1OT9A

Cryotrapped state in wild type photoactive yellow protein, induced with continuous illumination at 110k
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
125
structure length
125
Chain Sequence
b'MEHVAFGSEDIENTLAKMDDGQLDGLAFGAIQLDGDGNILQYNAAEGDITGRDPKQVIGKNFFKDVAPCTDSPEFYGKFKEGVASGNLNTMFEYTFDYQMTPTKVKVHMKKALSGDSYWVFVKRV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Photoactive yellow protein
publication title Short hydrogen bonds in photoactive yellow protein.
pubmed doi rcsb
source organism Halorhodospira halophila
molecule tags Luminescent protein
total genus 37
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2003-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00989 PAS PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 1ot9A00
5HDSA 2GJ3A 5DKKA 4F3LA 4I3JA 4LRZE 4RQ9A 3UB6A 1S67L 5IU1A 4HHDA 5KIZA 2PD8A 2VLGA 3LIEA 4EEUA 2WKRA 3LICA 2QJ7A 4B9OA 3CAXA 1UGUA 1OTIA 3VOLA 3LIDA 3LIBA 3PHYA 1P97A 1TS6A 5HZHA 1G28A 3A0SA 5DJTA 4K08A 3E4PA 2JHEA 4M4XA 1X0OA 5G4YA 1S4SA 3IS2B 1GSXA 2L0WA 2A24A 4HJ3A 4GHIB 3UB7A 2V0UA 2YKHA 3MR0A 4HH3A 5J4EA 3OLOA 1LSVA 1KOUA 1T1CA 2HV1A 4NXEA 1MZUA 2V1BA 2YKFA 4HOIA 3GECA 1TS8A 3LUQA 4I38A 3BY9A 3F1NB 4L9FA 4DJ3A 2VV7A 3LI8A 4LRYC 3EEHA 3B33A 2ZBBA 4R38A 3E4OA 1UWNX 1Y28A 4WUJA 2OOLA 3EWKA 4WF0A 4YWZA 4LLOB 3H7WB 1LL8A 4PKYA 4HH2A 1D7EA 3LIFA 1JNUA 1XJ2A 2L4RA 2QKPA 5AVEA 4I5SA 5HD3A 3H82B 5F5YA 4EW7A 1GSWA 4GS9B 2L1MA 4DJ2A 3NOPC 2JN7A 1S1YA 1LSXA 5HWVA 4LRXC 1TS0A 1XJ4A 1BYWA 3PYPA 3MJQA 5F68A 2BASA 4H6JB 5TBMB 1TS7A 1DP9A 3A0RA 4HQAA 2V9AA 3NOUC 1VB6A 3IS2A 3T50A 3UMEA 2KDKA 4GHIA 4JGQA 2QWSA 2INWA 1OTDA 1XJ6A 3UB9A 1T19A 3NOTC 4KUOA 2ZOHA 5HDCA 1LSWA 4GCZA 3A0VA 4HJ6A 5AVFA 4NXFA 3RH8B 3UB8A 2KX6A 1XFNA 3F1NA 2W27A 2PHYA 3C8CA 1OTBA 4L9EA 3VE3A 1DP6A 1EW0A 2W0NA 4GW9A 2PYRA 2Z6CA 5F69A 3ZQ5A 1D06A 2VEAA 5EFWA 4MN6A 4JGRA 2QHKA 4I3IA 4R6LA 4HIAA 1OT6A 5HD5A 2PD7A 5A8BA 1OJ5A 1DRMA 5F6AA 1S4RA 1T18A 2WKQA 1N9NA 1S1ZA 3H7WA 3SW1A 3F1PB 2ZOIA 2I9VA 1T1AA 1UWPX 2H28A 4LPZA 3D72A 4BBVA 4EETB 5J7EA 3F1OB 1T1BA 1OT9A 4XT2B 1NWZA 3H82A 3FC7A 3MQOA 4JGOA 2V0WA 3C2WA 1OTEA 5DKLA 1OTAA 1XFQA 1WA9A 3LI9A 4KQDA 4GS9A 5HWTA 5HSQA 4EESA 1OJGA 3MFXA 3MXQA 4HY8A 3BY8A 4WN5A 3CWFA 3HJKA 4KUKA 4F3LB 2EA9A 3LYXA 2OWHA 3ULFA 3NHQA 2CMNA 4WLAA 4R3AA 3P7NA 5G4ZA 2M1CA 4HP9A 1V9ZA 4H6JA 5TBMA 2K7SA 1F98A 1V9YA 1GSVA 4HP4A 3HJIA 4EERA 3BWLA 5HWWA 4NXBA 3E4QA 4BBUA 3VE4A 1S66L 4BBTA 4E04A 3KX0X 4EEPA 2OWJA 4JGPA 3UE6A 1P0ZA 2A24B 3CLOA 2J80A 4PKYG 3ICYA 2D02A 2VV8A 4HNBA 2V1AA 4I39A 2PR6A 3FG8A 2WKPA 3RTYA 2PYPA 5HDDA 3GDIA 3LIAA 3K3DA 2B02A 2PR5A 1N9LA 4NXGA 3K3CA 2Z6DA 1XJ3A 4L9GA 3IBRA 4I3AA 5J3WA 4HI4A 4HJ4A 3F1PA 2VV6A 3NJAA 3MQQA 4MN5A 3F1OA 2PDRA 4R70A 5IS1A 3H9WA 4XT2A 3UMDA 4EXOA 1LT0A 5I5LA 4WL9A 2R78A 4EQ1A 2QJ5A 3G6OA 5DJUA 1F9IA 2P7JA 1DP8A 1N9OA 2D01A 1ODVA
chains in the Genus database with same CATH superfamily
3IWQA 4LCMA 3UPOA 1AXBA 1L0GA 3WS0A 1H8MA 4RQ9A 3NECA 1S67L 2ACGA 3TOIA 2WKRA 2XK1A 4JF5A 3CMZA 5U47A 2QJ7A 4B9OA 2XLNA 4JXVA 1SKOA 4KG5A 3LIBA 1HD8A 3PHYA 1VM1A 1M40A 4E3OA 1WYBA 2ZQDA 5DFXA 3TE8A 2Y79A 3NIAA 5DJTA 3O5YA 5EOEA 2JHEA 5HPFA 3M2JA 2PBDP 1PZPA 5EVIC 5A91A 1VEUA 1LL9A 1JTGA 3A3DA 2MJ6A 3QP4A 3CUEA 4FCFA 1LHYA 5I94A 3W4QA 4NXEA 4ZAMA 2V1BA 4QHCA 4OQ0A 2Y2IA 1PFLA 1IYSA 3RXWA 3CPTB 4I38A 3VP4A 3BY9A 3WRTA 3HUNA 3F1NB 1E3UA 4BQMA 4PMAA 1K0KA 2EXBA 2VGLM 4DJ3A 3ZNTA 4WELA 5DTTA 5TJJA 1QMEA 1K57C 4OPYA 4EWFA 3BFFA 3MQ0A 2ZBBA 1ZKJA 2HP5A 4XUZA 4KZ5A 5FSRA 4IJGA 5HX9A 4WF0A 4YWZA 1ZTUA 5AQAA 1IYOA 2K2NA 3H7WB 1AWIA 1IKIA 5FDHA 1CI8A 1D7EA 2HJEA 4PHTA 5M1AA 3KSGA 2W1TB 4XXRA 4BL2A 5EECA 1KDSA 2EWWA 1HLUP 4MMNA 1FCOA 3B42A 3DTKA 3A3JA 1DY6A 1GSWA 4UAAA 4UHUA 4Y0TA 3CI6A 1PRQA 4DJ2A 3NOPC 3U4LP 4ESPA 4N1HA 1FR1A 2AVXA 4S2IA 2ZM2A 1S1YA 4U0TA 4U3TA 1FIKA 4WMCA 3BFCA 4WM9A 5CX7A 3PYPA 4JBFA 3IH9A 4EUZA 3MJQA 4DKIA 3HLEA 2HDUA 1L3LA 2W3EA 3ZVTA 4MEZA 2LB5A 2P9VA 1TS7A 2HF6A 1J9MA 1PZOA 1I5QA 3IS2A 2WAFA 3T50A 1KVMA 2ZMAA 2PU2A 5L2FA 2Y2HA 4IHQA 2QWSA 1XJ6A 5HAPA 1T19A 3NOTC 4NG2A 1K4FA 2WZXA 3AGEA 2ZQCA 3BFDA 4R3BA 1SDNA 1N9BA 4R1GA 3R7WA 2VX8A 1S0WA 2EX6A 4HJ6A 3SS3A 5GLAA 2H10A 2OLUA 1ONGA 2WUQA 5DTKA 2W27A 2OV5A 4OOMA 1OTBA 1ZG6A 2A2LA 4GW9A 4YOFA 4CLCE 2Z6CA 4E3JA 1VHMA 5TGFA 5KSCA 5EFWA 3HUOA 4LGWA 5A92A 3S7NA 4WZ5A 3HLWA 4K91A 4Q0HA 2XFTA 1PI4A 2PD7A 4ARZA 5A8BA 5FAPA 1OJ5A 4MN7A 4OP5A 1YLYA 5F6AA 1IFQA 3FPWA 2NUTC 1FILA 1T18A 3DTIA 3LGOA 4X68A 2K31A 3KSIA 3HREA 3PBOA 4GB7A 3VP1A 1NY0A 3SW1A 3F1PB 2ZOIA 4F94A 5TR7A 3VFHA 4YNRA 3VV4A 1W8YA 1T1AA 1UWPX 4OPQA 2LB9A 4BBVA 5E2EA 1S6RA 1IYQA 3E2KA 3ZNYA 5MC7A 5FI2A 2DRWA 1HZOA 1GA0A 3ZG8B 1OTAA 5AJGA 5EVIA 5TFQA 1NZOA 1WA9A 2Z2LB 5CECA 3LR0A 2HP6A 3GR2A 1EWZA 3V50A 2Y4AA 1STZA 4HBTA 3CWFA 3HJKA 1ES3A 4IVKA 1H5XA 3OBFA 1JWPA 3OPHA 2EA9A 2W3DA 2VKSA 3NHQA 3HCYA 4R3AA 1ONHA 3LEZA 2A3UA 2M1CA 4FH2A 3PBTA 1KDWA 4NKPA 4H6JA 3KO6A 4ID4A 2WGWA 1GSVA 1SKOB 1ACFA 3BWLA 3BEBA 5CEDA 4D2OA 4BL3A 4JXSA 1A0KA 3VP3A 5HW3A 3KYEA 4BBTA 3FPVA 3T4JA 3JYIA 4DE2A 1ZHHB 3L7HA 1K6SA 4MLLA 3B47A 1XXMA 5HAIA 4LCLA 3KSHA 1W7FA 3FYZA 4JLFA 3UE6A 4JPMA 4Q8IA 4QB8A 1H8YA 3JVVA 2VV8A 1CJFA 4Z1WA 2DNSA 2JKTI 3G2ZA 3BYDA 3ZDJA 1K38A 4DXBA 2WKPA 5HL1A 4N1XA 2Y2QA 3SH9A 1EI5A 4HBUA 5HARA 2B02A 1N9LA 1MY8A 1XA1A 4IVIA 3T12B 3VSKA 5FEGA 4I3AA 5J3WA 4BMWA 1NZUA 4HI4A 4WEJA 2VV6A 2JKRI 2J3TD 3Q07A 2J9OA 2XA7S 1MKIA 2Z2MB 3F1OA 1BLCA 4X1LA 2PDRA 4X25A 5IS1A 4JXWA 3MXRA 3G34A 4XT2A 3UMDA 4EXOA 4RA7A 4KZ3A 1NXYA 3DBAA 2JKGA 1F9IA 1N9OA 3M6HA 2JCHA 5HDSA 2GJ3A 3PBNA 3CITA 3VOYA 2J3WA 4R4SA 4F3LA 1Y54A 2B5RA 4I3JA 4LRZE 5M18A 3GTCA 2VLGA 4EEUA 4RYEA 3BFGA 3PAGA 4KZAA 2ZMFA 3VOZA 3BLSA 4O0PA 1EROA 4CLCD 5F1FA 1OTIA 3GSGA 3IBJA 1NJ4A 1CI9A 3LIDA 4YFMA 1L0EA 5CTMA 1IELA 2R9WA 1P97A 3HL9A 4Q0IA 4EBNA 3IXHA 5HZHA 1G28A 4R0QA 5DTSA 1XKZA 3UB5P 1VETA 3M6BA 2P9VB 3S7OA 4K08A 4S2NC 1P9WA 3K2NA 4KZ4A 3MBZA 3IS2B 3CJMA 4ZRRA 3ITBA 5A93A 1FOFA 2A24A 1C3BA 4KZBA 4EV4A 3DWZA 4HH3A 4Y15A 1Y4OA 2ZC3B 4IEDA 5KMWA 5J4EA 4LENA 1ZC2A 4IBXA 2XEPA 1KOUA 3R7WB 4E3NA 3EEAA 1YSPA 3SH8A 2VZWA 5FL3A 3IF6C 2YKFA 2H5SA 3GECA 1TS8A 4KZ8A 1E4DA 2FFYA 3IXBA 2DCFA 4XUXA 3A3EA 3VSLA 5CXWA 4GDNA 1YLPA 3LI8A 4LRYC 1LI0A 5HFOA 1ERQA 5HL6A 5LBRA 3T4OA 4KZ7A 2IWBA 4FD8A 2ZC4B 4ARZB 3E4OA 5EPHA 5CRFA 4WUJA 2GZAA 3ZFZA 3IXDA 3GRJA 3W8KA 5DF8A 4Y0OA 5IT5A 1LL8A 3ZHHA 4HH2A 4NK3A 1SKFA 3LIFA 1JNUA 2J3TC 2VGLS 1LL5A 1F5MA 4YINA 3A3IA 3S1YA 1PW8A 4QWOA 3Q82A 2X71A 3LY3A 3V5MA 5HD3A 3V3SA 4P6ZM 2HDRA 5AQ7A 2QMIA 5EVIB 1FSYA 3MXSA 1I2WA 2V1ZA 1NLZA 1PI5A 2JN7A 3P98A 3CHWP 5FQMA 5FQQA 3M2KA 5HWVA 2OSUA 3NDEA 3N4IA 3RXXA 1BYWA 1RCJA 5E43A 2W3GA 2HP9A 3E0YA 2XFSA 3JPUA 1OMEA 5F68A 4H6JB 3TW8A 2V9AA 3NOUC 2WGWB 4QY6A 4CLCC 3UMEA 4EBLA 4JGQA 1W8QA 1KGFA 1OTDA 3UB9A 4U0XA 5FEFA 2ZOHA 1DJAA 3VP2A 5HDCA 2EX8A 1LSWA 2R9XA 4ZJ1A 1BUEA 2QYBA 4EQIA 4PM9A 3UB8A 4DE3A 3G32A 3ISGA 2W3FA 2W0NA 3IWIA 3N8RA 3ZQ5A 1DJBA 3SZTA 1D06A 2VEAA 5CEBA 2G2WA 4X55A 4B4ZA 3JVUA 1XX2A 4I3IA 4HIAA 2RCXA 1NLYA 1OT6A 1BLPA 1GA9A 3GV9A 1S4RA 5JYOA 3AGFA 1SCWA 4ME4A 5GHXA 5HPIA 2I9VA 4IUKA 5FQKA 4E6XA 1L0FA 3W4OA 3LEQA 4LPZA 2VJWA 3O3VA 4EETB 5J7EA 1MWSA 1TEMA 3F1OB 4P87A 1T1BA 5CERA 4XT2B 3H82A 3FC7A 3T1SA 2V0WA 1FCMA 5BOHA 3PAEA 4GS9A 5GL9A 3WS4A 3UPNA 3QP1A 1WE4A 5HSQA 1MWUA 3LR3A 1K55A 3O87A 2HZ5A 3BY8A 3HLCA 4RX2A 4NEED 4F3LB 4KQQA 3N8LA 2OWHA 4JKTA 2V20A 3T4QA 4WLAA 3P7NA 1Q2QA 2PAVP 3N6IA 5TBMA 3EOIA 2C5WB 5DVAA 2Y2GA 1F98A 1GCEA 1W63Q 2O99A 3HJIA 4EERA 2Y2JA 4GDBA 5FAOA 1G5UA 4NXBA 1PWGA 3UE1A 4E3LA 4QPRA 2BTFP 2JE5A 1S66L 5D3OA 5CGWA 4FH4A 3EQVA 1VETB 4E04A 4MBHA 4D60A 1CQAA 1XP4A 4OLGA 1MWTA 1K54A 4MCWA 4E3KA 2A24B 3ZG7B 2BG1A 2W1RA 1YSQA 2ZM0A 3E98A 1NYMA 4OPZA 4KQRA 3TG9A 3MF0A 5F1GA 3LIAA 2EX9A 4LV0A 5DF7A 3HLGA 4ETXA 2Z6DA 1BLHA 1XJ3A 4L9GA 2J7VA 4GNUA 2JKTM 4HJ4A 2IA2A 2VGKA 5EM0A 4A5RA 2Q9MA 3MQQA 4MN5A 3IQAA 3MMHA 4CJNA 4PM7A 4S2PA 1L0DA 4BD1A 3WWXA 3H9WA 4G3VA 2ZC5B 3LR5A 5J8XA 4Y17A 5E2FA 1TDLA 4UEYA 1LT0A 4CLCA 2QJ5A 3C4OA 2QPNA 1LLBA 3G6OA 3ZG5A 2JKRM 3FZCA 2KLIA 4K0WA 3C30A 4X6TA 1ESIA 3D4FA 1ODVA 1YAXA 2Y55A 1CF0A 1NYYA 1YLWA 4GD6A 3GQZA 5DKKA 5FQJA 2V8FA 1MBLA 2GX5A 4PAUA 3UB6A 1JTDA 5IU1A 5KIZA 1J3WA 1W79A 5FQIA 4PM8A 5FA7A 4O8GA 2C6WB 4GOGA 3KYQA 3WS1A 1YMXA 3IT9A 4OLDA 3QNCA 2JBFA 2B95A 2V2FF 1CEFA 4G3KA 4LV3A 4MDZA 1K57A 4GD8A 4KG6A 4JXGA 4R3JA 2OAQ1 4DE0A 1GHPA 3LR4A 2W3HA 1FSWA 3WS5A 3SS4A 4M4XA 5E2GA 4DDYA 1ES5A 1GSXA 2NUPC 4HJ3A 4X53A 5FDSA 3MR0A 2O9AA 1VEUB 4WBGA 4DDSA 4QD4A 1T1CA 2HV1A 2IWDA 2IWCA 3NDGA 4CQHA 3MKFA 4HOIA 3LUQA 1TDGA 3ITAA 1IYPA 3UPPA 3EQUA 2HDSA 4L9FA 4HEFA 3MS6A 2XRNA 5CGSA 2HJ9C 2VV7A 3UDFA 3BQ8A 3R4KA 4X56A 1ERMA 3B33A 2Q0OA 2J8YA 3Q7VA 4NETA 1XGIA 5EVEA 4DE1A 3EWKA 3T4TA 4OONA 4LLOB 4PKYA 3QP2A 5EUAA 2DMWA 5AQBA 2XF3A 1XJ2A 2ZMVA 2L4RA 2PRFA 3MZDA 3BFEA 4N9LA 3P01A 4P85A 4ZTKA 4E3IA 2WKHA 5GLDA 3H82B 3FKWA 4BD0A 1G6AA 4EW7A 3SS5A 1YMSA 4PPRA 1ZG4A 2EFXA 2FFFB 3ZVWA 4GS9B 4IUHA 2L1MA 5JYPA 2WYXA 1PYYA 3PR6A 5M19A 2WGIA 5GLBA 4KG2A 1H3QA 4Y2FA 3G2YA 4LRXC 4OPRA 1OPXA 3D9YA 4EUVA 2BASA 5TBMB 3IHBA 3A0RA 3QP5A 1VB6A 3C5AA 3N8SA 4B93A 3PBSA 4P6ZS 2O9CA 3ZYTA 4AFIA 4GHIA 2HPBA 2INWA 4UQIM 4OOLA 3OOVA 3O88A 4G3WA 5FASA 1FQGA 4GCZA 1YM1A 3B3XA 5K5BA 5AVFA 2ZQ7A 4NXFA 4LV1A 2I72A 3RH8B 2KX6A 1XFNA 3QP8A 2EX2A 2PHYA 3C8CA 3VE3A 3RJUA 1MWRA 2PYRA 5F69A 3MZFA 3RFBA 3T4LA 2WKIA 1ALQA 3KYZA 3N7WA 4MN6A 4JGRA 3BJNA 2QHKA 3ZCZA 2J9PA 3VFFA 3TRCA 3FV7A 5HD5A 1HVBA 3LY4A 2Y8HA 3W2ZA 3D3OA 3T1QB 1VQQA 1YT4A 3Q7ZA 1N9NA 1LI9A 3SH7A 4C75A 1CEGA 1GHIA 1MC0A 1KVLA 4GJ4A 1BZAA 2QZ6A 1XPBA 3UNWA 2H28A 3D72A 2VK3A 2M7UA 4MBKA 1WYCA 1JWVA 3MQOA 4JGOA 4CLCB 1OTEA 4OP8A 5DKLA 4E3MA 2P04A 1XFQA 4Y13A 3LI9A 4KQDA 2XROA 2XD1A 5HWTA 4EESA 4II7A 2H0YA 3MXQA 1Q2PA 4DRTA 3V3RA 4HY8A 2H0TA 4KUKA 1W63M 3LYXA 3WS2A 4WZ5C 4Y0UA 3IHAA 4Z9QA 4GN2A 5EE8A 2K7SA 4WYYA 5F83A 1P9RA 3DW0A 3L9KA 1V9YA 3C7UA 3UO9A 3DTMA 4HP4A 1RGYA 3EGDC 4P6BA 1BLSA 3LFVA 5HWWA 5IHVA 3E4QA 4BBUA 5AQ9A 3OPPA 4FOFA 4ZJ2A 1YKDA 3BQAA 2ZJ9A 4B4XA 3QHYA 4GLQA 4Y3IA 3ZGAB 3BW6A 3KX0X 5L10A 4Y7PA 4EEPA 4OH0A 3HLFA 3V67A 5EOOA 5EVLA 3MZEA 1FR6A 1F2KA 3MSHA 2Y2MA 3IX3A 5KZHA 4PKYG 3SOIA 2X01A 3UN7A 4GZBA 4HNBA 2G2UA 2WKEA 4I39A 2PR6A 3O86A 1YQSA 3OCLA 3FG8A 3OZHA 3V39A 3RTYA 1PIOA 3S4XA 3IF5A 2PYPA 2HGVA 5FATA 4BLMA 4S2KA 3GDIA 2PBYA 3K3DA 2PR5A 3Q81A 2Q9NA 2UWXA 3K3CA 4X69A 2Y2PA 2E8IA 3NJAA 1SZVA 5GHYA 2WGVA 4EBPA 3W4PA 4LFUA 1U60A 1K56D 4WZ4A 3Q7VB 2ZL1A 2VGJA 3OCNA 4UA9A 4S2NA 4QY5A 1L2SA 3CZDA 3MFDA 4MNRA 5I5LA 2GNXA 2R78A 4EQ1A 4MBFA 1MPLA 2KOIA 2P7JA 1DP8A 4KZ6A 4ETZA 1NRJA 2EWVA 2XQZA 3BM6A 1YPRA 1ES4A 4HHDA 2OLVA 2PD8A 3HBRA 3IF6A 3UY6A 3LIEA 3LICA 1M6KA 1GHMA 3PBQA 4R4RA 4IBRA 3CAXA 3T4SA 3LO7A 4FTXA 1UGUA 1MKMA 3VOLA 2V8CA 4K0XA 4P0MA 4WEKA 3EGXC 3GVBA 4E6WA 3IXGA 5FI7A 1TS6A 3HLDA 4PM5A 1YLTA 3G4PA 2ZC6B 2G7UA 3NCKA 3A0SA 4BENA 3HUMA 1TVFA 3E4PA 2XR0A 1X0OA 5G4YA 1S4SA 2L0WA 3OPRA 4GHIB 3UB7A 2Y2KA 1Z09A 2UV0E 2XGNA 2V0UA 2E8JA 3Q1FA 2YKHA 4ZBEA 2ZD8A 2EXAA 2O9BA 3FKVA 3OLOA 1LSVA 4R23A 1MZUA 4QU3A 4S2LA 1PW1A 3C4PA 2JC7A 2EFUA 4ZJ3A 2A49A 4Q0JA 2ZC7A 1IOUA 2XD5A 1XGJA 1W5DA 2WADA 5L07A 4UA7A 1XA7A 4S2MA 2CC1A 3EEHA 4Y5FA 3T1RA 4X1MA 3TJZC 3HVFA 1TD5A 4EU0A 2Y59A 4R38A 2WAEA 1UWNX 1Y28A 3MKEA 5EM1A 2OOLA 2P08A 4HESA 3UE0A 4ZDXA 4BWIA 1BT5A 4OVDA 1E3UD 1TF1A 5DFYA 1PNEA 1BULA 5A90A 2XSSA 1SDEA 2XH9A 2QKPA 5AVEA 3NC8A 4I5SA 4N9KA 3T1XA 1DJCA 5F5YA 1IKGA 2XDMA 3UE3A 3KSFA 2FZ0A 4QJGA 3UDIA 3VMAA 1MXOA 3NY4A 1LSXA 3OC2A 1TS0A 1XJ4A 3C38A 4OQHA 3E2LA 2OAP1 5KSHA 1K6RA 3AGDA 4JF4A 1DP9A 5E2HA 4HQAA 3IWOA 5EV0A 5C5KA 4C3QA 2FH5A 2KDKA 3S7PA 5CTNA 5GHZA 1JVJA 2GDNA 4KUOA 2O0YA 3HLBA 2PT7A 1ES2A 3A0VA 4KZ9A 4RX3A 4WMCD 4S2OA 1KGEA 4OOYA 1CK3A 2PU4A 4O7DA 3CPTA 4O01A 4BJPA 3DWKA 5CHUA 3F1NA 4L9EA 1DP6A 1EW0A 2ZQ9A 3C7VA 2WK0A 1YLJA 5CHMA 3UDXA 5CGXA 4JF6A 4UQIS 3ZG0A 1G68A 3S22A 4L0LA 4R6LA 4UA6A 4S2JA 3BRMA 1PWDA 4DN0A 4RVAA 2Y2NA 1DRMA 3PTEA 2WKQA 2HDQA 3NULA 1S1ZA 3H7WA 5HAQA 3A3FA 1H8ZA 1D1JA 2VA0A 5L8MA 3DTEA 2W1TA 5FI6A 2X02A 1HTZA 4DMZA 1K4EA 3CUEC 4FSFA 1OT9A 2ZL1B 3T4KA 1NWZA 3BLMA 1YLZA 3WRZA 3I7JA 1RP5A 5CHJA 3C2WA 3S7QA 3NI9A 5FQ9A 2ZQAA 3VP0A 1OJGA 3MFXA 4WN5A 1E25A 3FWLA 1Z6FA 2M7VA 1O07A 5F82A 3ULFA 1RGZA 2CMNA 3IF6B 5G4ZA 4HP9A 1V9ZA 1H0MA 1BTLA 1QMFA 3ZG9B 4GKUA 3IH8A 5G18A 2ZQ8A 1ESUA 3LCEA 4KQOA 5EVID 4LV2A 1N4OA 4C6YA 3VE4A 3IX8A 1KE4A 1G6OA 3G30A 4N92A 4FUWA 1K25A 4PM6A 1JWZA 2RL3A 3U2AA 1IEMA 3NBLA 3OPLA 2OWJA 4JGPA 4CPKA 4DXCA 1P0ZA 2Y2LA 3CLOA 2ZLYA 2J80A 3ICYA 2D02A 2Y91A 5FAQA 3PBRA 3P09A 1K56A 2XA7M 5L09A 1PWCA 1K55C 1KE3A 1NRFA 1BSGA 1O7EA 2V1AA 4DF6A 4OQGA 4OQIA 3QP6A 5HDDA 5GLCA 2ZM8A 3G35A 4NXGA 1KGGA 3IBRA 3G31A 4M3KA 3BECA 4H8RA 3F1PA 2WZZA 1I2SA 3QNBA 1SHVA 5DF9A 3GMWA 3DAVA 1KE0A 4R70A 3TSGA 3IX4A 3PXPA 4WL9A 2Y2OA 1FCNA 2B18A 5DJUA 4OKPA 3CG5A 4B88A 2BLSA 4KENB 1K54C 2P74A 2D01A 2JKFA
chains in the Genus database with same CATH topology
1YAXA 4ETZA 5HDSA 1NRJA 2GJ3A 3PBNA 3CITA 5DKKA 2EWVA 2J3WA 1H8MA 4F3LA 4I3JA 2GX5A 4LRZE 4PAUA 4RQ9A 3UB6A 1S67L 5IU1A 4HHDA 5KIZA 2PD8A 2VLGA 3LIEA 4EEUA 2WKRA 3LICA 2ZMFA 2QJ7A 4O8GA 3PBQA 4B9OA 3CAXA 3T4SA 4O0PA 1UGUA 4CLCD 1MKMA 3KYQA 1OTIA 3VOLA 3IBJA 3LIDA 4WEKA 3EGXC 4G3KA 4MDZA 3LIBA 3PHYA 1P97A 1TS6A 4Q0IA 2OAQ1 5HZHA 1G28A 5DFXA 3TE8A 2G7UA 2Y79A 3A0SA 3LR4A 2W3HA 5DJTA 3O5YA 3S7OA 4K08A 1P9WA 3E4PA 2JHEA 4M4XA 3K2NA 1X0OA 5HPFA 5G4YA 1S4SA 3IS2B 1GSXA 4ZRRA 2L0WA 2NUPC 2A24A 4HJ3A 4GHIB 3UB7A 2V0UA 2YKHA 3MR0A 2O9AA 2O9BA 4HH3A 5J4EA 2MJ6A 3CUEA 3OLOA 1LSVA 1KOUA 1T1CA 2HV1A 3R7WB 4NXEA 3EEAA 4CQHA 1MZUA 2V1BA 1YSPA 2VZWA 5FL3A 2YKFA 4HOIA 3GECA 1TS8A 3LUQA 4Q0JA 4I38A 1IOUA 3BY9A 3F1NB 3EQUA 4L9FA 2VGLM 4DJ3A 2XRNA 4WELA 2HJ9C 2VV7A 3LI8A 4LRYC 5TJJA 3EEHA 3BQ8A 3R4KA 4Y5FA 5LBRA 5HL6A 3B33A 3TJZC 3T4OA 3MQ0A 1TD5A 4EU0A 2ZBBA 4R38A 4ARZB 3E4OA 1UWNX 1Y28A 4WUJA 2GZAA 2OOLA 2P08A 3EWKA 3T4TA 4IJGA 4WF0A 4YWZA 1ZTUA 4LLOB 2K2NA 3H7WB 4BWIA 5IT5A 1LL8A 4PKYA 4HH2A 1TF1A 2DMWA 5DFYA 1D7EA 3LIFA 1JNUA 2J3TC 2VGLS 2HJEA 1XJ2A 2XSSA 4PHTA 2ZMVA 2L4RA 1F5MA 3KSGA 2QKPA 3P01A 2W1TB 5AVEA 2EWWA 4I5SA 5HD3A 3H82B 4MMNA 4P6ZM 5F5YA 4EW7A 3UE3A 3B42A 1GSWA 3CI6A 3KSFA 4GS9B 4IUHA 2FZ0A 2L1MA 4DJ2A 1NLZA 3NOPC 3PR6A 2JN7A 1H3QA 1S1YA 1LSXA 3OC2A 4Y2FA 5HWVA 4LRXC 1TS0A 1XJ4A 3C38A 1OPXA 1BYWA 5CX7A 3PYPA 2W3GA 3MJQA 3E0YA 4EUVA 2OAP1 5F68A 2W3EA 2BASA 2LB5A 5KSHA 4H6JB 5TBMB 3TW8A 1TS7A 2HF6A 1DP9A 3A0RA 4HQAA 2V9AA 3NOUC 5C5KA 1VB6A 4CLCC 3IS2A 4B93A 3PBSA 4P6ZS 2O9CA 3T50A 3ZYTA 3UMEA 2FH5A 2KDKA 4AFIA 4GHIA 4IHQA 3S7PA 4JGQA 2QWSA 2INWA 1OTDA 1XJ6A 4OOLA 4UQIM 3UB9A 3OOVA 1T19A 3NOTC 4KUOA 2ZOHA 4G3WA 5HDCA 1LSWA 2O0YA 2PT7A 4GCZA 2VX8A 3A0VA 3R7WA 5K5BA 4HJ6A 5AVFA 2QYBA 4NXFA 3RH8B 4O01A 3UB8A 4BJPA 2KX6A 1XFNA 3F1NA 2W27A 2PHYA 3C8CA 1OTBA 4L9EA 4OOMA 3VE3A 1DP6A 1EW0A 2W3FA 2W0NA 2A2LA 4GW9A 4YOFA 4CLCE 2PYRA 2Z6CA 5F69A 3ZQ5A 1VHMA 3RFBA 1D06A 2VEAA 3T4LA 5EFWA 3KYZA 4MN6A 4JGRA 4UQIS 3BJNA 2QHKA 3JVUA 4L0LA 3S7NA 4I3IA 4R6LA 4HIAA 1NLYA 1OT6A 4Q0HA 5HD5A 3TRCA 2PD7A 4ARZA 5A8BA 1OJ5A 4DN0A 4MN7A 1DRMA 2Y8HA 3W2ZA 5F6AA 1IFQA 3D3OA 3FPWA 2NUTC 1S4RA 1T18A 2WKQA 1N9NA 2K31A 3KSIA 1S1ZA 3PBOA 3H7WA 3SW1A 3F1PB 4ME4A 1MC0A 4GJ4A 2ZOIA 5HPIA 2I9VA 4IUKA 2VA0A 5L8MA 4YNRA 3VV4A 1T1AA 1UWPX 2H28A 2LB9A 3D72A 4LPZA 4BBVA 2W1TA 2VJWA 4EETB 5J7EA 4DMZA 3F1OB 3CUEC 1T1BA 4FSFA 2M7UA 1OT9A 5MC7A 4XT2B 1NWZA 3H82A 3T4KA 3FC7A 3MQOA 4JGOA 4CLCB 2V0WA 3C2WA 3S7QA 1OTEA 5DKLA 1OTAA 5AJGA 2P04A 1XFQA 1WA9A 3LI9A 4KQDA 2XROA 4GS9A 3LR0A 5HWTA 5HSQA 4EESA 3LR3A 4II7A 1OJGA 3MFXA 3MXQA 1STZA 4HY8A 3BY8A 4WN5A 3CWFA 3HJKA 3OBFA 4KUKA 4NEED 4F3LB 2M7VA 1W63M 2EA9A 3LYXA 2OWHA 3ULFA 2W3DA 2VKSA 2CMNA 3NHQA 3HCYA 3T4QA 4WLAA 4R3AA 3P7NA 5G4ZA 2M1CA 4HP9A 1V9ZA 3PBTA 4NKPA 4H6JA 5TBMA 3KO6A 2K7SA 3EOIA 1P9RA 1F98A 1V9YA 1GSVA 4KQOA 4HP4A 3EGDC 1W63Q 2O99A 3HJIA 3LFVA 4EERA 3BWLA 5HWWA 4NXBA 3E4QA 4BBUA 3VE4A 4QPRA 4FOFA 1YKDA 1S66L 4BBTA 3FPVA 1G6OA 3T4JA 3BQAA 1ZHHB 3EQVA 4GLQA 4E04A 4Y3IA 3BW6A 3B47A 3KX0X 3U2AA 3KSHA 4EEPA 2OWJA 4JGPA 3UE6A 3V67A 1P0ZA 4MCWA 2A24B 3CLOA 2J80A 4PKYG 3JVVA 3ICYA 2D02A 2VV8A 3PBRA 4Z1WA 2W1RA 2XA7M 2JKTI 4HNBA 1YSQA 2V1AA 4I39A 2PR6A 3E98A 3OCLA 3FG8A 2WKPA 3RTYA 2PYPA 2HGVA 3MF0A 5HDDA 3LIAA 3GDIA 3K3DA 2B02A 2PR5A 1N9LA 4ETXA 4NXGA 3K3CA 2Z6DA 1XJ3A 4L9GA 3IBRA 4I3AA 5J3WA 2JKTM 4BMWA 4HI4A 4WEJA 4HJ4A 2IA2A 3F1PA 2VV6A 3NJAA 2JKRI 3MQQA 4MN5A 2J3TD 3MMHA 5DF9A 2XA7S 3F1OA 2PDRA 4R70A 5IS1A 3H9WA 4G3VA 4XT2A 3OCNA 3UMDA 4EXOA 3LR5A 4UEYA 3PXPA 1LT0A 5I5LA 4CLCA 2GNXA 3DBAA 4WL9A 2R78A 4EQ1A 2QJ5A 2B18A 3G6OA 5DJUA 2JKRM 2KLIA 1F9IA 2KOIA 2P7JA 3C30A 1DP8A 1N9OA 2D01A 1ODVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HDS A;  2GJ3 A;  5DKK A;  4F3L A;  4I3J A;  4LRZ E;  4RQ9 A;  3UB6 A;  1S67 L;  5IU1 A;  4HHD A;  5KIZ A;  2PD8 A;  2VLG A;  3LIE A;  4EEU A;  2WKR A;  3LIC A;  2QJ7 A;  4B9O A;  3CAX A;  1UGU A;  1OTI A;  3VOL A;  3LID A;  3LIB A;  3PHY A;  1P97 A;  1TS6 A;  5HZH A;  1G28 A;  3A0S A;  5DJT A;  4K08 A;  3E4P A;  2JHE A;  4M4X A;  1X0O A;  5G4Y A;  1S4S A;  3IS2 B;  1GSX A;  2L0W A;  2A24 A;  4HJ3 A;  4GHI B;  3UB7 A;  2V0U A;  2YKH A;  3MR0 A;  4HH3 A;  5J4E A;  3OLO A;  1LSV A;  1KOU A;  1T1C A;  2HV1 A;  4NXE A;  1MZU A;  2V1B A;  2YKF A;  4HOI A;  3GEC A;  1TS8 A;  3LUQ A;  4I38 A;  3BY9 A;  3F1N B;  4L9F A;  4DJ3 A;  2VV7 A;  3LI8 A;  4LRY C;  3EEH A;  3B33 A;  2ZBB A;  4R38 A;  3E4O A;  1UWN X;  1Y28 A;  4WUJ A;  2OOL A;  3EWK A;  4WF0 A;  4YWZ A;  4LLO B;  3H7W B;  1LL8 A;  4PKY A;  4HH2 A;  1D7E A;  3LIF A;  1JNU A;  1XJ2 A;  2L4R A;  2QKP A;  5AVE A;  4I5S A;  5HD3 A;  3H82 B;  5F5Y A;  4EW7 A;  1GSW A;  4GS9 B;  2L1M A;  4DJ2 A;  3NOP C;  2JN7 A;  1S1Y A;  1LSX A;  5HWV A;  4LRX C;  1TS0 A;  1XJ4 A;  1BYW A;  3PYP A;  3MJQ A;  5F68 A;  2BAS A;  4H6J B;  5TBM B;  1TS7 A;  1DP9 A;  3A0R A;  4HQA A;  2V9A A;  3NOU C;  1VB6 A;  3IS2 A;  3T50 A;  3UME A;  2KDK A;  4GHI A;  4JGQ A;  2QWS A;  2INW A;  1OTD A;  1XJ6 A;  3UB9 A;  1T19 A;  3NOT C;  4KUO A;  2ZOH A;  5HDC A;  1LSW A;  4GCZ A;  3A0V A;  4HJ6 A;  5AVF A;  4NXF A;  3RH8 B;  3UB8 A;  2KX6 A;  1XFN A;  3F1N A;  2W27 A;  2PHY A;  3C8C A;  1OTB A;  4L9E A;  3VE3 A;  1DP6 A;  1EW0 A;  2W0N A;  4GW9 A;  2PYR A;  2Z6C A;  5F69 A;  3ZQ5 A;  1D06 A;  2VEA A;  5EFW A;  4MN6 A;  4JGR A;  2QHK A;  4I3I A;  4R6L A;  4HIA A;  1OT6 A;  5HD5 A;  2PD7 A;  5A8B A;  1OJ5 A;  1DRM A;  5F6A A;  1S4R A;  1T18 A;  2WKQ A;  1N9N A;  1S1Z A;  3H7W A;  3SW1 A;  3F1P B;  2ZOI A;  2I9V A;  1T1A A;  1UWP X;  2H28 A;  4LPZ A;  3D72 A;  4BBV A;  4EET B;  5J7E A;  3F1O B;  1T1B A;  1OT9 A;  4XT2 B;  1NWZ A;  3H82 A;  3FC7 A;  3MQO A;  4JGO A;  2V0W A;  3C2W A;  1OTE A;  5DKL A;  1OTA A;  1XFQ A;  1WA9 A;  3LI9 A;  4KQD A;  4GS9 A;  5HWT A;  5HSQ A;  4EES A;  1OJG A;  3MFX A;  3MXQ A;  4HY8 A;  3BY8 A;  4WN5 A;  3CWF A;  3HJK A;  4KUK A;  4F3L B;  2EA9 A;  3LYX A;  2OWH A;  3ULF A;  3NHQ A;  2CMN A;  4WLA A;  4R3A A;  3P7N A;  5G4Z A;  2M1C A;  4HP9 A;  1V9Z A;  4H6J A;  5TBM A;  2K7S A;  1F98 A;  1V9Y A;  1GSV A;  4HP4 A;  3HJI A;  4EER A;  3BWL A;  5HWW A;  4NXB A;  3E4Q A;  4BBU A;  3VE4 A;  1S66 L;  4BBT A;  4E04 A;  3KX0 X;  4EEP A;  2OWJ A;  4JGP A;  3UE6 A;  1P0Z A;  2A24 B;  3CLO A;  2J80 A;  4PKY G;  3ICY A;  2D02 A;  2VV8 A;  4HNB A;  2V1A A;  4I39 A;  2PR6 A;  3FG8 A;  2WKP A;  3RTY A;  2PYP A;  5HDD A;  3GDI A;  3LIA A;  3K3D A;  2B02 A;  2PR5 A;  1N9L A;  4NXG A;  3K3C A;  2Z6D A;  1XJ3 A;  4L9G A;  3IBR A;  4I3A A;  5J3W A;  4HI4 A;  4HJ4 A;  3F1P A;  2VV6 A;  3NJA A;  3MQQ A;  4MN5 A;  3F1O A;  2PDR A;  4R70 A;  5IS1 A;  3H9W A;  4XT2 A;  3UMD A;  4EXO A;  1LT0 A;  5I5L A;  4WL9 A;  2R78 A;  4EQ1 A;  2QJ5 A;  3G6O A;  5DJU A;  1F9I A;  2P7J A;  1DP8 A;  1N9O A;  2D01 A;  1ODV A; 
#chains in the Genus database with same CATH topology
 3IWQ A;  4LCM A;  3UPO A;  1AXB A;  1L0G A;  3WS0 A;  1H8M A;  4RQ9 A;  3NEC A;  1S67 L;  2ACG A;  3TOI A;  2WKR A;  2XK1 A;  4JF5 A;  3CMZ A;  5U47 A;  2QJ7 A;  4B9O A;  2XLN A;  4JXV A;  1SKO A;  4KG5 A;  3LIB A;  1HD8 A;  3PHY A;  1VM1 A;  1M40 A;  4E3O A;  1WYB A;  2ZQD A;  5DFX A;  3TE8 A;  2Y79 A;  3NIA A;  5DJT A;  3O5Y A;  5EOE A;  2JHE A;  5HPF A;  3M2J A;  2PBD P;  1PZP A;  5EVI C;  5A91 A;  1VEU A;  1LL9 A;  1JTG A;  3A3D A;  2MJ6 A;  3QP4 A;  3CUE A;  4FCF A;  1LHY A;  5I94 A;  3W4Q A;  4NXE A;  4ZAM A;  2V1B A;  4QHC A;  4OQ0 A;  2Y2I A;  1PFL A;  1IYS A;  3RXW A;  3CPT B;  4I38 A;  3VP4 A;  3BY9 A;  3WRT A;  3HUN A;  3F1N B;  1E3U A;  4BQM A;  4PMA A;  1K0K A;  2EXB A;  2VGL M;  4DJ3 A;  3ZNT A;  4WEL A;  5DTT A;  5TJJ A;  1QME A;  1K57 C;  4OPY A;  4EWF A;  3BFF A;  3MQ0 A;  2ZBB A;  1ZKJ A;  2HP5 A;  4XUZ A;  4KZ5 A;  5FSR A;  4IJG A;  5HX9 A;  4WF0 A;  4YWZ A;  1ZTU A;  5AQA A;  1IYO A;  2K2N A;  3H7W B;  1AWI A;  1IKI A;  5FDH A;  1CI8 A;  1D7E A;  2HJE A;  4PHT A;  5M1A A;  3KSG A;  2W1T B;  4XXR A;  4BL2 A;  5EEC A;  1KDS A;  2EWW A;  1HLU P;  4MMN A;  1FCO A;  3B42 A;  3DTK A;  3A3J A;  1DY6 A;  1GSW A;  4UAA A;  4UHU A;  4Y0T A;  3CI6 A;  1PRQ A;  4DJ2 A;  3NOP C;  3U4L P;  4ESP A;  4N1H A;  1FR1 A;  2AVX A;  4S2I A;  2ZM2 A;  1S1Y A;  4U0T A;  4U3T A;  1FIK A;  4WMC A;  3BFC A;  4WM9 A;  5CX7 A;  3PYP A;  4JBF A;  3IH9 A;  4EUZ A;  3MJQ A;  4DKI A;  3HLE A;  2HDU A;  1L3L A;  2W3E A;  3ZVT A;  4MEZ A;  2LB5 A;  2P9V A;  1TS7 A;  2HF6 A;  1J9M A;  1PZO A;  1I5Q A;  3IS2 A;  2WAF A;  3T50 A;  1KVM A;  2ZMA A;  2PU2 A;  5L2F A;  2Y2H A;  4IHQ A;  2QWS A;  1XJ6 A;  5HAP A;  1T19 A;  3NOT C;  4NG2 A;  1K4F A;  2WZX A;  3AGE A;  2ZQC A;  3BFD A;  4R3B A;  1SDN A;  1N9B A;  4R1G A;  3R7W A;  2VX8 A;  1S0W A;  2EX6 A;  4HJ6 A;  3SS3 A;  5GLA A;  2H10 A;  2OLU A;  1ONG A;  2WUQ A;  5DTK A;  2W27 A;  2OV5 A;  4OOM A;  1OTB A;  1ZG6 A;  2A2L A;  4GW9 A;  4YOF A;  4CLC E;  2Z6C A;  4E3J A;  1VHM A;  5TGF A;  5KSC A;  5EFW A;  3HUO A;  4LGW A;  5A92 A;  3S7N A;  4WZ5 A;  3HLW A;  4K91 A;  4Q0H A;  2XFT A;  1PI4 A;  2PD7 A;  4ARZ A;  5A8B A;  5FAP A;  1OJ5 A;  4MN7 A;  4OP5 A;  1YLY A;  5F6A A;  1IFQ A;  3FPW A;  2NUT C;  1FIL A;  1T18 A;  3DTI A;  3LGO A;  4X68 A;  2K31 A;  3KSI A;  3HRE A;  3PBO A;  4GB7 A;  3VP1 A;  1NY0 A;  3SW1 A;  3F1P B;  2ZOI A;  4F94 A;  5TR7 A;  3VFH A;  4YNR A;  3VV4 A;  1W8Y A;  1T1A A;  1UWP X;  4OPQ A;  2LB9 A;  4BBV A;  5E2E A;  1S6R A;  1IYQ A;  3E2K A;  3ZNY A;  5MC7 A;  5FI2 A;  2DRW A;  1HZO A;  1GA0 A;  3ZG8 B;  1OTA A;  5AJG A;  5EVI A;  5TFQ A;  1NZO A;  1WA9 A;  2Z2L B;  5CEC A;  3LR0 A;  2HP6 A;  3GR2 A;  1EWZ A;  3V50 A;  2Y4A A;  1STZ A;  4HBT A;  3CWF A;  3HJK A;  1ES3 A;  4IVK A;  1H5X A;  3OBF A;  1JWP A;  3OPH A;  2EA9 A;  2W3D A;  2VKS A;  3NHQ A;  3HCY A;  4R3A A;  1ONH A;  3LEZ A;  2A3U A;  2M1C A;  4FH2 A;  3PBT A;  1KDW A;  4NKP A;  4H6J A;  3KO6 A;  4ID4 A;  2WGW A;  1GSV A;  1SKO B;  1ACF A;  3BWL A;  3BEB A;  5CED A;  4D2O A;  4BL3 A;  4JXS A;  1A0K A;  3VP3 A;  5HW3 A;  3KYE A;  4BBT A;  3FPV A;  3T4J A;  3JYI A;  4DE2 A;  1ZHH B;  3L7H A;  1K6S A;  4MLL A;  3B47 A;  1XXM A;  5HAI A;  4LCL A;  3KSH A;  1W7F A;  3FYZ A;  4JLF A;  3UE6 A;  4JPM A;  4Q8I A;  4QB8 A;  1H8Y A;  3JVV A;  2VV8 A;  1CJF A;  4Z1W A;  2DNS A;  2JKT I;  3G2Z A;  3BYD A;  3ZDJ A;  1K38 A;  4DXB A;  2WKP A;  5HL1 A;  4N1X A;  2Y2Q A;  3SH9 A;  1EI5 A;  4HBU A;  5HAR A;  2B02 A;  1N9L A;  1MY8 A;  1XA1 A;  4IVI A;  3T12 B;  3VSK A;  5FEG A;  4I3A A;  5J3W A;  4BMW A;  1NZU A;  4HI4 A;  4WEJ A;  2VV6 A;  2JKR I;  2J3T D;  3Q07 A;  2J9O A;  2XA7 S;  1MKI A;  2Z2M B;  3F1O A;  1BLC A;  4X1L A;  2PDR A;  4X25 A;  5IS1 A;  4JXW A;  3MXR A;  3G34 A;  4XT2 A;  3UMD A;  4EXO A;  4RA7 A;  4KZ3 A;  1NXY A;  3DBA A;  2JKG A;  1F9I A;  1N9O A;  3M6H A;  2JCH A;  5HDS A;  2GJ3 A;  3PBN A;  3CIT A;  3VOY A;  2J3W A;  4R4S A;  4F3L A;  1Y54 A;  2B5R A;  4I3J A;  4LRZ E;  5M18 A;  3GTC A;  2VLG A;  4EEU A;  4RYE A;  3BFG A;  3PAG A;  4KZA A;  2ZMF A;  3VOZ A;  3BLS A;  4O0P A;  1ERO A;  4CLC D;  5F1F A;  1OTI A;  3GSG A;  3IBJ A;  1NJ4 A;  1CI9 A;  3LID A;  4YFM A;  1L0E A;  5CTM A;  1IEL A;  2R9W A;  1P97 A;  3HL9 A;  4Q0I A;  4EBN A;  3IXH A;  5HZH A;  1G28 A;  4R0Q A;  5DTS A;  1XKZ A;  3UB5 P;  1VET A;  3M6B A;  2P9V B;  3S7O A;  4K08 A;  4S2N C;  1P9W A;  3K2N A;  4KZ4 A;  3MBZ A;  3IS2 B;  3CJM A;  4ZRR A;  3ITB A;  5A93 A;  1FOF A;  2A24 A;  1C3B A;  4KZB A;  4EV4 A;  3DWZ A;  4HH3 A;  4Y15 A;  1Y4O A;  2ZC3 B;  4IED A;  5KMW A;  5J4E A;  4LEN A;  1ZC2 A;  4IBX A;  2XEP A;  1KOU A;  3R7W B;  4E3N A;  3EEA A;  1YSP A;  3SH8 A;  2VZW A;  5FL3 A;  3IF6 C;  2YKF A;  2H5S A;  3GEC A;  1TS8 A;  4KZ8 A;  1E4D A;  2FFY A;  3IXB A;  2DCF A;  4XUX A;  3A3E A;  3VSL A;  5CXW A;  4GDN A;  1YLP A;  3LI8 A;  4LRY C;  1LI0 A;  5HFO A;  1ERQ A;  5HL6 A;  5LBR A;  3T4O A;  4KZ7 A;  2IWB A;  4FD8 A;  2ZC4 B;  4ARZ B;  3E4O A;  5EPH A;  5CRF A;  4WUJ A;  2GZA A;  3ZFZ A;  3IXD A;  3GRJ A;  3W8K A;  5DF8 A;  4Y0O A;  5IT5 A;  1LL8 A;  3ZHH A;  4HH2 A;  4NK3 A;  1SKF A;  3LIF A;  1JNU A;  2J3T C;  2VGL S;  1LL5 A;  1F5M A;  4YIN A;  3A3I A;  3S1Y A;  1PW8 A;  4QWO A;  3Q82 A;  2X71 A;  3LY3 A;  3V5M A;  5HD3 A;  3V3S A;  4P6Z M;  2HDR A;  5AQ7 A;  2QMI A;  5EVI B;  1FSY A;  3MXS A;  1I2W A;  2V1Z A;  1NLZ A;  1PI5 A;  2JN7 A;  3P98 A;  3CHW P;  5FQM A;  5FQQ A;  3M2K A;  5HWV A;  2OSU A;  3NDE A;  3N4I A;  3RXX A;  1BYW A;  1RCJ A;  5E43 A;  2W3G A;  2HP9 A;  3E0Y A;  2XFS A;  3JPU A;  1OME A;  5F68 A;  4H6J B;  3TW8 A;  2V9A A;  3NOU C;  2WGW B;  4QY6 A;  4CLC C;  3UME A;  4EBL A;  4JGQ A;  1W8Q A;  1KGF A;  1OTD A;  3UB9 A;  4U0X A;  5FEF A;  2ZOH A;  1DJA A;  3VP2 A;  5HDC A;  2EX8 A;  1LSW A;  2R9X A;  4ZJ1 A;  1BUE A;  2QYB A;  4EQI A;  4PM9 A;  3UB8 A;  4DE3 A;  3G32 A;  3ISG A;  2W3F A;  2W0N A;  3IWI A;  3N8R A;  3ZQ5 A;  1DJB A;  3SZT A;  1D06 A;  2VEA A;  5CEB A;  2G2W A;  4X55 A;  4B4Z A;  3JVU A;  1XX2 A;  4I3I A;  4HIA A;  2RCX A;  1NLY A;  1OT6 A;  1BLP A;  1GA9 A;  3GV9 A;  1S4R A;  5JYO A;  3AGF A;  1SCW A;  4ME4 A;  5GHX A;  5HPI A;  2I9V A;  4IUK A;  5FQK A;  4E6X A;  1L0F A;  3W4O A;  3LEQ A;  4LPZ A;  2VJW A;  3O3V A;  4EET B;  5J7E A;  1MWS A;  1TEM A;  3F1O B;  4P87 A;  1T1B A;  5CER A;  4XT2 B;  3H82 A;  3FC7 A;  3T1S A;  2V0W A;  1FCM A;  5BOH A;  3PAE A;  4GS9 A;  5GL9 A;  3WS4 A;  3UPN A;  3QP1 A;  1WE4 A;  5HSQ A;  1MWU A;  3LR3 A;  1K55 A;  3O87 A;  2HZ5 A;  3BY8 A;  3HLC A;  4RX2 A;  4NEE D;  4F3L B;  4KQQ A;  3N8L A;  2OWH A;  4JKT A;  2V20 A;  3T4Q A;  4WLA A;  3P7N A;  1Q2Q A;  2PAV P;  3N6I A;  5TBM A;  3EOI A;  2C5W B;  5DVA A;  2Y2G A;  1F98 A;  1GCE A;  1W63 Q;  2O99 A;  3HJI A;  4EER A;  2Y2J A;  4GDB A;  5FAO A;  1G5U A;  4NXB A;  1PWG A;  3UE1 A;  4E3L A;  4QPR A;  2BTF P;  2JE5 A;  1S66 L;  5D3O A;  5CGW A;  4FH4 A;  3EQV A;  1VET B;  4E04 A;  4MBH A;  4D60 A;  1CQA A;  1XP4 A;  4OLG A;  1MWT A;  1K54 A;  4MCW A;  4E3K A;  2A24 B;  3ZG7 B;  2BG1 A;  2W1R A;  1YSQ A;  2ZM0 A;  3E98 A;  1NYM A;  4OPZ A;  4KQR A;  3TG9 A;  3MF0 A;  5F1G A;  3LIA A;  2EX9 A;  4LV0 A;  5DF7 A;  3HLG A;  4ETX A;  2Z6D A;  1BLH A;  1XJ3 A;  4L9G A;  2J7V A;  4GNU A;  2JKT M;  4HJ4 A;  2IA2 A;  2VGK A;  5EM0 A;  4A5R A;  2Q9M A;  3MQQ A;  4MN5 A;  3IQA A;  3MMH A;  4CJN A;  4PM7 A;  4S2P A;  1L0D A;  4BD1 A;  3WWX A;  3H9W A;  4G3V A;  2ZC5 B;  3LR5 A;  5J8X A;  4Y17 A;  5E2F A;  1TDL A;  4UEY A;  1LT0 A;  4CLC A;  2QJ5 A;  3C4O A;  2QPN A;  1LLB A;  3G6O A;  3ZG5 A;  2JKR M;  3FZC A;  2KLI A;  4K0W A;  3C30 A;  4X6T A;  1ESI A;  3D4F A;  1ODV A;  1YAX A;  2Y55 A;  1CF0 A;  1NYY A;  1YLW A;  4GD6 A;  3GQZ A;  5DKK A;  5FQJ A;  2V8F A;  1MBL A;  2GX5 A;  4PAU A;  3UB6 A;  1JTD A;  5IU1 A;  5KIZ A;  1J3W A;  1W79 A;  5FQI A;  4PM8 A;  5FA7 A;  4O8G A;  2C6W B;  4GOG A;  3KYQ A;  3WS1 A;  1YMX A;  3IT9 A;  4OLD A;  3QNC A;  2JBF A;  2B95 A;  2V2F F;  1CEF A;  4G3K A;  4LV3 A;  4MDZ A;  1K57 A;  4GD8 A;  4KG6 A;  4JXG A;  4R3J A;  2OAQ 1;  4DE0 A;  1GHP A;  3LR4 A;  2W3H A;  1FSW A;  3WS5 A;  3SS4 A;  4M4X A;  5E2G A;  4DDY A;  1ES5 A;  1GSX A;  2NUP C;  4HJ3 A;  4X53 A;  5FDS A;  3MR0 A;  2O9A A;  1VEU B;  4WBG A;  4DDS A;  4QD4 A;  1T1C A;  2HV1 A;  2IWD A;  2IWC A;  3NDG A;  4CQH A;  3MKF A;  4HOI A;  3LUQ A;  1TDG A;  3ITA A;  1IYP A;  3UPP A;  3EQU A;  2HDS A;  4L9F A;  4HEF A;  3MS6 A;  2XRN A;  5CGS A;  2HJ9 C;  2VV7 A;  3UDF A;  3BQ8 A;  3R4K A;  4X56 A;  1ERM A;  3B33 A;  2Q0O A;  2J8Y A;  3Q7V A;  4NET A;  1XGI A;  5EVE A;  4DE1 A;  3EWK A;  3T4T A;  4OON A;  4LLO B;  4PKY A;  3QP2 A;  5EUA A;  2DMW A;  5AQB A;  2XF3 A;  1XJ2 A;  2ZMV A;  2L4R A;  2PRF A;  3MZD A;  3BFE A;  4N9L A;  3P01 A;  4P85 A;  4ZTK A;  4E3I A;  2WKH A;  5GLD A;  3H82 B;  3FKW A;  4BD0 A;  1G6A A;  4EW7 A;  3SS5 A;  1YMS A;  4PPR A;  1ZG4 A;  2EFX A;  2FFF B;  3ZVW A;  4GS9 B;  4IUH A;  2L1M A;  5JYP A;  2WYX A;  1PYY A;  3PR6 A;  5M19 A;  2WGI A;  5GLB A;  4KG2 A;  1H3Q A;  4Y2F A;  3G2Y A;  4LRX C;  4OPR A;  1OPX A;  3D9Y A;  4EUV A;  2BAS A;  5TBM B;  3IHB A;  3A0R A;  3QP5 A;  1VB6 A;  3C5A A;  3N8S A;  4B93 A;  3PBS A;  4P6Z S;  2O9C A;  3ZYT A;  4AFI A;  4GHI A;  2HPB A;  2INW A;  4UQI M;  4OOL A;  3OOV A;  3O88 A;  4G3W A;  5FAS A;  1FQG A;  4GCZ A;  1YM1 A;  3B3X A;  5K5B A;  5AVF A;  2ZQ7 A;  4NXF A;  4LV1 A;  2I72 A;  3RH8 B;  2KX6 A;  1XFN A;  3QP8 A;  2EX2 A;  2PHY A;  3C8C A;  3VE3 A;  3RJU A;  1MWR A;  2PYR A;  5F69 A;  3MZF A;  3RFB A;  3T4L A;  2WKI A;  1ALQ A;  3KYZ A;  3N7W A;  4MN6 A;  4JGR A;  3BJN A;  2QHK A;  3ZCZ A;  2J9P A;  3VFF A;  3TRC A;  3FV7 A;  5HD5 A;  1HVB A;  3LY4 A;  2Y8H A;  3W2Z A;  3D3O A;  3T1Q B;  1VQQ A;  1YT4 A;  3Q7Z A;  1N9N A;  1LI9 A;  3SH7 A;  4C75 A;  1CEG A;  1GHI A;  1MC0 A;  1KVL A;  4GJ4 A;  1BZA A;  2QZ6 A;  1XPB A;  3UNW A;  2H28 A;  3D72 A;  2VK3 A;  2M7U A;  4MBK A;  1WYC A;  1JWV A;  3MQO A;  4JGO A;  4CLC B;  1OTE A;  4OP8 A;  5DKL A;  4E3M A;  2P04 A;  1XFQ A;  4Y13 A;  3LI9 A;  4KQD A;  2XRO A;  2XD1 A;  5HWT A;  4EES A;  4II7 A;  2H0Y A;  3MXQ A;  1Q2P A;  4DRT A;  3V3R A;  4HY8 A;  2H0T A;  4KUK A;  1W63 M;  3LYX A;  3WS2 A;  4WZ5 C;  4Y0U A;  3IHA A;  4Z9Q A;  4GN2 A;  5EE8 A;  2K7S A;  4WYY A;  5F83 A;  1P9R A;  3DW0 A;  3L9K A;  1V9Y A;  3C7U A;  3UO9 A;  3DTM A;  4HP4 A;  1RGY A;  3EGD C;  4P6B A;  1BLS A;  3LFV A;  5HWW A;  5IHV A;  3E4Q A;  4BBU A;  5AQ9 A;  3OPP A;  4FOF A;  4ZJ2 A;  1YKD A;  3BQA A;  2ZJ9 A;  4B4X A;  3QHY A;  4GLQ A;  4Y3I A;  3ZGA B;  3BW6 A;  3KX0 X;  5L10 A;  4Y7P A;  4EEP A;  4OH0 A;  3HLF A;  3V67 A;  5EOO A;  5EVL A;  3MZE A;  1FR6 A;  1F2K A;  3MSH A;  2Y2M A;  3IX3 A;  5KZH A;  4PKY G;  3SOI A;  2X01 A;  3UN7 A;  4GZB A;  4HNB A;  2G2U A;  2WKE A;  4I39 A;  2PR6 A;  3O86 A;  1YQS A;  3OCL A;  3FG8 A;  3OZH A;  3V39 A;  3RTY A;  1PIO A;  3S4X A;  3IF5 A;  2PYP A;  2HGV A;  5FAT A;  4BLM A;  4S2K A;  3GDI A;  2PBY A;  3K3D A;  2PR5 A;  3Q81 A;  2Q9N A;  2UWX A;  3K3C A;  4X69 A;  2Y2P A;  2E8I A;  3NJA A;  1SZV A;  5GHY A;  2WGV A;  4EBP A;  3W4P A;  4LFU A;  1U60 A;  1K56 D;  4WZ4 A;  3Q7V B;  2ZL1 A;  2VGJ A;  3OCN A;  4UA9 A;  4S2N A;  4QY5 A;  1L2S A;  3CZD A;  3MFD A;  4MNR A;  5I5L A;  2GNX A;  2R78 A;  4EQ1 A;  4MBF A;  1MPL A;  2KOI A;  2P7J A;  1DP8 A;  4KZ6 A;  4ETZ A;  1NRJ A;  2EWV A;  2XQZ A;  3BM6 A;  1YPR A;  1ES4 A;  4HHD A;  2OLV A;  2PD8 A;  3HBR A;  3IF6 A;  3UY6 A;  3LIE A;  3LIC A;  1M6K A;  1GHM A;  3PBQ A;  4R4R A;  4IBR A;  3CAX A;  3T4S A;  3LO7 A;  4FTX A;  1UGU A;  1MKM A;  3VOL A;  2V8C A;  4K0X A;  4P0M A;  4WEK A;  3EGX C;  3GVB A;  4E6W A;  3IXG A;  5FI7 A;  1TS6 A;  3HLD A;  4PM5 A;  1YLT A;  3G4P A;  2ZC6 B;  2G7U A;  3NCK A;  3A0S A;  4BEN A;  3HUM A;  1TVF A;  3E4P A;  2XR0 A;  1X0O A;  5G4Y A;  1S4S A;  2L0W A;  3OPR A;  4GHI B;  3UB7 A;  2Y2K A;  1Z09 A;  2UV0 E;  2XGN A;  2V0U A;  2E8J A;  3Q1F A;  2YKH A;  4ZBE A;  2ZD8 A;  2EXA A;  2O9B A;  3FKV A;  3OLO A;  1LSV A;  4R23 A;  1MZU A;  4QU3 A;  4S2L A;  1PW1 A;  3C4P A;  2JC7 A;  2EFU A;  4ZJ3 A;  2A49 A;  4Q0J A;  2ZC7 A;  1IOU A;  2XD5 A;  1XGJ A;  1W5D A;  2WAD A;  5L07 A;  4UA7 A;  1XA7 A;  4S2M A;  2CC1 A;  3EEH A;  4Y5F A;  3T1R A;  4X1M A;  3TJZ C;  3HVF A;  1TD5 A;  4EU0 A;  2Y59 A;  4R38 A;  2WAE A;  1UWN X;  1Y28 A;  3MKE A;  5EM1 A;  2OOL A;  2P08 A;  4HES A;  3UE0 A;  4ZDX A;  4BWI A;  1BT5 A;  4OVD A;  1E3U D;  1TF1 A;  5DFY A;  1PNE A;  1BUL A;  5A90 A;  2XSS A;  1SDE A;  2XH9 A;  2QKP A;  5AVE A;  3NC8 A;  4I5S A;  4N9K A;  3T1X A;  1DJC A;  5F5Y A;  1IKG A;  2XDM A;  3UE3 A;  3KSF A;  2FZ0 A;  4QJG A;  3UDI A;  3VMA A;  1MXO A;  3NY4 A;  1LSX A;  3OC2 A;  1TS0 A;  1XJ4 A;  3C38 A;  4OQH A;  3E2L A;  2OAP 1;  5KSH A;  1K6R A;  3AGD A;  4JF4 A;  1DP9 A;  5E2H A;  4HQA A;  3IWO A;  5EV0 A;  5C5K A;  4C3Q A;  2FH5 A;  2KDK A;  3S7P A;  5CTN A;  5GHZ A;  1JVJ A;  2GDN A;  4KUO A;  2O0Y A;  3HLB A;  2PT7 A;  1ES2 A;  3A0V A;  4KZ9 A;  4RX3 A;  4WMC D;  4S2O A;  1KGE A;  4OOY A;  1CK3 A;  2PU4 A;  4O7D A;  3CPT A;  4O01 A;  4BJP A;  3DWK A;  5CHU A;  3F1N A;  4L9E A;  1DP6 A;  1EW0 A;  2ZQ9 A;  3C7V A;  2WK0 A;  1YLJ A;  5CHM A;  3UDX A;  5CGX A;  4JF6 A;  4UQI S;  3ZG0 A;  1G68 A;  3S22 A;  4L0L A;  4R6L A;  4UA6 A;  4S2J A;  3BRM A;  1PWD A;  4DN0 A;  4RVA A;  2Y2N A;  1DRM A;  3PTE A;  2WKQ A;  2HDQ A;  3NUL A;  1S1Z A;  3H7W A;  5HAQ A;  3A3F A;  1H8Z A;  1D1J A;  2VA0 A;  5L8M A;  3DTE A;  2W1T A;  5FI6 A;  2X02 A;  1HTZ A;  4DMZ A;  1K4E A;  3CUE C;  4FSF A;  1OT9 A;  2ZL1 B;  3T4K A;  1NWZ A;  3BLM A;  1YLZ A;  3WRZ A;  3I7J A;  1RP5 A;  5CHJ A;  3C2W A;  3S7Q A;  3NI9 A;  5FQ9 A;  2ZQA A;  3VP0 A;  1OJG A;  3MFX A;  4WN5 A;  1E25 A;  3FWL A;  1Z6F A;  2M7V A;  1O07 A;  5F82 A;  3ULF A;  1RGZ A;  2CMN A;  3IF6 B;  5G4Z A;  4HP9 A;  1V9Z A;  1H0M A;  1BTL A;  1QMF A;  3ZG9 B;  4GKU A;  3IH8 A;  5G18 A;  2ZQ8 A;  1ESU A;  3LCE A;  4KQO A;  5EVI D;  4LV2 A;  1N4O A;  4C6Y A;  3VE4 A;  3IX8 A;  1KE4 A;  1G6O A;  3G30 A;  4N92 A;  4FUW A;  1K25 A;  4PM6 A;  1JWZ A;  2RL3 A;  3U2A A;  1IEM A;  3NBL A;  3OPL A;  2OWJ A;  4JGP A;  4CPK A;  4DXC A;  1P0Z A;  2Y2L A;  3CLO A;  2ZLY A;  2J80 A;  3ICY A;  2D02 A;  2Y91 A;  5FAQ A;  3PBR A;  3P09 A;  1K56 A;  2XA7 M;  5L09 A;  1PWC A;  1K55 C;  1KE3 A;  1NRF A;  1BSG A;  1O7E A;  2V1A A;  4DF6 A;  4OQG A;  4OQI A;  3QP6 A;  5HDD A;  5GLC A;  2ZM8 A;  3G35 A;  4NXG A;  1KGG A;  3IBR A;  3G31 A;  4M3K A;  3BEC A;  4H8R A;  3F1P A;  2WZZ A;  1I2S A;  3QNB A;  1SHV A;  5DF9 A;  3GMW A;  3DAV A;  1KE0 A;  4R70 A;  3TSG A;  3IX4 A;  3PXP A;  4WL9 A;  2Y2O A;  1FCN A;  2B18 A;  5DJU A;  4OKP A;  3CG5 A;  4B88 A;  2BLS A;  4KEN B;  1K54 C;  2P74 A;  2D01 A;  2JKF A; 
#chains in the Genus database with same CATH homology
 1YAX A;  4ETZ A;  5HDS A;  1NRJ A;  2GJ3 A;  3PBN A;  3CIT A;  5DKK A;  2EWV A;  2J3W A;  1H8M A;  4F3L A;  4I3J A;  2GX5 A;  4LRZ E;  4PAU A;  4RQ9 A;  3UB6 A;  1S67 L;  5IU1 A;  4HHD A;  5KIZ A;  2PD8 A;  2VLG A;  3LIE A;  4EEU A;  2WKR A;  3LIC A;  2ZMF A;  2QJ7 A;  4O8G A;  3PBQ A;  4B9O A;  3CAX A;  3T4S A;  4O0P A;  1UGU A;  4CLC D;  1MKM A;  3KYQ A;  1OTI A;  3VOL A;  3IBJ A;  3LID A;  4WEK A;  3EGX C;  4G3K A;  4MDZ A;  3LIB A;  3PHY A;  1P97 A;  1TS6 A;  4Q0I A;  2OAQ 1;  5HZH A;  1G28 A;  5DFX A;  3TE8 A;  2G7U A;  2Y79 A;  3A0S A;  3LR4 A;  2W3H A;  5DJT A;  3O5Y A;  3S7O A;  4K08 A;  1P9W A;  3E4P A;  2JHE A;  4M4X A;  3K2N A;  1X0O A;  5HPF A;  5G4Y A;  1S4S A;  3IS2 B;  1GSX A;  4ZRR A;  2L0W A;  2NUP C;  2A24 A;  4HJ3 A;  4GHI B;  3UB7 A;  2V0U A;  2YKH A;  3MR0 A;  2O9A A;  2O9B A;  4HH3 A;  5J4E A;  2MJ6 A;  3CUE A;  3OLO A;  1LSV A;  1KOU A;  1T1C A;  2HV1 A;  3R7W B;  4NXE A;  3EEA A;  4CQH A;  1MZU A;  2V1B A;  1YSP A;  2VZW A;  5FL3 A;  2YKF A;  4HOI A;  3GEC A;  1TS8 A;  3LUQ A;  4Q0J A;  4I38 A;  1IOU A;  3BY9 A;  3F1N B;  3EQU A;  4L9F A;  2VGL M;  4DJ3 A;  2XRN A;  4WEL A;  2HJ9 C;  2VV7 A;  3LI8 A;  4LRY C;  5TJJ A;  3EEH A;  3BQ8 A;  3R4K A;  4Y5F A;  5LBR A;  5HL6 A;  3B33 A;  3TJZ C;  3T4O A;  3MQ0 A;  1TD5 A;  4EU0 A;  2ZBB A;  4R38 A;  4ARZ B;  3E4O A;  1UWN X;  1Y28 A;  4WUJ A;  2GZA A;  2OOL A;  2P08 A;  3EWK A;  3T4T A;  4IJG A;  4WF0 A;  4YWZ A;  1ZTU A;  4LLO B;  2K2N A;  3H7W B;  4BWI A;  5IT5 A;  1LL8 A;  4PKY A;  4HH2 A;  1TF1 A;  2DMW A;  5DFY A;  1D7E A;  3LIF A;  1JNU A;  2J3T C;  2VGL S;  2HJE A;  1XJ2 A;  2XSS A;  4PHT A;  2ZMV A;  2L4R A;  1F5M A;  3KSG A;  2QKP A;  3P01 A;  2W1T B;  5AVE A;  2EWW A;  4I5S A;  5HD3 A;  3H82 B;  4MMN A;  4P6Z M;  5F5Y A;  4EW7 A;  3UE3 A;  3B42 A;  1GSW A;  3CI6 A;  3KSF A;  4GS9 B;  4IUH A;  2FZ0 A;  2L1M A;  4DJ2 A;  1NLZ A;  3NOP C;  3PR6 A;  2JN7 A;  1H3Q A;  1S1Y A;  1LSX A;  3OC2 A;  4Y2F A;  5HWV A;  4LRX C;  1TS0 A;  1XJ4 A;  3C38 A;  1OPX A;  1BYW A;  5CX7 A;  3PYP A;  2W3G A;  3MJQ A;  3E0Y A;  4EUV A;  2OAP 1;  5F68 A;  2W3E A;  2BAS A;  2LB5 A;  5KSH A;  4H6J B;  5TBM B;  3TW8 A;  1TS7 A;  2HF6 A;  1DP9 A;  3A0R A;  4HQA A;  2V9A A;  3NOU C;  5C5K A;  1VB6 A;  4CLC C;  3IS2 A;  4B93 A;  3PBS A;  4P6Z S;  2O9C A;  3T50 A;  3ZYT A;  3UME A;  2FH5 A;  2KDK A;  4AFI A;  4GHI A;  4IHQ A;  3S7P A;  4JGQ A;  2QWS A;  2INW A;  1OTD A;  1XJ6 A;  4OOL A;  4UQI M;  3UB9 A;  3OOV A;  1T19 A;  3NOT C;  4KUO A;  2ZOH A;  4G3W A;  5HDC A;  1LSW A;  2O0Y A;  2PT7 A;  4GCZ A;  2VX8 A;  3A0V A;  3R7W A;  5K5B A;  4HJ6 A;  5AVF A;  2QYB A;  4NXF A;  3RH8 B;  4O01 A;  3UB8 A;  4BJP A;  2KX6 A;  1XFN A;  3F1N A;  2W27 A;  2PHY A;  3C8C A;  1OTB A;  4L9E A;  4OOM A;  3VE3 A;  1DP6 A;  1EW0 A;  2W3F A;  2W0N A;  2A2L A;  4GW9 A;  4YOF A;  4CLC E;  2PYR A;  2Z6C A;  5F69 A;  3ZQ5 A;  1VHM A;  3RFB A;  1D06 A;  2VEA A;  3T4L A;  5EFW A;  3KYZ A;  4MN6 A;  4JGR A;  4UQI S;  3BJN A;  2QHK A;  3JVU A;  4L0L A;  3S7N A;  4I3I A;  4R6L A;  4HIA A;  1NLY A;  1OT6 A;  4Q0H A;  5HD5 A;  3TRC A;  2PD7 A;  4ARZ A;  5A8B A;  1OJ5 A;  4DN0 A;  4MN7 A;  1DRM A;  2Y8H A;  3W2Z A;  5F6A A;  1IFQ A;  3D3O A;  3FPW A;  2NUT C;  1S4R A;  1T18 A;  2WKQ A;  1N9N A;  2K31 A;  3KSI A;  1S1Z A;  3PBO A;  3H7W A;  3SW1 A;  3F1P B;  4ME4 A;  1MC0 A;  4GJ4 A;  2ZOI A;  5HPI A;  2I9V A;  4IUK A;  2VA0 A;  5L8M A;  4YNR A;  3VV4 A;  1T1A A;  1UWP X;  2H28 A;  2LB9 A;  3D72 A;  4LPZ A;  4BBV A;  2W1T A;  2VJW A;  4EET B;  5J7E A;  4DMZ A;  3F1O B;  3CUE C;  1T1B A;  4FSF A;  2M7U A;  1OT9 A;  5MC7 A;  4XT2 B;  1NWZ A;  3H82 A;  3T4K A;  3FC7 A;  3MQO A;  4JGO A;  4CLC B;  2V0W A;  3C2W A;  3S7Q A;  1OTE A;  5DKL A;  1OTA A;  5AJG A;  2P04 A;  1XFQ A;  1WA9 A;  3LI9 A;  4KQD A;  2XRO A;  4GS9 A;  3LR0 A;  5HWT A;  5HSQ A;  4EES A;  3LR3 A;  4II7 A;  1OJG A;  3MFX A;  3MXQ A;  1STZ A;  4HY8 A;  3BY8 A;  4WN5 A;  3CWF A;  3HJK A;  3OBF A;  4KUK A;  4NEE D;  4F3L B;  2M7V A;  1W63 M;  2EA9 A;  3LYX A;  2OWH A;  3ULF A;  2W3D A;  2VKS A;  2CMN A;  3NHQ A;  3HCY A;  3T4Q A;  4WLA A;  4R3A A;  3P7N A;  5G4Z A;  2M1C A;  4HP9 A;  1V9Z A;  3PBT A;  4NKP A;  4H6J A;  5TBM A;  3KO6 A;  2K7S A;  3EOI A;  1P9R A;  1F98 A;  1V9Y A;  1GSV A;  4KQO A;  4HP4 A;  3EGD C;  1W63 Q;  2O99 A;  3HJI A;  3LFV A;  4EER A;  3BWL A;  5HWW A;  4NXB A;  3E4Q A;  4BBU A;  3VE4 A;  4QPR A;  4FOF A;  1YKD A;  1S66 L;  4BBT A;  3FPV A;  1G6O A;  3T4J A;  3BQA A;  1ZHH B;  3EQV A;  4GLQ A;  4E04 A;  4Y3I A;  3BW6 A;  3B47 A;  3KX0 X;  3U2A A;  3KSH A;  4EEP A;  2OWJ A;  4JGP A;  3UE6 A;  3V67 A;  1P0Z A;  4MCW A;  2A24 B;  3CLO A;  2J80 A;  4PKY G;  3JVV A;  3ICY A;  2D02 A;  2VV8 A;  3PBR A;  4Z1W A;  2W1R A;  2XA7 M;  2JKT I;  4HNB A;  1YSQ A;  2V1A A;  4I39 A;  2PR6 A;  3E98 A;  3OCL A;  3FG8 A;  2WKP A;  3RTY A;  2PYP A;  2HGV A;  3MF0 A;  5HDD A;  3LIA A;  3GDI A;  3K3D A;  2B02 A;  2PR5 A;  1N9L A;  4ETX A;  4NXG A;  3K3C A;  2Z6D A;  1XJ3 A;  4L9G A;  3IBR A;  4I3A A;  5J3W A;  2JKT M;  4BMW A;  4HI4 A;  4WEJ A;  4HJ4 A;  2IA2 A;  3F1P A;  2VV6 A;  3NJA A;  2JKR I;  3MQQ A;  4MN5 A;  2J3T D;  3MMH A;  5DF9 A;  2XA7 S;  3F1O A;  2PDR A;  4R70 A;  5IS1 A;  3H9W A;  4G3V A;  4XT2 A;  3OCN A;  3UMD A;  4EXO A;  3LR5 A;  4UEY A;  3PXP A;  1LT0 A;  5I5L A;  4CLC A;  2GNX A;  3DBA A;  4WL9 A;  2R78 A;  4EQ1 A;  2QJ5 A;  2B18 A;  3G6O A;  5DJU A;  2JKR M;  2KLI A;  1F9I A;  2KOI A;  2P7J A;  3C30 A;  1DP8 A;  1N9O A;  2D01 A;  1ODV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...