA 3T50A 5J7EA 3F1PB 1P0ZA 4HIAA 3NOPC 4JGOA 2ZBBA 4MMNA 5HWVA 3JVUA 3EEHA 1DP9A 2QWSA 3F1OA 3G6OA 2B02A 3A0RA 4F3LB 3CAXA 2HJEA 1YSPA 4B9OA 2JKTI 3PBTA 4H6JB 3R7WA 3KSFA 1N9OA 3VE4A 4AFIA 2BASA 2W3DA 2PDRA 4FOFA 5TBMB 2XA7S 2Z6DA 3LFVA 4I38A 4BBVA 2D02A 3IBRA 2EWWA 1NLZA 3EWKA 3LICA 3TJZC 4HH3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LRX C;  5A8B A;  3C2W A;  1S1Y A;  5AVF A;  3GDI A;  1T1C A;  2VV7 A;  4RQ9 A;  2PD7 A;  1OTE A;  5HZH A;  5G4Y A;  1T1B A;  3UB9 A;  1LSW A;  4MN6 A;  5HWT A;  3BWL A;  1S4R A;  4H6J A;  2R78 A;  3P7N A;  4PKY A;  3UMD A;  1OJG A;  1OT9 A;  4HOI A;  1XFQ A;  2JN7 A;  3ULF A;  2V0W A;  1T18 A;  2JHE A;  1DRM A;  3H7W B;  4YWZ A;  3RTY A;  3VE3 A;  2K7S A;  1V9Z A;  1T19 A;  3NOT C;  2J80 A;  4GS9 B;  1F98 A;  4JGQ A;  3UB8 A;  3CWF A;  2OWJ A;  4EEU A;  4LRY C;  1MZU A;  5HDS A;  3H7W A;  3IS2 B;  2Z6C A;  4I3A A;  4HP9 A;  3E4Q A;  1D7E A;  2I9V A;  5AVE A;  4EEP A;  4PKY G;  3H9W A;  3LIE A;  2V1A A;  4EET B;  4HP4 A;  4EW7 A;  1GSW A;  4GS9 A;  4HJ4 A;  4LRZ E;  3K3C A;  5F68 A;  4M4X A;  3FG8 A;  4EQ1 A;  4HY8 A;  5DKL A;  1WA9 A;  4WLA A;  1ODV A;  2QJ7 A;  3IS2 A;  5DJT A;  5HDC A;  1JNU A;  4NXB A;  2PR5 A;  3LID A;  4L9E A;  1F9I A;  1S1Z A;  2L4R A;  2VV6 A;  1XFN A;  3LIB A;  1NWZ A;  1UWP X;  4NXG A;  4BBT A;  2PYP A;  4MN5 A;  5IS1 A;  4EES A;  4HHD A;  1GSV A;  1OTA A;  2W0N A;  2VV8 A;  1GSX A;  1UGU A;  3LI8 A;  2V9A A;  4WUJ A;  2PYR A;  4HNB A;  1VB6 A;  3H82 A;  1G28 A;  4HQA A;  1P97 A;  3ICY A;  1DP8 A;  1DP6 A;  5DKK A;  1D06 A;  4I5S A;  5KIZ A;  1UWN X;  3MXQ A;  4HJ3 A;  2L1M A;  2ZOI A;  5HD5 A;  4WL9 A;  2VEA A;  1KOU A;  4KQD A;  4HH2 A;  3RH8 B;  4BBU A;  2L0W A;  2P7J A;  1N9N A;  2PD8 A;  3BY9 A;  5HWW A;  3LIA A;  3PHY A;  3VOL A;  3CLO A;  2WKR A;  3MFX A;  2WKQ A;  1OTB A;  3PYP A;  4EXO A;  1S4S A;  3UE6 A;  1TS7 A;  3C8C A;  2ZOH A;  3ZQ5 A;  1TS8 A;  4HJ6 A;  2INW A;  2A24 A;  3MR0 A;  2QKP A;  4XT2 B;  1LL8 A;  3UME A;  1N9L A;  2HV1 A;  2PR6 A;  3LYX A;  3HJI A;  3HJK A;  5HSQ A;  2KX6 A;  3FC7 A;  3K3D A;  5IU1 A;  3D72 A;  3H82 B;  4LPZ A;  3F1N B;  4R6L A;  3OLO A;  1XJ4 A;  5HD3 A;  1BYW A;  3MJQ A;  2YKH A;  4XT2 A;  1OTD A;  1TS0 A;  2KDK A;  2D01 A;  5J3W A;  3GEC A;  4KUK A;  2W27 A;  4JGP A;  1Y28 A;  4DJ3 A;  1OT6 A;  5J4E A;  4WF0 A;  4I39 A;  3F1N A;  4L9G A;  3F1P A;  2YKF A;  4WN5 A;  5G4Z A;  1XJ3 A;  4F3L A;  3LI9 A;  4HI4 A;  3B33 A;  4JGR A;  2WKP A;  2V1B A;  1S66 L;  3UB6 A;  1OTI A;  5TBM A;  4EER A;  4NXE A;  4GHI B;  5DJU A;  3BY8 A;  4NXF A;  2GJ3 A;  2V0U A;  2H28 A;  2A24 B;  3A0V A;  2EA9 A;  4R70 A;  2QJ5 A;  2PHY A;  1T1A A;  1EW0 A;  2CMN A;  4GW9 A;  4GCZ A;  3MQQ A;  5F69 A;  1X0O A;  3A0S A;  3SW1 A;  1TS6 A;  4LLO B;  5F6A A;  1OJ5 A;  1LSX A;  4E04 A;  1XJ6 A;  5HDD A;  4GHI A;  3F1O B;  2OWH A;  3UB7 A;  1XJ2 A;  1V9Y A;  3LIF A;  3E4O A;  4R3A A;  3E4P A;  2M1C A;  3NJA A;  3MQO A;  1S67 L;  1LT0 A;  4I3J A;  5I5L A;  5F5Y A;  4I3I A;  2QHK A;  3NOU C;  2VLG A;  3KX0 X;  4R38 A;  4K08 A;  2OOL A;  3LUQ A;  4DJ2 A;  5EFW A;  3NHQ A;  1LSV A;  4L9F A;  4KUO A;  3T50 A;  5J7E A;  3F1P B;  1P0Z A;  4HIA A;  3NOP C;  4JGO A;  2ZBB A;  5HWV A;  3EEH A;  1DP9 A;  2QWS A;  3F1O A;  3G6O A;  2B02 A;  3A0R A;  4F3L B;  3CAX A;  4B9O A;  4H6J B;  1N9O A;  3VE4 A;  2BAS A;  2PDR A;  5TBM B;  2Z6D A;  4I38 A;  4BBV A;  2D02 A;  3IBR A;  3EWK A;  3LIC A;  4HH3 A; 
#chains in the Genus database with same CATH topology
 4G3K A;  4LRX C;  3OOV A;  4BMW A;  3BEB A;  2ZC4 B;  4RQ9 A;  2PD7 A;  4DRT A;  1FSW A;  5E2E A;  1T1B A;  1H8Y A;  3UB9 A;  3T1S A;  1LSW A;  2ZLY A;  3T12 B;  4XUX A;  3TG9 A;  4H6J A;  4PM8 A;  2R78 A;  1OT9 A;  4X56 A;  3ZG0 A;  3O87 A;  2EXB A;  1IOU A;  3ULF A;  3L7H A;  4MN7 A;  1MWT A;  3C30 A;  2V0W A;  2JHE A;  1ZKJ A;  3P09 A;  3SS4 A;  3V5M A;  1SZV A;  3NY4 A;  1XXM A;  3MZD A;  3QHY A;  1FCO A;  1YLZ A;  4DN0 A;  3VE3 A;  1WE4 A;  1T19 A;  1N9B A;  1YMX A;  3KSH A;  2J80 A;  1ERQ A;  3MFD A;  4JGQ A;  4CLC A;  4NG2 A;  4DKI A;  3UB8 A;  3CWF A;  2J8Y A;  2OWJ A;  5CER A;  1YLW A;  3MS6 A;  2XR0 A;  3H7W A;  3IS2 B;  3SOI A;  1XGJ A;  4S2P A;  3R7W B;  4MCW A;  4R3J A;  4YNR A;  4OVD A;  4KEN B;  2EXA A;  4PM6 A;  2VA0 A;  2LB5 A;  3H9W A;  1IYQ A;  1ONG A;  4CLC E;  4EET B;  3UY6 A;  1Z6F A;  4HP4 A;  1GSW A;  2ZQ7 A;  4GS9 A;  4P6Z S;  4HJ4 A;  2BTF P;  3NUL A;  2Y59 A;  4JXW A;  1KGE A;  4R1G A;  1TF1 A;  1KGG A;  3G34 A;  2QJ7 A;  3GRJ A;  4OQI A;  2RCX A;  4GOG A;  3RFB A;  5HDC A;  3KYQ A;  3PAG A;  3LID A;  3S7Q A;  1O07 A;  4L9E A;  1TVF A;  4Y13 A;  4IBX A;  1H8M A;  4OON A;  4QB8 A;  3B47 A;  3D4F A;  2JKR M;  3ZG5 A;  4BBT A;  2ACG A;  3CHW P;  1HZO A;  3N8R A;  1IKG A;  1JWV A;  4JXG A;  1J3W A;  3EEA A;  5EOE A;  2ZC3 B;  5KSH A;  1SDN A;  5J8X A;  1UGU A;  5FI2 A;  3PBO A;  2V9A A;  4B93 A;  1TEM A;  2PYR A;  2XH9 A;  1VB6 A;  2NUT C;  4HQA A;  2XQZ A;  4YOF A;  1DP8 A;  4HBU A;  3IQA A;  5FQQ A;  2VZW A;  3DW0 A;  3LR5 A;  5EM1 A;  2Y2H A;  3MSH A;  1ESU A;  5KIZ A;  4ID4 A;  4HJ3 A;  1K6R A;  5GHX A;  1W79 A;  2WZZ A;  1DJB A;  5HD5 A;  2E8J A;  4KQD A;  3RH8 B;  2JC7 A;  4BBU A;  2XLN A;  2L0W A;  5HAQ A;  3LIA A;  2RL3 A;  4C3Q A;  2V2F F;  3VOL A;  2WGW A;  1OPX A;  1IKI A;  4H8R A;  1IYO A;  1FCM A;  4EBN A;  3MFX A;  3ZDJ A;  4MBK A;  2EX8 A;  5JYO A;  1OTB A;  4E3N A;  1BTL A;  3UE6 A;  3BQ8 A;  1I2S A;  1L0G A;  1TS8 A;  3EGX C;  1FOF A;  1GA0 A;  2O9B A;  2Z2L B;  1TD5 A;  2P9V B;  4E6W A;  4L0L A;  2ZQ8 A;  5TJJ A;  3IH9 A;  1PZP A;  2WGI A;  4JPM A;  4Y5F A;  2KX6 A;  3K3D A;  4X69 A;  1K57 A;  1SDE A;  1O7E A;  2EX2 A;  4WZ5 C;  2WZX A;  3DBA A;  1BUE A;  3QP4 A;  3MJQ A;  4WYY A;  1W63 M;  3W8K A;  4XT2 A;  1BZA A;  4BD1 A;  2CC1 A;  2D01 A;  1ZHH B;  2Y2G A;  4EUV A;  1YQS A;  2G7U A;  4KUK A;  2W27 A;  3FKW A;  3IBJ A;  4DJ3 A;  4DF6 A;  3HLE A;  2PBY A;  4WMC A;  1J9M A;  3CPT B;  3ITB A;  1MY8 A;  1ERM A;  3IF6 A;  2WK0 A;  4R4R A;  2XD1 A;  5G18 A;  4MEZ A;  3CZD A;  4Q0I A;  3T1X A;  2EFX A;  1XJ3 A;  3LO7 A;  1BUL A;  4C75 A;  4O01 A;  2WKH A;  3C5A A;  3LI9 A;  3UPP A;  3B33 A;  4RVA A;  1MPL A;  1VET B;  1OTI A;  2J9O A;  3PBS A;  5TBM A;  4EER A;  4NXE A;  1HTZ A;  2DCF A;  4NXF A;  2ZQC A;  2A24 B;  4R70 A;  1KGF A;  1T1A A;  4OPZ A;  4QWO A;  5DFX A;  3ZFZ A;  3LEZ A;  2CMN A;  2R9X A;  1X0O A;  3SW1 A;  4P6B A;  3CJM A;  1OJ5 A;  3PBN A;  1L0D A;  3SS5 A;  1GHP A;  5CX7 A;  1Q2P A;  3PXP A;  1Z09 A;  1FIK A;  3F1O B;  4EBL A;  1XPB A;  4R3A A;  2KOI A;  3S7O A;  4HES A;  3NJA A;  3MQO A;  2W1T A;  3UE0 A;  3T4J A;  1JTG A;  5EVE A;  5F5Y A;  5MC7 A;  1YLT A;  3VMA A;  5GHZ A;  5DFY A;  4U3T A;  5EPH A;  3KX0 X;  5JYP A;  1YAX A;  3BQA A;  3T1Q B;  5F83 A;  3R4K A;  1LSV A;  1ES5 A;  4LV3 A;  3GR2 A;  3WS4 A;  3A3D A;  3JVU A;  1DP9 A;  2QWS A;  5EVI A;  1EWZ A;  1YSP A;  4B9O A;  4E3O A;  3MZF A;  3R7W A;  3S22 A;  1N9O A;  1VQQ A;  4AFI A;  2PDR A;  1JVJ A;  2XA7 S;  3LFV A;  3HLC A;  4KZB A;  3LIC A;  4M3K A;  3M2J A;  2ZQA A;  4QU3 A;  3CUE A;  1S1Y A;  4OPR A;  5AVF A;  2QYB A;  3IWO A;  2JCH A;  1G68 A;  2VV7 A;  4X55 A;  1U60 A;  2ZC7 A;  3T4L A;  3ZNT A;  4X1M A;  5FEG A;  3S7P A;  3A3J A;  2EX9 A;  4MN6 A;  1XKZ A;  2KLI A;  5FI6 A;  4PKY A;  3UMD A;  1LL9 A;  1OJG A;  3PTE A;  2JN7 A;  3DAV A;  3MXR A;  5L2F A;  2AVX A;  5FQK A;  4MLL A;  4II7 A;  1VEU B;  2W3H A;  4OLG A;  1K6S A;  3Q7V A;  2JKG A;  2WAD A;  4R4S A;  3ZHH A;  4S2K A;  3IF5 A;  4GKU A;  3VFF A;  1SKO B;  4YWZ A;  3RTY A;  4N9L A;  4OQH A;  1E3U D;  3W4P A;  4ZTK A;  2K7S A;  5AJG A;  4IBR A;  1FSY A;  4OP8 A;  2NUP C;  1LI0 A;  3I7J A;  1K55 A;  2GNX A;  5EVL A;  1MZU A;  4XUZ A;  4S2I A;  2Z6C A;  4I3A A;  4HP9 A;  4JLF A;  2HGV A;  1PNE A;  1D7E A;  4EEP A;  4X68 A;  4EQI A;  3V39 A;  4FH4 A;  3C7U A;  3LIE A;  2Y2K A;  4BL3 A;  4BEN A;  4R0Q A;  4LRZ E;  5F68 A;  4DMZ A;  3HUM A;  4HBT A;  3S1Y A;  4EQ1 A;  4HY8 A;  1WA9 A;  3VFH A;  1ODV A;  1CI8 A;  1G5U A;  2X71 A;  4GD8 A;  5F82 A;  3T4K A;  2PU4 A;  1ERO A;  2B95 A;  4IUK A;  1NYY A;  4OOL A;  2XRO A;  3G4P A;  5FDH A;  2WUQ A;  3JVV A;  5HAR A;  1S1Z A;  2VV6 A;  3OPR A;  1YM1 A;  1PW8 A;  1NWZ A;  3ZG8 B;  1L2S A;  4NXG A;  3QP2 A;  5IS1 A;  3DWK A;  1RGZ A;  3TSG A;  4HHD A;  5K5B A;  2VGJ A;  1GSV A;  1OTA A;  2P9V A;  2W0N A;  5CHJ A;  4ETX A;  1GSX A;  2J3T D;  3B3X A;  3FPW A;  3UPO A;  3MF0 A;  4HNB A;  3U2A A;  3CI6 A;  5EOO A;  5CEC A;  3N7W A;  5DKK A;  4Q0J A;  1XP4 A;  3BRM A;  2GZA A;  4KZ7 A;  1MWS A;  3BFE A;  3N4I A;  2J3T C;  4ZJ1 A;  3OPP A;  5HFO A;  3BJN A;  4OQ0 A;  2QMI A;  2VEA A;  1KOU A;  4QJG A;  3HLB A;  1DJA A;  5DTT A;  4BQM A;  2P7J A;  4JF4 A;  5BOH A;  3MKE A;  1EI5 A;  3SZT A;  3EQU A;  4MBH A;  3E98 A;  4GB7 A;  3NBL A;  3OPL A;  4ARZ B;  4CLC D;  2WKR A;  3MZE A;  4RX3 A;  4QHC A;  5HX9 A;  2Y2M A;  1ALQ A;  4D2O A;  1Q2Q A;  1N4O A;  5FQJ A;  2Y2J A;  1YKD A;  4EWF A;  5HL1 A;  1FR1 A;  2B18 A;  2ZOH A;  3UDI A;  4HJ6 A;  3ITA A;  3W4Q A;  2P04 A;  2A24 A;  2W3F A;  3WRZ A;  1LHY A;  1LL8 A;  4ZDX A;  3MKF A;  4Z9Q A;  2H0T A;  4CLC C;  4UA6 A;  2A3U A;  2G2W A;  2PR6 A;  2J9P A;  3LYX A;  2B5R A;  3HJI A;  5A92 A;  5HSQ A;  4KZA A;  1W5D A;  3D72 A;  2XF3 A;  4LPZ A;  3EQV A;  3F1N B;  3V3R A;  3OLO A;  4GZB A;  2ZM8 A;  2W1R A;  4K91 A;  1BYW A;  5FAT A;  3OC2 A;  2ZMV A;  3WS1 A;  3BLM A;  5HAI A;  5CED A;  3G2Z A;  5DTS A;  1OTD A;  1TS0 A;  2FFF B;  3BYD A;  5F1F A;  3GQZ A;  1W7F A;  3UNW A;  3GEC A;  3S7N A;  4LGW A;  2A49 A;  4JGP A;  1K56 A;  1P9W A;  5IT5 A;  3V3S A;  4P87 A;  3Q07 A;  4P0M A;  5J4E A;  1PWG A;  3HUO A;  4I39 A;  5A90 A;  4FSF A;  4L9G A;  4S2M A;  3FPV A;  3FWL A;  3LR4 A;  2JE5 A;  5CGW A;  1H5X A;  5CGX A;  3U4L P;  4HI4 A;  3O5Y A;  1PWD A;  2QPN A;  3VP4 A;  4GNU A;  1ESI A;  4IHQ A;  4E6X A;  4GHI B;  4GN2 A;  2OLU A;  3ZGA B;  4WM9 A;  5DJU A;  2PBD P;  2ZD8 A;  3BY8 A;  2GJ3 A;  4F94 A;  5FEF A;  3A0V A;  5EUA A;  2HJ9 C;  2EA9 A;  3HLW A;  3UO9 A;  3C7V A;  3C4O A;  1QMF A;  4GW9 A;  3MQQ A;  1K38 A;  5F69 A;  2ZQ9 A;  1S0W A;  1XGI A;  1QME A;  4LLO B;  5F6A A;  1BSG A;  4BL2 A;  5FL3 A;  4E3I A;  1XJ6 A;  5F1G A;  4ZBE A;  3ZCZ A;  3SH9 A;  2OWH A;  5D3O A;  1GHM A;  2GDN A;  3DWZ A;  2HZ5 A;  3E4P A;  4GLQ A;  4PM7 A;  3V67 A;  3ZYT A;  4WZ5 A;  1ZC2 A;  2J7V A;  3LCE A;  3ZG9 B;  2HP9 A;  1JWZ A;  1AWI A;  4B4Z A;  3FKV A;  1SKO A;  4GJ4 A;  1K4E A;  4GDN A;  4K08 A;  2OOL A;  3LUQ A;  2UV0 E;  4DJ2 A;  1JTD A;  4CPK A;  4L9F A;  5HAP A;  3T50 A;  3F1P B;  1K54 C;  4MMN A;  5AQB A;  3HUN A;  3IWI A;  4F3L B;  3SH8 A;  3CAX A;  2HJE A;  1IYP A;  5FA7 A;  2Y4A A;  3FV7 A;  5CXW A;  4H6J B;  3KSF A;  3VE4 A;  4N9K A;  3BLS A;  1C3B A;  1IEM A;  2HP6 A;  2ZL1 A;  4BBV A;  4S2N C;  2D02 A;  3EWK A;  1IEL A;  4R23 A;  5GLA A;  4X25 A;  1H8Z A;  3DTE A;  1HVB A;  4GDB A;  1NZU A;  2ZMF A;  2Q0O A;  1K57 C;  4WMC D;  4NET A;  3QP6 A;  5HZH A;  3B42 A;  3M6B A;  5G4Y A;  5AQ7 A;  3A3I A;  3KO6 A;  5CHU A;  2HF6 A;  4OOY A;  2W3E A;  5HWT A;  1YT4 A;  4ZAM A;  1RGY A;  4CLC B;  4HOI A;  5EEC A;  2VK3 A;  3G2Y A;  5FQI A;  1CF0 A;  3UPN A;  2VGL M;  1DY6 A;  2PT7 A;  4LCM A;  1DRM A;  2WGV A;  3H7W B;  4UQI M;  3GMW A;  3VP0 A;  4BLM A;  2XDM A;  5DVA A;  3G31 A;  3CMZ A;  3OPH A;  4UEY A;  2XD5 A;  5EM0 A;  4Y15 A;  2XGN A;  5CEB A;  1V9Z A;  1KDW A;  4ETZ A;  1YSQ A;  3TRC A;  4GS9 B;  4LFU A;  4IUH A;  4Q0H A;  5L10 A;  4NK3 A;  1FIL A;  1SKF A;  5E2F A;  4LRY C;  1XA7 A;  5HDS A;  3GSG A;  5C5K A;  1MBL A;  3UDX A;  3E4Q A;  3M2K A;  1M40 A;  1E4D A;  4DE3 A;  3HLG A;  4KG5 A;  5KMW A;  3UE1 A;  5FQ9 A;  1YLJ A;  1F5M A;  3HBR A;  4DXB A;  2OLV A;  4IVI A;  3TOI A;  4EW7 A;  1DJC A;  2H5S A;  2JKF A;  3K3C A;  1PW1 A;  4M4X A;  3FG8 A;  2PRF A;  5DKL A;  3QP5 A;  4OP5 A;  3ZG7 B;  3IS2 A;  2BLS A;  1JNU A;  2JKR I;  3VSL A;  3D3O A;  1BLH A;  2PR5 A;  5EVI D;  3Q82 A;  3BM6 A;  4FH2 A;  5FDS A;  5M1A A;  1F9I A;  1ES3 A;  2L4R A;  3LIB A;  3AGE A;  1XA1 A;  2PYP A;  3BW6 A;  4RX2 A;  5CTM A;  4MN5 A;  2ZM2 A;  4EES A;  3GV9 A;  4DXC A;  2R9W A;  5E43 A;  4ZRR A;  1Y4O A;  1BLS A;  2VV8 A;  3IXG A;  1YPR A;  2VJW A;  4Q8I A;  2HDS A;  5EVI C;  3IX4 A;  1G6A A;  2FFY A;  2H0Y A;  4DDS A;  4IVK A;  3PR6 A;  4S2J A;  4Z1W A;  2HDR A;  2V1Z A;  3KSG A;  3ZVT A;  5AQ9 A;  2X01 A;  4JXV A;  2WKI A;  1VHM A;  3WS0 A;  1KE3 A;  2VGK A;  2WGW B;  3WWX A;  2HP5 A;  2C5W B;  1ACF A;  3KSI A;  4I5S A;  1XX2 A;  1Y54 A;  5M19 A;  2Z2M B;  4OKP A;  5DF8 A;  1UWN X;  3MXQ A;  2Y2N A;  2WYX A;  3CIT A;  4QY5 A;  3ISG A;  1W8Q A;  3QNC A;  1N9N A;  3S4X A;  1VM1 A;  5KZH A;  3SH7 A;  3BY9 A;  4UAA A;  4EBP A;  4CQH A;  4KQR A;  4FCF A;  3ZVW A;  2C6W B;  3CLO A;  1LI9 A;  4WEL A;  2DNS A;  1NXY A;  3LEQ A;  5FAO A;  2WKQ A;  4WBG A;  1PWC A;  1FQG A;  1SHV A;  4Y2F A;  3ZQ5 A;  4WEK A;  2INW A;  3MR0 A;  4XT2 B;  3IHA A;  3EGD C;  4EUZ A;  1N9L A;  4KZ3 A;  4LV2 A;  1E25 A;  2HV1 A;  3T1R A;  3HJK A;  1MKI A;  3GVB A;  3H82 B;  1ES2 A;  3QNB A;  4R6L A;  1KVL A;  4KZ4 A;  1XJ4 A;  5HW3 A;  2WAF A;  4S2L A;  5U47 A;  3A3F A;  4MDZ A;  5E2H A;  2YKH A;  1F2K A;  1JWP A;  2LB9 A;  5FSR A;  2QZ6 A;  1G6O A;  2Y79 A;  5FAS A;  2KDK A;  2PAV P;  3CG5 A;  3G30 A;  1NLY A;  4UHU A;  5J3W A;  3BFC A;  1ES4 A;  5TGF A;  1HD8 A;  1Y28 A;  2GX5 A;  3LR3 A;  3WS5 A;  2Q9M A;  4GD6 A;  4WF0 A;  3F1P A;  4Y3I A;  4WN5 A;  5GLC A;  3O88 A;  1PI4 A;  5G4Z A;  1K25 A;  4F3L A;  2V8C A;  3LY3 A;  4ZJ2 A;  5KSC A;  4ME4 A;  3MBZ A;  3NIA A;  4YIN A;  2OV5 A;  2WKP A;  3W4O A;  2V1B A;  4WZ4 A;  1S66 L;  3UB6 A;  3AGF A;  1NYM A;  2IWC A;  3W2Z A;  1D1J A;  3CPT A;  4DDY A;  3LGO A;  5GLB A;  2V20 A;  4LV1 A;  2W1T B;  3IWQ A;  2PHY A;  3WS2 A;  2M7U A;  3Q7Z A;  3MMH A;  5CRF A;  1EW0 A;  3MXS A;  4Y7P A;  1W63 Q;  1MKM A;  5HPF A;  5L07 A;  1CI9 A;  1TS6 A;  4B4X A;  1LSX A;  4E04 A;  1CQA A;  3HVF A;  1BLP A;  4LEN A;  1VET A;  5EVI B;  1XJ2 A;  4C6Y A;  4WEJ A;  3LIF A;  3E4O A;  4Y17 A;  2M1C A;  5TFQ A;  3QP1 A;  4BWI A;  3NI9 A;  2FZ0 A;  1S67 L;  4LV0 A;  1GCE A;  4E3M A;  3E2L A;  5L09 A;  4MBF A;  1NJ4 A;  4OPY A;  5EFW A;  4X1L A;  1PFL A;  4O0P A;  3O86 A;  4G3V A;  4KUO A;  5J7E A;  1P0Z A;  4JGO A;  3NOP C;  2ZBB A;  4IED A;  1BT5 A;  4RYE A;  5HWV A;  3F1O A;  2B02 A;  3FYZ A;  1KVM A;  3A0R A;  3RJU A;  4RA7 A;  1WYB A;  4PM5 A;  5A91 A;  2JKT I;  4DE2 A;  1HLU P;  2BAS A;  5AQA A;  4FOF A;  1PRQ A;  4I38 A;  1GA9 A;  3ZNY A;  3V50 A;  1L0E A;  1WYC A;  3Q7V B;  5A8B A;  3C2W A;  4FD8 A;  2Y8H A;  1K56 D;  3GDI A;  4O7D A;  4FUW A;  1T1C A;  1OTE A;  5FAP A;  2XK1 A;  2ZC6 B;  3T4O A;  2WAE A;  4EV4 A;  4KZ9 A;  4JXS A;  3Q81 A;  3UB5 P;  5FAQ A;  3VP3 A;  3BWL A;  1S4R A;  2JBF A;  2Y2I A;  3PBQ A;  5E2G A;  3P7N A;  3IHB A;  2FH5 A;  4XXR A;  1XFQ A;  4KZ8 A;  2HPB A;  4K0W A;  2HDU A;  2ZQD A;  3LY4 A;  1T18 A;  4NEE D;  4P6Z M;  3OCN A;  2O9C A;  2Y2P A;  2PU2 A;  4N92 A;  3LR0 A;  2X02 A;  1CJF A;  2Y55 A;  1STZ A;  4FTX A;  4UA9 A;  2XEP A;  4X6T A;  3P98 A;  1BLC A;  3G35 A;  3NOT C;  3PAE A;  1YLY A;  2VX8 A;  1S6R A;  1F98 A;  1GHI A;  3HRE A;  2DMW A;  3IXB A;  4KQQ A;  4EEU A;  1PI5 A;  1NZO A;  1PYY A;  1VEU A;  1KE4 A;  2EX6 A;  4PM9 A;  2H10 A;  3T4Q A;  4E3J A;  1K54 A;  1H0M A;  5FQM A;  2I9V A;  5AVE A;  4PKY G;  5TR7 A;  1FR6 A;  1ZTU A;  3IXD A;  1MXO A;  1IFQ A;  4KG2 A;  5CHM A;  1CK3 A;  2V1A A;  2O99 A;  3IXH A;  4G3W A;  2VGL S;  2EWV A;  4KZ6 A;  5HPI A;  4Y0U A;  2I72 A;  4UQI S;  2XRN A;  2M7V A;  4PHT A;  5EV0 A;  1FCN A;  3AGD A;  5GL9 A;  1MC0 A;  4S2N A;  3M6H A;  4WLA A;  5GLD A;  2WKE A;  4DE1 A;  5DJT A;  1TDG A;  5L8M A;  4NXB A;  1A0K A;  1IYS A;  5A93 A;  3PBR A;  2Y91 A;  2O9A A;  2K2N A;  5DF7 A;  3E2K A;  3N6I A;  1XFN A;  3NDG A;  3OCL A;  3KYE A;  1LLB A;  1UWP X;  3WRT A;  4OLD A;  1YMS A;  4O8G A;  2V8F A;  4BJP A;  4HEF A;  1K4F A;  3LI8 A;  4JF6 A;  3UE3 A;  4WUJ A;  2OAP 1;  3MQ0 A;  5DF9 A;  3H82 A;  1G28 A;  1P97 A;  1H3Q A;  3ICY A;  2XFS A;  3UN7 A;  1DP6 A;  4DE0 A;  5DTK A;  1L0F A;  1D06 A;  1RP5 A;  5LBR A;  2Q9N A;  3T4T A;  5I94 A;  3IF6 C;  5FI7 A;  2L1M A;  5CGS A;  3DTK A;  4ESP A;  1LL5 A;  3QP8 A;  2ZOI A;  1M6K A;  4WL9 A;  3EOI A;  4HH2 A;  2PD8 A;  5HL6 A;  3C4P A;  2W3G A;  5HWW A;  3VP1 A;  3PHY A;  1MWR A;  1NY0 A;  5CTN A;  3HLD A;  1TDL A;  4Y0O A;  4KQO A;  2IA2 A;  2ZJ9 A;  1CEF A;  2P74 A;  3A3E A;  2K31 A;  4Y0T A;  3PYP A;  3VOY A;  4EU0 A;  4EXO A;  1S4S A;  2ZC5 B;  4R3B A;  1I5Q A;  1TS7 A;  3C8C A;  4KG6 A;  5EE8 A;  1K0K A;  2QKP A;  3UME A;  3G32 A;  3UDF A;  3HLF A;  3IX3 A;  4PMA A;  4ARZ A;  3GTC A;  3VV4 A;  1OME A;  4N1H A;  4OQG A;  3FC7 A;  5IU1 A;  1I2W A;  2O0Y A;  2OSU A;  2XFT A;  3C38 A;  5HD3 A;  4BD0 A;  4QPR A;  1P9R A;  1AXB A;  4CJN A;  3E0Y A;  4JBF A;  3IH8 A;  3P01 A;  4UA7 A;  2UWX A;  3N8S A;  4NKP A;  3L9K A;  3T4S A;  3TE8 A;  5M18 A;  4OPQ A;  1OT6 A;  1ZG4 A;  3KYZ A;  4JF5 A;  1ZG6 A;  4E3K A;  2JKT M;  1NRJ A;  4MNR A;  3F1N A;  4IJG A;  4KZ5 A;  3N8L A;  2YKF A;  2G2U A;  4JKT A;  4A5R A;  1PIO A;  1L3L A;  3TW8 A;  3NEC A;  4LCL A;  4D60 A;  1YLP A;  3CUE C;  4JGR A;  3NCK A;  1KDS A;  4OOM A;  3NC8 A;  3NDE A;  4OH0 A;  2ZMA A;  3VP2 A;  1NRF A;  2Y2O A;  2V0U A;  4YFM A;  2H28 A;  2XSS A;  3FZC A;  3OZH A;  1MWU A;  5IHV A;  3DTI A;  1E3U A;  2E8I A;  2QJ5 A;  5GHY A;  2OAQ 1;  3BFF A;  2IWB A;  1PZO A;  3SS3 A;  3K2N A;  2P08 A;  4P85 A;  4GCZ A;  3JPU A;  4N1X A;  2MJ6 A;  3OBF A;  3A0S A;  1RCJ A;  2XA7 M;  3RXW A;  3O3V A;  2VKS A;  2HDQ A;  5HDD A;  1W8Y A;  4GHI A;  4E3L A;  3UB7 A;  4ZJ3 A;  1V9Y A;  3Q1F A;  4PAU A;  4S2O A;  2A2L A;  1SCW A;  1CEG A;  1LT0 A;  4I3J A;  5I5L A;  4QY6 A;  3BFD A;  4I3I A;  1K55 C;  2ZL1 B;  2QHK A;  4K0X A;  3NOU C;  2VLG A;  4R38 A;  2DRW A;  3D9Y A;  3VSK A;  1KE0 A;  3NHQ A;  3HCY A;  2J3W A;  3IF6 B;  4U0X A;  2BG1 A;  4HIA A;  4B88 A;  3EEH A;  3G6O A;  3IX8 A;  2IWD A;  1ONH A;  4PPR A;  2EFU A;  3IT9 A;  3DTM A;  3VOZ A;  3PBT A;  2Y2L A;  3BEC A;  2ZM0 A;  3RXX A;  2W3D A;  4U0T A;  5TBM B;  3JYI A;  2Y2Q A;  2Z6D A;  3HL9 A;  3IBR A;  3BFG A;  2EWW A;  1NLZ A;  4X53 A;  4QD4 A;  3TJZ C;  4HH3 A; 
#chains in the Genus database with same CATH homology
 4G3K A;  4LRX C;  3CUE A;  5A8B A;  3C2W A;  3OOV A;  1S1Y A;  5AVF A;  2QYB A;  4BMW A;  2Y8H A;  3GDI A;  2ZMF A;  1T1C A;  2VV7 A;  4RQ9 A;  2PD7 A;  1OTE A;  3T4L A;  3T4O A;  3B42 A;  5G4Y A;  5HZH A;  3KO6 A;  1T1B A;  2HF6 A;  2W3E A;  3S7P A;  3UB9 A;  1LSW A;  4MN6 A;  5HWT A;  3BWL A;  1S4R A;  2KLI A;  3PBQ A;  4H6J A;  2R78 A;  3P7N A;  4PKY A;  2FH5 A;  1OJG A;  3UMD A;  1OT9 A;  4HOI A;  4CLC B;  1XFQ A;  2JN7 A;  1IOU A;  3ULF A;  4MN7 A;  2VGL M;  3C30 A;  2V0W A;  1T18 A;  2PT7 A;  2JHE A;  1DRM A;  4NEE D;  4P6Z M;  4UQI M;  3H7W B;  3OCN A;  4II7 A;  2W3H A;  2O9C A;  3LR0 A;  4UEY A;  4YWZ A;  3RTY A;  1STZ A;  4DN0 A;  3VE3 A;  2K7S A;  5AJG A;  1V9Z A;  1T19 A;  4ETZ A;  1YSQ A;  3KSH A;  3NOT C;  2J80 A;  2NUP C;  3TRC A;  4GS9 B;  2VX8 A;  1F98 A;  4JGQ A;  4CLC A;  4IUH A;  3UB8 A;  2DMW A;  3CWF A;  4Q0H A;  2GNX A;  2OWJ A;  4EEU A;  4LRY C;  1MZU A;  5HDS A;  5C5K A;  3H7W A;  3IS2 B;  2Z6C A;  4I3A A;  4HP9 A;  3E4Q A;  3R7W B;  4MCW A;  3T4Q A;  2HGV A;  1D7E A;  4YNR A;  2I9V A;  5AVE A;  4EEP A;  4PKY G;  1ZTU A;  2VA0 A;  2LB5 A;  1F5M A;  1IFQ A;  3H9W A;  3LIE A;  2V1A A;  4CLC E;  2O99 A;  4G3W A;  4EET B;  2VGL S;  2EWV A;  5HPI A;  4HP4 A;  4EW7 A;  1GSW A;  4GS9 A;  4P6Z S;  4UQI S;  2XRN A;  4HJ4 A;  4LRZ E;  2M7V A;  3K3C A;  5F68 A;  4DMZ A;  4M4X A;  3FG8 A;  4PHT A;  4EQ1 A;  4HY8 A;  1MC0 A;  5DKL A;  1WA9 A;  1TF1 A;  4WLA A;  1ODV A;  2QJ7 A;  3T4K A;  3IS2 A;  3RFB A;  5DJT A;  5HDC A;  1JNU A;  4IUK A;  5L8M A;  2JKR I;  3KYQ A;  3D3O A;  4NXB A;  2PR5 A;  3LID A;  3S7Q A;  4L9E A;  4OOL A;  3PBR A;  2XRO A;  3JVV A;  2O9A A;  1F9I A;  2K2N A;  1S1Z A;  2L4R A;  1H8M A;  2VV6 A;  1XFN A;  3B47 A;  3LIB A;  3OCL A;  1NWZ A;  2JKR M;  1UWP X;  4NXG A;  4BBT A;  2PYP A;  3BW6 A;  4MN5 A;  5IS1 A;  4EES A;  4HHD A;  5K5B A;  4ZRR A;  1GSV A;  1OTA A;  2W0N A;  2VV8 A;  2VJW A;  3EEA A;  4O8G A;  4BJP A;  4ETX A;  5KSH A;  1GSX A;  2J3T D;  1UGU A;  3LI8 A;  3FPW A;  3PBO A;  2V9A A;  3UE3 A;  4WUJ A;  4B93 A;  3MF0 A;  2OAP 1;  2PYR A;  4HNB A;  3MQ0 A;  3U2A A;  1VB6 A;  3CI6 A;  1G28 A;  3H82 A;  5DF9 A;  2NUT C;  4HQA A;  3PR6 A;  4Z1W A;  1P97 A;  4YOF A;  3KSG A;  1H3Q A;  3ICY A;  1DP8 A;  1VHM A;  2VZW A;  1DP6 A;  3LR5 A;  5DKK A;  4Q0J A;  3KSI A;  1D06 A;  2GZA A;  4I5S A;  5LBR A;  3T4T A;  5KIZ A;  2J3T C;  1UWN X;  3MXQ A;  4HJ3 A;  3BJN A;  2L1M A;  2ZOI A;  5HD5 A;  4WL9 A;  2VEA A;  3CIT A;  1KOU A;  3EOI A;  4KQD A;  4HH2 A;  3RH8 B;  4BBU A;  2L0W A;  2P7J A;  1N9N A;  2PD8 A;  5HL6 A;  2W3G A;  3BY9 A;  3LIA A;  5HWW A;  4CQH A;  3PHY A;  3EQU A;  3VOL A;  3E98 A;  1OPX A;  3CLO A;  4ARZ B;  4CLC D;  2WKR A;  4WEL A;  3MFX A;  4KQO A;  2WKQ A;  2IA2 A;  1OTB A;  2K31 A;  3PYP A;  4EU0 A;  4EXO A;  1S4S A;  3UE6 A;  3BQ8 A;  1YKD A;  1TS7 A;  3C8C A;  2ZOH A;  2B18 A;  4Y2F A;  3ZQ5 A;  1TS8 A;  4HJ6 A;  4WEK A;  2INW A;  2P04 A;  2A24 A;  2W3F A;  2QKP A;  3MR0 A;  3EGX C;  4XT2 B;  1LL8 A;  3UME A;  3EGD C;  1N9L A;  2O9B A;  4CLC C;  1TD5 A;  4L0L A;  2HV1 A;  5TJJ A;  2PR6 A;  4ARZ A;  3LYX A;  3HJI A;  3HJK A;  3VV4 A;  5HSQ A;  4Y5F A;  2KX6 A;  3FC7 A;  3K3D A;  5IU1 A;  3D72 A;  3H82 B;  4LPZ A;  3EQV A;  3F1N B;  4R6L A;  2O0Y A;  3OLO A;  1XJ4 A;  3C38 A;  3DBA A;  2W1R A;  5HD3 A;  1BYW A;  4QPR A;  3OC2 A;  1P9R A;  2ZMV A;  4MDZ A;  3MJQ A;  2YKH A;  1W63 M;  3E0Y A;  4XT2 A;  2LB9 A;  1OTD A;  1TS0 A;  1G6O A;  2Y79 A;  2KDK A;  3P01 A;  2D01 A;  1NLY A;  1ZHH B;  5J3W A;  3GEC A;  4NKP A;  4EUV A;  3S7N A;  2G7U A;  4KUK A;  2W27 A;  4JGP A;  3IBJ A;  1Y28 A;  4DJ3 A;  1P9W A;  5IT5 A;  3T4S A;  3TE8 A;  2GX5 A;  3LR3 A;  1OT6 A;  5J4E A;  3KYZ A;  4WF0 A;  4I39 A;  2JKT M;  1NRJ A;  3F1N A;  4FSF A;  4IJG A;  4L9G A;  3F1P A;  4Y3I A;  2YKF A;  4WN5 A;  3FPV A;  3LR4 A;  4Q0I A;  5G4Z A;  1XJ3 A;  3TW8 A;  4F3L A;  4O01 A;  3CUE C;  3LI9 A;  4ME4 A;  4HI4 A;  3B33 A;  3O5Y A;  4JGR A;  2WKP A;  2V1B A;  1S66 L;  3UB6 A;  1OTI A;  4IHQ A;  3PBS A;  5TBM A;  4OOM A;  4EER A;  4NXE A;  4GHI B;  5DJU A;  3W2Z A;  3BY8 A;  4NXF A;  2GJ3 A;  2V0U A;  2H28 A;  2A24 B;  2XSS A;  3A0V A;  2HJ9 C;  2EA9 A;  4R70 A;  2W1T B;  2QJ5 A;  2PHY A;  1T1A A;  2M7U A;  3MMH A;  2OAQ 1;  1EW0 A;  5DFX A;  3K2N A;  2P08 A;  2CMN A;  4GW9 A;  4GCZ A;  3MQQ A;  5F69 A;  1W63 Q;  2MJ6 A;  3OBF A;  1MKM A;  1X0O A;  3A0S A;  5HPF A;  3SW1 A;  1TS6 A;  4LLO B;  5F6A A;  1OJ5 A;  3PBN A;  1LSX A;  4E04 A;  2XA7 M;  5FL3 A;  5CX7 A;  2VKS A;  1XJ6 A;  3PXP A;  5HDD A;  4GHI A;  3F1O B;  2OWH A;  3UB7 A;  1XJ2 A;  1V9Y A;  4WEJ A;  3LIF A;  3E4O A;  4R3A A;  3E4P A;  4GLQ A;  4PAU A;  2KOI A;  3S7O A;  2M1C A;  4BWI A;  3NJA A;  2A2L A;  2W1T A;  2FZ0 A;  1S67 L;  1LT0 A;  3MQO A;  4I3J A;  5I5L A;  3V67 A;  3ZYT A;  3T4J A;  5F5Y A;  4I3I A;  5MC7 A;  2QHK A;  4GJ4 A;  3NOU C;  2VLG A;  5DFY A;  3KX0 X;  4R38 A;  4K08 A;  2OOL A;  1YAX A;  3BQA A;  3LUQ A;  3R4K A;  4DJ2 A;  5EFW A;  3NHQ A;  4O0P A;  1LSV A;  4G3V A;  3HCY A;  4L9F A;  4KUO A;  2J3W A;  3T50 A;  5J7E A;  3F1P B;  1P0Z A;  4HIA A;  3NOP C;  4JGO A;  2ZBB A;  4MMN A;  5HWV A;  3JVU A;  3EEH A;  1DP9 A;  2QWS A;  3F1O A;  3G6O A;  2B02 A;  3A0R A;  4F3L B;  3CAX A;  2HJE A;  1YSP A;  4B9O A;  2JKT I;  3PBT A;  4H6J B;  3R7W A;  3KSF A;  1N9O A;  3VE4 A;  4AFI A;  2BAS A;  2W3D A;  2PDR A;  4FOF A;  5TBM B;  2XA7 S;  2Z6D A;  3LFV A;  4I38 A;  4BBV A;  2D02 A;  3IBR A;  2EWW A;  1NLZ A;  3EWK A;  3LIC A;  3TJZ C;  4HH3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...