2PR6A

Structural basis for light-dependent signaling in the dimeric lov photosensor ytva (light structure)
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
128
structure length
128
Chain Sequence
LDHVRVGVVITDPALEDNPIVYVNQGFVQMTGYETEEILGKNCRFLQGKHTDPAEVDNIRTALQNKEPVTVQIQNYKKDGTMFWNELNIDPMEIEDKTYFVGIQNDITKQKEYEKLLEDSLTEITALS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Blue-light photoreceptor
publication title Structural Basis for Light-dependent Signaling in the Dimeric LOV Domain of the Photosensor YtvA.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Flavoprotein, signaling protein
total genus 42
structure length 128
sequence length 128
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13426 PAS_9 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2pr6A00
4BBTA 2H28A 5HSQA 1LSVA 3C8CA 3F1PB 2Z6DA 4F3LA 3UE6A 2ZBBA 1VB6A 2A24A 4WUJA 2W27A 1OT6A 3LIEA 1DP9A 4I3IA 4HNBA 1S67L 1XJ3A 3F1NB 3EEHA 2M1CA 1DP6A 2GJ3A 3HJKA 2BASA 3C2WA 1LSWA 1OJGA 3PHYA 4HHDA 3UMDA 5J7EA 5AVEA 2V1BA 3ICYA 1TS7A 3CLOA 3F1NA 5HDSA 5G4ZA 5AVFA 2I9VA 4HY8A 1TS6A 1T1AA 4WF0A 2CMNA 5G4YA 3LIAA 4JGRA 2WKRA 3GECA 1DP8A 3H9WA 4R3AA 1S1ZA 3NJAA 1OTDA 4R70A 1OJ5A 3A0VA 2WKQA 4PKYG 2QKPA 3LIDA 5IS1A 4L9GA 3KX0X 1BYWA 3MFXA 4BBUA 4K08A 2INWA 3H7WB 4RQ9A 2JN7A 4I3AA 5TBMA 4HJ3A 3NOUC 2PR6A 2QHKA 2P7JA 2VV7A 3BY8A 2L1MA 4WL9A 1D7EA 3T50A 1T19A 4LPZA 4DJ2A 3H7WA 4EEPA 4EERA 4EQ1A 2L0WA 1XFQA 3LI9A 2Z6CA 3GDIA 2PD8A 3BWLA 4LRXC 5DKKA 5F6AA 1S4RA 4HJ4A 4HQAA 1T1CA 1Y28A 2D01A 2V1AA 3B33A 4GCZA 2K7SA 2ZOHA 1TS8A 3VE4A 2B02A 4LRYC 2QJ5A 1XJ4A 3NOTC 3RH8B 3F1PA 3RTYA 1F98A 3VOLA 1GSVA 3ZQ5A 1P0ZA 3E4PA 3D72A 4KUOA 4NXGA 3UB6A 4JGPA 2PHYA 3IBRA 4E04A 4XT2B 4EW7A 3MQOA 2HV1A 3VE3A 3EWKA 4GHIB 2YKFA 1N9NA 2WKPA 2L4RA 3NOPC 1S4SA 1D06A 4WLAA 1TS0A 3FG8A 1UWPX 4HP4A 1WA9A 2PDRA 4GHIA 1F9IA 1OTBA 4GW9A 2KX6A 1EW0A 3UMEA 3LI8A 4H6JB 5EFWA 1X0OA 3K3CA 1LT0A 4HI4A 4NXFA 1LL8A 1T18A 4NXEA 1GSWA 3F1OB 1MZUA 3CAXA 1S1YA 3LIBA 3IS2B 2OWJA 2V0WA 4R38A 5HWVA 1DRMA 4I38A 5DKLA 5J3WA 1XJ6A 4LRZE 1G28A 5HWTA 3H82B 5HD3A 3FC7A 2R78A 3E4OA 4LLOB 4DJ3A 4GS9B 4BBVA 3UB8A 1S66L 4YWZA 3H82A 4M4XA 2VV8A 5A8BA 4PKYA 4F3LB 4HIAA 3K3DA 3SW1A 2VV6A 3G6OA 4GS9A 4L9FA 1T1BA 5J4EA 5DJTA 4JGQA 4JGOA 2V0UA 5I5LA 2JHEA 1P97A 3NHQA 1OT9A 4NXBA 1XJ2A 3UB7A 2OWHA 3P7NA 3MXQA 2PYRA 3A0SA 1V9YA 4HH2A 2VEAA 2J80A 1NWZA 3A0RA 3PYPA 4R6LA 4XT2A 1XFNA 4EESA 1OTIA 1LSXA 4B9OA 1UGUA 3LYXA 2W0NA 2QJ7A 4HH3A 1OTAA 2QWSA 1ODVA 3LIFA 4I3JA 3HJIA 1UWNX 5HDCA 4EEUA 2EA9A 4MN6A 1V9ZA 1JNUA 2PYPA 3OLOA 5HWWA 3BY9A 4H6JA 2ZOIA 5TBMB 4KQDA 2PD7A 3LUQA 3MQQA 4I39A 4EXOA 4HOIA 2VLGA 4WN5A 3MR0A 2D02A 4L9EA 5DJUA 3F1OA 4I5SA 5HDDA 1N9LA 3IS2A 4HP9A 1GSXA 3MJQA 3E4QA 4MN5A 5KIZA 1KOUA 5F69A 1OTEA 4KUKA 5HZHA 3UB9A 2YKHA 1N9OA 3LICA 5IU1A 3ULFA 2OOLA 5HD5A 2KDKA 5F68A 4HJ6A 5F5YA 2PR5A 2V9AA 4EETB 3CWFA 2A24B
chains in the Genus database with same CATH superfamily
2H28A 4OKPA 3JPUA 2ZC4B 5HSQA 4B88A 4LCMA 3BW6A 2Y91A 2J7VA 1JWZA 5BOHA 4WUJA 2K31A 4P87A 1XPBA 2W27A 2WZXA 2QZ6A 3IXBA 3VSLA 3HLCA 1J3WA 1S67L 3A3DA 1AXBA 3QNCA 3EEHA 4QB8A 3HJKA 2V1ZA 1NLZA 2BASA 2O99A 5FA7A 3A3EA 2WGVA 4LV2A 2XK1A 3UMDA 2VGJA 2V1BA 1BLSA 3CHWP 1N9BA 1NRFA 3CLOA 1IEMA 3F1NA 2R9WA 5G4ZA 1ESUA 3HLDA 4UHUA 4ZJ3A 3VP3A 1Y4OA 3Q1FA 3IXHA 2HP9A 1BLHA 1GCEA 3IT9A 1W8YA 4GDNA 1E3UA 3H9WA 4R3AA 4Q0HA 1KE4A 1S6RA 3KSIA 4E3MA 3C38A 2OAQ1 3LIDA 4X53A 4JF6A 3KX0X 4WMCD 1BYWA 4ESPA 4EU0A 1H8MA 2INWA 4KZ9A 3H7WB 4O01A 4I3AA 1O07A 3CPTB 5TBMA 1E25A 3V39A 2XEPA 2J8YA 5CEDA 3AGFA 2QHKA 2P7JA 2EX9A 1SKOA 4LPZA 2JC7A 4Z1WA 1MKMA 4OPZA 4E6WA 5EV0A 3CJMA 1IYOA 3GDIA 4P0MA 5F6AA 1S4RA 5DVAA 2PT7A 4KZAA 5EVID 3O86A 1FILA 1GHMA 4OOLA 2D01A 3DTEA 4IUHA 3T1QB 4ZTKA 4UAAA 4GCZA 4OPRA 3U2AA 4EUZA 2JE5A 2WKIA 3MBZA 3GVBA 2JCHA 1MY8A 3C4PA 1TS8A 3MZFA 1VEUB 3EGDC 4QD4A 2QJ5A 3MKFA 3GRJA 3F1PA 4IVIA 1ES2A 2FZ0A 2CC1A 3NECA 1PZOA 4KUOA 3UB6A 4DRTA 2J3TC 3ISGA 1MWUA 5GLCA 1PZPA 4MLLA 5CERA 5KZHA 5GHYA 4BMWA 3VP2A 3VE3A 5FQMA 3OPHA 4RA7A 4GHIB 4C75A 2A3UA 1N9NA 3VP0A 2L4RA 5HPIA 3TG9A 3D3OA 2ZL1A 5E43A 4FTXA 4WLAA 4R0QA 1TS0A 4E3JA 3VFHA 1K4FA 1S0WA 4HP4A 1YLTA 3SH8A 2B5RA 3RXWA 4KZ4A 2KX6A 3Q81A 5L09A 3UMEA 3ZNTA 3LI8A 1PFLA 3QNBA 2OAP1 2XDMA 3TE8A 4OVDA 1JVJA 1ONHA 4Y13A 3IF6A 2RCXA 1PI5A 1X0OA 1XXMA 3T4QA 3K3CA 5IT5A 2V20A 4F94A 5EOEA 1F5MA 3BECA 3IWOA 3OC2A 1T18A 2VGLM 4Q8IA 1IELA 4NKPA 1GSWA 2ACGA 3IHAA 3F1OB 5DTSA 2QPNA 3CAXA 2M7UA 1S1YA 2XSSA 1H5XA 3IS2B 2V0WA 4R38A 1VETA 4WBGA 1M40A 1XJ6A 1TD5A 3ZG8B 4WZ4A 1SHVA 2LB5A 1W5DA 3E2KA 5I94A 4NEED 1MC0A 1I2WA 2KOIA 4BBVA 1S66L 5CHJA 5FI2A 2VK3A 5U47A 3P09A 1NY0A 4M4XA 3LCEA 4Z9QA 3SW1A 4X68A 3G6OA 1RP5A 2ZMAA 4P6ZM 4KZ6A 1Q2QA 2B95A 4AFIA 4JGOA 5I5LA 4NETA 5MC7A 1BT5A 3SH7A 3NDGA 4KQOA 2ZC3B 2ZM0A 3C4OA 1OT9A 2G2UA 3SS5A 4E3NA 3W4QA 4CPKA 4WMCA 3UB7A 3DWKA 5M18A 3MXQA 3G2YA 1WE4A 1U60A 4Y3IA 4B4XA 2A2LA 2EX6A 2WGIA 1GHPA 2WKHA 2ZQDA 1NYMA 1NWZA 3O5YA 2GZAA 1XFNA 3M6HA 5CHMA 5DFXA 2JKGA 4B9OA 3BQAA 4BD0A 1UGUA 2P9VA 3FV7A 4Y15A 5GHZA 3BM6A 3CZDA 2B18A 4GD6A 1ODVA 1HZOA 3GQZA 4I3JA 3HJIA 5CTNA 4X55A 2HJEA 3HVFA 3R7WA 1YSQA 5CHUA 1IOUA 1JNUA 1MXOA 2PYPA 3ZG5A 3VV4A 1WYCA 1XGJA 3WRTA 3UN7A 4ZRRA 4OQHA 4H6JA 2X71A 5E2HA 2DNSA 4KQDA 1H8YA 2VKSA 3I7JA 2P04A 3BQ8A 3LY4A 2X02A 2WAFA 4I39A 5CTMA 4EXOA 3NDEA 2OLVA 4GNUA 4BL3A 3UO9A 4U0TA 3V5MA 2D02A 1K54A 3ZVWA 2Y2QA 5FQKA 2EWVA 2WGWA 1N9LA 1L2SA 2BTFP 2HZ5A 3ZFZA 5KIZA 4E3LA 5F69A 4BL2A 3UNWA 5HZHA 3UB9A 2YKHA 1ES3A 3LICA 5IU1A 2Z2MB 3WS2A 1IYQA 3ZG7B 4IBXA 3Q7VA 1CI8A 4YFMA 4LV1A 1E3UD 5F5YA 2W3HA 2V9AA 1TF1A 1PIOA 1DY6A 1K55C 3S1YA 2LB9A 1RCJA 1LSVA 3LY3A 3NCKA 5CGXA 3ZG0A 4F3LA 3UE6A 2A24A 2W1TA 1P9WA 3EQUA 3MQ0A 5TJJA 1W79A 2FFFB 1TDGA 1OT6A 3O88A 1O7EA 3LIEA 2XFSA 4IUKA 3FPVA 1DP9A 3MMHA 3PBNA 3S7PA 3UDXA 3IXDA 3PR6A 2XRNA 3C2WA 1LSWA 3PHYA 3CI6A 2ZQAA 4DE0A 2PAVP 2W3EA 1G6OA 4S2KA 3ICYA 3O3VA 2I9VA 2ZC6B 3HLBA 4HY8A 3FWLA 4LCLA 1F2KA 1T1AA 1K25A 3Q7ZA 1KGFA 2J3WA 3N8LA 4NK3A 1FIKA 1CK3A 5L8MA 4UA7A 3T4KA 3BFDA 2X01A 2WKRA 3UDFA 4KENB 5FQQA 4E3OA 1OTDA 2NUPC 1OJ5A 3A0VA 2HJ9C 2VZWA 3HUNA 4EBPA 1MWTA 2WKQA 5IS1A 1W7FA 1A0KA 3MFXA 3S7NA 3VOYA 4K08A 4BBUA 3V3SA 1SDEA 3W4OA 4RQ9A 2JN7A 2A49A 4HJ3A 4PM6A 4X25A 2VV7A 2JKFA 1D7EA 4UEYA 1K57A 3BYDA 1BUEA 4DJ2A 4GKUA 3H7WA 4EEPA 3S22A 4FOFA 1CQAA 2PD8A 2ZM8A 1LI9A 3EGXC 1FSYA 3NY4A 4MMNA 1Y28A 4OQIA 3IWIA 4YOFA 2EFXA 2WADA 3P01A 3K2NA 5CRFA 4R4RA 3A3IA 1JWPA 5HAIA 4S2NA 3WWXA 5HPFA 3FKWA 2Y55A 4LRYC 4JXSA 3UE0A 2Y2IA 4JPMA 1XJ4A 3VSKA 3NULA 1GSVA 3ZQ5A 1P0ZA 3E4PA 3BFEA 3DBAA 5HAPA 4NXGA 1PW8A 4JGPA 3DW0A 1WYBA 4JKTA 3ZGAB 2VGKA 4D60A 4ARZA 3LO7A 1XKZA 2VX8A 3LR0A 5L2FA 4DE3A 4ME4A 5E2EA 2WKPA 4QWOA 2ZQCA 4Y0UA 4B4ZA 3G34A 2PDRA 1GA9A 4GHIA 1F9IA 4E6XA 4GW9A 4QHCA 1SCWA 4EQIA 3QP6A 3LGOA 2PRFA 2NUTC 2Y8HA 5GLAA 5EM0A 3LR5A 3OOVA 5CECA 1DJAA 1YPRA 3DTIA 3E0YA 5FDSA 1IYPA 3UE3A 1P9RA 4ZJ1A 4X6TA 2H0YA 1ZHHB 4HESA 4UA6A 3UE1A 3LIBA 3R4KA 4EBLA 5HWVA 1XX2A 3QP2A 5J3WA 1YMXA 4UQIS 1M6KA 3C7VA 4KZ3A 2ZC5B 2XR0A 5F82A 3B3XA 2J3TD 3WS5A 4PAUA 5AQBA 2R78A 3G35A 4LLOB 3UB8A 3MZEA 4BLMA 1TEMA 4EBNA 1K6RA 1IYSA 3MXSA 4A5RA 1CEGA 2JKTI 1NRJA 3OPLA 4HBTA 4HIAA 1DJBA 4Q0IA 1NZOA 4O0PA 2VV6A 2OV5A 4S2PA 4KG5A 3GMWA 4OOYA 1IFQA 4ZAMA 1YLYA 5J4EA 4OQGA 4FH2A 1FQGA 2V0UA 4OOMA 3V3RA 1PWCA 3QP8A 3RJUA 3G4PA 3NHQA 1K4EA 4D2OA 4NXBA 3KSFA 3LFVA 2PYRA 3A0SA 1V9YA 1N4OA 3KYZA 1JTDA 3HLEA 3HUMA 4IJGA 2HF6A 4LV3A 3C30A 1FR6A 1CI9A 1MWRA 4P85A 4XT2A 4R6LA 1OTIA 3A3JA 4Y0TA 5L10A 5EVIC 1H8ZA 4Q0JA 1LI0A 5GL9A 1YLZA 2QWSA 2JKTM 3E2LA 4E3IA 4L0LA 2H5SA 3BFFA 4K91A 5FI6A 1PNEA 4Y5FA 1V9ZA 4KQRA 2C6WB 3OLOA 2XA7S 3D4FA 2Y2MA 5TBMB 1VHMA 2PD7A 1SDNA 3LUQA 2GX5A 4PMAA 3MQQA 3UPPA 3E98A 4XUXA 1XA1A 3JVUA 3CMZA 4WN5A 2BLSA 3CUEC 4L9EA 4KZ5A 5DJUA 4K0WA 4UA9A 3T4LA 4LENA 4GOGA 4CLCB 4C3QA 3O87A 3E4QA 1YKDA 2O0YA 3DTKA 5E2GA 3ZDJA 4KUKA 4MEZA 3PAEA 4EWFA 1N9OA 4GJ4A 2ZQ7A 5HARA 5HD5A 2KDKA 4O7DA 2XF3A 1K56A 4QU3A 2EX8A 5K5BA 1HTZA 1ZKJA 1ZG6A 5GLBA 3IHBA 4NG2A 3C8CA 3F1PB 1BULA 5KSHA 3AGEA 3M6BA 3L9KA 1YLWA 3ITBA 4KG6A 2Y2HA 3PBRA 3NBLA 3QP5A 5FEGA 4JXVA 4HNBA 2Y2NA 2JKRI 4XUZA 2M1CA 4P6BA 1PYYA 5G18A 2ZL1B 5FQ9A 1OJGA 4HHDA 4ZJ2A 1KGEA 4OLGA 5CGWA 2DCFA 1TS7A 2WYXA 3KYQA 4FUWA 4HEFA 3G2ZA 3ZG9B 4K0XA 4WF0A 1L0EA 5FL3A 3LIAA 2XFTA 4H8RA 3IF6B 3RXXA 4EUVA 3GECA 3VP4A 2JBFA 1DP8A 2EWWA 4QPRA 1S1ZA 3NJAA 5CXWA 2XD1A 4IEDA 1PI4A 1YM1A 2HDQA 1LLBA 3LR3A 3IQAA 1I2SA 1MKIA 2ZLYA 3U4LP 1VETB 5F1GA 4L9GA 3UPNA 4OP5A 1K38A 2JKRM 2Y4AA 3EOIA 2PR6A 2XQZA 4B93A 2O9CA 1KGGA 4WL9A 1FR1A 1T19A 3PTEA 3GSGA 4EQ1A 2UV0E 1JWVA 3LI9A 1NLYA 3ZNYA 1RGZA 3BWLA 4E3KA 4HQAA 3IH8A 1D1JA 1T1CA 2VGLS 3DAVA 4S2OA 2AVXA 2C5WB 5FAQA 3B33A 5FSRA 4PM7A 4U0XA 5IHVA 4WELA 1QMEA 2OSUA 2ZOHA 4RYEA 4DN0A 4BJPA 4WYYA 2IA2A 3MF0A 3TJZC 3BEBA 1K0KA 3CITA 5TGFA 3BLSA 1F98A 3VOLA 4KZBA 4X56A 5JYPA 3IBRA 4E04A 4EW7A 1H3QA 2Q9MA 2P9VB 2IWCA 1L3LA 4LFUA 4DMZA 4IHQA 2YKFA 4X1MA 1G5UA 2ZC7A 5DTKA 1ALQA 4C6YA 4P6ZS 3QP1A 4OQ0A 3MS6A 1D06A 5DF7A 3JYIA 5EVIB 1BLPA 3SZTA 1UWPX 3R7WB 1WA9A 3GR2A 4JF5A 5DF9A 2J9PA 4MDZA 3QP4A 1VQQA 3UY6A 2WZZA 2Y2JA 4H6JB 5EFWA 1ZC2A 5JYOA 2W3FA 1G68A 1EI5A 4JBFA 2K2NA 2J9OA 3G31A 1LT0A 1E4DA 4YNRA 1NZUA 5AQAA 1YT4A 3EEAA 1YMSA 3DTMA 1ERQA 3BFCA 3IBJA 4NXEA 1KDWA 4R1GA 3MFDA 4GLQA 4QY5A 2PU2A 2E8JA 4CLCC 2R9XA 1DRMA 5DKLA 4BWIA 4WEJA 4LRZE 3CPTA 3H82B 3PBQA 3Q7VB 2ZQ8A 3FC7A 4RX3A 4O8GA 3E4OA 4DJ3A 4DXBA 4GS9B 4G3VA 4YWZA 4G3KA 5AQ7A 3C5AA 3KSGA 2V8FA 5FATA 2VV8A 5A8BA 3LEQA 4PKYA 4F3LB 4HBUA 5D3OA 1ACFA 2VA0A 3V50A 3SOIA 4L9FA 2Y2OA 3WS4A 2W1TB 3NI9A 5L07A 3LR4A 4GB7A 2EXAA 5KMWA 3KO6A 4R3JA 5DJTA 3GTCA 1YAXA 5FQIA 1CJFA 2JHEA 5EVEA 1AWIA 1P97A 1JTGA 1VEUA 3WS1A 4CQHA 1K55A 2Y59A 3ZVTA 3T4TA 2ZD8A 3N4IA 4FD8A 5DFYA 4LV0A 4FCFA 3IX4A 1RGYA 4U3TA 2OWHA 3P7NA 1MWSA 3KYEA 4DXCA 3IF5A 3TOIA 4ID4A 1Q2PA 2VEAA 1K56D 4WZ5C 3PYPA 1PWDA 3FZCA 1KVLA 2P74A 4EESA 5F1FA 1IKGA 2ZM2A 1LSXA 2W1RA 4GZBA 2XA7M 1K6SA 5HL6A 1FCMA 3LYXA 3FPWA 2Y79A 3IF6C 1OPXA 2QJ7A 4ETXA 4HH3A 1OTAA 3BFGA 5A90A 1UWNX 2QMIA 2HP5A 3IXGA 1Z09A 1L0GA 4MBKA 5CGSA 4X1LA 4R4SA 1J9MA 5HWWA 3A3FA 1KDSA 1BTLA 5TR7A 3TW8A 2FFYA 5EECA 4OP8A 4MNRA 2G7UA 5GLDA 2HGVA 3N7WA 4S2LA 4OH0A 1ES5A 4X69A 3F1OA 4I5SA 3WRZA 1L0FA 5HDDA 3IS2A 4HP9A 2HP6A 2XGNA 3MJQA 4YINA 5E2FA 2PBYA 4Y17A 1OTEA 2OOLA 3HCYA 4KZ7A 3MKEA 5A92A 3RFBA 1VM1A 4N9KA 3M2JA 3C7UA 4CLCA 3ZHHA 1LHYA 3OCNA 1CEFA 4FSFA 4BBTA 2DMWA 2ZQ9A 2XROA 4RX2A 4DKIA 3IH9A 4WM9A 3FYZA 4PM8A 5CX7A 4KZ8A 3HLGA 5FASA 2Z6DA 2IWDA 2ZBBA 1VB6A 5HL1A 4N1XA 3IX8A 4RVAA 2E8IA 5EOOA 4ARZB 2H0TA 1W63M 4I3IA 2HDSA 1XJ3A 3F1NB 3Q82A 1BLCA 1BZAA 1HLUP 1DP6A 2GJ3A 1YLPA 3WS0A 1TDLA 4QY6A 2P08A 5J7EA 5AVEA 3T1RA 2W3GA 3M2KA 1OMEA 3Q07A 4IVKA 5HDSA 2XLNA 5AVFA 1QMFA 4LGWA 1TS6A 2EFUA 1EROA 5HX9A 3KSHA 3IWQA 1NJ4A 4QJGA 2CMNA 5G4YA 3HBRA 3W2ZA 5HFOA 2GNXA 4JGRA 4OPYA 1FSWA 1XGIA 4KG2A 4WZ5A 1TVFA 5HAQA 2FH5A 2W3DA 1K54C 4R70A 3T4JA 3N8RA 5FEFA 4PKYG 2QKPA 1SZVA 4R3BA 1SKOB 4FH4A 1HD8A 2O9BA 3B47A 5EM1A 4N9LA 3VFFA 3VMAA 3NOUC 3EQVA 1PRQA 1ES4A 3BY8A 2L1MA 1KE3A 3T50A 5FI7A 1W63Q 2M7VA 4Y0OA 4G3WA 4EERA 3BJNA 2L0WA 1XFQA 5AJGA 1ONGA 3UDIA 2Z6CA 4DE1A 5J8XA 4MN7A 1IKIA 5DKKA 4LRXC 2V8CA 4HJ4A 4ETZA 2V1AA 2WK0A 2WUQA 5FAPA 3L7HA 1HVBA 2K7SA 2Y2GA 3OCLA 1YLJA 5EUAA 5C5KA 2DRWA 3JVVA 5FQJA 2EX2A 3FKVA 3VE4A 2VJWA 1DJCA 2B02A 2ZJ9A 3G30A 3N6IA 1LL5A 3NOTC 2IWBA 4WEKA 3RH8B 2Y2LA 2HDUA 4DDSA 3RTYA 4GN2A 1G6AA 1W8QA 3D72A 2PHYA 4N1HA 4XT2B 1MPLA 1FCNA 3TSGA 3MQOA 1ZG4A 3AGDA 2HV1A 1SKFA 2G2WA 3HREA 4CJNA 1LL9A 3EWKA 4II7A 1FCOA 3NOPC 1S4SA 4EV4A 2Z2LB 1C3BA 4DDYA 2BG1A 3FG8A 2WAEA 1H0MA 3W8KA 4DF6A 5A93A 3PBSA 3G32A 1OTBA 4PM5A 1XP4A 4DE2A 1EW0A 1I5QA 5EVIA 1ERMA 5AQ9A 3ITAA 4N92A 5FAOA 4MBHA 4IBRA 5LBRA 4S2IA 3MZDA 4HI4A 4NXFA 1LL8A 1K57C 4JXGA 1YSPA 2WKEA 2H10A 1MZUA 3N8SA 2Y2PA 1PWGA 3OPPA 2OWJA 4MBFA 4I38A 3T1SA 1KVMA 5HW3A 2EXBA 2MJ6A 2V2FF 1G28A 5HWTA 1BSGA 3PBOA 3OZHA 3NC8A 5DF8A 3SS3A 3B42A 5HD3A 5FDHA 3S4XA 2GDNA 2Y2KA 2Q9NA 3CUEA 3HLWA 4S2JA 4S2NC 3NIAA 1KE0A 3LEZA 3GV9A 4CLCE 3V67A 3H82A 1GHIA 2UWXA 2Q0OA 5DTTA 3CG5A 3K3DA 3TRCA 5F83A 1STZA 4BD1A 2I72A 5KSCA 4GDBA 3OPRA 4GS9A 4KQQA 5M19A 1FOFA 1NXYA 3PAGA 2OLUA 1T1BA 2ZMVA 3MXRA 1ESIA 4JGQA 3OBFA 4JF4A 4M3KA 4R23A 1XJ2A 3BLMA 3SS4A 3SH9A 4Y7PA 3HL9A 3IX3A 4PHTA 3S7QA 4HH2A 3D9YA 1PW1A 2O9AA 2J80A 1ZTUA 3A0RA 4CLCD 2XD5A 3DWZA 3QHYA 3T4OA 1GA0A 4JLFA 4BQMA 2XH9A 4OLDA 1L0DA 2W0NA 3UB5P 5CEBA 5TFQA 2KLIA 4ZBEA 3LIFA 3W4PA 4PM9A 2ZMFA 4XXRA 4UQIM 5HDCA 3PXPA 4EEUA 3BRMA 3T4SA 3T1XA 2EA9A 3HLFA 4MN6A 3MSHA 3ZCZA 3PBTA 5A91A 2PU4A 1NYYA 3UPOA 2HPBA 4OPQA 3BY9A 2QYBA 1Y54A 2ZOIA 4PPRA 2WGWB 1XA7A 4HOIA 3T12B 5EPHA 3S7OA 1YQSA 2VLGA 3VOZA 4ZDXA 5EVLA 3MR0A 4Y2FA 1CF0A 2PBDP 1EWZA 1GSXA 3P98A 4MN5A 1KOUA 4OONA 5GHXA 4JXWA 1MBLA 5EE8A 4MCWA 3ULFA 2HDRA 5M1AA 5F68A 3HUOA 4HJ6A 4GD8A 2PR5A 4EETB 3ZYTA 3CWFA 4S2MA 2RL3A 1Z6FA 2A24B 3VP1A 4BENA
chains in the Genus database with same CATH topology
4FSFA 4BBTA 2DMWA 2H28A 2XROA 1TF1A 2LB9A 5HSQA 1LSVA 5CX7A 3C8CA 3BW6A 3F1PB 2Z6DA 4F3LA 5KSHA 3UE6A 2ZBBA 1VB6A 2A24A 4WUJA 2K31A 2W1TA 1P9WA 3EQUA 3MQ0A 2W27A 5TJJA 3PBRA 1OT6A 4ARZB 3LIEA 4IUKA 3FPVA 1DP9A 1W63M 3MMHA 4I3IA 4HNBA 1S67L 3PBNA 1XJ3A 2JKRI 3S7PA 3F1NB 3EEHA 2M1CA 1DP6A 2GJ3A 3HJKA 3PR6A 1NLZA 3C2WA 2BASA 2XRNA 1LSWA 1OJGA 2O99A 3CI6A 3PHYA 4HHDA 2P08A 3UMDA 5J7EA 5AVEA 2W3GA 2W3EA 2V1BA 1G6OA 3ICYA 1TS7A 3CLOA 3F1NA 3KYQA 5HDSA 5G4ZA 5AVFA 2I9VA 4HY8A 1TS6A 3KSHA 1T1AA 4WF0A 2J3WA 2CMNA 5G4YA 5FL3A 3W2ZA 3LIAA 2GNXA 5L8MA 4JGRA 3T4KA 4EUVA 2WKRA 3GECA 1DP8A 2EWWA 4QPRA 3H9WA 4R3AA 1S1ZA 4Q0HA 3NJAA 3KSIA 2FH5A 1OTDA 2W3DA 4R70A 1OJ5A 3A0VA 2HJ9C 2NUPC 2VZWA 3T4JA 3LR3A 2WKQA 4PKYG 3C38A 2QKPA 2OAQ1 3LIDA 5IS1A 4L9GA 3KX0X 1BYWA 3MFXA 3S7NA 4K08A 4BBUA 4EU0A 2O9BA 1H8MA 3B47A 2INWA 3H7WB 2JKRM 4O01A 4RQ9A 2JN7A 4I3AA 5TBMA 3EOIA 4HJ3A 3NOUC 2PR6A 3EQVA 2QHKA 4B93A 2O9CA 2P7JA 2VV7A 3BY8A 2L1MA 4WL9A 1D7EA 4UEYA 3T50A 1W63Q 1T19A 4LPZA 2M7VA 4Z1WA 4DJ2A 4G3WA 3H7WA 4EEPA 4EERA 4EQ1A 1MKMA 3BJNA 2L0WA 1XFQA 5AJGA 3LI9A 1NLYA 2Z6CA 4FOFA 4MN7A 3GDIA 2PD8A 3BWLA 4LRXC 5DKKA 5F6AA 1S4RA 2PT7A 3EGXC 4HJ4A 4HQAA 4MMNA 1T1CA 2VGLS 1Y28A 2D01A 4OOLA 2V1AA 4ETZA 4IUHA 3B33A 4YOFA 4GCZA 3P01A 4WELA 3U2AA 3K2NA 2K7SA 3OCLA 2ZOHA 5C5KA 4DN0A 4BJPA 1TS8A 3JVVA 5HPFA 3EGDC 2IA2A 3MF0A 3TJZC 3VE4A 2VJWA 2B02A 4LRYC 2QJ5A 3CITA 1XJ4A 3NOTC 4WEKA 3RH8B 3F1PA 3RTYA 1F98A 2FZ0A 3VOLA 1GSVA 3ZQ5A 1P0ZA 3E4PA 3D72A 3DBAA 4KUOA 4NXGA 3UB6A 4JGPA 2J3TC 2PHYA 3IBRA 4E04A 4XT2B 4EW7A 1H3QA 4ARZA 3MQOA 2VX8A 4BMWA 2HV1A 3LR0A 3VE3A 4DMZA 3EWKA 4GHIB 4IHQA 2YKFA 4II7A 1N9NA 4ME4A 4P6ZS 2WKPA 2L4RA 3NOPC 5HPIA 1S4SA 3D3OA 1D06A 4WLAA 1TS0A 3FG8A 1UWPX 4HP4A 3R7WB 1WA9A 3PBSA 2PDRA 4GHIA 1F9IA 1OTBA 5DF9A 4GW9A 4MDZA 2KX6A 1EW0A 3UMEA 3LI8A 2OAP1 3TE8A 4H6JB 2NUTC 2Y8HA 5EFWA 2W3FA 3LR5A 3OOVA 5LBRA 2K2NA 1X0OA 3T4QA 5IT5A 3K3CA 1LT0A 4YNRA 1F5MA 3E0YA 3EEAA 4HI4A 4NXFA 1LL8A 3OC2A 3UE3A 3IBJA 1T18A 1YSPA 4NXEA 1P9RA 2VGLM 4NKPA 1GSWA 4GLQA 3F1OB 1ZHHB 1MZUA 3CAXA 2M7UA 1S1YA 2XSSA 3LIBA 3IS2B 2OWJA 2V0WA 3R4KA 4CLCC 4R38A 5HWVA 1DRMA 4I38A 5DKLA 4BWIA 5J3WA 4WEJA 1XJ6A 2MJ6A 1TD5A 4UQIS 1G28A 4LRZE 5HWTA 3PBOA 3H82B 3PBQA 2LB5A 2J3TD 3B42A 5HD3A 3FC7A 4NEED 4O8GA 4PAUA 2R78A 3E4OA 1MC0A 4LLOB 4DJ3A 3CUEA 2KOIA 4GS9B 4BBVA 3UB8A 1S66L 4G3VA 4YWZA 4G3KA 4CLCE 3V67A 3KSGA 3H82A 4M4XA 2VV8A 5A8BA 4PKYA 2JKTI 1NRJA 4HIAA 4F3LB 3K3DA 4Q0IA 3TRCA 3SW1A 1STZA 2VA0A 4O0PA 2VV6A 3G6OA 4GS9A 4L9FA 2W1TB 3LR4A 4P6ZM 1IFQA 1T1BA 5J4EA 3KO6A 2ZMVA 5DJTA 1YAXA 4AFIA 4JGQA 4JGOA 2V0UA 3OBFA 4OOMA 5I5LA 2JHEA 1P97A 5MC7A 4CQHA 3NHQA 4KQOA 1OT9A 4NXBA 3T4TA 1XJ2A 5DFYA 3UB7A 2OWHA 3KSFA 3LFVA 3MXQA 3P7NA 2PYRA 3A0SA 1V9YA 4Y3IA 2A2LA 4PHTA 3KYZA 3S7QA 4HH2A 4IJGA 2HF6A 2VEAA 2O9AA 2J80A 1NWZA 1ZTUA 3A0RA 2GZAA 3C30A 3O5YA 3PYPA 4R6LA 4XT2A 4CLCD 1XFNA 4EESA 1OTIA 5DFXA 3T4OA 1LSXA 4B9OA 2W1RA 3BQAA 2XA7M 1UGUA 4Q0JA 5HL6A 3LYXA 3FPWA 2Y79A 2W0NA 1OPXA 2QJ7A 2B18A 4ETXA 2KLIA 4HH3A 1OTAA 2QWSA 1ODVA 3LIFA 2JKTM 2ZMFA 4I3JA 3HJIA 1UWNX 4L0LA 4UQIM 5HDCA 2HJEA 3PXPA 4EEUA 3R7WA 1YSQA 3T4SA 2EA9A 1IOUA 4MN6A 4Y5FA 1V9ZA 1JNUA 2PYPA 3PBTA 3VV4A 3OLOA 2XA7S 5HWWA 4ZRRA 3BY9A 4H6JA 2QYBA 2ZOIA 3TW8A 5TBMB 4KQDA 1VHMA 2PD7A 2VKSA 3LUQA 2GX5A 2P04A 2G7UA 3BQ8A 3MQQA 3E98A 4I39A 4EXOA 4HOIA 2HGVA 3S7OA 2VLGA 3JVUA 4WN5A 3MR0A 4Y2FA 3CUEC 2D02A 4L9EA 5DJUA 3F1OA 3T4LA 4I5SA 2EWVA 5HDDA 4CLCB 1N9LA 3IS2A 4HP9A 1GSXA 3MJQA 3E4QA 4MN5A 5KIZA 1KOUA 1YKDA 5F69A 2O0YA 1OTEA 4KUKA 5HZHA 3UB9A 2YKHA 1N9OA 3LICA 4MCWA 4GJ4A 5IU1A 3ULFA 2OOLA 3HCYA 2KDKA 5HD5A 3RFBA 5F68A 4HJ6A 4CLCA 5K5BA 5F5YA 2W3HA 2PR5A 3OCNA 2V9AA 4EETB 3ZYTA 3CWFA 2A24B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BBT A;  2H28 A;  5HSQ A;  1LSV A;  3C8C A;  3F1P B;  2Z6D A;  4F3L A;  3UE6 A;  2ZBB A;  1VB6 A;  2A24 A;  4WUJ A;  2W27 A;  1OT6 A;  3LIE A;  1DP9 A;  4I3I A;  4HNB A;  1S67 L;  1XJ3 A;  3F1N B;  3EEH A;  2M1C A;  1DP6 A;  2GJ3 A;  3HJK A;  2BAS A;  3C2W A;  1LSW A;  1OJG A;  3PHY A;  4HHD A;  3UMD A;  5J7E A;  5AVE A;  2V1B A;  3ICY A;  1TS7 A;  3CLO A;  3F1N A;  5HDS A;  5G4Z A;  5AVF A;  2I9V A;  4HY8 A;  1TS6 A;  1T1A A;  4WF0 A;  2CMN A;  5G4Y A;  3LIA A;  4JGR A;  2WKR A;  3GEC A;  1DP8 A;  3H9W A;  4R3A A;  1S1Z A;  3NJA A;  1OTD A;  4R70 A;  1OJ5 A;  3A0V A;  2WKQ A;  4PKY G;  2QKP A;  3LID A;  5IS1 A;  4L9G A;  3KX0 X;  1BYW A;  3MFX A;  4BBU A;  4K08 A;  2INW A;  3H7W B;  4RQ9 A;  2JN7 A;  4I3A A;  5TBM A;  4HJ3 A;  3NOU C;  2PR6 A;  2QHK A;  2P7J A;  2VV7 A;  3BY8 A;  2L1M A;  4WL9 A;  1D7E A;  3T50 A;  1T19 A;  4LPZ A;  4DJ2 A;  3H7W A;  4EEP A;  4EER A;  4EQ1 A;  2L0W A;  1XFQ A;  3LI9 A;  2Z6C A;  3GDI A;  2PD8 A;  3BWL A;  4LRX C;  5DKK A;  5F6A A;  1S4R A;  4HJ4 A;  4HQA A;  1T1C A;  1Y28 A;  2D01 A;  2V1A A;  3B33 A;  4GCZ A;  2K7S A;  2ZOH A;  1TS8 A;  3VE4 A;  2B02 A;  4LRY C;  2QJ5 A;  1XJ4 A;  3NOT C;  3RH8 B;  3F1P A;  3RTY A;  1F98 A;  3VOL A;  1GSV A;  3ZQ5 A;  1P0Z A;  3E4P A;  3D72 A;  4KUO A;  4NXG A;  3UB6 A;  4JGP A;  2PHY A;  3IBR A;  4E04 A;  4XT2 B;  4EW7 A;  3MQO A;  2HV1 A;  3VE3 A;  3EWK A;  4GHI B;  2YKF A;  1N9N A;  2WKP A;  2L4R A;  3NOP C;  1S4S A;  1D06 A;  4WLA A;  1TS0 A;  3FG8 A;  1UWP X;  4HP4 A;  1WA9 A;  2PDR A;  4GHI A;  1F9I A;  1OTB A;  4GW9 A;  2KX6 A;  1EW0 A;  3UME A;  3LI8 A;  4H6J B;  5EFW A;  1X0O A;  3K3C A;  1LT0 A;  4HI4 A;  4NXF A;  1LL8 A;  1T18 A;  4NXE A;  1GSW A;  3F1O B;  1MZU A;  3CAX A;  1S1Y A;  3LIB A;  3IS2 B;  2OWJ A;  2V0W A;  4R38 A;  5HWV A;  1DRM A;  4I38 A;  5DKL A;  5J3W A;  1XJ6 A;  4LRZ E;  1G28 A;  5HWT A;  3H82 B;  5HD3 A;  3FC7 A;  2R78 A;  3E4O A;  4LLO B;  4DJ3 A;  4GS9 B;  4BBV A;  3UB8 A;  1S66 L;  4YWZ A;  3H82 A;  4M4X A;  2VV8 A;  5A8B A;  4PKY A;  4F3L B;  4HIA A;  3K3D A;  3SW1 A;  2VV6 A;  3G6O A;  4GS9 A;  4L9F A;  1T1B A;  5J4E A;  5DJT A;  4JGQ A;  4JGO A;  2V0U A;  5I5L A;  2JHE A;  1P97 A;  3NHQ A;  1OT9 A;  4NXB A;  1XJ2 A;  3UB7 A;  2OWH A;  3P7N A;  3MXQ A;  2PYR A;  3A0S A;  1V9Y A;  4HH2 A;  2VEA A;  2J80 A;  1NWZ A;  3A0R A;  3PYP A;  4R6L A;  4XT2 A;  1XFN A;  4EES A;  1OTI A;  1LSX A;  4B9O A;  1UGU A;  3LYX A;  2W0N A;  2QJ7 A;  4HH3 A;  1OTA A;  2QWS A;  1ODV A;  3LIF A;  4I3J A;  3HJI A;  1UWN X;  5HDC A;  4EEU A;  2EA9 A;  4MN6 A;  1V9Z A;  1JNU A;  2PYP A;  3OLO A;  5HWW A;  3BY9 A;  4H6J A;  2ZOI A;  5TBM B;  4KQD A;  2PD7 A;  3LUQ A;  3MQQ A;  4I39 A;  4EXO A;  4HOI A;  2VLG A;  4WN5 A;  3MR0 A;  2D02 A;  4L9E A;  5DJU A;  3F1O A;  4I5S A;  5HDD A;  1N9L A;  3IS2 A;  4HP9 A;  1GSX A;  3MJQ A;  3E4Q A;  4MN5 A;  5KIZ A;  1KOU A;  5F69 A;  1OTE A;  4KUK A;  5HZH A;  3UB9 A;  2YKH A;  1N9O A;  3LIC A;  5IU1 A;  3ULF A;  2OOL A;  5HD5 A;  2KDK A;  5F68 A;  4HJ6 A;  5F5Y A;  2PR5 A;  2V9A A;  4EET B;  3CWF A;  2A24 B; 
#chains in the Genus database with same CATH topology
 2H28 A;  4OKP A;  3JPU A;  2ZC4 B;  5HSQ A;  4B88 A;  4LCM A;  3BW6 A;  2Y91 A;  2J7V A;  1JWZ A;  5BOH A;  4WUJ A;  2K31 A;  4P87 A;  1XPB A;  2W27 A;  2WZX A;  2QZ6 A;  3IXB A;  3VSL A;  3HLC A;  1J3W A;  1S67 L;  3A3D A;  1AXB A;  3QNC A;  3EEH A;  4QB8 A;  3HJK A;  2V1Z A;  1NLZ A;  2BAS A;  2O99 A;  5FA7 A;  3A3E A;  2WGV A;  4LV2 A;  2XK1 A;  3UMD A;  2VGJ A;  2V1B A;  1BLS A;  3CHW P;  1N9B A;  1NRF A;  3CLO A;  1IEM A;  3F1N A;  2R9W A;  5G4Z A;  1ESU A;  3HLD A;  4UHU A;  4ZJ3 A;  3VP3 A;  1Y4O A;  3Q1F A;  3IXH A;  2HP9 A;  1BLH A;  1GCE A;  3IT9 A;  1W8Y A;  4GDN A;  1E3U A;  3H9W A;  4R3A A;  4Q0H A;  1KE4 A;  1S6R A;  3KSI A;  4E3M A;  3C38 A;  2OAQ 1;  3LID A;  4X53 A;  4JF6 A;  3KX0 X;  4WMC D;  1BYW A;  4ESP A;  4EU0 A;  1H8M A;  2INW A;  4KZ9 A;  3H7W B;  4O01 A;  4I3A A;  1O07 A;  3CPT B;  5TBM A;  1E25 A;  3V39 A;  2XEP A;  2J8Y A;  5CED A;  3AGF A;  2QHK A;  2P7J A;  2EX9 A;  1SKO A;  4LPZ A;  2JC7 A;  4Z1W A;  1MKM A;  4OPZ A;  4E6W A;  5EV0 A;  3CJM A;  1IYO A;  3GDI A;  4P0M A;  5F6A A;  1S4R A;  5DVA A;  2PT7 A;  4KZA A;  5EVI D;  3O86 A;  1FIL A;  1GHM A;  4OOL A;  2D01 A;  3DTE A;  4IUH A;  3T1Q B;  4ZTK A;  4UAA A;  4GCZ A;  4OPR A;  3U2A A;  4EUZ A;  2JE5 A;  2WKI A;  3MBZ A;  3GVB A;  2JCH A;  1MY8 A;  3C4P A;  1TS8 A;  3MZF A;  1VEU B;  3EGD C;  4QD4 A;  2QJ5 A;  3MKF A;  3GRJ A;  3F1P A;  4IVI A;  1ES2 A;  2FZ0 A;  2CC1 A;  3NEC A;  1PZO A;  4KUO A;  3UB6 A;  4DRT A;  2J3T C;  3ISG A;  1MWU A;  5GLC A;  1PZP A;  4MLL A;  5CER A;  5KZH A;  5GHY A;  4BMW A;  3VP2 A;  3VE3 A;  5FQM A;  3OPH A;  4RA7 A;  4GHI B;  4C75 A;  2A3U A;  1N9N A;  3VP0 A;  2L4R A;  5HPI A;  3TG9 A;  3D3O A;  2ZL1 A;  5E43 A;  4FTX A;  4WLA A;  4R0Q A;  1TS0 A;  4E3J A;  3VFH A;  1K4F A;  1S0W A;  4HP4 A;  1YLT A;  3SH8 A;  2B5R A;  3RXW A;  4KZ4 A;  2KX6 A;  3Q81 A;  5L09 A;  3UME A;  3ZNT A;  3LI8 A;  1PFL A;  3QNB A;  2OAP 1;  2XDM A;  3TE8 A;  4OVD A;  1JVJ A;  1ONH A;  4Y13 A;  3IF6 A;  2RCX A;  1PI5 A;  1X0O A;  1XXM A;  3T4Q A;  3K3C A;  5IT5 A;  2V20 A;  4F94 A;  5EOE A;  1F5M A;  3BEC A;  3IWO A;  3OC2 A;  1T18 A;  2VGL M;  4Q8I A;  1IEL A;  4NKP A;  1GSW A;  2ACG A;  3IHA A;  3F1O B;  5DTS A;  2QPN A;  3CAX A;  2M7U A;  1S1Y A;  2XSS A;  1H5X A;  3IS2 B;  2V0W A;  4R38 A;  1VET A;  4WBG A;  1M40 A;  1XJ6 A;  1TD5 A;  3ZG8 B;  4WZ4 A;  1SHV A;  2LB5 A;  1W5D A;  3E2K A;  5I94 A;  4NEE D;  1MC0 A;  1I2W A;  2KOI A;  4BBV A;  1S66 L;  5CHJ A;  5FI2 A;  2VK3 A;  5U47 A;  3P09 A;  1NY0 A;  4M4X A;  3LCE A;  4Z9Q A;  3SW1 A;  4X68 A;  3G6O A;  1RP5 A;  2ZMA A;  4P6Z M;  4KZ6 A;  1Q2Q A;  2B95 A;  4AFI A;  4JGO A;  5I5L A;  4NET A;  5MC7 A;  1BT5 A;  3SH7 A;  3NDG A;  4KQO A;  2ZC3 B;  2ZM0 A;  3C4O A;  1OT9 A;  2G2U A;  3SS5 A;  4E3N A;  3W4Q A;  4CPK A;  4WMC A;  3UB7 A;  3DWK A;  5M18 A;  3MXQ A;  3G2Y A;  1WE4 A;  1U60 A;  4Y3I A;  4B4X A;  2A2L A;  2EX6 A;  2WGI A;  1GHP A;  2WKH A;  2ZQD A;  1NYM A;  1NWZ A;  3O5Y A;  2GZA A;  1XFN A;  3M6H A;  5CHM A;  5DFX A;  2JKG A;  4B9O A;  3BQA A;  4BD0 A;  1UGU A;  2P9V A;  3FV7 A;  4Y15 A;  5GHZ A;  3BM6 A;  3CZD A;  2B18 A;  4GD6 A;  1ODV A;  1HZO A;  3GQZ A;  4I3J A;  3HJI A;  5CTN A;  4X55 A;  2HJE A;  3HVF A;  3R7W A;  1YSQ A;  5CHU A;  1IOU A;  1JNU A;  1MXO A;  2PYP A;  3ZG5 A;  3VV4 A;  1WYC A;  1XGJ A;  3WRT A;  3UN7 A;  4ZRR A;  4OQH A;  4H6J A;  2X71 A;  5E2H A;  2DNS A;  4KQD A;  1H8Y A;  2VKS A;  3I7J A;  2P04 A;  3BQ8 A;  3LY4 A;  2X02 A;  2WAF A;  4I39 A;  5CTM A;  4EXO A;  3NDE A;  2OLV A;  4GNU A;  4BL3 A;  3UO9 A;  4U0T A;  3V5M A;  2D02 A;  1K54 A;  3ZVW A;  2Y2Q A;  5FQK A;  2EWV A;  2WGW A;  1N9L A;  1L2S A;  2BTF P;  2HZ5 A;  3ZFZ A;  5KIZ A;  4E3L A;  5F69 A;  4BL2 A;  3UNW A;  5HZH A;  3UB9 A;  2YKH A;  1ES3 A;  3LIC A;  5IU1 A;  2Z2M B;  3WS2 A;  1IYQ A;  3ZG7 B;  4IBX A;  3Q7V A;  1CI8 A;  4YFM A;  4LV1 A;  1E3U D;  5F5Y A;  2W3H A;  2V9A A;  1TF1 A;  1PIO A;  1DY6 A;  1K55 C;  3S1Y A;  2LB9 A;  1RCJ A;  1LSV A;  3LY3 A;  3NCK A;  5CGX A;  3ZG0 A;  4F3L A;  3UE6 A;  2A24 A;  2W1T A;  1P9W A;  3EQU A;  3MQ0 A;  5TJJ A;  1W79 A;  2FFF B;  1TDG A;  1OT6 A;  3O88 A;  1O7E A;  3LIE A;  2XFS A;  4IUK A;  3FPV A;  1DP9 A;  3MMH A;  3PBN A;  3S7P A;  3UDX A;  3IXD A;  3PR6 A;  2XRN A;  3C2W A;  1LSW A;  3PHY A;  3CI6 A;  2ZQA A;  4DE0 A;  2PAV P;  2W3E A;  1G6O A;  4S2K A;  3ICY A;  3O3V A;  2I9V A;  2ZC6 B;  3HLB A;  4HY8 A;  3FWL A;  4LCL A;  1F2K A;  1T1A A;  1K25 A;  3Q7Z A;  1KGF A;  2J3W A;  3N8L A;  4NK3 A;  1FIK A;  1CK3 A;  5L8M A;  4UA7 A;  3T4K A;  3BFD A;  2X01 A;  2WKR A;  3UDF A;  4KEN B;  5FQQ A;  4E3O A;  1OTD A;  2NUP C;  1OJ5 A;  3A0V A;  2HJ9 C;  2VZW A;  3HUN A;  4EBP A;  1MWT A;  2WKQ A;  5IS1 A;  1W7F A;  1A0K A;  3MFX A;  3S7N A;  3VOY A;  4K08 A;  4BBU A;  3V3S A;  1SDE A;  3W4O A;  4RQ9 A;  2JN7 A;  2A49 A;  4HJ3 A;  4PM6 A;  4X25 A;  2VV7 A;  2JKF A;  1D7E A;  4UEY A;  1K57 A;  3BYD A;  1BUE A;  4DJ2 A;  4GKU A;  3H7W A;  4EEP A;  3S22 A;  4FOF A;  1CQA A;  2PD8 A;  2ZM8 A;  1LI9 A;  3EGX C;  1FSY A;  3NY4 A;  4MMN A;  1Y28 A;  4OQI A;  3IWI A;  4YOF A;  2EFX A;  2WAD A;  3P01 A;  3K2N A;  5CRF A;  4R4R A;  3A3I A;  1JWP A;  5HAI A;  4S2N A;  3WWX A;  5HPF A;  3FKW A;  2Y55 A;  4LRY C;  4JXS A;  3UE0 A;  2Y2I A;  4JPM A;  1XJ4 A;  3VSK A;  3NUL A;  1GSV A;  3ZQ5 A;  1P0Z A;  3E4P A;  3BFE A;  3DBA A;  5HAP A;  4NXG A;  1PW8 A;  4JGP A;  3DW0 A;  1WYB A;  4JKT A;  3ZGA B;  2VGK A;  4D60 A;  4ARZ A;  3LO7 A;  1XKZ A;  2VX8 A;  3LR0 A;  5L2F A;  4DE3 A;  4ME4 A;  5E2E A;  2WKP A;  4QWO A;  2ZQC A;  4Y0U A;  4B4Z A;  3G34 A;  2PDR A;  1GA9 A;  4GHI A;  1F9I A;  4E6X A;  4GW9 A;  4QHC A;  1SCW A;  4EQI A;  3QP6 A;  3LGO A;  2PRF A;  2NUT C;  2Y8H A;  5GLA A;  5EM0 A;  3LR5 A;  3OOV A;  5CEC A;  1DJA A;  1YPR A;  3DTI A;  3E0Y A;  5FDS A;  1IYP A;  3UE3 A;  1P9R A;  4ZJ1 A;  4X6T A;  2H0Y A;  1ZHH B;  4HES A;  4UA6 A;  3UE1 A;  3LIB A;  3R4K A;  4EBL A;  5HWV A;  1XX2 A;  3QP2 A;  5J3W A;  1YMX A;  4UQI S;  1M6K A;  3C7V A;  4KZ3 A;  2ZC5 B;  2XR0 A;  5F82 A;  3B3X A;  2J3T D;  3WS5 A;  4PAU A;  5AQB A;  2R78 A;  3G35 A;  4LLO B;  3UB8 A;  3MZE A;  4BLM A;  1TEM A;  4EBN A;  1K6R A;  1IYS A;  3MXS A;  4A5R A;  1CEG A;  2JKT I;  1NRJ A;  3OPL A;  4HBT A;  4HIA A;  1DJB A;  4Q0I A;  1NZO A;  4O0P A;  2VV6 A;  2OV5 A;  4S2P A;  4KG5 A;  3GMW A;  4OOY A;  1IFQ A;  4ZAM A;  1YLY A;  5J4E A;  4OQG A;  4FH2 A;  1FQG A;  2V0U A;  4OOM A;  3V3R A;  1PWC A;  3QP8 A;  3RJU A;  3G4P A;  3NHQ A;  1K4E A;  4D2O A;  4NXB A;  3KSF A;  3LFV A;  2PYR A;  3A0S A;  1V9Y A;  1N4O A;  3KYZ A;  1JTD A;  3HLE A;  3HUM A;  4IJG A;  2HF6 A;  4LV3 A;  3C30 A;  1FR6 A;  1CI9 A;  1MWR A;  4P85 A;  4XT2 A;  4R6L A;  1OTI A;  3A3J A;  4Y0T A;  5L10 A;  5EVI C;  1H8Z A;  4Q0J A;  1LI0 A;  5GL9 A;  1YLZ A;  2QWS A;  2JKT M;  3E2L A;  4E3I A;  4L0L A;  2H5S A;  3BFF A;  4K91 A;  5FI6 A;  1PNE A;  4Y5F A;  1V9Z A;  4KQR A;  2C6W B;  3OLO A;  2XA7 S;  3D4F A;  2Y2M A;  5TBM B;  1VHM A;  2PD7 A;  1SDN A;  3LUQ A;  2GX5 A;  4PMA A;  3MQQ A;  3UPP A;  3E98 A;  4XUX A;  1XA1 A;  3JVU A;  3CMZ A;  4WN5 A;  2BLS A;  3CUE C;  4L9E A;  4KZ5 A;  5DJU A;  4K0W A;  4UA9 A;  3T4L A;  4LEN A;  4GOG A;  4CLC B;  4C3Q A;  3O87 A;  3E4Q A;  1YKD A;  2O0Y A;  3DTK A;  5E2G A;  3ZDJ A;  4KUK A;  4MEZ A;  3PAE A;  4EWF A;  1N9O A;  4GJ4 A;  2ZQ7 A;  5HAR A;  5HD5 A;  2KDK A;  4O7D A;  2XF3 A;  1K56 A;  4QU3 A;  2EX8 A;  5K5B A;  1HTZ A;  1ZKJ A;  1ZG6 A;  5GLB A;  3IHB A;  4NG2 A;  3C8C A;  3F1P B;  1BUL A;  5KSH A;  3AGE A;  3M6B A;  3L9K A;  1YLW A;  3ITB A;  4KG6 A;  2Y2H A;  3PBR A;  3NBL A;  3QP5 A;  5FEG A;  4JXV A;  4HNB A;  2Y2N A;  2JKR I;  4XUZ A;  2M1C A;  4P6B A;  1PYY A;  5G18 A;  2ZL1 B;  5FQ9 A;  1OJG A;  4HHD A;  4ZJ2 A;  1KGE A;  4OLG A;  5CGW A;  2DCF A;  1TS7 A;  2WYX A;  3KYQ A;  4FUW A;  4HEF A;  3G2Z A;  3ZG9 B;  4K0X A;  4WF0 A;  1L0E A;  5FL3 A;  3LIA A;  2XFT A;  4H8R A;  3IF6 B;  3RXX A;  4EUV A;  3GEC A;  3VP4 A;  2JBF A;  1DP8 A;  2EWW A;  4QPR A;  1S1Z A;  3NJA A;  5CXW A;  2XD1 A;  4IED A;  1PI4 A;  1YM1 A;  2HDQ A;  1LLB A;  3LR3 A;  3IQA A;  1I2S A;  1MKI A;  2ZLY A;  3U4L P;  1VET B;  5F1G A;  4L9G A;  3UPN A;  4OP5 A;  1K38 A;  2JKR M;  2Y4A A;  3EOI A;  2PR6 A;  2XQZ A;  4B93 A;  2O9C A;  1KGG A;  4WL9 A;  1FR1 A;  1T19 A;  3PTE A;  3GSG A;  4EQ1 A;  2UV0 E;  1JWV A;  3LI9 A;  1NLY A;  3ZNY A;  1RGZ A;  3BWL A;  4E3K A;  4HQA A;  3IH8 A;  1D1J A;  1T1C A;  2VGL S;  3DAV A;  4S2O A;  2AVX A;  2C5W B;  5FAQ A;  3B33 A;  5FSR A;  4PM7 A;  4U0X A;  5IHV A;  4WEL A;  1QME A;  2OSU A;  2ZOH A;  4RYE A;  4DN0 A;  4BJP A;  4WYY A;  2IA2 A;  3MF0 A;  3TJZ C;  3BEB A;  1K0K A;  3CIT A;  5TGF A;  3BLS A;  1F98 A;  3VOL A;  4KZB A;  4X56 A;  5JYP A;  3IBR A;  4E04 A;  4EW7 A;  1H3Q A;  2Q9M A;  2P9V B;  2IWC A;  1L3L A;  4LFU A;  4DMZ A;  4IHQ A;  2YKF A;  4X1M A;  1G5U A;  2ZC7 A;  5DTK A;  1ALQ A;  4C6Y A;  4P6Z S;  3QP1 A;  4OQ0 A;  3MS6 A;  1D06 A;  5DF7 A;  3JYI A;  5EVI B;  1BLP A;  3SZT A;  1UWP X;  3R7W B;  1WA9 A;  3GR2 A;  4JF5 A;  5DF9 A;  2J9P A;  4MDZ A;  3QP4 A;  1VQQ A;  3UY6 A;  2WZZ A;  2Y2J A;  4H6J B;  5EFW A;  1ZC2 A;  5JYO A;  2W3F A;  1G68 A;  1EI5 A;  4JBF A;  2K2N A;  2J9O A;  3G31 A;  1LT0 A;  1E4D A;  4YNR A;  1NZU A;  5AQA A;  1YT4 A;  3EEA A;  1YMS A;  3DTM A;  1ERQ A;  3BFC A;  3IBJ A;  4NXE A;  1KDW A;  4R1G A;  3MFD A;  4GLQ A;  4QY5 A;  2PU2 A;  2E8J A;  4CLC C;  2R9X A;  1DRM A;  5DKL A;  4BWI A;  4WEJ A;  4LRZ E;  3CPT A;  3H82 B;  3PBQ A;  3Q7V B;  2ZQ8 A;  3FC7 A;  4RX3 A;  4O8G A;  3E4O A;  4DJ3 A;  4DXB A;  4GS9 B;  4G3V A;  4YWZ A;  4G3K A;  5AQ7 A;  3C5A A;  3KSG A;  2V8F A;  5FAT A;  2VV8 A;  5A8B A;  3LEQ A;  4PKY A;  4F3L B;  4HBU A;  5D3O A;  1ACF A;  2VA0 A;  3V50 A;  3SOI A;  4L9F A;  2Y2O A;  3WS4 A;  2W1T B;  3NI9 A;  5L07 A;  3LR4 A;  4GB7 A;  2EXA A;  5KMW A;  3KO6 A;  4R3J A;  5DJT A;  3GTC A;  1YAX A;  5FQI A;  1CJF A;  2JHE A;  5EVE A;  1AWI A;  1P97 A;  1JTG A;  1VEU A;  3WS1 A;  4CQH A;  1K55 A;  2Y59 A;  3ZVT A;  3T4T A;  2ZD8 A;  3N4I A;  4FD8 A;  5DFY A;  4LV0 A;  4FCF A;  3IX4 A;  1RGY A;  4U3T A;  2OWH A;  3P7N A;  1MWS A;  3KYE A;  4DXC A;  3IF5 A;  3TOI A;  4ID4 A;  1Q2P A;  2VEA A;  1K56 D;  4WZ5 C;  3PYP A;  1PWD A;  3FZC A;  1KVL A;  2P74 A;  4EES A;  5F1F A;  1IKG A;  2ZM2 A;  1LSX A;  2W1R A;  4GZB A;  2XA7 M;  1K6S A;  5HL6 A;  1FCM A;  3LYX A;  3FPW A;  2Y79 A;  3IF6 C;  1OPX A;  2QJ7 A;  4ETX A;  4HH3 A;  1OTA A;  3BFG A;  5A90 A;  1UWN X;  2QMI A;  2HP5 A;  3IXG A;  1Z09 A;  1L0G A;  4MBK A;  5CGS A;  4X1L A;  4R4S A;  1J9M A;  5HWW A;  3A3F A;  1KDS A;  1BTL A;  5TR7 A;  3TW8 A;  2FFY A;  5EEC A;  4OP8 A;  4MNR A;  2G7U A;  5GLD A;  2HGV A;  3N7W A;  4S2L A;  4OH0 A;  1ES5 A;  4X69 A;  3F1O A;  4I5S A;  3WRZ A;  1L0F A;  5HDD A;  3IS2 A;  4HP9 A;  2HP6 A;  2XGN A;  3MJQ A;  4YIN A;  5E2F A;  2PBY A;  4Y17 A;  1OTE A;  2OOL A;  3HCY A;  4KZ7 A;  3MKE A;  5A92 A;  3RFB A;  1VM1 A;  4N9K A;  3M2J A;  3C7U A;  4CLC A;  3ZHH A;  1LHY A;  3OCN A;  1CEF A;  4FSF A;  4BBT A;  2DMW A;  2ZQ9 A;  2XRO A;  4RX2 A;  4DKI A;  3IH9 A;  4WM9 A;  3FYZ A;  4PM8 A;  5CX7 A;  4KZ8 A;  3HLG A;  5FAS A;  2Z6D A;  2IWD A;  2ZBB A;  1VB6 A;  5HL1 A;  4N1X A;  3IX8 A;  4RVA A;  2E8I A;  5EOO A;  4ARZ B;  2H0T A;  1W63 M;  4I3I A;  2HDS A;  1XJ3 A;  3F1N B;  3Q82 A;  1BLC A;  1BZA A;  1HLU P;  1DP6 A;  2GJ3 A;  1YLP A;  3WS0 A;  1TDL A;  4QY6 A;  2P08 A;  5J7E A;  5AVE A;  3T1R A;  2W3G A;  3M2K A;  1OME A;  3Q07 A;  4IVK A;  5HDS A;  2XLN A;  5AVF A;  1QMF A;  4LGW A;  1TS6 A;  2EFU A;  1ERO A;  5HX9 A;  3KSH A;  3IWQ A;  1NJ4 A;  4QJG A;  2CMN A;  5G4Y A;  3HBR A;  3W2Z A;  5HFO A;  2GNX A;  4JGR A;  4OPY A;  1FSW A;  1XGI A;  4KG2 A;  4WZ5 A;  1TVF A;  5HAQ A;  2FH5 A;  2W3D A;  1K54 C;  4R70 A;  3T4J A;  3N8R A;  5FEF A;  4PKY G;  2QKP A;  1SZV A;  4R3B A;  1SKO B;  4FH4 A;  1HD8 A;  2O9B A;  3B47 A;  5EM1 A;  4N9L A;  3VFF A;  3VMA A;  3NOU C;  3EQV A;  1PRQ A;  1ES4 A;  3BY8 A;  2L1M A;  1KE3 A;  3T50 A;  5FI7 A;  1W63 Q;  2M7V A;  4Y0O A;  4G3W A;  4EER A;  3BJN A;  2L0W A;  1XFQ A;  5AJG A;  1ONG A;  3UDI A;  2Z6C A;  4DE1 A;  5J8X A;  4MN7 A;  1IKI A;  5DKK A;  4LRX C;  2V8C A;  4HJ4 A;  4ETZ A;  2V1A A;  2WK0 A;  2WUQ A;  5FAP A;  3L7H A;  1HVB A;  2K7S A;  2Y2G A;  3OCL A;  1YLJ A;  5EUA A;  5C5K A;  2DRW A;  3JVV A;  5FQJ A;  2EX2 A;  3FKV A;  3VE4 A;  2VJW A;  1DJC A;  2B02 A;  2ZJ9 A;  3G30 A;  3N6I A;  1LL5 A;  3NOT C;  2IWB A;  4WEK A;  3RH8 B;  2Y2L A;  2HDU A;  4DDS A;  3RTY A;  4GN2 A;  1G6A A;  1W8Q A;  3D72 A;  2PHY A;  4N1H A;  4XT2 B;  1MPL A;  1FCN A;  3TSG A;  3MQO A;  1ZG4 A;  3AGD A;  2HV1 A;  1SKF A;  2G2W A;  3HRE A;  4CJN A;  1LL9 A;  3EWK A;  4II7 A;  1FCO A;  3NOP C;  1S4S A;  4EV4 A;  2Z2L B;  1C3B A;  4DDY A;  2BG1 A;  3FG8 A;  2WAE A;  1H0M A;  3W8K A;  4DF6 A;  5A93 A;  3PBS A;  3G32 A;  1OTB A;  4PM5 A;  1XP4 A;  4DE2 A;  1EW0 A;  1I5Q A;  5EVI A;  1ERM A;  5AQ9 A;  3ITA A;  4N92 A;  5FAO A;  4MBH A;  4IBR A;  5LBR A;  4S2I A;  3MZD A;  4HI4 A;  4NXF A;  1LL8 A;  1K57 C;  4JXG A;  1YSP A;  2WKE A;  2H10 A;  1MZU A;  3N8S A;  2Y2P A;  1PWG A;  3OPP A;  2OWJ A;  4MBF A;  4I38 A;  3T1S A;  1KVM A;  5HW3 A;  2EXB A;  2MJ6 A;  2V2F F;  1G28 A;  5HWT A;  1BSG A;  3PBO A;  3OZH A;  3NC8 A;  5DF8 A;  3SS3 A;  3B42 A;  5HD3 A;  5FDH A;  3S4X A;  2GDN A;  2Y2K A;  2Q9N A;  3CUE A;  3HLW A;  4S2J A;  4S2N C;  3NIA A;  1KE0 A;  3LEZ A;  3GV9 A;  4CLC E;  3V67 A;  3H82 A;  1GHI A;  2UWX A;  2Q0O A;  5DTT A;  3CG5 A;  3K3D A;  3TRC A;  5F83 A;  1STZ A;  4BD1 A;  2I72 A;  5KSC A;  4GDB A;  3OPR A;  4GS9 A;  4KQQ A;  5M19 A;  1FOF A;  1NXY A;  3PAG A;  2OLU A;  1T1B A;  2ZMV A;  3MXR A;  1ESI A;  4JGQ A;  3OBF A;  4JF4 A;  4M3K A;  4R23 A;  1XJ2 A;  3BLM A;  3SS4 A;  3SH9 A;  4Y7P A;  3HL9 A;  3IX3 A;  4PHT A;  3S7Q A;  4HH2 A;  3D9Y A;  1PW1 A;  2O9A A;  2J80 A;  1ZTU A;  3A0R A;  4CLC D;  2XD5 A;  3DWZ A;  3QHY A;  3T4O A;  1GA0 A;  4JLF A;  4BQM A;  2XH9 A;  4OLD A;  1L0D A;  2W0N A;  3UB5 P;  5CEB A;  5TFQ A;  2KLI A;  4ZBE A;  3LIF A;  3W4P A;  4PM9 A;  2ZMF A;  4XXR A;  4UQI M;  5HDC A;  3PXP A;  4EEU A;  3BRM A;  3T4S A;  3T1X A;  2EA9 A;  3HLF A;  4MN6 A;  3MSH A;  3ZCZ A;  3PBT A;  5A91 A;  2PU4 A;  1NYY A;  3UPO A;  2HPB A;  4OPQ A;  3BY9 A;  2QYB A;  1Y54 A;  2ZOI A;  4PPR A;  2WGW B;  1XA7 A;  4HOI A;  3T12 B;  5EPH A;  3S7O A;  1YQS A;  2VLG A;  3VOZ A;  4ZDX A;  5EVL A;  3MR0 A;  4Y2F A;  1CF0 A;  2PBD P;  1EWZ A;  1GSX A;  3P98 A;  4MN5 A;  1KOU A;  4OON A;  5GHX A;  4JXW A;  1MBL A;  5EE8 A;  4MCW A;  3ULF A;  2HDR A;  5M1A A;  5F68 A;  3HUO A;  4HJ6 A;  4GD8 A;  2PR5 A;  4EET B;  3ZYT A;  3CWF A;  4S2M A;  2RL3 A;  1Z6F A;  2A24 B;  3VP1 A;  4BEN A; 
#chains in the Genus database with same CATH homology
 4FSF A;  4BBT A;  2DMW A;  2H28 A;  2XRO A;  1TF1 A;  2LB9 A;  5HSQ A;  1LSV A;  5CX7 A;  3C8C A;  3BW6 A;  3F1P B;  2Z6D A;  4F3L A;  5KSH A;  3UE6 A;  2ZBB A;  1VB6 A;  2A24 A;  4WUJ A;  2K31 A;  2W1T A;  1P9W A;  3EQU A;  3MQ0 A;  2W27 A;  5TJJ A;  3PBR A;  1OT6 A;  4ARZ B;  3LIE A;  4IUK A;  3FPV A;  1DP9 A;  1W63 M;  3MMH A;  4I3I A;  4HNB A;  1S67 L;  3PBN A;  1XJ3 A;  2JKR I;  3S7P A;  3F1N B;  3EEH A;  2M1C A;  1DP6 A;  2GJ3 A;  3HJK A;  3PR6 A;  1NLZ A;  3C2W A;  2BAS A;  2XRN A;  1LSW A;  1OJG A;  2O99 A;  3CI6 A;  3PHY A;  4HHD A;  2P08 A;  3UMD A;  5J7E A;  5AVE A;  2W3G A;  2W3E A;  2V1B A;  1G6O A;  3ICY A;  1TS7 A;  3CLO A;  3F1N A;  3KYQ A;  5HDS A;  5G4Z A;  5AVF A;  2I9V A;  4HY8 A;  1TS6 A;  3KSH A;  1T1A A;  4WF0 A;  2J3W A;  2CMN A;  5G4Y A;  5FL3 A;  3W2Z A;  3LIA A;  2GNX A;  5L8M A;  4JGR A;  3T4K A;  4EUV A;  2WKR A;  3GEC A;  1DP8 A;  2EWW A;  4QPR A;  3H9W A;  4R3A A;  1S1Z A;  4Q0H A;  3NJA A;  3KSI A;  2FH5 A;  1OTD A;  2W3D A;  4R70 A;  1OJ5 A;  3A0V A;  2HJ9 C;  2NUP C;  2VZW A;  3T4J A;  3LR3 A;  2WKQ A;  4PKY G;  3C38 A;  2QKP A;  2OAQ 1;  3LID A;  5IS1 A;  4L9G A;  3KX0 X;  1BYW A;  3MFX A;  3S7N A;  4K08 A;  4BBU A;  4EU0 A;  2O9B A;  1H8M A;  3B47 A;  2INW A;  3H7W B;  2JKR M;  4O01 A;  4RQ9 A;  2JN7 A;  4I3A A;  5TBM A;  3EOI A;  4HJ3 A;  3NOU C;  2PR6 A;  3EQV A;  2QHK A;  4B93 A;  2O9C A;  2P7J A;  2VV7 A;  3BY8 A;  2L1M A;  4WL9 A;  1D7E A;  4UEY A;  3T50 A;  1W63 Q;  1T19 A;  4LPZ A;  2M7V A;  4Z1W A;  4DJ2 A;  4G3W A;  3H7W A;  4EEP A;  4EER A;  4EQ1 A;  1MKM A;  3BJN A;  2L0W A;  1XFQ A;  5AJG A;  3LI9 A;  1NLY A;  2Z6C A;  4FOF A;  4MN7 A;  3GDI A;  2PD8 A;  3BWL A;  4LRX C;  5DKK A;  5F6A A;  1S4R A;  2PT7 A;  3EGX C;  4HJ4 A;  4HQA A;  4MMN A;  1T1C A;  2VGL S;  1Y28 A;  2D01 A;  4OOL A;  2V1A A;  4ETZ A;  4IUH A;  3B33 A;  4YOF A;  4GCZ A;  3P01 A;  4WEL A;  3U2A A;  3K2N A;  2K7S A;  3OCL A;  2ZOH A;  5C5K A;  4DN0 A;  4BJP A;  1TS8 A;  3JVV A;  5HPF A;  3EGD C;  2IA2 A;  3MF0 A;  3TJZ C;  3VE4 A;  2VJW A;  2B02 A;  4LRY C;  2QJ5 A;  3CIT A;  1XJ4 A;  3NOT C;  4WEK A;  3RH8 B;  3F1P A;  3RTY A;  1F98 A;  2FZ0 A;  3VOL A;  1GSV A;  3ZQ5 A;  1P0Z A;  3E4P A;  3D72 A;  3DBA A;  4KUO A;  4NXG A;  3UB6 A;  4JGP A;  2J3T C;  2PHY A;  3IBR A;  4E04 A;  4XT2 B;  4EW7 A;  1H3Q A;  4ARZ A;  3MQO A;  2VX8 A;  4BMW A;  2HV1 A;  3LR0 A;  3VE3 A;  4DMZ A;  3EWK A;  4GHI B;  4IHQ A;  2YKF A;  4II7 A;  1N9N A;  4ME4 A;  4P6Z S;  2WKP A;  2L4R A;  3NOP C;  5HPI A;  1S4S A;  3D3O A;  1D06 A;  4WLA A;  1TS0 A;  3FG8 A;  1UWP X;  4HP4 A;  3R7W B;  1WA9 A;  3PBS A;  2PDR A;  4GHI A;  1F9I A;  1OTB A;  5DF9 A;  4GW9 A;  4MDZ A;  2KX6 A;  1EW0 A;  3UME A;  3LI8 A;  2OAP 1;  3TE8 A;  4H6J B;  2NUT C;  2Y8H A;  5EFW A;  2W3F A;  3LR5 A;  3OOV A;  5LBR A;  2K2N A;  1X0O A;  3T4Q A;  5IT5 A;  3K3C A;  1LT0 A;  4YNR A;  1F5M A;  3E0Y A;  3EEA A;  4HI4 A;  4NXF A;  1LL8 A;  3OC2 A;  3UE3 A;  3IBJ A;  1T18 A;  1YSP A;  4NXE A;  1P9R A;  2VGL M;  4NKP A;  1GSW A;  4GLQ A;  3F1O B;  1ZHH B;  1MZU A;  3CAX A;  2M7U A;  1S1Y A;  2XSS A;  3LIB A;  3IS2 B;  2OWJ A;  2V0W A;  3R4K A;  4CLC C;  4R38 A;  5HWV A;  1DRM A;  4I38 A;  5DKL A;  4BWI A;  5J3W A;  4WEJ A;  1XJ6 A;  2MJ6 A;  1TD5 A;  4UQI S;  1G28 A;  4LRZ E;  5HWT A;  3PBO A;  3H82 B;  3PBQ A;  2LB5 A;  2J3T D;  3B42 A;  5HD3 A;  3FC7 A;  4NEE D;  4O8G A;  4PAU A;  2R78 A;  3E4O A;  1MC0 A;  4LLO B;  4DJ3 A;  3CUE A;  2KOI A;  4GS9 B;  4BBV A;  3UB8 A;  1S66 L;  4G3V A;  4YWZ A;  4G3K A;  4CLC E;  3V67 A;  3KSG A;  3H82 A;  4M4X A;  2VV8 A;  5A8B A;  4PKY A;  2JKT I;  1NRJ A;  4HIA A;  4F3L B;  3K3D A;  4Q0I A;  3TRC A;  3SW1 A;  1STZ A;  2VA0 A;  4O0P A;  2VV6 A;  3G6O A;  4GS9 A;  4L9F A;  2W1T B;  3LR4 A;  4P6Z M;  1IFQ A;  1T1B A;  5J4E A;  3KO6 A;  2ZMV A;  5DJT A;  1YAX A;  4AFI A;  4JGQ A;  4JGO A;  2V0U A;  3OBF A;  4OOM A;  5I5L A;  2JHE A;  1P97 A;  5MC7 A;  4CQH A;  3NHQ A;  4KQO A;  1OT9 A;  4NXB A;  3T4T A;  1XJ2 A;  5DFY A;  3UB7 A;  2OWH A;  3KSF A;  3LFV A;  3MXQ A;  3P7N A;  2PYR A;  3A0S A;  1V9Y A;  4Y3I A;  2A2L A;  4PHT A;  3KYZ A;  3S7Q A;  4HH2 A;  4IJG A;  2HF6 A;  2VEA A;  2O9A A;  2J80 A;  1NWZ A;  1ZTU A;  3A0R A;  2GZA A;  3C30 A;  3O5Y A;  3PYP A;  4R6L A;  4XT2 A;  4CLC D;  1XFN A;  4EES A;  1OTI A;  5DFX A;  3T4O A;  1LSX A;  4B9O A;  2W1R A;  3BQA A;  2XA7 M;  1UGU A;  4Q0J A;  5HL6 A;  3LYX A;  3FPW A;  2Y79 A;  2W0N A;  1OPX A;  2QJ7 A;  2B18 A;  4ETX A;  2KLI A;  4HH3 A;  1OTA A;  2QWS A;  1ODV A;  3LIF A;  2JKT M;  2ZMF A;  4I3J A;  3HJI A;  1UWN X;  4L0L A;  4UQI M;  5HDC A;  2HJE A;  3PXP A;  4EEU A;  3R7W A;  1YSQ A;  3T4S A;  2EA9 A;  1IOU A;  4MN6 A;  4Y5F A;  1V9Z A;  1JNU A;  2PYP A;  3PBT A;  3VV4 A;  3OLO A;  2XA7 S;  5HWW A;  4ZRR A;  3BY9 A;  4H6J A;  2QYB A;  2ZOI A;  3TW8 A;  5TBM B;  4KQD A;  1VHM A;  2PD7 A;  2VKS A;  3LUQ A;  2GX5 A;  2P04 A;  2G7U A;  3BQ8 A;  3MQQ A;  3E98 A;  4I39 A;  4EXO A;  4HOI A;  2HGV A;  3S7O A;  2VLG A;  3JVU A;  4WN5 A;  3MR0 A;  4Y2F A;  3CUE C;  2D02 A;  4L9E A;  5DJU A;  3F1O A;  3T4L A;  4I5S A;  2EWV A;  5HDD A;  4CLC B;  1N9L A;  3IS2 A;  4HP9 A;  1GSX A;  3MJQ A;  3E4Q A;  4MN5 A;  5KIZ A;  1KOU A;  1YKD A;  5F69 A;  2O0Y A;  1OTE A;  4KUK A;  5HZH A;  3UB9 A;  2YKH A;  1N9O A;  3LIC A;  4MCW A;  4GJ4 A;  5IU1 A;  3ULF A;  2OOL A;  3HCY A;  2KDK A;  5HD5 A;  3RFB A;  5F68 A;  4HJ6 A;  4CLC A;  5K5B A;  5F5Y A;  2W3H A;  2PR5 A;  3OCN A;  2V9A A;  4EET B;  3ZYT A;  3CWF A;  2A24 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...