4BLMA

Beta-lactamase of bacillus licheniformis 749(slash)c. refinement at 2 angstroms resolution and analysis of hydration
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
256
structure length
256
Chain Sequence
DDFAKLEEQFDAKLGIFALDTGTNRTVAYRPDERFAFASTIKALTVGVLLQQKSIEDLNQRITYTRDDLVNYNPITEKHVDTGMTLKELADASLRYSDNAAQNLILKQIGGPESLKKELRKIGDEVTNPERFEPELNEVNPGETQDTSTARALVTSLRAFALEDKLPSEKRELLIDWMKRNTTGDALIRAGVPDGWEVADKTGAASYGTRNDIAIIWPPKGDPVVLAVLSSRDKKDAKYDDKLIAEATKVVMKALN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA-LACTAMASE
publication title Beta-lactamase of Bacillus licheniformis 749/C. Refinement at 2 A resolution and analysis of hydration.
pubmed doi rcsb
source organism Bacillus licheniformis
molecule tags Hydrolase(acting in cyclic amides)
total genus 88
structure length 256
sequence length 256
chains with identical sequence B
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 1991-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00144 Beta-lactamase Beta-lactamase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 4blmA00
1N9BA 5FQ9A 1ONHA 3IWQA 4NETA 2XF3A 3A3JA 4X6TA 2ZQ7A 1WYBA 1SDEA 1ZG4A 1Q2QA 2HDRA 5HFOA 3W4PA 5FQKA 3M6HA 1PIOA 3HLGA 4E3OA 2WKHA 4IBXA 4UAAA 3VP4A 3N4IA 1NY0A 1E3UA 2ZC3B 2ZQCA 4GN2A 3VP3A 1KGEA 2Y4AA 4KZ5A 5CHJA 4M3KA 4IBRA 3MZDA 4BLMA 2XR0A 4HESA 4Y0UA 4E3KA 4HBTA 1K56A 5HW3A 4MBKA 1ZC2A 4GD6A 4Y0OA 3HUOA 3WWXA 1Y54A 1WE4A 1PYYA 4S2KA 2WAFA 2JE5A 4L0LA 2EFXA 3ITBA 2OLVA 4FH4A 1XGIA 1DJCA 3OPHA 4OP5A 3C7VA 3DWZA 3IF6A 5CEDA 4ZBEA 3GSGA 3JYIA 3SH7A 3OPPA 1L0GA 4JLFA 1ESUA 1XKZA 4GB7A 2PBYA 3QNCA 4E3IA 3BYDA 2Y2GA 1TVFA 5FQMA 1RGZA 3MXRA 4JPMA 1FQGA 4KZ4A 4RA7A 3UN7A 5EVIB 2H10A 1MBLA 3PAEA 5TR7A 4OP8A 2ZC7A 3NBLA 4OQGA 3NC8A 5DTSA 3UE1A 3D4FA 5IHVA 4O7DA 4BD1A 3NDGA 2HP5A 2XQZA 4LV0A 5GLAA 5E2FA 4BL2A 4OQHA 1ES4A 1PWDA 1LL5A 3PAGA 1BTLA 3WS4A 2A49A 1OMEA 1ES2A 1FCMA 2ZQ8A 2EX8A 1GCEA 4DE3A 4KZ3A 1ALQA 3ZNTA 2ZD8A 5M18A 5EOOA 2RL3A 4WZ5C 1MWTA 2ZC5B 5EE8A 5AQBA 5CECA 2Q9NA 4XUXA 2WGWA 2IWCA 2XD5A 4EWFA 1NRFA 3RJUA 4LV1A 1IKIA 2EX6A 2C6WB 5BOHA 4K0WA 4JF5A 5HAQA 1MXOA 4YINA 1YMSA 2GDNA 3GV9A 5FA7A 3ISGA 1K6RA 3ZG7B 2ZJ9A 3N8RA 5CHMA 4NK3A 3MKEA 3G30A 4WMCA 2PU4A 3OCLA 4KZ8A 2EXBA 3SS5A 4E3JA 3UPNA 1K54A 1MPLA 2OV5A 4PM7A 5CXWA 1JTGA 4D2OA 4WYYA 3VP1A 3DTMA 4KQQA 1IYPA 3GTCA 4UA7A 3BLMA 4KG2A 2Y2KA 2B5RA 4RYEA 1DY6A 5J8XA 3GVBA 5DF7A 4GDBA 3ZG8B 1CEGA 1XPBA 3IHBA 3N8LA 1EWZA 1BT5A 2WZXA 3ZCZA 4U0TA 4MLLA 2ZMAA 4OLDA 2J9OA 2ZLYA 4GD8A 2G2WA 1K56D 5FQQA 1KE0A 1IYQA 4WZ4A 3NCKA 1L0DA 3G35A 4S2OA 1RGYA 2E8IA 1IYOA 3WS5A 5EECA 2HPBA 5EUAA 1ERMA 3BM6A 3G2YA 2PU2A 3IF6B 4P87A 5F82A 3BECA 4Z9QA 4C6YA 3UY6A 1M6KA 1K55A 5DF9A 5EPHA 4R3BA 3WS1A 1NZOA 2C5WB 3S22A 4OONA 2ZM0A 5FQIA 1TDLA 3HLDA 5G18A 2WYXA 2XD1A 1BLSA 4JBFA 1YLPA 1H8YA 4LENA 5FDHA 4S2PA 5DF8A 1U60A 3BFGA 5KSHA 1IYSA 3IXDA 5U47A 5M19A 3TSGA 5F83A 3ZG0A 2Q9MA 5E2GA 1YT4A 1LI9A 3WRZA 3TG9A 1CI9A 4PPRA 1JTDA 1HD8A 3BFEA 2Y91A 5AQAA 5FAQA 1ZG6A 4UA9A 3UPOA 4KG6A 3W4QA 4Q8IA 3V39A 5CGSA 2WK0A 1K57C 1K6SA 2A3UA 5TFQA 1K57A 2FFFB 1HVBA 2XH9A 3M2KA 3PBSA 3M2JA 4JXSA 4N9LA 3TOIA 3ZNYA 1W79A 3LY3A 2QZ6A 3BFDA 4C75A 3A3FA 3GQZA 4HEFA 3WS0A 4DE2A 2RCXA 4FH2A 1ZKJA 2Y2HA 4MBHA 1ES3A 5FI7A 4OPRA 5KMWA 3S4XA 1SDNA 2WGWB 5HAIA 4DDYA 5GL9A 2P9VA 4K0XA 3W4OA 1G68A 1YQSA 3O88A 4N92A 5GHXA 4OVDA 5CGWA 2WKEA 4BD0A 5GLCA 5CTMA 2X71A 4KQOA 5F1FA 4EV4A 4H8RA 3SS3A 3A3IA 3Q1FA 1JWVA 4FSFA 2JC7A 2HDSA 2HDUA 3GRJA 3IWIA 1I2WA 4YFMA 1FOFA 5EVID 4WMCD 3W8KA 4N1HA 1LHYA 5FASA 1BULA 1TEMA 5CERA 3P98A 1YLWA 4R23A 1FR1A 3PBOA 2Y2OA 5EVLA 1XA1A 4OLGA 4QD4A 4PM6A 3V3RA 1JVJA 4QHCA 5FAPA 3DWKA 1Q2PA 1ESIA 3C4OA 4LCMA 5L2FA 1YLZA 3ZGAB 3VSKA 4PM5A 2H0TA 2WZZA 3C7UA 4GNUA 3VOYA 4B88A 4PM8A 4EBLA 1SCWA 5D3OA 3EQVA 1W8YA 1AXBA 1O7EA 3BFFA 4OOMA 2X02A 4WM9A 4XUZA 4WZ5A 4BJPA 3M6BA 4N1XA 5EOEA 3FWLA 2IWBA 1G6AA 1NYYA 3NI9A 4OH0A 1W5DA 1QMFA 2UWXA 2ZM2A 4B4ZA 3VP2A 2Z2MB 4Y0TA 5FAOA 2WUQA 2XEPA 4LV3A 1KVMA 2Y2IA 3VP0A 4DF6A 4QJGA 4P85A 4RX3A 4UA6A 5KSCA 1MKIA 2ZQ9A 1YLJA 4A5RA 4CJNA 2OLUA 4EBNA 1BLPA 2Y2JA 3N8SA 1PW1A 5AQ7A 1H5XA 1E4DA 1MWRA 4BQMA 3HLEA 4RVAA 3QNBA 1XA7A 3PBNA 5E43A 4GDNA 4OPQA 3AGFA 1H8ZA 2HP6A 3I7JA 3VFFA 3HBRA 4QB8A 1E3UD 4BENA 1CK3A 2EXAA 3GMWA 4KZ9A 4OPZA 3G34A 5HAPA 4E3MA 2Y2PA 2Y2LA 3ZFZA 4X53A 4OOYA 4PMAA 1CEFA 3NIAA 1FSWA 4QY5A 3UDXA 4KG5A 2Y2MA 3N7WA 4WELA 2EX9A 1IEMA 1W8QA 2XFTA 4FCFA 3CZDA 4F94A 1NYMA 1DJBA 1FCNA 1HTZA 3HREA 3LY4A 3O3VA 2Y55A 1EROA 3FYZA 4EUZA 1PI5A 3IXHA 3E2LA 2P9VB 4WEKA 3LO7A 2XK1A 3SS4A 1PWGA 5CHUA 2V20A 3WRTA 5TGFA 2EX2A 1LI0A 2H5SA 4R0QA 4S2JA 3BLSA 5HARA 1BLCA 2QMIA 2BLSA 5A91A 3RXXA 4KZ7A 1KVLA 5GHZA 1W7FA 1TDGA 5A92A 5FI6A 1I5QA 3E2KA 4QU3A 5DTTA 2CC1A 5CRFA 3HLCA 2R9XA 3VMAA 2V1ZA 4K91A 2JBFA 2ZC6B 1L0EA 3HUMA 4IEDA 4E6XA 4JKTA 1KE4A 2Z2LB 1BLHA 3IQAA 3LCEA 3OCNA 4KZBA 3BFCA 4OPYA 3VSLA 2BG1A 3MZEA 3OC2A 1I2SA 4KZ6A 4X68A 1K38A 3V3SA 5DTKA 2R9WA 1NJ4A 3WS2A 3UNWA 1FCOA 3UO9A 1CI8A 1PWCA 3ZVTA 2IWDA 3AGDA 4ID4A 4DE1A 1SKFA 1YLYA 4KZAA 5AQ9A 2XLNA 5FATA 3SH8A 1Z6FA 2DRWA 4BL3A 4JF6A 2ZM8A 1GHPA 3HL9A 3MXSA 4GKUA 4R4RA 4RX2A 3DW0A 3UDIA 1JWPA 1IKGA 4N9KA 3O86A 5FI2A 1ERQA 3Q81A 4HBUA 5GHYA 3IHAA 1PI4A 1IELA 1N4OA 3GR2A 4ZJ2A 5DVAA 5HL1A 3EQUA 4X69A 3O87A 2X01A 4ZTKA 3HVFA 4QY6A 3V5MA 3S1YA 3P09A 2FFYA 5HX9A 5GLBA 1PZOA 4ZJ1A 3HLBA 1PW8A 3ZG9B 1JWZA 4JXGA 4P6BA 4DE0A 1ONGA 3SOIA 3IF6C 3NY4A 1KDWA 1YM1A 2HP9A 1C3BA 3B3XA 3MZFA 1XX2A 3IH9A 3OPRA 3Q7VA 2J8YA 1L0FA 3MFDA 4DDSA 4EBPA 4DXBA 5JYPA 3FKVA 4R4SA 2DNSA 1LLBA 2ZQAA 3CG5A 3IWOA 3MKFA 4P0MA 5CEBA 2Y59A 3UPPA 1XGJA 4DXCA 3LEZA 1K25A 1MY8A 3IT9A 2Y2QA 5F1GA 4B4XA 3G4PA 2HDQA 3C4PA 3V50A 1GA9A 2VGJA 2VGKA 3IF5A 4ZAMA 3UDFA 3AGEA 1VQQA 3CJMA 2ZC4B 3FZCA 1BSGA 4Y7PA 3PTEA 2XGNA 1BUEA 2DCFA 2JCHA 3OPLA 3HUNA 1K4EA 1WYCA 3IXGA 4S2MA 3SH9A 2ZQDA 1VM1A 3BRMA 5E2EA 4EQIA 1PZPA 4UHUA 5A93A 4IVKA 4MNRA 2OSUA 4MEZA 1S6RA 1O07A 1M40A 4GZBA 4JF4A 1K4FA 3A3EA 4U3TA 5KZHA 4KQRA 3IXBA 3MBZA 3PBTA 4U0XA 1BZAA 3N6IA 4MBFA 2XDMA 4C3QA 4WEJA 4XXRA 3IH8A 5CTNA 1MWUA 5I94A 1GHMA 3FKWA 4JXVA 5M1AA 1GHIA 2XFSA 4R1GA 3UE0A 4E3NA 3FV7A 1KGFA 2WGVA 2Y2NA 5EVIC 1YLTA 5EVIA 3NDEA 4S2IA 5E2HA 3ZVWA 2J9PA 3VOZA 4WBGA 1RCJA 1S0WA 4ZDXA 1K54C 1QMEA 2EFUA 3A3DA 2WADA 4OOLA 4DRTA 4CPKA 1HZOA 3C5AA 2H0YA 3QHYA 4X56A 3BEBA 2V2FF 4FD8A 1MWSA 2QPNA 1RP5A 3HLFA 4R3JA 1XXMA 2WGIA 3G2ZA 5FQJA 1NZUA 3ITAA 2I72A 4PM9A 1FR6A 1FSYA 4GOGA 4E6WA 1XP4A 1KDSA 3RXWA 4LV2A 4KENB 4DKIA 3Q7ZA 1SHVA 3CMZA 1KGGA 1YMXA 2G2UA 4E3LA 2J7VA 5CGXA 4S2NC 1KE3A 3ZHHA 4S2NA 4OQ0A 5JYOA 3ZG5A 3Q82A 4OQIA 2WAEA 4LCLA 1NXYA 4X55A 1LL9A 1E25A 4JXWA 2P74A 1DJAA 3ZDJA 4ZJ3A 3PBQA 5GLDA 2WKIA 4OKPA 3UE3A 1EI5A 3G31A 3PBRA 3Q7VB 1K55C 3HLWA 4IVIA 3OZHA 5FSRA 1ES5A 1L2SA 1J9MA 3Q07A 1GA0A 4S2LA 3VFHA 5A90A 3G32A
chains in the Genus database with same CATH superfamily
1N9BA 5FQ9A 3IWQA 3BQAA 2P7JA 3M6HA 4E3OA 4IBXA 4R38A 1KGEA 4KZ5A 5CHJA 4M3KA 3GECA 4E3KA 5HW3A 1UGUA 4QPRA 3B33A 3WWXA 1PYYA 4RQ9A 2M1CA 4S2KA 4L0LA 3LR3A 3ITBA 1JNUA 4ZBEA 3GSGA 2VK3A 3SH7A 2VKSA 3DAVA 4WLAA 2YKHA 1TVFA 1RGZA 2O9BA 1LSVA 3PAEA 2W1TB 4OP8A 3EGDC 5DTSA 3NC8A 4BBVA 3SZTA 3A0SA 5DFXA 4BD1A 2HP5A 2XQZA 5L8MA 5TBMB 5E2FA 1PWDA 3PAGA 1BTLA 1FILA 1TS7A 2A49A 3LIBA 1DRMA 2ZQ8A 2EX8A 1GCEA 5EM1A 4DE3A 5M18A 5AQBA 2ZOHA 5DFYA 3RJUA 4LV1A 5F6AA 2EX6A 3HJKA 4YINA 1YMSA 2FH5A 3ZG7B 5AVFA 4YOFA 2XROA 3OCLA 4KUKA 5CXWA 4D2OA 3DTMA 4HY8A 4UA7A 3BLMA 2ZOIA 2B5RA 4XT2B 1GSXA 1OPXA 5DF7A 4WF0A 5IT5A 1CEGA 3N8LA 1EWZA 1PNEA 4U0TA 2W3FA 4OLDA 3QP8A 2NUTC 5FQQA 1IYQA 3NCKA 4S2OA 3WS5A 3OOVA 2HPBA 2K2NA 3MS6A 1XJ2A 5J3WA 4DJ2A 4NXEA 5F82A 3IF6B 2XSSA 4Z9QA 4I3IA 4C6YA 1M6KA 1K55A 5DF9A 3WS1A 4R3BA 3D3OA 3S22A 1TDLA 5G18A 1MC0A 1H8YA 1SKOA 3T4LA 1IYSA 2M7VA 2Q9MA 4GHIB 1YT4A 1LI9A 5E2GA 3WRZA 5AQAA 3W4QA 3V39A 5CGSA 1EW0A 1K57C 1K57A 1S66L 1HVBA 3M2KA 4JXSA 5A93A 3R4KA 3F1PA 1W79A 2QZ6A 1YKDA 1ZKJA 1ES3A 5KMWA 1W63Q 3BJNA 1SDNA 4DDYA 4R3AA 5GL9A 2P9VA 5HZHA 3KX0X 4OVDA 2WKEA 3T1QB 4BD0A 1P9RA 3TE8A 3T4KA 3SS3A 4KQDA 1P0ZA 1BYWA 4WMCD 3W8KA 1LHYA 1YLWA 4R23A 1FR1A 1V9ZA 3MXQA 5EVLA 1XA1A 4HI4A 2JKTM 4QHCA 3C4OA 3ZGAB 1H0MA 4IUKA 1SCWA 5EV0A 1AXBA 1O7EA 5K5BA 4WZ5A 5EOEA 1G6AA 1S1ZA 1W5DA 3B47A 2WKPA 3C2WA 2WUQA 3OBFA 3VP0A 4CJNA 5J7EA 4Y13A 3N8SA 1PW1A 3HLEA 1XA7A 2VX8A 3LR5A 1H8ZA 1E3UD 2EXAA 4KZ9A 2KX6A 3F1NA 4E3MA 3EWKA 1D7EA 3NIAA 2PR6A 3IX3A 4KG5A 2XFTA 4FCFA 3CZDA 3F1OB 3RTYA 2Y55A 3FC7A 1PI5A 3IXHA 1PWGA 3WRTA 3FPVA 2L1MA 3HJIA 3KSGA 3BLSA 3RXXA 3EGXC 5GHZA 1W7FA 3R7WB 3E2KA 1XJ4A 4M4XA 2V1ZA 2JBFA 2ZC6B 3HUMA 3W2ZA 5HDCA 2HZ5A 4O0PA 4KZBA 3LCEA 2BG1A 3MZEA 3OC2A 4X68A 1OT6A 1NJ4A 3UNWA 3UO9A 1CI8A 4K08A 2IWDA 4DE1A 4KZAA 2KDKA 3K2NA 4JGPA 2A2LA 2DRWA 3MXSA 4GKUA 3DW0A 3UDIA 1IKGA 4Z1WA 4EW7A 3IHAA 1N4OA 1OT9A 3P7NA 4ZTKA 4QY6A 3V5MA 3S1YA 2FFYA 1L3LA 3BWLA 4NXFA 1ONGA 1DP8A 3IH9A 1OJGA 3UB6A 1XJ3A 1L0FA 3MFDA 4DXBA 3FKVA 4R4SA 3IWOA 2ZMVA 5CEBA 1S4SA 3UB9A 2Y2QA 5F1GA 4B4XA 3BW6A 2VGJA 4ZAMA 4MDZA 5FL3A 1BSGA 4Y7PA 3PTEA 5L10A 2DCFA 5F69A 2JCHA 3OPLA 3HUNA 1K4EA 1WYCA 3MR0A 4IUHA 1D06A 3LI9A 4IVKA 2OSUA 1O07A 1M40A 2IA2A 4JF4A 2PAVP 3MBZA 5FEFA 4R1GA 2KLIA 3FPWA 2Z6CA 1S0WA 2EFUA 4CPKA 1GSWA 3C5AA 5HDSA 2H0YA 3QHYA 3BEBA 3HLFA 4Y15A 5FQJA 5DKKA 4PM9A 4E6WA 3RXWA 4LV2A 3Q7ZA 1SHVA 3CMZA 5CX7A 1YMXA 2G2UA 4S2NC 1KE3A 4S2NA 5JYOA 3NOUC 2Y79A 4EERA 4PKYA 4HHDA 1NXYA 4JXWA 3KSHA 4D60A 2PBDP 5GLDA 4OKPA 1EI5A 3OZHA 2K31A 1ACFA 3Q07A 1GA0A 4MN7A 4ARZB 3G32A 4X6TA 3A3JA 3H7WB 1LT0A 2INWA 1Q2QA 4DJ3A 4B9OA 3HLGA 2B18A 4UAAA 1E3UA 2ZC3B 4WUJA 4YWZA 3LFVA 3LR0A 4PHTA 4BBTA 3GDIA 4IBRA 4BLMA 4HBTA 1K56A 2V1AA 4MBKA 1T1CA 4GD6A 2JE5A 4CLCB 2EFXA 2OWJA 4FH4A 2PD8A 3O5YA 3NOTC 5CEDA 2QHKA 2JKRI 4I5SA 3QNCA 4ARZA 5FQMA 3MXRA 4RA7A 3H7WA 1MBLA 5TR7A 1TD5A 2ZC7A 3D4FA 5IHVA 1OTIA 3QP2A 4JGRA 5EVEA 4OQHA 1MKMA 1FCMA 4CLCA 2ZD8A 5CECA 2Q9NA 2WGWA 2IWCA 2O0YA 2XD5A 3MF0A 4HH2A 1NRFA 3C8CA 3E0YA 4K0WA 2Z6DA 3LYXA 1D1JA 5FA7A 3GV9A 4H6JB 3IX8A 2ZJ9A 5CHMA 3MKEA 4MN6A 4PM7A 1JTGA 4WYYA 4EEPA 1IYPA 5FDSA 4RYEA 5J8XA 3GVBA 1X0OA 3IHBA 1BT5A 2WZXA 3LIEA 3ZCZA 2UV0E 2O9CA 4GD8A 1KE0A 1FIKA 4EEUA 3G35A 1IYOA 2ACGA 1UWPX 3BM6A 3ZQ5A 2R78A 5DKLA 1XFQA 1NZOA 3LGOA 2ZM0A 3HLDA 2V8CA 2JKFA 1F98A 2JKGA 3UE6A 2WKRA 4LENA 5KSHA 3TSGA 2XA7S 1NLZA 2VGLS 3TG9A 3PR6A 1JTDA 5FAQA 4UA9A 4I39A 3UPOA 3KYEA 4PAUA 2FFFB 3TOIA 3ZNYA 2ZL1B 2HF6A 3LY3A 3WS0A 2RCXA 2I9VA 2Y2HA 4MBHA 4O01A 3W4OA 1G68A 1YQSA 3O88A 4N92A 4X25A 3H9WA 5GHXA 5CGWA 4F3LB 4HQAA 5CTMA 2X71A 4CLCE 3VV4A 3ZYTA 5EVID 1MZUA 1BULA 3QP1A 3E4PA 1TF1A 3PBOA 2JHEA 1TS6A 4OLGA 4BMWA 5KIZA 1VEUB 1YLZA 4IJGA 4EESA 2JN7A 3T1RA 2ZL1A 4PM8A 5D3OA 3EQVA 2X02A 1AWIA 3BY9A 3FWLA 5F5YA 3NI9A 4OH0A 1QMFA 4B4ZA 4F3LA 3KYQA 2Z2MB 2XEPA 4QJGA 3LUQA 5KSCA 3LR4A 2ZQ9A 4EBNA 2OLUA 5AQ7A 1H5XA 1MWRA 4BQMA 4Q0HA 1IFQA 4RVAA 1SKOB 4FUWA 5E43A 3AGFA 2HP6A 3VFFA 1VEUA 2V0UA 4QB8A 3GMWA 3G34A 4FTXA 2Y2PA 4X53A 1FSWA 4QY5A 4P6ZM 2W0NA 2Y2MA 2EX9A 2ZMFA 3F1PB 4UEYA 1NYMA 1DJBA 1FCNA 1HTZA 3HREA 3MSHA 1EROA 3EOIA 2P9VB 4WEKA 4PKYG 5CHUA 2EX2A 1LI0A 1H8MA 3TRCA 3KO6A 3MQ0A 3SW1A 5HARA 1BLCA 2BLSA 2KOIA 5A92A 2XRNA 5FI6A 4QU3A 5DTTA 5CRFA 3VMAA 4K91A 1N9LA 2Z2LB 3IQAA 4OPYA 1I2SA 3V3SA 3WS2A 1FCOA 4HJ4A 3ZVTA 1SKFA 2V1BA 1GHPA 1Z09A 4RX2A 2J3TD 1UWNX 3Q81A 5GHYA 1IELA 3GR2A 4L9GA 2X01A 5HWVA 1LSXA 3MQQA 2J80A 3HLBA 3ZG9B 1JWZA 4JXGA 4P6BA 3IF6C 3NY4A 1YM1A 1C3BA 3B3XA 3Q7VA 4R6LA 4DDSA 4EBPA 2DNSA 1LLBA 2ZQAA 3F1NB 1XGJA 1P97A 3IT9A 1CF0A 3C4PA 1GA9A 2VGKA 3IF5A 3FZCA 2XA7M 3IXGA 4S2MA 3SH9A 1VM1A 4EQIA 4UHUA 3VE4A 4BBUA 4U3TA 3A3EA 1YSPA 4KQRA 4ETZA 2CMNA 3N6IA 2XDMA 4WEJA 4XXRA 5I94A 1GHMA 3FKWA 4JXVA 3A0VA 1KGFA 2Y2NA 5EVIC 5EVIA 4S2IA 5E2HA 3ZVWA 2J9PA 4WBGA 1RCJA 4ZDXA 1K54C 4X1MA 2WADA 4DRTA 1MWSA 1IOUA 1NZUA 2I72A 1FR6A 3NHQA 1W63M 4UQIS 2K7SA 5CGXA 4OQ0A 2HJ9C 3Q82A 3TW8A 4X55A 1LL9A 1E25A 3ZDJA 3UE3A 3LIDA 5EM0A 1ES5A 3U4LP 3NULA 4AFIA 4S2LA 4EXOA 3VFHA 5A90A 3KSIA 1ONHA 4NETA 2XF3A 2ZQ7A 1WYBA 1ZG4A 2HDRA 4GLQA 5HFOA 2W27A 1PIOA 3VP4A 3N4IA 1NY0A 1T18A 4GN2A 1NLYA 2Y4AA 4NKPA 3MZDA 3S7PA 4HESA 2MJ6A 2ZBBA 4Y0OA 3CITA 3HUOA 1Y54A 2H28A 1WE4A 4L9EA 3S7OA 2WAFA 3OPHA 4OP5A 3DWZA 4GCZA 2QWSA 4JLFA 4ZRRA 4GB7A 4E3IA 3BYDA 2Y2GA 4HJ6A 4JPMA 4KZ4A 2VA0A 2VV8A 1PRQA 3NBLA 3UE1A 3NDGA 4LV0A 5GLAA 2B95A 4IHQA 4BL2A 2J3WA 1ES4A 3WS4A 3LI8A 2J3TC 3ZNTA 3UB7A 1ZHHB 5EOOA 5EE8A 4Y5FA 4NXBA 4JF5A 5HAQA 3BQ8A 4CQHA 4GJ4A 3ISGA 3N8RA 4WMCA 3G30A 2PU4A 3UPNA 2OV5A 2OAQ1 4KQQA 1CQAA 4KG2A 1VETB 2Y2KA 2P08A 3C30A 1DY6A 2W3DA 4O8GA 1XPBA 5HWWA 5IU1A 3JPUA 4I38A 2NUPC 4WN5A 3T12B 4KUOA 3E98A 3T1SA 2GZAA 2PU2A 3T4QA 3UY6A 1F5MA 2C5WB 5FQIA 1P9WA 5F68A 3UMEA 2WYXA 4JBFA 3DTKA 3MJQA 5DJTA 1VETA 3IXDA 5U47A 5M19A 5F83A 1CI9A 3BFEA 2Y91A 1ZG6A 2QJ7A 4KG6A 4Q8IA 2WK0A 1K6SA 2A3UA 4NXGA 3PBSA 3M2JA 3T4SA 3BFDA 1DP6A 3A3FA 4HEFA 2G7UA 4DE2A 3EEHA 4FH2A 5FI7A 3U2AA 4OPRA 3S4XA 2WGWB 5HAIA 5GLCA 3NOPC 3L9KA 5F1FA 3CI6A 4H8RA 3Q1FA 4FSFA 2JC7A 2HDSA 2HDUA 3GRJA 3IWIA 1I2WA 2VV7A 4N1HA 5FASA 3CHWP 1TS0A 5CERA 3P98A 4QWOA 2VV6A 1OTAA 4QD4A 1Q2PA 4LCMA 4EU0A 3VSKA 2QJ5A 2WZZA 1DP9A 4EBLA 3LIFA 2V0WA 4EUVA 4OOMA 4BJPA 5AVEA 2VEAA 3M6BA 4N1XA 2PHYA 2IWBA 1H3QA 5J4EA 2FZ0A 2ZM2A 2UWXA 4HJ3A 4Y0TA 5FAOA 4LV3A 4DF6A 4RX3A 4UA6A 1F2KA 4A5RA 1BLPA 2Y2JA 1XFNA 3VOLA 3PBNA 1ODVA 4OPQA 3I7JA 1YPRA 3HBRA 2LB9A 4HOIA 4BENA 1CK3A 4OPZA 5HAPA 3ZFZA 2QYBA 1NRJA 3DBAA 4GS9A 4PMAA 3T4JA 3N7WA 4WELA 1IEMA 3LY4A 3O3VA 3FYZA 4EUZA 3E2LA 5HD3A 3LO7A 2XK1A 5TGFA 2H5SA 4R0QA 4S2JA 1YSQA 3JVUA 5A91A 4KZ7A 1KVLA 3NJAA 1I5QA 1LSWA 4E04A 1F9IA 1YAXA 2D01A 1V9YA 5MC7A 1NWZA 3HLCA 2R9XA 1L0EA 4IEDA 3QP6A 1KE4A 1BLHA 3BFCA 4KZ6A 5DTKA 2R9WA 1T1BA 4ID4A 1YLYA 3KSFA 5FATA 4BL3A 2ZM8A 4R4RA 4Y17A 4LFUA 1JWPA 2V8FA 4N9KA 5HD5A 3O86A 4G3VA 4ZJ2A 5HL1A 4X69A 3UB8A 3HVFA 3P09A 2V9AA 5GLBA 4ZJ1A 4DE0A 4G3WA 1KDWA 3MZFA 5HDDA 2JKTI 3OPRA 2JKRM 5JYPA 3PYPA 3CG5A 3MKFA 4P0MA 4LRXC 3UPPA 4DXCA 3LEZA 2HDQA 3TJZC 3E4QA 5G4YA 5L09A 3CJMA 2ZC4B 2GX5A 1BUEA 1PZPA 4MNRA 1S6RA 4LRZE 3IS2B 3IX4A 3PBTA 3IBJA 4C3QA 3IH8A 5M1AA 1GHIA 2XFSA 4G3KA 2WGVA 4ETXA 2GNXA 3NDEA 2W1TA 3VOZA 3A3DA 4OOLA 1G6OA 3ULFA 1LL8A 2V2FF 2HV1A 5TBMA 2BASA 2QPNA 1RP5A 3G2ZA 3ITAA 2PRFA 2DMWA 4GOGA 2PDRA 4DKIA 4KENB 2EWWA 1KGGA 2J7VA 3IS2A 3ZHHA 3ZG5A 3K3DA 2PT7A 3MFXA 2WAEA 4LCLA 4NEED 1DJAA 1S4RA 3PBQA 2WKIA 3G31A 3G6OA 3Q7VB 1K55C 5FSRA 1L2SA 1J9MA 2QKPA 1SDEA 1N9NA 3W4PA 5FQKA 2WKHA 4XT2A 4R70A 2ZQCA 2OWHA 3VP3A 4I3AA 2HGVA 2PD7A 3V67A 2XR0A 4Y0UA 3B42A 1OTBA 1PFLA 3D9YA 1ZC2A 4JGOA 3JVVA 2O9AA 2OLVA 1XGIA 1DJCA 3C7VA 3IBRA 3IF6A 3JYIA 1SZVA 3OPPA 1L0GA 4EQ1A 1ESUA 1XKZA 5IS1A 2PBYA 1FQGA 2EWVA 3UN7A 5EVIB 1HLUP 2H10A 4DMZA 4OQGA 3CAXA 5DJUA 4ESPA 4LRYC 1J3WA 4O7DA 3MMHA 4GHIA 4Y2FA 4MCWA 2A24B 2VGLM 1LL5A 5C5KA 1OMEA 2GJ3A 1ES2A 4KZ3A 1ALQA 3OLOA 2RL3A 4WZ5C 1MWTA 2ZC5B 4XUXA 3C38A 4EWFA 1IKIA 2W3EA 2C6WB 4HP9A 2Y8HA 3S7NA 5BOHA 1MXOA 2LB5A 3RH8B 3DTEA 1N9OA 2GDNA 1K6RA 3QP5A 4NK3A 2W1RA 4E3JA 4KZ8A 2EXBA 3SS5A 1K54A 1MPLA 3VP1A 1VHMA 3GTCA 2A24A 1OTEA 4GDBA 3ZG8B 4MLLA 2ZMAA 2J9OA 2ZLYA 2G2WA 1K56D 4WZ4A 1T19A 1L0DA 1RGYA 4L9FA 2E8IA 4II7A 5EECA 5HPFA 5EUAA 1ERMA 4LLOB 3BY8A 3G2YA 4P87A 4HH3A 3BECA 2O99A 5EPHA 3DTIA 4OONA 1KOUA 4HNBA 2XD1A 1BLSA 1YLPA 5FDHA 4S2PA 5DF8A 1U60A 3BFGA 3NECA 1Y4OA 1G28A 3ZG0A 4PPRA 1HD8A 5EFWA 5TFQA 4N9LA 2XH9A 3K3CA 4C75A 4LPZA 3F1OA 3GQZA 3L7HA 4CLCD 3CWFA 3CUEC 3CPTB 3CUEA 4K0XA 2OOLA 3A0RA 4KQOA 4EV4A 1ZTUA 3A3IA 1JWVA 2AVXA 1XJ6A 4YFMA 3R7WA 1FOFA 1TEMA 3CLOA 5L07A 2Y2OA 3EEAA 3H82B 4B93A 1A0KA 4PM6A 3V3RA 3KYZA 1JVJA 5FAPA 3DWKA 5L2FA 1ESIA 4PM5A 2H0TA 3C7UA 3MQOA 4GNUA 3VOYA 4B88A 4WL9A 4Q0JA 1W8YA 3D72A 3BFFA 4XUZA 4WM9A 2HJEA 3CPTA 3ICYA 1NYYA 1T1AA 5I5LA 3T50A 3PXPA 3VP2A 1KVMA 2Y2IA 4P85A 3UB5P 2VLGA 1MKIA 1YLJA 1E4DA 2L4RA 2BTFP 3H82A 3QNBA 4GDNA 3P01A 4BWIA 2W3GA 2Y2LA 4OOYA 1CEFA 3UDXA 3T4TA 1W8QA 4F94A 3QP4A 4HIAA 2E8JA 1G5UA 4GW9A 3SS4A 3LEQA 2V20A 5FEGA 5LBRA 2QMIA 1Y28A 1WA9A 3LIAA 1TDGA 4LGWA 2WKQA 2D02A 1VB6A 2CC1A 3LICA 3HCYA 3T1XA 4E6XA 2VZWA 4JKTA 1S67L 3OCNA 3VSLA 1K38A 2PR5A 1GSVA 3UMDA 1PWCA 3AGDA 5AQ9A 4YNRA 2EA9A 2XLNA 2L0WA 2YKFA 1Z6FA 3SH8A 4JF6A 1STZA 3HL9A 3PHYA 4Q0IA 5FI2A 1ERQA 4HBUA 4MN5A 1PI4A 5AJGA 5DVAA 2B02A 3EQUA 3O87A 4ME4A 5HX9A 1CJFA 1PZOA 4UQIM 1PW8A 3RFBA 2W3HA 5A8BA 3SOIA 2HP9A 1XX2A 2J8YA 2M7UA 4HP4A 5TJJA 2VJWA 2Y59A 4P6ZS 1K25A 4GS9B 1MY8A 3G4PA 3V50A 5HSQA 3UDFA 2PYRA 3AGEA 1VQQA 1K0KA 2XGNA 2ZQDA 3BRMA 5E2EA 1OTDA 4MEZA 4CLCC 4X1LA 4GZBA 4FOFA 3FG8A 1K4FA 5G4ZA 5KZHA 3IXBA 2P04A 4DN0A 4U0XA 1BZAA 4MBFA 5CTNA 1MWUA 5HWTA 4NG2A 3UE0A 4E3NA 3FV7A 1YLTA 1OJ5A 1S1YA 1QMEA 1HZOA 3T4OA 5HPIA 4X56A 4FD8A 4R3JA 1XXMA 2Q0OA 2WGIA 4I3JA 1FSYA 4EETB 1XP4A 1KDSA 4JGQA 5HL6A 4E3LA 2PYPA 4OQIA 2OAP1 3S7QA 2P74A 4ZJ3A 4MMNA 3E4OA 4Y3IA 4H6JA 3PBRA 3HLWA 4IVIA 3VE3A 1TS8A
chains in the Genus database with same CATH topology
1N9BA 5FQ9A 1ONHA 3IWQA 4NETA 2XF3A 3A3JA 4X6TA 2ZQ7A 1WYBA 1SDEA 1ZG4A 1Q2QA 2HDRA 5HFOA 3W4PA 5FQKA 3M6HA 1PIOA 3HLGA 4E3OA 2WKHA 4IBXA 4UAAA 3VP4A 3N4IA 1NY0A 1E3UA 2ZC3B 2ZQCA 4GN2A 3VP3A 1KGEA 2Y4AA 4KZ5A 5CHJA 4M3KA 4IBRA 3MZDA 4BLMA 2XR0A 4HESA 4Y0UA 4E3KA 4HBTA 1K56A 5HW3A 4MBKA 1ZC2A 4GD6A 4Y0OA 3HUOA 3WWXA 1Y54A 1WE4A 1PYYA 4S2KA 2WAFA 2JE5A 4L0LA 2EFXA 3ITBA 2OLVA 4FH4A 1XGIA 1DJCA 3OPHA 4OP5A 3C7VA 3DWZA 3IF6A 5CEDA 4ZBEA 3GSGA 3JYIA 3SH7A 3OPPA 1L0GA 4JLFA 1ESUA 1XKZA 4GB7A 2PBYA 3QNCA 4E3IA 3BYDA 2Y2GA 1TVFA 5FQMA 1RGZA 3MXRA 4JPMA 1FQGA 4KZ4A 4RA7A 3UN7A 5EVIB 2H10A 1MBLA 3PAEA 5TR7A 4OP8A 2ZC7A 3NBLA 4OQGA 3NC8A 5DTSA 3UE1A 3D4FA 5IHVA 4O7DA 4BD1A 3NDGA 2HP5A 2XQZA 4LV0A 5GLAA 5E2FA 4BL2A 4OQHA 1ES4A 1PWDA 1LL5A 3PAGA 1BTLA 3WS4A 2A49A 1OMEA 1ES2A 1FCMA 2ZQ8A 2EX8A 1GCEA 4DE3A 4KZ3A 1ALQA 3ZNTA 2ZD8A 5M18A 5EOOA 2RL3A 4WZ5C 1MWTA 2ZC5B 5EE8A 5AQBA 5CECA 2Q9NA 4XUXA 2WGWA 2IWCA 2XD5A 4EWFA 1NRFA 3RJUA 4LV1A 1IKIA 2EX6A 2C6WB 5BOHA 4K0WA 4JF5A 5HAQA 1MXOA 4YINA 1YMSA 2GDNA 3GV9A 5FA7A 3ISGA 1K6RA 3ZG7B 2ZJ9A 3N8RA 5CHMA 4NK3A 3MKEA 3G30A 4WMCA 2PU4A 3OCLA 4KZ8A 2EXBA 3SS5A 4E3JA 3UPNA 1K54A 1MPLA 2OV5A 4PM7A 5CXWA 1JTGA 4D2OA 4WYYA 3VP1A 3DTMA 4KQQA 1IYPA 3GTCA 4UA7A 3BLMA 4KG2A 2Y2KA 2B5RA 4RYEA 1DY6A 5J8XA 3GVBA 5DF7A 4GDBA 3ZG8B 1CEGA 1XPBA 3IHBA 3N8LA 1EWZA 1BT5A 2WZXA 3ZCZA 4U0TA 4MLLA 2ZMAA 4OLDA 2J9OA 2ZLYA 4GD8A 2G2WA 1K56D 5FQQA 1KE0A 1IYQA 4WZ4A 3NCKA 1L0DA 3G35A 4S2OA 1RGYA 2E8IA 1IYOA 3WS5A 5EECA 2HPBA 5EUAA 1ERMA 3BM6A 3G2YA 2PU2A 3IF6B 4P87A 5F82A 3BECA 4Z9QA 4C6YA 3UY6A 1M6KA 1K55A 5DF9A 5EPHA 4R3BA 3WS1A 1NZOA 2C5WB 3S22A 4OONA 2ZM0A 5FQIA 1TDLA 3HLDA 5G18A 2WYXA 2XD1A 1BLSA 4JBFA 1YLPA 1H8YA 4LENA 5FDHA 4S2PA 5DF8A 1U60A 3BFGA 5KSHA 1IYSA 3IXDA 5U47A 5M19A 3TSGA 5F83A 3ZG0A 2Q9MA 5E2GA 1YT4A 1LI9A 3WRZA 3TG9A 1CI9A 4PPRA 1JTDA 1HD8A 3BFEA 2Y91A 5AQAA 5FAQA 1ZG6A 4UA9A 3UPOA 4KG6A 3W4QA 4Q8IA 3V39A 5CGSA 2WK0A 1K57C 1K6SA 2A3UA 5TFQA 1K57A 2FFFB 1HVBA 2XH9A 3M2KA 3PBSA 3M2JA 4JXSA 4N9LA 3TOIA 3ZNYA 1W79A 3LY3A 2QZ6A 3BFDA 4C75A 3A3FA 3GQZA 4HEFA 3WS0A 4DE2A 2RCXA 4FH2A 1ZKJA 2Y2HA 4MBHA 1ES3A 5FI7A 4OPRA 5KMWA 3S4XA 1SDNA 2WGWB 5HAIA 4DDYA 5GL9A 2P9VA 4K0XA 3W4OA 1G68A 1YQSA 3O88A 4N92A 5GHXA 4OVDA 5CGWA 2WKEA 4BD0A 5GLCA 5CTMA 2X71A 4KQOA 5F1FA 4EV4A 4H8RA 3SS3A 3A3IA 3Q1FA 1JWVA 4FSFA 2JC7A 2HDSA 2HDUA 3GRJA 3IWIA 1I2WA 4YFMA 1FOFA 5EVID 4WMCD 3W8KA 4N1HA 1LHYA 5FASA 1BULA 1TEMA 5CERA 3P98A 1YLWA 4R23A 1FR1A 3PBOA 2Y2OA 5EVLA 1XA1A 4OLGA 4QD4A 4PM6A 3V3RA 1JVJA 4QHCA 5FAPA 3DWKA 1Q2PA 1ESIA 3C4OA 4LCMA 5L2FA 1YLZA 3ZGAB 3VSKA 4PM5A 2H0TA 2WZZA 3C7UA 4GNUA 3VOYA 4B88A 4PM8A 4EBLA 1SCWA 5D3OA 3EQVA 1W8YA 1AXBA 1O7EA 3BFFA 4OOMA 2X02A 4WM9A 4XUZA 4WZ5A 4BJPA 3M6BA 4N1XA 5EOEA 3FWLA 2IWBA 1G6AA 1NYYA 3NI9A 4OH0A 1W5DA 1QMFA 2UWXA 2ZM2A 4B4ZA 3VP2A 2Z2MB 4Y0TA 5FAOA 2WUQA 2XEPA 4LV3A 1KVMA 2Y2IA 3VP0A 4DF6A 4QJGA 4P85A 4RX3A 4UA6A 5KSCA 1MKIA 2ZQ9A 1YLJA 4A5RA 4CJNA 2OLUA 4EBNA 1BLPA 2Y2JA 3N8SA 1PW1A 5AQ7A 1H5XA 1E4DA 1MWRA 4BQMA 3HLEA 4RVAA 3QNBA 1XA7A 3PBNA 5E43A 4GDNA 4OPQA 3AGFA 1H8ZA 2HP6A 3I7JA 3VFFA 3HBRA 4QB8A 1E3UD 4BENA 1CK3A 2EXAA 3GMWA 4KZ9A 4OPZA 3G34A 5HAPA 4E3MA 2Y2PA 2Y2LA 3ZFZA 4X53A 4OOYA 4PMAA 1CEFA 3NIAA 1FSWA 4QY5A 3UDXA 4KG5A 2Y2MA 3N7WA 4WELA 2EX9A 1IEMA 1W8QA 2XFTA 4FCFA 3CZDA 4F94A 1NYMA 1DJBA 1FCNA 1HTZA 3HREA 3LY4A 3O3VA 2Y55A 1EROA 3FYZA 4EUZA 1PI5A 3IXHA 3E2LA 2P9VB 4WEKA 3LO7A 2XK1A 3SS4A 1PWGA 5CHUA 2V20A 3WRTA 5TGFA 2EX2A 1LI0A 2H5SA 4R0QA 4S2JA 3BLSA 5HARA 1BLCA 2QMIA 2BLSA 5A91A 3RXXA 4KZ7A 1KVLA 5GHZA 1W7FA 1TDGA 5A92A 5FI6A 1I5QA 3E2KA 4QU3A 5DTTA 2CC1A 5CRFA 3HLCA 2R9XA 3VMAA 2V1ZA 4K91A 2JBFA 2ZC6B 1L0EA 3HUMA 4IEDA 4E6XA 4JKTA 1KE4A 2Z2LB 1BLHA 3IQAA 3LCEA 3OCNA 4KZBA 3BFCA 4OPYA 3VSLA 2BG1A 3MZEA 3OC2A 1I2SA 4KZ6A 4X68A 1K38A 3V3SA 5DTKA 2R9WA 1NJ4A 3WS2A 3UNWA 1FCOA 3UO9A 1CI8A 1PWCA 3ZVTA 2IWDA 3AGDA 4ID4A 4DE1A 1SKFA 1YLYA 4KZAA 5AQ9A 2XLNA 5FATA 3SH8A 1Z6FA 2DRWA 4BL3A 4JF6A 2ZM8A 1GHPA 3HL9A 3MXSA 4GKUA 4R4RA 4RX2A 3DW0A 3UDIA 1JWPA 1IKGA 4N9KA 3O86A 5FI2A 1ERQA 3Q81A 4HBUA 5GHYA 3IHAA 1PI4A 1IELA 1N4OA 3GR2A 4ZJ2A 5DVAA 5HL1A 3EQUA 4X69A 3O87A 2X01A 4ZTKA 3HVFA 4QY6A 3V5MA 3S1YA 3P09A 2FFYA 5HX9A 5GLBA 1PZOA 4ZJ1A 3HLBA 1PW8A 3ZG9B 1JWZA 4JXGA 4P6BA 4DE0A 1ONGA 3SOIA 3IF6C 3NY4A 1KDWA 1YM1A 2HP9A 1C3BA 3B3XA 3MZFA 1XX2A 3IH9A 3OPRA 3Q7VA 2J8YA 1L0FA 3MFDA 4DDSA 4EBPA 4DXBA 5JYPA 3FKVA 4R4SA 2DNSA 1LLBA 2ZQAA 3CG5A 3IWOA 3MKFA 4P0MA 5CEBA 2Y59A 3UPPA 1XGJA 4DXCA 3LEZA 1K25A 1MY8A 3IT9A 2Y2QA 5F1GA 4B4XA 3G4PA 2HDQA 3C4PA 3V50A 1GA9A 2VGJA 2VGKA 3IF5A 4ZAMA 3UDFA 3AGEA 1VQQA 3CJMA 2ZC4B 3FZCA 1BSGA 4Y7PA 3PTEA 2XGNA 1BUEA 2DCFA 2JCHA 3OPLA 3HUNA 1K4EA 1WYCA 3IXGA 4S2MA 3SH9A 2ZQDA 1VM1A 3BRMA 5E2EA 4EQIA 1PZPA 4UHUA 5A93A 4IVKA 4MNRA 2OSUA 4MEZA 1S6RA 1O07A 1M40A 4GZBA 4JF4A 1K4FA 3A3EA 4U3TA 5KZHA 4KQRA 3IXBA 3MBZA 3PBTA 4U0XA 1BZAA 3N6IA 4MBFA 2XDMA 4C3QA 4WEJA 4XXRA 3IH8A 5CTNA 1MWUA 5I94A 1GHMA 3FKWA 4JXVA 5M1AA 1GHIA 2XFSA 4R1GA 3UE0A 4E3NA 3FV7A 1KGFA 2WGVA 2Y2NA 5EVIC 1YLTA 5EVIA 3NDEA 4S2IA 5E2HA 3ZVWA 2J9PA 3VOZA 4WBGA 1RCJA 1S0WA 4ZDXA 1K54C 1QMEA 2EFUA 3A3DA 2WADA 4OOLA 4DRTA 4CPKA 1HZOA 3C5AA 2H0YA 3QHYA 4X56A 3BEBA 2V2FF 4FD8A 1MWSA 2QPNA 1RP5A 3HLFA 4R3JA 1XXMA 2WGIA 3G2ZA 5FQJA 1NZUA 3ITAA 2I72A 4PM9A 1FR6A 1FSYA 4GOGA 4E6WA 1XP4A 1KDSA 3RXWA 4LV2A 4KENB 4DKIA 3Q7ZA 1SHVA 3CMZA 1KGGA 1YMXA 2G2UA 4E3LA 2J7VA 5CGXA 4S2NC 1KE3A 3ZHHA 4S2NA 4OQ0A 5JYOA 3ZG5A 3Q82A 4OQIA 2WAEA 4LCLA 1NXYA 4X55A 1LL9A 1E25A 4JXWA 2P74A 1DJAA 3ZDJA 4ZJ3A 3PBQA 5GLDA 2WKIA 4OKPA 3UE3A 1EI5A 3G31A 3PBRA 3Q7VB 1K55C 3HLWA 4IVIA 3OZHA 5FSRA 1ES5A 1L2SA 1J9MA 3Q07A 1GA0A 4S2LA 3VFHA 5A90A 3G32A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N9B A;  5FQ9 A;  1ONH A;  3IWQ A;  4NET A;  2XF3 A;  3A3J A;  4X6T A;  2ZQ7 A;  1WYB A;  1SDE A;  1ZG4 A;  1Q2Q A;  2HDR A;  5HFO A;  3W4P A;  5FQK A;  3M6H A;  1PIO A;  3HLG A;  4E3O A;  2WKH A;  4IBX A;  4UAA A;  3VP4 A;  3N4I A;  1NY0 A;  1E3U A;  2ZC3 B;  2ZQC A;  4GN2 A;  3VP3 A;  1KGE A;  2Y4A A;  4KZ5 A;  5CHJ A;  4M3K A;  4IBR A;  3MZD A;  4BLM A;  2XR0 A;  4HES A;  4Y0U A;  4E3K A;  4HBT A;  1K56 A;  5HW3 A;  4MBK A;  1ZC2 A;  4GD6 A;  4Y0O A;  3HUO A;  3WWX A;  1Y54 A;  1WE4 A;  1PYY A;  4S2K A;  2WAF A;  2JE5 A;  4L0L A;  2EFX A;  3ITB A;  2OLV A;  4FH4 A;  1XGI A;  1DJC A;  3OPH A;  4OP5 A;  3C7V A;  3DWZ A;  3IF6 A;  5CED A;  4ZBE A;  3GSG A;  3JYI A;  3SH7 A;  3OPP A;  1L0G A;  4JLF A;  1ESU A;  1XKZ A;  4GB7 A;  2PBY A;  3QNC A;  4E3I A;  3BYD A;  2Y2G A;  1TVF A;  5FQM A;  1RGZ A;  3MXR A;  4JPM A;  1FQG A;  4KZ4 A;  4RA7 A;  3UN7 A;  5EVI B;  2H10 A;  1MBL A;  3PAE A;  5TR7 A;  4OP8 A;  2ZC7 A;  3NBL A;  4OQG A;  3NC8 A;  5DTS A;  3UE1 A;  3D4F A;  5IHV A;  4O7D A;  4BD1 A;  3NDG A;  2HP5 A;  2XQZ A;  4LV0 A;  5GLA A;  5E2F A;  4BL2 A;  4OQH A;  1ES4 A;  1PWD A;  1LL5 A;  3PAG A;  1BTL A;  3WS4 A;  2A49 A;  1OME A;  1ES2 A;  1FCM A;  2ZQ8 A;  2EX8 A;  1GCE A;  4DE3 A;  4KZ3 A;  1ALQ A;  3ZNT A;  2ZD8 A;  5M18 A;  5EOO A;  2RL3 A;  4WZ5 C;  1MWT A;  2ZC5 B;  5EE8 A;  5AQB A;  5CEC A;  2Q9N A;  4XUX A;  2WGW A;  2IWC A;  2XD5 A;  4EWF A;  1NRF A;  3RJU A;  4LV1 A;  1IKI A;  2EX6 A;  2C6W B;  5BOH A;  4K0W A;  4JF5 A;  5HAQ A;  1MXO A;  4YIN A;  1YMS A;  2GDN A;  3GV9 A;  5FA7 A;  3ISG A;  1K6R A;  3ZG7 B;  2ZJ9 A;  3N8R A;  5CHM A;  4NK3 A;  3MKE A;  3G30 A;  4WMC A;  2PU4 A;  3OCL A;  4KZ8 A;  2EXB A;  3SS5 A;  4E3J A;  3UPN A;  1K54 A;  1MPL A;  2OV5 A;  4PM7 A;  5CXW A;  1JTG A;  4D2O A;  4WYY A;  3VP1 A;  3DTM A;  4KQQ A;  1IYP A;  3GTC A;  4UA7 A;  3BLM A;  4KG2 A;  2Y2K A;  2B5R A;  4RYE A;  1DY6 A;  5J8X A;  3GVB A;  5DF7 A;  4GDB A;  3ZG8 B;  1CEG A;  1XPB A;  3IHB A;  3N8L A;  1EWZ A;  1BT5 A;  2WZX A;  3ZCZ A;  4U0T A;  4MLL A;  2ZMA A;  4OLD A;  2J9O A;  2ZLY A;  4GD8 A;  2G2W A;  1K56 D;  5FQQ A;  1KE0 A;  1IYQ A;  4WZ4 A;  3NCK A;  1L0D A;  3G35 A;  4S2O A;  1RGY A;  2E8I A;  1IYO A;  3WS5 A;  5EEC A;  2HPB A;  5EUA A;  1ERM A;  3BM6 A;  3G2Y A;  2PU2 A;  3IF6 B;  4P87 A;  5F82 A;  3BEC A;  4Z9Q A;  4C6Y A;  3UY6 A;  1M6K A;  1K55 A;  5DF9 A;  5EPH A;  4R3B A;  3WS1 A;  1NZO A;  2C5W B;  3S22 A;  4OON A;  2ZM0 A;  5FQI A;  1TDL A;  3HLD A;  5G18 A;  2WYX A;  2XD1 A;  1BLS A;  4JBF A;  1YLP A;  1H8Y A;  4LEN A;  5FDH A;  4S2P A;  5DF8 A;  1U60 A;  3BFG A;  5KSH A;  1IYS A;  3IXD A;  5U47 A;  5M19 A;  3TSG A;  5F83 A;  3ZG0 A;  2Q9M A;  5E2G A;  1YT4 A;  1LI9 A;  3WRZ A;  3TG9 A;  1CI9 A;  4PPR A;  1JTD A;  1HD8 A;  3BFE A;  2Y91 A;  5AQA A;  5FAQ A;  1ZG6 A;  4UA9 A;  3UPO A;  4KG6 A;  3W4Q A;  4Q8I A;  3V39 A;  5CGS A;  2WK0 A;  1K57 C;  1K6S A;  2A3U A;  5TFQ A;  1K57 A;  2FFF B;  1HVB A;  2XH9 A;  3M2K A;  3PBS A;  3M2J A;  4JXS A;  4N9L A;  3TOI A;  3ZNY A;  1W79 A;  3LY3 A;  2QZ6 A;  3BFD A;  4C75 A;  3A3F A;  3GQZ A;  4HEF A;  3WS0 A;  4DE2 A;  2RCX A;  4FH2 A;  1ZKJ A;  2Y2H A;  4MBH A;  1ES3 A;  5FI7 A;  4OPR A;  5KMW A;  3S4X A;  1SDN A;  2WGW B;  5HAI A;  4DDY A;  5GL9 A;  2P9V A;  4K0X A;  3W4O A;  1G68 A;  1YQS A;  3O88 A;  4N92 A;  5GHX A;  4OVD A;  5CGW A;  2WKE A;  4BD0 A;  5GLC A;  5CTM A;  2X71 A;  4KQO A;  5F1F A;  4EV4 A;  4H8R A;  3SS3 A;  3A3I A;  3Q1F A;  1JWV A;  4FSF A;  2JC7 A;  2HDS A;  2HDU A;  3GRJ A;  3IWI A;  1I2W A;  4YFM A;  1FOF A;  5EVI D;  4WMC D;  3W8K A;  4N1H A;  1LHY A;  5FAS A;  1BUL A;  1TEM A;  5CER A;  3P98 A;  1YLW A;  4R23 A;  1FR1 A;  3PBO A;  2Y2O A;  5EVL A;  1XA1 A;  4OLG A;  4QD4 A;  4PM6 A;  3V3R A;  1JVJ A;  4QHC A;  5FAP A;  3DWK A;  1Q2P A;  1ESI A;  3C4O A;  4LCM A;  5L2F A;  1YLZ A;  3ZGA B;  3VSK A;  4PM5 A;  2H0T A;  2WZZ A;  3C7U A;  4GNU A;  3VOY A;  4B88 A;  4PM8 A;  4EBL A;  1SCW A;  5D3O A;  3EQV A;  1W8Y A;  1AXB A;  1O7E A;  3BFF A;  4OOM A;  2X02 A;  4WM9 A;  4XUZ A;  4WZ5 A;  4BJP A;  3M6B A;  4N1X A;  5EOE A;  3FWL A;  2IWB A;  1G6A A;  1NYY A;  3NI9 A;  4OH0 A;  1W5D A;  1QMF A;  2UWX A;  2ZM2 A;  4B4Z A;  3VP2 A;  2Z2M B;  4Y0T A;  5FAO A;  2WUQ A;  2XEP A;  4LV3 A;  1KVM A;  2Y2I A;  3VP0 A;  4DF6 A;  4QJG A;  4P85 A;  4RX3 A;  4UA6 A;  5KSC A;  1MKI A;  2ZQ9 A;  1YLJ A;  4A5R A;  4CJN A;  2OLU A;  4EBN A;  1BLP A;  2Y2J A;  3N8S A;  1PW1 A;  5AQ7 A;  1H5X A;  1E4D A;  1MWR A;  4BQM A;  3HLE A;  4RVA A;  3QNB A;  1XA7 A;  3PBN A;  5E43 A;  4GDN A;  4OPQ A;  3AGF A;  1H8Z A;  2HP6 A;  3I7J A;  3VFF A;  3HBR A;  4QB8 A;  1E3U D;  4BEN A;  1CK3 A;  2EXA A;  3GMW A;  4KZ9 A;  4OPZ A;  3G34 A;  5HAP A;  4E3M A;  2Y2P A;  2Y2L A;  3ZFZ A;  4X53 A;  4OOY A;  4PMA A;  1CEF A;  3NIA A;  1FSW A;  4QY5 A;  3UDX A;  4KG5 A;  2Y2M A;  3N7W A;  4WEL A;  2EX9 A;  1IEM A;  1W8Q A;  2XFT A;  4FCF A;  3CZD A;  4F94 A;  1NYM A;  1DJB A;  1FCN A;  1HTZ A;  3HRE A;  3LY4 A;  3O3V A;  2Y55 A;  1ERO A;  3FYZ A;  4EUZ A;  1PI5 A;  3IXH A;  3E2L A;  2P9V B;  4WEK A;  3LO7 A;  2XK1 A;  3SS4 A;  1PWG A;  5CHU A;  2V20 A;  3WRT A;  5TGF A;  2EX2 A;  1LI0 A;  2H5S A;  4R0Q A;  4S2J A;  3BLS A;  5HAR A;  1BLC A;  2QMI A;  2BLS A;  5A91 A;  3RXX A;  4KZ7 A;  1KVL A;  5GHZ A;  1W7F A;  1TDG A;  5A92 A;  5FI6 A;  1I5Q A;  3E2K A;  4QU3 A;  5DTT A;  2CC1 A;  5CRF A;  3HLC A;  2R9X A;  3VMA A;  2V1Z A;  4K91 A;  2JBF A;  2ZC6 B;  1L0E A;  3HUM A;  4IED A;  4E6X A;  4JKT A;  1KE4 A;  2Z2L B;  1BLH A;  3IQA A;  3LCE A;  3OCN A;  4KZB A;  3BFC A;  4OPY A;  3VSL A;  2BG1 A;  3MZE A;  3OC2 A;  1I2S A;  4KZ6 A;  4X68 A;  1K38 A;  3V3S A;  5DTK A;  2R9W A;  1NJ4 A;  3WS2 A;  3UNW A;  1FCO A;  3UO9 A;  1CI8 A;  1PWC A;  3ZVT A;  2IWD A;  3AGD A;  4ID4 A;  4DE1 A;  1SKF A;  1YLY A;  4KZA A;  5AQ9 A;  2XLN A;  5FAT A;  3SH8 A;  1Z6F A;  2DRW A;  4BL3 A;  4JF6 A;  2ZM8 A;  1GHP A;  3HL9 A;  3MXS A;  4GKU A;  4R4R A;  4RX2 A;  3DW0 A;  3UDI A;  1JWP A;  1IKG A;  4N9K A;  3O86 A;  5FI2 A;  1ERQ A;  3Q81 A;  4HBU A;  5GHY A;  3IHA A;  1PI4 A;  1IEL A;  1N4O A;  3GR2 A;  4ZJ2 A;  5DVA A;  5HL1 A;  3EQU A;  4X69 A;  3O87 A;  2X01 A;  4ZTK A;  3HVF A;  4QY6 A;  3V5M A;  3S1Y A;  3P09 A;  2FFY A;  5HX9 A;  5GLB A;  1PZO A;  4ZJ1 A;  3HLB A;  1PW8 A;  3ZG9 B;  1JWZ A;  4JXG A;  4P6B A;  4DE0 A;  1ONG A;  3SOI A;  3IF6 C;  3NY4 A;  1KDW A;  1YM1 A;  2HP9 A;  1C3B A;  3B3X A;  3MZF A;  1XX2 A;  3IH9 A;  3OPR A;  3Q7V A;  2J8Y A;  1L0F A;  3MFD A;  4DDS A;  4EBP A;  4DXB A;  5JYP A;  3FKV A;  4R4S A;  2DNS A;  1LLB A;  2ZQA A;  3CG5 A;  3IWO A;  3MKF A;  4P0M A;  5CEB A;  2Y59 A;  3UPP A;  1XGJ A;  4DXC A;  3LEZ A;  1K25 A;  1MY8 A;  3IT9 A;  2Y2Q A;  5F1G A;  4B4X A;  3G4P A;  2HDQ A;  3C4P A;  3V50 A;  1GA9 A;  2VGJ A;  2VGK A;  3IF5 A;  4ZAM A;  3UDF A;  3AGE A;  1VQQ A;  3CJM A;  2ZC4 B;  3FZC A;  1BSG A;  4Y7P A;  3PTE A;  2XGN A;  1BUE A;  2DCF A;  2JCH A;  3OPL A;  3HUN A;  1K4E A;  1WYC A;  3IXG A;  4S2M A;  3SH9 A;  2ZQD A;  1VM1 A;  3BRM A;  5E2E A;  4EQI A;  1PZP A;  4UHU A;  5A93 A;  4IVK A;  4MNR A;  2OSU A;  4MEZ A;  1S6R A;  1O07 A;  1M40 A;  4GZB A;  4JF4 A;  1K4F A;  3A3E A;  4U3T A;  5KZH A;  4KQR A;  3IXB A;  3MBZ A;  3PBT A;  4U0X A;  1BZA A;  3N6I A;  4MBF A;  2XDM A;  4C3Q A;  4WEJ A;  4XXR A;  3IH8 A;  5CTN A;  1MWU A;  5I94 A;  1GHM A;  3FKW A;  4JXV A;  5M1A A;  1GHI A;  2XFS A;  4R1G A;  3UE0 A;  4E3N A;  3FV7 A;  1KGF A;  2WGV A;  2Y2N A;  5EVI C;  1YLT A;  5EVI A;  3NDE A;  4S2I A;  5E2H A;  3ZVW A;  2J9P A;  3VOZ A;  4WBG A;  1RCJ A;  1S0W A;  4ZDX A;  1K54 C;  1QME A;  2EFU A;  3A3D A;  2WAD A;  4OOL A;  4DRT A;  4CPK A;  1HZO A;  3C5A A;  2H0Y A;  3QHY A;  4X56 A;  3BEB A;  2V2F F;  4FD8 A;  1MWS A;  2QPN A;  1RP5 A;  3HLF A;  4R3J A;  1XXM A;  2WGI A;  3G2Z A;  5FQJ A;  1NZU A;  3ITA A;  2I72 A;  4PM9 A;  1FR6 A;  1FSY A;  4GOG A;  4E6W A;  1XP4 A;  1KDS A;  3RXW A;  4LV2 A;  4KEN B;  4DKI A;  3Q7Z A;  1SHV A;  3CMZ A;  1KGG A;  1YMX A;  2G2U A;  4E3L A;  2J7V A;  5CGX A;  4S2N C;  1KE3 A;  3ZHH A;  4S2N A;  4OQ0 A;  5JYO A;  3ZG5 A;  3Q82 A;  4OQI A;  2WAE A;  4LCL A;  1NXY A;  4X55 A;  1LL9 A;  1E25 A;  4JXW A;  2P74 A;  1DJA A;  3ZDJ A;  4ZJ3 A;  3PBQ A;  5GLD A;  2WKI A;  4OKP A;  3UE3 A;  1EI5 A;  3G31 A;  3PBR A;  3Q7V B;  1K55 C;  3HLW A;  4IVI A;  3OZH A;  5FSR A;  1ES5 A;  1L2S A;  1J9M A;  3Q07 A;  1GA0 A;  4S2L A;  3VFH A;  5A90 A;  3G32 A; 
#chains in the Genus database with same CATH topology
 1N9B A;  5FQ9 A;  3IWQ A;  3BQA A;  2P7J A;  3M6H A;  4E3O A;  4IBX A;  4R38 A;  1KGE A;  4KZ5 A;  5CHJ A;  4M3K A;  3GEC A;  4E3K A;  5HW3 A;  1UGU A;  4QPR A;  3B33 A;  3WWX A;  1PYY A;  4RQ9 A;  2M1C A;  4S2K A;  4L0L A;  3LR3 A;  3ITB A;  1JNU A;  4ZBE A;  3GSG A;  2VK3 A;  3SH7 A;  2VKS A;  3DAV A;  4WLA A;  2YKH A;  1TVF A;  1RGZ A;  2O9B A;  1LSV A;  3PAE A;  2W1T B;  4OP8 A;  3EGD C;  5DTS A;  3NC8 A;  4BBV A;  3SZT A;  3A0S A;  5DFX A;  4BD1 A;  2HP5 A;  2XQZ A;  5L8M A;  5TBM B;  5E2F A;  1PWD A;  3PAG A;  1BTL A;  1FIL A;  1TS7 A;  2A49 A;  3LIB A;  1DRM A;  2ZQ8 A;  2EX8 A;  1GCE A;  5EM1 A;  4DE3 A;  5M18 A;  5AQB A;  2ZOH A;  5DFY A;  3RJU A;  4LV1 A;  5F6A A;  2EX6 A;  3HJK A;  4YIN A;  1YMS A;  2FH5 A;  3ZG7 B;  5AVF A;  4YOF A;  2XRO A;  3OCL A;  4KUK A;  5CXW A;  4D2O A;  3DTM A;  4HY8 A;  4UA7 A;  3BLM A;  2ZOI A;  2B5R A;  4XT2 B;  1GSX A;  1OPX A;  5DF7 A;  4WF0 A;  5IT5 A;  1CEG A;  3N8L A;  1EWZ A;  1PNE A;  4U0T A;  2W3F A;  4OLD A;  3QP8 A;  2NUT C;  5FQQ A;  1IYQ A;  3NCK A;  4S2O A;  3WS5 A;  3OOV A;  2HPB A;  2K2N A;  3MS6 A;  1XJ2 A;  5J3W A;  4DJ2 A;  4NXE A;  5F82 A;  3IF6 B;  2XSS A;  4Z9Q A;  4I3I A;  4C6Y A;  1M6K A;  1K55 A;  5DF9 A;  3WS1 A;  4R3B A;  3D3O A;  3S22 A;  1TDL A;  5G18 A;  1MC0 A;  1H8Y A;  1SKO A;  3T4L A;  1IYS A;  2M7V A;  2Q9M A;  4GHI B;  1YT4 A;  1LI9 A;  5E2G A;  3WRZ A;  5AQA A;  3W4Q A;  3V39 A;  5CGS A;  1EW0 A;  1K57 C;  1K57 A;  1S66 L;  1HVB A;  3M2K A;  4JXS A;  5A93 A;  3R4K A;  3F1P A;  1W79 A;  2QZ6 A;  1YKD A;  1ZKJ A;  1ES3 A;  5KMW A;  1W63 Q;  3BJN A;  1SDN A;  4DDY A;  4R3A A;  5GL9 A;  2P9V A;  5HZH A;  3KX0 X;  4OVD A;  2WKE A;  3T1Q B;  4BD0 A;  1P9R A;  3TE8 A;  3T4K A;  3SS3 A;  4KQD A;  1P0Z A;  1BYW A;  4WMC D;  3W8K A;  1LHY A;  1YLW A;  4R23 A;  1FR1 A;  1V9Z A;  3MXQ A;  5EVL A;  1XA1 A;  4HI4 A;  2JKT M;  4QHC A;  3C4O A;  3ZGA B;  1H0M A;  4IUK A;  1SCW A;  5EV0 A;  1AXB A;  1O7E A;  5K5B A;  4WZ5 A;  5EOE A;  1G6A A;  1S1Z A;  1W5D A;  3B47 A;  2WKP A;  3C2W A;  2WUQ A;  3OBF A;  3VP0 A;  4CJN A;  5J7E A;  4Y13 A;  3N8S A;  1PW1 A;  3HLE A;  1XA7 A;  2VX8 A;  3LR5 A;  1H8Z A;  1E3U D;  2EXA A;  4KZ9 A;  2KX6 A;  3F1N A;  4E3M A;  3EWK A;  1D7E A;  3NIA A;  2PR6 A;  3IX3 A;  4KG5 A;  2XFT A;  4FCF A;  3CZD A;  3F1O B;  3RTY A;  2Y55 A;  3FC7 A;  1PI5 A;  3IXH A;  1PWG A;  3WRT A;  3FPV A;  2L1M A;  3HJI A;  3KSG A;  3BLS A;  3RXX A;  3EGX C;  5GHZ A;  1W7F A;  3R7W B;  3E2K A;  1XJ4 A;  4M4X A;  2V1Z A;  2JBF A;  2ZC6 B;  3HUM A;  3W2Z A;  5HDC A;  2HZ5 A;  4O0P A;  4KZB A;  3LCE A;  2BG1 A;  3MZE A;  3OC2 A;  4X68 A;  1OT6 A;  1NJ4 A;  3UNW A;  3UO9 A;  1CI8 A;  4K08 A;  2IWD A;  4DE1 A;  4KZA A;  2KDK A;  3K2N A;  4JGP A;  2A2L A;  2DRW A;  3MXS A;  4GKU A;  3DW0 A;  3UDI A;  1IKG A;  4Z1W A;  4EW7 A;  3IHA A;  1N4O A;  1OT9 A;  3P7N A;  4ZTK A;  4QY6 A;  3V5M A;  3S1Y A;  2FFY A;  1L3L A;  3BWL A;  4NXF A;  1ONG A;  1DP8 A;  3IH9 A;  1OJG A;  3UB6 A;  1XJ3 A;  1L0F A;  3MFD A;  4DXB A;  3FKV A;  4R4S A;  3IWO A;  2ZMV A;  5CEB A;  1S4S A;  3UB9 A;  2Y2Q A;  5F1G A;  4B4X A;  3BW6 A;  2VGJ A;  4ZAM A;  4MDZ A;  5FL3 A;  1BSG A;  4Y7P A;  3PTE A;  5L10 A;  2DCF A;  5F69 A;  2JCH A;  3OPL A;  3HUN A;  1K4E A;  1WYC A;  3MR0 A;  4IUH A;  1D06 A;  3LI9 A;  4IVK A;  2OSU A;  1O07 A;  1M40 A;  2IA2 A;  4JF4 A;  2PAV P;  3MBZ A;  5FEF A;  4R1G A;  2KLI A;  3FPW A;  2Z6C A;  1S0W A;  2EFU A;  4CPK A;  1GSW A;  3C5A A;  5HDS A;  2H0Y A;  3QHY A;  3BEB A;  3HLF A;  4Y15 A;  5FQJ A;  5DKK A;  4PM9 A;  4E6W A;  3RXW A;  4LV2 A;  3Q7Z A;  1SHV A;  3CMZ A;  5CX7 A;  1YMX A;  2G2U A;  4S2N C;  1KE3 A;  4S2N A;  5JYO A;  3NOU C;  2Y79 A;  4EER A;  4PKY A;  4HHD A;  1NXY A;  4JXW A;  3KSH A;  4D60 A;  2PBD P;  5GLD A;  4OKP A;  1EI5 A;  3OZH A;  2K31 A;  1ACF A;  3Q07 A;  1GA0 A;  4MN7 A;  4ARZ B;  3G32 A;  4X6T A;  3A3J A;  3H7W B;  1LT0 A;  2INW A;  1Q2Q A;  4DJ3 A;  4B9O A;  3HLG A;  2B18 A;  4UAA A;  1E3U A;  2ZC3 B;  4WUJ A;  4YWZ A;  3LFV A;  3LR0 A;  4PHT A;  4BBT A;  3GDI A;  4IBR A;  4BLM A;  4HBT A;  1K56 A;  2V1A A;  4MBK A;  1T1C A;  4GD6 A;  2JE5 A;  4CLC B;  2EFX A;  2OWJ A;  4FH4 A;  2PD8 A;  3O5Y A;  3NOT C;  5CED A;  2QHK A;  2JKR I;  4I5S A;  3QNC A;  4ARZ A;  5FQM A;  3MXR A;  4RA7 A;  3H7W A;  1MBL A;  5TR7 A;  1TD5 A;  2ZC7 A;  3D4F A;  5IHV A;  1OTI A;  3QP2 A;  4JGR A;  5EVE A;  4OQH A;  1MKM A;  1FCM A;  4CLC A;  2ZD8 A;  5CEC A;  2Q9N A;  2WGW A;  2IWC A;  2O0Y A;  2XD5 A;  3MF0 A;  4HH2 A;  1NRF A;  3C8C A;  3E0Y A;  4K0W A;  2Z6D A;  3LYX A;  1D1J A;  5FA7 A;  3GV9 A;  4H6J B;  3IX8 A;  2ZJ9 A;  5CHM A;  3MKE A;  4MN6 A;  4PM7 A;  1JTG A;  4WYY A;  4EEP A;  1IYP A;  5FDS A;  4RYE A;  5J8X A;  3GVB A;  1X0O A;  3IHB A;  1BT5 A;  2WZX A;  3LIE A;  3ZCZ A;  2UV0 E;  2O9C A;  4GD8 A;  1KE0 A;  1FIK A;  4EEU A;  3G35 A;  1IYO A;  2ACG A;  1UWP X;  3BM6 A;  3ZQ5 A;  2R78 A;  5DKL A;  1XFQ A;  1NZO A;  3LGO A;  2ZM0 A;  3HLD A;  2V8C A;  2JKF A;  1F98 A;  2JKG A;  3UE6 A;  2WKR A;  4LEN A;  5KSH A;  3TSG A;  2XA7 S;  1NLZ A;  2VGL S;  3TG9 A;  3PR6 A;  1JTD A;  5FAQ A;  4UA9 A;  4I39 A;  3UPO A;  3KYE A;  4PAU A;  2FFF B;  3TOI A;  3ZNY A;  2ZL1 B;  2HF6 A;  3LY3 A;  3WS0 A;  2RCX A;  2I9V A;  2Y2H A;  4MBH A;  4O01 A;  3W4O A;  1G68 A;  1YQS A;  3O88 A;  4N92 A;  4X25 A;  3H9W A;  5GHX A;  5CGW A;  4F3L B;  4HQA A;  5CTM A;  2X71 A;  4CLC E;  3VV4 A;  3ZYT A;  5EVI D;  1MZU A;  1BUL A;  3QP1 A;  3E4P A;  1TF1 A;  3PBO A;  2JHE A;  1TS6 A;  4OLG A;  4BMW A;  5KIZ A;  1VEU B;  1YLZ A;  4IJG A;  4EES A;  2JN7 A;  3T1R A;  2ZL1 A;  4PM8 A;  5D3O A;  3EQV A;  2X02 A;  1AWI A;  3BY9 A;  3FWL A;  5F5Y A;  3NI9 A;  4OH0 A;  1QMF A;  4B4Z A;  4F3L A;  3KYQ A;  2Z2M B;  2XEP A;  4QJG A;  3LUQ A;  5KSC A;  3LR4 A;  2ZQ9 A;  4EBN A;  2OLU A;  5AQ7 A;  1H5X A;  1MWR A;  4BQM A;  4Q0H A;  1IFQ A;  4RVA A;  1SKO B;  4FUW A;  5E43 A;  3AGF A;  2HP6 A;  3VFF A;  1VEU A;  2V0U A;  4QB8 A;  3GMW A;  3G34 A;  4FTX A;  2Y2P A;  4X53 A;  1FSW A;  4QY5 A;  4P6Z M;  2W0N A;  2Y2M A;  2EX9 A;  2ZMF A;  3F1P B;  4UEY A;  1NYM A;  1DJB A;  1FCN A;  1HTZ A;  3HRE A;  3MSH A;  1ERO A;  3EOI A;  2P9V B;  4WEK A;  4PKY G;  5CHU A;  2EX2 A;  1LI0 A;  1H8M A;  3TRC A;  3KO6 A;  3MQ0 A;  3SW1 A;  5HAR A;  1BLC A;  2BLS A;  2KOI A;  5A92 A;  2XRN A;  5FI6 A;  4QU3 A;  5DTT A;  5CRF A;  3VMA A;  4K91 A;  1N9L A;  2Z2L B;  3IQA A;  4OPY A;  1I2S A;  3V3S A;  3WS2 A;  1FCO A;  4HJ4 A;  3ZVT A;  1SKF A;  2V1B A;  1GHP A;  1Z09 A;  4RX2 A;  2J3T D;  1UWN X;  3Q81 A;  5GHY A;  1IEL A;  3GR2 A;  4L9G A;  2X01 A;  5HWV A;  1LSX A;  3MQQ A;  2J80 A;  3HLB A;  3ZG9 B;  1JWZ A;  4JXG A;  4P6B A;  3IF6 C;  3NY4 A;  1YM1 A;  1C3B A;  3B3X A;  3Q7V A;  4R6L A;  4DDS A;  4EBP A;  2DNS A;  1LLB A;  2ZQA A;  3F1N B;  1XGJ A;  1P97 A;  3IT9 A;  1CF0 A;  3C4P A;  1GA9 A;  2VGK A;  3IF5 A;  3FZC A;  2XA7 M;  3IXG A;  4S2M A;  3SH9 A;  1VM1 A;  4EQI A;  4UHU A;  3VE4 A;  4BBU A;  4U3T A;  3A3E A;  1YSP A;  4KQR A;  4ETZ A;  2CMN A;  3N6I A;  2XDM A;  4WEJ A;  4XXR A;  5I94 A;  1GHM A;  3FKW A;  4JXV A;  3A0V A;  1KGF A;  2Y2N A;  5EVI C;  5EVI A;  4S2I A;  5E2H A;  3ZVW A;  2J9P A;  4WBG A;  1RCJ A;  4ZDX A;  1K54 C;  4X1M A;  2WAD A;  4DRT A;  1MWS A;  1IOU A;  1NZU A;  2I72 A;  1FR6 A;  3NHQ A;  1W63 M;  4UQI S;  2K7S A;  5CGX A;  4OQ0 A;  2HJ9 C;  3Q82 A;  3TW8 A;  4X55 A;  1LL9 A;  1E25 A;  3ZDJ A;  3UE3 A;  3LID A;  5EM0 A;  1ES5 A;  3U4L P;  3NUL A;  4AFI A;  4S2L A;  4EXO A;  3VFH A;  5A90 A;  3KSI A;  1ONH A;  4NET A;  2XF3 A;  2ZQ7 A;  1WYB A;  1ZG4 A;  2HDR A;  4GLQ A;  5HFO A;  2W27 A;  1PIO A;  3VP4 A;  3N4I A;  1NY0 A;  1T18 A;  4GN2 A;  1NLY A;  2Y4A A;  4NKP A;  3MZD A;  3S7P A;  4HES A;  2MJ6 A;  2ZBB A;  4Y0O A;  3CIT A;  3HUO A;  1Y54 A;  2H28 A;  1WE4 A;  4L9E A;  3S7O A;  2WAF A;  3OPH A;  4OP5 A;  3DWZ A;  4GCZ A;  2QWS A;  4JLF A;  4ZRR A;  4GB7 A;  4E3I A;  3BYD A;  2Y2G A;  4HJ6 A;  4JPM A;  4KZ4 A;  2VA0 A;  2VV8 A;  1PRQ A;  3NBL A;  3UE1 A;  3NDG A;  4LV0 A;  5GLA A;  2B95 A;  4IHQ A;  4BL2 A;  2J3W A;  1ES4 A;  3WS4 A;  3LI8 A;  2J3T C;  3ZNT A;  3UB7 A;  1ZHH B;  5EOO A;  5EE8 A;  4Y5F A;  4NXB A;  4JF5 A;  5HAQ A;  3BQ8 A;  4CQH A;  4GJ4 A;  3ISG A;  3N8R A;  4WMC A;  3G30 A;  2PU4 A;  3UPN A;  2OV5 A;  2OAQ 1;  4KQQ A;  1CQA A;  4KG2 A;  1VET B;  2Y2K A;  2P08 A;  3C30 A;  1DY6 A;  2W3D A;  4O8G A;  1XPB A;  5HWW A;  5IU1 A;  3JPU A;  4I38 A;  2NUP C;  4WN5 A;  3T12 B;  4KUO A;  3E98 A;  3T1S A;  2GZA A;  2PU2 A;  3T4Q A;  3UY6 A;  1F5M A;  2C5W B;  5FQI A;  1P9W A;  5F68 A;  3UME A;  2WYX A;  4JBF A;  3DTK A;  3MJQ A;  5DJT A;  1VET A;  3IXD A;  5U47 A;  5M19 A;  5F83 A;  1CI9 A;  3BFE A;  2Y91 A;  1ZG6 A;  2QJ7 A;  4KG6 A;  4Q8I A;  2WK0 A;  1K6S A;  2A3U A;  4NXG A;  3PBS A;  3M2J A;  3T4S A;  3BFD A;  1DP6 A;  3A3F A;  4HEF A;  2G7U A;  4DE2 A;  3EEH A;  4FH2 A;  5FI7 A;  3U2A A;  4OPR A;  3S4X A;  2WGW B;  5HAI A;  5GLC A;  3NOP C;  3L9K A;  5F1F A;  3CI6 A;  4H8R A;  3Q1F A;  4FSF A;  2JC7 A;  2HDS A;  2HDU A;  3GRJ A;  3IWI A;  1I2W A;  2VV7 A;  4N1H A;  5FAS A;  3CHW P;  1TS0 A;  5CER A;  3P98 A;  4QWO A;  2VV6 A;  1OTA A;  4QD4 A;  1Q2P A;  4LCM A;  4EU0 A;  3VSK A;  2QJ5 A;  2WZZ A;  1DP9 A;  4EBL A;  3LIF A;  2V0W A;  4EUV A;  4OOM A;  4BJP A;  5AVE A;  2VEA A;  3M6B A;  4N1X A;  2PHY A;  2IWB A;  1H3Q A;  5J4E A;  2FZ0 A;  2ZM2 A;  2UWX A;  4HJ3 A;  4Y0T A;  5FAO A;  4LV3 A;  4DF6 A;  4RX3 A;  4UA6 A;  1F2K A;  4A5R A;  1BLP A;  2Y2J A;  1XFN A;  3VOL A;  3PBN A;  1ODV A;  4OPQ A;  3I7J A;  1YPR A;  3HBR A;  2LB9 A;  4HOI A;  4BEN A;  1CK3 A;  4OPZ A;  5HAP A;  3ZFZ A;  2QYB A;  1NRJ A;  3DBA A;  4GS9 A;  4PMA A;  3T4J A;  3N7W A;  4WEL A;  1IEM A;  3LY4 A;  3O3V A;  3FYZ A;  4EUZ A;  3E2L A;  5HD3 A;  3LO7 A;  2XK1 A;  5TGF A;  2H5S A;  4R0Q A;  4S2J A;  1YSQ A;  3JVU A;  5A91 A;  4KZ7 A;  1KVL A;  3NJA A;  1I5Q A;  1LSW A;  4E04 A;  1F9I A;  1YAX A;  2D01 A;  1V9Y A;  5MC7 A;  1NWZ A;  3HLC A;  2R9X A;  1L0E A;  4IED A;  3QP6 A;  1KE4 A;  1BLH A;  3BFC A;  4KZ6 A;  5DTK A;  2R9W A;  1T1B A;  4ID4 A;  1YLY A;  3KSF A;  5FAT A;  4BL3 A;  2ZM8 A;  4R4R A;  4Y17 A;  4LFU A;  1JWP A;  2V8F A;  4N9K A;  5HD5 A;  3O86 A;  4G3V A;  4ZJ2 A;  5HL1 A;  4X69 A;  3UB8 A;  3HVF A;  3P09 A;  2V9A A;  5GLB A;  4ZJ1 A;  4DE0 A;  4G3W A;  1KDW A;  3MZF A;  5HDD A;  2JKT I;  3OPR A;  2JKR M;  5JYP A;  3PYP A;  3CG5 A;  3MKF A;  4P0M A;  4LRX C;  3UPP A;  4DXC A;  3LEZ A;  2HDQ A;  3TJZ C;  3E4Q A;  5G4Y A;  5L09 A;  3CJM A;  2ZC4 B;  2GX5 A;  1BUE A;  1PZP A;  4MNR A;  1S6R A;  4LRZ E;  3IS2 B;  3IX4 A;  3PBT A;  3IBJ A;  4C3Q A;  3IH8 A;  5M1A A;  1GHI A;  2XFS A;  4G3K A;  2WGV A;  4ETX A;  2GNX A;  3NDE A;  2W1T A;  3VOZ A;  3A3D A;  4OOL A;  1G6O A;  3ULF A;  1LL8 A;  2V2F F;  2HV1 A;  5TBM A;  2BAS A;  2QPN A;  1RP5 A;  3G2Z A;  3ITA A;  2PRF A;  2DMW A;  4GOG A;  2PDR A;  4DKI A;  4KEN B;  2EWW A;  1KGG A;  2J7V A;  3IS2 A;  3ZHH A;  3ZG5 A;  3K3D A;  2PT7 A;  3MFX A;  2WAE A;  4LCL A;  4NEE D;  1DJA A;  1S4R A;  3PBQ A;  2WKI A;  3G31 A;  3G6O A;  3Q7V B;  1K55 C;  5FSR A;  1L2S A;  1J9M A;  2QKP A;  1SDE A;  1N9N A;  3W4P A;  5FQK A;  2WKH A;  4XT2 A;  4R70 A;  2ZQC A;  2OWH A;  3VP3 A;  4I3A A;  2HGV A;  2PD7 A;  3V67 A;  2XR0 A;  4Y0U A;  3B42 A;  1OTB A;  1PFL A;  3D9Y A;  1ZC2 A;  4JGO A;  3JVV A;  2O9A A;  2OLV A;  1XGI A;  1DJC A;  3C7V A;  3IBR A;  3IF6 A;  3JYI A;  1SZV A;  3OPP A;  1L0G A;  4EQ1 A;  1ESU A;  1XKZ A;  5IS1 A;  2PBY A;  1FQG A;  2EWV A;  3UN7 A;  5EVI B;  1HLU P;  2H10 A;  4DMZ A;  4OQG A;  3CAX A;  5DJU A;  4ESP A;  4LRY C;  1J3W A;  4O7D A;  3MMH A;  4GHI A;  4Y2F A;  4MCW A;  2A24 B;  2VGL M;  1LL5 A;  5C5K A;  1OME A;  2GJ3 A;  1ES2 A;  4KZ3 A;  1ALQ A;  3OLO A;  2RL3 A;  4WZ5 C;  1MWT A;  2ZC5 B;  4XUX A;  3C38 A;  4EWF A;  1IKI A;  2W3E A;  2C6W B;  4HP9 A;  2Y8H A;  3S7N A;  5BOH A;  1MXO A;  2LB5 A;  3RH8 B;  3DTE A;  1N9O A;  2GDN A;  1K6R A;  3QP5 A;  4NK3 A;  2W1R A;  4E3J A;  4KZ8 A;  2EXB A;  3SS5 A;  1K54 A;  1MPL A;  3VP1 A;  1VHM A;  3GTC A;  2A24 A;  1OTE A;  4GDB A;  3ZG8 B;  4MLL A;  2ZMA A;  2J9O A;  2ZLY A;  2G2W A;  1K56 D;  4WZ4 A;  1T19 A;  1L0D A;  1RGY A;  4L9F A;  2E8I A;  4II7 A;  5EEC A;  5HPF A;  5EUA A;  1ERM A;  4LLO B;  3BY8 A;  3G2Y A;  4P87 A;  4HH3 A;  3BEC A;  2O99 A;  5EPH A;  3DTI A;  4OON A;  1KOU A;  4HNB A;  2XD1 A;  1BLS A;  1YLP A;  5FDH A;  4S2P A;  5DF8 A;  1U60 A;  3BFG A;  3NEC A;  1Y4O A;  1G28 A;  3ZG0 A;  4PPR A;  1HD8 A;  5EFW A;  5TFQ A;  4N9L A;  2XH9 A;  3K3C A;  4C75 A;  4LPZ A;  3F1O A;  3GQZ A;  3L7H A;  4CLC D;  3CWF A;  3CUE C;  3CPT B;  3CUE A;  4K0X A;  2OOL A;  3A0R A;  4KQO A;  4EV4 A;  1ZTU A;  3A3I A;  1JWV A;  2AVX A;  1XJ6 A;  4YFM A;  3R7W A;  1FOF A;  1TEM A;  3CLO A;  5L07 A;  2Y2O A;  3EEA A;  3H82 B;  4B93 A;  1A0K A;  4PM6 A;  3V3R A;  3KYZ A;  1JVJ A;  5FAP A;  3DWK A;  5L2F A;  1ESI A;  4PM5 A;  2H0T A;  3C7U A;  3MQO A;  4GNU A;  3VOY A;  4B88 A;  4WL9 A;  4Q0J A;  1W8Y A;  3D72 A;  3BFF A;  4XUZ A;  4WM9 A;  2HJE A;  3CPT A;  3ICY A;  1NYY A;  1T1A A;  5I5L A;  3T50 A;  3PXP A;  3VP2 A;  1KVM A;  2Y2I A;  4P85 A;  3UB5 P;  2VLG A;  1MKI A;  1YLJ A;  1E4D A;  2L4R A;  2BTF P;  3H82 A;  3QNB A;  4GDN A;  3P01 A;  4BWI A;  2W3G A;  2Y2L A;  4OOY A;  1CEF A;  3UDX A;  3T4T A;  1W8Q A;  4F94 A;  3QP4 A;  4HIA A;  2E8J A;  1G5U A;  4GW9 A;  3SS4 A;  3LEQ A;  2V20 A;  5FEG A;  5LBR A;  2QMI A;  1Y28 A;  1WA9 A;  3LIA A;  1TDG A;  4LGW A;  2WKQ A;  2D02 A;  1VB6 A;  2CC1 A;  3LIC A;  3HCY A;  3T1X A;  4E6X A;  2VZW A;  4JKT A;  1S67 L;  3OCN A;  3VSL A;  1K38 A;  2PR5 A;  1GSV A;  3UMD A;  1PWC A;  3AGD A;  5AQ9 A;  4YNR A;  2EA9 A;  2XLN A;  2L0W A;  2YKF A;  1Z6F A;  3SH8 A;  4JF6 A;  1STZ A;  3HL9 A;  3PHY A;  4Q0I A;  5FI2 A;  1ERQ A;  4HBU A;  4MN5 A;  1PI4 A;  5AJG A;  5DVA A;  2B02 A;  3EQU A;  3O87 A;  4ME4 A;  5HX9 A;  1CJF A;  1PZO A;  4UQI M;  1PW8 A;  3RFB A;  2W3H A;  5A8B A;  3SOI A;  2HP9 A;  1XX2 A;  2J8Y A;  2M7U A;  4HP4 A;  5TJJ A;  2VJW A;  2Y59 A;  4P6Z S;  1K25 A;  4GS9 B;  1MY8 A;  3G4P A;  3V50 A;  5HSQ A;  3UDF A;  2PYR A;  3AGE A;  1VQQ A;  1K0K A;  2XGN A;  2ZQD A;  3BRM A;  5E2E A;  1OTD A;  4MEZ A;  4CLC C;  4X1L A;  4GZB A;  4FOF A;  3FG8 A;  1K4F A;  5G4Z A;  5KZH A;  3IXB A;  2P04 A;  4DN0 A;  4U0X A;  1BZA A;  4MBF A;  5CTN A;  1MWU A;  5HWT A;  4NG2 A;  3UE0 A;  4E3N A;  3FV7 A;  1YLT A;  1OJ5 A;  1S1Y A;  1QME A;  1HZO A;  3T4O A;  5HPI A;  4X56 A;  4FD8 A;  4R3J A;  1XXM A;  2Q0O A;  2WGI A;  4I3J A;  1FSY A;  4EET B;  1XP4 A;  1KDS A;  4JGQ A;  5HL6 A;  4E3L A;  2PYP A;  4OQI A;  2OAP 1;  3S7Q A;  2P74 A;  4ZJ3 A;  4MMN A;  3E4O A;  4Y3I A;  4H6J A;  3PBR A;  3HLW A;  4IVI A;  3VE3 A;  1TS8 A; 
#chains in the Genus database with same CATH homology
 1N9B A;  5FQ9 A;  1ONH A;  3IWQ A;  4NET A;  2XF3 A;  3A3J A;  4X6T A;  2ZQ7 A;  1WYB A;  1SDE A;  1ZG4 A;  1Q2Q A;  2HDR A;  5HFO A;  3W4P A;  5FQK A;  3M6H A;  1PIO A;  3HLG A;  4E3O A;  2WKH A;  4IBX A;  4UAA A;  3VP4 A;  3N4I A;  1NY0 A;  1E3U A;  2ZC3 B;  2ZQC A;  4GN2 A;  3VP3 A;  1KGE A;  2Y4A A;  4KZ5 A;  5CHJ A;  4M3K A;  4IBR A;  3MZD A;  4BLM A;  2XR0 A;  4HES A;  4Y0U A;  4E3K A;  4HBT A;  1K56 A;  5HW3 A;  4MBK A;  1ZC2 A;  4GD6 A;  4Y0O A;  3HUO A;  3WWX A;  1Y54 A;  1WE4 A;  1PYY A;  4S2K A;  2WAF A;  2JE5 A;  4L0L A;  2EFX A;  3ITB A;  2OLV A;  4FH4 A;  1XGI A;  1DJC A;  3OPH A;  4OP5 A;  3C7V A;  3DWZ A;  3IF6 A;  5CED A;  4ZBE A;  3GSG A;  3JYI A;  3SH7 A;  3OPP A;  1L0G A;  4JLF A;  1ESU A;  1XKZ A;  4GB7 A;  2PBY A;  3QNC A;  4E3I A;  3BYD A;  2Y2G A;  1TVF A;  5FQM A;  1RGZ A;  3MXR A;  4JPM A;  1FQG A;  4KZ4 A;  4RA7 A;  3UN7 A;  5EVI B;  2H10 A;  1MBL A;  3PAE A;  5TR7 A;  4OP8 A;  2ZC7 A;  3NBL A;  4OQG A;  3NC8 A;  5DTS A;  3UE1 A;  3D4F A;  5IHV A;  4O7D A;  4BD1 A;  3NDG A;  2HP5 A;  2XQZ A;  4LV0 A;  5GLA A;  5E2F A;  4BL2 A;  4OQH A;  1ES4 A;  1PWD A;  1LL5 A;  3PAG A;  1BTL A;  3WS4 A;  2A49 A;  1OME A;  1ES2 A;  1FCM A;  2ZQ8 A;  2EX8 A;  1GCE A;  4DE3 A;  4KZ3 A;  1ALQ A;  3ZNT A;  2ZD8 A;  5M18 A;  5EOO A;  2RL3 A;  4WZ5 C;  1MWT A;  2ZC5 B;  5EE8 A;  5AQB A;  5CEC A;  2Q9N A;  4XUX A;  2WGW A;  2IWC A;  2XD5 A;  4EWF A;  1NRF A;  3RJU A;  4LV1 A;  1IKI A;  2EX6 A;  2C6W B;  5BOH A;  4K0W A;  4JF5 A;  5HAQ A;  1MXO A;  4YIN A;  1YMS A;  2GDN A;  3GV9 A;  5FA7 A;  3ISG A;  1K6R A;  3ZG7 B;  2ZJ9 A;  3N8R A;  5CHM A;  4NK3 A;  3MKE A;  3G30 A;  4WMC A;  2PU4 A;  3OCL A;  4KZ8 A;  2EXB A;  3SS5 A;  4E3J A;  3UPN A;  1K54 A;  1MPL A;  2OV5 A;  4PM7 A;  5CXW A;  1JTG A;  4D2O A;  4WYY A;  3VP1 A;  3DTM A;  4KQQ A;  1IYP A;  3GTC A;  4UA7 A;  3BLM A;  4KG2 A;  2Y2K A;  2B5R A;  4RYE A;  1DY6 A;  5J8X A;  3GVB A;  5DF7 A;  4GDB A;  3ZG8 B;  1CEG A;  1XPB A;  3IHB A;  3N8L A;  1EWZ A;  1BT5 A;  2WZX A;  3ZCZ A;  4U0T A;  4MLL A;  2ZMA A;  4OLD A;  2J9O A;  2ZLY A;  4GD8 A;  2G2W A;  1K56 D;  5FQQ A;  1KE0 A;  1IYQ A;  4WZ4 A;  3NCK A;  1L0D A;  3G35 A;  4S2O A;  1RGY A;  2E8I A;  1IYO A;  3WS5 A;  5EEC A;  2HPB A;  5EUA A;  1ERM A;  3BM6 A;  3G2Y A;  2PU2 A;  3IF6 B;  4P87 A;  5F82 A;  3BEC A;  4Z9Q A;  4C6Y A;  3UY6 A;  1M6K A;  1K55 A;  5DF9 A;  5EPH A;  4R3B A;  3WS1 A;  1NZO A;  2C5W B;  3S22 A;  4OON A;  2ZM0 A;  5FQI A;  1TDL A;  3HLD A;  5G18 A;  2WYX A;  2XD1 A;  1BLS A;  4JBF A;  1YLP A;  1H8Y A;  4LEN A;  5FDH A;  4S2P A;  5DF8 A;  1U60 A;  3BFG A;  5KSH A;  1IYS A;  3IXD A;  5U47 A;  5M19 A;  3TSG A;  5F83 A;  3ZG0 A;  2Q9M A;  5E2G A;  1YT4 A;  1LI9 A;  3WRZ A;  3TG9 A;  1CI9 A;  4PPR A;  1JTD A;  1HD8 A;  3BFE A;  2Y91 A;  5AQA A;  5FAQ A;  1ZG6 A;  4UA9 A;  3UPO A;  4KG6 A;  3W4Q A;  4Q8I A;  3V39 A;  5CGS A;  2WK0 A;  1K57 C;  1K6S A;  2A3U A;  5TFQ A;  1K57 A;  2FFF B;  1HVB A;  2XH9 A;  3M2K A;  3PBS A;  3M2J A;  4JXS A;  4N9L A;  3TOI A;  3ZNY A;  1W79 A;  3LY3 A;  2QZ6 A;  3BFD A;  4C75 A;  3A3F A;  3GQZ A;  4HEF A;  3WS0 A;  4DE2 A;  2RCX A;  4FH2 A;  1ZKJ A;  2Y2H A;  4MBH A;  1ES3 A;  5FI7 A;  4OPR A;  5KMW A;  3S4X A;  1SDN A;  2WGW B;  5HAI A;  4DDY A;  5GL9 A;  2P9V A;  4K0X A;  3W4O A;  1G68 A;  1YQS A;  3O88 A;  4N92 A;  5GHX A;  4OVD A;  5CGW A;  2WKE A;  4BD0 A;  5GLC A;  5CTM A;  2X71 A;  4KQO A;  5F1F A;  4EV4 A;  4H8R A;  3SS3 A;  3A3I A;  3Q1F A;  1JWV A;  4FSF A;  2JC7 A;  2HDS A;  2HDU A;  3GRJ A;  3IWI A;  1I2W A;  4YFM A;  1FOF A;  5EVI D;  4WMC D;  3W8K A;  4N1H A;  1LHY A;  5FAS A;  1BUL A;  1TEM A;  5CER A;  3P98 A;  1YLW A;  4R23 A;  1FR1 A;  3PBO A;  2Y2O A;  5EVL A;  1XA1 A;  4OLG A;  4QD4 A;  4PM6 A;  3V3R A;  1JVJ A;  4QHC A;  5FAP A;  3DWK A;  1Q2P A;  1ESI A;  3C4O A;  4LCM A;  5L2F A;  1YLZ A;  3ZGA B;  3VSK A;  4PM5 A;  2H0T A;  2WZZ A;  3C7U A;  4GNU A;  3VOY A;  4B88 A;  4PM8 A;  4EBL A;  1SCW A;  5D3O A;  3EQV A;  1W8Y A;  1AXB A;  1O7E A;  3BFF A;  4OOM A;  2X02 A;  4WM9 A;  4XUZ A;  4WZ5 A;  4BJP A;  3M6B A;  4N1X A;  5EOE A;  3FWL A;  2IWB A;  1G6A A;  1NYY A;  3NI9 A;  4OH0 A;  1W5D A;  1QMF A;  2UWX A;  2ZM2 A;  4B4Z A;  3VP2 A;  2Z2M B;  4Y0T A;  5FAO A;  2WUQ A;  2XEP A;  4LV3 A;  1KVM A;  2Y2I A;  3VP0 A;  4DF6 A;  4QJG A;  4P85 A;  4RX3 A;  4UA6 A;  5KSC A;  1MKI A;  2ZQ9 A;  1YLJ A;  4A5R A;  4CJN A;  2OLU A;  4EBN A;  1BLP A;  2Y2J A;  3N8S A;  1PW1 A;  5AQ7 A;  1H5X A;  1E4D A;  1MWR A;  4BQM A;  3HLE A;  4RVA A;  3QNB A;  1XA7 A;  3PBN A;  5E43 A;  4GDN A;  4OPQ A;  3AGF A;  1H8Z A;  2HP6 A;  3I7J A;  3VFF A;  3HBR A;  4QB8 A;  1E3U D;  4BEN A;  1CK3 A;  2EXA A;  3GMW A;  4KZ9 A;  4OPZ A;  3G34 A;  5HAP A;  4E3M A;  2Y2P A;  2Y2L A;  3ZFZ A;  4X53 A;  4OOY A;  4PMA A;  1CEF A;  3NIA A;  1FSW A;  4QY5 A;  3UDX A;  4KG5 A;  2Y2M A;  3N7W A;  4WEL A;  2EX9 A;  1IEM A;  1W8Q A;  2XFT A;  4FCF A;  3CZD A;  4F94 A;  1NYM A;  1DJB A;  1FCN A;  1HTZ A;  3HRE A;  3LY4 A;  3O3V A;  2Y55 A;  1ERO A;  3FYZ A;  4EUZ A;  1PI5 A;  3IXH A;  3E2L A;  2P9V B;  4WEK A;  3LO7 A;  2XK1 A;  3SS4 A;  1PWG A;  5CHU A;  2V20 A;  3WRT A;  5TGF A;  2EX2 A;  1LI0 A;  2H5S A;  4R0Q A;  4S2J A;  3BLS A;  5HAR A;  1BLC A;  2QMI A;  2BLS A;  5A91 A;  3RXX A;  4KZ7 A;  1KVL A;  5GHZ A;  1W7F A;  1TDG A;  5A92 A;  5FI6 A;  1I5Q A;  3E2K A;  4QU3 A;  5DTT A;  2CC1 A;  5CRF A;  3HLC A;  2R9X A;  3VMA A;  2V1Z A;  4K91 A;  2JBF A;  2ZC6 B;  1L0E A;  3HUM A;  4IED A;  4E6X A;  4JKT A;  1KE4 A;  2Z2L B;  1BLH A;  3IQA A;  3LCE A;  3OCN A;  4KZB A;  3BFC A;  4OPY A;  3VSL A;  2BG1 A;  3MZE A;  3OC2 A;  1I2S A;  4KZ6 A;  4X68 A;  1K38 A;  3V3S A;  5DTK A;  2R9W A;  1NJ4 A;  3WS2 A;  3UNW A;  1FCO A;  3UO9 A;  1CI8 A;  1PWC A;  3ZVT A;  2IWD A;  3AGD A;  4ID4 A;  4DE1 A;  1SKF A;  1YLY A;  4KZA A;  5AQ9 A;  2XLN A;  5FAT A;  3SH8 A;  1Z6F A;  2DRW A;  4BL3 A;  4JF6 A;  2ZM8 A;  1GHP A;  3HL9 A;  3MXS A;  4GKU A;  4R4R A;  4RX2 A;  3DW0 A;  3UDI A;  1JWP A;  1IKG A;  4N9K A;  3O86 A;  5FI2 A;  1ERQ A;  3Q81 A;  4HBU A;  5GHY A;  3IHA A;  1PI4 A;  1IEL A;  1N4O A;  3GR2 A;  4ZJ2 A;  5DVA A;  5HL1 A;  3EQU A;  4X69 A;  3O87 A;  2X01 A;  4ZTK A;  3HVF A;  4QY6 A;  3V5M A;  3S1Y A;  3P09 A;  2FFY A;  5HX9 A;  5GLB A;  1PZO A;  4ZJ1 A;  3HLB A;  1PW8 A;  3ZG9 B;  1JWZ A;  4JXG A;  4P6B A;  4DE0 A;  1ONG A;  3SOI A;  3IF6 C;  3NY4 A;  1KDW A;  1YM1 A;  2HP9 A;  1C3B A;  3B3X A;  3MZF A;  1XX2 A;  3IH9 A;  3OPR A;  3Q7V A;  2J8Y A;  1L0F A;  3MFD A;  4DDS A;  4EBP A;  4DXB A;  5JYP A;  3FKV A;  4R4S A;  2DNS A;  1LLB A;  2ZQA A;  3CG5 A;  3IWO A;  3MKF A;  4P0M A;  5CEB A;  2Y59 A;  3UPP A;  1XGJ A;  4DXC A;  3LEZ A;  1K25 A;  1MY8 A;  3IT9 A;  2Y2Q A;  5F1G A;  4B4X A;  3G4P A;  2HDQ A;  3C4P A;  3V50 A;  1GA9 A;  2VGJ A;  2VGK A;  3IF5 A;  4ZAM A;  3UDF A;  3AGE A;  1VQQ A;  3CJM A;  2ZC4 B;  3FZC A;  1BSG A;  4Y7P A;  3PTE A;  2XGN A;  1BUE A;  2DCF A;  2JCH A;  3OPL A;  3HUN A;  1K4E A;  1WYC A;  3IXG A;  4S2M A;  3SH9 A;  2ZQD A;  1VM1 A;  3BRM A;  5E2E A;  4EQI A;  1PZP A;  4UHU A;  5A93 A;  4IVK A;  4MNR A;  2OSU A;  4MEZ A;  1S6R A;  1O07 A;  1M40 A;  4GZB A;  4JF4 A;  1K4F A;  3A3E A;  4U3T A;  5KZH A;  4KQR A;  3IXB A;  3MBZ A;  3PBT A;  4U0X A;  1BZA A;  3N6I A;  4MBF A;  2XDM A;  4C3Q A;  4WEJ A;  4XXR A;  3IH8 A;  5CTN A;  1MWU A;  5I94 A;  1GHM A;  3FKW A;  4JXV A;  5M1A A;  1GHI A;  2XFS A;  4R1G A;  3UE0 A;  4E3N A;  3FV7 A;  1KGF A;  2WGV A;  2Y2N A;  5EVI C;  1YLT A;  5EVI A;  3NDE A;  4S2I A;  5E2H A;  3ZVW A;  2J9P A;  3VOZ A;  4WBG A;  1RCJ A;  1S0W A;  4ZDX A;  1K54 C;  1QME A;  2EFU A;  3A3D A;  2WAD A;  4OOL A;  4DRT A;  4CPK A;  1HZO A;  3C5A A;  2H0Y A;  3QHY A;  4X56 A;  3BEB A;  2V2F F;  4FD8 A;  1MWS A;  2QPN A;  1RP5 A;  3HLF A;  4R3J A;  1XXM A;  2WGI A;  3G2Z A;  5FQJ A;  1NZU A;  3ITA A;  2I72 A;  4PM9 A;  1FR6 A;  1FSY A;  4GOG A;  4E6W A;  1XP4 A;  1KDS A;  3RXW A;  4LV2 A;  4KEN B;  4DKI A;  3Q7Z A;  1SHV A;  3CMZ A;  1KGG A;  1YMX A;  2G2U A;  4E3L A;  2J7V A;  5CGX A;  4S2N C;  1KE3 A;  3ZHH A;  4S2N A;  4OQ0 A;  5JYO A;  3ZG5 A;  3Q82 A;  4OQI A;  2WAE A;  4LCL A;  1NXY A;  4X55 A;  1LL9 A;  1E25 A;  4JXW A;  2P74 A;  1DJA A;  3ZDJ A;  4ZJ3 A;  3PBQ A;  5GLD A;  2WKI A;  4OKP A;  3UE3 A;  1EI5 A;  3G31 A;  3PBR A;  3Q7V B;  1K55 C;  3HLW A;  4IVI A;  3OZH A;  5FSR A;  1ES5 A;  1L2S A;  1J9M A;  3Q07 A;  1GA0 A;  4S2L A;  3VFH A;  5A90 A;  3G32 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...