5HDCA

Femtosecond structural dynamics drives the trans/cis isomerization in photoactive yellow protein: 100 fs to 400 fs structure
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
125
structure length
124
Chain Sequence
MEHVAFGSEDIENTLAKMDDGQLDGLAFGAIQLDGDGNILQYNAAEGDITGRDPKQVIGKNFFKDVAPTDSPEFYGKFKEGVASGNLNTMFEYTFDYQMTPTKVKVHMKKALSGDSYWVFVKRV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Photoactive yellow protein
publication title Femtosecond structural dynamics drives the trans/cis isomerization in photoactive yellow protein.
pubmed doi rcsb
source organism Halorhodospira halophila
molecule tags Signaling protein
total genus 32
structure length 124
sequence length 125
ec nomenclature
pdb deposition date 2016-01-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00989 PAS PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 5hdcA00
2VV6A 3PHYA 2V0UA 4I39A 1S4RA 1LSVA 3ULFA 3MXQA 3NOPC 5F6AA 2INWA 4GS9A 3BWLA 2A24B 2KDKA 2GJ3A 2J80A 4HJ3A 2V1AA 1T18A 5TBMA 3MQOA 4GS9B 4I3IA 5TBMB 4HJ4A 1OTEA 4JGPA 2KX6A 3F1OA 2ZOHA 2D02A 4B9OA 1OTDA 3MQQA 2WKRA 4JGOA 3A0VA 4M4XA 4HH2A 4R6LA 1LL8A 4HI4A 4LRYC 1S1ZA 1GSWA 2W27A 4K08A 1LT0A 1TS0A 4EERA 5G4YA 4BBTA 2WKQA 4LRXC 2I9VA 2QHKA 2QWSA 4R38A 2BASA 2ZBBA 3MR0A 4NXGA 5A8BA 4LPZA 3RTYA 5HD3A 4PKYA 4EQ1A 1LSWA 4GW9A 4L9GA 3H82A 1V9YA 4WN5A 4EXOA 2PYRA 3MJQA 4GCZA 3E4PA 2L0WA 4NXFA 3VOLA 2HV1A 3LI9A 1TS6A 4GHIA 3P7NA 4H6JA 1G28A 2QJ5A 1S67L 5EFWA 3H9WA 4HHDA 1D06A 4GHIB 4H6JB 1OTBA 4LLOB 4KQDA 3HJKA 1XJ2A 2PD7A 4HQAA 1UGUA 3UMEA 3KX0X 1TS8A 1Y28A 5HSQA 3LI8A 2JHEA 3GECA 3CWFA 3IBRA 5F69A 3SW1A 1GSXA 1V9ZA 3FC7A 5DKLA 3E4QA 5F5YA 1OJGA 3A0SA 3B33A 4WL9A 2JN7A 2D01A 3LIBA 4HY8A 2H28A 2PR5A 1P97A 1OTIA 3D72A 2VEAA 3NJAA 3CLOA 4EW7A 3UE6A 1WA9A 2PYPA 2QKPA 1S4SA 5HD5A 5IU1A 2R78A 5DJTA 1KOUA 2V0WA 2OOLA 4I38A 3FG8A 3VE3A 3RH8B 4HIAA 1N9LA 2VV8A 3ICYA 2CMNA 3F1PA 4EESA 3BY8A 3NHQA 3EWKA 1MZUA 1OTAA 1X0OA 3F1OB 4I3JA 1EW0A 1XFNA 4E04A 4L9EA 1OT9A 3C8CA 2L4RA 3NOTC 4RQ9A 3LICA 4BBUA 3BY9A 3LUQA 5F68A 2WKPA 4EEUA 5HWWA 2Z6DA 4XT2A 4BBVA 3LIFA 3GDIA 3H7WA 4NXBA 4WLAA 4HOIA 2OWHA 1T19A 3F1NA 4I5SA 3UB6A 3C2WA 3H7WB 1OT6A 3F1NB 3H82B 3IS2A 1T1CA 4R3AA 1S1YA 2B02A 1F98A 3A0RA 1LSXA 1T1BA 2P7JA 1P0ZA 2PDRA 2OWJA 4HH3A 3G6OA 3UB7A 2YKFA 1F9IA 5DJUA 4EETB 3E4OA 3UB9A 4NXEA 3MFXA 1DRMA 1XFQA 2EA9A 5AVEA 4MN5A 5DKKA 4JGQA 5J3WA 4HP4A 2YKHA 5J4EA 2A24A 1N9NA 3UB8A 2VLGA 4JGRA 5HZHA 2L1MA 3UMDA 3HJIA 1DP6A 5HWTA 4HP9A 5KIZA 2PR6A 2V1BA 3LIDA 3LIEA 1T1AA 3F1PB 4MN6A 2ZOIA 1JNUA 2M1CA 1DP9A 5HDCA 4KUOA 5HWVA 4DJ2A 1GSVA 1XJ4A 4YWZA 4DJ3A 1ODVA 3LIAA 4HJ6A 2QJ7A 1D7EA 2PD8A 5HDSA 4WF0A 4I3AA 3ZQ5A 1VB6A 1S66L 2K7SA 3T50A 1BYWA 1XJ6A 4XT2B 3EEHA 4L9FA 1UWPX 4WUJA 1UWNX 3K3CA 5AVFA 3K3DA 2VV7A 1N9OA 4HNBA 4EEPA 2W0NA 1TS7A 5J7EA 3PYPA 3IS2B 3LYXA 4F3LA 1NWZA 4PKYG 4KUKA 1OJ5A 1XJ3A 2PHYA 4R70A 3VE4A 4F3LB 5IS1A 1DP8A 3CAXA 5HDDA 2V9AA 4LRZE 5G4ZA 3NOUC 2Z6CA 5I5LA 3OLOA
chains in the Genus database with same CATH superfamily
3SH9A 5CTMA 3PHYA 2XA7S 2O9AA 3QP5A 3WS1A 1ERMA 1S4RA 3NOPC 1AXBA 1E4DA 4JF4A 1BT5A 3Q82A 2A49A 5EVEA 1DJBA 2KDKA 4E3JA 5CHJA 4HJ3A 5JYPA 4GS9B 1WE4A 2WADA 3IQAA 4LCMA 5TBMB 2UWXA 5DTTA 3DTIA 4NK3A 4R4SA 2XH9A 1F2KA 2ZOHA 3CUEA 1PRQA 2WKRA 3A0VA 1FIKA 1LL8A 4LRYC 4K08A 3NDGA 2ZC6B 3CITA 4WZ4A 2QMIA 5G4YA 1NRJA 3BLSA 2WKQA 1BZAA 3Q7ZA 2I9VA 4CLCA 4YNRA 1IYPA 2QWSA 2BASA 4LCLA 3IXDA 4EQIA 4OLGA 5A8BA 3UDXA 4EQ1A 1LSWA 4OPZA 2HZ5A 4S2MA 5DVAA 2XROA 1K0KA 1IEMA 4EXOA 2WGWB 2ZQDA 4PM9A 2J7VA 3VFHA 4FH2A 1TVFA 2L0WA 4YINA 1NLYA 4DF6A 3E2KA 2QZ6A 5E2HA 1G28A 1S67L 2QJ5A 3K2NA 3OCNA 4GZBA 3QP2A 4HHDA 3N7WA 4MCWA 4B4XA 4EUZA 4GHIB 5C5KA 5FASA 4H6JB 4KQDA 3HJKA 4ZDXA 2PD7A 4GDBA 5FA7A 2O9CA 2J3TD 3DWKA 4HQAA 5HAPA 3EQVA 3UDFA 4A5RA 2JHEA 3G30A 2OLVA 4OVDA 3IBRA 1GSXA 5FDSA 4Q8IA 4GD8A 4GOGA 3FPVA 1JTGA 4HY8A 4ID4A 1NZUA 2PR5A 4RYEA 3LO7A 3OOVA 1HVBA 2EWWA 3CLOA 4S2LA 4B93A 1WYBA 1ES3A 5AQBA 3QP4A 4Y0TA 2PYPA 4WZ5C 2X01A 3HLFA 1KOUA 2V0WA 2HDSA 2OOLA 2DNSA 3C38A 3FG8A 4Z9QA 3BECA 5FQQA 3VE3A 4E3KA 1ES5A 4S2NA 5E43A 1YLYA 2VV8A 3NC8A 1XX2A 3UB5P 1OTAA 5EOOA 5FAPA 5FI6A 3F1OB 3ZNTA 4I3JA 1EW0A 3QNCA 5M1AA 4OH0A 2QPNA 1MY8A 4L9EA 5CECA 2PU4A 3NOTC 2H0TA 4RQ9A 3U2AA 5F68A 4F94A 5F1FA 4Q0JA 4JXWA 5CGSA 3OPRA 4HOIA 4QB8A 1FSYA 1MKMA 1FSWA 3V3SA 4Y15A 3F1NB 4CLCD 1CEGA 1MC0A 1L0EA 1KDSA 1ZHHB 3BYDA 1JTDA 3A0RA 1LSXA 4QWOA 1T1BA 2P7JA 4ETXA 1IOUA 2ZLYA 1IKIA 3T4LA 3HUMA 1MXOA 3OC2A 3NBLA 3UB9A 3MZEA 4ARZB 4OPYA 4LENA 2WZXA 3BM6A 1K55C 4G3WA 1KDWA 3MKEA 5KSCA 3KSFA 1SKFA 3G34A 1Y4OA 4GNUA 4PHTA 3DTKA 4IVKA 4G3KA 2WGVA 2B18A 5HPFA 2W3FA 3VSKA 3V3RA 2W1RA 2Y2LA 4E3IA 1ZTUA 5E2GA 1MKIA 3CHWP 4IBXA 1L2SA 4KZAA 1W8YA 3JVUA 3TOIA 4IBRA 3GQZA 3HJIA 4HP9A 2A2LA 2XD1A 3NI9A 3Q7VB 4MNRA 3E98A 2EXAA 4X55A 4HESA 2ZOIA 3EGXC 1W79A 4WMCA 3AGEA 1NZOA 3ZG5A 4E3OA 2XEPA 3M2JA 2R9WA 2OAQ1 3AGDA 3PBNA 5E2EA 2ZQ7A 4KZ5A 3G35A 1CJFA 4I3AA 4L9FA 1UWPX 3GVBA 2M7UA 1VEUB 3CPTB 3K3CA 4LGWA 4LV3A 1BLCA 4IHQA 2VV7A 2I72A 2WGWA 2W0NA 5EM0A 3PYPA 1N9BA 1K54C 1G6AA 2VKSA 2J9PA 2JKFA 4O8GA 2IWBA 4QD4A 2RL3A 1IYQA 3S7PA 5TFQA 4R70A 4F3LB 4KZ9A 3KYZA 2EWVA 2C5WB 1SDNA 1DP8A 3JVVA 1FR1A 2ZC3B 3V39A 2X02A 3LR0A 3HUOA 4GLQA 5HDDA 3VMAA 2V9AA 3VP4A 1ALQA 4E3NA 2O9BA 4FUWA 3UPNA 4L0LA 3FKVA 1HD8A 5GLDA 2HDRA 2ZQ9A 2Y91A 3BFEA 3HREA 1S6RA 3HLBA 2ZC7A 3SS4A 3SH8A 3ULFA 4ZJ2A 4OONA 3KYEA 3GTCA 3PBRA 1YM1A 1FCNA 5HFOA 3ITAA 2V8CA 3WS4A 2A24B 3UPPA 2J80A 2AVXA 1T18A 2A3UA 5CEBA 3MKFA 4GJ4A 4HJ4A 2VX8A 3F1OA 4B9OA 4DXBA 1PWDA 3BQ8A 1BUEA 1U60A 1OTDA 2C6WB 3QNBA 4NETA 3MQQA 4OPRA 4R6LA 3W4QA 4ME4A 2FZ0A 1IELA 4HI4A 4OQGA 1S1ZA 4X68A 1GSWA 4RX3A 3KO6A 5CGWA 3T4QA 2PBDP 2Y79A 4BBTA 4BL2A 2XFSA 2WK0A 4KENB 4OP8A 1Q2QA 2ZBBA 4BJPA 3MR0A 1VETB 4NXGA 3RTYA 3G32A 4WMCD 1EI5A 2XR0A 4E6WA 5A93A 5A91A 4HBTA 3PXPA 2FFYA 2XSSA 5F82A 2JC7A 1IKGA 1A0KA 5FQJA 2Y2PA 4IEDA 4JBFA 3GSGA 1V9YA 4BENA 4D60A 2PYRA 4GCZA 3E4PA 4NXFA 3LI9A 1VM1A 4DDSA 1TS6A 4O01A 1NJ4A 1PI4A 4RA7A 2BG1A 3H9WA 3T4TA 2XQZA 1W63M 5CGXA 3PBTA 3QP1A 4LLOB 4GKUA 1UGUA 5EVLA 3W4PA 4ARZA 3UMEA 5D3OA 5HSQA 2VGJA 3IF6C 4CPKA 3LI8A 5KSHA 3GECA 3CWFA 4R3JA 5F69A 5DF7A 2G2UA 3A3FA 3T4OA 5F5YA 5M19A 3A0SA 2JKGA 3B33A 2XA7M 2JN7A 1H8MA 4WL9A 2WKIA 3TRCA 4BWIA 1CI9A 3HUNA 3CJMA 4UHUA 2XRNA 3N6IA 3R7WB 2ZMAA 1YMXA 5EV0A 5GHXA 4DE1A 3UO9A 1S4SA 5HD5A 2GZAA 4CJNA 4OQHA 1QMEA 2IA2A 3PR6A 2RCXA 1XPBA 3RH8B 3MXSA 4LV1A 3RXWA 2CMNA 1S0WA 3DTMA 5AQ9A 1DY6A 4EESA 4P6ZS 4BQMA 1I2SA 3IHAA 3IX4A 5A90A 4U0XA 1XA1A 1FCMA 1CI8A 2G7UA 2O0YA 3OBFA 3GR2A 1PZOA 1OT9A 4KG5A 1L3LA 2DMWA 3C8CA 5FAQA 5FDHA 1Z6FA 3LICA 3LR4A 4BBUA 3E2LA 2MJ6A 3LUQA 4G3VA 4EEUA 5FQMA 5L8MA 3ZGAB 1K38A 3IXGA 4CLCC 2Q0OA 2IWDA 4BBVA 5LBRA 4NKPA 1O7EA 1DJCA 2BLSA 1K4FA 3H7WA 3CPTA 1T19A 3RJUA 3O86A 3W8KA 3IXHA 1OT6A 4BMWA 4E6XA 4IUHA 1NLZA 3H82B 4R3AA 1MWSA 1TEMA 2V20A 1S1YA 3LCEA 4JXSA 3KSGA 1IFQA 1P9RA 2EFUA 3WS2A 2GX5A 2XDMA 3N8RA 2WAEA 4P0MA 3MXRA 4EU0A 4E3LA 1XA7A 5DJUA 2W3DA 2PU2A 1YLTA 3VOYA 3MFXA 3BQAA 1XFQA 2JKTM 4LFUA 5AVEA 5DKKA 1YLJA 3G31A 3S4XA 2Z2LB 2V1ZA 4X69A 4JGQA 3T4SA 3T1QB 4MN7A 3PAGA 2EX9A 4HP4A 4N9KA 4OQIA 2XK1A 3IWOA 2Y2HA 1H3QA 2Y2NA 5L10A 2A24A 1L0GA 3UB8A 1K57A 4OKPA 4WZ5A 1P9WA 5HZHA 2P9VA 2HP5A 2DRWA 2HDQA 4QY6A 3UMDA 4OQ0A 3CI6A 4U3TA 1FR6A 2ZD8A 5FEGA 2V1BA 3W4OA 1T1AA 4MN6A 4N1HA 1SZVA 1JNUA 2M1CA 5HDCA 4KUOA 1CEFA 1YKDA 2W1TB 5HWVA 1STZA 2ZQAA 3S7QA 2P08A 2XFTA 4DJ3A 3WS5A 1ESIA 2H5SA 3WRZA 3LIAA 3HLGA 3VP2A 4WM9A 4UEYA 5IHVA 1FOFA 3SOIA 3T1XA 1ONGA 2VK3A 4HJ6A 2ZMFA 4Q0IA 3ZDJA 1IYOA 1GHIA 1EROA 3OCLA 4WF0A 3IWQA 5FL3A 2H10A 2Y2MA 3T50A 1VETA 3EEHA 1E3UA 4U0TA 5HAIA 1MWTA 4X1MA 2B95A 1KE0A 3GRJA 5GLAA 3KSIA 3K3DA 5EUAA 3ZG9B 3O3VA 3V67A 1N9OA 4HNBA 1BLPA 3ZHHA 1KE3A 2VGLS 2ZL1B 4QHCA 3IS2B 3LYXA 4BD1A 4EWFA 4PKYG 4KUKA 4N1XA 1H8YA 2K31A 4QPRA 1KVLA 3HLDA 5IS1A 1G6OA 3C30A 2Y2OA 4H8RA 4X53A 4KZ8A 1N4OA 3EGDC 3CAXA 3P09A 5FI2A 1MWRA 4GDNA 1RCJA 3OPPA 2PAVP 4R23A 3VP3A 3D9YA 2OLUA 3L9KA 1ES4A 3IF6B 1K55A 3E0YA 5I5LA 3UY6A 1QMFA 1TDGA 1K6SA 3KSHA 2V0UA 5G18A 3KYQA 3MXQA 3R7WA 3S1YA 3IWIA 2INWA 4MBKA 2Q9NA 1NYYA 2WYXA 3BWLA 2WZZA 4GS9A 5HPIA 4KZ3A 3C7VA 2GDNA 2Y4AA 2V1AA 5TBMA 3MQOA 4B4ZA 2K2NA 3DBAA 2J8YA 4M3KA 3PBQA 2B5RA 4JGPA 4HBUA 5HW3A 2W3GA 3DAVA 1PW1A 1YQSA 3I7JA 2D02A 5HARA 3A3IA 3MQ0A 4OP5A 4Z1WA 1MWUA 4M4XA 1PYYA 3BFFA 1L0DA 3TE8A 1JWZA 2JE5A 1JWPA 3MZDA 1XGJA 2W27A 3QP8A 1LT0A 5A92A 1TS0A 4EERA 4EBNA 2EFXA 4LRXC 3O88A 2V8FA 4R38A 4Y2FA 3HLWA 4KQOA 4LPZA 1G5UA 4CLCB 3HBRA 2ZM8A 4PKYA 4XXRA 4ZRRA 1YSPA 5KMWA 4QU3A 3UN7A 4MLLA 4BD0A 4JPMA 1XXMA 4L9GA 3H82A 4WN5A 5EVIC 4DDYA 4DXCA 5EE8A 3MJQA 3VP0A 4DN0A 2CC1A 1K54A 1E3UD 2G2WA 2R9XA 5FAOA 1I2WA 5E2FA 4GHIA 1GHPA 4H6JA 5EFWA 5F1GA 5I94A 1K56A 1H5XA 3A3EA 1FCOA 2OSUA 1OTBA 3NY4A 4XUXA 3LR5A 4KQRA 1Y54A 3PBOA 1TF1A 2GNXA 4DE2A 3KX0X 1PWGA 3ZG7B 2WUQA 3VSLA 1Y28A 4P85A 4S2PA 4JLFA 5DTSA 3SW1A 4KG2A 3D3OA 1V9ZA 3IBJA 5TGFA 5EM1A 1EWZA 1OJGA 4R4RA 4X56A 3LIBA 3S7OA 2H28A 5DF9A 1P97A 3IF5A 3P01A 4JKTA 3NJAA 2O99A 1RGZA 1LLBA 3JPUA 5DF8A 5IU1A 2R78A 1JVJA 2XF3A 3TG9A 1LI0A 4FH4A 2XD5A 1BLHA 3G2ZA 2H0YA 1N9LA 3LY4A 3ICYA 3UE1A 3BW6A 4S2KA 3P98A 1MZUA 3Q81A 4S2JA 3B42A 2W1TA 4ZJ1A 4DKIA 4AFIA 2ZJ9A 1XFNA 1O07A 2L4RA 1NRFA 4IUKA 4PM7A 4ZBEA 4K0XA 3BY9A 3LFVA 3BEBA 5KZHA 5F83A 3RFBA 4CQHA 4MBHA 4LV2A 5J8XA 3GDIA 4DE3A 3NCKA 4NXBA 2OWHA 3F1NA 3HLEA 4OOYA 1IYSA 3C4OA 3MMHA 3UB6A 3C2WA 2J3TC 5L07A 3MSHA 3IH9A 3IS2A 1T1CA 5TR7A 1PW8A 1SCWA 3LEQA 2EX8A 1CF0A 1TDLA 2WKHA 5FI7A 3T1SA 2UV0E 3MS6A 2PDRA 5L2FA 2Q9MA 3A3JA 2BTFP 2YKFA 2ACGA 1K4EA 1RGYA 2X71A 4P87A 5HL1A 1H0MA 3O5YA 3NIAA 2JCHA 4KZ6A 1C3BA 1NYMA 4EUVA 3UE0A 4OLDA 3IF6A 4MN5A 4Y0OA 5AJGA 4GD6A 3M6BA 1K56D 4UQIS 4MMNA 3MFDA 5J3WA 5FQ9A 2E8IA 2HPBA 2VZWA 3EOIA 1ERQA 4FOFA 4WBGA 4O0PA 2YKHA 4N92A 5J4EA 4EBLA 1YSQA 1N9NA 4HEFA 2VLGA 4JGRA 3QP6A 3PTEA 3LY3A 3Q7VA 3GV9A 1OPXA 5K5BA 5HWTA 4P6ZM 4C3QA 4PPRA 4O7DA 5KIZA 3FPWA 4DE0A 3F1PB 2IWCA 3CUEC 2PBYA 3SS3A 3U4LP 3OZHA 1D1JA 1PWCA 3C5AA 3VFFA 3N4IA 3SH7A 5IT5A 1GSVA 1XJ4A 1K25A 1GA9A 4KZ7A 3V50A 2Y2QA 2HGVA 3Q07A 2QJ7A 2WAFA 2PD8A 4IJGA 3ZQ5A 1VB6A 2K7SA 1M6KA 5EOEA 1XJ6A 1VEUA 1CQAA 4XT2B 1JWVA 3BFCA 2Y2GA 5DTKA 3ZVWA 5AQ7A 4WEJA 1UWNX 2J9OA 5JYOA 3HCYA 1HLUP 5FEFA 5TJJA 4WEKA 3FYZA 4ZTKA 4MDZA 1TS7A 2DCFA 2JBFA 3LGOA 3OPHA 5EVIB 4F3LA 3PBSA 1PNEA 4ESPA 2WGIA 1OJ5A 1KGEA 1XJ3A 3BRMA 5BOHA 1BULA 1BLSA 1BTLA 4KZBA 3VE4A 2J3WA 3TSGA 4DRTA 5CTNA 1LI9A 3MF0A 3SS5A 4EBPA 1VQQA 3B47A 5GHZA 3ZFZA 4X1LA 4YOFA 2Y55A 5G4ZA 4FTXA 2KLIA 2HP9A 4BLMA 2Z6CA 3C4PA 3MBZA 4CLCE 3VP1A 5GLBA 2VV6A 4I39A 1LSVA 3G2YA 5F6AA 2EX6A 4XUZA 3HL9A 2GJ3A 2LB5A 5CRFA 1K57C 3RXXA 4S2NC 4QY5A 3ZG0A 2V2FF 4R1GA 4I3IA 1OTEA 1XP4A 2KX6A 2QYBA 5CHMA 4Y17A 4S2IA 4PM5A 4X25A 5CEDA 2HF6A 4JGOA 4HH2A 3ZYTA 3ZVTA 4WYYA 2P04A 2Y2JA 1ZKJA 3SZTA 3MZFA 2HJEA 1NXYA 2JKTI 2WKEA 3FV7A 4R0QA 1YLWA 1W5DA 2QHKA 3BJNA 1AWIA 3UPOA 1FILA 4Y7PA 4K91A 1YAXA 2LB9A 5DFYA 3ITBA 3AGFA 5HD3A 1DJAA 3S7NA 3IHBA 1ONHA 3DWZA 4OPQA 1PIOA 4C75A 4GW9A 5HX9A 3IX8A 2VGLM 1CK3A 1ZG4A 5DFXA 1Q2PA 3VOLA 2HV1A 3FWLA 2OV5A 4KQQA 1J3WA 5CXWA 5GLCA 3P7NA 1TD5A 3C7UA 3BFGA 5GHYA 1D06A 2P74A 1SKOB 3B3XA 4FD8A 4FCFA 3Q1FA 4K0WA 1XJ2A 5HL6A 3EEAA 3S22A 5FQIA 1LL5A 1KVMA 4YFMA 3IX3A 3OPLA 1TS8A 2XGNA 2ZQCA 4KG6A 3T4KA 3VV4A 1FQGA 2VGKA 3LEZA 3FC7A 5DKLA 3E4QA 1H8ZA 1W63Q 1ACFA 1J9MA 4GB7A 4Y13A 1MPLA 3CG5A 1VHMA 2D01A 4N9LA 4MBFA 1YT4A 3ZG8B 5L09A 1OTIA 3D72A 4FSFA 4KZ4A 3L7HA 1KGGA 2VEAA 3LR3A 1ESUA 4EW7A 1PI5A 1GCEA 3UE6A 1WA9A 4OOLA 1W7FA 2QKPA 4II7A 3UDIA 3BFDA 5DJTA 3UNWA 4I38A 2ZC5B 3IT9A 1HZOA 2HP6A 2HJ9C 4B88A 4HIAA 3T12B 3F1PA 3BY8A 3NHQA 4R3BA 4RVAA 3EWKA 4P6BA 3UE3A 1X0OA 2XLNA 3V5MA 2KOIA 2ZQ8A 5CX7A 4UAAA 3M2KA 3WWXA 2Z2MB 4E04A 1ZC2A 3TW8A 3NDEA 1K6RA 4JF5A 4UA9A 1KGFA 2WKPA 5GL9A 5HWWA 1F5MA 2Z6DA 1I5QA 2Y8HA 4XT2A 2NUTC 3VOZA 1NY0A 3LIFA 3NECA 5HAQA 5CERA 5EECA 1YLZA 4WLAA 3N8SA 1GHMA 4MEZA 4I5SA 3H7WB 1L0FA 4JXGA 4NEED 1G68A 3JYIA 4BL3A 2PT7A 1KE4A 3GMWA 5EVIA 4UA6A 3ZNYA 2JKRM 5FQKA 3G4PA 2B02A 3T4JA 1F98A 1OMEA 3NULA 1P0ZA 2OWJA 4QJGA 4HH3A 1ES2A 3G6OA 2FH5A 2M7VA 3UB7A 2Y2IA 1PFLA 3CMZA 1F9IA 4EETB 3E4OA 3FZCA 4NXEA 1W8QA 1DRMA 2EA9A 4GN2A 1M40A 1SDEA 2VJWA 3IXBA 4E3MA 3DTEA 4WELA 2NUPC 3DW0A 3A3DA 3N8LA 5AQAA 4ZJ3A 2EXBA 4UA7A 3ISGA 3FKWA 4Y5FA 5CHUA 3ZCZA 2W3EA 2PRFA 2OAP1 5FSRA 4IVIA 3T1RA 2L1MA 4Y0UA 2Y59A 4PM8A 1DP6A 1XGIA 2P9VB 4S2OA 2PR6A 1XKZA 4D2OA 3LIDA 3LIEA 4JXVA 2JKRI 1YLPA 4PAUA 1DP9A 4X6TA 3HLCA 3IH8A 4DJ2A 4YWZA 2FFFB 1E25A 1ODVA 4PM6A 2ZM2A 5U47A 2E8JA 1BSGA 3EQUA 4PMAA 3BLMA 4LV0A 1HTZA 4Q0HA 3PAEA 5M18A 1D7EA 3TJZC 5HDSA 1S66L 1BYWA 4EV4A 4ZAMA 4Y3IA 1LL9A 1YMSA 4ETZA 1GA0A 2VA0A 1SHVA 4WUJA 4NG2A 5EPHA 3W2ZA 2ZL1A 4OOMA 2EX2A 3D4FA 5AVFA 3R4KA 3WRTA 2W3HA 4EEPA 5FATA 1ZG6A 1PZPA 5J7EA 3M6HA 1RP5A 1WYCA 5MC7A 1NWZA 2PHYA 1SKOA 4DMZA 1Z09A 4RX2A 3QHYA 3HVFA 5EVID 3CZDA 2ZMVA 4C6YA 2HDUA 4LRZE 4UQIM 1YPRA 3NOUC 1LHYA 2Y2KA 2ZM0A 4JF6A 3WS0A 3OLOA 3O87A 1MBLA 2ZC4B
chains in the Genus database with same CATH topology
3KSHA 2VV6A 3PHYA 2XA7S 2V0UA 2O9AA 4I39A 1S4RA 1LSVA 3ULFA 3KYQA 3MXQA 3R7WA 3NOPC 5F6AA 2INWA 3PBRA 4GS9A 3BWLA 5HPIA 2A24B 2KDKA 2GJ3A 2J80A 2LB5A 4HJ3A 2V1AA 1T18A 5TBMA 3MQOA 4GS9B 2K2NA 3DBAA 3PBQA 4I3IA 1OTEA 4GJ4A 4HJ4A 4JGPA 2KX6A 5TBMB 2QYBA 2W3GA 2VX8A 3F1OA 2ZOHA 2D02A 4B9OA 3BQ8A 3CUEA 1OTDA 3MQ0A 4Z1WA 3MQQA 2WKRA 2HF6A 3A0VA 4JGOA 4HH2A 4M4XA 4R6LA 3TE8A 4ME4A 2FZ0A 1LL8A 4HI4A 3ZYTA 4LRYC 1S1ZA 2P04A 1GSWA 2W27A 4K08A 1LT0A 3KO6A 1TS0A 3CITA 4EERA 2HJEA 3T4QA 2JKTI 5G4YA 1NRJA 2Y79A 4BBTA 2WKQA 4LRXC 2I9VA 4CLCA 2QHKA 4YNRA 3BJNA 2QWSA 4R38A 2BASA 4Y2FA 4KQOA 2ZBBA 4BJPA 3MR0A 4NXGA 5A8BA 4LPZA 3RTYA 1YAXA 2LB9A 5DFYA 4CLCB 5HD3A 4PKYA 3PXPA 4ZRRA 1YSPA 3S7NA 4EQ1A 2XSSA 1LSWA 4GW9A 2VGLM 4L9GA 3H82A 5DFXA 2XROA 1V9YA 4WN5A 4EXOA 2PYRA 3MJQA 4GCZA 3E4PA 4DN0A 2L0WA 4NXFA 3VOLA 2HV1A 3LI9A 1NLYA 1TS6A 4O01A 4GHIA 3P7NA 1TD5A 4H6JA 1G28A 2QJ5A 1S67L 5EFWA 3K2NA 3H9WA 3OCNA 3T4TA 1W63M 3PBTA 4HHDA 1D06A 4MCWA 4GHIB 5C5KA 4H6JB 1OTBA 4LLOB 4KQDA 3LR5A 3HJKA 1XJ2A 2PD7A 2O9CA 5HL6A 2J3TD 3EEAA 4HQAA 1UGUA 3PBOA 1TF1A 2GNXA 4ARZA 3UMEA 3EQVA 3KX0X 1TS8A 1Y28A 5HSQA 3LI8A 5KSHA 2JHEA 3T4KA 3GECA 3VV4A 3CWFA 3IBRA 5F69A 3SW1A 1GSXA 3D3OA 1V9ZA 3FC7A 3IBJA 5DKLA 3E4QA 3T4OA 5F5YA 1W63Q 1OJGA 3A0SA 3B33A 3FPVA 2XA7M 1VHMA 1H8MA 2D01A 2JN7A 3LIBA 4HY8A 4WL9A 3S7OA 2H28A 2PR5A 5DF9A 1P97A 3P01A 1OTIA 3D72A 4FSFA 3TRCA 4BWIA 3OOVA 2VEAA 2EWWA 2XRNA 3LR3A 3NJAA 3CLOA 2O99A 4B93A 4EW7A 3R7WB 3UE6A 1WA9A 4OOLA 2PYPA 2QKPA 4II7A 1S4SA 5HD5A 5IU1A 2R78A 2GZAA 5DJTA 1KOUA 2V0WA 2IA2A 2OOLA 3PR6A 4I38A 3C38A 3FG8A 2HJ9C 3VE3A 3RH8B 4HIAA 1N9LA 2VV8A 3ICYA 2CMNA 3F1PA 4EESA 3BW6A 3BY8A 3NHQA 3EWKA 4P6ZS 1MZUA 1OTAA 3UE3A 3B42A 1X0OA 3F1OB 4I3JA 2W1TA 1EW0A 4AFIA 2KOIA 5CX7A 1XFNA 2G7UA 4E04A 2O0YA 3OBFA 4L9EA 1OT9A 2DMWA 3TW8A 3C8CA 2L4RA 3NOTC 4IUKA 4RQ9A 3LICA 3LR4A 4BBUA 3BY9A 3U2AA 3LFVA 2MJ6A 3LUQA 5F68A 4G3VA 2WKPA 4EEUA 5HWWA 1F5MA 2Z6DA 5L8MA 2Y8HA 4XT2A 3RFBA 4CLCC 4BBVA 2NUTC 4CQHA 3LIFA 5LBRA 4NKPA 4Q0JA 3GDIA 3H7WA 4NXBA 4WLAA 4HOIA 2OWHA 1T19A 3F1NA 3MMHA 4I5SA 3UB6A 3C2WA 2J3TC 1MKMA 3H7WB 1OT6A 4BMWA 4NEED 3F1NB 4IUHA 1NLZA 3H82B 3IS2A 2PT7A 1T1CA 4R3AA 4CLCD 1MC0A 1ZHHB 2JKRM 1S1YA 3KSGA 1IFQA 2B02A 3T4JA 1F98A 1P9RA 3A0RA 1LSXA 2GX5A 1T1BA 2P7JA 4ETXA 1P0ZA 2PDRA 1IOUA 2OWJA 4HH3A 3G6OA 4EU0A 2FH5A 2M7VA 3UB7A 2YKFA 1F9IA 3T4LA 5DJUA 2W3DA 3OC2A 4EETB 3E4OA 3UB9A 3O5YA 4NXEA 4ARZB 3MFXA 3BQAA 1DRMA 1XFQA 2JKTM 2EA9A 5AVEA 4EUVA 2VJWA 4G3WA 4MN5A 5DKKA 5AJGA 3KSFA 4WELA 4UQIS 4JGQA 2NUPC 4PHTA 3T4SA 4MN7A 4G3KA 2B18A 5HPFA 4MMNA 5J3WA 4HP4A 2W3FA 2VZWA 2W1RA 1H3QA 3EOIA 4FOFA 1ZTUA 4O0PA 2YKHA 5J4EA 4Y5FA 1YSQA 2A24A 1N9NA 2W3EA 3UB8A 2VLGA 3JVUA 2OAP1 4JGRA 1P9WA 5HZHA 2L1MA 1OPXA 3UMDA 3HJIA 5K5BA 1DP6A 5HWTA 4HP9A 3CI6A 4P6ZM 2A2LA 5KIZA 3FPWA 2PR6A 2V1BA 3E98A 3LIEA 3LIDA 1T1AA 3F1PB 3CUEC 4MN6A 2JKRI 2ZOIA 1JNUA 2M1CA 4PAUA 1DP9A 3EGXC 5HDCA 4KUOA 1YKDA 2W1TB 5HWVA 4DJ2A 1GSVA 1STZA 1XJ4A 4YWZA 3S7QA 5IT5A 2P08A 4DJ3A 1ODVA 3LIAA 4UEYA 3EQUA 2OAQ1 4HJ6A 4Q0HA 2HGVA 2ZMFA 3PBNA 2QJ7A 1D7EA 4Q0IA 3TJZC 2PD8A 3OCLA 4IJGA 4WF0A 4I3AA 5FL3A 5HDSA 3ZQ5A 1VB6A 1S66L 2K7SA 3T50A 1BYWA 1XJ6A 4XT2B 3EEHA 4L9FA 4Y3IA 4ETZA 2VA0A 1UWPX 4WUJA 2M7UA 4WEJA 1UWNX 3K3CA 3W2ZA 3KSIA 3HCYA 4OOMA 5AVFA 4IHQA 5TJJA 3K3DA 3R4KA 4WEKA 2VV7A 3V67A 1N9OA 2W3HA 4HNBA 2W0NA 4EEPA 4MDZA 1TS7A 5J7EA 2VGLS 3PYPA 3IS2B 3LYXA 2VKSA 5MC7A 4F3LA 3PBSA 4O8GA 1NWZA 4PKYG 4KUKA 1OJ5A 1XJ3A 2K31A 2PHYA 4QPRA 3S7PA 4R70A 3VE4A 4F3LB 2J3WA 5IS1A 1G6OA 3C30A 3KYZA 2EWVA 4DMZA 1DP8A 3JVVA 3EGDC 3CAXA 3LR0A 3MF0A 4GLQA 5HDDA 2V9AA 2ZMVA 3B47A 4YOFA 4LRZE 4UQIM 2O9BA 5G4ZA 2KLIA 3E0YA 3NOUC 4L0LA 2Z6CA 5I5LA 4CLCE 3OLOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VV6 A;  3PHY A;  2V0U A;  4I39 A;  1S4R A;  1LSV A;  3ULF A;  3MXQ A;  3NOP C;  5F6A A;  2INW A;  4GS9 A;  3BWL A;  2A24 B;  2KDK A;  2GJ3 A;  2J80 A;  4HJ3 A;  2V1A A;  1T18 A;  5TBM A;  3MQO A;  4GS9 B;  4I3I A;  5TBM B;  4HJ4 A;  1OTE A;  4JGP A;  2KX6 A;  3F1O A;  2ZOH A;  2D02 A;  4B9O A;  1OTD A;  3MQQ A;  2WKR A;  4JGO A;  3A0V A;  4M4X A;  4HH2 A;  4R6L A;  1LL8 A;  4HI4 A;  4LRY C;  1S1Z A;  1GSW A;  2W27 A;  4K08 A;  1LT0 A;  1TS0 A;  4EER A;  5G4Y A;  4BBT A;  2WKQ A;  4LRX C;  2I9V A;  2QHK A;  2QWS A;  4R38 A;  2BAS A;  2ZBB A;  3MR0 A;  4NXG A;  5A8B A;  4LPZ A;  3RTY A;  5HD3 A;  4PKY A;  4EQ1 A;  1LSW A;  4GW9 A;  4L9G A;  3H82 A;  1V9Y A;  4WN5 A;  4EXO A;  2PYR A;  3MJQ A;  4GCZ A;  3E4P A;  2L0W A;  4NXF A;  3VOL A;  2HV1 A;  3LI9 A;  1TS6 A;  4GHI A;  3P7N A;  4H6J A;  1G28 A;  2QJ5 A;  1S67 L;  5EFW A;  3H9W A;  4HHD A;  1D06 A;  4GHI B;  4H6J B;  1OTB A;  4LLO B;  4KQD A;  3HJK A;  1XJ2 A;  2PD7 A;  4HQA A;  1UGU A;  3UME A;  3KX0 X;  1TS8 A;  1Y28 A;  5HSQ A;  3LI8 A;  2JHE A;  3GEC A;  3CWF A;  3IBR A;  5F69 A;  3SW1 A;  1GSX A;  1V9Z A;  3FC7 A;  5DKL A;  3E4Q A;  5F5Y A;  1OJG A;  3A0S A;  3B33 A;  4WL9 A;  2JN7 A;  2D01 A;  3LIB A;  4HY8 A;  2H28 A;  2PR5 A;  1P97 A;  1OTI A;  3D72 A;  2VEA A;  3NJA A;  3CLO A;  4EW7 A;  3UE6 A;  1WA9 A;  2PYP A;  2QKP A;  1S4S A;  5HD5 A;  5IU1 A;  2R78 A;  5DJT A;  1KOU A;  2V0W A;  2OOL A;  4I38 A;  3FG8 A;  3VE3 A;  3RH8 B;  4HIA A;  1N9L A;  2VV8 A;  3ICY A;  2CMN A;  3F1P A;  4EES A;  3BY8 A;  3NHQ A;  3EWK A;  1MZU A;  1OTA A;  1X0O A;  3F1O B;  4I3J A;  1EW0 A;  1XFN A;  4E04 A;  4L9E A;  1OT9 A;  3C8C A;  2L4R A;  3NOT C;  4RQ9 A;  3LIC A;  4BBU A;  3BY9 A;  3LUQ A;  5F68 A;  2WKP A;  4EEU A;  5HWW A;  2Z6D A;  4XT2 A;  4BBV A;  3LIF A;  3GDI A;  3H7W A;  4NXB A;  4WLA A;  4HOI A;  2OWH A;  1T19 A;  3F1N A;  4I5S A;  3UB6 A;  3C2W A;  3H7W B;  1OT6 A;  3F1N B;  3H82 B;  3IS2 A;  1T1C A;  4R3A A;  1S1Y A;  2B02 A;  1F98 A;  3A0R A;  1LSX A;  1T1B A;  2P7J A;  1P0Z A;  2PDR A;  2OWJ A;  4HH3 A;  3G6O A;  3UB7 A;  2YKF A;  1F9I A;  5DJU A;  4EET B;  3E4O A;  3UB9 A;  4NXE A;  3MFX A;  1DRM A;  1XFQ A;  2EA9 A;  5AVE A;  4MN5 A;  5DKK A;  4JGQ A;  5J3W A;  4HP4 A;  2YKH A;  5J4E A;  2A24 A;  1N9N A;  3UB8 A;  2VLG A;  4JGR A;  5HZH A;  2L1M A;  3UMD A;  3HJI A;  1DP6 A;  5HWT A;  4HP9 A;  5KIZ A;  2PR6 A;  2V1B A;  3LID A;  3LIE A;  1T1A A;  3F1P B;  4MN6 A;  2ZOI A;  1JNU A;  2M1C A;  1DP9 A;  5HDC A;  4KUO A;  5HWV A;  4DJ2 A;  1GSV A;  1XJ4 A;  4YWZ A;  4DJ3 A;  1ODV A;  3LIA A;  4HJ6 A;  2QJ7 A;  1D7E A;  2PD8 A;  5HDS A;  4WF0 A;  4I3A A;  3ZQ5 A;  1VB6 A;  1S66 L;  2K7S A;  3T50 A;  1BYW A;  1XJ6 A;  4XT2 B;  3EEH A;  4L9F A;  1UWP X;  4WUJ A;  1UWN X;  3K3C A;  5AVF A;  3K3D A;  2VV7 A;  1N9O A;  4HNB A;  4EEP A;  2W0N A;  1TS7 A;  5J7E A;  3PYP A;  3IS2 B;  3LYX A;  4F3L A;  1NWZ A;  4PKY G;  4KUK A;  1OJ5 A;  1XJ3 A;  2PHY A;  4R70 A;  3VE4 A;  4F3L B;  5IS1 A;  1DP8 A;  3CAX A;  5HDD A;  2V9A A;  4LRZ E;  5G4Z A;  3NOU C;  2Z6C A;  5I5L A;  3OLO A; 
#chains in the Genus database with same CATH topology
 3SH9 A;  5CTM A;  3PHY A;  2XA7 S;  2O9A A;  3QP5 A;  3WS1 A;  1ERM A;  1S4R A;  3NOP C;  1AXB A;  1E4D A;  4JF4 A;  1BT5 A;  3Q82 A;  2A49 A;  5EVE A;  1DJB A;  2KDK A;  4E3J A;  5CHJ A;  4HJ3 A;  5JYP A;  4GS9 B;  1WE4 A;  2WAD A;  3IQA A;  4LCM A;  5TBM B;  2UWX A;  5DTT A;  3DTI A;  4NK3 A;  4R4S A;  2XH9 A;  1F2K A;  2ZOH A;  3CUE A;  1PRQ A;  2WKR A;  3A0V A;  1FIK A;  1LL8 A;  4LRY C;  4K08 A;  3NDG A;  2ZC6 B;  3CIT A;  4WZ4 A;  2QMI A;  5G4Y A;  1NRJ A;  3BLS A;  2WKQ A;  1BZA A;  3Q7Z A;  2I9V A;  4CLC A;  4YNR A;  1IYP A;  2QWS A;  2BAS A;  4LCL A;  3IXD A;  4EQI A;  4OLG A;  5A8B A;  3UDX A;  4EQ1 A;  1LSW A;  4OPZ A;  2HZ5 A;  4S2M A;  5DVA A;  2XRO A;  1K0K A;  1IEM A;  4EXO A;  2WGW B;  2ZQD A;  4PM9 A;  2J7V A;  3VFH A;  4FH2 A;  1TVF A;  2L0W A;  4YIN A;  1NLY A;  4DF6 A;  3E2K A;  2QZ6 A;  5E2H A;  1G28 A;  1S67 L;  2QJ5 A;  3K2N A;  3OCN A;  4GZB A;  3QP2 A;  4HHD A;  3N7W A;  4MCW A;  4B4X A;  4EUZ A;  4GHI B;  5C5K A;  5FAS A;  4H6J B;  4KQD A;  3HJK A;  4ZDX A;  2PD7 A;  4GDB A;  5FA7 A;  2O9C A;  2J3T D;  3DWK A;  4HQA A;  5HAP A;  3EQV A;  3UDF A;  4A5R A;  2JHE A;  3G30 A;  2OLV A;  4OVD A;  3IBR A;  1GSX A;  5FDS A;  4Q8I A;  4GD8 A;  4GOG A;  3FPV A;  1JTG A;  4HY8 A;  4ID4 A;  1NZU A;  2PR5 A;  4RYE A;  3LO7 A;  3OOV A;  1HVB A;  2EWW A;  3CLO A;  4S2L A;  4B93 A;  1WYB A;  1ES3 A;  5AQB A;  3QP4 A;  4Y0T A;  2PYP A;  4WZ5 C;  2X01 A;  3HLF A;  1KOU A;  2V0W A;  2HDS A;  2OOL A;  2DNS A;  3C38 A;  3FG8 A;  4Z9Q A;  3BEC A;  5FQQ A;  3VE3 A;  4E3K A;  1ES5 A;  4S2N A;  5E43 A;  1YLY A;  2VV8 A;  3NC8 A;  1XX2 A;  3UB5 P;  1OTA A;  5EOO A;  5FAP A;  5FI6 A;  3F1O B;  3ZNT A;  4I3J A;  1EW0 A;  3QNC A;  5M1A A;  4OH0 A;  2QPN A;  1MY8 A;  4L9E A;  5CEC A;  2PU4 A;  3NOT C;  2H0T A;  4RQ9 A;  3U2A A;  5F68 A;  4F94 A;  5F1F A;  4Q0J A;  4JXW A;  5CGS A;  3OPR A;  4HOI A;  4QB8 A;  1FSY A;  1MKM A;  1FSW A;  3V3S A;  4Y15 A;  3F1N B;  4CLC D;  1CEG A;  1MC0 A;  1L0E A;  1KDS A;  1ZHH B;  3BYD A;  1JTD A;  3A0R A;  1LSX A;  4QWO A;  1T1B A;  2P7J A;  4ETX A;  1IOU A;  2ZLY A;  1IKI A;  3T4L A;  3HUM A;  1MXO A;  3OC2 A;  3NBL A;  3UB9 A;  3MZE A;  4ARZ B;  4OPY A;  4LEN A;  2WZX A;  3BM6 A;  1K55 C;  4G3W A;  1KDW A;  3MKE A;  5KSC A;  3KSF A;  1SKF A;  3G34 A;  1Y4O A;  4GNU A;  4PHT A;  3DTK A;  4IVK A;  4G3K A;  2WGV A;  2B18 A;  5HPF A;  2W3F A;  3VSK A;  3V3R A;  2W1R A;  2Y2L A;  4E3I A;  1ZTU A;  5E2G A;  1MKI A;  3CHW P;  4IBX A;  1L2S A;  4KZA A;  1W8Y A;  3JVU A;  3TOI A;  4IBR A;  3GQZ A;  3HJI A;  4HP9 A;  2A2L A;  2XD1 A;  3NI9 A;  3Q7V B;  4MNR A;  3E98 A;  2EXA A;  4X55 A;  4HES A;  2ZOI A;  3EGX C;  1W79 A;  4WMC A;  3AGE A;  1NZO A;  3ZG5 A;  4E3O A;  2XEP A;  3M2J A;  2R9W A;  2OAQ 1;  3AGD A;  3PBN A;  5E2E A;  2ZQ7 A;  4KZ5 A;  3G35 A;  1CJF A;  4I3A A;  4L9F A;  1UWP X;  3GVB A;  2M7U A;  1VEU B;  3CPT B;  3K3C A;  4LGW A;  4LV3 A;  1BLC A;  4IHQ A;  2VV7 A;  2I72 A;  2WGW A;  2W0N A;  5EM0 A;  3PYP A;  1N9B A;  1K54 C;  1G6A A;  2VKS A;  2J9P A;  2JKF A;  4O8G A;  2IWB A;  4QD4 A;  2RL3 A;  1IYQ A;  3S7P A;  5TFQ A;  4R70 A;  4F3L B;  4KZ9 A;  3KYZ A;  2EWV A;  2C5W B;  1SDN A;  1DP8 A;  3JVV A;  1FR1 A;  2ZC3 B;  3V39 A;  2X02 A;  3LR0 A;  3HUO A;  4GLQ A;  5HDD A;  3VMA A;  2V9A A;  3VP4 A;  1ALQ A;  4E3N A;  2O9B A;  4FUW A;  3UPN A;  4L0L A;  3FKV A;  1HD8 A;  5GLD A;  2HDR A;  2ZQ9 A;  2Y91 A;  3BFE A;  3HRE A;  1S6R A;  3HLB A;  2ZC7 A;  3SS4 A;  3SH8 A;  3ULF A;  4ZJ2 A;  4OON A;  3KYE A;  3GTC A;  3PBR A;  1YM1 A;  1FCN A;  5HFO A;  3ITA A;  2V8C A;  3WS4 A;  2A24 B;  3UPP A;  2J80 A;  2AVX A;  1T18 A;  2A3U A;  5CEB A;  3MKF A;  4GJ4 A;  4HJ4 A;  2VX8 A;  3F1O A;  4B9O A;  4DXB A;  1PWD A;  3BQ8 A;  1BUE A;  1U60 A;  1OTD A;  2C6W B;  3QNB A;  4NET A;  3MQQ A;  4OPR A;  4R6L A;  3W4Q A;  4ME4 A;  2FZ0 A;  1IEL A;  4HI4 A;  4OQG A;  1S1Z A;  4X68 A;  1GSW A;  4RX3 A;  3KO6 A;  5CGW A;  3T4Q A;  2PBD P;  2Y79 A;  4BBT A;  4BL2 A;  2XFS A;  2WK0 A;  4KEN B;  4OP8 A;  1Q2Q A;  2ZBB A;  4BJP A;  3MR0 A;  1VET B;  4NXG A;  3RTY A;  3G32 A;  4WMC D;  1EI5 A;  2XR0 A;  4E6W A;  5A93 A;  5A91 A;  4HBT A;  3PXP A;  2FFY A;  2XSS A;  5F82 A;  2JC7 A;  1IKG A;  1A0K A;  5FQJ A;  2Y2P A;  4IED A;  4JBF A;  3GSG A;  1V9Y A;  4BEN A;  4D60 A;  2PYR A;  4GCZ A;  3E4P A;  4NXF A;  3LI9 A;  1VM1 A;  4DDS A;  1TS6 A;  4O01 A;  1NJ4 A;  1PI4 A;  4RA7 A;  2BG1 A;  3H9W A;  3T4T A;  2XQZ A;  1W63 M;  5CGX A;  3PBT A;  3QP1 A;  4LLO B;  4GKU A;  1UGU A;  5EVL A;  3W4P A;  4ARZ A;  3UME A;  5D3O A;  5HSQ A;  2VGJ A;  3IF6 C;  4CPK A;  3LI8 A;  5KSH A;  3GEC A;  3CWF A;  4R3J A;  5F69 A;  5DF7 A;  2G2U A;  3A3F A;  3T4O A;  5F5Y A;  5M19 A;  3A0S A;  2JKG A;  3B33 A;  2XA7 M;  2JN7 A;  1H8M A;  4WL9 A;  2WKI A;  3TRC A;  4BWI A;  1CI9 A;  3HUN A;  3CJM A;  4UHU A;  2XRN A;  3N6I A;  3R7W B;  2ZMA A;  1YMX A;  5EV0 A;  5GHX A;  4DE1 A;  3UO9 A;  1S4S A;  5HD5 A;  2GZA A;  4CJN A;  4OQH A;  1QME A;  2IA2 A;  3PR6 A;  2RCX A;  1XPB A;  3RH8 B;  3MXS A;  4LV1 A;  3RXW A;  2CMN A;  1S0W A;  3DTM A;  5AQ9 A;  1DY6 A;  4EES A;  4P6Z S;  4BQM A;  1I2S A;  3IHA A;  3IX4 A;  5A90 A;  4U0X A;  1XA1 A;  1FCM A;  1CI8 A;  2G7U A;  2O0Y A;  3OBF A;  3GR2 A;  1PZO A;  1OT9 A;  4KG5 A;  1L3L A;  2DMW A;  3C8C A;  5FAQ A;  5FDH A;  1Z6F A;  3LIC A;  3LR4 A;  4BBU A;  3E2L A;  2MJ6 A;  3LUQ A;  4G3V A;  4EEU A;  5FQM A;  5L8M A;  3ZGA B;  1K38 A;  3IXG A;  4CLC C;  2Q0O A;  2IWD A;  4BBV A;  5LBR A;  4NKP A;  1O7E A;  1DJC A;  2BLS A;  1K4F A;  3H7W A;  3CPT A;  1T19 A;  3RJU A;  3O86 A;  3W8K A;  3IXH A;  1OT6 A;  4BMW A;  4E6X A;  4IUH A;  1NLZ A;  3H82 B;  4R3A A;  1MWS A;  1TEM A;  2V20 A;  1S1Y A;  3LCE A;  4JXS A;  3KSG A;  1IFQ A;  1P9R A;  2EFU A;  3WS2 A;  2GX5 A;  2XDM A;  3N8R A;  2WAE A;  4P0M A;  3MXR A;  4EU0 A;  4E3L A;  1XA7 A;  5DJU A;  2W3D A;  2PU2 A;  1YLT A;  3VOY A;  3MFX A;  3BQA A;  1XFQ A;  2JKT M;  4LFU A;  5AVE A;  5DKK A;  1YLJ A;  3G31 A;  3S4X A;  2Z2L B;  2V1Z A;  4X69 A;  4JGQ A;  3T4S A;  3T1Q B;  4MN7 A;  3PAG A;  2EX9 A;  4HP4 A;  4N9K A;  4OQI A;  2XK1 A;  3IWO A;  2Y2H A;  1H3Q A;  2Y2N A;  5L10 A;  2A24 A;  1L0G A;  3UB8 A;  1K57 A;  4OKP A;  4WZ5 A;  1P9W A;  5HZH A;  2P9V A;  2HP5 A;  2DRW A;  2HDQ A;  4QY6 A;  3UMD A;  4OQ0 A;  3CI6 A;  4U3T A;  1FR6 A;  2ZD8 A;  5FEG A;  2V1B A;  3W4O A;  1T1A A;  4MN6 A;  4N1H A;  1SZV A;  1JNU A;  2M1C A;  5HDC A;  4KUO A;  1CEF A;  1YKD A;  2W1T B;  5HWV A;  1STZ A;  2ZQA A;  3S7Q A;  2P08 A;  2XFT A;  4DJ3 A;  3WS5 A;  1ESI A;  2H5S A;  3WRZ A;  3LIA A;  3HLG A;  3VP2 A;  4WM9 A;  4UEY A;  5IHV A;  1FOF A;  3SOI A;  3T1X A;  1ONG A;  2VK3 A;  4HJ6 A;  2ZMF A;  4Q0I A;  3ZDJ A;  1IYO A;  1GHI A;  1ERO A;  3OCL A;  4WF0 A;  3IWQ A;  5FL3 A;  2H10 A;  2Y2M A;  3T50 A;  1VET A;  3EEH A;  1E3U A;  4U0T A;  5HAI A;  1MWT A;  4X1M A;  2B95 A;  1KE0 A;  3GRJ A;  5GLA A;  3KSI A;  3K3D A;  5EUA A;  3ZG9 B;  3O3V A;  3V67 A;  1N9O A;  4HNB A;  1BLP A;  3ZHH A;  1KE3 A;  2VGL S;  2ZL1 B;  4QHC A;  3IS2 B;  3LYX A;  4BD1 A;  4EWF A;  4PKY G;  4KUK A;  4N1X A;  1H8Y A;  2K31 A;  4QPR A;  1KVL A;  3HLD A;  5IS1 A;  1G6O A;  3C30 A;  2Y2O A;  4H8R A;  4X53 A;  4KZ8 A;  1N4O A;  3EGD C;  3CAX A;  3P09 A;  5FI2 A;  1MWR A;  4GDN A;  1RCJ A;  3OPP A;  2PAV P;  4R23 A;  3VP3 A;  3D9Y A;  2OLU A;  3L9K A;  1ES4 A;  3IF6 B;  1K55 A;  3E0Y A;  5I5L A;  3UY6 A;  1QMF A;  1TDG A;  1K6S A;  3KSH A;  2V0U A;  5G18 A;  3KYQ A;  3MXQ A;  3R7W A;  3S1Y A;  3IWI A;  2INW A;  4MBK A;  2Q9N A;  1NYY A;  2WYX A;  3BWL A;  2WZZ A;  4GS9 A;  5HPI A;  4KZ3 A;  3C7V A;  2GDN A;  2Y4A A;  2V1A A;  5TBM A;  3MQO A;  4B4Z A;  2K2N A;  3DBA A;  2J8Y A;  4M3K A;  3PBQ A;  2B5R A;  4JGP A;  4HBU A;  5HW3 A;  2W3G A;  3DAV A;  1PW1 A;  1YQS A;  3I7J A;  2D02 A;  5HAR A;  3A3I A;  3MQ0 A;  4OP5 A;  4Z1W A;  1MWU A;  4M4X A;  1PYY A;  3BFF A;  1L0D A;  3TE8 A;  1JWZ A;  2JE5 A;  1JWP A;  3MZD A;  1XGJ A;  2W27 A;  3QP8 A;  1LT0 A;  5A92 A;  1TS0 A;  4EER A;  4EBN A;  2EFX A;  4LRX C;  3O88 A;  2V8F A;  4R38 A;  4Y2F A;  3HLW A;  4KQO A;  4LPZ A;  1G5U A;  4CLC B;  3HBR A;  2ZM8 A;  4PKY A;  4XXR A;  4ZRR A;  1YSP A;  5KMW A;  4QU3 A;  3UN7 A;  4MLL A;  4BD0 A;  4JPM A;  1XXM A;  4L9G A;  3H82 A;  4WN5 A;  5EVI C;  4DDY A;  4DXC A;  5EE8 A;  3MJQ A;  3VP0 A;  4DN0 A;  2CC1 A;  1K54 A;  1E3U D;  2G2W A;  2R9X A;  5FAO A;  1I2W A;  5E2F A;  4GHI A;  1GHP A;  4H6J A;  5EFW A;  5F1G A;  5I94 A;  1K56 A;  1H5X A;  3A3E A;  1FCO A;  2OSU A;  1OTB A;  3NY4 A;  4XUX A;  3LR5 A;  4KQR A;  1Y54 A;  3PBO A;  1TF1 A;  2GNX A;  4DE2 A;  3KX0 X;  1PWG A;  3ZG7 B;  2WUQ A;  3VSL A;  1Y28 A;  4P85 A;  4S2P A;  4JLF A;  5DTS A;  3SW1 A;  4KG2 A;  3D3O A;  1V9Z A;  3IBJ A;  5TGF A;  5EM1 A;  1EWZ A;  1OJG A;  4R4R A;  4X56 A;  3LIB A;  3S7O A;  2H28 A;  5DF9 A;  1P97 A;  3IF5 A;  3P01 A;  4JKT A;  3NJA A;  2O99 A;  1RGZ A;  1LLB A;  3JPU A;  5DF8 A;  5IU1 A;  2R78 A;  1JVJ A;  2XF3 A;  3TG9 A;  1LI0 A;  4FH4 A;  2XD5 A;  1BLH A;  3G2Z A;  2H0Y A;  1N9L A;  3LY4 A;  3ICY A;  3UE1 A;  3BW6 A;  4S2K A;  3P98 A;  1MZU A;  3Q81 A;  4S2J A;  3B42 A;  2W1T A;  4ZJ1 A;  4DKI A;  4AFI A;  2ZJ9 A;  1XFN A;  1O07 A;  2L4R A;  1NRF A;  4IUK A;  4PM7 A;  4ZBE A;  4K0X A;  3BY9 A;  3LFV A;  3BEB A;  5KZH A;  5F83 A;  3RFB A;  4CQH A;  4MBH A;  4LV2 A;  5J8X A;  3GDI A;  4DE3 A;  3NCK A;  4NXB A;  2OWH A;  3F1N A;  3HLE A;  4OOY A;  1IYS A;  3C4O A;  3MMH A;  3UB6 A;  3C2W A;  2J3T C;  5L07 A;  3MSH A;  3IH9 A;  3IS2 A;  1T1C A;  5TR7 A;  1PW8 A;  1SCW A;  3LEQ A;  2EX8 A;  1CF0 A;  1TDL A;  2WKH A;  5FI7 A;  3T1S A;  2UV0 E;  3MS6 A;  2PDR A;  5L2F A;  2Q9M A;  3A3J A;  2BTF P;  2YKF A;  2ACG A;  1K4E A;  1RGY A;  2X71 A;  4P87 A;  5HL1 A;  1H0M A;  3O5Y A;  3NIA A;  2JCH A;  4KZ6 A;  1C3B A;  1NYM A;  4EUV A;  3UE0 A;  4OLD A;  3IF6 A;  4MN5 A;  4Y0O A;  5AJG A;  4GD6 A;  3M6B A;  1K56 D;  4UQI S;  4MMN A;  3MFD A;  5J3W A;  5FQ9 A;  2E8I A;  2HPB A;  2VZW A;  3EOI A;  1ERQ A;  4FOF A;  4WBG A;  4O0P A;  2YKH A;  4N92 A;  5J4E A;  4EBL A;  1YSQ A;  1N9N A;  4HEF A;  2VLG A;  4JGR A;  3QP6 A;  3PTE A;  3LY3 A;  3Q7V A;  3GV9 A;  1OPX A;  5K5B A;  5HWT A;  4P6Z M;  4C3Q A;  4PPR A;  4O7D A;  5KIZ A;  3FPW A;  4DE0 A;  3F1P B;  2IWC A;  3CUE C;  2PBY A;  3SS3 A;  3U4L P;  3OZH A;  1D1J A;  1PWC A;  3C5A A;  3VFF A;  3N4I A;  3SH7 A;  5IT5 A;  1GSV A;  1XJ4 A;  1K25 A;  1GA9 A;  4KZ7 A;  3V50 A;  2Y2Q A;  2HGV A;  3Q07 A;  2QJ7 A;  2WAF A;  2PD8 A;  4IJG A;  3ZQ5 A;  1VB6 A;  2K7S A;  1M6K A;  5EOE A;  1XJ6 A;  1VEU A;  1CQA A;  4XT2 B;  1JWV A;  3BFC A;  2Y2G A;  5DTK A;  3ZVW A;  5AQ7 A;  4WEJ A;  1UWN X;  2J9O A;  5JYO A;  3HCY A;  1HLU P;  5FEF A;  5TJJ A;  4WEK A;  3FYZ A;  4ZTK A;  4MDZ A;  1TS7 A;  2DCF A;  2JBF A;  3LGO A;  3OPH A;  5EVI B;  4F3L A;  3PBS A;  1PNE A;  4ESP A;  2WGI A;  1OJ5 A;  1KGE A;  1XJ3 A;  3BRM A;  5BOH A;  1BUL A;  1BLS A;  1BTL A;  4KZB A;  3VE4 A;  2J3W A;  3TSG A;  4DRT A;  5CTN A;  1LI9 A;  3MF0 A;  3SS5 A;  4EBP A;  1VQQ A;  3B47 A;  5GHZ A;  3ZFZ A;  4X1L A;  4YOF A;  2Y55 A;  5G4Z A;  4FTX A;  2KLI A;  2HP9 A;  4BLM A;  2Z6C A;  3C4P A;  3MBZ A;  4CLC E;  3VP1 A;  5GLB A;  2VV6 A;  4I39 A;  1LSV A;  3G2Y A;  5F6A A;  2EX6 A;  4XUZ A;  3HL9 A;  2GJ3 A;  2LB5 A;  5CRF A;  1K57 C;  3RXX A;  4S2N C;  4QY5 A;  3ZG0 A;  2V2F F;  4R1G A;  4I3I A;  1OTE A;  1XP4 A;  2KX6 A;  2QYB A;  5CHM A;  4Y17 A;  4S2I A;  4PM5 A;  4X25 A;  5CED A;  2HF6 A;  4JGO A;  4HH2 A;  3ZYT A;  3ZVT A;  4WYY A;  2P04 A;  2Y2J A;  1ZKJ A;  3SZT A;  3MZF A;  2HJE A;  1NXY A;  2JKT I;  2WKE A;  3FV7 A;  4R0Q A;  1YLW A;  1W5D A;  2QHK A;  3BJN A;  1AWI A;  3UPO A;  1FIL A;  4Y7P A;  4K91 A;  1YAX A;  2LB9 A;  5DFY A;  3ITB A;  3AGF A;  5HD3 A;  1DJA A;  3S7N A;  3IHB A;  1ONH A;  3DWZ A;  4OPQ A;  1PIO A;  4C75 A;  4GW9 A;  5HX9 A;  3IX8 A;  2VGL M;  1CK3 A;  1ZG4 A;  5DFX A;  1Q2P A;  3VOL A;  2HV1 A;  3FWL A;  2OV5 A;  4KQQ A;  1J3W A;  5CXW A;  5GLC A;  3P7N A;  1TD5 A;  3C7U A;  3BFG A;  5GHY A;  1D06 A;  2P74 A;  1SKO B;  3B3X A;  4FD8 A;  4FCF A;  3Q1F A;  4K0W A;  1XJ2 A;  5HL6 A;  3EEA A;  3S22 A;  5FQI A;  1LL5 A;  1KVM A;  4YFM A;  3IX3 A;  3OPL A;  1TS8 A;  2XGN A;  2ZQC A;  4KG6 A;  3T4K A;  3VV4 A;  1FQG A;  2VGK A;  3LEZ A;  3FC7 A;  5DKL A;  3E4Q A;  1H8Z A;  1W63 Q;  1ACF A;  1J9M A;  4GB7 A;  4Y13 A;  1MPL A;  3CG5 A;  1VHM A;  2D01 A;  4N9L A;  4MBF A;  1YT4 A;  3ZG8 B;  5L09 A;  1OTI A;  3D72 A;  4FSF A;  4KZ4 A;  3L7H A;  1KGG A;  2VEA A;  3LR3 A;  1ESU A;  4EW7 A;  1PI5 A;  1GCE A;  3UE6 A;  1WA9 A;  4OOL A;  1W7F A;  2QKP A;  4II7 A;  3UDI A;  3BFD A;  5DJT A;  3UNW A;  4I38 A;  2ZC5 B;  3IT9 A;  1HZO A;  2HP6 A;  2HJ9 C;  4B88 A;  4HIA A;  3T12 B;  3F1P A;  3BY8 A;  3NHQ A;  4R3B A;  4RVA A;  3EWK A;  4P6B A;  3UE3 A;  1X0O A;  2XLN A;  3V5M A;  2KOI A;  2ZQ8 A;  5CX7 A;  4UAA A;  3M2K A;  3WWX A;  2Z2M B;  4E04 A;  1ZC2 A;  3TW8 A;  3NDE A;  1K6R A;  4JF5 A;  4UA9 A;  1KGF A;  2WKP A;  5GL9 A;  5HWW A;  1F5M A;  2Z6D A;  1I5Q A;  2Y8H A;  4XT2 A;  2NUT C;  3VOZ A;  1NY0 A;  3LIF A;  3NEC A;  5HAQ A;  5CER A;  5EEC A;  1YLZ A;  4WLA A;  3N8S A;  1GHM A;  4MEZ A;  4I5S A;  3H7W B;  1L0F A;  4JXG A;  4NEE D;  1G68 A;  3JYI A;  4BL3 A;  2PT7 A;  1KE4 A;  3GMW A;  5EVI A;  4UA6 A;  3ZNY A;  2JKR M;  5FQK A;  3G4P A;  2B02 A;  3T4J A;  1F98 A;  1OME A;  3NUL A;  1P0Z A;  2OWJ A;  4QJG A;  4HH3 A;  1ES2 A;  3G6O A;  2FH5 A;  2M7V A;  3UB7 A;  2Y2I A;  1PFL A;  3CMZ A;  1F9I A;  4EET B;  3E4O A;  3FZC A;  4NXE A;  1W8Q A;  1DRM A;  2EA9 A;  4GN2 A;  1M40 A;  1SDE A;  2VJW A;  3IXB A;  4E3M A;  3DTE A;  4WEL A;  2NUP C;  3DW0 A;  3A3D A;  3N8L A;  5AQA A;  4ZJ3 A;  2EXB A;  4UA7 A;  3ISG A;  3FKW A;  4Y5F A;  5CHU A;  3ZCZ A;  2W3E A;  2PRF A;  2OAP 1;  5FSR A;  4IVI A;  3T1R A;  2L1M A;  4Y0U A;  2Y59 A;  4PM8 A;  1DP6 A;  1XGI A;  2P9V B;  4S2O A;  2PR6 A;  1XKZ A;  4D2O A;  3LID A;  3LIE A;  4JXV A;  2JKR I;  1YLP A;  4PAU A;  1DP9 A;  4X6T A;  3HLC A;  3IH8 A;  4DJ2 A;  4YWZ A;  2FFF B;  1E25 A;  1ODV A;  4PM6 A;  2ZM2 A;  5U47 A;  2E8J A;  1BSG A;  3EQU A;  4PMA A;  3BLM A;  4LV0 A;  1HTZ A;  4Q0H A;  3PAE A;  5M18 A;  1D7E A;  3TJZ C;  5HDS A;  1S66 L;  1BYW A;  4EV4 A;  4ZAM A;  4Y3I A;  1LL9 A;  1YMS A;  4ETZ A;  1GA0 A;  2VA0 A;  1SHV A;  4WUJ A;  4NG2 A;  5EPH A;  3W2Z A;  2ZL1 A;  4OOM A;  2EX2 A;  3D4F A;  5AVF A;  3R4K A;  3WRT A;  2W3H A;  4EEP A;  5FAT A;  1ZG6 A;  1PZP A;  5J7E A;  3M6H A;  1RP5 A;  1WYC A;  5MC7 A;  1NWZ A;  2PHY A;  1SKO A;  4DMZ A;  1Z09 A;  4RX2 A;  3QHY A;  3HVF A;  5EVI D;  3CZD A;  2ZMV A;  4C6Y A;  2HDU A;  4LRZ E;  4UQI M;  1YPR A;  3NOU C;  1LHY A;  2Y2K A;  2ZM0 A;  4JF6 A;  3WS0 A;  3OLO A;  3O87 A;  1MBL A;  2ZC4 B; 
#chains in the Genus database with same CATH homology
 3KSH A;  2VV6 A;  3PHY A;  2XA7 S;  2V0U A;  2O9A A;  4I39 A;  1S4R A;  1LSV A;  3ULF A;  3KYQ A;  3MXQ A;  3R7W A;  3NOP C;  5F6A A;  2INW A;  3PBR A;  4GS9 A;  3BWL A;  5HPI A;  2A24 B;  2KDK A;  2GJ3 A;  2J80 A;  2LB5 A;  4HJ3 A;  2V1A A;  1T18 A;  5TBM A;  3MQO A;  4GS9 B;  2K2N A;  3DBA A;  3PBQ A;  4I3I A;  1OTE A;  4GJ4 A;  4HJ4 A;  4JGP A;  2KX6 A;  5TBM B;  2QYB A;  2W3G A;  2VX8 A;  3F1O A;  2ZOH A;  2D02 A;  4B9O A;  3BQ8 A;  3CUE A;  1OTD A;  3MQ0 A;  4Z1W A;  3MQQ A;  2WKR A;  2HF6 A;  3A0V A;  4JGO A;  4HH2 A;  4M4X A;  4R6L A;  3TE8 A;  4ME4 A;  2FZ0 A;  1LL8 A;  4HI4 A;  3ZYT A;  4LRY C;  1S1Z A;  2P04 A;  1GSW A;  2W27 A;  4K08 A;  1LT0 A;  3KO6 A;  1TS0 A;  3CIT A;  4EER A;  2HJE A;  3T4Q A;  2JKT I;  5G4Y A;  1NRJ A;  2Y79 A;  4BBT A;  2WKQ A;  4LRX C;  2I9V A;  4CLC A;  2QHK A;  4YNR A;  3BJN A;  2QWS A;  4R38 A;  2BAS A;  4Y2F A;  4KQO A;  2ZBB A;  4BJP A;  3MR0 A;  4NXG A;  5A8B A;  4LPZ A;  3RTY A;  1YAX A;  2LB9 A;  5DFY A;  4CLC B;  5HD3 A;  4PKY A;  3PXP A;  4ZRR A;  1YSP A;  3S7N A;  4EQ1 A;  2XSS A;  1LSW A;  4GW9 A;  2VGL M;  4L9G A;  3H82 A;  5DFX A;  2XRO A;  1V9Y A;  4WN5 A;  4EXO A;  2PYR A;  3MJQ A;  4GCZ A;  3E4P A;  4DN0 A;  2L0W A;  4NXF A;  3VOL A;  2HV1 A;  3LI9 A;  1NLY A;  1TS6 A;  4O01 A;  4GHI A;  3P7N A;  1TD5 A;  4H6J A;  1G28 A;  2QJ5 A;  1S67 L;  5EFW A;  3K2N A;  3H9W A;  3OCN A;  3T4T A;  1W63 M;  3PBT A;  4HHD A;  1D06 A;  4MCW A;  4GHI B;  5C5K A;  4H6J B;  1OTB A;  4LLO B;  4KQD A;  3LR5 A;  3HJK A;  1XJ2 A;  2PD7 A;  2O9C A;  5HL6 A;  2J3T D;  3EEA A;  4HQA A;  1UGU A;  3PBO A;  1TF1 A;  2GNX A;  4ARZ A;  3UME A;  3EQV A;  3KX0 X;  1TS8 A;  1Y28 A;  5HSQ A;  3LI8 A;  5KSH A;  2JHE A;  3T4K A;  3GEC A;  3VV4 A;  3CWF A;  3IBR A;  5F69 A;  3SW1 A;  1GSX A;  3D3O A;  1V9Z A;  3FC7 A;  3IBJ A;  5DKL A;  3E4Q A;  3T4O A;  5F5Y A;  1W63 Q;  1OJG A;  3A0S A;  3B33 A;  3FPV A;  2XA7 M;  1VHM A;  1H8M A;  2D01 A;  2JN7 A;  3LIB A;  4HY8 A;  4WL9 A;  3S7O A;  2H28 A;  2PR5 A;  5DF9 A;  1P97 A;  3P01 A;  1OTI A;  3D72 A;  4FSF A;  3TRC A;  4BWI A;  3OOV A;  2VEA A;  2EWW A;  2XRN A;  3LR3 A;  3NJA A;  3CLO A;  2O99 A;  4B93 A;  4EW7 A;  3R7W B;  3UE6 A;  1WA9 A;  4OOL A;  2PYP A;  2QKP A;  4II7 A;  1S4S A;  5HD5 A;  5IU1 A;  2R78 A;  2GZA A;  5DJT A;  1KOU A;  2V0W A;  2IA2 A;  2OOL A;  3PR6 A;  4I38 A;  3C38 A;  3FG8 A;  2HJ9 C;  3VE3 A;  3RH8 B;  4HIA A;  1N9L A;  2VV8 A;  3ICY A;  2CMN A;  3F1P A;  4EES A;  3BW6 A;  3BY8 A;  3NHQ A;  3EWK A;  4P6Z S;  1MZU A;  1OTA A;  3UE3 A;  3B42 A;  1X0O A;  3F1O B;  4I3J A;  2W1T A;  1EW0 A;  4AFI A;  2KOI A;  5CX7 A;  1XFN A;  2G7U A;  4E04 A;  2O0Y A;  3OBF A;  4L9E A;  1OT9 A;  2DMW A;  3TW8 A;  3C8C A;  2L4R A;  3NOT C;  4IUK A;  4RQ9 A;  3LIC A;  3LR4 A;  4BBU A;  3BY9 A;  3U2A A;  3LFV A;  2MJ6 A;  3LUQ A;  5F68 A;  4G3V A;  2WKP A;  4EEU A;  5HWW A;  1F5M A;  2Z6D A;  5L8M A;  2Y8H A;  4XT2 A;  3RFB A;  4CLC C;  4BBV A;  2NUT C;  4CQH A;  3LIF A;  5LBR A;  4NKP A;  4Q0J A;  3GDI A;  3H7W A;  4NXB A;  4WLA A;  4HOI A;  2OWH A;  1T19 A;  3F1N A;  3MMH A;  4I5S A;  3UB6 A;  3C2W A;  2J3T C;  1MKM A;  3H7W B;  1OT6 A;  4BMW A;  4NEE D;  3F1N B;  4IUH A;  1NLZ A;  3H82 B;  3IS2 A;  2PT7 A;  1T1C A;  4R3A A;  4CLC D;  1MC0 A;  1ZHH B;  2JKR M;  1S1Y A;  3KSG A;  1IFQ A;  2B02 A;  3T4J A;  1F98 A;  1P9R A;  3A0R A;  1LSX A;  2GX5 A;  1T1B A;  2P7J A;  4ETX A;  1P0Z A;  2PDR A;  1IOU A;  2OWJ A;  4HH3 A;  3G6O A;  4EU0 A;  2FH5 A;  2M7V A;  3UB7 A;  2YKF A;  1F9I A;  3T4L A;  5DJU A;  2W3D A;  3OC2 A;  4EET B;  3E4O A;  3UB9 A;  3O5Y A;  4NXE A;  4ARZ B;  3MFX A;  3BQA A;  1DRM A;  1XFQ A;  2JKT M;  2EA9 A;  5AVE A;  4EUV A;  2VJW A;  4G3W A;  4MN5 A;  5DKK A;  5AJG A;  3KSF A;  4WEL A;  4UQI S;  4JGQ A;  2NUP C;  4PHT A;  3T4S A;  4MN7 A;  4G3K A;  2B18 A;  5HPF A;  4MMN A;  5J3W A;  4HP4 A;  2W3F A;  2VZW A;  2W1R A;  1H3Q A;  3EOI A;  4FOF A;  1ZTU A;  4O0P A;  2YKH A;  5J4E A;  4Y5F A;  1YSQ A;  2A24 A;  1N9N A;  2W3E A;  3UB8 A;  2VLG A;  3JVU A;  2OAP 1;  4JGR A;  1P9W A;  5HZH A;  2L1M A;  1OPX A;  3UMD A;  3HJI A;  5K5B A;  1DP6 A;  5HWT A;  4HP9 A;  3CI6 A;  4P6Z M;  2A2L A;  5KIZ A;  3FPW A;  2PR6 A;  2V1B A;  3E98 A;  3LIE A;  3LID A;  1T1A A;  3F1P B;  3CUE C;  4MN6 A;  2JKR I;  2ZOI A;  1JNU A;  2M1C A;  4PAU A;  1DP9 A;  3EGX C;  5HDC A;  4KUO A;  1YKD A;  2W1T B;  5HWV A;  4DJ2 A;  1GSV A;  1STZ A;  1XJ4 A;  4YWZ A;  3S7Q A;  5IT5 A;  2P08 A;  4DJ3 A;  1ODV A;  3LIA A;  4UEY A;  3EQU A;  2OAQ 1;  4HJ6 A;  4Q0H A;  2HGV A;  2ZMF A;  3PBN A;  2QJ7 A;  1D7E A;  4Q0I A;  3TJZ C;  2PD8 A;  3OCL A;  4IJG A;  4WF0 A;  4I3A A;  5FL3 A;  5HDS A;  3ZQ5 A;  1VB6 A;  1S66 L;  2K7S A;  3T50 A;  1BYW A;  1XJ6 A;  4XT2 B;  3EEH A;  4L9F A;  4Y3I A;  4ETZ A;  2VA0 A;  1UWP X;  4WUJ A;  2M7U A;  4WEJ A;  1UWN X;  3K3C A;  3W2Z A;  3KSI A;  3HCY A;  4OOM A;  5AVF A;  4IHQ A;  5TJJ A;  3K3D A;  3R4K A;  4WEK A;  2VV7 A;  3V67 A;  1N9O A;  2W3H A;  4HNB A;  2W0N A;  4EEP A;  4MDZ A;  1TS7 A;  5J7E A;  2VGL S;  3PYP A;  3IS2 B;  3LYX A;  2VKS A;  5MC7 A;  4F3L A;  3PBS A;  4O8G A;  1NWZ A;  4PKY G;  4KUK A;  1OJ5 A;  1XJ3 A;  2K31 A;  2PHY A;  4QPR A;  3S7P A;  4R70 A;  3VE4 A;  4F3L B;  2J3W A;  5IS1 A;  1G6O A;  3C30 A;  3KYZ A;  2EWV A;  4DMZ A;  1DP8 A;  3JVV A;  3EGD C;  3CAX A;  3LR0 A;  3MF0 A;  4GLQ A;  5HDD A;  2V9A A;  2ZMV A;  3B47 A;  4YOF A;  4LRZ E;  4UQI M;  2O9B A;  5G4Z A;  2KLI A;  3E0Y A;  3NOU C;  4L0L A;  2Z6C A;  5I5L A;  4CLC E;  3OLO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...