5HDCA

Femtosecond structural dynamics drives the trans/cis isomerization in photoactive yellow protein: 100 fs to 400 fs structure
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
125
structure length
124
Chain Sequence
MEHVAFGSEDIENTLAKMDDGQLDGLAFGAIQLDGDGNILQYNAAEGDITGRDPKQVIGKNFFKDVAPTDSPEFYGKFKEGVASGNLNTMFEYTFDYQMTPTKVKVHMKKALSGDSYWVFVKRV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Photoactive yellow protein
publication title Femtosecond structural dynamics drives the trans/cis isomerization in photoactive yellow protein.
pubmed doi rcsb
source organism Halorhodospira halophila
total genus 32
structure length 124
sequence length 125
ec nomenclature
pdb deposition date 2016-01-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00989 PAS PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 5hdcA00
1TS7A 3F1OA 3H82A 3EWKA 5J7EA 5I5LA 1S67L 2PHYA 5HDSA 3MQOA 2CMNA 4HH2A 4HJ4A 3PHYA 2L1MA 4GS9B 2V9AA 4KUOA 2A24B 2L4RA 4GHIA 3FC7A 4HIAA 2VV6A 2R78A 2PD8A 3F1PA 4M4XA 3LUQA 4HP4A 2OOLA 4MN6A 4EERA 3LIAA 2KX6A 4F3LB 5HWWA 3UB8A 1OT6A 3F1NA 5A8BA 1S1YA 3LICA 1S4RA 2W0NA 1KOUA 2D02A 3B33A 4JGQA 2ZOIA 2JHEA 1EW0A 4MN5A 3E4PA 1S1ZA 1GSVA 5AVEA 4GW9A 1TS6A 2INWA 1XJ3A 1LL8A 3H9WA 4BBVA 1JNUA 3H7WA 3C8CA 4XT2B 3A0RA 2PYRA 1G28A 3NOTC 1N9NA 2L0WA 3NJAA 3RH8B 2V1BA 1S66L 4EQ1A 5F68A 1ODVA 3SW1A 1XFNA 1LSWA 1OTEA 4L9FA 3D72A 3MQQA 5TBMB 1LSXA 2EA9A 3UMDA 3G6OA 2KDKA 3VE3A 3F1OB 3H82B 4L9GA 1OTDA 1N9LA 2QJ7A 5F69A 4I3AA 1F98A 2PD7A 2Z6DA 3EEHA 4R3AA 1T19A 2JN7A 4I5SA 1N9OA 4I39A 1T1AA 2ZBBA 3CWFA 1OTBA 5HD5A 4LPZA 4EEPA 5DJUA 4WL9A 1V9ZA 4GHIB 3RTYA 4HQAA 4EXOA 1F9IA 1NWZA 1DP6A 2A24A 5DKKA 2H28A 3ZQ5A 5DJTA 4LLOB 3MR0A 3K3DA 2V0WA 4KUKA 1P0ZA 4EW7A 4EEUA 5HDCA 3KX0X 2P7JA 2W27A 5IS1A 3C2WA 1GSWA 2YKFA 2I9VA 2QKPA 5HSQA 3HJKA 4R38A 2OWJA 1VB6A 4HY8A 5F6AA 5KIZA 4I3JA 5DKLA 4LRYC 4PKYA 4LRZE 5HD3A 3ICYA 3OLOA 4I3IA 4K08A 4JGOA 3LYXA 1TS0A 4H6JB 3T50A 3H7WB 1DP9A 1XJ4A 1LSVA 2D01A 2V1AA 4HNBA 2YKHA 3IS2B 3LI8A 4HOIA 4EETB 3FG8A 3GDIA 2PR5A 3LIDA 1BYWA 4L9EA 5AVFA 2HV1A 4HH3A 4NXEA 4RQ9A 3LIEA 3MJQA 3PYPA 2QHKA 1WA9A 3BY8A 2OWHA 5TBMA 2QJ5A 5HWVA 4WUJA 4KQDA 2PDRA 4WF0A 3LIBA 4PKYG 2QWSA 4WLAA 5G4YA 2ZOHA 2Z6CA 3BY9A 4DJ2A 4R70A 2PYPA 5HWTA 3UB7A 2VV7A 4HJ6A 4E04A 5IU1A 2V0UA 1OTAA 1DRMA 1XJ6A 4GS9A 4I38A 3NOUC 4HHDA 2K7SA 4NXFA 1Y28A 3F1PB 3VE4A 2WKQA 4JGRA 3UB6A 3ULFA 3MFXA 4DJ3A 3UB9A 3VOLA 1UWPX 3HJIA 1OT9A 3F1NB 4F3LA 4JGPA 1S4SA 1X0OA 2WKRA 1OTIA 1XJ2A 3E4QA 3GECA 1MZUA 3CLOA 4R6LA 1GSXA 1OJGA 4EESA 4GCZA 3A0VA 1T18A 3MXQA 3E4OA 2WKPA 4NXGA 1UGUA 3A0SA 1UWNX 3K3CA 1D06A 3LI9A 2VLGA 4LRXC 1XFQA 4B9OA 5F5YA 4WN5A 3NOPC 1T1CA 1D7EA 1OJ5A 2B02A 4XT2A 2M1CA 4H6JA 4HP9A 1P97A 3UMEA 5HDDA 1V9YA 5J4EA 2VV8A 5G4ZA 3CAXA 1DP8A 3IS2A 3P7NA 1T1BA 5HZHA 3IBRA 2PR6A 4YWZA 4BBTA 1LT0A 3BWLA 3NHQA 1TS8A 2J80A 5EFWA 2VEAA 3LIFA 4HI4A 3UE6A 2GJ3A 4HJ3A 4NXBA 2BASA 5J3WA 4BBUA
chains in the Genus database with same CATH superfamily
1TS7A 3IWOA 1VETA 1BZAA 3EWKA 2Y2PA 1TEMA 1DY6A 4KZ6A 5GLAA 2AVXA 2ZC6B 5I5LA 2XA7S 1E4DA 5AQBA 5FQKA 3BW6A 3KYEA 3MQOA 1XPBA 2J3TC 5FASA 3CPTB 3DWKA 3IHAA 1CEGA 3W4PA 2HDUA 5L07A 2PT7A 3A3FA 3JPUA 4JXGA 1XGIA 4MMNA 2L4RA 4GHIA 1G68A 3FC7A 4HIAA 3FWLA 1SDEA 1MWUA 2PD8A 5EM1A 4OPZA 3BJNA 1H8ZA 4HP4A 1LI9A 4NK3A 4N9KA 2O99A 3LIAA 2KX6A 2OAP1 4F3LB 3JYIA 3UB8A 3DBAA 5F1GA 2J7VA 4X68A 2ZL1A 3C7UA 1OT6A 1ERMA 1NZOA 4BLMA 3BLSA 1ESUA 1EI5A 1K54C 5FAOA 3IF5A 4EBLA 4GDBA 3A3IA 3W2ZA 2JHEA 2XROA 4KZ3A 4S2JA 1YLYA 5FL3A 4ZRRA 2ZM0A 2INWA 2EX6A 4P6BA 5E2GA 5FDHA 4RX3A 3O3VA 1YPRA 3NDGA 5FATA 1FCNA 2ZQ9A 4B4ZA 2PYRA 3ZG9B 1F5MA 1G28A 3NOTC 2Q9MA 2B5RA 1YLWA 1ONGA 3VMAA 1ODVA 1M6KA 4GN2A 1LSWA 1AXBA 2Y55A 4FCFA 4L9FA 4K91A 2H10A 5TBMB 3IWQA 2X01A 3CMZA 2G2UA 3VP2A 2EA9A 2EXBA 2W3FA 4Y0OA 3F1OB 2HP6A 2ZM8A 3PBSA 4I3AA 1F98A 3MSHA 2PD7A 1KVLA 2Y79A 4RX2A 1T19A 3PAEA 2EFUA 2JN7A 1ESIA 4UHUA 2NUPC 4LPZA 4DDSA 2XLNA 3Q7VA 2Q0OA 1JVJA 2VJWA 3EQUA 3LEZA 5CERA 4KG6A 3G31A 2WUQA 4LLOB 1KDWA 4LFUA 3K3DA 1TDGA 4O01A 5HL6A 5DF8A 4EW7A 3EOIA 5AQ7A 4S2LA 1FR6A 3KX0X 5GHXA 2GZAA 3UNWA 4E6XA 5IS1A 4DKIA 4JXVA 4MBFA 5FI6A 5DF7A 2X02A 4R38A 3DTIA 2P74A 3UDFA 1AWIA 4FOFA 3S1YA 5F1FA 1HZOA 4PAUA 1Z09A 3BFFA 3OPHA 4BENA 1W8YA 2J8YA 2W3DA 1H3QA 3RJUA 3UDXA 4PKYA 4LRZE 5HD3A 5BOHA 4Y5FA 4JGOA 1E3UA 1BLPA 3OCLA 4BL3A 3ZG8B 4CQHA 4M3KA 3QP8A 5KSHA 1LSVA 2V1AA 5CTNA 2ZC3B 4EBNA 3FYZA 3WWXA 2C5WB 5AQ9A 3WS2A 4EETB 2R9XA 4ZTKA 3GDIA 2Y8HA 2WZZA 3HUMA 3LIDA 5DTKA 4UQIS 2IWCA 3OBFA 5AVFA 3PBOA 2ZC4B 1IYPA 4NXEA 2VKSA 3MJQA 2ZM2A 3HCYA 2XA7M 2XH9A 2QHKA 1WA9A 2OWHA 5HWVA 1FILA 2Y2LA 2FZ0A 1RP5A 2FFFB 1GHMA 4GD8A 4FH2A 4LCMA 5FAPA 2EX9A 4PM6A 2OV5A 4JF4A 4DJ2A 3L9KA 2PYPA 2JKRI 3T4JA 3BRMA 5HWTA 1YLZA 2VV7A 5TFQA 4E04A 5FQQA 5IU1A 2WGWB 3VP4A 3WS0A 1DRMA 5AQAA 1QMFA 1VQQA 3CITA 4Q0HA 5G18A 1Y28A 1G6AA 4LV1A 4OONA 4ZJ1A 4UA7A 2IWBA 1KGFA 5JYPA 2WGIA 4X56A 1JWZA 4JGRA 4CLCD 4OQHA 1K56A 5DTTA 2M7VA 1OT9A 1K4EA 1H5XA 1S4SA 2EWWA 3NECA 2WKRA 3S7OA 5FQ9A 2HP9A 2PBDP 1MZUA 3V3RA 5KSCA 3SZTA 3A0VA 1SKOB 1W79A 3WS4A 1T18A 3MXQA 3VOYA 2Y2QA 5DTSA 3UE3A 3AGFA 3T1XA 3A0SA 4BD0A 1UWNX 2HPBA 2XR0A 4QWOA 2VLGA 3PBTA 2KOIA 3OPPA 3IXGA 2DRWA 5F5YA 3CUEA 3MMHA 3B42A 1T1CA 1OJ5A 4Y15A 4XT2A 3MXSA 4E3JA 1DJCA 4OOYA 4HESA 2XSSA 5EM0A 4LENA 3T4KA 2PU2A 4MEZA 4FH4A 4PHTA 2A49A 3CAXA 3IF6A 3P7NA 3KSFA 1T1BA 3S4XA 4IBXA 3SH8A 1I2WA 3HLGA 1GHPA 3NHQA 1G6OA 1SDNA 2HF6A 1TS8A 2Z2LB 2G2WA 1Q2PA 3LGOA 2V20A 2GJ3A 3O88A 3QHYA 4HJ3A 4NXBA 2EX2A 3E0YA 2J9OA 3H82A 4CLCA 1S67L 3HBRA 2PHYA 1N9BA 2RCXA 3EQVA 4D60A 2XQZA 4HJ4A 2QMIA 2LB9A 5FDSA 2VX8A 4Z1WA 2V9AA 4NETA 1XA7A 4WMCA 2A24B 3S7NA 4IHQA 3ZFZA 2ZLYA 2E8JA 3Q7ZA 2VV6A 3NBLA 2MJ6A 1E25A 2XD5A 3NDEA 5EOEA 3LUQA 3IX4A 3UO9A 1ZTUA 3BYDA 5GHZA 1IKGA 1MPLA 2JKGA 3HREA 2Y2JA 4JF5A 3TE8A 3BLMA 1LI0A 2BLSA 3CHWP 3M6BA 4ZDXA 4S2IA 4YINA 3GV9A 1KOUA 2W1RA 3QP6A 4IVIA 5EVID 2Q9NA 2QPNA 2VGLM 2Y2HA 5DF9A 5I94A 2ZOIA 1EW0A 1TD5A 4MN5A 3MBZA 3KSIA 2XFTA 2P9VA 2UWXA 3PR6A 4KQQA 2H0YA 3MXRA 3ZHHA 1KE0A 2K2NA 3D9YA 4LV3A 1LHYA 3E2KA 4YNRA 4JXSA 4JBFA 1KDSA 4Q0JA 4C3QA 4ARZA 3VP0A 4R4RA 2Y2KA 3HLFA 5L2FA 3UPPA 4UQIM 2VZWA 4OH0A 4OVDA 3D3OA 3NJAA 3U4LP 3RH8B 2V1BA 4EQ1A 1L3LA 5F68A 1YKDA 2HJEA 5C5KA 4IVKA 3LR0A 2OLUA 1L2SA 3OZHA 3EGDC 5A93A 4E3NA 3E2LA 4EWFA 1J3WA 2HDQA 3T12B 1SKFA 4MBKA 2KDKA 3VE3A 2V2FF 3OPRA 1OTDA 1PNEA 4XUZA 5F69A 3KYZA 3CUEC 2Z6DA 3EEHA 4PPRA 4R3AA 1W8QA 5HL1A 2O9AA 3G4PA 4I39A 4KZ8A 1T1AA 2W3EA 3ZVTA 1OTBA 3T4SA 1OPXA 1VHMA 2JC7A 3CPTA 4II7A 5EVIA 3SH7A 5DJUA 4C75A 1Q2QA 1V9ZA 4GHIB 4Y0TA 3IF6C 5GLCA 1L0EA 5CECA 1NWZA 4K0WA 3T4LA 3FZCA 4P87A 2J3WA 2H28A 1I5QA 1VEUA 3UPNA 2WAFA 4X6TA 2V1ZA 1P0ZA 1KGEA 1PFLA 3FKWA 2EFXA 4EEUA 2W3GA 1U60A 2V8FA 3DTKA 4CLCC 4PM8A 3S22A 5CGXA 3CJMA 3TJZC 4DE1A 3C2WA 3ZYTA 2QKPA 1XKZA 5A90A 2HJ9C 3IX8A 5E2EA 5CHUA 1N4OA 3NY4A 5KIZA 3KSHA 4CLCE 3LY4A 5CGSA 4YOFA 2PRFA 1CI9A 3ICYA 2ZMAA 4I3IA 3MFDA 1GA9A 1TS0A 4BQMA 4H6JB 3T50A 1DP9A 4QHCA 3LR3A 3Q81A 1K57A 5M19A 2KLIA 1NJ4A 2VGKA 5FQIA 1FQGA 1CJFA 2YKHA 2Y91A 2XRNA 3IS2B 3NIAA 4HOIA 5HARA 2FH5A 3VSKA 1CEFA 2GNXA 3TG9A 1SCWA 2EX8A 1BSGA 2E8IA 4HH3A 4RQ9A 1E3UD 5AJGA 3PYPA 3B47A 1ZHHB 5CX7A 4R4SA 1MBLA 5TBMA 3I7JA 5FI2A 3KO6A 3V67A 2ZJ9A 4HEFA 3LIBA 5LBRA 4QJGA 4LV2A 5E2FA 4RYEA 4WLAA 4ZAMA 4S2PA 5GLDA 2ZOHA 4R70A 1VM1A 1ES5A 1TVFA 3MF0A 2V0UA 4BJPA 1XJ6A 3HLEA 4DDYA 4GS9A 3BFDA 1ACFA 3F1PB 1GCEA 1BLCA 2C6WB 3VE4A 3M2KA 4ZJ2A 2JKRM 2WKQA 4S2NC 3N8SA 4OLGA 4Q8IA 5FEFA 1NLZA 3UB6A 3MFXA 3VOLA 5JYOA 3F1NB 4JGPA 4UA9A 2Y2IA 3IH9A 1OTIA 3E4QA 1YMXA 4OQGA 1OJGA 4JPMA 2RL3A 4GCZA 3C4OA 5EPHA 3P01A 3LR4A 1PI4A 5HAIA 3WRTA 3N8LA 2JBFA 3K3CA 3RFBA 1YT4A 4P6ZM 4WBGA 2VGLS 1WE4A 3CG5A 3N6IA 4WYYA 2H0TA 2I72A 3EEAA 2OLVA 1K56D 5EVIC 3OPLA 3AGEA 3S7PA 2CC1A 4GKUA 1XFQA 5EV0A 2HZ5A 5D3OA 3NOPC 1W63M 1ERQA 4R3JA 2Y59A 3DTMA 2GDNA 4KZBA 3Q82A 2P08A 4QY5A 1YLTA 3IXBA 1P97A 5EVLA 1YSQA 4Y0UA 1IEMA 2VGJA 2PBYA 2WYXA 1WYCA 4EU0A 4GD6A 3A3JA 3RXXA 3BWLA 3RXWA 3DAVA 3NI9A 5U47A 4DF6A 2W1TB 1ALQA 3GMWA 5FEGA 3MZDA 5A92A 5J3WA 2A2LA 4DMZA 1YM1A 3G2YA 1STZA 3GSGA 3DW0A 5L10A 3GRJA 5CRFA 4BL2A 5HDSA 2CMNA 4HH2A 4ESPA 5EE8A 1K57C 4KQOA 3PHYA 1XGJA 3IWIA 3IHBA 4KUOA 4IBRA 1ZC2A 2WGWA 2XK1A 1NRJA 5M1AA 4M4XA 4OPQA 3IBJA 4WZ4A 2OOLA 3G2ZA 4MN6A 4PM7A 2K31A 5HPFA 1EWZA 5HWWA 4E3LA 3BFGA 3K2NA 3V5MA 4G3VA 5DFYA 1IFQA 5A8BA 4FTXA 4WMCD 4OKPA 1S4RA 2W0NA 1K4FA 2IA2A 3LFVA 4RA7A 1SKOA 3BECA 3MZEA 3VFHA 3S7QA 3E4PA 3PAGA 4H8RA 4EUVA 4OOLA 1S1ZA 1Z6FA 1GSVA 1MKMA 5HX9A 4OP5A 4Y2FA 1TS6A 3BFCA 3PBQA 3H9WA 4BBVA 3ZGAB 5F83A 1HLUP 3SS5A 1JNUA 1ZG6A 3H7WA 3C8CA 4XT2B 1CI8A 3MS6A 4HBTA 4XXRA 3UPOA 3A0RA 4KG5A 1MKIA 2UV0E 4MDZA 3UY6A 1N9NA 2L0WA 4AFIA 5E2HA 3IF6B 1BLHA 1YSPA 4P0MA 1L0DA 3IQAA 3R7WB 1XFNA 4KG2A 1PZPA 1BT5A 1L0FA 1KE3A 3D72A 4QB8A 1LSXA 3R4KA 4Z9QA 1CQAA 3LY3A 4LGWA 2XF3A 1O07A 3H82B 4JLFA 4CLCB 2VK3A 4R3BA 1N9LA 2XD1A 5K5BA 5KZHA 3BM6A 3FKVA 4FUWA 3KSGA 4MN7A 4I5SA 1K38A 3O87A 2GX5A 4IEDA 2QYBA 4EEPA 2WKEA 1JWVA 4WL9A 1IYOA 3ITAA 4HQAA 1FCOA 3UE1A 4OP8A 5TJJA 2A24A 2V8CA 2WKIA 3T1QB 4X1MA 3FPVA 5DJTA 3V39A 2WK0A 2V0WA 4KUKA 4BMWA 1FIKA 4R1GA 3IH8A 1W63Q 3C4PA 2XDMA 1A0KA 3C7VA 4K0XA 3M6HA 3P09A 2PAVP 5HDCA 2P7JA 2W27A 4O0PA 4MCWA 4G3WA 4E3OA 2YKFA 2JKFA 3PBRA 3HJKA 1LL5A 5EOOA 2XEPA 1PWDA 4GB7A 1IELA 4CPKA 3A3EA 2Y2OA 5F6AA 3T4QA 1SZVA 4I3JA 2OAQ1 4P6ZS 5DKLA 4LRYC 3W8KA 3W4OA 1WYBA 3OLOA 3V50A 3T1RA 3LYXA 2DCFA 3G35A 4JF6A 1XJ4A 3AGDA 2HDRA 5HW3A 1TDLA 3WS1A 2D01A 4HNBA 4X55A 3NCKA 1ES3A 3QP5A 2X71A 5TGFA 5IHVA 4C6YA 3G32A 3LI8A 4A5RA 3VOZA 1BULA 3BEBA 1KE4A 2ZQ7A 2ZQCA 3W4QA 3FG8A 2ZQ8A 3HVFA 4NG2A 4MLLA 5CTMA 2JE5A 3BQAA 3ITBA 2PR5A 4L9EA 4DXCA 3ZG5A 1O7EA 5CXWA 1VETB 1W5DA 3LR5A 2H5SA 2QJ5A 3BFEA 4WF0A 4ETZA 1XXMA 4PKYG 2QWSA 3U2AA 2BTFP 1CK3A 1XX2A 4F94A 3BY9A 1FR1A 4PMAA 4L0LA 4X25A 3GR2A 5EVIB 3NOUC 1MC0A 4DE3A 5FAQA 2M7UA 5GL9A 1FSYA 2VA0A 3T4TA 5CGWA 1M40A 1RGZA 1VEUB 2ZL1B 3ULFA 4DJ3A 3DWZA 3UB9A 1UWPX 4F3LA 1SHVA 4ETXA 5M18A 1IYQA 1KVMA 1XJ2A 4LCLA 1DJAA 3CLOA 4EESA 2O9CA 3IXHA 1ES4A 3E4OA 1NXYA 4NXGA 2QZ6A 2EXAA 3OC2A 5MC7A 1UGUA 4BD1A 5TR7A 5CHMA 4N1XA 1H8MA 3L7HA 3N8RA 4S2KA 1D06A 4GLQA 2WZXA 4OPRA 2HGVA 4LRXC 5EECA 5CEBA 1GA0A 4B9OA 2IWDA 4HBUA 4FSFA 1NZUA 4WN5A 1BTLA 5L8MA 4LV0A 4X69A 1BLSA 3G34A 2B02A 3MZFA 1YMSA 4DE2A 2M1CA 2Z2MB 1NYMA 4ZJ3A 3GTCA 5CEDA 4H6JA 4HP9A 4XUXA 4U3TA 3HUNA 3UMEA 5HDDA 3ZDJA 1V9YA 3P98A 3TOIA 2VV8A 5IT5A 5G4ZA 4B88A 1K55A 4DN0A 1DP8A 3IS2A 4DRTA 3C38A 3N4IA 3IBRA 2PR6A 3HL9A 2HDSA 1S6RA 1H0MA 2ZC7A 1LT0A 3DTEA 1PZOA 3TSGA 1S0WA 4D2OA 3VP3A 4NKPA 2VEAA 4WZ5A 1Y4OA 3LIFA 4HI4A 3UE6A 4KZ5A 2O9BA 1EROA 3HLDA 4EV4A 4DE0A 3F1OA 3MKEA 3D4FA 1K6RA 4UAAA 1NYYA 5J7EA 1QMEA 1PRQA 4S2OA 4OQIA 3UDIA 3Q7VB 2L1MA 3ZNTA 3TW8A 3PBNA 4GS9B 3V3SA 4QPRA 1J9MA 1BUEA 3PXPA 4O7DA 3SOIA 2ZMFA 1MWRA 3EGXC 1PW8A 2R78A 1C3BA 4FD8A 1OMEA 4GOGA 2Y2NA 3F1PA 4OOMA 4X53A 1P9RA 5HFOA 5J8XA 5FA7A 1D1JA 2OSUA 4EERA 3Q07A 2EWVA 3HLCA 4MBHA 3TRCA 1ZG4A 2ZC5B 3E98A 3F1NA 4IUHA 4S2MA 3C5AA 1L0GA 1S1YA 3BQ8A 3LICA 2R9WA 4MNRA 2D02A 3B33A 5EVEA 5HAQA 2WAEA 4JGQA 1IYSA 1PYYA 3CI6A 4OLDA 1Y54A 4Y7PA 2FFYA 5AVEA 4GW9A 4UA6A 1XJ3A 4R0QA 4B4XA 1LL8A 3QP2A 4QY6A 4GJ4A 5L09A 3GQZA 4E6WA 1H8YA 1HTZA 2ZQDA 4Q0IA 2Y2GA 3HLBA 1S66L 5E43A 4JKTA 3SW1A 5FSRA 4OQ0A 1OTEA 1K6SA 3IX3A 3ZVWA 2JKTM 3QNBA 3MQQA 1HVBA 1XA1A 2WGVA 3UMDA 3G6OA 2W1TA 2J3TD 3ZG0A 2NUTC 5FI7A 4G3KA 1LL9A 4L9GA 1YLPA 2QJ7A 4EBPA 4DXBA 4KZ7A 1YAXA 2JCHA 3Q1FA 3NULA 1ZKJA 1N9OA 1LLBA 2ACGA 2ZBBA 3CWFA 5HD5A 3SS3A 3FV7A 2HP5A 4KZ9A 3O5YA 1PWCA 4RVAA 3RTYA 3M2JA 1K55C 4EXOA 1F9IA 1DP6A 4JXWA 4O8GA 5DKKA 3ZQ5A 1NLYA 3WS5A 3MR0A 5HPIA 1RGYA 3IT9A 4BWIA 3UB5P 3O86A 2ZD8A 4WZ5C 4E3KA 4B93A 3VFFA 3PTEA 4NEED 1NRFA 1P9WA 1GSWA 4QU3A 2I9VA 3VV4A 2ZMVA 5HSQA 3OCNA 1CF0A 2Y4AA 3IXDA 3LO7A 2OWJA 1VB6A 4HY8A 2A3UA 3FPWA 2PU4A 4KQRA 1JTDA 2B95A 5EUAA 3ZCZA 4KZ4A 3N7WA 1TF1A 4ID4A 4K08A 5F82A 3H7WB 4WEJA 1ONHA 1MXOA 4X1LA 4Y17A 2JKTI 4EUZA 5HAPA 5DVAA 1K25A 3G30A 4GDNA 4ME4A 1DJBA 2W3HA 1G5UA 3MQ0A 1BYWA 2Y2MA 3HLWA 5FQMA 2HV1A 3OOVA 4CJNA 3KYQA 4WEKA 3LIEA 5KMWA 4GNUA 1IOUA 3R7WA 2WKHA 4GZBA 1JTGA 3UN7A 3BY8A 3GVBA 4E3IA 4WUJA 4KQDA 2PDRA 1XP4A 4KENB 3JVUA 3JVVA 1K54A 4U0XA 2LB5A 1YLJA 2XGNA 3MKFA 3NC8A 5G4YA 3A3DA 1FCMA 2Z6CA 4ZBEA 1MWSA 3LCEA 1MWTA 5DFXA 3UB7A 4HJ6A 1W7FA 1OTAA 2B18A 4N92A 4I38A 4WELA 4HHDA 5GHYA 2K7SA 2WADA 4E3MA 4P85A 4NXFA 4IUKA 3ISGA 5A91A 2P04A 4UEYA 3SS4A 1FOFA 3VSLA 3HUOA 4EQIA 3HJIA 3SH9A 3ZNYA 1IKIA 3C30A 4Y13A 1X0OA 3UE0A 3QP4A 2G7UA 3GECA 3QNCA 4R6LA 2ZQAA 1GSXA 4Y3IA 3ZG7B 3VP1A 1K0KA 2WKPA 2XFSA 4N1HA 2O0YA 2P9VB 2BG1A 4YFMA 1ES2A 5FQJA 3LI9A 1GHIA 1JWPA 1FSWA 4PM5A 1PI5A 4QD4A 2DNSA 1MY8A 2J9PA 3T1SA 4WM9A 5GLBA 1PWGA 3QP1A 4ARZB 4OPYA 1D7EA 1PW1A 4PM9A 1KGGA 4N9LA 3B3XA 1HD8A 3CZDA 1RCJA 2DMWA 4IJGA 5J4EA 4U0TA 4KZAA 3WRZA 5HZHA 4YWZA 4BBTA 5CHJA 4R23A 3LEQA 2J80A 1F2KA 4S2NA 5EFWA 1I2SA 3T4OA 1NY0A 1YQSA 2BASA 1PIOA 4BBUA
chains in the Genus database with same CATH topology
1TS7A 3E0YA 3F1OA 2A2LA 3EWKA 3H82A 4CLCA 4DMZA 5J7EA 1STZA 5I5LA 1S67L 2XA7S 3BW6A 2PHYA 5HDSA 3MQOA 2CMNA 2J3TC 3EQVA 4HH2A 4HJ4A 4KQOA 3PHYA 2LB9A 2L1MA 2VX8A 4Z1WA 3TW8A 2PT7A 3PBNA 4GS9B 4QPRA 2V9AA 4KUOA 2A24B 3S7NA 4MMNA 4IHQA 3PXPA 2L4RA 4GHIA 3FC7A 2ZMFA 3EGXC 4HIAA 2VV6A 1NRJA 2MJ6A 2R78A 2PD8A 3F1PA 4OOMA 3BJNA 4M4XA 1P9RA 3LUQA 3IBJA 4HP4A 1ZTUA 2OOLA 4MN6A 2K31A 4EERA 5HPFA 2O99A 3LIAA 2KX6A 2OAP1 4F3LB 5HWWA 2EWVA 3UB8A 3DBAA 3TRCA 3K2NA 1OT6A 4G3VA 5DFYA 3TE8A 3E98A 3F1NA 1IFQA 4IUHA 5A8BA 1S1YA 3BQ8A 3LICA 1S4RA 2W0NA 1KOUA 2D02A 3B33A 2W1RA 2IA2A 3LFVA 2VGLM 5DF9A 4JGQA 2ZOIA 3W2ZA 2JHEA 2XROA 3S7QA 1EW0A 1TD5A 3CI6A 3E4PA 4MN5A 3KSIA 4EUVA 4OOLA 1S1ZA 1GSVA 1MKMA 5AVEA 5FL3A 4GW9A 4ZRRA 3PR6A 4Y2FA 1TS6A 2INWA 1XJ3A 3PBQA 1LL8A 3H9WA 4GJ4A 4BBVA 2K2NA 1JNUA 3H7WA 3C8CA 4XT2B 4YNRA 4Q0JA 4ARZA 3A0RA 2PYRA 4UQIM 2VZWA 1F5MA 1G28A 3NOTC 4MDZA 1N9NA 2L0WA 4AFIA 4Q0IA 3D3OA 3NJAA 3RH8B 2V1BA 1S66L 1YSPA 4EQ1A 5F68A 1ODVA 1YKDA 2HJEA 5C5KA 3R7WB 3SW1A 1XFNA 1LSWA 1OTEA 4L9FA 3LR0A 2JKTM 3D72A 3MQQA 5TBMB 1LSXA 3R4KA 3EGDC 2EA9A 3UMDA 3G6OA 2W1TA 2J3TD 2KDKA 2W3FA 3VE3A 2NUTC 3F1OB 3H82B 4CLCB 4G3KA 4L9GA 1OTDA 1N9LA 2QJ7A 5F69A 3PBSA 4I3AA 3KYZA 1F98A 3CUEC 1YAXA 2PD7A 5K5BA 2Z6DA 2Y79A 3KSGA 3EEHA 4MN7A 4R3AA 1T19A 2JN7A 2O9AA 1N9OA 4I5SA 4I39A 1T1AA 2ZBBA 2W3EA 2NUPC 3CWFA 1OTBA 5HD5A 3T4SA 1OPXA 1VHMA 2GX5A 4LPZA 2QYBA 4II7A 4EEPA 3O5YA 5DJUA 4WL9A 1V9ZA 4GHIB 3RTYA 2VJWA 4HQAA 4EXOA 3EQUA 1F9IA 1NWZA 3T4LA 5TJJA 1DP6A 2A24A 2J3WA 4O8GA 5DKKA 2H28A 3FPVA 3ZQ5A 5DJTA 4LLOB 1NLYA 3MR0A 5HPIA 4BWIA 3K3DA 2V0WA 4KUKA 4BMWA 1P0ZA 4O01A 5HL6A 1W63Q 4EW7A 3EOIA 4EEUA 4B93A 2W3GA 5HDCA 3KX0X 2P7JA 2W27A 4CLCC 4O0PA 2GZAA 4NEED 3TJZC 1P9WA 5IS1A 4MCWA 4G3WA 3C2WA 1GSWA 2YKFA 3ZYTA 2I9VA 2QKPA 3VV4A 2ZMVA 3PBRA 5HSQA 3OCNA 3HJKA 2HJ9C 4R38A 2OWJA 4FOFA 1VB6A 4HY8A 4PAUA 5F6AA 3FPWA 3KSHA 4CLCE 3T4QA 5KIZA 4I3JA 2OAQ1 2W3DA 4P6ZS 1H3QA 4YOFA 5DKLA 4LRYC 4PKYA 4LRZE 1TF1A 5HD3A 3ICYA 3OLOA 4I3IA 4K08A 4Y5FA 4JGOA 3LYXA 1TS0A 4H6JB 3T50A 3H7WB 3OCLA 4WEJA 4CQHA 1DP9A 1XJ4A 3LR3A 5KSHA 1LSVA 2D01A 2V1AA 2KLIA 2JKTI 4HNBA 2YKHA 3IS2B 2XRNA 3LI8A 4HOIA 4EETB 4ME4A 3FG8A 2FH5A 3GDIA 2Y8HA 3BQAA 2GNXA 2PR5A 2W3HA 3LIDA 3MQ0A 4UQIS 1BYWA 4L9EA 3OBFA 5AVFA 2HV1A 3OOVA 3PBOA 3KYQA 4HH3A 4WEKA 4NXEA 4RQ9A 2VKSA 3LIEA 3MJQA 1IOUA 5AJGA 3PYPA 3HCYA 3R7WA 3B47A 1ZHHB 2XA7M 2QHKA 1WA9A 5CX7A 3BY8A 3LR5A 2OWHA 5TBMA 2QJ5A 5HWVA 3KO6A 4KQDA 4WUJA 3V67A 2PDRA 2FZ0A 4WF0A 4ETZA 3LIBA 4PKYG 3JVUA 5LBRA 2QWSA 3U2AA 3JVVA 2LB5A 4WLAA 5G4YA 2ZOHA 2Z6CA 3BY9A 4DJ2A 4R70A 2PYPA 2JKRI 3T4JA 4L0LA 5DFXA 5HWTA 2VV7A 3MF0A 4HJ6A 3UB7A 5IU1A 4E04A 2V0UA 1OTAA 2B18A 4BJPA 1DRMA 1XJ6A 3CITA 4GS9A 4I38A 3NOUC 1MC0A 4HHDA 4Q0HA 4WELA 2K7SA 2M7UA 4NXFA 4IUKA 1Y28A 3F1PB 2VA0A 2P04A 3T4TA 3VE4A 2JKRM 2WKQA 4UEYA 4JGRA 1NLZA 3UB6A 3ULFA 4CLCD 3MFXA 4DJ3A 3UB9A 3VOLA 1UWPX 3HJIA 2M7VA 1OT9A 3F1NB 4F3LA 4JGPA 4ETXA 1S4SA 2EWWA 3C30A 1X0OA 2WKRA 3S7OA 1OTIA 1XJ2A 2G7UA 3E4QA 3GECA 1MZUA 3CLOA 4R6LA 1GSXA 1OJGA 4EESA 2O9CA 4GCZA 4Y3IA 3A0VA 1T18A 3LR4A 3P01A 3MXQA 3E4OA 2WKPA 4NXGA 3UE3A 3OC2A 5MC7A 1UGUA 2O0YA 3A0SA 1H8MA 1UWNX 3K3CA 3RFBA 4P6ZM 1D06A 4GLQA 2VGLS 3LI9A 2VLGA 2HGVA 3PBTA 4LRXC 2KOIA 3EEAA 3S7PA 1XFQA 4B9OA 5F5YA 3CUEA 4FSFA 4WN5A 5L8MA 3MMHA 3NOPC 3B42A 4ARZB 1T1CA 1D7EA 1W63M 1OJ5A 2B02A 4XT2A 2M1CA 2P08A 4H6JA 4HP9A 1P97A 2XSSA 3T4KA 3UMEA 5HDDA 1YSQA 1V9YA 4PHTA 2DMWA 4IJGA 5J4EA 2VV8A 5IT5A 5G4ZA 3CAXA 4DN0A 1DP8A 3IS2A 3C38A 4EU0A 3P7NA 3KSFA 1T1BA 5HZHA 3IBRA 2PR6A 4YWZA 4BBTA 1LT0A 3BWLA 3NHQA 1G6OA 2HF6A 1TS8A 2J80A 5EFWA 2W1TB 3T4OA 4NKPA 2VEAA 3LIFA 4HI4A 3UE6A 2GJ3A 4HJ3A 4NXBA 2O9BA 2BASA 5J3WA 4BBUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TS7 A;  3F1O A;  3H82 A;  3EWK A;  5J7E A;  5I5L A;  1S67 L;  2PHY A;  5HDS A;  3MQO A;  2CMN A;  4HH2 A;  4HJ4 A;  3PHY A;  2L1M A;  4GS9 B;  2V9A A;  4KUO A;  2A24 B;  2L4R A;  4GHI A;  3FC7 A;  4HIA A;  2VV6 A;  2R78 A;  2PD8 A;  3F1P A;  4M4X A;  3LUQ A;  4HP4 A;  2OOL A;  4MN6 A;  4EER A;  3LIA A;  2KX6 A;  4F3L B;  5HWW A;  3UB8 A;  1OT6 A;  3F1N A;  5A8B A;  1S1Y A;  3LIC A;  1S4R A;  2W0N A;  1KOU A;  2D02 A;  3B33 A;  4JGQ A;  2ZOI A;  2JHE A;  1EW0 A;  4MN5 A;  3E4P A;  1S1Z A;  1GSV A;  5AVE A;  4GW9 A;  1TS6 A;  2INW A;  1XJ3 A;  1LL8 A;  3H9W A;  4BBV A;  1JNU A;  3H7W A;  3C8C A;  4XT2 B;  3A0R A;  2PYR A;  1G28 A;  3NOT C;  1N9N A;  2L0W A;  3NJA A;  3RH8 B;  2V1B A;  1S66 L;  4EQ1 A;  5F68 A;  1ODV A;  3SW1 A;  1XFN A;  1LSW A;  1OTE A;  4L9F A;  3D72 A;  3MQQ A;  5TBM B;  1LSX A;  2EA9 A;  3UMD A;  3G6O A;  2KDK A;  3VE3 A;  3F1O B;  3H82 B;  4L9G A;  1OTD A;  1N9L A;  2QJ7 A;  5F69 A;  4I3A A;  1F98 A;  2PD7 A;  2Z6D A;  3EEH A;  4R3A A;  1T19 A;  2JN7 A;  4I5S A;  1N9O A;  4I39 A;  1T1A A;  2ZBB A;  3CWF A;  1OTB A;  5HD5 A;  4LPZ A;  4EEP A;  5DJU A;  4WL9 A;  1V9Z A;  4GHI B;  3RTY A;  4HQA A;  4EXO A;  1F9I A;  1NWZ A;  1DP6 A;  2A24 A;  5DKK A;  2H28 A;  3ZQ5 A;  5DJT A;  4LLO B;  3MR0 A;  3K3D A;  2V0W A;  4KUK A;  1P0Z A;  4EW7 A;  4EEU A;  5HDC A;  3KX0 X;  2P7J A;  2W27 A;  5IS1 A;  3C2W A;  1GSW A;  2YKF A;  2I9V A;  2QKP A;  5HSQ A;  3HJK A;  4R38 A;  2OWJ A;  1VB6 A;  4HY8 A;  5F6A A;  5KIZ A;  4I3J A;  5DKL A;  4LRY C;  4PKY A;  4LRZ E;  5HD3 A;  3ICY A;  3OLO A;  4I3I A;  4K08 A;  4JGO A;  3LYX A;  1TS0 A;  4H6J B;  3T50 A;  3H7W B;  1DP9 A;  1XJ4 A;  1LSV A;  2D01 A;  2V1A A;  4HNB A;  2YKH A;  3IS2 B;  3LI8 A;  4HOI A;  4EET B;  3FG8 A;  3GDI A;  2PR5 A;  3LID A;  1BYW A;  4L9E A;  5AVF A;  2HV1 A;  4HH3 A;  4NXE A;  4RQ9 A;  3LIE A;  3MJQ A;  3PYP A;  2QHK A;  1WA9 A;  3BY8 A;  2OWH A;  5TBM A;  2QJ5 A;  5HWV A;  4WUJ A;  4KQD A;  2PDR A;  4WF0 A;  3LIB A;  4PKY G;  2QWS A;  4WLA A;  5G4Y A;  2ZOH A;  2Z6C A;  3BY9 A;  4DJ2 A;  4R70 A;  2PYP A;  5HWT A;  3UB7 A;  2VV7 A;  4HJ6 A;  4E04 A;  5IU1 A;  2V0U A;  1OTA A;  1DRM A;  1XJ6 A;  4GS9 A;  4I38 A;  3NOU C;  4HHD A;  2K7S A;  4NXF A;  1Y28 A;  3F1P B;  3VE4 A;  2WKQ A;  4JGR A;  3UB6 A;  3ULF A;  3MFX A;  4DJ3 A;  3UB9 A;  3VOL A;  1UWP X;  3HJI A;  1OT9 A;  3F1N B;  4F3L A;  4JGP A;  1S4S A;  1X0O A;  2WKR A;  1OTI A;  1XJ2 A;  3E4Q A;  3GEC A;  1MZU A;  3CLO A;  4R6L A;  1GSX A;  1OJG A;  4EES A;  4GCZ A;  3A0V A;  1T18 A;  3MXQ A;  3E4O A;  2WKP A;  4NXG A;  1UGU A;  3A0S A;  1UWN X;  3K3C A;  1D06 A;  3LI9 A;  2VLG A;  4LRX C;  1XFQ A;  4B9O A;  5F5Y A;  4WN5 A;  3NOP C;  1T1C A;  1D7E A;  1OJ5 A;  2B02 A;  4XT2 A;  2M1C A;  4H6J A;  4HP9 A;  1P97 A;  3UME A;  5HDD A;  1V9Y A;  5J4E A;  2VV8 A;  5G4Z A;  3CAX A;  1DP8 A;  3IS2 A;  3P7N A;  1T1B A;  5HZH A;  3IBR A;  2PR6 A;  4YWZ A;  4BBT A;  1LT0 A;  3BWL A;  3NHQ A;  1TS8 A;  2J80 A;  5EFW A;  2VEA A;  3LIF A;  4HI4 A;  3UE6 A;  2GJ3 A;  4HJ3 A;  4NXB A;  2BAS A;  5J3W A;  4BBU A; 
#chains in the Genus database with same CATH topology
 1TS7 A;  3IWO A;  1VET A;  1BZA A;  3EWK A;  2Y2P A;  1TEM A;  1DY6 A;  4KZ6 A;  5GLA A;  2AVX A;  2ZC6 B;  5I5L A;  2XA7 S;  1E4D A;  5AQB A;  5FQK A;  3BW6 A;  3KYE A;  3MQO A;  1XPB A;  2J3T C;  5FAS A;  3CPT B;  3DWK A;  3IHA A;  1CEG A;  3W4P A;  2HDU A;  5L07 A;  2PT7 A;  3A3F A;  3JPU A;  4JXG A;  1XGI A;  4MMN A;  2L4R A;  4GHI A;  1G68 A;  3FC7 A;  4HIA A;  3FWL A;  1SDE A;  1MWU A;  2PD8 A;  5EM1 A;  4OPZ A;  3BJN A;  1H8Z A;  4HP4 A;  1LI9 A;  4NK3 A;  4N9K A;  2O99 A;  3LIA A;  2KX6 A;  2OAP 1;  4F3L B;  3JYI A;  3UB8 A;  3DBA A;  5F1G A;  2J7V A;  4X68 A;  2ZL1 A;  3C7U A;  1OT6 A;  1ERM A;  1NZO A;  4BLM A;  3BLS A;  1ESU A;  1EI5 A;  1K54 C;  5FAO A;  3IF5 A;  4EBL A;  4GDB A;  3A3I A;  3W2Z A;  2JHE A;  2XRO A;  4KZ3 A;  4S2J A;  1YLY A;  5FL3 A;  4ZRR A;  2ZM0 A;  2INW A;  2EX6 A;  4P6B A;  5E2G A;  5FDH A;  4RX3 A;  3O3V A;  1YPR A;  3NDG A;  5FAT A;  1FCN A;  2ZQ9 A;  4B4Z A;  2PYR A;  3ZG9 B;  1F5M A;  1G28 A;  3NOT C;  2Q9M A;  2B5R A;  1YLW A;  1ONG A;  3VMA A;  1ODV A;  1M6K A;  4GN2 A;  1LSW A;  1AXB A;  2Y55 A;  4FCF A;  4L9F A;  4K91 A;  2H10 A;  5TBM B;  3IWQ A;  2X01 A;  3CMZ A;  2G2U A;  3VP2 A;  2EA9 A;  2EXB A;  2W3F A;  4Y0O A;  3F1O B;  2HP6 A;  2ZM8 A;  3PBS A;  4I3A A;  1F98 A;  3MSH A;  2PD7 A;  1KVL A;  2Y79 A;  4RX2 A;  1T19 A;  3PAE A;  2EFU A;  2JN7 A;  1ESI A;  4UHU A;  2NUP C;  4LPZ A;  4DDS A;  2XLN A;  3Q7V A;  2Q0O A;  1JVJ A;  2VJW A;  3EQU A;  3LEZ A;  5CER A;  4KG6 A;  3G31 A;  2WUQ A;  4LLO B;  1KDW A;  4LFU A;  3K3D A;  1TDG A;  4O01 A;  5HL6 A;  5DF8 A;  4EW7 A;  3EOI A;  5AQ7 A;  4S2L A;  1FR6 A;  3KX0 X;  5GHX A;  2GZA A;  3UNW A;  4E6X A;  5IS1 A;  4DKI A;  4JXV A;  4MBF A;  5FI6 A;  5DF7 A;  2X02 A;  4R38 A;  3DTI A;  2P74 A;  3UDF A;  1AWI A;  4FOF A;  3S1Y A;  5F1F A;  1HZO A;  4PAU A;  1Z09 A;  3BFF A;  3OPH A;  4BEN A;  1W8Y A;  2J8Y A;  2W3D A;  1H3Q A;  3RJU A;  3UDX A;  4PKY A;  4LRZ E;  5HD3 A;  5BOH A;  4Y5F A;  4JGO A;  1E3U A;  1BLP A;  3OCL A;  4BL3 A;  3ZG8 B;  4CQH A;  4M3K A;  3QP8 A;  5KSH A;  1LSV A;  2V1A A;  5CTN A;  2ZC3 B;  4EBN A;  3FYZ A;  3WWX A;  2C5W B;  5AQ9 A;  3WS2 A;  4EET B;  2R9X A;  4ZTK A;  3GDI A;  2Y8H A;  2WZZ A;  3HUM A;  3LID A;  5DTK A;  4UQI S;  2IWC A;  3OBF A;  5AVF A;  3PBO A;  2ZC4 B;  1IYP A;  4NXE A;  2VKS A;  3MJQ A;  2ZM2 A;  3HCY A;  2XA7 M;  2XH9 A;  2QHK A;  1WA9 A;  2OWH A;  5HWV A;  1FIL A;  2Y2L A;  2FZ0 A;  1RP5 A;  2FFF B;  1GHM A;  4GD8 A;  4FH2 A;  4LCM A;  5FAP A;  2EX9 A;  4PM6 A;  2OV5 A;  4JF4 A;  4DJ2 A;  3L9K A;  2PYP A;  2JKR I;  3T4J A;  3BRM A;  5HWT A;  1YLZ A;  2VV7 A;  5TFQ A;  4E04 A;  5FQQ A;  5IU1 A;  2WGW B;  3VP4 A;  3WS0 A;  1DRM A;  5AQA A;  1QMF A;  1VQQ A;  3CIT A;  4Q0H A;  5G18 A;  1Y28 A;  1G6A A;  4LV1 A;  4OON A;  4ZJ1 A;  4UA7 A;  2IWB A;  1KGF A;  5JYP A;  2WGI A;  4X56 A;  1JWZ A;  4JGR A;  4CLC D;  4OQH A;  1K56 A;  5DTT A;  2M7V A;  1OT9 A;  1K4E A;  1H5X A;  1S4S A;  2EWW A;  3NEC A;  2WKR A;  3S7O A;  5FQ9 A;  2HP9 A;  2PBD P;  1MZU A;  3V3R A;  5KSC A;  3SZT A;  3A0V A;  1SKO B;  1W79 A;  3WS4 A;  1T18 A;  3MXQ A;  3VOY A;  2Y2Q A;  5DTS A;  3UE3 A;  3AGF A;  3T1X A;  3A0S A;  4BD0 A;  1UWN X;  2HPB A;  2XR0 A;  4QWO A;  2VLG A;  3PBT A;  2KOI A;  3OPP A;  3IXG A;  2DRW A;  5F5Y A;  3CUE A;  3MMH A;  3B42 A;  1T1C A;  1OJ5 A;  4Y15 A;  4XT2 A;  3MXS A;  4E3J A;  1DJC A;  4OOY A;  4HES A;  2XSS A;  5EM0 A;  4LEN A;  3T4K A;  2PU2 A;  4MEZ A;  4FH4 A;  4PHT A;  2A49 A;  3CAX A;  3IF6 A;  3P7N A;  3KSF A;  1T1B A;  3S4X A;  4IBX A;  3SH8 A;  1I2W A;  3HLG A;  1GHP A;  3NHQ A;  1G6O A;  1SDN A;  2HF6 A;  1TS8 A;  2Z2L B;  2G2W A;  1Q2P A;  3LGO A;  2V20 A;  2GJ3 A;  3O88 A;  3QHY A;  4HJ3 A;  4NXB A;  2EX2 A;  3E0Y A;  2J9O A;  3H82 A;  4CLC A;  1S67 L;  3HBR A;  2PHY A;  1N9B A;  2RCX A;  3EQV A;  4D60 A;  2XQZ A;  4HJ4 A;  2QMI A;  2LB9 A;  5FDS A;  2VX8 A;  4Z1W A;  2V9A A;  4NET A;  1XA7 A;  4WMC A;  2A24 B;  3S7N A;  4IHQ A;  3ZFZ A;  2ZLY A;  2E8J A;  3Q7Z A;  2VV6 A;  3NBL A;  2MJ6 A;  1E25 A;  2XD5 A;  3NDE A;  5EOE A;  3LUQ A;  3IX4 A;  3UO9 A;  1ZTU A;  3BYD A;  5GHZ A;  1IKG A;  1MPL A;  2JKG A;  3HRE A;  2Y2J A;  4JF5 A;  3TE8 A;  3BLM A;  1LI0 A;  2BLS A;  3CHW P;  3M6B A;  4ZDX A;  4S2I A;  4YIN A;  3GV9 A;  1KOU A;  2W1R A;  3QP6 A;  4IVI A;  5EVI D;  2Q9N A;  2QPN A;  2VGL M;  2Y2H A;  5DF9 A;  5I94 A;  2ZOI A;  1EW0 A;  1TD5 A;  4MN5 A;  3MBZ A;  3KSI A;  2XFT A;  2P9V A;  2UWX A;  3PR6 A;  4KQQ A;  2H0Y A;  3MXR A;  3ZHH A;  1KE0 A;  2K2N A;  3D9Y A;  4LV3 A;  1LHY A;  3E2K A;  4YNR A;  4JXS A;  4JBF A;  1KDS A;  4Q0J A;  4C3Q A;  4ARZ A;  3VP0 A;  4R4R A;  2Y2K A;  3HLF A;  5L2F A;  3UPP A;  4UQI M;  2VZW A;  4OH0 A;  4OVD A;  3D3O A;  3NJA A;  3U4L P;  3RH8 B;  2V1B A;  4EQ1 A;  1L3L A;  5F68 A;  1YKD A;  2HJE A;  5C5K A;  4IVK A;  3LR0 A;  2OLU A;  1L2S A;  3OZH A;  3EGD C;  5A93 A;  4E3N A;  3E2L A;  4EWF A;  1J3W A;  2HDQ A;  3T12 B;  1SKF A;  4MBK A;  2KDK A;  3VE3 A;  2V2F F;  3OPR A;  1OTD A;  1PNE A;  4XUZ A;  5F69 A;  3KYZ A;  3CUE C;  2Z6D A;  3EEH A;  4PPR A;  4R3A A;  1W8Q A;  5HL1 A;  2O9A A;  3G4P A;  4I39 A;  4KZ8 A;  1T1A A;  2W3E A;  3ZVT A;  1OTB A;  3T4S A;  1OPX A;  1VHM A;  2JC7 A;  3CPT A;  4II7 A;  5EVI A;  3SH7 A;  5DJU A;  4C75 A;  1Q2Q A;  1V9Z A;  4GHI B;  4Y0T A;  3IF6 C;  5GLC A;  1L0E A;  5CEC A;  1NWZ A;  4K0W A;  3T4L A;  3FZC A;  4P87 A;  2J3W A;  2H28 A;  1I5Q A;  1VEU A;  3UPN A;  2WAF A;  4X6T A;  2V1Z A;  1P0Z A;  1KGE A;  1PFL A;  3FKW A;  2EFX A;  4EEU A;  2W3G A;  1U60 A;  2V8F A;  3DTK A;  4CLC C;  4PM8 A;  3S22 A;  5CGX A;  3CJM A;  3TJZ C;  4DE1 A;  3C2W A;  3ZYT A;  2QKP A;  1XKZ A;  5A90 A;  2HJ9 C;  3IX8 A;  5E2E A;  5CHU A;  1N4O A;  3NY4 A;  5KIZ A;  3KSH A;  4CLC E;  3LY4 A;  5CGS A;  4YOF A;  2PRF A;  1CI9 A;  3ICY A;  2ZMA A;  4I3I A;  3MFD A;  1GA9 A;  1TS0 A;  4BQM A;  4H6J B;  3T50 A;  1DP9 A;  4QHC A;  3LR3 A;  3Q81 A;  1K57 A;  5M19 A;  2KLI A;  1NJ4 A;  2VGK A;  5FQI A;  1FQG A;  1CJF A;  2YKH A;  2Y91 A;  2XRN A;  3IS2 B;  3NIA A;  4HOI A;  5HAR A;  2FH5 A;  3VSK A;  1CEF A;  2GNX A;  3TG9 A;  1SCW A;  2EX8 A;  1BSG A;  2E8I A;  4HH3 A;  4RQ9 A;  1E3U D;  5AJG A;  3PYP A;  3B47 A;  1ZHH B;  5CX7 A;  4R4S A;  1MBL A;  5TBM A;  3I7J A;  5FI2 A;  3KO6 A;  3V67 A;  2ZJ9 A;  4HEF A;  3LIB A;  5LBR A;  4QJG A;  4LV2 A;  5E2F A;  4RYE A;  4WLA A;  4ZAM A;  4S2P A;  5GLD A;  2ZOH A;  4R70 A;  1VM1 A;  1ES5 A;  1TVF A;  3MF0 A;  2V0U A;  4BJP A;  1XJ6 A;  3HLE A;  4DDY A;  4GS9 A;  3BFD A;  1ACF A;  3F1P B;  1GCE A;  1BLC A;  2C6W B;  3VE4 A;  3M2K A;  4ZJ2 A;  2JKR M;  2WKQ A;  4S2N C;  3N8S A;  4OLG A;  4Q8I A;  5FEF A;  1NLZ A;  3UB6 A;  3MFX A;  3VOL A;  5JYO A;  3F1N B;  4JGP A;  4UA9 A;  2Y2I A;  3IH9 A;  1OTI A;  3E4Q A;  1YMX A;  4OQG A;  1OJG A;  4JPM A;  2RL3 A;  4GCZ A;  3C4O A;  5EPH A;  3P01 A;  3LR4 A;  1PI4 A;  5HAI A;  3WRT A;  3N8L A;  2JBF A;  3K3C A;  3RFB A;  1YT4 A;  4P6Z M;  4WBG A;  2VGL S;  1WE4 A;  3CG5 A;  3N6I A;  4WYY A;  2H0T A;  2I72 A;  3EEA A;  2OLV A;  1K56 D;  5EVI C;  3OPL A;  3AGE A;  3S7P A;  2CC1 A;  4GKU A;  1XFQ A;  5EV0 A;  2HZ5 A;  5D3O A;  3NOP C;  1W63 M;  1ERQ A;  4R3J A;  2Y59 A;  3DTM A;  2GDN A;  4KZB A;  3Q82 A;  2P08 A;  4QY5 A;  1YLT A;  3IXB A;  1P97 A;  5EVL A;  1YSQ A;  4Y0U A;  1IEM A;  2VGJ A;  2PBY A;  2WYX A;  1WYC A;  4EU0 A;  4GD6 A;  3A3J A;  3RXX A;  3BWL A;  3RXW A;  3DAV A;  3NI9 A;  5U47 A;  4DF6 A;  2W1T B;  1ALQ A;  3GMW A;  5FEG A;  3MZD A;  5A92 A;  5J3W A;  2A2L A;  4DMZ A;  1YM1 A;  3G2Y A;  1STZ A;  3GSG A;  3DW0 A;  5L10 A;  3GRJ A;  5CRF A;  4BL2 A;  5HDS A;  2CMN A;  4HH2 A;  4ESP A;  5EE8 A;  1K57 C;  4KQO A;  3PHY A;  1XGJ A;  3IWI A;  3IHB A;  4KUO A;  4IBR A;  1ZC2 A;  2WGW A;  2XK1 A;  1NRJ A;  5M1A A;  4M4X A;  4OPQ A;  3IBJ A;  4WZ4 A;  2OOL A;  3G2Z A;  4MN6 A;  4PM7 A;  2K31 A;  5HPF A;  1EWZ A;  5HWW A;  4E3L A;  3BFG A;  3K2N A;  3V5M A;  4G3V A;  5DFY A;  1IFQ A;  5A8B A;  4FTX A;  4WMC D;  4OKP A;  1S4R A;  2W0N A;  1K4F A;  2IA2 A;  3LFV A;  4RA7 A;  1SKO A;  3BEC A;  3MZE A;  3VFH A;  3S7Q A;  3E4P A;  3PAG A;  4H8R A;  4EUV A;  4OOL A;  1S1Z A;  1Z6F A;  1GSV A;  1MKM A;  5HX9 A;  4OP5 A;  4Y2F A;  1TS6 A;  3BFC A;  3PBQ A;  3H9W A;  4BBV A;  3ZGA B;  5F83 A;  1HLU P;  3SS5 A;  1JNU A;  1ZG6 A;  3H7W A;  3C8C A;  4XT2 B;  1CI8 A;  3MS6 A;  4HBT A;  4XXR A;  3UPO A;  3A0R A;  4KG5 A;  1MKI A;  2UV0 E;  4MDZ A;  3UY6 A;  1N9N A;  2L0W A;  4AFI A;  5E2H A;  3IF6 B;  1BLH A;  1YSP A;  4P0M A;  1L0D A;  3IQA A;  3R7W B;  1XFN A;  4KG2 A;  1PZP A;  1BT5 A;  1L0F A;  1KE3 A;  3D72 A;  4QB8 A;  1LSX A;  3R4K A;  4Z9Q A;  1CQA A;  3LY3 A;  4LGW A;  2XF3 A;  1O07 A;  3H82 B;  4JLF A;  4CLC B;  2VK3 A;  4R3B A;  1N9L A;  2XD1 A;  5K5B A;  5KZH A;  3BM6 A;  3FKV A;  4FUW A;  3KSG A;  4MN7 A;  4I5S A;  1K38 A;  3O87 A;  2GX5 A;  4IED A;  2QYB A;  4EEP A;  2WKE A;  1JWV A;  4WL9 A;  1IYO A;  3ITA A;  4HQA A;  1FCO A;  3UE1 A;  4OP8 A;  5TJJ A;  2A24 A;  2V8C A;  2WKI A;  3T1Q B;  4X1M A;  3FPV A;  5DJT A;  3V39 A;  2WK0 A;  2V0W A;  4KUK A;  4BMW A;  1FIK A;  4R1G A;  3IH8 A;  1W63 Q;  3C4P A;  2XDM A;  1A0K A;  3C7V A;  4K0X A;  3M6H A;  3P09 A;  2PAV P;  5HDC A;  2P7J A;  2W27 A;  4O0P A;  4MCW A;  4G3W A;  4E3O A;  2YKF A;  2JKF A;  3PBR A;  3HJK A;  1LL5 A;  5EOO A;  2XEP A;  1PWD A;  4GB7 A;  1IEL A;  4CPK A;  3A3E A;  2Y2O A;  5F6A A;  3T4Q A;  1SZV A;  4I3J A;  2OAQ 1;  4P6Z S;  5DKL A;  4LRY C;  3W8K A;  3W4O A;  1WYB A;  3OLO A;  3V50 A;  3T1R A;  3LYX A;  2DCF A;  3G35 A;  4JF6 A;  1XJ4 A;  3AGD A;  2HDR A;  5HW3 A;  1TDL A;  3WS1 A;  2D01 A;  4HNB A;  4X55 A;  3NCK A;  1ES3 A;  3QP5 A;  2X71 A;  5TGF A;  5IHV A;  4C6Y A;  3G32 A;  3LI8 A;  4A5R A;  3VOZ A;  1BUL A;  3BEB A;  1KE4 A;  2ZQ7 A;  2ZQC A;  3W4Q A;  3FG8 A;  2ZQ8 A;  3HVF A;  4NG2 A;  4MLL A;  5CTM A;  2JE5 A;  3BQA A;  3ITB A;  2PR5 A;  4L9E A;  4DXC A;  3ZG5 A;  1O7E A;  5CXW A;  1VET B;  1W5D A;  3LR5 A;  2H5S A;  2QJ5 A;  3BFE A;  4WF0 A;  4ETZ A;  1XXM A;  4PKY G;  2QWS A;  3U2A A;  2BTF P;  1CK3 A;  1XX2 A;  4F94 A;  3BY9 A;  1FR1 A;  4PMA A;  4L0L A;  4X25 A;  3GR2 A;  5EVI B;  3NOU C;  1MC0 A;  4DE3 A;  5FAQ A;  2M7U A;  5GL9 A;  1FSY A;  2VA0 A;  3T4T A;  5CGW A;  1M40 A;  1RGZ A;  1VEU B;  2ZL1 B;  3ULF A;  4DJ3 A;  3DWZ A;  3UB9 A;  1UWP X;  4F3L A;  1SHV A;  4ETX A;  5M18 A;  1IYQ A;  1KVM A;  1XJ2 A;  4LCL A;  1DJA A;  3CLO A;  4EES A;  2O9C A;  3IXH A;  1ES4 A;  3E4O A;  1NXY A;  4NXG A;  2QZ6 A;  2EXA A;  3OC2 A;  5MC7 A;  1UGU A;  4BD1 A;  5TR7 A;  5CHM A;  4N1X A;  1H8M A;  3L7H A;  3N8R A;  4S2K A;  1D06 A;  4GLQ A;  2WZX A;  4OPR A;  2HGV A;  4LRX C;  5EEC A;  5CEB A;  1GA0 A;  4B9O A;  2IWD A;  4HBU A;  4FSF A;  1NZU A;  4WN5 A;  1BTL A;  5L8M A;  4LV0 A;  4X69 A;  1BLS A;  3G34 A;  2B02 A;  3MZF A;  1YMS A;  4DE2 A;  2M1C A;  2Z2M B;  1NYM A;  4ZJ3 A;  3GTC A;  5CED A;  4H6J A;  4HP9 A;  4XUX A;  4U3T A;  3HUN A;  3UME A;  5HDD A;  3ZDJ A;  1V9Y A;  3P98 A;  3TOI A;  2VV8 A;  5IT5 A;  5G4Z A;  4B88 A;  1K55 A;  4DN0 A;  1DP8 A;  3IS2 A;  4DRT A;  3C38 A;  3N4I A;  3IBR A;  2PR6 A;  3HL9 A;  2HDS A;  1S6R A;  1H0M A;  2ZC7 A;  1LT0 A;  3DTE A;  1PZO A;  3TSG A;  1S0W A;  4D2O A;  3VP3 A;  4NKP A;  2VEA A;  4WZ5 A;  1Y4O A;  3LIF A;  4HI4 A;  3UE6 A;  4KZ5 A;  2O9B A;  1ERO A;  3HLD A;  4EV4 A;  4DE0 A;  3F1O A;  3MKE A;  3D4F A;  1K6R A;  4UAA A;  1NYY A;  5J7E A;  1QME A;  1PRQ A;  4S2O A;  4OQI A;  3UDI A;  3Q7V B;  2L1M A;  3ZNT A;  3TW8 A;  3PBN A;  4GS9 B;  3V3S A;  4QPR A;  1J9M A;  1BUE A;  3PXP A;  4O7D A;  3SOI A;  2ZMF A;  1MWR A;  3EGX C;  1PW8 A;  2R78 A;  1C3B A;  4FD8 A;  1OME A;  4GOG A;  2Y2N A;  3F1P A;  4OOM A;  4X53 A;  1P9R A;  5HFO A;  5J8X A;  5FA7 A;  1D1J A;  2OSU A;  4EER A;  3Q07 A;  2EWV A;  3HLC A;  4MBH A;  3TRC A;  1ZG4 A;  2ZC5 B;  3E98 A;  3F1N A;  4IUH A;  4S2M A;  3C5A A;  1L0G A;  1S1Y A;  3BQ8 A;  3LIC A;  2R9W A;  4MNR A;  2D02 A;  3B33 A;  5EVE A;  5HAQ A;  2WAE A;  4JGQ A;  1IYS A;  1PYY A;  3CI6 A;  4OLD A;  1Y54 A;  4Y7P A;  2FFY A;  5AVE A;  4GW9 A;  4UA6 A;  1XJ3 A;  4R0Q A;  4B4X A;  1LL8 A;  3QP2 A;  4QY6 A;  4GJ4 A;  5L09 A;  3GQZ A;  4E6W A;  1H8Y A;  1HTZ A;  2ZQD A;  4Q0I A;  2Y2G A;  3HLB A;  1S66 L;  5E43 A;  4JKT A;  3SW1 A;  5FSR A;  4OQ0 A;  1OTE A;  1K6S A;  3IX3 A;  3ZVW A;  2JKT M;  3QNB A;  3MQQ A;  1HVB A;  1XA1 A;  2WGV A;  3UMD A;  3G6O A;  2W1T A;  2J3T D;  3ZG0 A;  2NUT C;  5FI7 A;  4G3K A;  1LL9 A;  4L9G A;  1YLP A;  2QJ7 A;  4EBP A;  4DXB A;  4KZ7 A;  1YAX A;  2JCH A;  3Q1F A;  3NUL A;  1ZKJ A;  1N9O A;  1LLB A;  2ACG A;  2ZBB A;  3CWF A;  5HD5 A;  3SS3 A;  3FV7 A;  2HP5 A;  4KZ9 A;  3O5Y A;  1PWC A;  4RVA A;  3RTY A;  3M2J A;  1K55 C;  4EXO A;  1F9I A;  1DP6 A;  4JXW A;  4O8G A;  5DKK A;  3ZQ5 A;  1NLY A;  3WS5 A;  3MR0 A;  5HPI A;  1RGY A;  3IT9 A;  4BWI A;  3UB5 P;  3O86 A;  2ZD8 A;  4WZ5 C;  4E3K A;  4B93 A;  3VFF A;  3PTE A;  4NEE D;  1NRF A;  1P9W A;  1GSW A;  4QU3 A;  2I9V A;  3VV4 A;  2ZMV A;  5HSQ A;  3OCN A;  1CF0 A;  2Y4A A;  3IXD A;  3LO7 A;  2OWJ A;  1VB6 A;  4HY8 A;  2A3U A;  3FPW A;  2PU4 A;  4KQR A;  1JTD A;  2B95 A;  5EUA A;  3ZCZ A;  4KZ4 A;  3N7W A;  1TF1 A;  4ID4 A;  4K08 A;  5F82 A;  3H7W B;  4WEJ A;  1ONH A;  1MXO A;  4X1L A;  4Y17 A;  2JKT I;  4EUZ A;  5HAP A;  5DVA A;  1K25 A;  3G30 A;  4GDN A;  4ME4 A;  1DJB A;  2W3H A;  1G5U A;  3MQ0 A;  1BYW A;  2Y2M A;  3HLW A;  5FQM A;  2HV1 A;  3OOV A;  4CJN A;  3KYQ A;  4WEK A;  3LIE A;  5KMW A;  4GNU A;  1IOU A;  3R7W A;  2WKH A;  4GZB A;  1JTG A;  3UN7 A;  3BY8 A;  3GVB A;  4E3I A;  4WUJ A;  4KQD A;  2PDR A;  1XP4 A;  4KEN B;  3JVU A;  3JVV A;  1K54 A;  4U0X A;  2LB5 A;  1YLJ A;  2XGN A;  3MKF A;  3NC8 A;  5G4Y A;  3A3D A;  1FCM A;  2Z6C A;  4ZBE A;  1MWS A;  3LCE A;  1MWT A;  5DFX A;  3UB7 A;  4HJ6 A;  1W7F A;  1OTA A;  2B18 A;  4N92 A;  4I38 A;  4WEL A;  4HHD A;  5GHY A;  2K7S A;  2WAD A;  4E3M A;  4P85 A;  4NXF A;  4IUK A;  3ISG A;  5A91 A;  2P04 A;  4UEY A;  3SS4 A;  1FOF A;  3VSL A;  3HUO A;  4EQI A;  3HJI A;  3SH9 A;  3ZNY A;  1IKI A;  3C30 A;  4Y13 A;  1X0O A;  3UE0 A;  3QP4 A;  2G7U A;  3GEC A;  3QNC A;  4R6L A;  2ZQA A;  1GSX A;  4Y3I A;  3ZG7 B;  3VP1 A;  1K0K A;  2WKP A;  2XFS A;  4N1H A;  2O0Y A;  2P9V B;  2BG1 A;  4YFM A;  1ES2 A;  5FQJ A;  3LI9 A;  1GHI A;  1JWP A;  1FSW A;  4PM5 A;  1PI5 A;  4QD4 A;  2DNS A;  1MY8 A;  2J9P A;  3T1S A;  4WM9 A;  5GLB A;  1PWG A;  3QP1 A;  4ARZ B;  4OPY A;  1D7E A;  1PW1 A;  4PM9 A;  1KGG A;  4N9L A;  3B3X A;  1HD8 A;  3CZD A;  1RCJ A;  2DMW A;  4IJG A;  5J4E A;  4U0T A;  4KZA A;  3WRZ A;  5HZH A;  4YWZ A;  4BBT A;  5CHJ A;  4R23 A;  3LEQ A;  2J80 A;  1F2K A;  4S2N A;  5EFW A;  1I2S A;  3T4O A;  1NY0 A;  1YQS A;  2BAS A;  1PIO A;  4BBU A; 
#chains in the Genus database with same CATH homology
 1TS7 A;  3E0Y A;  3F1O A;  2A2L A;  3EWK A;  3H82 A;  4CLC A;  4DMZ A;  5J7E A;  1STZ A;  5I5L A;  1S67 L;  2XA7 S;  3BW6 A;  2PHY A;  5HDS A;  3MQO A;  2CMN A;  2J3T C;  3EQV A;  4HH2 A;  4HJ4 A;  4KQO A;  3PHY A;  2LB9 A;  2L1M A;  2VX8 A;  4Z1W A;  3TW8 A;  2PT7 A;  3PBN A;  4GS9 B;  4QPR A;  2V9A A;  4KUO A;  2A24 B;  3S7N A;  4MMN A;  4IHQ A;  3PXP A;  2L4R A;  4GHI A;  3FC7 A;  2ZMF A;  3EGX C;  4HIA A;  2VV6 A;  1NRJ A;  2MJ6 A;  2R78 A;  2PD8 A;  3F1P A;  4OOM A;  3BJN A;  4M4X A;  1P9R A;  3LUQ A;  3IBJ A;  4HP4 A;  1ZTU A;  2OOL A;  4MN6 A;  2K31 A;  4EER A;  5HPF A;  2O99 A;  3LIA A;  2KX6 A;  2OAP 1;  4F3L B;  5HWW A;  2EWV A;  3UB8 A;  3DBA A;  3TRC A;  3K2N A;  1OT6 A;  4G3V A;  5DFY A;  3TE8 A;  3E98 A;  3F1N A;  1IFQ A;  4IUH A;  5A8B A;  1S1Y A;  3BQ8 A;  3LIC A;  1S4R A;  2W0N A;  1KOU A;  2D02 A;  3B33 A;  2W1R A;  2IA2 A;  3LFV A;  2VGL M;  5DF9 A;  4JGQ A;  2ZOI A;  3W2Z A;  2JHE A;  2XRO A;  3S7Q A;  1EW0 A;  1TD5 A;  3CI6 A;  3E4P A;  4MN5 A;  3KSI A;  4EUV A;  4OOL A;  1S1Z A;  1GSV A;  1MKM A;  5AVE A;  5FL3 A;  4GW9 A;  4ZRR A;  3PR6 A;  4Y2F A;  1TS6 A;  2INW A;  1XJ3 A;  3PBQ A;  1LL8 A;  3H9W A;  4GJ4 A;  4BBV A;  2K2N A;  1JNU A;  3H7W A;  3C8C A;  4XT2 B;  4YNR A;  4Q0J A;  4ARZ A;  3A0R A;  2PYR A;  4UQI M;  2VZW A;  1F5M A;  1G28 A;  3NOT C;  4MDZ A;  1N9N A;  2L0W A;  4AFI A;  4Q0I A;  3D3O A;  3NJA A;  3RH8 B;  2V1B A;  1S66 L;  1YSP A;  4EQ1 A;  5F68 A;  1ODV A;  1YKD A;  2HJE A;  5C5K A;  3R7W B;  3SW1 A;  1XFN A;  1LSW A;  1OTE A;  4L9F A;  3LR0 A;  2JKT M;  3D72 A;  3MQQ A;  5TBM B;  1LSX A;  3R4K A;  3EGD C;  2EA9 A;  3UMD A;  3G6O A;  2W1T A;  2J3T D;  2KDK A;  2W3F A;  3VE3 A;  2NUT C;  3F1O B;  3H82 B;  4CLC B;  4G3K A;  4L9G A;  1OTD A;  1N9L A;  2QJ7 A;  5F69 A;  3PBS A;  4I3A A;  3KYZ A;  1F98 A;  3CUE C;  1YAX A;  2PD7 A;  5K5B A;  2Z6D A;  2Y79 A;  3KSG A;  3EEH A;  4MN7 A;  4R3A A;  1T19 A;  2JN7 A;  2O9A A;  1N9O A;  4I5S A;  4I39 A;  1T1A A;  2ZBB A;  2W3E A;  2NUP C;  3CWF A;  1OTB A;  5HD5 A;  3T4S A;  1OPX A;  1VHM A;  2GX5 A;  4LPZ A;  2QYB A;  4II7 A;  4EEP A;  3O5Y A;  5DJU A;  4WL9 A;  1V9Z A;  4GHI B;  3RTY A;  2VJW A;  4HQA A;  4EXO A;  3EQU A;  1F9I A;  1NWZ A;  3T4L A;  5TJJ A;  1DP6 A;  2A24 A;  2J3W A;  4O8G A;  5DKK A;  2H28 A;  3FPV A;  3ZQ5 A;  5DJT A;  4LLO B;  1NLY A;  3MR0 A;  5HPI A;  4BWI A;  3K3D A;  2V0W A;  4KUK A;  4BMW A;  1P0Z A;  4O01 A;  5HL6 A;  1W63 Q;  4EW7 A;  3EOI A;  4EEU A;  4B93 A;  2W3G A;  5HDC A;  3KX0 X;  2P7J A;  2W27 A;  4CLC C;  4O0P A;  2GZA A;  4NEE D;  3TJZ C;  1P9W A;  5IS1 A;  4MCW A;  4G3W A;  3C2W A;  1GSW A;  2YKF A;  3ZYT A;  2I9V A;  2QKP A;  3VV4 A;  2ZMV A;  3PBR A;  5HSQ A;  3OCN A;  3HJK A;  2HJ9 C;  4R38 A;  2OWJ A;  4FOF A;  1VB6 A;  4HY8 A;  4PAU A;  5F6A A;  3FPW A;  3KSH A;  4CLC E;  3T4Q A;  5KIZ A;  4I3J A;  2OAQ 1;  2W3D A;  4P6Z S;  1H3Q A;  4YOF A;  5DKL A;  4LRY C;  4PKY A;  4LRZ E;  1TF1 A;  5HD3 A;  3ICY A;  3OLO A;  4I3I A;  4K08 A;  4Y5F A;  4JGO A;  3LYX A;  1TS0 A;  4H6J B;  3T50 A;  3H7W B;  3OCL A;  4WEJ A;  4CQH A;  1DP9 A;  1XJ4 A;  3LR3 A;  5KSH A;  1LSV A;  2D01 A;  2V1A A;  2KLI A;  2JKT I;  4HNB A;  2YKH A;  3IS2 B;  2XRN A;  3LI8 A;  4HOI A;  4EET B;  4ME4 A;  3FG8 A;  2FH5 A;  3GDI A;  2Y8H A;  3BQA A;  2GNX A;  2PR5 A;  2W3H A;  3LID A;  3MQ0 A;  4UQI S;  1BYW A;  4L9E A;  3OBF A;  5AVF A;  2HV1 A;  3OOV A;  3PBO A;  3KYQ A;  4HH3 A;  4WEK A;  4NXE A;  4RQ9 A;  2VKS A;  3LIE A;  3MJQ A;  1IOU A;  5AJG A;  3PYP A;  3HCY A;  3R7W A;  3B47 A;  1ZHH B;  2XA7 M;  2QHK A;  1WA9 A;  5CX7 A;  3BY8 A;  3LR5 A;  2OWH A;  5TBM A;  2QJ5 A;  5HWV A;  3KO6 A;  4KQD A;  4WUJ A;  3V67 A;  2PDR A;  2FZ0 A;  4WF0 A;  4ETZ A;  3LIB A;  4PKY G;  3JVU A;  5LBR A;  2QWS A;  3U2A A;  3JVV A;  2LB5 A;  4WLA A;  5G4Y A;  2ZOH A;  2Z6C A;  3BY9 A;  4DJ2 A;  4R70 A;  2PYP A;  2JKR I;  3T4J A;  4L0L A;  5DFX A;  5HWT A;  2VV7 A;  3MF0 A;  4HJ6 A;  3UB7 A;  5IU1 A;  4E04 A;  2V0U A;  1OTA A;  2B18 A;  4BJP A;  1DRM A;  1XJ6 A;  3CIT A;  4GS9 A;  4I38 A;  3NOU C;  1MC0 A;  4HHD A;  4Q0H A;  4WEL A;  2K7S A;  2M7U A;  4NXF A;  4IUK A;  1Y28 A;  3F1P B;  2VA0 A;  2P04 A;  3T4T A;  3VE4 A;  2JKR M;  2WKQ A;  4UEY A;  4JGR A;  1NLZ A;  3UB6 A;  3ULF A;  4CLC D;  3MFX A;  4DJ3 A;  3UB9 A;  3VOL A;  1UWP X;  3HJI A;  2M7V A;  1OT9 A;  3F1N B;  4F3L A;  4JGP A;  4ETX A;  1S4S A;  2EWW A;  3C30 A;  1X0O A;  2WKR A;  3S7O A;  1OTI A;  1XJ2 A;  2G7U A;  3E4Q A;  3GEC A;  1MZU A;  3CLO A;  4R6L A;  1GSX A;  1OJG A;  4EES A;  2O9C A;  4GCZ A;  4Y3I A;  3A0V A;  1T18 A;  3LR4 A;  3P01 A;  3MXQ A;  3E4O A;  2WKP A;  4NXG A;  3UE3 A;  3OC2 A;  5MC7 A;  1UGU A;  2O0Y A;  3A0S A;  1H8M A;  1UWN X;  3K3C A;  3RFB A;  4P6Z M;  1D06 A;  4GLQ A;  2VGL S;  3LI9 A;  2VLG A;  2HGV A;  3PBT A;  4LRX C;  2KOI A;  3EEA A;  3S7P A;  1XFQ A;  4B9O A;  5F5Y A;  3CUE A;  4FSF A;  4WN5 A;  5L8M A;  3MMH A;  3NOP C;  3B42 A;  4ARZ B;  1T1C A;  1D7E A;  1W63 M;  1OJ5 A;  2B02 A;  4XT2 A;  2M1C A;  2P08 A;  4H6J A;  4HP9 A;  1P97 A;  2XSS A;  3T4K A;  3UME A;  5HDD A;  1YSQ A;  1V9Y A;  4PHT A;  2DMW A;  4IJG A;  5J4E A;  2VV8 A;  5IT5 A;  5G4Z A;  3CAX A;  4DN0 A;  1DP8 A;  3IS2 A;  3C38 A;  4EU0 A;  3P7N A;  3KSF A;  1T1B A;  5HZH A;  3IBR A;  2PR6 A;  4YWZ A;  4BBT A;  1LT0 A;  3BWL A;  3NHQ A;  1G6O A;  2HF6 A;  1TS8 A;  2J80 A;  5EFW A;  2W1T B;  3T4O A;  4NKP A;  2VEA A;  3LIF A;  4HI4 A;  3UE6 A;  2GJ3 A;  4HJ3 A;  4NXB A;  2O9B A;  2BAS A;  5J3W A;  4BBU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...