1OT9A

Cryotrapped state in wild type photoactive yellow protein, induced with continuous illumination at 110k
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
125
structure length
125
Chain Sequence
MEHVAFGSEDIENTLAKMDDGQLDGLAFGAIQLDGDGNILQYNAAEGDITGRDPKQVIGKNFFKDVAPCTDSPEFYGKFKEGVASGNLNTMFEYTFDYQMTPTKVKVHMKKALSGDSYWVFVKRV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Luminescent protein
molecule keywords Photoactive yellow protein
publication title Short hydrogen bonds in photoactive yellow protein.
pubmed doi rcsb
source organism Halorhodospira halophila
total genus 37
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2003-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00989 PAS PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 1ot9A00
3VE4A 2KDKA 3LYXA 4HNBA 4JGQA 3RH8B 4HP4A 4WUJA 4LRXC 3K3CA 4HIAA 2VLGA 3MQQA 4GW9A 1XFNA 3BWLA 5A8BA 5KIZA 5TBMA 3VOLA 2EA9A 4H6JA 1OT6A 4NXFA 4XT2B 1N9OA 3B33A 3LIAA 1OT9A 3CLOA 2J80A 4KQDA 4HOIA 2PD8A 3NOUC 4RQ9A 1D7EA 3G6OA 2ZOIA 4EW7A 1WA9A 2WKRA 4GS9B 3NHQA 3LUQA 3E4OA 4YWZA 1XJ3A 4EERA 1NWZA 3EEHA 4HI4A 2V1BA 2QWSA 3IBRA 4E04A 4EEUA 1BYWA 3D72A 3NOTC 2PDRA 3H7WA 4L9FA 4HP9A 1LT0A 5IS1A 5F69A 5HDCA 1S1YA 1T1BA 4NXBA 1JNUA 1OTDA 4EQ1A 5HWVA 5F6AA 4R6LA 4WLAA 3E4QA 1V9ZA 1T18A 3F1PB 2A24B 4R70A 4GHIB 1X0OA 2INWA 3LIBA 3UB7A 3MR0A 4HH2A 5HZHA 4HHDA 2BASA 4F3LA 4HJ3A 4LLOB 4HJ4A 1DP8A 1UWPX 2HV1A 3ZQ5A 5HWWA 1T1AA 3LI8A 4KUOA 3H9WA 2QKPA 1F98A 4HH3A 5DJUA 1LSWA 2VEAA 2QHKA 4HQAA 3MJQA 3H82B 3K3DA 5F68A 4MN5A 3FG8A 4NXGA 4M4XA 2L1MA 3FC7A 3IS2B 2W0NA 4I39A 2WKQA 3IS2A 5J4EA 3A0RA 3PHYA 2OWHA 3GECA 1S1ZA 4XT2A 2PHYA 3MQOA 4B9OA 5HSQA 4HY8A 2QJ5A 2ZBBA 3UE6A 5DKKA 2PD7A 2YKHA 2V0WA 5I5LA 5G4YA 1KOUA 3UB9A 2JHEA 4GS9A 3F1OB 3MXQA 4I3AA 4DJ2A 1UGUA 1Y28A 4I5SA 3ULFA 2PYPA 2JN7A 2QJ7A 4JGPA 5J3WA 2OOLA 1OTEA 4MN6A 4EESA 1ODVA 4WF0A 3LIEA 2K7SA 1P0ZA 1N9LA 3NOPC 4BBUA 1XJ4A 4EETB 3OLOA 2B02A 2VV8A 1S66L 2L4RA 3F1PA 3F1NB 2A24A 1VB6A 2Z6CA 2KX6A 2YKFA 4GHIA 5DKLA 3A0VA 3MFXA 5HD5A 4L9EA 1S4SA 3LI9A 2L0WA 1S4RA 1DP6A 3BY8A 2V0UA 1V9YA 2D01A 1LL8A 3CWFA 4LPZA 4R38A 1GSXA 4EEPA 3UMEA 1G28A 3LIDA 2V9AA 5HD3A 1OTBA 2GJ3A 4K08A 1GSVA 3H82A 1XFQA 3P7NA 3CAXA 3ICYA 1P97A 2R78A 5TBMB 4WN5A 3HJIA 4L9GA 4H6JB 1OTIA 2PR6A 1TS8A 2VV7A 5AVFA 2P7JA 1LSVA 1TS7A 3F1OA 1LSXA 5F5YA 2D02A 2M1CA 3T50A 1TS6A 4JGOA 2CMNA 3LICA 3UB8A 1XJ2A 3BY9A 2WKPA 3RTYA 3GDIA 3LIFA 2V1AA 1OJGA 2VV6A 3SW1A 3PYPA 4GCZA 4I3IA 2OWJA 2W27A 1TS0A 4LRZE 1XJ6A 3EWKA 4I3JA 3A0SA 1EW0A 3NJAA 4R3AA 1DRMA 4WL9A 1D06A 4NXEA 1S67L 4KUKA 3H7WB 2Z6DA 5HDDA 1N9NA 4BBTA 2PR5A 1T19A 3E4PA 1T1CA 4PKYA 4I38A 1GSWA 3F1NA 4DJ3A 5J7EA 3UMDA 3UB6A 4JGRA 3C2WA 3KX0X 3VE3A 1UWNX 5G4ZA 5HDSA 5DJTA 4LRYC 1MZUA 2I9VA 4PKYG 5IU1A 1F9IA 5AVEA 1OTAA 3HJKA 5EFWA 3C8CA 2PYRA 4HJ6A 4F3LB 2H28A 4EXOA 1OJ5A 2ZOHA 4BBVA 1DP9A 5HWTA
chains in the Genus database with same CATH superfamily
3VE4A 4U3TA 3EGDC 2IA2A 1C3BA 2Y8HA 4PM5A 1IYOA 2XRNA 4HP4A 4S2NC 4WUJA 3K3CA 3ZNYA 5F1FA 4GW9A 1XFNA 4Y15A 5A8BA 1CEFA 2ZJ9A 3R7WA 2I72A 2EA9A 3O5YA 4X69A 3HLEA 3B33A 4XXRA 2V1ZA 3CLOA 3P01A 2J80A 4IJGA 4HOIA 2Y2QA 4KZ8A 1D7EA 4E3JA 2ZQ7A 4EW7A 4LCMA 2WKRA 4GS9B 3LCEA 5CHJA 4ZTKA 3NHQA 3CMZA 4YWZA 3M6BA 1FQGA 3KSFA 3PBOA 2GX5A 4EERA 3O87A 4HESA 3EEHA 2DNSA 2HP9A 5CXWA 2X71A 2E8JA 3BLSA 3GTCA 3VP2A 4E04A 3WRZA 2J3TD 3M2JA 1W7FA 1BZAA 4RX2A 1O7EA 3IX3A 1LHYA 2EXBA 5L2FA 4CLCE 4L9FA 4HP9A 4BL2A 1LT0A 4C75A 1EI5A 5IS1A 3T1RA 5TGFA 5HDCA 3HLCA 1T1BA 2C5WB 4E3KA 2JKGA 2ZQ9A 4MBKA 1YSPA 4Q0HA 3GSGA 5EUAA 2G2WA 2XGNA 1KVMA 2ZC5B 4X55A 5I94A 4KG6A 3OPPA 4FCFA 5FEGA 1KE4A 4WMCA 3N8RA 3W2ZA 4ARZA 5HZHA 3A3FA 5FQIA 3AGEA 3ZQ5A 5HWWA 3N8LA 3VP0A 4Y17A 3H9WA 1MY8A 4OQ0A 3HLGA 4HH3A 1K55C 4H8RA 1K4EA 4JXGA 3TOIA 2QHKA 3PBSA 4HQAA 4B4ZA 3K3DA 4MN5A 1K38A 1NXYA 2FFYA 2H0TA 2L1MA 5FDSA 4I39A 3BJNA 3IS2A 4DE0A 2OWHA 4G3VA 1BLSA 2Q9MA 3BEBA 1S1ZA 3G31A 1ONHA 2ZM2A 1RCJA 2HGVA 3UE3A 1G6AA 2XD1A 3ZCZA 1G5UA 3BFGA 4DDSA 5CRFA 1ES4A 4X6TA 3LO7A 1NYYA 4Y0OA 3ZG9B 3DWZA 2W3HA 5EOOA 3C7UA 5FQQA 1E3UD 1J9MA 4S2JA 1L0DA 3QNCA 4KZ6A 1TEMA 3IBJA 1GHIA 3WS4A 5CECA 3C4PA 4C6YA 4UA6A 1K25A 1LLBA 5L07A 4BMWA 4OLGA 3CPTA 1SDEA 3UDIA 4GZBA 4FH4A 5FQJA 4BL3A 4EUZA 3LIEA 3IXGA 5A90A 2IWBA 4LV2A 4MCWA 4BBUA 3O86A 1VETA 2Y91A 4EETB 3IXHA 1BULA 4RA7A 3KSIA 3DW0A 3F1PA 3C5AA 3LEZA 2O9BA 2ZD8A 4WEKA 2EWWA 3A0VA 3GR2A 2QZ6A 3QP5A 4WYYA 2ZMFA 5A91A 2XFSA 2V8FA 1HD8A 4JLFA 4L0LA 3FKVA 4B93A 4LPZA 2H0YA 3MFDA 3IT9A 1KDSA 1G6OA 4N9KA 2JKRI 5HD3A 5AQ7A 4IBRA 1OTBA 2Y2KA 2WADA 1N9BA 3H82A 2OLVA 1MXOA 1TDLA 2ACGA 2V8CA 1XFQA 1PNEA 2WUQA 4C3QA 4WZ4A 2WKEA 1YLTA 4MDZA 3PAEA 2WZZA 3L7HA 5IT5A 5HX9A 3CAXA 3C7VA 2BLSA 3V67A 3DTEA 3VP4A 3G4PA 4Y3IA 5CGSA 4WN5A 3T4SA 3UNWA 4L9GA 1IYPA 1VM1A 3ZDJA 3IF6A 1FR6A 3M6HA 5HAIA 4QU3A 3B47A 2P7JA 5C5KA 1TS7A 3F1OA 1BLHA 4KZ7A 5FQ9A 4ME4A 5F5YA 1L0FA 5L09A 2D02A 2VJWA 2FFFB 4ETZA 1W79A 4OOYA 3Q81A 2CMNA 3LICA 2VGJA 3HBRA 3MXRA 1XJ2A 2WKPA 1IFQA 4LV1A 3TJZC 1XP4A 4KG2A 2V1AA 4HBUA 3MSHA 1KE3A 5FAOA 3SW1A 4GLQA 1STZA 2FH5A 4RVAA 2OLUA 3VSLA 1XA7A 5M18A 3A3JA 3V5MA 1HLUP 4GOGA 4R3AA 5E43A 3NDGA 1S67L 1YAXA 4OONA 2P9VA 4LFUA 4DXCA 2WK0A 3NDEA 1GCEA 1NJ4A 3WWXA 4UHUA 1T19A 3N8SA 4OVDA 1CF0A 1ERMA 3E4PA 1GA0A 4QPRA 4PPRA 4KQQA 1CK3A 5J7EA 3UB6A 1P9WA 2XA7M 3A3EA 2Q0OA 4JPMA 1MZUA 4PKYG 5IU1A 4AFIA 3UE1A 4DKIA 2Y59A 4ARZB 2NUPC 3GQZA 1ZG6A 1XGIA 4WELA 4BWIA 5HARA 1OJ5A 3RJUA 1DP9A 2R9XA 2J9PA 3KYEA 5HWTA 2KDKA 4HNBA 3T1XA 5DFYA 1YKDA 2Y4AA 2EX2A 3RH8B 4LRXC 1RGYA 2VLGA 3MQQA 3QHYA 3LR4A 3B42A 1KGEA 4WZ5A 5AQ9A 1YLZA 2DRWA 4H6JA 5JYPA 1OT6A 1N9OA 3SH8A 3HCYA 5CHUA 2LB9A 1OT9A 3A3DA 5DFXA 4KQDA 2PD8A 3CJMA 2XDMA 3NOUC 4RQ9A 4OP8A 4DN0A 1JTDA 2W1TB 4NKPA 5FDHA 1WA9A 1RGZA 4UAAA 3KSGA 3ZYTA 1TVFA 4CLCD 3LUQA 4KZBA 5GLBA 1TD5A 5GHXA 1NWZA 1ZTUA 4P6ZM 1KE0A 3ZFZA 2A3UA 1MWSA 3LEQA 5CHMA 2KLIA 4XUXA 3PAGA 2ZMVA 3M2KA 2VKSA 3FKWA 5KSHA 3W4OA 3HUNA 4D2OA 3CPTB 5IHVA 3NOTC 5CTMA 3AGDA 1QMEA 2PDRA 5FI7A 3ZG7B 3NI9A 5GHYA 4DMZA 1YLPA 4QY6A 2WYXA 4S2MA 5F69A 3IHAA 1BUEA 1S1YA 4NXBA 2ZC4B 5EECA 4Z9QA 2WAFA 3G2YA 1VETB 3T1QB 1OTDA 5HWVA 2XR0A 4WLAA 3E4QA 2EX8A 1V9ZA 2O99A 3ZNTA 3F1PB 4N1HA 4R70A 3RFBA 1TF1A 3PBNA 3OOVA 3IX4A 2Z2MB 1S6RA 3A3IA 1IKIA 5A92A 2H10A 4IVKA 4R3BA 4BLMA 2BASA 4F3LA 4OQHA 4LLOB 3P98A 5EVEA 4UA9A 4R3JA 3LI8A 3W8KA 5HPFA 5DF9A 2EFUA 1O07A 2J3WA 2QMIA 5EV0A 5DJUA 4R0QA 3UN7A 4BD0A 3H82B 4MEZA 3DTIA 3SS3A 4IHQA 5EE8A 4NXGA 3N6IA 4M4XA 2HPBA 3IQAA 4K0WA 4QHCA 3LY4A 5FASA 2HDQA 1JWVA 4E3OA 5HW3A 2XROA 4XT2A 2PHYA 4IUHA 4B9OA 3BRMA 4OOLA 4HY8A 3KO6A 5E2GA 5DKKA 2YKHA 4KZAA 4DXBA 2XA7S 2JHEA 3Q7VA 3F1OB 2W1RA 4R1GA 4OLDA 4DF6A 3GMWA 4I3AA 4PM6A 2Y79A 5L10A 3WS0A 3BM6A 1JWPA 3NBLA 2EX9A 3SZTA 1HTZA 3PBRA 5CGXA 1VQQA 3V50A 1CJFA 4S2KA 4K91A 4Q0JA 3VV4A 2EX6A 1PWCA 3S7OA 3OCNA 3N4IA 3L9KA 2CC1A 2UV0E 2OV5A 1Q2PA 2WGIA 4ZAMA 1TDGA 4EESA 4WF0A 3ZG0A 5FAPA 1P0ZA 5KZHA 1K57A 2R9WA 1MWRA 2V20A 4X1MA 1XKZA 3HLBA 2B02A 1YLWA 2A24A 1VB6A 2KX6A 4U0XA 4EQIA 5DKLA 5HL1A 1SZVA 5DTKA 3LI9A 3HLDA 4N92A 1GHMA 1S4RA 5HFOA 3EEAA 3HUOA 3DTMA 2DCFA 3OBFA 2XEPA 2V0UA 1BLCA 1KGFA 1MC0A 4YOFA 4E3NA 1LL8A 2VA0A 2O9CA 4P6ZS 4R38A 4OKPA 3S7NA 2VGKA 4EEPA 4NG2A 3OPLA 1RP5A 1NZOA 1W8YA 4EBLA 4EBNA 4K08A 2PAVP 1Y54A 2B95A 4ZJ2A 5DVAA 2ZQAA 1Z6FA 2HJEA 1IYQA 3ICYA 2O0YA 2Y2HA 3T4LA 1BSGA 1W8QA 4H6JB 4IUKA 1OTIA 1QMFA 5CTNA 1E4DA 3IWOA 5AVFA 5CERA 4OQIA 4M3KA 4YNRA 3QP8A 5FL3A 1LSXA 5DTTA 3MMHA 2M1CA 3ZGAB 5EVIA 5FSRA 2GDNA 4QD4A 4GDNA 3UB8A 1HZOA 4B4XA 4EV4A 1VEUA 2GZAA 2Y55A 1OJGA 4O8GA 2PBYA 4QB8A 3T1SA 5U47A 5TJJA 1K54A 2RL3A 2W27A 3K2NA 2ZL1A 1WE4A 1TS0A 3QP6A 1YM1A 3EWKA 3EQUA 3MZFA 5CEDA 3A0SA 1K56D 3UE0A 2HDSA 4BQMA 3TE8A 2Z6DA 5HDDA 2HF6A 3D3OA 2GNXA 3BFDA 4WBGA 1SCWA 3C38A 4YINA 3ZVWA 1DJAA 1T1CA 4JKTA 4I38A 5EPHA 4OH0A 5E2FA 4GJ4A 1YPRA 4MLLA 3T12B 1W63Q 3UMDA 2LB5A 3C2WA 3NECA 3KX0X 3CZDA 5DJTA 4FTXA 4LRYC 2I9VA 4N1XA 4PMAA 2J9OA 5AVEA 3HREA 3HJKA 5EFWA 5FA7A 5HPIA 2PYRA 4LENA 4F3LB 2H28A 1ES3A 4BBVA 1E25A 2Z2LB 1FIKA 5D3OA 1PRQA 4O01A 2VZWA 4CJNA 1I5QA 3V39A 3UDXA 1J3WA 1EROA 1SKOA 1PW8A 4NEED 1MWUA 4PAUA 4QJGA 4YFMA 3NULA 4UEYA 3UO9A 4HIAA 5FAQA 3E2KA 5EOEA 3R7WB 4Y0TA 3SS5A 3OZHA 2ZM8A 1ALQA 3OPRA 4NXFA 1KDWA 3EQVA 4XT2B 2ZQCA 2B5RA 3LIAA 4ESPA 3W4PA 3LR3A 3VFFA 3VP3A 3BFFA 3KYZA 4Y0UA 3TW8A 1NRFA 3FZCA 3ZG8B 1K57C 3DBAA 2ZM0A 5E2EA 3Q7VB 3E4OA 2P74A 3O88A 2OAP1 4U0TA 1M40A 1ZC2A 5FQKA 3U4LP 3PTEA 4RX3A 4WEJA 2V1BA 4S2NA 4EU0A 1ONGA 2QWSA 3PR6A 1JWZA 5E2HA 2K31A 4JXWA 1BYWA 2WGVA 5GLAA 2JKTM 3BFEA 2EWVA 3HLWA 3IH9A 2DMWA 5LBRA 4OPQA 5CEBA 3MZEA 4ZBEA 2HP5A 2JKFA 3IF5A 4R6LA 1Q2QA 1SDNA 2Y2GA 5J8XA 2A24B 3DWKA 3GV9A 4PM8A 1X0OA 1LL5A 4LGWA 4PM9A 2INWA 4X1LA 3VSKA 3ISGA 5F82A 4HH2A 4FSFA 4HHDA 4R23A 1N4OA 1CI9A 2HV1A 4CPKA 4GD6A 5DTSA 3G32A 3PBTA 1FCMA 5AQAA 1YLJA 3IXDA 5EVIC 1MPLA 3MJQA 3RXWA 5F68A 2ZC6B 3OPHA 3VOZA 4LCLA 4BENA 3IS2B 3BFCA 2W0NA 1NLYA 2WKQA 5J4EA 3PHYA 1PWGA 1NY0A 3MQOA 1L0GA 4OPZA 4IBXA 3IWIA 2QJ5A 2PD7A 4BJPA 4Y7PA 1KOUA 3LGOA 1WYBA 1H8MA 4DJ2A 5EVIB 1UGUA 4I5SA 3ULFA 2E8IA 4P87A 2PYPA 5TR7A 4KQOA 5AQBA 2JN7A 2WGWA 1LL9A 2WKHA 3Q7ZA 1F5MA 4KZ3A 5GHZA 1OTEA 1BT5A 5HAQA 4MN6A 2XH9A 3TSGA 2JE5A 1ODVA 1ZG4A 5FI6A 3QP2A 1W63M 2ZQDA 2A2LA 4MNRA 3MKEA 1N9LA 3CHWP 3MQ0A 3V3SA 4DE3A 3I7JA 2VV8A 1S66L 2L4RA 3WRTA 3VFHA 3UPPA 1P9RA 1DJCA 4OP5A 1OMEA 1E3UA 1FSYA 4GHIA 1PI4A 2Z6CA 3G30A 2QYBA 3MXSA 1YMXA 3HUMA 3MFXA 2V2FF 4L9EA 4PHTA 1S4SA 2PBDP 4DRTA 3D4FA 3OCLA 1PWDA 3G34A 4ZJ1A 4CQHA 5F83A 3IF6C 3BY8A 1ESUA 5A93A 1V9YA 1IELA 2D01A 3LR0A 3NY4A 1GSXA 1PIOA 1NRJA 3UMEA 3LIDA 2V9AA 4JF6A 3BQAA 1K56A 4R4SA 3FV7A 3VOYA 3SH7A 2K2NA 4O0PA 4OQGA 1SKOB 3LR5A 3AGFA 3FPVA 2JKRM 3P7NA 3WS1A 1IOUA 3W4QA 2J8YA 4II7A 1M6KA 1P97A 2R78A 1OPXA 1K6SA 3IF6B 3S22A 1W5DA 1L2SA 3P09A 2PR6A 4P85A 2VK3A 1MBLA 1LSVA 3WS5A 2XSSA 3T4OA 1L0EA 4KQRA 3TG9A 3JYIA 1GHPA 4X53A 1FILA 1JVJA 1TS6A 3FWLA 3MBZA 2Y2LA 3RTYA 3GDIA 2QPNA 2VV6A 3QP1A 4I3IA 4EUVA 3V3RA 2OWJA 3CUEA 1EWZA 2JKTI 4X56A 1FCNA 1SHVA 2Y2MA 3ZHHA 4EWFA 4I3JA 1EW0A 1FOFA 2J3TC 1DRMA 2P9VB 1D06A 4NXEA 4KUKA 4KZ4A 4BBTA 2PR5A 2NUTC 1D1JA 2HDUA 4HBTA 4PKYA 1GSWA 5HAPA 3F1NA 1S0WA 3JVVA 4NK3A 3LY3A 1Z09A 2XFTA 2XQZA 3UDFA 3E0YA 4JGRA 1VHMA 4KENB 3HLFA 4WZ5C 2UWXA 1ZKJA 3VE3A 2Y2PA 5G18A 4X25A 1XXMA 4Y5FA 1K6RA 4S2IA 3QNBA 3UB5P 1PZOA 3UPOA 4FUWA 1I2SA 1F9IA 1OTAA 3FPWA 3C8CA 3S7QA 4EXOA 2ZOHA 1PFLA 1PW1A 3EGXC 4UQIS 1FSWA 2PRFA 5BOHA 3IH8A 4KZ5A 1ERQA 4QY5A 2A49A 5TFQA 2W3GA 3LYXA 3ITBA 4JGQA 1ESIA 4HEFA 3BECA 3BW6A 4ZJ3A 1NZUA 1BLPA 2EXAA 4Q0IA 1PYYA 4P6BA 4E6XA 1SKFA 1PZPA 3BWLA 5KIZA 5TBMA 3C4OA 3VOLA 5MC7A 4KG5A 3BQ8A 4OOMA 4OPYA 3Q1FA 4DE2A 1DY6A 2JC7A 3C30A 2AVXA 3G6OA 2ZOIA 5F1GA 3UPNA 3S7PA 1H5XA 2B18A 2W1TA 4FOFA 1F2KA 1H3QA 5KSCA 5FI2A 5K5BA 3QP4A 1XJ3A 2VGLS 3NC8A 1NLZA 2O9AA 2M7UA 1I2WA 3HL9A 4HI4A 4Z1WA 3E2LA 4E3IA 3IBRA 4EEUA 2WGWB 4RYEA 2ZC7A 4K0XA 5M19A 1CEGA 3D72A 4JF5A 2X01A 2Y2IA 3T4TA 1LI9A 3H7WA 3S4XA 2G2UA 5L8MA 4N9LA 5CGWA 2P04A 4G3KA 1U60A 1JNUA 3ZG5A 4IEDA 4EQ1A 5F6AA 4GDBA 3OC2A 2WAEA 3CITA 4Q8IA 4CLCA 1T18A 4JF4A 2JBFA 4GHIB 4GNUA 1NYMA 3R4KA 2W3FA 5M1AA 2ZMAA 3LIBA 3UB7A 3MR0A 2XD5A 1JTGA 3S1YA 4HJ3A 4HJ4A 5EVLA 1DP8A 1UWPX 1GA9A 5HL6A 1T1AA 3DAVA 5EM1A 2IWCA 3GRJA 3Q82A 4KUOA 5EM0A 3D9YA 2QKPA 4ZRRA 4F94A 1F98A 2PU2A 2WZXA 4WM9A 1LSWA 2VEAA 4Y13A 4JXSA 5KMWA 1FR1A 2P08A 3FG8A 3IX8A 3B3XA 2C6WB 3KYQA 2Y2OA 3FC7A 4PM7A 4LV3A 3MZDA 3WS2A 3A0RA 3GECA 3CUEC 3TRCA 2PU4A 3T4JA 5JYOA 5HSQA 2BTFP 2HZ5A 3U2AA 4GB7A 1ZHHB 2ZBBA 1XPBA 3UE6A 2FZ0A 2V0WA 2JCHA 1KVLA 1YQSA 5I5LA 5FATA 5G4YA 1HVBA 3UB9A 4UA7A 3O3VA 4GS9A 4ZDXA 3NIAA 4B88A 3T4KA 3MXQA 4P0MA 2EFXA 5AJGA 4WMCD 1Y28A 4JXVA 5DF7A 1XA1A 2HDRA 4S2LA 3IXBA 1YLYA 2QJ7A 4JGPA 3CG5A 3MS6A 4S2OA 3T4QA 3FYZA 5J3WA 2X02A 2OOLA 2XLNA 3SS4A 3GVBA 4GD8A 4E6WA 4G3WA 2K7SA 1LI0A 3VP1A 3NOPC 1XJ4A 2MJ6A 3NCKA 3OLOA 1Y4OA 2HP6A 4E3MA 2OAQ1 3CI6A 3F1NB 4MBHA 2M7VA 1PI5A 2YKFA 3ZVTA 2J7VA 3PBQA 5GL9A 1FCOA 4E3LA 4DE1A 5HD5A 1IYSA 1A0KA 2L0WA 1DP6A 1K0KA 4Y2FA 2W3DA 5GLCA 1H8ZA 3JPUA 4MBFA 2XF3A 4R4RA 3G2ZA 5DF8A 3CWFA 4GKUA 1CI8A 1WYCA 3Q07A 2OSUA 4ID4A 1G28A 3N7WA 5EVID 1XGJA 5FQMA 4FD8A 2GJ3A 2H5SA 1GSVA 3BLMA 5FEFA 4DDYA 2Y2NA 1H0MA 1G68A 1ES2A 3EOIA 1K54C 1MKMA 3BYDA 3IHBA 2Q9NA 1AWIA 3PXPA 3UY6A 4O7DA 5TBMB 3LFVA 3HJIA 4LV0A 1XX2A 2ZC3B 1MKIA 5GLDA 3G35A 1TS8A 2VV7A 4A5RA 4FH2A 5CX7A 2WKIA 4OPRA 2ZLYA 1KGGA 1IEMA 1K55A 4NETA 3T50A 3KSHA 4JGOA 2IWDA 4UQIM 4CLCC 1VEUB 3BY9A 3RXXA 2PT7A 3LIFA 1H8YA 2RCXA 2Y2JA 3PYPA 2W3EA 4GCZA 2ZL1B 3ITAA 4JBFA 4QWOA 1IKGA 2BG1A 3SOIA 4LRZE 1BTLA 1ES5A 1XJ6A 4S2PA 3NJAA 4KZ9A 4WL9A 4BD1A 1K4FA 3H7WB 1N9NA 4GN2A 4XUZA 2HJ9C 2XK1A 3IWQA 3E98A 3VMAA 1DJBA 2G7UA 1AXBA 3MF0A 1YMSA 2VX8A 3SH9A 4DJ3A 4X68A 4CLCB 3MKFA 1ACFA 3HVFA 1UWNX 5G4ZA 1CQAA 5HDSA 4MN7A 2VGLM 2KOIA 1YSQA 4ETXA 1L3LA 4D60A 4HJ6A 4IVIA 3JVUA 1YT4A 1MWTA 3DTKA 4MMNA 2ZQ8A 4EBPA
chains in the Genus database with same CATH topology
3VE4A 2KDKA 3EGDC 2W3GA 3LYXA 4HNBA 2IA2A 4NEED 4JGQA 5DFYA 2Y8HA 4PAUA 1YKDA 2XRNA 4UEYA 3RH8B 4HP4A 4WUJA 3BW6A 4LRXC 3K3CA 4Q0IA 4HIAA 2VLGA 3MQQA 4GW9A 1XFNA 3LR4A 3R7WB 3BWLA 5A8BA 3B42A 5KIZA 5TBMA 3R7WA 3VOLA 5MC7A 2EA9A 3BQ8A 4H6JA 3O5YA 4OOMA 1OT6A 4NXFA 3EQVA 4XT2B 1N9OA 3B33A 3HCYA 2LB9A 3LIAA 1OT9A 3CLOA 3P01A 5DFXA 2J80A 3LR3A 4IJGA 4KQDA 4HOIA 2PD8A 3NOUC 4RQ9A 3C30A 1D7EA 4DN0A 3KYZA 3G6OA 2W1TB 2ZOIA 4NKPA 3TW8A 3S7PA 4EW7A 3DBAA 1WA9A 2B18A 2WKRA 4GS9B 2W1TA 4FOFA 3KSGA 1H3QA 3ZYTA 4CLCD 3NHQA 3LUQA 3E4OA 4YWZA 5K5BA 1XJ3A 2OAP1 2VGLS 1TD5A 1NLZA 2O9AA 3KSFA 3PBOA 2GX5A 4EERA 1NWZA 3EEHA 2M7UA 1ZTUA 4P6ZM 4HI4A 4WEJA 2V1BA 4Z1WA 4EU0A 2QWSA 3IBRA 4E04A 4EEUA 2KLIA 3PR6A 2K31A 2ZMVA 2J3TD 1BYWA 2VKSA 5KSHA 3D72A 2JKTM 3NOTC 3T4TA 4CLCE 2PDRA 3H7WA 4L9FA 4HP9A 5L8MA 1LT0A 2EWVA 4DMZA 2P04A 5IS1A 5F69A 2DMWA 5HDCA 1S1YA 4G3KA 1T1BA 4NXBA 5LBRA 1JNUA 1OTDA 4EQ1A 5HWVA 5F6AA 4R6LA 3OC2A 4WLAA 3CITA 3E4QA 1YSPA 4CLCA 2O99A 1V9ZA 4Q0HA 1T18A 3F1PB 2A24B 4R70A 4GHIB 3RFBA 1TF1A 3PBNA 3OOVA 1X0OA 3R4KA 2INWA 2W3FA 3LIBA 3UB7A 3W2ZA 4ARZA 3MR0A 4HH2A 5HZHA 4FSFA 4HHDA 2BASA 4F3LA 4HJ3A 4LLOB 4HJ4A 1DP8A 1UWPX 2HV1A 3ZQ5A 5HWWA 5HL6A 1T1AA 3LI8A 3PBTA 4KUOA 3H9WA 5HPFA 5DF9A 2J3WA 2QKPA 4ZRRA 1F98A 4HH3A 5DJUA 1LSWA 2VEAA 2QHKA 3PBSA 4HQAA 3MJQA 3H82B 3K3DA 4IHQA 4MN5A 5F68A 2P08A 3FG8A 4NXGA 3KYQA 4M4XA 2L1MA 3FC7A 3IS2B 2W0NA 1NLYA 4I39A 2WKQA 3BJNA 3IS2A 5J4EA 3A0RA 3PHYA 2OWHA 3GECA 4G3VA 3CUEC 3TRCA 2XROA 1S1ZA 4XT2A 3T4JA 2PHYA 3MQOA 4IUHA 4B9OA 2HGVA 3UE3A 5HSQA 3U2AA 4OOLA 4HY8A 2QJ5A 1ZHHB 3KO6A 2ZBBA 3UE6A 2FZ0A 5DKKA 2PD7A 2YKHA 2V0WA 4BJPA 5I5LA 5G4YA 2XA7S 1KOUA 3UB9A 2JHEA 4GS9A 2W3HA 3F1OB 2W1RA 3T4KA 3MXQA 4I3AA 1H8MA 4DJ2A 2Y79A 1UGUA 5AJGA 1Y28A 4I5SA 3ULFA 3IBJA 2PYPA 4KQOA 3PBRA 2JN7A 2QJ7A 4JGPA 4Q0JA 3VV4A 4BMWA 3S7OA 3OCNA 3T4QA 1F5MA 5J3WA 2OOLA 1OTEA 4MN6A 4EESA 1ODVA 4WF0A 1W63M 3LIEA 4G3WA 2A2LA 2K7SA 1P0ZA 1N9LA 3NOPC 4MCWA 3MQ0A 4BBUA 1XJ4A 4EETB 2MJ6A 3OLOA 2B02A 2VV8A 1S66L 2L4RA 3KSIA 2OAQ1 3CI6A 1P9RA 3F1PA 3F1NB 2M7VA 2A24A 2O9BA 1VB6A 2Z6CA 2KX6A 2YKFA 4GHIA 4WEKA 2EWWA 5DKLA 3A0VA 3PBQA 2QYBA 3MFXA 5HD5A 4L9EA 4PHTA 1S4SA 3LI9A 3OCLA 2ZMFA 4CQHA 2L0WA 1S4RA 1DP6A 3EEAA 4Y2FA 2W3DA 4L0LA 3BY8A 3OBFA 2V0UA 1V9YA 2D01A 1MC0A 4YOFA 4B93A 1LL8A 3LR0A 3CWFA 4LPZA 2VA0A 2O9CA 4P6ZS 4R38A 1GSXA 3S7NA 1NRJA 4EEPA 3UMEA 1G28A 3LIDA 1G6OA 2V9AA 3BQAA 2JKRI 5HD3A 1OTBA 2GJ3A 2K2NA 4O0PA 4K08A 1GSVA 3H82A 1XFQA 3LR5A 3FPVA 2JKRM 3P7NA 4MDZA 3EOIA 1IOUA 2HJEA 5IT5A 1MKMA 3CAXA 3ICYA 4II7A 1P97A 2R78A 3V67A 1OPXA 2O0YA 3PXPA 5TBMB 4Y3IA 4WN5A 3LFVA 3HJIA 3T4SA 3T4LA 4L9GA 4H6JB 4IUKA 1OTIA 2PR6A 1TS8A 2VV7A 3B47A 5AVFA 2P7JA 5C5KA 5CX7A 1LSVA 1TS7A 4YNRA 3F1OA 2XSSA 3T4OA 5FL3A 1LSXA 4ME4A 5F5YA 2D02A 3MMHA 2VJWA 2M1CA 3T50A 4ETZA 1TS6A 3KSHA 4JGOA 2CMNA 3LICA 4UQIM 4CLCC 3UB8A 1XJ2A 3BY9A 2WKPA 1IFQA 3TJZC 3RTYA 2PT7A 3GDIA 2GZAA 3LIFA 2V1AA 1OJGA 2VV6A 4O8GA 3SW1A 4GLQA 1STZA 3PYPA 2W3EA 4GCZA 2FH5A 4I3IA 5TJJA 4EUVA 2OWJA 3CUEA 2W27A 3K2NA 2JKTI 1TS0A 4LRZE 1XJ6A 3EWKA 3EQUA 4I3JA 3A0SA 1EW0A 3NJAA 2J3TC 4R3AA 1DRMA 4WL9A 1D06A 4NXEA 1S67L 4KUKA 3TE8A 1YAXA 3H7WB 2Z6DA 5HDDA 1N9NA 2HF6A 4BBTA 3D3OA 2PR5A 2GNXA 3C38A 2HJ9C 2NUTC 3E98A 1T19A 2G7UA 3E4PA 3MF0A 1T1CA 4PKYA 4QPRA 4I38A 1GSWA 3F1NA 3JVVA 4GJ4A 2VX8A 4DJ3A 1W63Q 4CLCB 5J7EA 3UMDA 2LB5A 3UB6A 3E0YA 3C2WA 1VHMA 4JGRA 1P9WA 3KX0X 2XA7M 3VE3A 1UWNX 5G4ZA 5HDSA 4Y5FA 5DJTA 4MN7A 2VGLM 4LRYC 2KOIA 1YSQA 1MZUA 2I9VA 4PKYG 5IU1A 4AFIA 4ETXA 1F9IA 5AVEA 4ARZB 2NUPC 1OTAA 3FPWA 3HJKA 3C8CA 5EFWA 2PYRA 5HPIA 4HJ6A 4WELA 4F3LB 2H28A 3S7QA 4BWIA 4EXOA 1OJ5A 2ZOHA 4BBVA 3EGXC 3JVUA 4UQIS 1DP9A 4MMNA 4O01A 2VZWA 5HWTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VE4 A;  2KDK A;  3LYX A;  4HNB A;  4JGQ A;  3RH8 B;  4HP4 A;  4WUJ A;  4LRX C;  3K3C A;  4HIA A;  2VLG A;  3MQQ A;  4GW9 A;  1XFN A;  3BWL A;  5A8B A;  5KIZ A;  5TBM A;  3VOL A;  2EA9 A;  4H6J A;  1OT6 A;  4NXF A;  4XT2 B;  1N9O A;  3B33 A;  3LIA A;  1OT9 A;  3CLO A;  2J80 A;  4KQD A;  4HOI A;  2PD8 A;  3NOU C;  4RQ9 A;  1D7E A;  3G6O A;  2ZOI A;  4EW7 A;  1WA9 A;  2WKR A;  4GS9 B;  3NHQ A;  3LUQ A;  3E4O A;  4YWZ A;  1XJ3 A;  4EER A;  1NWZ A;  3EEH A;  4HI4 A;  2V1B A;  2QWS A;  3IBR A;  4E04 A;  4EEU A;  1BYW A;  3D72 A;  3NOT C;  2PDR A;  3H7W A;  4L9F A;  4HP9 A;  1LT0 A;  5IS1 A;  5F69 A;  5HDC A;  1S1Y A;  1T1B A;  4NXB A;  1JNU A;  1OTD A;  4EQ1 A;  5HWV A;  5F6A A;  4R6L A;  4WLA A;  3E4Q A;  1V9Z A;  1T18 A;  3F1P B;  2A24 B;  4R70 A;  4GHI B;  1X0O A;  2INW A;  3LIB A;  3UB7 A;  3MR0 A;  4HH2 A;  5HZH A;  4HHD A;  2BAS A;  4F3L A;  4HJ3 A;  4LLO B;  4HJ4 A;  1DP8 A;  1UWP X;  2HV1 A;  3ZQ5 A;  5HWW A;  1T1A A;  3LI8 A;  4KUO A;  3H9W A;  2QKP A;  1F98 A;  4HH3 A;  5DJU A;  1LSW A;  2VEA A;  2QHK A;  4HQA A;  3MJQ A;  3H82 B;  3K3D A;  5F68 A;  4MN5 A;  3FG8 A;  4NXG A;  4M4X A;  2L1M A;  3FC7 A;  3IS2 B;  2W0N A;  4I39 A;  2WKQ A;  3IS2 A;  5J4E A;  3A0R A;  3PHY A;  2OWH A;  3GEC A;  1S1Z A;  4XT2 A;  2PHY A;  3MQO A;  4B9O A;  5HSQ A;  4HY8 A;  2QJ5 A;  2ZBB A;  3UE6 A;  5DKK A;  2PD7 A;  2YKH A;  2V0W A;  5I5L A;  5G4Y A;  1KOU A;  3UB9 A;  2JHE A;  4GS9 A;  3F1O B;  3MXQ A;  4I3A A;  4DJ2 A;  1UGU A;  1Y28 A;  4I5S A;  3ULF A;  2PYP A;  2JN7 A;  2QJ7 A;  4JGP A;  5J3W A;  2OOL A;  1OTE A;  4MN6 A;  4EES A;  1ODV A;  4WF0 A;  3LIE A;  2K7S A;  1P0Z A;  1N9L A;  3NOP C;  4BBU A;  1XJ4 A;  4EET B;  3OLO A;  2B02 A;  2VV8 A;  1S66 L;  2L4R A;  3F1P A;  3F1N B;  2A24 A;  1VB6 A;  2Z6C A;  2KX6 A;  2YKF A;  4GHI A;  5DKL A;  3A0V A;  3MFX A;  5HD5 A;  4L9E A;  1S4S A;  3LI9 A;  2L0W A;  1S4R A;  1DP6 A;  3BY8 A;  2V0U A;  1V9Y A;  2D01 A;  1LL8 A;  3CWF A;  4LPZ A;  4R38 A;  1GSX A;  4EEP A;  3UME A;  1G28 A;  3LID A;  2V9A A;  5HD3 A;  1OTB A;  2GJ3 A;  4K08 A;  1GSV A;  3H82 A;  1XFQ A;  3P7N A;  3CAX A;  3ICY A;  1P97 A;  2R78 A;  5TBM B;  4WN5 A;  3HJI A;  4L9G A;  4H6J B;  1OTI A;  2PR6 A;  1TS8 A;  2VV7 A;  5AVF A;  2P7J A;  1LSV A;  1TS7 A;  3F1O A;  1LSX A;  5F5Y A;  2D02 A;  2M1C A;  3T50 A;  1TS6 A;  4JGO A;  2CMN A;  3LIC A;  3UB8 A;  1XJ2 A;  3BY9 A;  2WKP A;  3RTY A;  3GDI A;  3LIF A;  2V1A A;  1OJG A;  2VV6 A;  3SW1 A;  3PYP A;  4GCZ A;  4I3I A;  2OWJ A;  2W27 A;  1TS0 A;  4LRZ E;  1XJ6 A;  3EWK A;  4I3J A;  3A0S A;  1EW0 A;  3NJA A;  4R3A A;  1DRM A;  4WL9 A;  1D06 A;  4NXE A;  1S67 L;  4KUK A;  3H7W B;  2Z6D A;  5HDD A;  1N9N A;  4BBT A;  2PR5 A;  1T19 A;  3E4P A;  1T1C A;  4PKY A;  4I38 A;  1GSW A;  3F1N A;  4DJ3 A;  5J7E A;  3UMD A;  3UB6 A;  4JGR A;  3C2W A;  3KX0 X;  3VE3 A;  1UWN X;  5G4Z A;  5HDS A;  5DJT A;  4LRY C;  1MZU A;  2I9V A;  4PKY G;  5IU1 A;  1F9I A;  5AVE A;  1OTA A;  3HJK A;  5EFW A;  3C8C A;  2PYR A;  4HJ6 A;  4F3L B;  2H28 A;  4EXO A;  1OJ5 A;  2ZOH A;  4BBV A;  1DP9 A;  5HWT A; 
#chains in the Genus database with same CATH topology
 3VE4 A;  4U3T A;  3EGD C;  2IA2 A;  1C3B A;  2Y8H A;  4PM5 A;  1IYO A;  2XRN A;  4HP4 A;  4S2N C;  4WUJ A;  3K3C A;  3ZNY A;  5F1F A;  4GW9 A;  1XFN A;  4Y15 A;  5A8B A;  1CEF A;  2ZJ9 A;  3R7W A;  2I72 A;  2EA9 A;  3O5Y A;  4X69 A;  3HLE A;  3B33 A;  4XXR A;  2V1Z A;  3CLO A;  3P01 A;  2J80 A;  4IJG A;  4HOI A;  2Y2Q A;  4KZ8 A;  1D7E A;  4E3J A;  2ZQ7 A;  4EW7 A;  4LCM A;  2WKR A;  4GS9 B;  3LCE A;  5CHJ A;  4ZTK A;  3NHQ A;  3CMZ A;  4YWZ A;  3M6B A;  1FQG A;  3KSF A;  3PBO A;  2GX5 A;  4EER A;  3O87 A;  4HES A;  3EEH A;  2DNS A;  2HP9 A;  5CXW A;  2X71 A;  2E8J A;  3BLS A;  3GTC A;  3VP2 A;  4E04 A;  3WRZ A;  2J3T D;  3M2J A;  1W7F A;  1BZA A;  4RX2 A;  1O7E A;  3IX3 A;  1LHY A;  2EXB A;  5L2F A;  4CLC E;  4L9F A;  4HP9 A;  4BL2 A;  1LT0 A;  4C75 A;  1EI5 A;  5IS1 A;  3T1R A;  5TGF A;  5HDC A;  3HLC A;  1T1B A;  2C5W B;  4E3K A;  2JKG A;  2ZQ9 A;  4MBK A;  1YSP A;  4Q0H A;  3GSG A;  5EUA A;  2G2W A;  2XGN A;  1KVM A;  2ZC5 B;  4X55 A;  5I94 A;  4KG6 A;  3OPP A;  4FCF A;  5FEG A;  1KE4 A;  4WMC A;  3N8R A;  3W2Z A;  4ARZ A;  5HZH A;  3A3F A;  5FQI A;  3AGE A;  3ZQ5 A;  5HWW A;  3N8L A;  3VP0 A;  4Y17 A;  3H9W A;  1MY8 A;  4OQ0 A;  3HLG A;  4HH3 A;  1K55 C;  4H8R A;  1K4E A;  4JXG A;  3TOI A;  2QHK A;  3PBS A;  4HQA A;  4B4Z A;  3K3D A;  4MN5 A;  1K38 A;  1NXY A;  2FFY A;  2H0T A;  2L1M A;  5FDS A;  4I39 A;  3BJN A;  3IS2 A;  4DE0 A;  2OWH A;  4G3V A;  1BLS A;  2Q9M A;  3BEB A;  1S1Z A;  3G31 A;  1ONH A;  2ZM2 A;  1RCJ A;  2HGV A;  3UE3 A;  1G6A A;  2XD1 A;  3ZCZ A;  1G5U A;  3BFG A;  4DDS A;  5CRF A;  1ES4 A;  4X6T A;  3LO7 A;  1NYY A;  4Y0O A;  3ZG9 B;  3DWZ A;  2W3H A;  5EOO A;  3C7U A;  5FQQ A;  1E3U D;  1J9M A;  4S2J A;  1L0D A;  3QNC A;  4KZ6 A;  1TEM A;  3IBJ A;  1GHI A;  3WS4 A;  5CEC A;  3C4P A;  4C6Y A;  4UA6 A;  1K25 A;  1LLB A;  5L07 A;  4BMW A;  4OLG A;  3CPT A;  1SDE A;  3UDI A;  4GZB A;  4FH4 A;  5FQJ A;  4BL3 A;  4EUZ A;  3LIE A;  3IXG A;  5A90 A;  2IWB A;  4LV2 A;  4MCW A;  4BBU A;  3O86 A;  1VET A;  2Y91 A;  4EET B;  3IXH A;  1BUL A;  4RA7 A;  3KSI A;  3DW0 A;  3F1P A;  3C5A A;  3LEZ A;  2O9B A;  2ZD8 A;  4WEK A;  2EWW A;  3A0V A;  3GR2 A;  2QZ6 A;  3QP5 A;  4WYY A;  2ZMF A;  5A91 A;  2XFS A;  2V8F A;  1HD8 A;  4JLF A;  4L0L A;  3FKV A;  4B93 A;  4LPZ A;  2H0Y A;  3MFD A;  3IT9 A;  1KDS A;  1G6O A;  4N9K A;  2JKR I;  5HD3 A;  5AQ7 A;  4IBR A;  1OTB A;  2Y2K A;  2WAD A;  1N9B A;  3H82 A;  2OLV A;  1MXO A;  1TDL A;  2ACG A;  2V8C A;  1XFQ A;  1PNE A;  2WUQ A;  4C3Q A;  4WZ4 A;  2WKE A;  1YLT A;  4MDZ A;  3PAE A;  2WZZ A;  3L7H A;  5IT5 A;  5HX9 A;  3CAX A;  3C7V A;  2BLS A;  3V67 A;  3DTE A;  3VP4 A;  3G4P A;  4Y3I A;  5CGS A;  4WN5 A;  3T4S A;  3UNW A;  4L9G A;  1IYP A;  1VM1 A;  3ZDJ A;  3IF6 A;  1FR6 A;  3M6H A;  5HAI A;  4QU3 A;  3B47 A;  2P7J A;  5C5K A;  1TS7 A;  3F1O A;  1BLH A;  4KZ7 A;  5FQ9 A;  4ME4 A;  5F5Y A;  1L0F A;  5L09 A;  2D02 A;  2VJW A;  2FFF B;  4ETZ A;  1W79 A;  4OOY A;  3Q81 A;  2CMN A;  3LIC A;  2VGJ A;  3HBR A;  3MXR A;  1XJ2 A;  2WKP A;  1IFQ A;  4LV1 A;  3TJZ C;  1XP4 A;  4KG2 A;  2V1A A;  4HBU A;  3MSH A;  1KE3 A;  5FAO A;  3SW1 A;  4GLQ A;  1STZ A;  2FH5 A;  4RVA A;  2OLU A;  3VSL A;  1XA7 A;  5M18 A;  3A3J A;  3V5M A;  1HLU P;  4GOG A;  4R3A A;  5E43 A;  3NDG A;  1S67 L;  1YAX A;  4OON A;  2P9V A;  4LFU A;  4DXC A;  2WK0 A;  3NDE A;  1GCE A;  1NJ4 A;  3WWX A;  4UHU A;  1T19 A;  3N8S A;  4OVD A;  1CF0 A;  1ERM A;  3E4P A;  1GA0 A;  4QPR A;  4PPR A;  4KQQ A;  1CK3 A;  5J7E A;  3UB6 A;  1P9W A;  2XA7 M;  3A3E A;  2Q0O A;  4JPM A;  1MZU A;  4PKY G;  5IU1 A;  4AFI A;  3UE1 A;  4DKI A;  2Y59 A;  4ARZ B;  2NUP C;  3GQZ A;  1ZG6 A;  1XGI A;  4WEL A;  4BWI A;  5HAR A;  1OJ5 A;  3RJU A;  1DP9 A;  2R9X A;  2J9P A;  3KYE A;  5HWT A;  2KDK A;  4HNB A;  3T1X A;  5DFY A;  1YKD A;  2Y4A A;  2EX2 A;  3RH8 B;  4LRX C;  1RGY A;  2VLG A;  3MQQ A;  3QHY A;  3LR4 A;  3B42 A;  1KGE A;  4WZ5 A;  5AQ9 A;  1YLZ A;  2DRW A;  4H6J A;  5JYP A;  1OT6 A;  1N9O A;  3SH8 A;  3HCY A;  5CHU A;  2LB9 A;  1OT9 A;  3A3D A;  5DFX A;  4KQD A;  2PD8 A;  3CJM A;  2XDM A;  3NOU C;  4RQ9 A;  4OP8 A;  4DN0 A;  1JTD A;  2W1T B;  4NKP A;  5FDH A;  1WA9 A;  1RGZ A;  4UAA A;  3KSG A;  3ZYT A;  1TVF A;  4CLC D;  3LUQ A;  4KZB A;  5GLB A;  1TD5 A;  5GHX A;  1NWZ A;  1ZTU A;  4P6Z M;  1KE0 A;  3ZFZ A;  2A3U A;  1MWS A;  3LEQ A;  5CHM A;  2KLI A;  4XUX A;  3PAG A;  2ZMV A;  3M2K A;  2VKS A;  3FKW A;  5KSH A;  3W4O A;  3HUN A;  4D2O A;  3CPT B;  5IHV A;  3NOT C;  5CTM A;  3AGD A;  1QME A;  2PDR A;  5FI7 A;  3ZG7 B;  3NI9 A;  5GHY A;  4DMZ A;  1YLP A;  4QY6 A;  2WYX A;  4S2M A;  5F69 A;  3IHA A;  1BUE A;  1S1Y A;  4NXB A;  2ZC4 B;  5EEC A;  4Z9Q A;  2WAF A;  3G2Y A;  1VET B;  3T1Q B;  1OTD A;  5HWV A;  2XR0 A;  4WLA A;  3E4Q A;  2EX8 A;  1V9Z A;  2O99 A;  3ZNT A;  3F1P B;  4N1H A;  4R70 A;  3RFB A;  1TF1 A;  3PBN A;  3OOV A;  3IX4 A;  2Z2M B;  1S6R A;  3A3I A;  1IKI A;  5A92 A;  2H10 A;  4IVK A;  4R3B A;  4BLM A;  2BAS A;  4F3L A;  4OQH A;  4LLO B;  3P98 A;  5EVE A;  4UA9 A;  4R3J A;  3LI8 A;  3W8K A;  5HPF A;  5DF9 A;  2EFU A;  1O07 A;  2J3W A;  2QMI A;  5EV0 A;  5DJU A;  4R0Q A;  3UN7 A;  4BD0 A;  3H82 B;  4MEZ A;  3DTI A;  3SS3 A;  4IHQ A;  5EE8 A;  4NXG A;  3N6I A;  4M4X A;  2HPB A;  3IQA A;  4K0W A;  4QHC A;  3LY4 A;  5FAS A;  2HDQ A;  1JWV A;  4E3O A;  5HW3 A;  2XRO A;  4XT2 A;  2PHY A;  4IUH A;  4B9O A;  3BRM A;  4OOL A;  4HY8 A;  3KO6 A;  5E2G A;  5DKK A;  2YKH A;  4KZA A;  4DXB A;  2XA7 S;  2JHE A;  3Q7V A;  3F1O B;  2W1R A;  4R1G A;  4OLD A;  4DF6 A;  3GMW A;  4I3A A;  4PM6 A;  2Y79 A;  5L10 A;  3WS0 A;  3BM6 A;  1JWP A;  3NBL A;  2EX9 A;  3SZT A;  1HTZ A;  3PBR A;  5CGX A;  1VQQ A;  3V50 A;  1CJF A;  4S2K A;  4K91 A;  4Q0J A;  3VV4 A;  2EX6 A;  1PWC A;  3S7O A;  3OCN A;  3N4I A;  3L9K A;  2CC1 A;  2UV0 E;  2OV5 A;  1Q2P A;  2WGI A;  4ZAM A;  1TDG A;  4EES A;  4WF0 A;  3ZG0 A;  5FAP A;  1P0Z A;  5KZH A;  1K57 A;  2R9W A;  1MWR A;  2V20 A;  4X1M A;  1XKZ A;  3HLB A;  2B02 A;  1YLW A;  2A24 A;  1VB6 A;  2KX6 A;  4U0X A;  4EQI A;  5DKL A;  5HL1 A;  1SZV A;  5DTK A;  3LI9 A;  3HLD A;  4N92 A;  1GHM A;  1S4R A;  5HFO A;  3EEA A;  3HUO A;  3DTM A;  2DCF A;  3OBF A;  2XEP A;  2V0U A;  1BLC A;  1KGF A;  1MC0 A;  4YOF A;  4E3N A;  1LL8 A;  2VA0 A;  2O9C A;  4P6Z S;  4R38 A;  4OKP A;  3S7N A;  2VGK A;  4EEP A;  4NG2 A;  3OPL A;  1RP5 A;  1NZO A;  1W8Y A;  4EBL A;  4EBN A;  4K08 A;  2PAV P;  1Y54 A;  2B95 A;  4ZJ2 A;  5DVA A;  2ZQA A;  1Z6F A;  2HJE A;  1IYQ A;  3ICY A;  2O0Y A;  2Y2H A;  3T4L A;  1BSG A;  1W8Q A;  4H6J B;  4IUK A;  1OTI A;  1QMF A;  5CTN A;  1E4D A;  3IWO A;  5AVF A;  5CER A;  4OQI A;  4M3K A;  4YNR A;  3QP8 A;  5FL3 A;  1LSX A;  5DTT A;  3MMH A;  2M1C A;  3ZGA B;  5EVI A;  5FSR A;  2GDN A;  4QD4 A;  4GDN A;  3UB8 A;  1HZO A;  4B4X A;  4EV4 A;  1VEU A;  2GZA A;  2Y55 A;  1OJG A;  4O8G A;  2PBY A;  4QB8 A;  3T1S A;  5U47 A;  5TJJ A;  1K54 A;  2RL3 A;  2W27 A;  3K2N A;  2ZL1 A;  1WE4 A;  1TS0 A;  3QP6 A;  1YM1 A;  3EWK A;  3EQU A;  3MZF A;  5CED A;  3A0S A;  1K56 D;  3UE0 A;  2HDS A;  4BQM A;  3TE8 A;  2Z6D A;  5HDD A;  2HF6 A;  3D3O A;  2GNX A;  3BFD A;  4WBG A;  1SCW A;  3C38 A;  4YIN A;  3ZVW A;  1DJA A;  1T1C A;  4JKT A;  4I38 A;  5EPH A;  4OH0 A;  5E2F A;  4GJ4 A;  1YPR A;  4MLL A;  3T12 B;  1W63 Q;  3UMD A;  2LB5 A;  3C2W A;  3NEC A;  3KX0 X;  3CZD A;  5DJT A;  4FTX A;  4LRY C;  2I9V A;  4N1X A;  4PMA A;  2J9O A;  5AVE A;  3HRE A;  3HJK A;  5EFW A;  5FA7 A;  5HPI A;  2PYR A;  4LEN A;  4F3L B;  2H28 A;  1ES3 A;  4BBV A;  1E25 A;  2Z2L B;  1FIK A;  5D3O A;  1PRQ A;  4O01 A;  2VZW A;  4CJN A;  1I5Q A;  3V39 A;  3UDX A;  1J3W A;  1ERO A;  1SKO A;  1PW8 A;  4NEE D;  1MWU A;  4PAU A;  4QJG A;  4YFM A;  3NUL A;  4UEY A;  3UO9 A;  4HIA A;  5FAQ A;  3E2K A;  5EOE A;  3R7W B;  4Y0T A;  3SS5 A;  3OZH A;  2ZM8 A;  1ALQ A;  3OPR A;  4NXF A;  1KDW A;  3EQV A;  4XT2 B;  2ZQC A;  2B5R A;  3LIA A;  4ESP A;  3W4P A;  3LR3 A;  3VFF A;  3VP3 A;  3BFF A;  3KYZ A;  4Y0U A;  3TW8 A;  1NRF A;  3FZC A;  3ZG8 B;  1K57 C;  3DBA A;  2ZM0 A;  5E2E A;  3Q7V B;  3E4O A;  2P74 A;  3O88 A;  2OAP 1;  4U0T A;  1M40 A;  1ZC2 A;  5FQK A;  3U4L P;  3PTE A;  4RX3 A;  4WEJ A;  2V1B A;  4S2N A;  4EU0 A;  1ONG A;  2QWS A;  3PR6 A;  1JWZ A;  5E2H A;  2K31 A;  4JXW A;  1BYW A;  2WGV A;  5GLA A;  2JKT M;  3BFE A;  2EWV A;  3HLW A;  3IH9 A;  2DMW A;  5LBR A;  4OPQ A;  5CEB A;  3MZE A;  4ZBE A;  2HP5 A;  2JKF A;  3IF5 A;  4R6L A;  1Q2Q A;  1SDN A;  2Y2G A;  5J8X A;  2A24 B;  3DWK A;  3GV9 A;  4PM8 A;  1X0O A;  1LL5 A;  4LGW A;  4PM9 A;  2INW A;  4X1L A;  3VSK A;  3ISG A;  5F82 A;  4HH2 A;  4FSF A;  4HHD A;  4R23 A;  1N4O A;  1CI9 A;  2HV1 A;  4CPK A;  4GD6 A;  5DTS A;  3G32 A;  3PBT A;  1FCM A;  5AQA A;  1YLJ A;  3IXD A;  5EVI C;  1MPL A;  3MJQ A;  3RXW A;  5F68 A;  2ZC6 B;  3OPH A;  3VOZ A;  4LCL A;  4BEN A;  3IS2 B;  3BFC A;  2W0N A;  1NLY A;  2WKQ A;  5J4E A;  3PHY A;  1PWG A;  1NY0 A;  3MQO A;  1L0G A;  4OPZ A;  4IBX A;  3IWI A;  2QJ5 A;  2PD7 A;  4BJP A;  4Y7P A;  1KOU A;  3LGO A;  1WYB A;  1H8M A;  4DJ2 A;  5EVI B;  1UGU A;  4I5S A;  3ULF A;  2E8I A;  4P87 A;  2PYP A;  5TR7 A;  4KQO A;  5AQB A;  2JN7 A;  2WGW A;  1LL9 A;  2WKH A;  3Q7Z A;  1F5M A;  4KZ3 A;  5GHZ A;  1OTE A;  1BT5 A;  5HAQ A;  4MN6 A;  2XH9 A;  3TSG A;  2JE5 A;  1ODV A;  1ZG4 A;  5FI6 A;  3QP2 A;  1W63 M;  2ZQD A;  2A2L A;  4MNR A;  3MKE A;  1N9L A;  3CHW P;  3MQ0 A;  3V3S A;  4DE3 A;  3I7J A;  2VV8 A;  1S66 L;  2L4R A;  3WRT A;  3VFH A;  3UPP A;  1P9R A;  1DJC A;  4OP5 A;  1OME A;  1E3U A;  1FSY A;  4GHI A;  1PI4 A;  2Z6C A;  3G30 A;  2QYB A;  3MXS A;  1YMX A;  3HUM A;  3MFX A;  2V2F F;  4L9E A;  4PHT A;  1S4S A;  2PBD P;  4DRT A;  3D4F A;  3OCL A;  1PWD A;  3G34 A;  4ZJ1 A;  4CQH A;  5F83 A;  3IF6 C;  3BY8 A;  1ESU A;  5A93 A;  1V9Y A;  1IEL A;  2D01 A;  3LR0 A;  3NY4 A;  1GSX A;  1PIO A;  1NRJ A;  3UME A;  3LID A;  2V9A A;  4JF6 A;  3BQA A;  1K56 A;  4R4S A;  3FV7 A;  3VOY A;  3SH7 A;  2K2N A;  4O0P A;  4OQG A;  1SKO B;  3LR5 A;  3AGF A;  3FPV A;  2JKR M;  3P7N A;  3WS1 A;  1IOU A;  3W4Q A;  2J8Y A;  4II7 A;  1M6K A;  1P97 A;  2R78 A;  1OPX A;  1K6S A;  3IF6 B;  3S22 A;  1W5D A;  1L2S A;  3P09 A;  2PR6 A;  4P85 A;  2VK3 A;  1MBL A;  1LSV A;  3WS5 A;  2XSS A;  3T4O A;  1L0E A;  4KQR A;  3TG9 A;  3JYI A;  1GHP A;  4X53 A;  1FIL A;  1JVJ A;  1TS6 A;  3FWL A;  3MBZ A;  2Y2L A;  3RTY A;  3GDI A;  2QPN A;  2VV6 A;  3QP1 A;  4I3I A;  4EUV A;  3V3R A;  2OWJ A;  3CUE A;  1EWZ A;  2JKT I;  4X56 A;  1FCN A;  1SHV A;  2Y2M A;  3ZHH A;  4EWF A;  4I3J A;  1EW0 A;  1FOF A;  2J3T C;  1DRM A;  2P9V B;  1D06 A;  4NXE A;  4KUK A;  4KZ4 A;  4BBT A;  2PR5 A;  2NUT C;  1D1J A;  2HDU A;  4HBT A;  4PKY A;  1GSW A;  5HAP A;  3F1N A;  1S0W A;  3JVV A;  4NK3 A;  3LY3 A;  1Z09 A;  2XFT A;  2XQZ A;  3UDF A;  3E0Y A;  4JGR A;  1VHM A;  4KEN B;  3HLF A;  4WZ5 C;  2UWX A;  1ZKJ A;  3VE3 A;  2Y2P A;  5G18 A;  4X25 A;  1XXM A;  4Y5F A;  1K6R A;  4S2I A;  3QNB A;  3UB5 P;  1PZO A;  3UPO A;  4FUW A;  1I2S A;  1F9I A;  1OTA A;  3FPW A;  3C8C A;  3S7Q A;  4EXO A;  2ZOH A;  1PFL A;  1PW1 A;  3EGX C;  4UQI S;  1FSW A;  2PRF A;  5BOH A;  3IH8 A;  4KZ5 A;  1ERQ A;  4QY5 A;  2A49 A;  5TFQ A;  2W3G A;  3LYX A;  3ITB A;  4JGQ A;  1ESI A;  4HEF A;  3BEC A;  3BW6 A;  4ZJ3 A;  1NZU A;  1BLP A;  2EXA A;  4Q0I A;  1PYY A;  4P6B A;  4E6X A;  1SKF A;  1PZP A;  3BWL A;  5KIZ A;  5TBM A;  3C4O A;  3VOL A;  5MC7 A;  4KG5 A;  3BQ8 A;  4OOM A;  4OPY A;  3Q1F A;  4DE2 A;  1DY6 A;  2JC7 A;  3C30 A;  2AVX A;  3G6O A;  2ZOI A;  5F1G A;  3UPN A;  3S7P A;  1H5X A;  2B18 A;  2W1T A;  4FOF A;  1F2K A;  1H3Q A;  5KSC A;  5FI2 A;  5K5B A;  3QP4 A;  1XJ3 A;  2VGL S;  3NC8 A;  1NLZ A;  2O9A A;  2M7U A;  1I2W A;  3HL9 A;  4HI4 A;  4Z1W A;  3E2L A;  4E3I A;  3IBR A;  4EEU A;  2WGW B;  4RYE A;  2ZC7 A;  4K0X A;  5M19 A;  1CEG A;  3D72 A;  4JF5 A;  2X01 A;  2Y2I A;  3T4T A;  1LI9 A;  3H7W A;  3S4X A;  2G2U A;  5L8M A;  4N9L A;  5CGW A;  2P04 A;  4G3K A;  1U60 A;  1JNU A;  3ZG5 A;  4IED A;  4EQ1 A;  5F6A A;  4GDB A;  3OC2 A;  2WAE A;  3CIT A;  4Q8I A;  4CLC A;  1T18 A;  4JF4 A;  2JBF A;  4GHI B;  4GNU A;  1NYM A;  3R4K A;  2W3F A;  5M1A A;  2ZMA A;  3LIB A;  3UB7 A;  3MR0 A;  2XD5 A;  1JTG A;  3S1Y A;  4HJ3 A;  4HJ4 A;  5EVL A;  1DP8 A;  1UWP X;  1GA9 A;  5HL6 A;  1T1A A;  3DAV A;  5EM1 A;  2IWC A;  3GRJ A;  3Q82 A;  4KUO A;  5EM0 A;  3D9Y A;  2QKP A;  4ZRR A;  4F94 A;  1F98 A;  2PU2 A;  2WZX A;  4WM9 A;  1LSW A;  2VEA A;  4Y13 A;  4JXS A;  5KMW A;  1FR1 A;  2P08 A;  3FG8 A;  3IX8 A;  3B3X A;  2C6W B;  3KYQ A;  2Y2O A;  3FC7 A;  4PM7 A;  4LV3 A;  3MZD A;  3WS2 A;  3A0R A;  3GEC A;  3CUE C;  3TRC A;  2PU4 A;  3T4J A;  5JYO A;  5HSQ A;  2BTF P;  2HZ5 A;  3U2A A;  4GB7 A;  1ZHH B;  2ZBB A;  1XPB A;  3UE6 A;  2FZ0 A;  2V0W A;  2JCH A;  1KVL A;  1YQS A;  5I5L A;  5FAT A;  5G4Y A;  1HVB A;  3UB9 A;  4UA7 A;  3O3V A;  4GS9 A;  4ZDX A;  3NIA A;  4B88 A;  3T4K A;  3MXQ A;  4P0M A;  2EFX A;  5AJG A;  4WMC D;  1Y28 A;  4JXV A;  5DF7 A;  1XA1 A;  2HDR A;  4S2L A;  3IXB A;  1YLY A;  2QJ7 A;  4JGP A;  3CG5 A;  3MS6 A;  4S2O A;  3T4Q A;  3FYZ A;  5J3W A;  2X02 A;  2OOL A;  2XLN A;  3SS4 A;  3GVB A;  4GD8 A;  4E6W A;  4G3W A;  2K7S A;  1LI0 A;  3VP1 A;  3NOP C;  1XJ4 A;  2MJ6 A;  3NCK A;  3OLO A;  1Y4O A;  2HP6 A;  4E3M A;  2OAQ 1;  3CI6 A;  3F1N B;  4MBH A;  2M7V A;  1PI5 A;  2YKF A;  3ZVT A;  2J7V A;  3PBQ A;  5GL9 A;  1FCO A;  4E3L A;  4DE1 A;  5HD5 A;  1IYS A;  1A0K A;  2L0W A;  1DP6 A;  1K0K A;  4Y2F A;  2W3D A;  5GLC A;  1H8Z A;  3JPU A;  4MBF A;  2XF3 A;  4R4R A;  3G2Z A;  5DF8 A;  3CWF A;  4GKU A;  1CI8 A;  1WYC A;  3Q07 A;  2OSU A;  4ID4 A;  1G28 A;  3N7W A;  5EVI D;  1XGJ A;  5FQM A;  4FD8 A;  2GJ3 A;  2H5S A;  1GSV A;  3BLM A;  5FEF A;  4DDY A;  2Y2N A;  1H0M A;  1G68 A;  1ES2 A;  3EOI A;  1K54 C;  1MKM A;  3BYD A;  3IHB A;  2Q9N A;  1AWI A;  3PXP A;  3UY6 A;  4O7D A;  5TBM B;  3LFV A;  3HJI A;  4LV0 A;  1XX2 A;  2ZC3 B;  1MKI A;  5GLD A;  3G35 A;  1TS8 A;  2VV7 A;  4A5R A;  4FH2 A;  5CX7 A;  2WKI A;  4OPR A;  2ZLY A;  1KGG A;  1IEM A;  1K55 A;  4NET A;  3T50 A;  3KSH A;  4JGO A;  2IWD A;  4UQI M;  4CLC C;  1VEU B;  3BY9 A;  3RXX A;  2PT7 A;  3LIF A;  1H8Y A;  2RCX A;  2Y2J A;  3PYP A;  2W3E A;  4GCZ A;  2ZL1 B;  3ITA A;  4JBF A;  4QWO A;  1IKG A;  2BG1 A;  3SOI A;  4LRZ E;  1BTL A;  1ES5 A;  1XJ6 A;  4S2P A;  3NJA A;  4KZ9 A;  4WL9 A;  4BD1 A;  1K4F A;  3H7W B;  1N9N A;  4GN2 A;  4XUZ A;  2HJ9 C;  2XK1 A;  3IWQ A;  3E98 A;  3VMA A;  1DJB A;  2G7U A;  1AXB A;  3MF0 A;  1YMS A;  2VX8 A;  3SH9 A;  4DJ3 A;  4X68 A;  4CLC B;  3MKF A;  1ACF A;  3HVF A;  1UWN X;  5G4Z A;  1CQA A;  5HDS A;  4MN7 A;  2VGL M;  2KOI A;  1YSQ A;  4ETX A;  1L3L A;  4D60 A;  4HJ6 A;  4IVI A;  3JVU A;  1YT4 A;  1MWT A;  3DTK A;  4MMN A;  2ZQ8 A;  4EBP A; 
#chains in the Genus database with same CATH homology
 3VE4 A;  2KDK A;  3EGD C;  2W3G A;  3LYX A;  4HNB A;  2IA2 A;  4NEE D;  4JGQ A;  5DFY A;  2Y8H A;  4PAU A;  1YKD A;  2XRN A;  4UEY A;  3RH8 B;  4HP4 A;  4WUJ A;  3BW6 A;  4LRX C;  3K3C A;  4Q0I A;  4HIA A;  2VLG A;  3MQQ A;  4GW9 A;  1XFN A;  3LR4 A;  3R7W B;  3BWL A;  5A8B A;  3B42 A;  5KIZ A;  5TBM A;  3R7W A;  3VOL A;  5MC7 A;  2EA9 A;  3BQ8 A;  4H6J A;  3O5Y A;  4OOM A;  1OT6 A;  4NXF A;  3EQV A;  4XT2 B;  1N9O A;  3B33 A;  3HCY A;  2LB9 A;  3LIA A;  1OT9 A;  3CLO A;  3P01 A;  5DFX A;  2J80 A;  3LR3 A;  4IJG A;  4KQD A;  4HOI A;  2PD8 A;  3NOU C;  4RQ9 A;  3C30 A;  1D7E A;  4DN0 A;  3KYZ A;  3G6O A;  2W1T B;  2ZOI A;  4NKP A;  3TW8 A;  3S7P A;  4EW7 A;  3DBA A;  1WA9 A;  2B18 A;  2WKR A;  4GS9 B;  2W1T A;  4FOF A;  3KSG A;  1H3Q A;  3ZYT A;  4CLC D;  3NHQ A;  3LUQ A;  3E4O A;  4YWZ A;  5K5B A;  1XJ3 A;  2OAP 1;  2VGL S;  1TD5 A;  1NLZ A;  2O9A A;  3KSF A;  3PBO A;  2GX5 A;  4EER A;  1NWZ A;  3EEH A;  2M7U A;  1ZTU A;  4P6Z M;  4HI4 A;  4WEJ A;  2V1B A;  4Z1W A;  4EU0 A;  2QWS A;  3IBR A;  4E04 A;  4EEU A;  2KLI A;  3PR6 A;  2K31 A;  2ZMV A;  2J3T D;  1BYW A;  2VKS A;  5KSH A;  3D72 A;  2JKT M;  3NOT C;  3T4T A;  4CLC E;  2PDR A;  3H7W A;  4L9F A;  4HP9 A;  5L8M A;  1LT0 A;  2EWV A;  4DMZ A;  2P04 A;  5IS1 A;  5F69 A;  2DMW A;  5HDC A;  1S1Y A;  4G3K A;  1T1B A;  4NXB A;  5LBR A;  1JNU A;  1OTD A;  4EQ1 A;  5HWV A;  5F6A A;  4R6L A;  3OC2 A;  4WLA A;  3CIT A;  3E4Q A;  1YSP A;  4CLC A;  2O99 A;  1V9Z A;  4Q0H A;  1T18 A;  3F1P B;  2A24 B;  4R70 A;  4GHI B;  3RFB A;  1TF1 A;  3PBN A;  3OOV A;  1X0O A;  3R4K A;  2INW A;  2W3F A;  3LIB A;  3UB7 A;  3W2Z A;  4ARZ A;  3MR0 A;  4HH2 A;  5HZH A;  4FSF A;  4HHD A;  2BAS A;  4F3L A;  4HJ3 A;  4LLO B;  4HJ4 A;  1DP8 A;  1UWP X;  2HV1 A;  3ZQ5 A;  5HWW A;  5HL6 A;  1T1A A;  3LI8 A;  3PBT A;  4KUO A;  3H9W A;  5HPF A;  5DF9 A;  2J3W A;  2QKP A;  4ZRR A;  1F98 A;  4HH3 A;  5DJU A;  1LSW A;  2VEA A;  2QHK A;  3PBS A;  4HQA A;  3MJQ A;  3H82 B;  3K3D A;  4IHQ A;  4MN5 A;  5F68 A;  2P08 A;  3FG8 A;  4NXG A;  3KYQ A;  4M4X A;  2L1M A;  3FC7 A;  3IS2 B;  2W0N A;  1NLY A;  4I39 A;  2WKQ A;  3BJN A;  3IS2 A;  5J4E A;  3A0R A;  3PHY A;  2OWH A;  3GEC A;  4G3V A;  3CUE C;  3TRC A;  2XRO A;  1S1Z A;  4XT2 A;  3T4J A;  2PHY A;  3MQO A;  4IUH A;  4B9O A;  2HGV A;  3UE3 A;  5HSQ A;  3U2A A;  4OOL A;  4HY8 A;  2QJ5 A;  1ZHH B;  3KO6 A;  2ZBB A;  3UE6 A;  2FZ0 A;  5DKK A;  2PD7 A;  2YKH A;  2V0W A;  4BJP A;  5I5L A;  5G4Y A;  2XA7 S;  1KOU A;  3UB9 A;  2JHE A;  4GS9 A;  2W3H A;  3F1O B;  2W1R A;  3T4K A;  3MXQ A;  4I3A A;  1H8M A;  4DJ2 A;  2Y79 A;  1UGU A;  5AJG A;  1Y28 A;  4I5S A;  3ULF A;  3IBJ A;  2PYP A;  4KQO A;  3PBR A;  2JN7 A;  2QJ7 A;  4JGP A;  4Q0J A;  3VV4 A;  4BMW A;  3S7O A;  3OCN A;  3T4Q A;  1F5M A;  5J3W A;  2OOL A;  1OTE A;  4MN6 A;  4EES A;  1ODV A;  4WF0 A;  1W63 M;  3LIE A;  4G3W A;  2A2L A;  2K7S A;  1P0Z A;  1N9L A;  3NOP C;  4MCW A;  3MQ0 A;  4BBU A;  1XJ4 A;  4EET B;  2MJ6 A;  3OLO A;  2B02 A;  2VV8 A;  1S66 L;  2L4R A;  3KSI A;  2OAQ 1;  3CI6 A;  1P9R A;  3F1P A;  3F1N B;  2M7V A;  2A24 A;  2O9B A;  1VB6 A;  2Z6C A;  2KX6 A;  2YKF A;  4GHI A;  4WEK A;  2EWW A;  5DKL A;  3A0V A;  3PBQ A;  2QYB A;  3MFX A;  5HD5 A;  4L9E A;  4PHT A;  1S4S A;  3LI9 A;  3OCL A;  2ZMF A;  4CQH A;  2L0W A;  1S4R A;  1DP6 A;  3EEA A;  4Y2F A;  2W3D A;  4L0L A;  3BY8 A;  3OBF A;  2V0U A;  1V9Y A;  2D01 A;  1MC0 A;  4YOF A;  4B93 A;  1LL8 A;  3LR0 A;  3CWF A;  4LPZ A;  2VA0 A;  2O9C A;  4P6Z S;  4R38 A;  1GSX A;  3S7N A;  1NRJ A;  4EEP A;  3UME A;  1G28 A;  3LID A;  1G6O A;  2V9A A;  3BQA A;  2JKR I;  5HD3 A;  1OTB A;  2GJ3 A;  2K2N A;  4O0P A;  4K08 A;  1GSV A;  3H82 A;  1XFQ A;  3LR5 A;  3FPV A;  2JKR M;  3P7N A;  4MDZ A;  3EOI A;  1IOU A;  2HJE A;  5IT5 A;  1MKM A;  3CAX A;  3ICY A;  4II7 A;  1P97 A;  2R78 A;  3V67 A;  1OPX A;  2O0Y A;  3PXP A;  5TBM B;  4Y3I A;  4WN5 A;  3LFV A;  3HJI A;  3T4S A;  3T4L A;  4L9G A;  4H6J B;  4IUK A;  1OTI A;  2PR6 A;  1TS8 A;  2VV7 A;  3B47 A;  5AVF A;  2P7J A;  5C5K A;  5CX7 A;  1LSV A;  1TS7 A;  4YNR A;  3F1O A;  2XSS A;  3T4O A;  5FL3 A;  1LSX A;  4ME4 A;  5F5Y A;  2D02 A;  3MMH A;  2VJW A;  2M1C A;  3T50 A;  4ETZ A;  1TS6 A;  3KSH A;  4JGO A;  2CMN A;  3LIC A;  4UQI M;  4CLC C;  3UB8 A;  1XJ2 A;  3BY9 A;  2WKP A;  1IFQ A;  3TJZ C;  3RTY A;  2PT7 A;  3GDI A;  2GZA A;  3LIF A;  2V1A A;  1OJG A;  2VV6 A;  4O8G A;  3SW1 A;  4GLQ A;  1STZ A;  3PYP A;  2W3E A;  4GCZ A;  2FH5 A;  4I3I A;  5TJJ A;  4EUV A;  2OWJ A;  3CUE A;  2W27 A;  3K2N A;  2JKT I;  1TS0 A;  4LRZ E;  1XJ6 A;  3EWK A;  3EQU A;  4I3J A;  3A0S A;  1EW0 A;  3NJA A;  2J3T C;  4R3A A;  1DRM A;  4WL9 A;  1D06 A;  4NXE A;  1S67 L;  4KUK A;  3TE8 A;  1YAX A;  3H7W B;  2Z6D A;  5HDD A;  1N9N A;  2HF6 A;  4BBT A;  3D3O A;  2PR5 A;  2GNX A;  3C38 A;  2HJ9 C;  2NUT C;  3E98 A;  1T19 A;  2G7U A;  3E4P A;  3MF0 A;  1T1C A;  4PKY A;  4QPR A;  4I38 A;  1GSW A;  3F1N A;  3JVV A;  4GJ4 A;  2VX8 A;  4DJ3 A;  1W63 Q;  4CLC B;  5J7E A;  3UMD A;  2LB5 A;  3UB6 A;  3E0Y A;  3C2W A;  1VHM A;  4JGR A;  1P9W A;  3KX0 X;  2XA7 M;  3VE3 A;  1UWN X;  5G4Z A;  5HDS A;  4Y5F A;  5DJT A;  4MN7 A;  2VGL M;  4LRY C;  2KOI A;  1YSQ A;  1MZU A;  2I9V A;  4PKY G;  5IU1 A;  4AFI A;  4ETX A;  1F9I A;  5AVE A;  4ARZ B;  2NUP C;  1OTA A;  3FPW A;  3HJK A;  3C8C A;  5EFW A;  2PYR A;  5HPI A;  4HJ6 A;  4WEL A;  4F3L B;  2H28 A;  3S7Q A;  4BWI A;  4EXO A;  1OJ5 A;  2ZOH A;  4BBV A;  3EGX C;  3JVU A;  4UQI S;  1DP9 A;  4MMN A;  4O01 A;  2VZW A;  5HWT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...