2PR6A

Structural basis for light-dependent signaling in the dimeric lov photosensor ytva (light structure)
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
128
structure length
128
Chain Sequence
b'LDHVRVGVVITDPALEDNPIVYVNQGFVQMTGYETEEILGKNCRFLQGKHTDPAEVDNIRTALQNKEPVTVQIQNYKKDGTMFWNELNIDPMEIEDKTYFVGIQNDITKQKEYEKLLEDSLTEITALS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Blue-light photoreceptor
molecule tags Flavoprotein, signaling protein
source organism Bacillus subtilis
publication title Structural Basis for Light-dependent Signaling in the Dimeric LOV Domain of the Photosensor YtvA.
pubmed doi rcsb
total genus 42
structure length 128
sequence length 128
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13426 PAS_9 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2pr6A00
5IS1A 3MJQA 4EERA 2D02A 4LPZA 2R78A 2KDKA 2V1AA 3IBRA 3D72A 2ZOIA 4HQAA 4R70A 3BY9A 2V0WA 3H7WB 2W0NA 3IS2A 4HJ3A 5HDDA 2V0UA 3CWFA 2BASA 4I3AA 5HD3A 1KOUA 2W27A 1OJGA 2ZBBA 1LT0A 4HP4A 4R3AA 5HWWA 1T1CA 2GJ3A 3E4OA 4GS9B 5IU1A 3LI8A 4NXBA 3F1NB 2VV7A 2QWSA 3C8CA 1F9IA 2V1BA 4GS9A 4HJ4A 1V9YA 5F5YA 2WKRA 4HJ6A 1F98A 1P97A 1OTDA 1TS7A 2ZOHA 3MXQA 4NXGA 2B02A 1G28A 3KX0X 3ULFA 4E04A 3B33A 4EEPA 2L0WA 3T50A 4HHDA 3LICA 3PYPA 5I5LA 3BWLA 3LUQA 4MN5A 3UB9A 3EWKA 5HDCA 1UWPX 1DRMA 2L1MA 3A0VA 3LIEA 4GHIB 5A8BA 2V9AA 3LI9A 2K7SA 4GHIA 5J4EA 3P7NA 5AVFA 4KUKA 1V9ZA 2A24B 2Z6DA 1P0ZA 1Y28A 3EEHA 2PHYA 3H82A 3LIBA 2QKPA 3LYXA 3UMEA 2YKHA 3MFXA 4H6JB 3NOPC 1T1BA 2M1CA 2VEAA 4R38A 1N9NA 5J3WA 3VOLA 1T1AA 4RQ9A 4BBUA 3F1OA 5DJTA 4HY8A 1D7EA 2JN7A 5G4ZA 3GECA 1S4SA 5EFWA 5HWTA 3PHYA 1MZUA 4GCZA 5HDSA 1OTAA 1XFNA 1S1ZA 1S4RA 5TBMA 2A24A 3F1OB 4JGQA 4JGRA 3FG8A 1NWZA 1XJ2A 2YKFA 4PKYG 3UB7A 2PYPA 3E4PA 4LRYC 2OWHA 4NXFA 4H6JA 3OLOA 4EQ1A 1S1YA 1S67L 2WKQA 2OOLA 3VE3A 3NOUC 3HJKA 4LRZE 4WF0A 4BBTA 1LSXA 2PR5A 1BYWA 2Z6CA 3H7WA 3IS2B 5F6AA 5AVEA 4EW7A 5HZHA 2PD8A 2EA9A 4I3JA 4HNBA 1EW0A 2JHEA 1GSXA 1DP9A 1OT9A 1TS6A 2QHKA 3F1PB 3FC7A 1N9OA 4HH2A 4XT2B 4LLOB 4L9EA 1LSVA 4KUOA 5F68A 2PR6A 5F69A 3C2WA 4JGOA 4L9GA 2VV8A 4WUJA 3GDIA 1T18A 4BBVA 3BY8A 5J7EA 2KX6A 2INWA 5DKKA 1XJ3A 2I9VA 4HI4A 3UMDA 4WN5A 4DJ3A 3MQQA 3NJAA 2J80A 3RTYA 4EETB 3MQOA 3UB8A 3UB6A 5KIZA 1UGUA 1LL8A 1X0OA 2HV1A 2WKPA 4L9FA 5G4YA 4DJ2A 1JNUA 3H82B 4GW9A 3RH8B 1LSWA 1OJ5A 1OTIA 2QJ7A 5TBMB 4R6LA 3SW1A 3UE6A 4WLAA 2PDRA 3G6OA 4LRXC 1N9LA 2L4RA 4I5SA 2P7JA 4HP9A 1UWNX 1DP8A 1GSWA 4F3LA 4EESA 2H28A 3K3DA 2CMNA 3HJIA 3NOTC 3A0RA 3K3CA 4HH3A 1VB6A 4HIAA 4M4XA 4WL9A 1DP6A 4PKYA 5HWVA 5HSQA 4XT2A 3LIFA 1OT6A 2VV6A 3LIAA 3LIDA 3H9WA 4JGPA 4I3IA 4EEUA 4HOIA 4K08A 4YWZA 4F3LB 3F1NA 3A0SA 1GSVA 1T19A 4MN6A 3VE4A 1ODVA 1TS8A 2PD7A 4NXEA 1WA9A 3ICYA 1OTEA 2QJ5A 2VLGA 4I39A 3ZQ5A 4B9OA 1XJ6A 3CLOA 4KQDA 3CAXA 1D06A 4I38A 1XFQA 2D01A 3E4QA 3MR0A 2PYRA 1OTBA 1XJ4A 2OWJA 1S66L 3NHQA 5DJUA 3F1PA 1TS0A 5DKLA 4EXOA 5HD5A
chains in the Genus database with same CATH superfamily
3M2KA 3NECA 4HQAA 4CLCD 3Q07A 3S7NA 1J3WA 2P08A 2ZBBA 5CGXA 4BD1A 3IF6C 2O9AA 3MXSA 3DTIA 5TR7A 4NXBA 3WS5A 5G18A 4Y3IA 4Y5FA 5FQJA 3T4LA 1BTLA 4E04A 3UDXA 4S2MA 5GLCA 3EWKA 3SH8A 3T4KA 4FOFA 2V1ZA 1ZG4A 4MLLA 4R38A 2WKHA 4DDYA 5DFYA 2HJEA 2J9OA 4JBFA 4MEZA 4KG6A 1XFNA 5DF9A 3E4PA 2O9CA 3HREA 3CZDA 3FYZA 2VGKA 1L2SA 2FH5A 4Y0TA 3A3DA 3OPPA 4QU3A 4WZ5A 4FCFA 4R4SA 4YNRA 5BOHA 3MQQA 4OP5A 4Y17A 4FH2A 2EWWA 1X0OA 2WKPA 1JVJA 2ZLYA 1H0MA 1W79A 1OJ5A 4WZ5C 1H8YA 3IBJA 4LRXC 2L4RA 5FATA 5DFXA 1Q2PA 4JGPA 4UQIS 1ES4A 1K6RA 4JXGA 3AGDA 4LV0A 3IH8A 3CAXA 4I38A 5F1FA 5DJUA 3OPHA 3A3EA 4N1XA 4P85A 2J8YA 2Y2OA 1H8MA 4N9LA 2K2NA 1OJGA 5EM1A 1LT0A 3FWLA 3T1QB 3OOVA 3RXXA 3QNCA 1IKGA 5DF7A 4DDSA 4JXSA 5E2GA 4B88A 4PM9A 1SDNA 3MSHA 4QHCA 2QYBA 5AQAA 3GECA 3DWKA 3LR3A 1OTAA 3NC8A 3VMAA 1BT5A 1XJ2A 3BW6A 4RX2A 4Y2FA 3CI6A 4OOYA 1GCEA 2EA9A 5F83A 1GSXA 1BLHA 3F1PB 3ZCZA 1NLZA 2WYXA 3W4PA 2W3HA 2LB9A 5F69A 4OP8A 4RYEA 3VP3A 3ITAA 3O88A 4BLMA 4EUVA 3WS0A 4Y15A 1ONHA 3WS1A 4LV1A 1MWUA 2XH9A 2JBFA 4QJGA 3LCEA 1LSWA 3ITBA 3IWIA 2WKIA 2XSSA 4K0WA 4R3JA 5IT5A 5FEFA 3Q82A 3CG5A 2Y2KA 4D60A 4R23A 3S7OA 1FCMA 1QMEA 1XX2A 3F1NA 3ZG5A 4OPQA 4UAAA 4HEFA 3BFFA 1IEMA 1CK3A 1PZOA 5CTMA 1YKDA 4EERA 4LPZA 3CHWP 2VGJA 3D72A 2Y2JA 4E6WA 5KZHA 2DMWA 2VA0A 4OPRA 4LCMA 1G6OA 1YAXA 1IELA 4ETZA 5E2EA 2B02A 3TE8A 1FCNA 2L0WA 4EUZA 5KSCA 1YLJA 3UB9A 5EOOA 2OLVA 1NYMA 3LI9A 3O86A 1F5MA 2QKPA 3UMEA 5KSHA 3VOLA 1G68A 2XFTA 2HP9A 4X25A 2PBDP 3MQ0A 3FG8A 2DRWA 3MZFA 3OLOA 3R4KA 4O01A 3SZTA 3Q7VA 4CLCC 1JTDA 5CGWA 4GLQA 2XRNA 4HNBA 1H8ZA 4L9EA 4FSFA 1T18A 1K6SA 4WMCD 3LY4A 5FI7A 1MWSA 3MQOA 3UO9A 1LHYA 4GOGA 3VFHA 2BTFP 2WADA 3LR4A 2Q9NA 2P9VB 1JWPA 3NOTC 4P87A 4EEPA 4D2OA 3A0RA 4XXRA 4OH0A 1KVLA 5EVIA 2ZC7A 3IT9A 5GLBA 3IXBA 3A0SA 3D9YA 5FAOA 2PYRA 2OWJA 1MKMA 3G32A 5DKLA 3CUEA 4KZ3A 5CERA 4X68A 1TDGA 3SS5A 4OLDA 4ZDXA 3R7WB 1V9YA 2G2WA 1TS7A 2V8FA 1K57A 3HLEA 3PYPA 4EU0A 1FSWA 3HLGA 2V9AA 2K7SA 3V3RA 1XGJA 4O0PA 3PBRA 2EX8A 3UDFA 2PHYA 3ZHHA 1MY8A 4UQIM 1YMSA 4R4RA 1JWVA 4FUWA 1YSPA 1HTZA 3UNWA 3WS4A 1ES5A 2C5WB 3BRMA 3D3OA 2OWHA 4MDZA 4KZ6A 4XUXA 4N9KA 4BJPA 2B5RA 4WBGA 4BBTA 2HPBA 3H7WA 1JWZA 3KO6A 4YWZA 1DP9A 4PMAA 1NJ4A 3BEBA 5DF8A 3D4FA 4S2NC 2VV8A 1HZOA 4OVDA 1K4EA 1OPXA 1XJ3A 2JE5A 1KVMA 3RTYA 2J3WA 1KGFA 2M7UA 3VP2A 5EV0A 4NK3A 1SHVA 4DJ2A 3PTEA 5C5KA 3C4PA 4HP9A 4GJ4A 3W4QA 1YLTA 5HWVA 3CMZA 3LIFA 3LIAA 4S2NA 1TS8A 3IHAA 3ZQ5A 2JKRI 4KQDA 3BFGA 1S66L 3TRCA 4EXOA 2B95A 1ZC2A 2VKSA 3LEZA 2JKTI 2WGWA 3Q7VB 5GLDA 2Y79A 3M6BA 3G30A 3MXQA 2G2UA 5CGSA 3IX4A 4UA7A 1C3BA 4GHIA 3P7NA 4XUZA 4ZTKA 1P0ZA 1Y28A 3G35A 2GDNA 4HBTA 1N9NA 2ZQ9A 1BLPA 3C5AA 5FDHA 1U60A 4NETA 1XXMA 3GSGA 3NBLA 4EBPA 1XPBA 2OV5A 2WGIA 3MMHA 4JLFA 2H0TA 3JYIA 4H6JA 4GNUA 2M7VA 4L0LA 4CLCA 5F6AA 2IWDA 4YINA 1DJAA 3KSHA 2XA7S 1ES2A 5FEGA 1ZG6A 4KQRA 4WYYA 1L0GA 2KX6A 4DJ3A 2HJ9C 4L9FA 1E4DA 3NIAA 4IUHA 5AQ7A 4IVKA 4P6BA 3ZVWA 3WRTA 5TBMB 3GRJA 4MBKA 4ARZA 1EWZA 4K0XA 3S7QA 4HH3A 3LEQA 4GD8A 4S2LA 2WZZA 3QHYA 1BLSA 3V3SA 5AJGA 1XJ6A 3B42A 4FD8A 5GHXA 1G6AA 3NHQA 2XK1A 4M3KA 5FSRA 2ZC5B 1K25A 2R78A 3K2NA 1LI9A 5HAPA 3BQAA 4WELA 1SKOB 2HGVA 2P74A 4UA6A 4DMZA 5HW3A 1P97A 1OTDA 5TJJA 3R7WA 3HCYA 1EI5A 1PW8A 3LIEA 4PAUA 5FA7A 3EGDC 5FQKA 2Z2LB 4IEDA 4RX3A 1I2WA 2XF3A 3O3VA 4X53A 2YKHA 2Y91A 2V20A 3UE1A 5M1AA 3T4QA 3GVBA 2Y2HA 2V8CA 4G3VA 1Y54A 3OZHA 4ETXA 2YKFA 1PWCA 1YLWA 3MBZA 3TW8A 2EWVA 5AVEA 4MBFA 2J9PA 4OQGA 4DXBA 1K54A 3O87A 1OT9A 1BLCA 5L2FA 1LSVA 4KUOA 2HF6A 3GR2A 3T4OA 1Z09A 5J7EA 2INWA 4ZJ1A 4WN5A 3VV4A 3ZG7B 5FQ9A 4HESA 4S2JA 5FAPA 3FPVA 1MC0A 3GMWA 3H82B 2HDUA 1N9LA 1DP8A 1MBLA 2WZXA 3N8RA 4MN7A 3P98A 4HOIA 1FSYA 4K08A 2JKRM 4LGWA 3ZYTA 1GSVA 2WAEA 1PZPA 1XKZA 4G3WA 4FH4A 3MR0A 1XJ4A 1Y4OA 2Y2GA 2W3EA 3ISGA 5IS1A 4RA7A 4X1MA 3UY6A 1KDWA 4KQOA 4B93A 4HJ3A 5HDDA 5HD3A 4DN0A 3ZVTA 3PBSA 2GJ3A 1LI0A 2ZQCA 5EUAA 2ZOHA 1XA7A 2K31A 2Y59A 4MN5A 4MMNA 1ERMA 1IYPA 2B18A 2FFYA 3KSGA 4DRTA 4KUKA 1YMXA 3LIBA 1W63Q 3L9KA 4H6JB 1T1BA 4NEED 1BUEA 5DJTA 2VZWA 1MWTA 2UWXA 1S4SA 2W3DA 1SCWA 2EFUA 1S4RA 1WYBA 1RCJA 5DTTA 4NG2A 1VEUA 2JKGA 3RFBA 3QP4A 3OCNA 3T4SA 4JKTA 3HVFA 4WF0A 3MKEA 4HBUA 1TS6A 5HPIA 1FR1A 3W2ZA 4GB7A 5HAIA 3VP0A 3G4PA 4WUJA 2IWBA 2J3TC 3BY8A 4ZJ2A 4DF6A 3DWZA 1XA1A 2J80A 3NCKA 3UB8A 2PU4A 2O0YA 1JNUA 3V50A 5HL6A 3Q1FA 3HUMA 1M40A 4I5SA 2ZM8A 2JKFA 3HJIA 1PRQA 5CRFA 2VV6A 1K0KA 3H9WA 3M6HA 5FL3A 3V5MA 3MFDA 3FPWA 4F3LB 2FFFB 2VX8A 5L07A 4BWIA 3CLOA 1D06A 1RP5A 4LV2A 1LL9A 1M6KA 3LR5A 2OAP1 1N4OA 2GNXA 1IKIA 4Q0HA 2CC1A 3H7WB 3LFVA 3CWFA 2BASA 3MXRA 1STZA 4P0MA 3UPOA 4YOFA 3F1NB 4NXGA 4ESPA 4O7DA 3ZNTA 2A3UA 3N4IA 3LUQA 1QMFA 1UWPX 4GHIB 4QD4A 1V9ZA 3H82A 1EROA 1I2SA 1MWRA 3UPPA 2ZMFA 1ALQA 5EECA 1Q2QA 4JGRA 1IYSA 1YSQA 4LRYC 3A3JA 4NXFA 2ZC6B 1ESUA 2QZ6A 3IH9A 3UDIA 3UN7A 1W63M 1K56D 4BL2A 4I3JA 1H5XA 1EW0A 3BFDA 2ZQ8A 3IWOA 1ZHHB 2XGNA 3S1YA 5A90A 3CPTA 3NULA 4C6YA 3UPNA 3PBOA 4LCLA 1KGEA 4GDNA 4OKPA 1OTIA 4II7A 2A49A 2W3GA 5EE8A 5FQQA 4EESA 3HLWA 1DP6A 4PKYA 2JCHA 5KMWA 3O5YA 3IXGA 1T19A 4B4ZA 2PD7A 1WA9A 3CITA 2WUQA 4KZ4A 1CEFA 3E4QA 4Z1WA 4OONA 1E25A 3N8SA 5CTNA 2V0WA 5CEBA 5FAQA 3QP6A 4GS9B 1AXBA 2BG1A 3ULFA 1JTGA 1NLYA 3W4OA 3VP1A 5HDCA 3A0VA 4S2PA 3ZNYA 4JGOA 3NOPC 2M1CA 3T1RA 4BENA 1FQGA 5J3WA 1ERQA 1LL5A 1D7EA 2JN7A 5G4ZA 2WK0A 5EFWA 4OQ0A 5F1GA 1P9WA 2OAQ1 3N7WA 2XDMA 2A24A 5M19A 4X56A 2DCFA 3LGOA 4UHUA 4ME4A 1FR6A 1K56A 3HJKA 4JF5A 3IF6B 2XLNA 2PR5A 3GQZA 2Z6CA 4ZJ3A 3HLFA 2W1TB 2XEPA 4IUKA 1VEUB 5HAQA 2HZ5A 3UE3A 3DW0A 4E3JA 1VETB 4WZ4A 1PIOA 5FDSA 5HL1A 4GW9A 2HP6A 4KZAA 1DY6A 2IWCA 3VP4A 1VB6A 1GHIA 4E3KA 2G7UA 1GA0A 3G31A 1S6RA 3ICYA 5A91A 1OTEA 4MNRA 3DTKA 5CHJA 1VM1A 1OTBA 3BJNA 5EVID 2J7VA 3KYEA 1K55A 2QPNA 2Q0OA 5EOEA 2ZOIA 4KZ8A 1VQQA 3DBAA 3MZEA 5IHVA 1TVFA 4BD0A 3LI8A 3T1SA 2QWSA 4QPRA 5EPHA 4Y0OA 3BECA 5J8XA 1G28A 5HPFA 3T50A 2WKEA 1K38A 3BWLA 3PR6A 2Y4AA 4F94A 1W5DA 2GX5A 2ZMAA 3Q7ZA 3C38A 2X02A 2ZC3B 3C7VA 2HDRA 3T4TA 2ZQ7A 2PAVP 2Q9MA 1HLUP 4O8GA 2KOIA 4G3KA 4ARZB 2ZJ9A 4GCZA 4U0XA 5TBMA 4JGQA 2X01A 4N1HA 3IWQA 4PM8A 3LO7A 5HX9A 4LRZE 3IF5A 3G2YA 3FC7A 4XT2B 3TJZC 1VHMA 3ZDJA 3AGFA 3IQAA 3UMDA 5L09A 3EOIA 3NY4A 5KIZA 3ZGAB 5G4YA 2QJ7A 5FI6A 2Y2IA 1UWNX 3NDGA 3E98A 1ESIA 2XQZA 4WL9A 2H5SA 3MF0A 3T1XA 1AWIA 2EX9A 4DE0A 4H8RA 5DTKA 3E2KA 2PT7A 4I39A 1KDSA 1YT4A 2EX2A 1BZAA 3Q81A 3IBRA 4AFIA 4I3AA 3E2LA 2VGLM 5HWWA 1RGZA 5FQIA 4GS9A 3ZG9B 2WKRA 3PBQA 3B33A 5EVLA 3T12B 3QNBA 2R9WA 4KG2A 2P9VA 4CLCB 3LYXA 1OMEA 2Y8HA 1NRFA 4E3OA 4QY5A 3A3FA 4Y0UA 3EEAA 2XROA 4IVIA 1CQAA 3S4XA 1E3UA 3EQUA 4EQ1A 2WKQA 4E6XA 3NOUC 1LSXA 1YLPA 5HZHA 4PM7A 4BQMA 3HLBA 1N9OA 3DAVA 5HARA 1A0KA 4PM6A 2I9VA 3BM6A 4HI4A 4OOLA 4DKIA 4EETB 1NYYA 1FCOA 2HP5A 2EFXA 3RH8B 5JYPA 4DE1A 3G2ZA 2XD5A 3BLMA 1GSWA 2W3FA 2H28A 4DE2A 1K57C 1OT6A 3FKWA 1KE4A 3VSKA 4B9OA 4E3NA 2RL3A 3IX3A 2ZC4B 4X69A 5A92A 5M18A 2D02A 5A93A 2KDKA 2V1AA 1K55C 3G34A 3EQVA 1KOUA 4E3MA 5CHUA 2EXAA 2VGLS 2JKTM 3E4OA 2VV7A 1J9MA 2XD1A 2ACGA 5F5YA 4S2IA 3KX0X 4Y7PA 4Y13A 4X1LA 4HHDA 1CI9A 4IJGA 3MS6A 4ZAMA 1DRMA 4Q0JA 5FQMA 1PWDA 5AVFA 5J4EA 1TDLA 4IBXA 1SZVA 1I5QA 1T1AA 4RQ9A 5AQ9A 1L0DA 3N6IA 4BBUA 4KZ9A 3BQ8A 3KSIA 2DNSA 3PBNA 4DE3A 4LV3A 5TFQA 1MXOA 5L8MA 5HDSA 3S7PA 4EW7A 4PKYG 2X71A 3PXPA 1IOUA 3NI9A 3CPTB 1S67L 4LFUA 3FV7A 3IS2B 3OCLA 1NY0A 1TF1A 1PI4A 3EGXC 5K5BA 4U3TA 1MPLA 3WS2A 5DKKA 5D3OA 4EV4A 2PBYA 3T4JA 3NJAA 3OPRA 4KG5A 1PI5A 2HV1A 2I72A 1ACFA 3WRZA 1L0FA 1PW1A 5DTSA 2PDRA 5AQBA 3G6OA 4OPYA 2MJ6A 3K3DA 5MC7A 3LIDA 3IX8A 1FILA 4EEUA 4JPMA 1IFQA 5CXWA 5L10A 3ZFZA 5EVIB 4KENB 5GLAA 4GDBA 4LENA 1TS0A 1PWGA 2ZQAA 2WAFA 4EQIA 1NXYA 4GN2A 4PPRA 2ZL1A 2IA2A 2W27A 4GD6A 1FOFA 2ZM0A 1LLBA 3WWXA 1FIKA 5HFOA 3I7JA 4ZRRA 1YM1A 1SKFA 3PAGA 1IYQA 3UB5P 3HUNA 3LICA 3JVUA 5EM0A 2A24B 2C6WB 3HLDA 1W7FA 2KLIA 3TG9A 1ZTUA 3E0YA 5EVEA 4HY8A 1DJCA 3VFFA 3BFEA 2Y2LA 1SDEA 3IHBA 3B47A 1S1ZA 3VSLA 4UA9A 3F1OB 5JYOA 3JPUA 3MZDA 1S1YA 4KZ5A 4P6ZM 4CPKA 3KYQA 4MBHA 1GA9A 3VOYA 4BMWA 4LLOB 3QP8A 3ZG0A 3A3IA 2W1RA 3JVVA 1K4FA 4KZ7A 3GDIA 5U47A 2QMIA 5EVIC 4WEKA 4Z9QA 1F2KA 2BLSA 2Y2MA 1ONGA 4E3LA 3CUEC 1CI8A 5HSQA 4OQHA 4WM9A 2GZAA 3HBRA 3KYZA 1P9RA 3V39A 2W1TA 1ODVA 4NXEA 4X6TA 4R0QA 3SS4A 2PU2A 2EX6A 1XFQA 2D01A 3BFCA 4A5RA 4CLCE 1CF0A 4JF4A 1HVBA 1RGYA 5CECA 2JC7A 3CJMA 4HP4A 1W8YA 4R3AA 3C8CA 1SKOA 2V1BA 3MKFA 4HJ4A 5FI2A 4HJ6A 3NDEA 4CQHA 1VETA 3SS3A 4UEYA 5I5LA 3GTCA 1L3LA 5A8BA 3V67A 2OSUA 2Z6DA 4OQIA 3EEHA 3C4OA 4JF6A 1MKIA 4DXCA 4IHQA 2Y2PA 3P01A 2EXBA 4EWFA 3VOZA 1Z6FA 1NWZA 2NUTC 3UB7A 2LB5A 2PYPA 3RXWA 2OOLA 1S0WA 4X55A 3HUOA 1TEMA 2H10A 1E3UD 3HL9A 5F68A 1PYYA 2PR6A 4L9GA 2XR0A 3PBTA 1XP4A 2O99A 1PNEA 3UB6A 1LL8A 4R3BA 3IF6A 2UV0E 1ES3A 2H0YA 4WLAA 4F3LA 2A2LA 2CMNA 4M4XA 5GL9A 4XT2A 3RJUA 4GZBA 4I3IA 3IXDA 1TD5A 1L0EA 4P6ZS 2RCXA 4EBNA 3KSFA 3QP2A 3OBFA 4Q0IA 5E2HA 2HDSA 3B3XA 4S2KA 2ZQDA 3BY9A 2W0NA 4MCWA 2P04A 2V0UA 4RVAA 3N8LA 4K91A 2VK3A 4CJNA 3FKVA 4U0TA 1GHMA 4WMCA 4QY6A 4JXWA 4KQQA 1F98A 3BYDA 4IBRA 1BULA 2Y2QA 2L1MA 3LY3A 2HDQA 2VJWA 1YLZA 4R1GA 2VEAA 1NZUA 2ZM2A 2ZMVA 3F1OA 2PRFA 3U2AA 4Q8IA 2O9BA 1MZUA 2E8JA 3S22A 2OLUA 5E43A 3C30A 4OLGA 3SOIA 4PM5A 4WEJA 2V2FF 2NUPC 3VE3A 3PAEA 1YLYA 3M2JA 2XA7M 2JHEA 4HH2A 1D1JA 3P09A 1DJBA 1H3QA 2ZD8A 1O07A 1BSGA 1CJFA 3DTMA 1NRJA 1PFLA 1G5UA 1W8QA 4PHTA 1O7EA 3SW1A 4R6LA 1K54C 3UE6A 5E2FA 2P7JA 1IYOA 4QB8A 5F82A 3GV9A 3K3CA 4OPZA 4S2OA 4GKUA 3HLCA 3LR0A 4MN6A 1XGIA 2QJ5A 2VLGA 1WE4A 5I94A 2FZ0A 3L7HA 1YPRA 3TSGA 3C7UA 3MJQA 5TGFA 3W8KA 4C75A 2WGWB 4R70A 3IS2A 1KGGA 5CHMA 1T1CA 5IU1A 1KE3A 4YFMA 1F9IA 3OC2A 1KE0A 3SH7A 5CX7A 3FZCA 5GHZA 1ZKJA 1WYCA 3MFXA 2J3TD 2Z2MB 1NZOA 4OOMA 3U4LP 5LBRA 5HWTA 2AVXA 3PHYA 4E3IA 4FTXA 2ZL1B 2XFSA 1N9BA 2E8IA 1YQSA 4B4XA 3AGEA 2Y2NA 1BYWA 5GHYA 4N92A 5CEDA 4KZBA 3UE0A 2PD8A 2WGVA 2QHKA 1HD8A 3QP5A 4QWOA 2Y55A 3C2WA 4NKPA 4EBLA 4BBVA 3TOIA 1UGUA 3QP1A 4JXVA 5DVAA 3OPLA 4ID4A 1GHPA 3DTEA 4HIAA 3IXHA 3SH9A 4ZBEA 2R9XA 3ZG8B 3VE4A 3BLSA 1CEGA 4BL3A 3F1PA 4C3QA 5FASA 5HD5A
chains in the Genus database with same CATH topology
4HQAA 4CLCD 2VKSA 2V0WA 3S7NA 2JKTI 2IA2A 2W27A 2P08A 2ZBBA 2O9AA 4GS9B 2Y79A 4NXBA 4Y3IA 4Y5FA 3MXQA 3ULFA 3T4LA 4ZRRA 4E04A 1NLYA 3LICA 3JVUA 3EWKA 5HDCA 3A0VA 3T4KA 4GHIA 3P7NA 4FOFA 2A24B 4JGOA 1P0ZA 1Y28A 2KLIA 4R38A 3NOPC 1ZTUA 2M1CA 3E0YA 1N9NA 5J3WA 4HY8A 5DFYA 1D7EA 2HJEA 2JN7A 5G4ZA 5EFWA 1P9WA 3B47A 2OAQ1 1XFNA 1S1ZA 5DF9A 3MMHA 2A24A 3F1OB 3E4PA 2O9CA 4ME4A 4H6JA 1S1YA 2M7VA 4P6ZM 3KYQA 3HJKA 4L0LA 2PR5A 2Z6CA 4CLCA 5F6AA 2FH5A 4BMWA 3KSHA 4LLOB 4YNRA 2XA7S 2W1RA 3JVVA 3GDIA 2W1TB 2KX6A 4IUKA 4DJ3A 3MQQA 3UE3A 2HJ9C 4WEKA 2EWWA 1X0OA 2WKPA 4L9FA 4IUHA 4GW9A 1OJ5A 5TBMB 3IBJA 4LRXC 2L4RA 4ARZA 3CUEC 5DFXA 3S7QA 4HH3A 5HSQA 1VB6A 2GZAA 3KYZA 4JGPA 2G7UA 1P9RA 4UQIS 2W1TA 1ODVA 4NXEA 3ICYA 1OTEA 5AJGA 1XJ6A 3B42A 3CAXA 4I38A 1XFQA 2D01A 5DJUA 1OTBA 3BJNA 3NHQA 4CLCE 1H8MA 2R78A 3K2NA 2ZOIA 2K2NA 3DBAA 3BQAA 1OJGA 1LT0A 4HP4A 4R3AA 4WELA 2HGVA 3LI8A 3OOVA 2QWSA 3C8CA 4QPRA 2V1BA 4HJ4A 4DMZA 4HJ6A 1P97A 1OTDA 4CQHA 1G28A 5TJJA 3R7WA 3HCYA 5HPFA 3T50A 4UEYA 5I5LA 3BWLA 3PR6A 5A8BA 3LIEA 2GX5A 4PAUA 3V67A 3EGDC 2Z6DA 3C38A 3EEHA 2YKHA 3T4TA 2QYBA 4IHQA 3T4QA 3P01A 3GECA 4O8GA 2KOIA 4G3KA 4ARZB 4GCZA 3LR3A 1OTAA 4G3VA 5TBMA 4JGQA 1NWZA 1XJ2A 2NUTC 2YKFA 3BW6A 2LB5A 2PYPA 3UB7A 4ETXA 2OOLA 3TW8A 4Y2FA 3CI6A 4LRZE 2EWVA 5AVEA 2EA9A 1GSXA 1OT9A 3FC7A 3F1PB 4XT2B 1NLZA 3TJZC 1LSVA 1VHMA 2W3HA 2LB9A 2PR6A 4KUOA 5F68A 5F69A 2HF6A 4L9GA 3T4OA 3PBTA 5J7EA 2INWA 4EUVA 3UMDA 3VV4A 4WN5A 3EOIA 2O99A 3UB6A 5KIZA 1LL8A 5G4YA 3FPVA 1MC0A 3H82B 1LSWA 2QJ7A 4WLAA 2XSSA 1N9LA 1UWNX 1DP8A 4F3LA 5IT5A 3E98A 2A2LA 2CMNA 3MF0A 4MN7A 4WL9A 4M4XA 4XT2A 4I3IA 4HOIA 3S7OA 4K08A 2JKRM 3F1NA 3ZYTA 1GSVA 1TD5A 4P6ZS 2PT7A 4I39A 4G3WA 3KSFA 3MR0A 1XJ4A 1YKDA 2W3EA 5IS1A 4EERA 3OBFA 4LPZA 4Q0IA 3IBRA 3D72A 4KQOA 4B93A 4AFIA 2DMWA 3BY9A 4HJ3A 2W0NA 4MCWA 5HDDA 2VA0A 2P04A 2V0UA 4I3AA 5HD3A 4DN0A 2VGLM 1G6OA 5HWWA 3PBSA 1YAXA 2GJ3A 4ETZA 4GS9A 2WKRA 3PBQA 1F98A 2ZOHA 2B02A 3TE8A 3B33A 2K31A 2L0WA 4MN5A 3UB9A 4MMNA 2L1MA 2B18A 3LI9A 4CLCB 3KSGA 1F5MA 4KUKA 3LYXA 2VJWA 3LIBA 2Y8HA 2QKPA 1W63Q 3UMEA 5KSHA 4H6JB 1T1BA 2VEAA 3VOLA 4NEED 2ZMVA 3F1OA 5DJTA 3U2AA 2VZWA 2O9BA 1S4SA 1MZUA 2W3DA 3EEAA 1S4RA 2XROA 3C30A 3MQ0A 3FG8A 3RFBA 3EQUA 3OCNA 3OLOA 3R4KA 4O01A 4WEJA 3T4SA 4EQ1A 2WKQA 2NUPC 3VE3A 4CLCC 3NOUC 4WF0A 1LSXA 5HZHA 4GLQA 2XRNA 2XA7M 1TS6A 2JHEA 4HNBA 5HPIA 1N9OA 4HH2A 3W2ZA 4L9EA 4FSFA 4WUJA 1T18A 2J3TC 1H3QA 3BY8A 2I9VA 4HI4A 4OOLA 2J80A 4EETB 3MQOA 3UB8A 1NRJA 2O0YA 3LR4A 1JNUA 4PHTA 3RH8B 3SW1A 4R6LA 5HL6A 3UE6A 4I5SA 2P7JA 1GSWA 2W3FA 3NOTC 2H28A 4EEPA 3HJIA 3A0RA 3K3CA 1OT6A 2VV6A 3H9WA 5FL3A 3FPWA 4F3LB 3LR0A 3A0SA 4MN6A 2VX8A 4B9OA 4BWIA 2QJ5A 2VLGA 3CLOA 1D06A 2PYRA 2FZ0A 2OWJA 1MKMA 5DKLA 3LR5A 2OAP1 3MJQA 2D02A 2GNXA 3CUEA 2KDKA 2V1AA 4Q0HA 4R70A 3H7WB 3IS2A 3LFVA 3CWFA 3EQVA 2BASA 1KOUA 1STZA 4YOFA 2VGLS 1T1CA 2JKTM 3E4OA 5IU1A 3F1NB 2VV7A 1F9IA 3R7WB 1V9YA 3OC2A 5F5YA 1TS7A 4NXGA 3KX0X 5CX7A 4HHDA 3PYPA 4IJGA 4EU0A 3LUQA 1UWPX 1DRMA 4GHIB 4Q0JA 2V9AA 2K7SA 5J4EA 5AVFA 4O0PA 3PBRA 1V9ZA 3H82A 2PHYA 4UQIM 3MFXA 2J3TD 1T1AA 4RQ9A 4BBUA 3BQ8A 3KSIA 3PBNA 4OOMA 5LBRA 1YSPA 5HWTA 2ZMFA 3PHYA 5L8MA 5HDSA 3S7PA 4EW7A 4PKYG 4JGRA 3D3OA 3PXPA 1IOUA 1YSQA 4LRYC 2OWHA 4NXFA 4MDZA 1S67L 4BJPA 4BBTA 1W63M 3H7WA 1BYWA 3IS2B 3OCLA 1TF1A 2PD8A 3KO6A 4I3JA 3EGXC 1EW0A 1DP9A 2QHKA 4YWZA 5K5BA 3C2WA 4NKPA 1ZHHB 2VV8A 4BBVA 5DKKA 1OPXA 1XJ3A 3PBOA 3T4JA 3NJAA 3RTYA 2J3WA 2M7UA 1UGUA 2HV1A 4DJ2A 1OTIA 4II7A 2W3GA 5C5KA 2PDRA 3G6OA 4HP9A 4GJ4A 2MJ6A 4EESA 3K3DA 4HIAA 5HWVA 1DP6A 4PKYA 5MC7A 3LIFA 3LIAA 3LIDA 3O5YA 4EEUA 1IFQA 3VE4A 1T19A 1TS8A 2PD7A 1WA9A 3CITA 3ZQ5A 2JKRI 4KQDA 3E4QA 4Z1WA 1S66L 3TRCA 3F1PA 1TS0A 4EXOA 5HD5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IS1 A;  3MJQ A;  4EER A;  2D02 A;  4LPZ A;  2R78 A;  2KDK A;  2V1A A;  3IBR A;  3D72 A;  2ZOI A;  4HQA A;  4R70 A;  3BY9 A;  2V0W A;  3H7W B;  2W0N A;  3IS2 A;  4HJ3 A;  5HDD A;  2V0U A;  3CWF A;  2BAS A;  4I3A A;  5HD3 A;  1KOU A;  2W27 A;  1OJG A;  2ZBB A;  1LT0 A;  4HP4 A;  4R3A A;  5HWW A;  1T1C A;  2GJ3 A;  3E4O A;  4GS9 B;  5IU1 A;  3LI8 A;  4NXB A;  3F1N B;  2VV7 A;  2QWS A;  3C8C A;  1F9I A;  2V1B A;  4GS9 A;  4HJ4 A;  1V9Y A;  5F5Y A;  2WKR A;  4HJ6 A;  1F98 A;  1P97 A;  1OTD A;  1TS7 A;  2ZOH A;  3MXQ A;  4NXG A;  2B02 A;  1G28 A;  3KX0 X;  3ULF A;  4E04 A;  3B33 A;  4EEP A;  2L0W A;  3T50 A;  4HHD A;  3LIC A;  3PYP A;  5I5L A;  3BWL A;  3LUQ A;  4MN5 A;  3UB9 A;  3EWK A;  5HDC A;  1UWP X;  1DRM A;  2L1M A;  3A0V A;  3LIE A;  4GHI B;  5A8B A;  2V9A A;  3LI9 A;  2K7S A;  4GHI A;  5J4E A;  3P7N A;  5AVF A;  4KUK A;  1V9Z A;  2A24 B;  2Z6D A;  1P0Z A;  1Y28 A;  3EEH A;  2PHY A;  3H82 A;  3LIB A;  2QKP A;  3LYX A;  3UME A;  2YKH A;  3MFX A;  4H6J B;  3NOP C;  1T1B A;  2M1C A;  2VEA A;  4R38 A;  1N9N A;  5J3W A;  3VOL A;  1T1A A;  4RQ9 A;  4BBU A;  3F1O A;  5DJT A;  4HY8 A;  1D7E A;  2JN7 A;  5G4Z A;  3GEC A;  1S4S A;  5EFW A;  5HWT A;  3PHY A;  1MZU A;  4GCZ A;  5HDS A;  1OTA A;  1XFN A;  1S1Z A;  1S4R A;  5TBM A;  2A24 A;  3F1O B;  4JGQ A;  4JGR A;  3FG8 A;  1NWZ A;  1XJ2 A;  2YKF A;  4PKY G;  3UB7 A;  2PYP A;  3E4P A;  4LRY C;  2OWH A;  4NXF A;  4H6J A;  3OLO A;  4EQ1 A;  1S1Y A;  1S67 L;  2WKQ A;  2OOL A;  3VE3 A;  3NOU C;  3HJK A;  4LRZ E;  4WF0 A;  4BBT A;  1LSX A;  2PR5 A;  1BYW A;  2Z6C A;  3H7W A;  3IS2 B;  5F6A A;  5AVE A;  4EW7 A;  5HZH A;  2PD8 A;  2EA9 A;  4I3J A;  4HNB A;  1EW0 A;  2JHE A;  1GSX A;  1DP9 A;  1OT9 A;  1TS6 A;  2QHK A;  3F1P B;  3FC7 A;  1N9O A;  4HH2 A;  4XT2 B;  4LLO B;  4L9E A;  1LSV A;  4KUO A;  5F68 A;  2PR6 A;  5F69 A;  3C2W A;  4JGO A;  4L9G A;  2VV8 A;  4WUJ A;  3GDI A;  1T18 A;  4BBV A;  3BY8 A;  5J7E A;  2KX6 A;  2INW A;  5DKK A;  1XJ3 A;  2I9V A;  4HI4 A;  3UMD A;  4WN5 A;  4DJ3 A;  3MQQ A;  3NJA A;  2J80 A;  3RTY A;  4EET B;  3MQO A;  3UB8 A;  3UB6 A;  5KIZ A;  1UGU A;  1LL8 A;  1X0O A;  2HV1 A;  2WKP A;  4L9F A;  5G4Y A;  4DJ2 A;  1JNU A;  3H82 B;  4GW9 A;  3RH8 B;  1LSW A;  1OJ5 A;  1OTI A;  2QJ7 A;  5TBM B;  4R6L A;  3SW1 A;  3UE6 A;  4WLA A;  2PDR A;  3G6O A;  4LRX C;  1N9L A;  2L4R A;  4I5S A;  2P7J A;  4HP9 A;  1UWN X;  1DP8 A;  1GSW A;  4F3L A;  4EES A;  2H28 A;  3K3D A;  2CMN A;  3HJI A;  3NOT C;  3A0R A;  3K3C A;  4HH3 A;  1VB6 A;  4HIA A;  4M4X A;  4WL9 A;  1DP6 A;  4PKY A;  5HWV A;  5HSQ A;  4XT2 A;  3LIF A;  1OT6 A;  2VV6 A;  3LIA A;  3LID A;  3H9W A;  4JGP A;  4I3I A;  4EEU A;  4HOI A;  4K08 A;  4YWZ A;  4F3L B;  3F1N A;  3A0S A;  1GSV A;  1T19 A;  4MN6 A;  3VE4 A;  1ODV A;  1TS8 A;  2PD7 A;  4NXE A;  1WA9 A;  3ICY A;  1OTE A;  2QJ5 A;  2VLG A;  4I39 A;  3ZQ5 A;  4B9O A;  1XJ6 A;  3CLO A;  4KQD A;  3CAX A;  1D06 A;  4I38 A;  1XFQ A;  2D01 A;  3E4Q A;  3MR0 A;  2PYR A;  1OTB A;  1XJ4 A;  2OWJ A;  1S66 L;  3NHQ A;  5DJU A;  3F1P A;  1TS0 A;  5DKL A;  4EXO A;  5HD5 A; 
#chains in the Genus database with same CATH topology
 3M2K A;  3NEC A;  4HQA A;  4CLC D;  3Q07 A;  3S7N A;  1J3W A;  2P08 A;  2ZBB A;  5CGX A;  4BD1 A;  3IF6 C;  2O9A A;  3MXS A;  3DTI A;  5TR7 A;  4NXB A;  3WS5 A;  5G18 A;  4Y3I A;  4Y5F A;  5FQJ A;  3T4L A;  1BTL A;  4E04 A;  3UDX A;  4S2M A;  5GLC A;  3EWK A;  3SH8 A;  3T4K A;  4FOF A;  2V1Z A;  1ZG4 A;  4MLL A;  4R38 A;  2WKH A;  4DDY A;  5DFY A;  2HJE A;  2J9O A;  4JBF A;  4MEZ A;  4KG6 A;  1XFN A;  5DF9 A;  3E4P A;  2O9C A;  3HRE A;  3CZD A;  3FYZ A;  2VGK A;  1L2S A;  2FH5 A;  4Y0T A;  3A3D A;  3OPP A;  4QU3 A;  4WZ5 A;  4FCF A;  4R4S A;  4YNR A;  5BOH A;  3MQQ A;  4OP5 A;  4Y17 A;  4FH2 A;  2EWW A;  1X0O A;  2WKP A;  1JVJ A;  2ZLY A;  1H0M A;  1W79 A;  1OJ5 A;  4WZ5 C;  1H8Y A;  3IBJ A;  4LRX C;  2L4R A;  5FAT A;  5DFX A;  1Q2P A;  4JGP A;  4UQI S;  1ES4 A;  1K6R A;  4JXG A;  3AGD A;  4LV0 A;  3IH8 A;  3CAX A;  4I38 A;  5F1F A;  5DJU A;  3OPH A;  3A3E A;  4N1X A;  4P85 A;  2J8Y A;  2Y2O A;  1H8M A;  4N9L A;  2K2N A;  1OJG A;  5EM1 A;  1LT0 A;  3FWL A;  3T1Q B;  3OOV A;  3RXX A;  3QNC A;  1IKG A;  5DF7 A;  4DDS A;  4JXS A;  5E2G A;  4B88 A;  4PM9 A;  1SDN A;  3MSH A;  4QHC A;  2QYB A;  5AQA A;  3GEC A;  3DWK A;  3LR3 A;  1OTA A;  3NC8 A;  3VMA A;  1BT5 A;  1XJ2 A;  3BW6 A;  4RX2 A;  4Y2F A;  3CI6 A;  4OOY A;  1GCE A;  2EA9 A;  5F83 A;  1GSX A;  1BLH A;  3F1P B;  3ZCZ A;  1NLZ A;  2WYX A;  3W4P A;  2W3H A;  2LB9 A;  5F69 A;  4OP8 A;  4RYE A;  3VP3 A;  3ITA A;  3O88 A;  4BLM A;  4EUV A;  3WS0 A;  4Y15 A;  1ONH A;  3WS1 A;  4LV1 A;  1MWU A;  2XH9 A;  2JBF A;  4QJG A;  3LCE A;  1LSW A;  3ITB A;  3IWI A;  2WKI A;  2XSS A;  4K0W A;  4R3J A;  5IT5 A;  5FEF A;  3Q82 A;  3CG5 A;  2Y2K A;  4D60 A;  4R23 A;  3S7O A;  1FCM A;  1QME A;  1XX2 A;  3F1N A;  3ZG5 A;  4OPQ A;  4UAA A;  4HEF A;  3BFF A;  1IEM A;  1CK3 A;  1PZO A;  5CTM A;  1YKD A;  4EER A;  4LPZ A;  3CHW P;  2VGJ A;  3D72 A;  2Y2J A;  4E6W A;  5KZH A;  2DMW A;  2VA0 A;  4OPR A;  4LCM A;  1G6O A;  1YAX A;  1IEL A;  4ETZ A;  5E2E A;  2B02 A;  3TE8 A;  1FCN A;  2L0W A;  4EUZ A;  5KSC A;  1YLJ A;  3UB9 A;  5EOO A;  2OLV A;  1NYM A;  3LI9 A;  3O86 A;  1F5M A;  2QKP A;  3UME A;  5KSH A;  3VOL A;  1G68 A;  2XFT A;  2HP9 A;  4X25 A;  2PBD P;  3MQ0 A;  3FG8 A;  2DRW A;  3MZF A;  3OLO A;  3R4K A;  4O01 A;  3SZT A;  3Q7V A;  4CLC C;  1JTD A;  5CGW A;  4GLQ A;  2XRN A;  4HNB A;  1H8Z A;  4L9E A;  4FSF A;  1T18 A;  1K6S A;  4WMC D;  3LY4 A;  5FI7 A;  1MWS A;  3MQO A;  3UO9 A;  1LHY A;  4GOG A;  3VFH A;  2BTF P;  2WAD A;  3LR4 A;  2Q9N A;  2P9V B;  1JWP A;  3NOT C;  4P87 A;  4EEP A;  4D2O A;  3A0R A;  4XXR A;  4OH0 A;  1KVL A;  5EVI A;  2ZC7 A;  3IT9 A;  5GLB A;  3IXB A;  3A0S A;  3D9Y A;  5FAO A;  2PYR A;  2OWJ A;  1MKM A;  3G32 A;  5DKL A;  3CUE A;  4KZ3 A;  5CER A;  4X68 A;  1TDG A;  3SS5 A;  4OLD A;  4ZDX A;  3R7W B;  1V9Y A;  2G2W A;  1TS7 A;  2V8F A;  1K57 A;  3HLE A;  3PYP A;  4EU0 A;  1FSW A;  3HLG A;  2V9A A;  2K7S A;  3V3R A;  1XGJ A;  4O0P A;  3PBR A;  2EX8 A;  3UDF A;  2PHY A;  3ZHH A;  1MY8 A;  4UQI M;  1YMS A;  4R4R A;  1JWV A;  4FUW A;  1YSP A;  1HTZ A;  3UNW A;  3WS4 A;  1ES5 A;  2C5W B;  3BRM A;  3D3O A;  2OWH A;  4MDZ A;  4KZ6 A;  4XUX A;  4N9K A;  4BJP A;  2B5R A;  4WBG A;  4BBT A;  2HPB A;  3H7W A;  1JWZ A;  3KO6 A;  4YWZ A;  1DP9 A;  4PMA A;  1NJ4 A;  3BEB A;  5DF8 A;  3D4F A;  4S2N C;  2VV8 A;  1HZO A;  4OVD A;  1K4E A;  1OPX A;  1XJ3 A;  2JE5 A;  1KVM A;  3RTY A;  2J3W A;  1KGF A;  2M7U A;  3VP2 A;  5EV0 A;  4NK3 A;  1SHV A;  4DJ2 A;  3PTE A;  5C5K A;  3C4P A;  4HP9 A;  4GJ4 A;  3W4Q A;  1YLT A;  5HWV A;  3CMZ A;  3LIF A;  3LIA A;  4S2N A;  1TS8 A;  3IHA A;  3ZQ5 A;  2JKR I;  4KQD A;  3BFG A;  1S66 L;  3TRC A;  4EXO A;  2B95 A;  1ZC2 A;  2VKS A;  3LEZ A;  2JKT I;  2WGW A;  3Q7V B;  5GLD A;  2Y79 A;  3M6B A;  3G30 A;  3MXQ A;  2G2U A;  5CGS A;  3IX4 A;  4UA7 A;  1C3B A;  4GHI A;  3P7N A;  4XUZ A;  4ZTK A;  1P0Z A;  1Y28 A;  3G35 A;  2GDN A;  4HBT A;  1N9N A;  2ZQ9 A;  1BLP A;  3C5A A;  5FDH A;  1U60 A;  4NET A;  1XXM A;  3GSG A;  3NBL A;  4EBP A;  1XPB A;  2OV5 A;  2WGI A;  3MMH A;  4JLF A;  2H0T A;  3JYI A;  4H6J A;  4GNU A;  2M7V A;  4L0L A;  4CLC A;  5F6A A;  2IWD A;  4YIN A;  1DJA A;  3KSH A;  2XA7 S;  1ES2 A;  5FEG A;  1ZG6 A;  4KQR A;  4WYY A;  1L0G A;  2KX6 A;  4DJ3 A;  2HJ9 C;  4L9F A;  1E4D A;  3NIA A;  4IUH A;  5AQ7 A;  4IVK A;  4P6B A;  3ZVW A;  3WRT A;  5TBM B;  3GRJ A;  4MBK A;  4ARZ A;  1EWZ A;  4K0X A;  3S7Q A;  4HH3 A;  3LEQ A;  4GD8 A;  4S2L A;  2WZZ A;  3QHY A;  1BLS A;  3V3S A;  5AJG A;  1XJ6 A;  3B42 A;  4FD8 A;  5GHX A;  1G6A A;  3NHQ A;  2XK1 A;  4M3K A;  5FSR A;  2ZC5 B;  1K25 A;  2R78 A;  3K2N A;  1LI9 A;  5HAP A;  3BQA A;  4WEL A;  1SKO B;  2HGV A;  2P74 A;  4UA6 A;  4DMZ A;  5HW3 A;  1P97 A;  1OTD A;  5TJJ A;  3R7W A;  3HCY A;  1EI5 A;  1PW8 A;  3LIE A;  4PAU A;  5FA7 A;  3EGD C;  5FQK A;  2Z2L B;  4IED A;  4RX3 A;  1I2W A;  2XF3 A;  3O3V A;  4X53 A;  2YKH A;  2Y91 A;  2V20 A;  3UE1 A;  5M1A A;  3T4Q A;  3GVB A;  2Y2H A;  2V8C A;  4G3V A;  1Y54 A;  3OZH A;  4ETX A;  2YKF A;  1PWC A;  1YLW A;  3MBZ A;  3TW8 A;  2EWV A;  5AVE A;  4MBF A;  2J9P A;  4OQG A;  4DXB A;  1K54 A;  3O87 A;  1OT9 A;  1BLC A;  5L2F A;  1LSV A;  4KUO A;  2HF6 A;  3GR2 A;  3T4O A;  1Z09 A;  5J7E A;  2INW A;  4ZJ1 A;  4WN5 A;  3VV4 A;  3ZG7 B;  5FQ9 A;  4HES A;  4S2J A;  5FAP A;  3FPV A;  1MC0 A;  3GMW A;  3H82 B;  2HDU A;  1N9L A;  1DP8 A;  1MBL A;  2WZX A;  3N8R A;  4MN7 A;  3P98 A;  4HOI A;  1FSY A;  4K08 A;  2JKR M;  4LGW A;  3ZYT A;  1GSV A;  2WAE A;  1PZP A;  1XKZ A;  4G3W A;  4FH4 A;  3MR0 A;  1XJ4 A;  1Y4O A;  2Y2G A;  2W3E A;  3ISG A;  5IS1 A;  4RA7 A;  4X1M A;  3UY6 A;  1KDW A;  4KQO A;  4B93 A;  4HJ3 A;  5HDD A;  5HD3 A;  4DN0 A;  3ZVT A;  3PBS A;  2GJ3 A;  1LI0 A;  2ZQC A;  5EUA A;  2ZOH A;  1XA7 A;  2K31 A;  2Y59 A;  4MN5 A;  4MMN A;  1ERM A;  1IYP A;  2B18 A;  2FFY A;  3KSG A;  4DRT A;  4KUK A;  1YMX A;  3LIB A;  1W63 Q;  3L9K A;  4H6J B;  1T1B A;  4NEE D;  1BUE A;  5DJT A;  2VZW A;  1MWT A;  2UWX A;  1S4S A;  2W3D A;  1SCW A;  2EFU A;  1S4R A;  1WYB A;  1RCJ A;  5DTT A;  4NG2 A;  1VEU A;  2JKG A;  3RFB A;  3QP4 A;  3OCN A;  3T4S A;  4JKT A;  3HVF A;  4WF0 A;  3MKE A;  4HBU A;  1TS6 A;  5HPI A;  1FR1 A;  3W2Z A;  4GB7 A;  5HAI A;  3VP0 A;  3G4P A;  4WUJ A;  2IWB A;  2J3T C;  3BY8 A;  4ZJ2 A;  4DF6 A;  3DWZ A;  1XA1 A;  2J80 A;  3NCK A;  3UB8 A;  2PU4 A;  2O0Y A;  1JNU A;  3V50 A;  5HL6 A;  3Q1F A;  3HUM A;  1M40 A;  4I5S A;  2ZM8 A;  2JKF A;  3HJI A;  1PRQ A;  5CRF A;  2VV6 A;  1K0K A;  3H9W A;  3M6H A;  5FL3 A;  3V5M A;  3MFD A;  3FPW A;  4F3L B;  2FFF B;  2VX8 A;  5L07 A;  4BWI A;  3CLO A;  1D06 A;  1RP5 A;  4LV2 A;  1LL9 A;  1M6K A;  3LR5 A;  2OAP 1;  1N4O A;  2GNX A;  1IKI A;  4Q0H A;  2CC1 A;  3H7W B;  3LFV A;  3CWF A;  2BAS A;  3MXR A;  1STZ A;  4P0M A;  3UPO A;  4YOF A;  3F1N B;  4NXG A;  4ESP A;  4O7D A;  3ZNT A;  2A3U A;  3N4I A;  3LUQ A;  1QMF A;  1UWP X;  4GHI B;  4QD4 A;  1V9Z A;  3H82 A;  1ERO A;  1I2S A;  1MWR A;  3UPP A;  2ZMF A;  1ALQ A;  5EEC A;  1Q2Q A;  4JGR A;  1IYS A;  1YSQ A;  4LRY C;  3A3J A;  4NXF A;  2ZC6 B;  1ESU A;  2QZ6 A;  3IH9 A;  3UDI A;  3UN7 A;  1W63 M;  1K56 D;  4BL2 A;  4I3J A;  1H5X A;  1EW0 A;  3BFD A;  2ZQ8 A;  3IWO A;  1ZHH B;  2XGN A;  3S1Y A;  5A90 A;  3CPT A;  3NUL A;  4C6Y A;  3UPN A;  3PBO A;  4LCL A;  1KGE A;  4GDN A;  4OKP A;  1OTI A;  4II7 A;  2A49 A;  2W3G A;  5EE8 A;  5FQQ A;  4EES A;  3HLW A;  1DP6 A;  4PKY A;  2JCH A;  5KMW A;  3O5Y A;  3IXG A;  1T19 A;  4B4Z A;  2PD7 A;  1WA9 A;  3CIT A;  2WUQ A;  4KZ4 A;  1CEF A;  3E4Q A;  4Z1W A;  4OON A;  1E25 A;  3N8S A;  5CTN A;  2V0W A;  5CEB A;  5FAQ A;  3QP6 A;  4GS9 B;  1AXB A;  2BG1 A;  3ULF A;  1JTG A;  1NLY A;  3W4O A;  3VP1 A;  5HDC A;  3A0V A;  4S2P A;  3ZNY A;  4JGO A;  3NOP C;  2M1C A;  3T1R A;  4BEN A;  1FQG A;  5J3W A;  1ERQ A;  1LL5 A;  1D7E A;  2JN7 A;  5G4Z A;  2WK0 A;  5EFW A;  4OQ0 A;  5F1G A;  1P9W A;  2OAQ 1;  3N7W A;  2XDM A;  2A24 A;  5M19 A;  4X56 A;  2DCF A;  3LGO A;  4UHU A;  4ME4 A;  1FR6 A;  1K56 A;  3HJK A;  4JF5 A;  3IF6 B;  2XLN A;  2PR5 A;  3GQZ A;  2Z6C A;  4ZJ3 A;  3HLF A;  2W1T B;  2XEP A;  4IUK A;  1VEU B;  5HAQ A;  2HZ5 A;  3UE3 A;  3DW0 A;  4E3J A;  1VET B;  4WZ4 A;  1PIO A;  5FDS A;  5HL1 A;  4GW9 A;  2HP6 A;  4KZA A;  1DY6 A;  2IWC A;  3VP4 A;  1VB6 A;  1GHI A;  4E3K A;  2G7U A;  1GA0 A;  3G31 A;  1S6R A;  3ICY A;  5A91 A;  1OTE A;  4MNR A;  3DTK A;  5CHJ A;  1VM1 A;  1OTB A;  3BJN A;  5EVI D;  2J7V A;  3KYE A;  1K55 A;  2QPN A;  2Q0O A;  5EOE A;  2ZOI A;  4KZ8 A;  1VQQ A;  3DBA A;  3MZE A;  5IHV A;  1TVF A;  4BD0 A;  3LI8 A;  3T1S A;  2QWS A;  4QPR A;  5EPH A;  4Y0O A;  3BEC A;  5J8X A;  1G28 A;  5HPF A;  3T50 A;  2WKE A;  1K38 A;  3BWL A;  3PR6 A;  2Y4A A;  4F94 A;  1W5D A;  2GX5 A;  2ZMA A;  3Q7Z A;  3C38 A;  2X02 A;  2ZC3 B;  3C7V A;  2HDR A;  3T4T A;  2ZQ7 A;  2PAV P;  2Q9M A;  1HLU P;  4O8G A;  2KOI A;  4G3K A;  4ARZ B;  2ZJ9 A;  4GCZ A;  4U0X A;  5TBM A;  4JGQ A;  2X01 A;  4N1H A;  3IWQ A;  4PM8 A;  3LO7 A;  5HX9 A;  4LRZ E;  3IF5 A;  3G2Y A;  3FC7 A;  4XT2 B;  3TJZ C;  1VHM A;  3ZDJ A;  3AGF A;  3IQA A;  3UMD A;  5L09 A;  3EOI A;  3NY4 A;  5KIZ A;  3ZGA B;  5G4Y A;  2QJ7 A;  5FI6 A;  2Y2I A;  1UWN X;  3NDG A;  3E98 A;  1ESI A;  2XQZ A;  4WL9 A;  2H5S A;  3MF0 A;  3T1X A;  1AWI A;  2EX9 A;  4DE0 A;  4H8R A;  5DTK A;  3E2K A;  2PT7 A;  4I39 A;  1KDS A;  1YT4 A;  2EX2 A;  1BZA A;  3Q81 A;  3IBR A;  4AFI A;  4I3A A;  3E2L A;  2VGL M;  5HWW A;  1RGZ A;  5FQI A;  4GS9 A;  3ZG9 B;  2WKR A;  3PBQ A;  3B33 A;  5EVL A;  3T12 B;  3QNB A;  2R9W A;  4KG2 A;  2P9V A;  4CLC B;  3LYX A;  1OME A;  2Y8H A;  1NRF A;  4E3O A;  4QY5 A;  3A3F A;  4Y0U A;  3EEA A;  2XRO A;  4IVI A;  1CQA A;  3S4X A;  1E3U A;  3EQU A;  4EQ1 A;  2WKQ A;  4E6X A;  3NOU C;  1LSX A;  1YLP A;  5HZH A;  4PM7 A;  4BQM A;  3HLB A;  1N9O A;  3DAV A;  5HAR A;  1A0K A;  4PM6 A;  2I9V A;  3BM6 A;  4HI4 A;  4OOL A;  4DKI A;  4EET B;  1NYY A;  1FCO A;  2HP5 A;  2EFX A;  3RH8 B;  5JYP A;  4DE1 A;  3G2Z A;  2XD5 A;  3BLM A;  1GSW A;  2W3F A;  2H28 A;  4DE2 A;  1K57 C;  1OT6 A;  3FKW A;  1KE4 A;  3VSK A;  4B9O A;  4E3N A;  2RL3 A;  3IX3 A;  2ZC4 B;  4X69 A;  5A92 A;  5M18 A;  2D02 A;  5A93 A;  2KDK A;  2V1A A;  1K55 C;  3G34 A;  3EQV A;  1KOU A;  4E3M A;  5CHU A;  2EXA A;  2VGL S;  2JKT M;  3E4O A;  2VV7 A;  1J9M A;  2XD1 A;  2ACG A;  5F5Y A;  4S2I A;  3KX0 X;  4Y7P A;  4Y13 A;  4X1L A;  4HHD A;  1CI9 A;  4IJG A;  3MS6 A;  4ZAM A;  1DRM A;  4Q0J A;  5FQM A;  1PWD A;  5AVF A;  5J4E A;  1TDL A;  4IBX A;  1SZV A;  1I5Q A;  1T1A A;  4RQ9 A;  5AQ9 A;  1L0D A;  3N6I A;  4BBU A;  4KZ9 A;  3BQ8 A;  3KSI A;  2DNS A;  3PBN A;  4DE3 A;  4LV3 A;  5TFQ A;  1MXO A;  5L8M A;  5HDS A;  3S7P A;  4EW7 A;  4PKY G;  2X71 A;  3PXP A;  1IOU A;  3NI9 A;  3CPT B;  1S67 L;  4LFU A;  3FV7 A;  3IS2 B;  3OCL A;  1NY0 A;  1TF1 A;  1PI4 A;  3EGX C;  5K5B A;  4U3T A;  1MPL A;  3WS2 A;  5DKK A;  5D3O A;  4EV4 A;  2PBY A;  3T4J A;  3NJA A;  3OPR A;  4KG5 A;  1PI5 A;  2HV1 A;  2I72 A;  1ACF A;  3WRZ A;  1L0F A;  1PW1 A;  5DTS A;  2PDR A;  5AQB A;  3G6O A;  4OPY A;  2MJ6 A;  3K3D A;  5MC7 A;  3LID A;  3IX8 A;  1FIL A;  4EEU A;  4JPM A;  1IFQ A;  5CXW A;  5L10 A;  3ZFZ A;  5EVI B;  4KEN B;  5GLA A;  4GDB A;  4LEN A;  1TS0 A;  1PWG A;  2ZQA A;  2WAF A;  4EQI A;  1NXY A;  4GN2 A;  4PPR A;  2ZL1 A;  2IA2 A;  2W27 A;  4GD6 A;  1FOF A;  2ZM0 A;  1LLB A;  3WWX A;  1FIK A;  5HFO A;  3I7J A;  4ZRR A;  1YM1 A;  1SKF A;  3PAG A;  1IYQ A;  3UB5 P;  3HUN A;  3LIC A;  3JVU A;  5EM0 A;  2A24 B;  2C6W B;  3HLD A;  1W7F A;  2KLI A;  3TG9 A;  1ZTU A;  3E0Y A;  5EVE A;  4HY8 A;  1DJC A;  3VFF A;  3BFE A;  2Y2L A;  1SDE A;  3IHB A;  3B47 A;  1S1Z A;  3VSL A;  4UA9 A;  3F1O B;  5JYO A;  3JPU A;  3MZD A;  1S1Y A;  4KZ5 A;  4P6Z M;  4CPK A;  3KYQ A;  4MBH A;  1GA9 A;  3VOY A;  4BMW A;  4LLO B;  3QP8 A;  3ZG0 A;  3A3I A;  2W1R A;  3JVV A;  1K4F A;  4KZ7 A;  3GDI A;  5U47 A;  2QMI A;  5EVI C;  4WEK A;  4Z9Q A;  1F2K A;  2BLS A;  2Y2M A;  1ONG A;  4E3L A;  3CUE C;  1CI8 A;  5HSQ A;  4OQH A;  4WM9 A;  2GZA A;  3HBR A;  3KYZ A;  1P9R A;  3V39 A;  2W1T A;  1ODV A;  4NXE A;  4X6T A;  4R0Q A;  3SS4 A;  2PU2 A;  2EX6 A;  1XFQ A;  2D01 A;  3BFC A;  4A5R A;  4CLC E;  1CF0 A;  4JF4 A;  1HVB A;  1RGY A;  5CEC A;  2JC7 A;  3CJM A;  4HP4 A;  1W8Y A;  4R3A A;  3C8C A;  1SKO A;  2V1B A;  3MKF A;  4HJ4 A;  5FI2 A;  4HJ6 A;  3NDE A;  4CQH A;  1VET A;  3SS3 A;  4UEY A;  5I5L A;  3GTC A;  1L3L A;  5A8B A;  3V67 A;  2OSU A;  2Z6D A;  4OQI A;  3EEH A;  3C4O A;  4JF6 A;  1MKI A;  4DXC A;  4IHQ A;  2Y2P A;  3P01 A;  2EXB A;  4EWF A;  3VOZ A;  1Z6F A;  1NWZ A;  2NUT C;  3UB7 A;  2LB5 A;  2PYP A;  3RXW A;  2OOL A;  1S0W A;  4X55 A;  3HUO A;  1TEM A;  2H10 A;  1E3U D;  3HL9 A;  5F68 A;  1PYY A;  2PR6 A;  4L9G A;  2XR0 A;  3PBT A;  1XP4 A;  2O99 A;  1PNE A;  3UB6 A;  1LL8 A;  4R3B A;  3IF6 A;  2UV0 E;  1ES3 A;  2H0Y A;  4WLA A;  4F3L A;  2A2L A;  2CMN A;  4M4X A;  5GL9 A;  4XT2 A;  3RJU A;  4GZB A;  4I3I A;  3IXD A;  1TD5 A;  1L0E A;  4P6Z S;  2RCX A;  4EBN A;  3KSF A;  3QP2 A;  3OBF A;  4Q0I A;  5E2H A;  2HDS A;  3B3X A;  4S2K A;  2ZQD A;  3BY9 A;  2W0N A;  4MCW A;  2P04 A;  2V0U A;  4RVA A;  3N8L A;  4K91 A;  2VK3 A;  4CJN A;  3FKV A;  4U0T A;  1GHM A;  4WMC A;  4QY6 A;  4JXW A;  4KQQ A;  1F98 A;  3BYD A;  4IBR A;  1BUL A;  2Y2Q A;  2L1M A;  3LY3 A;  2HDQ A;  2VJW A;  1YLZ A;  4R1G A;  2VEA A;  1NZU A;  2ZM2 A;  2ZMV A;  3F1O A;  2PRF A;  3U2A A;  4Q8I A;  2O9B A;  1MZU A;  2E8J A;  3S22 A;  2OLU A;  5E43 A;  3C30 A;  4OLG A;  3SOI A;  4PM5 A;  4WEJ A;  2V2F F;  2NUP C;  3VE3 A;  3PAE A;  1YLY A;  3M2J A;  2XA7 M;  2JHE A;  4HH2 A;  1D1J A;  3P09 A;  1DJB A;  1H3Q A;  2ZD8 A;  1O07 A;  1BSG A;  1CJF A;  3DTM A;  1NRJ A;  1PFL A;  1G5U A;  1W8Q A;  4PHT A;  1O7E A;  3SW1 A;  4R6L A;  1K54 C;  3UE6 A;  5E2F A;  2P7J A;  1IYO A;  4QB8 A;  5F82 A;  3GV9 A;  3K3C A;  4OPZ A;  4S2O A;  4GKU A;  3HLC A;  3LR0 A;  4MN6 A;  1XGI A;  2QJ5 A;  2VLG A;  1WE4 A;  5I94 A;  2FZ0 A;  3L7H A;  1YPR A;  3TSG A;  3C7U A;  3MJQ A;  5TGF A;  3W8K A;  4C75 A;  2WGW B;  4R70 A;  3IS2 A;  1KGG A;  5CHM A;  1T1C A;  5IU1 A;  1KE3 A;  4YFM A;  1F9I A;  3OC2 A;  1KE0 A;  3SH7 A;  5CX7 A;  3FZC A;  5GHZ A;  1ZKJ A;  1WYC A;  3MFX A;  2J3T D;  2Z2M B;  1NZO A;  4OOM A;  3U4L P;  5LBR A;  5HWT A;  2AVX A;  3PHY A;  4E3I A;  4FTX A;  2ZL1 B;  2XFS A;  1N9B A;  2E8I A;  1YQS A;  4B4X A;  3AGE A;  2Y2N A;  1BYW A;  5GHY A;  4N92 A;  5CED A;  4KZB A;  3UE0 A;  2PD8 A;  2WGV A;  2QHK A;  1HD8 A;  3QP5 A;  4QWO A;  2Y55 A;  3C2W A;  4NKP A;  4EBL A;  4BBV A;  3TOI A;  1UGU A;  3QP1 A;  4JXV A;  5DVA A;  3OPL A;  4ID4 A;  1GHP A;  3DTE A;  4HIA A;  3IXH A;  3SH9 A;  4ZBE A;  2R9X A;  3ZG8 B;  3VE4 A;  3BLS A;  1CEG A;  4BL3 A;  3F1P A;  4C3Q A;  5FAS A;  5HD5 A; 
#chains in the Genus database with same CATH homology
 4HQA A;  4CLC D;  2VKS A;  2V0W A;  3S7N A;  2JKT I;  2IA2 A;  2W27 A;  2P08 A;  2ZBB A;  2O9A A;  4GS9 B;  2Y79 A;  4NXB A;  4Y3I A;  4Y5F A;  3MXQ A;  3ULF A;  3T4L A;  4ZRR A;  4E04 A;  1NLY A;  3LIC A;  3JVU A;  3EWK A;  5HDC A;  3A0V A;  3T4K A;  4GHI A;  3P7N A;  4FOF A;  2A24 B;  4JGO A;  1P0Z A;  1Y28 A;  2KLI A;  4R38 A;  3NOP C;  1ZTU A;  2M1C A;  3E0Y A;  1N9N A;  5J3W A;  4HY8 A;  5DFY A;  1D7E A;  2HJE A;  2JN7 A;  5G4Z A;  5EFW A;  1P9W A;  3B47 A;  2OAQ 1;  1XFN A;  1S1Z A;  5DF9 A;  3MMH A;  2A24 A;  3F1O B;  3E4P A;  2O9C A;  4ME4 A;  4H6J A;  1S1Y A;  2M7V A;  4P6Z M;  3KYQ A;  3HJK A;  4L0L A;  2PR5 A;  2Z6C A;  4CLC A;  5F6A A;  2FH5 A;  4BMW A;  3KSH A;  4LLO B;  4YNR A;  2XA7 S;  2W1R A;  3JVV A;  3GDI A;  2W1T B;  2KX6 A;  4IUK A;  4DJ3 A;  3MQQ A;  3UE3 A;  2HJ9 C;  4WEK A;  2EWW A;  1X0O A;  2WKP A;  4L9F A;  4IUH A;  4GW9 A;  1OJ5 A;  5TBM B;  3IBJ A;  4LRX C;  2L4R A;  4ARZ A;  3CUE C;  5DFX A;  3S7Q A;  4HH3 A;  5HSQ A;  1VB6 A;  2GZA A;  3KYZ A;  4JGP A;  2G7U A;  1P9R A;  4UQI S;  2W1T A;  1ODV A;  4NXE A;  3ICY A;  1OTE A;  5AJG A;  1XJ6 A;  3B42 A;  3CAX A;  4I38 A;  1XFQ A;  2D01 A;  5DJU A;  1OTB A;  3BJN A;  3NHQ A;  4CLC E;  1H8M A;  2R78 A;  3K2N A;  2ZOI A;  2K2N A;  3DBA A;  3BQA A;  1OJG A;  1LT0 A;  4HP4 A;  4R3A A;  4WEL A;  2HGV A;  3LI8 A;  3OOV A;  2QWS A;  3C8C A;  4QPR A;  2V1B A;  4HJ4 A;  4DMZ A;  4HJ6 A;  1P97 A;  1OTD A;  4CQH A;  1G28 A;  5TJJ A;  3R7W A;  3HCY A;  5HPF A;  3T50 A;  4UEY A;  5I5L A;  3BWL A;  3PR6 A;  5A8B A;  3LIE A;  2GX5 A;  4PAU A;  3V67 A;  3EGD C;  2Z6D A;  3C38 A;  3EEH A;  2YKH A;  3T4T A;  2QYB A;  4IHQ A;  3T4Q A;  3P01 A;  3GEC A;  4O8G A;  2KOI A;  4G3K A;  4ARZ B;  4GCZ A;  3LR3 A;  1OTA A;  4G3V A;  5TBM A;  4JGQ A;  1NWZ A;  1XJ2 A;  2NUT C;  2YKF A;  3BW6 A;  2LB5 A;  2PYP A;  3UB7 A;  4ETX A;  2OOL A;  3TW8 A;  4Y2F A;  3CI6 A;  4LRZ E;  2EWV A;  5AVE A;  2EA9 A;  1GSX A;  1OT9 A;  3FC7 A;  3F1P B;  4XT2 B;  1NLZ A;  3TJZ C;  1LSV A;  1VHM A;  2W3H A;  2LB9 A;  2PR6 A;  4KUO A;  5F68 A;  5F69 A;  2HF6 A;  4L9G A;  3T4O A;  3PBT A;  5J7E A;  2INW A;  4EUV A;  3UMD A;  3VV4 A;  4WN5 A;  3EOI A;  2O99 A;  3UB6 A;  5KIZ A;  1LL8 A;  5G4Y A;  3FPV A;  1MC0 A;  3H82 B;  1LSW A;  2QJ7 A;  4WLA A;  2XSS A;  1N9L A;  1UWN X;  1DP8 A;  4F3L A;  5IT5 A;  3E98 A;  2A2L A;  2CMN A;  3MF0 A;  4MN7 A;  4WL9 A;  4M4X A;  4XT2 A;  4I3I A;  4HOI A;  3S7O A;  4K08 A;  2JKR M;  3F1N A;  3ZYT A;  1GSV A;  1TD5 A;  4P6Z S;  2PT7 A;  4I39 A;  4G3W A;  3KSF A;  3MR0 A;  1XJ4 A;  1YKD A;  2W3E A;  5IS1 A;  4EER A;  3OBF A;  4LPZ A;  4Q0I A;  3IBR A;  3D72 A;  4KQO A;  4B93 A;  4AFI A;  2DMW A;  3BY9 A;  4HJ3 A;  2W0N A;  4MCW A;  5HDD A;  2VA0 A;  2P04 A;  2V0U A;  4I3A A;  5HD3 A;  4DN0 A;  2VGL M;  1G6O A;  5HWW A;  3PBS A;  1YAX A;  2GJ3 A;  4ETZ A;  4GS9 A;  2WKR A;  3PBQ A;  1F98 A;  2ZOH A;  2B02 A;  3TE8 A;  3B33 A;  2K31 A;  2L0W A;  4MN5 A;  3UB9 A;  4MMN A;  2L1M A;  2B18 A;  3LI9 A;  4CLC B;  3KSG A;  1F5M A;  4KUK A;  3LYX A;  2VJW A;  3LIB A;  2Y8H A;  2QKP A;  1W63 Q;  3UME A;  5KSH A;  4H6J B;  1T1B A;  2VEA A;  3VOL A;  4NEE D;  2ZMV A;  3F1O A;  5DJT A;  3U2A A;  2VZW A;  2O9B A;  1S4S A;  1MZU A;  2W3D A;  3EEA A;  1S4R A;  2XRO A;  3C30 A;  3MQ0 A;  3FG8 A;  3RFB A;  3EQU A;  3OCN A;  3OLO A;  3R4K A;  4O01 A;  4WEJ A;  3T4S A;  4EQ1 A;  2WKQ A;  2NUP C;  3VE3 A;  4CLC C;  3NOU C;  4WF0 A;  1LSX A;  5HZH A;  4GLQ A;  2XRN A;  2XA7 M;  1TS6 A;  2JHE A;  4HNB A;  5HPI A;  1N9O A;  4HH2 A;  3W2Z A;  4L9E A;  4FSF A;  4WUJ A;  1T18 A;  2J3T C;  1H3Q A;  3BY8 A;  2I9V A;  4HI4 A;  4OOL A;  2J80 A;  4EET B;  3MQO A;  3UB8 A;  1NRJ A;  2O0Y A;  3LR4 A;  1JNU A;  4PHT A;  3RH8 B;  3SW1 A;  4R6L A;  5HL6 A;  3UE6 A;  4I5S A;  2P7J A;  1GSW A;  2W3F A;  3NOT C;  2H28 A;  4EEP A;  3HJI A;  3A0R A;  3K3C A;  1OT6 A;  2VV6 A;  3H9W A;  5FL3 A;  3FPW A;  4F3L B;  3LR0 A;  3A0S A;  4MN6 A;  2VX8 A;  4B9O A;  4BWI A;  2QJ5 A;  2VLG A;  3CLO A;  1D06 A;  2PYR A;  2FZ0 A;  2OWJ A;  1MKM A;  5DKL A;  3LR5 A;  2OAP 1;  3MJQ A;  2D02 A;  2GNX A;  3CUE A;  2KDK A;  2V1A A;  4Q0H A;  4R70 A;  3H7W B;  3IS2 A;  3LFV A;  3CWF A;  3EQV A;  2BAS A;  1KOU A;  1STZ A;  4YOF A;  2VGL S;  1T1C A;  2JKT M;  3E4O A;  5IU1 A;  3F1N B;  2VV7 A;  1F9I A;  3R7W B;  1V9Y A;  3OC2 A;  5F5Y A;  1TS7 A;  4NXG A;  3KX0 X;  5CX7 A;  4HHD A;  3PYP A;  4IJG A;  4EU0 A;  3LUQ A;  1UWP X;  1DRM A;  4GHI B;  4Q0J A;  2V9A A;  2K7S A;  5J4E A;  5AVF A;  4O0P A;  3PBR A;  1V9Z A;  3H82 A;  2PHY A;  4UQI M;  3MFX A;  2J3T D;  1T1A A;  4RQ9 A;  4BBU A;  3BQ8 A;  3KSI A;  3PBN A;  4OOM A;  5LBR A;  1YSP A;  5HWT A;  2ZMF A;  3PHY A;  5L8M A;  5HDS A;  3S7P A;  4EW7 A;  4PKY G;  4JGR A;  3D3O A;  3PXP A;  1IOU A;  1YSQ A;  4LRY C;  2OWH A;  4NXF A;  4MDZ A;  1S67 L;  4BJP A;  4BBT A;  1W63 M;  3H7W A;  1BYW A;  3IS2 B;  3OCL A;  1TF1 A;  2PD8 A;  3KO6 A;  4I3J A;  3EGX C;  1EW0 A;  1DP9 A;  2QHK A;  4YWZ A;  5K5B A;  3C2W A;  4NKP A;  1ZHH B;  2VV8 A;  4BBV A;  5DKK A;  1OPX A;  1XJ3 A;  3PBO A;  3T4J A;  3NJA A;  3RTY A;  2J3W A;  2M7U A;  1UGU A;  2HV1 A;  4DJ2 A;  1OTI A;  4II7 A;  2W3G A;  5C5K A;  2PDR A;  3G6O A;  4HP9 A;  4GJ4 A;  2MJ6 A;  4EES A;  3K3D A;  4HIA A;  5HWV A;  1DP6 A;  4PKY A;  5MC7 A;  3LIF A;  3LIA A;  3LID A;  3O5Y A;  4EEU A;  1IFQ A;  3VE4 A;  1T19 A;  1TS8 A;  2PD7 A;  1WA9 A;  3CIT A;  3ZQ5 A;  2JKR I;  4KQD A;  3E4Q A;  4Z1W A;  1S66 L;  3TRC A;  3F1P A;  1TS0 A;  4EXO A;  5HD5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...