4BLMA

Beta-lactamase of bacillus licheniformis 749(slash)c. refinement at 2 angstroms resolution and analysis of hydration
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
256
structure length
256
Chain Sequence
DDFAKLEEQFDAKLGIFALDTGTNRTVAYRPDERFAFASTIKALTVGVLLQQKSIEDLNQRITYTRDDLVNYNPITEKHVDTGMTLKELADASLRYSDNAAQNLILKQIGGPESLKKELRKIGDEVTNPERFEPELNEVNPGETQDTSTARALVTSLRAFALEDKLPSEKRELLIDWMKRNTTGDALIRAGVPDGWEVADKTGAASYGTRNDIAIIWPPKGDPVVLAVLSSRDKKDAKYDDKLIAEATKVVMKALN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA-LACTAMASE
publication title Beta-lactamase of Bacillus licheniformis 749/C. Refinement at 2 A resolution and analysis of hydration.
pubmed doi rcsb
source organism Bacillus licheniformis
molecule tags Hydrolase(acting in cyclic amides)
total genus 88
structure length 256
sequence length 256
chains with identical sequence B
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 1991-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00144 Beta-lactamase Beta-lactamase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 4blmA00
5FAQA 3DW0A 5GL9A 4C3QA 3A3FA 4K0WA 1XKZA 4OKPA 4WEJA 3FV7A 2Y2GA 5CHUA 4JXVA 1IYSA 1ERMA 4WZ5A 5HAPA 2H10A 1WYCA 4LENA 1ALQA 5EE8A 4C75A 1ZG6A 5GLDA 4OPQA 3HVFA 1FSYA 4LV0A 3SOIA 2Y2KA 2Y2QA 4OPYA 5FAOA 1DJCA 3A3JA 4DXBA 4OOMA 4E3MA 3Q1FA 4FH2A 1MPLA 2V20A 2WKHA 3IF5A 1GHPA 4M3KA 5CERA 1Y54A 3PBSA 3W4QA 3N4IA 4EBLA 5DVAA 4B88A 1CI9A 1H5XA 1ZG4A 4F94A 3SH8A 3V39A 4MBFA 4WYYA 3IQAA 3HLWA 3W8KA 3PAGA 4HBUA 2P74A 3C7UA 4KZ5A 4MLLA 2PU2A 4H8RA 1SKFA 4WMCA 5HL1A 1DY6A 3BFDA 1MWRA 1G6AA 1K56A 2ZLYA 4ZDXA 1ERQA 1O7EA 1YLWA 4XUZA 4HBTA 2WK0A 1H8ZA 5GLAA 3HLCA 4S2MA 1DJAA 5F1FA 4GN2A 4KZ7A 3BECA 3IWQA 1S0WA 1FCMA 3OCNA 4R4RA 4K91A 5DF8A 4DE1A 3IT9A 4GDNA 3ISGA 5DTSA 4N9KA 1PZPA 5F83A 2XF3A 5FDHA 5GLBA 1JWPA 1MWTA 2WKIA 2Y2PA 3BEBA 1BUEA 1YLTA 1K54A 4GD6A 4OH0A 4S2KA 3VP1A 3MZEA 1JVJA 2WAEA 4P85A 1HTZA 3LEZA 3Q7VA 3G35A 1Q2PA 4QD4A 1PYYA 1XXMA 4X53A 3VFHA 1SHVA 3UNWA 1BZAA 4BENA 4GD8A 1W8YA 4DE3A 4E3JA 1K57A 2G2UA 2WZZA 4P87A 1YLJA 4KQOA 1N9BA 4ZAMA 1ESIA 2WYXA 3HLEA 2BG1A 4S2IA 3ZCZA 1YMXA 2XDMA 4P6BA 1BLSA 2H0YA 2B5RA 3ZNYA 3ZNTA 4QY6A 3ZG8B 2XGNA 1BULA 1MWUA 4Z9QA 3JYIA 5HFOA 1KDSA 3QNCA 1EI5A 4K0XA 3N8SA 2ZC5B 3DWKA 2J9OA 1YLYA 3G30A 4UA9A 1JTDA 5AQ7A 3O3VA 2EXBA 1NYYA 1FCNA 4KQQA 3ZG0A 5KSCA 3WS1A 5EECA 4C6YA 4WZ5C 4D2OA 2Y2MA 3GVBA 2HP6A 3TSGA 1DJBA 1E3UA 1PW8A 1EROA 1SCWA 3HUNA 3IWIA 1ES3A 1Q2QA 3Q7VB 2Z2LB 3A3EA 1OMEA 1YLPA 1CI8A 1ZKJA 5HARA 3FKVA 3A3IA 4KG5A 2ZQDA 1YLZA 4R3BA 1RGZA 5EOOA 3WS4A 5JYPA 3MKFA 1E25A 2BLSA 2A49A 4BD0A 5I94A 2XQZA 1JTGA 2Z2MB 2OLUA 4RX2A 4OQGA 4PM8A 4EWFA 1L0GA 5AQBA 5BOHA 2Y59A 4IEDA 3AGFA 5HAQA 4QJGA 1HZOA 3V5MA 5GHYA 3C4OA 1IYQA 4CJNA 2RL3A 4JXWA 3UPPA 3I7JA 3VP3A 4EUZA 1GHMA 5FSRA 1BT5A 3IHAA 3BFGA 3D4FA 5CGWA 1RCJA 3ZFZA 2JBFA 4WEKA 2FFFB 3HLGA 2Y2JA 3G31A 3N7WA 4OQIA 2XFSA 2JC7A 4LCLA 1KE3A 3G2ZA 3BRMA 3PBQA 5CTNA 5TGFA 1LLBA 5HW3A 3LO7A 2Y2OA 3O86A 2IWCA 4OOLA 2WGWA 2OV5A 3VP2A 3ZVWA 4EBPA 4OLDA 3VP0A 3PBRA 1K54C 1PW1A 4DDSA 1FSWA 1XA1A 3HUMA 1VQQA 2P9VB 5DTTA 3W4OA 3S4XA 2QMIA 4S2NA 5EVLA 3QHYA 2E8IA 5GHZA 1KGEA 5FQMA 4DDYA 3VFFA 1K57C 3DTMA 3HLDA 4JPMA 1LI9A 1XP4A 4DF6A 3IF6A 4RX3A 3OPRA 4EV4A 2HPBA 2R9WA 3OC2A 1KDWA 4GKUA 2XFTA 4KQRA 1GHIA 5KZHA 4YINA 4PPRA 5AQ9A 2EX2A 3MKEA 4WZ4A 1M40A 5CEDA 4U3TA 4E6XA 1WYBA 1XX2A 3N8LA 1TDLA 2J9PA 4BLMA 4MNRA 1NY0A 4RVAA 3PBNA 4BL2A 1CK3A 2ZQ9A 4LV2A 4PMAA 3S1YA 1IKGA 3MFDA 4KZ8A 5FI6A 3GSGA 3EQUA 4MBHA 2XLNA 3G2YA 3MZFA 4NETA 5FQIA 5IHVA 1MBLA 2WZXA 1ES5A 1N4OA 3V3RA 1GA9A 2WGWB 1TDGA 4WMCD 3UE3A 2ZM8A 4P0MA 3VSKA 1K56D 1L0EA 2R9XA 5E2FA 2WAFA 4B4XA 3TOIA 2X01A 4BL3A 3MZDA 1K4EA 1YMSA 3WS2A 4X55A 2ZM0A 1O07A 2ZC7A 4OONA 4Y7PA 4XUXA 1KVLA 1NZUA 5M1AA 2ZQAA 3ZG9B 4XXRA 3IF6B 5EPHA 1K55A 3HREA 4U0TA 5CRFA 5FATA 4OPRA 2XR0A 1J9MA 3BFFA 4ZJ1A 3LY3A 4IVKA 2Y55A 5KSHA 3BM6A 3SH9A 5FASA 1W7FA 4JKTA 5CHJA 3SS5A 2HDRA 3GMWA 3MBZA 3NDGA 2ZQCA 1I2WA 4JF4A 5KMWA 1PWGA 1XPBA 3PBTA 2CC1A 4UHUA 5A93A 1PWDA 1LHYA 4QHCA 3A3DA 1MXOA 3NCKA 4HEFA 4OP8A 3WWXA 1G68A 3ZDJA 3MXRA 1I5QA 1K6RA 1PI4A 3N8RA 1ONGA 2ZC3B 5HAIA 3S22A 1IKIA 2HDQA 4RA7A 1TVFA 2JE5A 1IYOA 1W79A 2EX6A 2HDSA 3IH9A 2EFUA 3OZHA 4GZBA 4N1HA 5CGSA 5EVIA 1VM1A 1E4DA 2ZC6B 3V3SA 5CHMA 2Y91A 1BSGA 2J8YA 4E3KA 3FYZA 4GDBA 2OLVA 4WM9A 5DF9A 2PU4A 2Y2HA 1K25A 4B4ZA 4NK3A 2ZMAA 3NIAA 1BLHA 3OPHA 4Q8IA 1XA7A 2ZC4B 1PZOA 4S2NC 4N92A 3DWZA 3IXGA 4ID4A 1ESUA 3QNBA 4EBNA 3WS0A 4E3IA 1E3UD 2GDNA 2XD5A 1FQGA 3IF6C 3VSLA 5E2HA 2HDUA 3E2KA 1BLCA 3LY4A 3GTCA 5M19A 3CJMA 3PAEA 1HVBA 4S2LA 2IWDA 5M18A 3UY6A 5FQ9A 3B3XA 5FQKA 5DF7A 3NY4A 3UO9A 2DRWA 4S2OA 1QMEA 3Q7ZA 2ZQ8A 2PBYA 2EFXA 5EVIB 3UN7A 2J7VA 4IVIA 1WE4A 3ZHHA 3IH8A 1KVMA 3GR2A 1BLPA 5D3OA 1IYPA 2UWXA 4OVDA 4LV3A 4QY5A 2WGIA 2X02A 2Y2LA 2H0TA 3NC8A 3SH7A 4X68A 4E6WA 3AGEA 1FOFA 1HD8A 3P98A 4KZ6A 5CTMA 3GQZA 4DE2A 4GOGA 2WADA 3WS5A 1SDEA 3LCEA 1KGGA 3V50A 3G4PA 4E3LA 3FWLA 1KGFA 1Z6FA 1ZC2A 2VGJA 4X56A 1FCOA 3RXWA 4GNUA 3C4PA 3G34A 4WBGA 1ES4A 1LL9A 1C3BA 4S2PA 1H8YA 3CZDA 4FCFA 1K55C 5DTKA 4DE0A 4JBFA 3Q82A 4DKIA 4HESA 3Q81A 1K4FA 2C5WB 2I72A 4OOYA 1FR1A 4R1GA 1K6SA 3WRTA 2WKEA 2C6WB 4ZBEA 2Y4AA 2X71A 3IXHA 4JXSA 5JYOA 5EOEA 3VMAA 4KZBA 3UPOA 3C7VA 1NJ4A 3GV9A 5AQAA 3RJUA 4BJPA 1MKIA 1I2SA 2QZ6A 5E2GA 3IHBA 2V2FF 4Y0TA 4YFMA 4L0LA 1JWZA 4R23A 4N1XA 1XGJA 2Y2IA 3SS3A 3BFEA 3NBLA 4ZTKA 2EX8A 5EVIC 4PM5A 2XD1A 3OPLA 5CXWA 3Q07A 2ZQ7A 5E2EA 1PI5A 2WUQA 4BD1A 3TG9A 1LL5A 3VOZA 4KENB 1IEMA 3HLBA 3OPPA 1L0FA 2Q9MA 3UDIA 4ZJ3A 3MXSA 2EX9A 4CPKA 1YT4A 5F82A 4U0XA 5L2FA 3PTEA 5GLCA 2A3UA 1U60A 3ITBA 5A90A 5FQQA 4KZ4A 4E3OA 1MWSA 4FSFA 3M6BA 1KE0A 4OQ0A 3IWOA 4QB8A 3CG5A 3ZG7B 5CEBA 1EWZA 5A91A 3EQVA 4OP5A 4JXGA 3UDXA 3CMZA 2XH9A 4UA6A 3ZVTA 2V1ZA 3M2KA 1K38A 3AGDA 4WELA 5FI7A 3VOYA 1NXYA 3HL9A 1ONHA 4LV1A 2H5SA 5G18A 4X6TA 1ES2A 1PIOA 4JF6A 2Y2NA 4PM6A 3BFCA 3C5AA 4KG2A 1RGYA 5FAPA 1CEGA 5GHXA 2EXAA 4R4SA 1CEFA 2OSUA 3HLFA 3IXDA 3HUOA 1IELA 2ZD8A 2DCFA 3RXXA 3NI9A 5EUAA 4JF5A 3ZGAB 3BLMA 1NZOA 4OQHA 4Y0OA 1QMFA 4KG6A 4S2JA 3FKWA 5U47A 3UDFA 4FD8A 5EVID 2WGVA 1AXBA 5A92A 1GA0A 1JWVA 3VP4A 4IBXA 1FR6A 4FH4A 1PWCA 3GRJA 3IXBA 3M2JA 3PBOA 3E2LA 1GCEA 4OPZA 5J8XA 1S6RA 4OLGA 4GB7A 2FFYA 2Q9NA 4KZ3A 3N6IA 4MBKA 2HP5A 3O88A 3OCLA 4O7DA 1L0DA 2HP9A 4R3JA 1RP5A 1MY8A 5HX9A 1W8QA 4E3NA 5FQJA 4A5RA 3W4PA 4QU3A 1NRFA 4KZ9A 1NYMA 1XGIA 4RYEA 4IBRA 4MEZA 3FZCA 4KZAA 4PM9A 2XEPA 4UA7A 5CGXA 4JLFA 5FI2A 3SS4A 3WRZA 1YQSA 1TEMA 3ITAA 1LI0A 5TFQA 2XK1A 5E43A 1YM1A 4R0QA 5CECA 3UPNA 3G32A 4DRTA 1W5DA 4X69A 3ZG5A 2P9VA 2ZM2A 1BTLA 4LCMA 1L2SA 4N9LA 3NDEA 3M6HA 4EQIA 4Y0UA 2G2WA 3O87A 5F1GA 5FA7A 3BYDA 1SDNA 2QPNA 4ZJ2A 2ZJ9A 1KE4A 2RCXA 3P09A 4UAAA 2IWBA 4BQMA 5TR7A 1M6KA 2VGKA 4PM7A 3UE1A 4DXCA 3BLSA 3UE0A 2DNSA 3HBRA 2JCHA
chains in the Genus database with same CATH superfamily
4LRYC 1NWZA 3TRCA 4C3QA 4K0WA 2Y2GA 1IFQA 3T4QA 4WZ5A 1ALQA 3BQAA 3KSFA 2JKTM 3HVFA 1FSYA 1UWPX 4LV0A 3SOIA 2Y2KA 3A3JA 4E3MA 4FH2A 3T4JA 4M3KA 5CERA 3PBSA 3TE8A 1H5XA 4F94A 3V39A 4EU0A 4YWZA 3PAGA 2YKHA 2EWVA 5EVEA 1ACFA 1MWRA 2ZLYA 1YLWA 2WK0A 5GLAA 2VV6A 4S2MA 2Z6CA 5EM0A 3IWQA 4EEPA 3OCNA 5DF8A 1VETA 4DE1A 1P9RA 3ISGA 4N9KA 5F83A 3LR0A 5FDHA 1MWTA 3BEBA 1YLTA 1JVJA 4P85A 1HTZA 3LEZA 3Q7VA 1BZAA 4DE3A 1YLJA 2WYXA 4XT2A 2JKGA 4P6BA 1S66L 1BLSA 3EGXC 3ZNYA 3ZG8B 1MWUA 3JYIA 4K0XA 3N8SA 4UA9A 1FCNA 4KQQA 4I3JA 4C6YA 4Y15A 3ZQ5A 1ES3A 1Q2QA 3Q7VB 5IS1A 1YLPA 1OMEA 1CI8A 1H3QA 2PRFA 5HARA 1A0KA 3FKVA 1RGZA 5JYPA 2BLSA 2HV1A 4GLQA 5I94A 5A8BA 4PM8A 4GS9A 5AQBA 4IEDA 4ARZA 3C4OA 3VE4A 2A2LA 4JXWA 1EW0A 1S1YA 3VP3A 1YSQA 3L7HA 4EUZA 3EEHA 5FSRA 3IHAA 3D4FA 2FFFB 3G31A 3N7WA 4LCLA 3G2ZA 5TGFA 4NXFA 3LO7A 3LUQA 2MJ6A 3MSHA 4R6LA 1DRMA 4EBPA 5EV0A 3VP0A 1LSXA 2XROA 1T1AA 2O9CA 5EVLA 5FQMA 5FEGA 1K57C 3DTMA 4JPMA 3KYQA 4RX3A 4ARZB 2W3DA 2HPBA 2VGLS 4KQRA 2XFTA 4PPRA 1CQAA 2EWWA 4U3TA 4YOFA 4BLMA 2J9PA 4IHQA 4RVAA 1VHMA 2ZQ9A 4LV2A 5G4YA 3OOVA 1ES5A 1N4OA 3TJZC 4WMCD 2ZM8A 3P01A 2X01A 4BL3A 3MZDA 1S67L 3FG8A 3MQOA 5M1AA 2VEAA 5EPHA 3HREA 3MJQA 1OTIA 4U0TA 4Z1WA 4OPRA 2XR0A 3BM6A 2QHKA 3SH9A 5FASA 3R4KA 1W7FA 3SS5A 2UV0E 3MF0A 3GMWA 2ZQCA 3PBTA 2L0WA 4QHCA 1MXOA 3QP1A 3ZDJA 1I5QA 3H9WA 2PAVP 1PI4A 3N8RA 2ZC3B 3S22A 5DFYA 5FAOA 2EX6A 1W79A 2HDSA 5EVIA 4GZBA 3S7QA 1E4DA 4HP9A 1VB6A 2OLVA 3LIAA 4O01A 4B4ZA 3CUEC 4DN0A 2ZMAA 4DJ2A 5HD5A 1PZOA 3QNBA 1TF1A 1OTBA 3GTCA 3CJMA 5TBMA 5M18A 3UY6A 3B3XA 4E04A 3UO9A 5EVIB 3GR2A 4QY5A 2WGIA 4RQ9A 4MCWA 3AGEA 1FOFA 5CTMA 3GQZA 4DE2A 4LRXC 2B18A 3WS5A 1T1BA 3G4PA 3FWLA 1KGFA 4B93A 4X56A 4X25A 1PRQA 1OTAA 3C4PA 4WBGA 1ES4A 1C3BA 2INWA 4FCFA 4DKIA 1OJ5A 3Q82A 4OOYA 2C5WB 4R1GA 1FR1A 2C6WB 4ZBEA 5JYOA 4NG2A 4BJPA 3F1PB 5E2GA 3IHBA 2V2FF 4Y0TA 1JWZA 1XGJA 2Y2IA 3SS3A 4PM5A 3RFBA 3Q07A 1ODVA 1LT0A 3VOZA 4HH3A 4KENB 3K2NA 4HHDA 3KSGA 5F82A 2A3UA 1U60A 3ITBA 4LGWA 5FQQA 2O0YA 3A0SA 3NJAA 4IUHA 4QB8A 3CG5A 3ZG7B 5CEBA 4EW7A 2XH9A 3MMHA 3VOYA 3HL9A 2H5SA 5G18A 3QP5A 2EXAA 2Y79A 2DCFA 3RXXA 3NI9A 3BLMA 1L3LA 4Y5FA 4Y0OA 5U47A 5F69A 1GA0A 1JWVA 4GCZA 4IBXA 1FR6A 3GRJA 3M2JA 3PBOA 2YKFA 3E2LA 1S4SA 1S6RA 2J3TD 4OLGA 1OTDA 2Q9NA 4NXBA 4PKYG 4ZRRA 5HL6A 3OCLA 4KUOA 4O7DA 4UQIS 2V8CA 5FQJA 4II7A 4MEZA 2XEPA 5CGXA 3ITAA 5TFQA 4DRTA 4X69A 3H82A 4N9LA 3L9KA 5KIZA 3UB5P 1IOUA 2KDKA 2VZWA 2QPNA 3T4OA 2RCXA 5K5BA 4UAAA 1H8MA 3S7PA 3BLSA 3DW0A 5GL9A 4WEJA 2ZL1A 1ERMA 3S7OA 3VE3A 4HQAA 1ZG6A 3UB9A 4OPYA 4DXBA 1VEUA 3H82B 3N4IA 1F9IA 5DVAA 4B88A 2D01A 1ZG4A 3BQ8A 4HH2A 1OT6A 4HBUA 2P74A 3C7UA 4KZ5A 4H8RA 4WMCA 5HL1A 1DY6A 3BFDA 3LR5A 1ERQA 1O7EA 2O9BA 4XUZA 2L1MA 2ZL1B 4GN2A 3T4SA 1T19A 4GDNA 5DTSA 3O5YA 3E98A 2XF3A 5GLBA 1JWPA 1VEUB 1BUEA 1K54A 4OH0A 4S2KA 3MZEA 3G35A 4QD4A 1XXMA 3ICYA 1SHVA 4P6ZS 4GD8A 2HF6A 2O99A 2ACGA 2G2UA 4KQOA 1N9BA 2LB9A 1ESIA 4S2IA 3ZCZA 1UGUA 2XDMA 2J3WA 4MDZA 3ZNTA 2XGNA 1BULA 1KOUA 2OWJA 1G5UA 3DWKA 5AQ7A 2J9OA 1YKDA 2EXBA 4L9FA 5EECA 4CLCA 5J4EA 3B42A 4BBUA 2VK3A 4Q0JA 1SCWA 1EROA 5C5KA 3H7WA 2ZMVA 3KYZA 4KG5A 4R3BA 5EOOA 3QP8A 4JGPA 3DBAA 3MKFA 1D06A 2A49A 2OLUA 3CAXA 4OQGA 4EWFA 1L0GA 3NHQA 3ZYTA 5HAQA 3SW1A 2PR5A 5GHYA 1F98A 4CJNA 5HPFA 3S7NA 3LYXA 3T1XA 1BT5A 3BFGA 4HIAA 4WEKA 4OQIA 2XFSA 2JC7A 4CLCB 1KE3A 5FDSA 1P9WA 2WGWA 2QJ7A 3PBRA 2W3GA 4EQ1A 1FSWA 3HUMA 3W4OA 3S4XA 2QMIA 4Y3IA 2I9VA 4G3KA 1LI9A 1STZA 4DF6A 3IF6A 1GSXA 3A0VA 4EV4A 4YINA 3CI6A 1XJ2A 1M40A 5CEDA 4E6XA 1WYBA 3N8LA 3PBNA 4NXGA 3KO6A 4AFIA 3MFDA 4KZ8A 4NEED 2XLNA 3CITA 2WGWB 1TDGA 3VSKA 1K56D 1TD5A 5E2FA 4B4XA 1MC0A 1YMSA 3C30A 1O07A 2V8FA 5J3WA 2W1TA 1KVLA 1NZUA 2ZQAA 3LGOA 4XXRA 3IF6B 1K55A 5FATA 5CRFA 4QWOA 1J9MA 5KSHA 4IVKA 1PNEA 5CHJA 2HDRA 5KMWA 1PWGA 2PHYA 1PWDA 3A3DA 3MXQA 3WWXA 3MXRA 1DP9A 1ONGA 1CJFA 4ESPA 5CGSA 2EFUA 1VETB 1VM1A 3UE6A 1V9ZA 5CHMA 2J8YA 4E3KA 2HJ9C 4GDBA 5HDDA 4WM9A 2Y2HA 1K25A 2M7VA 1BLHA 1XA7A 2V9AA 4S2NC 3DWZA 3E4OA 4ID4A 1ESUA 2AVXA 1E3UD 2GDNA 4XT2B 4UQIM 3SZTA 3PAEA 4S2LA 3LIEA 5FQKA 5DF7A 4FUWA 4F3LA 3Q7ZA 2PBYA 2EFXA 3UN7A 4IVIA 1WE4A 5D3OA 4LV3A 2Y2LA 1DP6A 5AVEA 4X68A 1T18A 2LB5A 4KZ6A 1NLZA 2P08A 2VV7A 1SDEA 2A24A 1V9YA 2WKRA 5J7EA 3G34A 1W63M 1ZHHB 5DTKA 3LIFA 4M4XA 4GS9B 1NRJA 4JBFA 3Q81A 1K4FA 2I72A 4ETZA 2V0UA 3IX8A 5EOEA 3VMAA 4F3LB 3GV9A 5AQAA 3RJUA 2QZ6A 4L0LA 4R23A 2K2NA 1GSVA 2XD1A 5CXWA 2ZQ7A 4IJGA 2WUQA 2W27A 3HLBA 1L0FA 2A24B 4JGQA 4ZJ3A 2EX9A 2VLGA 1YT4A 4WLAA 3GDIA 5L2FA 3PTEA 5GLCA 5A90A 3BWLA 3FC7A 1MWSA 3LIBA 1KE0A 2GZAA 3IWOA 3EWKA 2JKRI 3AGDA 5AJGA 4X6TA 2IA2A 4JF6A 4PM6A 1LSWA 3C5AA 1RGYA 3KSIA 4P6ZM 4I5SA 3UB6A 1IELA 2ZD8A 3KX0X 1WA9A 5EUAA 5FL3A 3E0YA 4S2JA 3VOLA 2B02A 1BYWA 3K3CA 3HJIA 4GB7A 4CLCD 3V67A 3N6IA 4MBKA 3O88A 4E3NA 3W4PA 2K31A 3T4LA 1XGIA 4IBRA 4Y2FA 4KZAA 1LI0A 4Y17A 2PD7A 1YM1A 4R0QA 4JGOA 3G32A 1OTEA 1W5DA 3ULFA 2P9VA 2ZM2A 1BTLA 1L2SA 3T4TA 3M6HA 1MKMA 2G2WA 2VX8A 5FA7A 4R3AA 3PXPA 5TR7A 1M6KA 3UE1A 5FEFA 3DTKA 4DXCA 2ZBBA 1Y4OA 1W63Q 5MC7A 4R38A 2DNSA 3HBRA 2JCHA 5FAQA 4OKPA 3D3OA 4HJ3A 3FV7A 4JXVA 1CF0A 1K0KA 1WYCA 4LENA 5TBMB 5GLDA 2NUTC 1PFLA 4OOMA 3Q1FA 4KQDA 2PBDP 5IT5A 4EBLA 2QKPA 4MBFA 3IQAA 1F2KA 3W8KA 4MLLA 2PU2A 4EEUA 1K56A 5IU1A 4X1LA 5F5YA 1H8ZA 1DJAA 5F1FA 3BECA 1S0WA 1FCMA 3T1SA 4R4RA 4K91A 3IT9A 5DKKA 5EFWA 1PZPA 4X1MA 3LR3A 2WKIA 3CWFA 3R7WA 3BY8A 4GD6A 1XJ4A 3BY9A 2WAEA 1Q2PA 1PYYA 4X53A 2HJEA 1SKOA 3UNWA 1TS6A 4BENA 4WN5A 1K57A 4L9EA 3HLEA 2BG1A 1YMXA 4MN6A 1YSPA 1KDSA 4H6JA 3QNCA 4I39A 2VJWA 2ZC5B 1YLYA 3G30A 1JTDA 3ZG0A 5KSCA 3WS1A 4WZ5C 4D2OA 2Y2MA 3GVBA 2HP6A 3R7WB 1E3UA 3HUNA 4FTXA 2Z2LB 1YLZA 2D02A 4Q0IA 3WS4A 4I38A 3IS2A 4BD0A 5HWWA 1JTGA 2Z2MB 4RX2A 4NXEA 5BOHA 2Y59A 3FPWA 3AGFA 1HZOA 1IYQA 3UPPA 5HPIA 3I7JA 5CX7A 4B9OA 5CGWA 1P97A 2JBFA 3HLGA 4EUVA 1N9LA 3BRMA 3PBQA 2W3HA 2JKTI 3O86A 4OOLA 2OV5A 3VP2A 4WL9A 3T1QB 2E8JA 3CUEA 2O9AA 5GHZA 4DDYA 3VFFA 2M7UA 1XP4A 2EA9A 1DP8A 2R9WA 1KDWA 5KZHA 1GHIA 4HNBA 5AQ9A 4WZ4A 2VGLM 2HZ5A 4MNRA 2ZMFA 4BL2A 2OOLA 1CK3A 4PMAA 4HP4A 3U2AA 3EQUA 4MBHA 3MR0A 3IBRA 3MZFA 5FQIA 1Z09A 5IHVA 1MBLA 3V3RA 1GA9A 3F1NA 2J3TC 4P0MA 1XFNA 2R9XA 2OAQ1 2WAFA 3TOIA 3LI9A 2R78A 3WS2A 3G6OA 3NOPC 4PHTA 4XUXA 3BFFA 2KX6A 3C2WA 5L09A 4JKTA 3MBZA 1I2WA 4JF4A 1XPBA 3B47A 5A93A 3JVUA 1LHYA 5HAPA 4HEFA 2KLIA 3EGDC 1G68A 3PYPA 1K6RA 5HAIA 1IKIA 4RA7A 1TVFA 1TS7A 3IH9A 1XJ6A 3V3SA 2Y91A 2PR6A 4GHIA 3FYZA 3B33A 2JHEA 2VKSA 3IBJA 4DMZA 2ZOHA 5DF9A 4NK3A 2L4RA 3NIAA 5DFXA 3OPHA 2W0NA 3IXGA 4EBNA 3WS0A 4E3IA 1FQGA 4EETB 5HSQA 4DJ3A 3E2KA 1BLCA 3U4LP 1X0OA 1Y28A 3EEAA 5M19A 1HVBA 3ZHHA 2DMWA 3IH8A 1G28A 3RTYA 2UWXA 4GHIB 2X02A 4JGRA 3FPVA 4E6WA 5DJUA 3P98A 3H7WB 3VV4A 4R70A 2WADA 4MMNA 4E3LA 4BBTA 2VGJA 3RXWA 4GNUA 1LL9A 1H8YA 3CZDA 4DE0A 4HESA 1K6SA 2WKEA 4LFUA 2G7UA 4BBVA 2X71A 3IXHA 3F1OA 4JXSA 3MQ0A 1UWNX 4KZBA 3UPOA 1TS8A 1NJ4A 3C7VA 3MFXA 2PYPA 4YFMA 4KUKA 5EVIC 3OPLA 2WKQA 5E2EA 2HGVA 2PYRA 2Q0OA 1LL5A 4L9GA 2QWSA 1IEMA 2W3FA 5HZHA 3CHWP 3OPPA 3UDIA 4CPKA 4KZ4A 4FSFA 3M6BA 5A91A 3EQVA 3F1OB 5AVFA 4OP5A 4JXGA 3UDXA 3K3DA 3CMZA 4UA6A 3ZVTA 2V1ZA 3JPUA 4MN5A 5FI7A 2QYBA 1ONHA 4LV1A 3A0RA 1ES2A 2Y2NA 3BFCA 4PAUA 1CEGA 4R4SA 2BASA 3HLFA 3W2ZA 4Y13A 4JF5A 3ZGAB 3MS6A 3DTEA 2GNXA 2FZ0A 2WGVA 2W1TB 1AXBA 5A92A 4LLOB 1PWCA 3IXBA 1GCEA 1FIKA 3UMEA 5J8XA 2P7JA 4KZ3A 5TJJA 3NULA 2QJ5A 4R3JA 1XFQA 1RP5A 5HX9A 3HJKA 4QU3A 1NRFA 4KZ9A 4RYEA 3FZCA 4UA7A 5FI2A 3WRZA 4JLFA 1TEMA 1OPXA 2XK1A 3ZG5A 3KSHA 4LCMA 4HI4A 4PKYA 3BYDA 1SDNA 4ZJ2A 2ZJ9A 1KE4A 4GJ4A 3P09A 2VA0A 4BQMA 2VGKA 1YPRA 1SKFA 3A3FA 1XKZA 5CHUA 3LEQA 1IYSA 2H10A 5EE8A 4C75A 4HJ6A 4OPQA 2GX5A 2Y2QA 1DJCA 5L8MA 1MPLA 2V20A 2WKHA 3IF5A 1GHPA 3W4QA 1Y54A 4YNRA 1CI9A 2GJ3A 3QP6A 3SH8A 4WYYA 2PDRA 3HLWA 5L10A 1T1CA 1XJ3A 2V1BA 1G6AA 4ZDXA 2KOIA 2XRNA 3T1RA 4HBTA 1HLUP 3HLCA 4KZ7A 1GSWA 3MQQA 5HD3A 1P0ZA 1FILA 2Y2PA 3RH8B 3VP1A 3T50A 3NECA 2J80A 3OBFA 4G3WA 2Y8HA 2M1CA 3VFHA 3LI8A 1W8YA 4E3JA 2WZZA 4P87A 4ZAMA 3EOIA 5HWVA 2H0YA 2B5RA 4CLCE 4QY6A 4Z9QA 5HFOA 1J3WA 5F68A 1EI5A 1TS0A 2FH5A 3O3VA 1NYYA 3QP2A 4HJ4A 3TSGA 1DJBA 1PW8A 3IWIA 2JN7A 3A3EA 4HOIA 1ZKJA 3A3IA 2ZQDA 5DJTA 4D60A 4GW9A 4HY8A 2XA7S 1E25A 2XQZA 3CLOA 1NLYA 2B95A 4QJGA 4LPZA 3V5MA 2RL3A 3DAVA 3JVVA 3T12B 2ZOIA 1N9NA 4BWIA 3IX4A 1GHMA 1OT9A 3F1PA 1AWIA 1RCJA 3ZFZA 3CPTA 1MZUA 2Y2JA 1G6OA 5LBRA 5CTNA 4QPRA 1LLBA 5HW3A 2Y2OA 2IWCA 2VV8A 3ZVWA 5I5LA 4OLDA 1K54C 1PW1A 2W1RA 4DDSA 1XA1A 5DTTA 1VQQA 2P9VB 4S2NA 1D7EA 3QHYA 1S4RA 2E8IA 4I3AA 1KGEA 3HLDA 2CMNA 2W3EA 3GECA 3OPRA 3OC2A 4GKUA 5HDCA 2EX2A 3LFVA 3MKEA 2NUPC 2PD8A 1XX2A 1TDLA 3E4QA 1NY0A 3E4PA 3S1YA 3CPTB 4O8GA 1IKGA 4LRZE 4WUJA 3BW6A 2XSSA 5FI6A 3GSGA 3G2YA 4NETA 2WZXA 5EM1A 3UE3A 1L0EA 4CLCC 3PR6A 4MN7A 1K4EA 1D1JA 4X55A 2ZM0A 2ZC7A 4OONA 4Y7PA 1ZTUA 3ZG9B 4BMWA 4ZJ1A 3LY3A 2P04A 2Y55A 1F5MA 5HWTA 3UMDA 3IX3A 3NDGA 4UHUA 2CC1A 2JKRM 3NCKA 4OP8A 4ME4A 2HDQA 2JE5A 1IYOA 4N1HA 4EESA 3OZHA 2ZC6B 1BSGA 2PT7A 2PU4A 4Q8IA 4K08A 1SKOB 1SZVA 2ZC4B 4N92A 2XD5A 4O0PA 3IF6C 3VSLA 5E2HA 2HDUA 3LY4A 5DKLA 2IWDA 4H6JB 5FQ9A 5L07A 3NY4A 2DRWA 4S2OA 1QMEA 2ZQ8A 2J7VA 1KVMA 1BLPA 3OLOA 1IYPA 4OVDA 2H0TA 3BJNA 3NC8A 3SH7A 3NOTC 1HD8A 4Q0HA 4GOGA 1OJGA 3LCEA 1KGGA 3V50A 3IS2B 3KYEA 1Z6FA 1ZC2A 1FCOA 4S2PA 1K55C 1LSVA 2WKPA 3WRTA 2OAP1 2Y4AA 3PHYA 4UEYA 1MKIA 1I2SA 2OWHA 4N1XA 3BFEA 3NBLA 5HDSA 4ZTKA 2EX8A 3NOUC 1PI5A 4BD1A 3TG9A 4G3VA 2Q9MA 3MXSA 4U0XA 3UB7A 3TW8A 4E3OA 1S1ZA 4OQ0A 1EWZA 1JNUA 3M2KA 4WELA 1K38A 3QP4A 1NXYA 1YAXA 1PIOA 2V1AA 4KG2A 2V0WA 5FAPA 5GHXA 2Z6DA 3C8CA 1CEFA 3F1NB 2OSUA 3IXDA 3HUOA 1NZOA 4OQHA 1H0MA 3C38A 3LICA 1QMFA 4KG6A 3FKWA 5G4ZA 3HCYA 3UDFA 4FD8A 5EVID 3VP4A 4FH4A 3T4KA 4OPZA 2K7SA 3D72A 2FFYA 3P7NA 2HP5A 4EXOA 1L0DA 2HP9A 1MY8A 1W8QA 4WF0A 4A5RA 3LR4A 1NYMA 1N9OA 4PM9A 2BTFP 3SS4A 4IUKA 4CQHA 1YQSA 4FOFA 2JKFA 5E43A 5CECA 3UPNA 4EERA 2XA7M 3NDEA 4EQIA 4Y0UA 4ETXA 3O87A 5F1GA 3LIDA 4NKPA 3DTIA 2H28A 4I3IA 2IWBA 5F6AA 4PM7A 1LL8A 3UB8A 3UE0A 3D9YA
chains in the Genus database with same CATH topology
5FAQA 3DW0A 5GL9A 4C3QA 3A3FA 4K0WA 1XKZA 4OKPA 4WEJA 3FV7A 2Y2GA 5CHUA 4JXVA 1IYSA 1ERMA 4WZ5A 5HAPA 2H10A 1WYCA 4LENA 1ALQA 5EE8A 4C75A 1ZG6A 5GLDA 4OPQA 3HVFA 1FSYA 4LV0A 3SOIA 2Y2KA 2Y2QA 4OPYA 5FAOA 1DJCA 3A3JA 4DXBA 4OOMA 4E3MA 3Q1FA 4FH2A 1MPLA 2V20A 2WKHA 3IF5A 1GHPA 4M3KA 5CERA 1Y54A 3PBSA 3W4QA 3N4IA 4EBLA 5DVAA 4B88A 1CI9A 1H5XA 1ZG4A 4F94A 3SH8A 3V39A 4MBFA 4WYYA 3IQAA 3HLWA 3W8KA 3PAGA 4HBUA 2P74A 3C7UA 4KZ5A 4MLLA 2PU2A 4H8RA 1SKFA 4WMCA 5HL1A 1DY6A 3BFDA 1MWRA 1G6AA 1K56A 2ZLYA 4ZDXA 1ERQA 1O7EA 1YLWA 4XUZA 4HBTA 2WK0A 1H8ZA 5GLAA 3HLCA 4S2MA 1DJAA 5F1FA 4GN2A 4KZ7A 3BECA 3IWQA 1S0WA 1FCMA 3OCNA 4R4RA 4K91A 5DF8A 4DE1A 3IT9A 4GDNA 3ISGA 5DTSA 4N9KA 1PZPA 5F83A 2XF3A 5FDHA 5GLBA 1JWPA 1MWTA 2WKIA 2Y2PA 3BEBA 1BUEA 1YLTA 1K54A 4GD6A 4OH0A 4S2KA 3VP1A 3MZEA 1JVJA 2WAEA 4P85A 1HTZA 3LEZA 3Q7VA 3G35A 1Q2PA 4QD4A 1PYYA 1XXMA 4X53A 3VFHA 1SHVA 3UNWA 1BZAA 4BENA 4GD8A 1W8YA 4DE3A 4E3JA 1K57A 2G2UA 2WZZA 4P87A 1YLJA 4KQOA 1N9BA 4ZAMA 1ESIA 2WYXA 3HLEA 2BG1A 4S2IA 3ZCZA 1YMXA 2XDMA 4P6BA 1BLSA 2H0YA 2B5RA 3ZNYA 3ZNTA 4QY6A 3ZG8B 2XGNA 1BULA 1MWUA 4Z9QA 3JYIA 5HFOA 1KDSA 3QNCA 1EI5A 4K0XA 3N8SA 2ZC5B 3DWKA 2J9OA 1YLYA 3G30A 4UA9A 1JTDA 5AQ7A 3O3VA 2EXBA 1NYYA 1FCNA 4KQQA 3ZG0A 5KSCA 3WS1A 5EECA 4C6YA 4WZ5C 4D2OA 2Y2MA 3GVBA 2HP6A 3TSGA 1DJBA 1E3UA 1PW8A 1EROA 1SCWA 3HUNA 3IWIA 1ES3A 1Q2QA 3Q7VB 2Z2LB 3A3EA 1OMEA 1YLPA 1CI8A 1ZKJA 5HARA 3FKVA 3A3IA 4KG5A 2ZQDA 1YLZA 4R3BA 1RGZA 5EOOA 3WS4A 5JYPA 3MKFA 1E25A 2BLSA 2A49A 4BD0A 5I94A 2XQZA 1JTGA 2Z2MB 2OLUA 4RX2A 4OQGA 4PM8A 4EWFA 1L0GA 5AQBA 5BOHA 2Y59A 4IEDA 3AGFA 5HAQA 4QJGA 1HZOA 3V5MA 5GHYA 3C4OA 1IYQA 4CJNA 2RL3A 4JXWA 3UPPA 3I7JA 3VP3A 4EUZA 1GHMA 5FSRA 1BT5A 3IHAA 3BFGA 3D4FA 5CGWA 1RCJA 3ZFZA 2JBFA 4WEKA 2FFFB 3HLGA 2Y2JA 3G31A 3N7WA 4OQIA 2XFSA 2JC7A 4LCLA 1KE3A 3G2ZA 3BRMA 3PBQA 5CTNA 5TGFA 1LLBA 5HW3A 3LO7A 2Y2OA 3O86A 2IWCA 4OOLA 2WGWA 2OV5A 3VP2A 3ZVWA 4EBPA 4OLDA 3VP0A 3PBRA 1K54C 1PW1A 4DDSA 1FSWA 1XA1A 3HUMA 1VQQA 2P9VB 5DTTA 3W4OA 3S4XA 2QMIA 4S2NA 5EVLA 3QHYA 2E8IA 5GHZA 1KGEA 5FQMA 4DDYA 3VFFA 1K57C 3DTMA 3HLDA 4JPMA 1LI9A 1XP4A 4DF6A 3IF6A 4RX3A 3OPRA 4EV4A 2HPBA 2R9WA 3OC2A 1KDWA 4GKUA 2XFTA 4KQRA 1GHIA 5KZHA 4YINA 4PPRA 5AQ9A 2EX2A 3MKEA 4WZ4A 1M40A 5CEDA 4U3TA 4E6XA 1WYBA 1XX2A 3N8LA 1TDLA 2J9PA 4BLMA 4MNRA 1NY0A 4RVAA 3PBNA 4BL2A 1CK3A 2ZQ9A 4LV2A 4PMAA 3S1YA 1IKGA 3MFDA 4KZ8A 5FI6A 3GSGA 3EQUA 4MBHA 2XLNA 3G2YA 3MZFA 4NETA 5FQIA 5IHVA 1MBLA 2WZXA 1ES5A 1N4OA 3V3RA 1GA9A 2WGWB 1TDGA 4WMCD 3UE3A 2ZM8A 4P0MA 3VSKA 1K56D 1L0EA 2R9XA 5E2FA 2WAFA 4B4XA 3TOIA 2X01A 4BL3A 3MZDA 1K4EA 1YMSA 3WS2A 4X55A 2ZM0A 1O07A 2ZC7A 4OONA 4Y7PA 4XUXA 1KVLA 1NZUA 5M1AA 2ZQAA 3ZG9B 4XXRA 3IF6B 5EPHA 1K55A 3HREA 4U0TA 5CRFA 5FATA 4OPRA 2XR0A 1J9MA 3BFFA 4ZJ1A 3LY3A 4IVKA 2Y55A 5KSHA 3BM6A 3SH9A 5FASA 1W7FA 4JKTA 5CHJA 3SS5A 2HDRA 3GMWA 3MBZA 3NDGA 2ZQCA 1I2WA 4JF4A 5KMWA 1PWGA 1XPBA 3PBTA 2CC1A 4UHUA 5A93A 1PWDA 1LHYA 4QHCA 3A3DA 1MXOA 3NCKA 4HEFA 4OP8A 3WWXA 1G68A 3ZDJA 3MXRA 1I5QA 1K6RA 1PI4A 3N8RA 1ONGA 2ZC3B 5HAIA 3S22A 1IKIA 2HDQA 4RA7A 1TVFA 2JE5A 1IYOA 1W79A 2EX6A 2HDSA 3IH9A 2EFUA 3OZHA 4GZBA 4N1HA 5CGSA 5EVIA 1VM1A 1E4DA 2ZC6B 3V3SA 5CHMA 2Y91A 1BSGA 2J8YA 4E3KA 3FYZA 4GDBA 2OLVA 4WM9A 5DF9A 2PU4A 2Y2HA 1K25A 4B4ZA 4NK3A 2ZMAA 3NIAA 1BLHA 3OPHA 4Q8IA 1XA7A 2ZC4B 1PZOA 4S2NC 4N92A 3DWZA 3IXGA 4ID4A 1ESUA 3QNBA 4EBNA 3WS0A 4E3IA 1E3UD 2GDNA 2XD5A 1FQGA 3IF6C 3VSLA 5E2HA 2HDUA 3E2KA 1BLCA 3LY4A 3GTCA 5M19A 3CJMA 3PAEA 1HVBA 4S2LA 2IWDA 5M18A 3UY6A 5FQ9A 3B3XA 5FQKA 5DF7A 3NY4A 3UO9A 2DRWA 4S2OA 1QMEA 3Q7ZA 2ZQ8A 2PBYA 2EFXA 5EVIB 3UN7A 2J7VA 4IVIA 1WE4A 3ZHHA 3IH8A 1KVMA 3GR2A 1BLPA 5D3OA 1IYPA 2UWXA 4OVDA 4LV3A 4QY5A 2WGIA 2X02A 2Y2LA 2H0TA 3NC8A 3SH7A 4X68A 4E6WA 3AGEA 1FOFA 1HD8A 3P98A 4KZ6A 5CTMA 3GQZA 4DE2A 4GOGA 2WADA 3WS5A 1SDEA 3LCEA 1KGGA 3V50A 3G4PA 4E3LA 3FWLA 1KGFA 1Z6FA 1ZC2A 2VGJA 4X56A 1FCOA 3RXWA 4GNUA 3C4PA 3G34A 4WBGA 1ES4A 1LL9A 1C3BA 4S2PA 1H8YA 3CZDA 4FCFA 1K55C 5DTKA 4DE0A 4JBFA 3Q82A 4DKIA 4HESA 3Q81A 1K4FA 2C5WB 2I72A 4OOYA 1FR1A 4R1GA 1K6SA 3WRTA 2WKEA 2C6WB 4ZBEA 2Y4AA 2X71A 3IXHA 4JXSA 5JYOA 5EOEA 3VMAA 4KZBA 3UPOA 3C7VA 1NJ4A 3GV9A 5AQAA 3RJUA 4BJPA 1MKIA 1I2SA 2QZ6A 5E2GA 3IHBA 2V2FF 4Y0TA 4YFMA 4L0LA 1JWZA 4R23A 4N1XA 1XGJA 2Y2IA 3SS3A 3BFEA 3NBLA 4ZTKA 2EX8A 5EVIC 4PM5A 2XD1A 3OPLA 5CXWA 3Q07A 2ZQ7A 5E2EA 1PI5A 2WUQA 4BD1A 3TG9A 1LL5A 3VOZA 4KENB 1IEMA 3HLBA 3OPPA 1L0FA 2Q9MA 3UDIA 4ZJ3A 3MXSA 2EX9A 4CPKA 1YT4A 5F82A 4U0XA 5L2FA 3PTEA 5GLCA 2A3UA 1U60A 3ITBA 5A90A 5FQQA 4KZ4A 4E3OA 1MWSA 4FSFA 3M6BA 1KE0A 4OQ0A 3IWOA 4QB8A 3CG5A 3ZG7B 5CEBA 1EWZA 5A91A 3EQVA 4OP5A 4JXGA 3UDXA 3CMZA 2XH9A 4UA6A 3ZVTA 2V1ZA 3M2KA 1K38A 3AGDA 4WELA 5FI7A 3VOYA 1NXYA 3HL9A 1ONHA 4LV1A 2H5SA 5G18A 4X6TA 1ES2A 1PIOA 4JF6A 2Y2NA 4PM6A 3BFCA 3C5AA 4KG2A 1RGYA 5FAPA 1CEGA 5GHXA 2EXAA 4R4SA 1CEFA 2OSUA 3HLFA 3IXDA 3HUOA 1IELA 2ZD8A 2DCFA 3RXXA 3NI9A 5EUAA 4JF5A 3ZGAB 3BLMA 1NZOA 4OQHA 4Y0OA 1QMFA 4KG6A 4S2JA 3FKWA 5U47A 3UDFA 4FD8A 5EVID 2WGVA 1AXBA 5A92A 1GA0A 1JWVA 3VP4A 4IBXA 1FR6A 4FH4A 1PWCA 3GRJA 3IXBA 3M2JA 3PBOA 3E2LA 1GCEA 4OPZA 5J8XA 1S6RA 4OLGA 4GB7A 2FFYA 2Q9NA 4KZ3A 3N6IA 4MBKA 2HP5A 3O88A 3OCLA 4O7DA 1L0DA 2HP9A 4R3JA 1RP5A 1MY8A 5HX9A 1W8QA 4E3NA 5FQJA 4A5RA 3W4PA 4QU3A 1NRFA 4KZ9A 1NYMA 1XGIA 4RYEA 4IBRA 4MEZA 3FZCA 4KZAA 4PM9A 2XEPA 4UA7A 5CGXA 4JLFA 5FI2A 3SS4A 3WRZA 1YQSA 1TEMA 3ITAA 1LI0A 5TFQA 2XK1A 5E43A 1YM1A 4R0QA 5CECA 3UPNA 3G32A 4DRTA 1W5DA 4X69A 3ZG5A 2P9VA 2ZM2A 1BTLA 4LCMA 1L2SA 4N9LA 3NDEA 3M6HA 4EQIA 4Y0UA 2G2WA 3O87A 5F1GA 5FA7A 3BYDA 1SDNA 2QPNA 4ZJ2A 2ZJ9A 1KE4A 2RCXA 3P09A 4UAAA 2IWBA 4BQMA 5TR7A 1M6KA 2VGKA 4PM7A 3UE1A 4DXCA 3BLSA 3UE0A 2DNSA 3HBRA 2JCHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FAQ A;  3DW0 A;  5GL9 A;  4C3Q A;  3A3F A;  4K0W A;  1XKZ A;  4OKP A;  4WEJ A;  3FV7 A;  2Y2G A;  5CHU A;  4JXV A;  1IYS A;  1ERM A;  4WZ5 A;  5HAP A;  2H10 A;  1WYC A;  4LEN A;  1ALQ A;  5EE8 A;  4C75 A;  1ZG6 A;  5GLD A;  4OPQ A;  3HVF A;  1FSY A;  4LV0 A;  3SOI A;  2Y2K A;  2Y2Q A;  4OPY A;  5FAO A;  1DJC A;  3A3J A;  4DXB A;  4OOM A;  4E3M A;  3Q1F A;  4FH2 A;  1MPL A;  2V20 A;  2WKH A;  3IF5 A;  1GHP A;  4M3K A;  5CER A;  1Y54 A;  3PBS A;  3W4Q A;  3N4I A;  4EBL A;  5DVA A;  4B88 A;  1CI9 A;  1H5X A;  1ZG4 A;  4F94 A;  3SH8 A;  3V39 A;  4MBF A;  4WYY A;  3IQA A;  3HLW A;  3W8K A;  3PAG A;  4HBU A;  2P74 A;  3C7U A;  4KZ5 A;  4MLL A;  2PU2 A;  4H8R A;  1SKF A;  4WMC A;  5HL1 A;  1DY6 A;  3BFD A;  1MWR A;  1G6A A;  1K56 A;  2ZLY A;  4ZDX A;  1ERQ A;  1O7E A;  1YLW A;  4XUZ A;  4HBT A;  2WK0 A;  1H8Z A;  5GLA A;  3HLC A;  4S2M A;  1DJA A;  5F1F A;  4GN2 A;  4KZ7 A;  3BEC A;  3IWQ A;  1S0W A;  1FCM A;  3OCN A;  4R4R A;  4K91 A;  5DF8 A;  4DE1 A;  3IT9 A;  4GDN A;  3ISG A;  5DTS A;  4N9K A;  1PZP A;  5F83 A;  2XF3 A;  5FDH A;  5GLB A;  1JWP A;  1MWT A;  2WKI A;  2Y2P A;  3BEB A;  1BUE A;  1YLT A;  1K54 A;  4GD6 A;  4OH0 A;  4S2K A;  3VP1 A;  3MZE A;  1JVJ A;  2WAE A;  4P85 A;  1HTZ A;  3LEZ A;  3Q7V A;  3G35 A;  1Q2P A;  4QD4 A;  1PYY A;  1XXM A;  4X53 A;  3VFH A;  1SHV A;  3UNW A;  1BZA A;  4BEN A;  4GD8 A;  1W8Y A;  4DE3 A;  4E3J A;  1K57 A;  2G2U A;  2WZZ A;  4P87 A;  1YLJ A;  4KQO A;  1N9B A;  4ZAM A;  1ESI A;  2WYX A;  3HLE A;  2BG1 A;  4S2I A;  3ZCZ A;  1YMX A;  2XDM A;  4P6B A;  1BLS A;  2H0Y A;  2B5R A;  3ZNY A;  3ZNT A;  4QY6 A;  3ZG8 B;  2XGN A;  1BUL A;  1MWU A;  4Z9Q A;  3JYI A;  5HFO A;  1KDS A;  3QNC A;  1EI5 A;  4K0X A;  3N8S A;  2ZC5 B;  3DWK A;  2J9O A;  1YLY A;  3G30 A;  4UA9 A;  1JTD A;  5AQ7 A;  3O3V A;  2EXB A;  1NYY A;  1FCN A;  4KQQ A;  3ZG0 A;  5KSC A;  3WS1 A;  5EEC A;  4C6Y A;  4WZ5 C;  4D2O A;  2Y2M A;  3GVB A;  2HP6 A;  3TSG A;  1DJB A;  1E3U A;  1PW8 A;  1ERO A;  1SCW A;  3HUN A;  3IWI A;  1ES3 A;  1Q2Q A;  3Q7V B;  2Z2L B;  3A3E A;  1OME A;  1YLP A;  1CI8 A;  1ZKJ A;  5HAR A;  3FKV A;  3A3I A;  4KG5 A;  2ZQD A;  1YLZ A;  4R3B A;  1RGZ A;  5EOO A;  3WS4 A;  5JYP A;  3MKF A;  1E25 A;  2BLS A;  2A49 A;  4BD0 A;  5I94 A;  2XQZ A;  1JTG A;  2Z2M B;  2OLU A;  4RX2 A;  4OQG A;  4PM8 A;  4EWF A;  1L0G A;  5AQB A;  5BOH A;  2Y59 A;  4IED A;  3AGF A;  5HAQ A;  4QJG A;  1HZO A;  3V5M A;  5GHY A;  3C4O A;  1IYQ A;  4CJN A;  2RL3 A;  4JXW A;  3UPP A;  3I7J A;  3VP3 A;  4EUZ A;  1GHM A;  5FSR A;  1BT5 A;  3IHA A;  3BFG A;  3D4F A;  5CGW A;  1RCJ A;  3ZFZ A;  2JBF A;  4WEK A;  2FFF B;  3HLG A;  2Y2J A;  3G31 A;  3N7W A;  4OQI A;  2XFS A;  2JC7 A;  4LCL A;  1KE3 A;  3G2Z A;  3BRM A;  3PBQ A;  5CTN A;  5TGF A;  1LLB A;  5HW3 A;  3LO7 A;  2Y2O A;  3O86 A;  2IWC A;  4OOL A;  2WGW A;  2OV5 A;  3VP2 A;  3ZVW A;  4EBP A;  4OLD A;  3VP0 A;  3PBR A;  1K54 C;  1PW1 A;  4DDS A;  1FSW A;  1XA1 A;  3HUM A;  1VQQ A;  2P9V B;  5DTT A;  3W4O A;  3S4X A;  2QMI A;  4S2N A;  5EVL A;  3QHY A;  2E8I A;  5GHZ A;  1KGE A;  5FQM A;  4DDY A;  3VFF A;  1K57 C;  3DTM A;  3HLD A;  4JPM A;  1LI9 A;  1XP4 A;  4DF6 A;  3IF6 A;  4RX3 A;  3OPR A;  4EV4 A;  2HPB A;  2R9W A;  3OC2 A;  1KDW A;  4GKU A;  2XFT A;  4KQR A;  1GHI A;  5KZH A;  4YIN A;  4PPR A;  5AQ9 A;  2EX2 A;  3MKE A;  4WZ4 A;  1M40 A;  5CED A;  4U3T A;  4E6X A;  1WYB A;  1XX2 A;  3N8L A;  1TDL A;  2J9P A;  4BLM A;  4MNR A;  1NY0 A;  4RVA A;  3PBN A;  4BL2 A;  1CK3 A;  2ZQ9 A;  4LV2 A;  4PMA A;  3S1Y A;  1IKG A;  3MFD A;  4KZ8 A;  5FI6 A;  3GSG A;  3EQU A;  4MBH A;  2XLN A;  3G2Y A;  3MZF A;  4NET A;  5FQI A;  5IHV A;  1MBL A;  2WZX A;  1ES5 A;  1N4O A;  3V3R A;  1GA9 A;  2WGW B;  1TDG A;  4WMC D;  3UE3 A;  2ZM8 A;  4P0M A;  3VSK A;  1K56 D;  1L0E A;  2R9X A;  5E2F A;  2WAF A;  4B4X A;  3TOI A;  2X01 A;  4BL3 A;  3MZD A;  1K4E A;  1YMS A;  3WS2 A;  4X55 A;  2ZM0 A;  1O07 A;  2ZC7 A;  4OON A;  4Y7P A;  4XUX A;  1KVL A;  1NZU A;  5M1A A;  2ZQA A;  3ZG9 B;  4XXR A;  3IF6 B;  5EPH A;  1K55 A;  3HRE A;  4U0T A;  5CRF A;  5FAT A;  4OPR A;  2XR0 A;  1J9M A;  3BFF A;  4ZJ1 A;  3LY3 A;  4IVK A;  2Y55 A;  5KSH A;  3BM6 A;  3SH9 A;  5FAS A;  1W7F A;  4JKT A;  5CHJ A;  3SS5 A;  2HDR A;  3GMW A;  3MBZ A;  3NDG A;  2ZQC A;  1I2W A;  4JF4 A;  5KMW A;  1PWG A;  1XPB A;  3PBT A;  2CC1 A;  4UHU A;  5A93 A;  1PWD A;  1LHY A;  4QHC A;  3A3D A;  1MXO A;  3NCK A;  4HEF A;  4OP8 A;  3WWX A;  1G68 A;  3ZDJ A;  3MXR A;  1I5Q A;  1K6R A;  1PI4 A;  3N8R A;  1ONG A;  2ZC3 B;  5HAI A;  3S22 A;  1IKI A;  2HDQ A;  4RA7 A;  1TVF A;  2JE5 A;  1IYO A;  1W79 A;  2EX6 A;  2HDS A;  3IH9 A;  2EFU A;  3OZH A;  4GZB A;  4N1H A;  5CGS A;  5EVI A;  1VM1 A;  1E4D A;  2ZC6 B;  3V3S A;  5CHM A;  2Y91 A;  1BSG A;  2J8Y A;  4E3K A;  3FYZ A;  4GDB A;  2OLV A;  4WM9 A;  5DF9 A;  2PU4 A;  2Y2H A;  1K25 A;  4B4Z A;  4NK3 A;  2ZMA A;  3NIA A;  1BLH A;  3OPH A;  4Q8I A;  1XA7 A;  2ZC4 B;  1PZO A;  4S2N C;  4N92 A;  3DWZ A;  3IXG A;  4ID4 A;  1ESU A;  3QNB A;  4EBN A;  3WS0 A;  4E3I A;  1E3U D;  2GDN A;  2XD5 A;  1FQG A;  3IF6 C;  3VSL A;  5E2H A;  2HDU A;  3E2K A;  1BLC A;  3LY4 A;  3GTC A;  5M19 A;  3CJM A;  3PAE A;  1HVB A;  4S2L A;  2IWD A;  5M18 A;  3UY6 A;  5FQ9 A;  3B3X A;  5FQK A;  5DF7 A;  3NY4 A;  3UO9 A;  2DRW A;  4S2O A;  1QME A;  3Q7Z A;  2ZQ8 A;  2PBY A;  2EFX A;  5EVI B;  3UN7 A;  2J7V A;  4IVI A;  1WE4 A;  3ZHH A;  3IH8 A;  1KVM A;  3GR2 A;  1BLP A;  5D3O A;  1IYP A;  2UWX A;  4OVD A;  4LV3 A;  4QY5 A;  2WGI A;  2X02 A;  2Y2L A;  2H0T A;  3NC8 A;  3SH7 A;  4X68 A;  4E6W A;  3AGE A;  1FOF A;  1HD8 A;  3P98 A;  4KZ6 A;  5CTM A;  3GQZ A;  4DE2 A;  4GOG A;  2WAD A;  3WS5 A;  1SDE A;  3LCE A;  1KGG A;  3V50 A;  3G4P A;  4E3L A;  3FWL A;  1KGF A;  1Z6F A;  1ZC2 A;  2VGJ A;  4X56 A;  1FCO A;  3RXW A;  4GNU A;  3C4P A;  3G34 A;  4WBG A;  1ES4 A;  1LL9 A;  1C3B A;  4S2P A;  1H8Y A;  3CZD A;  4FCF A;  1K55 C;  5DTK A;  4DE0 A;  4JBF A;  3Q82 A;  4DKI A;  4HES A;  3Q81 A;  1K4F A;  2C5W B;  2I72 A;  4OOY A;  1FR1 A;  4R1G A;  1K6S A;  3WRT A;  2WKE A;  2C6W B;  4ZBE A;  2Y4A A;  2X71 A;  3IXH A;  4JXS A;  5JYO A;  5EOE A;  3VMA A;  4KZB A;  3UPO A;  3C7V A;  1NJ4 A;  3GV9 A;  5AQA A;  3RJU A;  4BJP A;  1MKI A;  1I2S A;  2QZ6 A;  5E2G A;  3IHB A;  2V2F F;  4Y0T A;  4YFM A;  4L0L A;  1JWZ A;  4R23 A;  4N1X A;  1XGJ A;  2Y2I A;  3SS3 A;  3BFE A;  3NBL A;  4ZTK A;  2EX8 A;  5EVI C;  4PM5 A;  2XD1 A;  3OPL A;  5CXW A;  3Q07 A;  2ZQ7 A;  5E2E A;  1PI5 A;  2WUQ A;  4BD1 A;  3TG9 A;  1LL5 A;  3VOZ A;  4KEN B;  1IEM A;  3HLB A;  3OPP A;  1L0F A;  2Q9M A;  3UDI A;  4ZJ3 A;  3MXS A;  2EX9 A;  4CPK A;  1YT4 A;  5F82 A;  4U0X A;  5L2F A;  3PTE A;  5GLC A;  2A3U A;  1U60 A;  3ITB A;  5A90 A;  5FQQ A;  4KZ4 A;  4E3O A;  1MWS A;  4FSF A;  3M6B A;  1KE0 A;  4OQ0 A;  3IWO A;  4QB8 A;  3CG5 A;  3ZG7 B;  5CEB A;  1EWZ A;  5A91 A;  3EQV A;  4OP5 A;  4JXG A;  3UDX A;  3CMZ A;  2XH9 A;  4UA6 A;  3ZVT A;  2V1Z A;  3M2K A;  1K38 A;  3AGD A;  4WEL A;  5FI7 A;  3VOY A;  1NXY A;  3HL9 A;  1ONH A;  4LV1 A;  2H5S A;  5G18 A;  4X6T A;  1ES2 A;  1PIO A;  4JF6 A;  2Y2N A;  4PM6 A;  3BFC A;  3C5A A;  4KG2 A;  1RGY A;  5FAP A;  1CEG A;  5GHX A;  2EXA A;  4R4S A;  1CEF A;  2OSU A;  3HLF A;  3IXD A;  3HUO A;  1IEL A;  2ZD8 A;  2DCF A;  3RXX A;  3NI9 A;  5EUA A;  4JF5 A;  3ZGA B;  3BLM A;  1NZO A;  4OQH A;  4Y0O A;  1QMF A;  4KG6 A;  4S2J A;  3FKW A;  5U47 A;  3UDF A;  4FD8 A;  5EVI D;  2WGV A;  1AXB A;  5A92 A;  1GA0 A;  1JWV A;  3VP4 A;  4IBX A;  1FR6 A;  4FH4 A;  1PWC A;  3GRJ A;  3IXB A;  3M2J A;  3PBO A;  3E2L A;  1GCE A;  4OPZ A;  5J8X A;  1S6R A;  4OLG A;  4GB7 A;  2FFY A;  2Q9N A;  4KZ3 A;  3N6I A;  4MBK A;  2HP5 A;  3O88 A;  3OCL A;  4O7D A;  1L0D A;  2HP9 A;  4R3J A;  1RP5 A;  1MY8 A;  5HX9 A;  1W8Q A;  4E3N A;  5FQJ A;  4A5R A;  3W4P A;  4QU3 A;  1NRF A;  4KZ9 A;  1NYM A;  1XGI A;  4RYE A;  4IBR A;  4MEZ A;  3FZC A;  4KZA A;  4PM9 A;  2XEP A;  4UA7 A;  5CGX A;  4JLF A;  5FI2 A;  3SS4 A;  3WRZ A;  1YQS A;  1TEM A;  3ITA A;  1LI0 A;  5TFQ A;  2XK1 A;  5E43 A;  1YM1 A;  4R0Q A;  5CEC A;  3UPN A;  3G32 A;  4DRT A;  1W5D A;  4X69 A;  3ZG5 A;  2P9V A;  2ZM2 A;  1BTL A;  4LCM A;  1L2S A;  4N9L A;  3NDE A;  3M6H A;  4EQI A;  4Y0U A;  2G2W A;  3O87 A;  5F1G A;  5FA7 A;  3BYD A;  1SDN A;  2QPN A;  4ZJ2 A;  2ZJ9 A;  1KE4 A;  2RCX A;  3P09 A;  4UAA A;  2IWB A;  4BQM A;  5TR7 A;  1M6K A;  2VGK A;  4PM7 A;  3UE1 A;  4DXC A;  3BLS A;  3UE0 A;  2DNS A;  3HBR A;  2JCH A; 
#chains in the Genus database with same CATH topology
 4LRY C;  1NWZ A;  3TRC A;  4C3Q A;  4K0W A;  2Y2G A;  1IFQ A;  3T4Q A;  4WZ5 A;  1ALQ A;  3BQA A;  3KSF A;  2JKT M;  3HVF A;  1FSY A;  1UWP X;  4LV0 A;  3SOI A;  2Y2K A;  3A3J A;  4E3M A;  4FH2 A;  3T4J A;  4M3K A;  5CER A;  3PBS A;  3TE8 A;  1H5X A;  4F94 A;  3V39 A;  4EU0 A;  4YWZ A;  3PAG A;  2YKH A;  2EWV A;  5EVE A;  1ACF A;  1MWR A;  2ZLY A;  1YLW A;  2WK0 A;  5GLA A;  2VV6 A;  4S2M A;  2Z6C A;  5EM0 A;  3IWQ A;  4EEP A;  3OCN A;  5DF8 A;  1VET A;  4DE1 A;  1P9R A;  3ISG A;  4N9K A;  5F83 A;  3LR0 A;  5FDH A;  1MWT A;  3BEB A;  1YLT A;  1JVJ A;  4P85 A;  1HTZ A;  3LEZ A;  3Q7V A;  1BZA A;  4DE3 A;  1YLJ A;  2WYX A;  4XT2 A;  2JKG A;  4P6B A;  1S66 L;  1BLS A;  3EGX C;  3ZNY A;  3ZG8 B;  1MWU A;  3JYI A;  4K0X A;  3N8S A;  4UA9 A;  1FCN A;  4KQQ A;  4I3J A;  4C6Y A;  4Y15 A;  3ZQ5 A;  1ES3 A;  1Q2Q A;  3Q7V B;  5IS1 A;  1YLP A;  1OME A;  1CI8 A;  1H3Q A;  2PRF A;  5HAR A;  1A0K A;  3FKV A;  1RGZ A;  5JYP A;  2BLS A;  2HV1 A;  4GLQ A;  5I94 A;  5A8B A;  4PM8 A;  4GS9 A;  5AQB A;  4IED A;  4ARZ A;  3C4O A;  3VE4 A;  2A2L A;  4JXW A;  1EW0 A;  1S1Y A;  3VP3 A;  1YSQ A;  3L7H A;  4EUZ A;  3EEH A;  5FSR A;  3IHA A;  3D4F A;  2FFF B;  3G31 A;  3N7W A;  4LCL A;  3G2Z A;  5TGF A;  4NXF A;  3LO7 A;  3LUQ A;  2MJ6 A;  3MSH A;  4R6L A;  1DRM A;  4EBP A;  5EV0 A;  3VP0 A;  1LSX A;  2XRO A;  1T1A A;  2O9C A;  5EVL A;  5FQM A;  5FEG A;  1K57 C;  3DTM A;  4JPM A;  3KYQ A;  4RX3 A;  4ARZ B;  2W3D A;  2HPB A;  2VGL S;  4KQR A;  2XFT A;  4PPR A;  1CQA A;  2EWW A;  4U3T A;  4YOF A;  4BLM A;  2J9P A;  4IHQ A;  4RVA A;  1VHM A;  2ZQ9 A;  4LV2 A;  5G4Y A;  3OOV A;  1ES5 A;  1N4O A;  3TJZ C;  4WMC D;  2ZM8 A;  3P01 A;  2X01 A;  4BL3 A;  3MZD A;  1S67 L;  3FG8 A;  3MQO A;  5M1A A;  2VEA A;  5EPH A;  3HRE A;  3MJQ A;  1OTI A;  4U0T A;  4Z1W A;  4OPR A;  2XR0 A;  3BM6 A;  2QHK A;  3SH9 A;  5FAS A;  3R4K A;  1W7F A;  3SS5 A;  2UV0 E;  3MF0 A;  3GMW A;  2ZQC A;  3PBT A;  2L0W A;  4QHC A;  1MXO A;  3QP1 A;  3ZDJ A;  1I5Q A;  3H9W A;  2PAV P;  1PI4 A;  3N8R A;  2ZC3 B;  3S22 A;  5DFY A;  5FAO A;  2EX6 A;  1W79 A;  2HDS A;  5EVI A;  4GZB A;  3S7Q A;  1E4D A;  4HP9 A;  1VB6 A;  2OLV A;  3LIA A;  4O01 A;  4B4Z A;  3CUE C;  4DN0 A;  2ZMA A;  4DJ2 A;  5HD5 A;  1PZO A;  3QNB A;  1TF1 A;  1OTB A;  3GTC A;  3CJM A;  5TBM A;  5M18 A;  3UY6 A;  3B3X A;  4E04 A;  3UO9 A;  5EVI B;  3GR2 A;  4QY5 A;  2WGI A;  4RQ9 A;  4MCW A;  3AGE A;  1FOF A;  5CTM A;  3GQZ A;  4DE2 A;  4LRX C;  2B18 A;  3WS5 A;  1T1B A;  3G4P A;  3FWL A;  1KGF A;  4B93 A;  4X56 A;  4X25 A;  1PRQ A;  1OTA A;  3C4P A;  4WBG A;  1ES4 A;  1C3B A;  2INW A;  4FCF A;  4DKI A;  1OJ5 A;  3Q82 A;  4OOY A;  2C5W B;  4R1G A;  1FR1 A;  2C6W B;  4ZBE A;  5JYO A;  4NG2 A;  4BJP A;  3F1P B;  5E2G A;  3IHB A;  2V2F F;  4Y0T A;  1JWZ A;  1XGJ A;  2Y2I A;  3SS3 A;  4PM5 A;  3RFB A;  3Q07 A;  1ODV A;  1LT0 A;  3VOZ A;  4HH3 A;  4KEN B;  3K2N A;  4HHD A;  3KSG A;  5F82 A;  2A3U A;  1U60 A;  3ITB A;  4LGW A;  5FQQ A;  2O0Y A;  3A0S A;  3NJA A;  4IUH A;  4QB8 A;  3CG5 A;  3ZG7 B;  5CEB A;  4EW7 A;  2XH9 A;  3MMH A;  3VOY A;  3HL9 A;  2H5S A;  5G18 A;  3QP5 A;  2EXA A;  2Y79 A;  2DCF A;  3RXX A;  3NI9 A;  3BLM A;  1L3L A;  4Y5F A;  4Y0O A;  5U47 A;  5F69 A;  1GA0 A;  1JWV A;  4GCZ A;  4IBX A;  1FR6 A;  3GRJ A;  3M2J A;  3PBO A;  2YKF A;  3E2L A;  1S4S A;  1S6R A;  2J3T D;  4OLG A;  1OTD A;  2Q9N A;  4NXB A;  4PKY G;  4ZRR A;  5HL6 A;  3OCL A;  4KUO A;  4O7D A;  4UQI S;  2V8C A;  5FQJ A;  4II7 A;  4MEZ A;  2XEP A;  5CGX A;  3ITA A;  5TFQ A;  4DRT A;  4X69 A;  3H82 A;  4N9L A;  3L9K A;  5KIZ A;  3UB5 P;  1IOU A;  2KDK A;  2VZW A;  2QPN A;  3T4O A;  2RCX A;  5K5B A;  4UAA A;  1H8M A;  3S7P A;  3BLS A;  3DW0 A;  5GL9 A;  4WEJ A;  2ZL1 A;  1ERM A;  3S7O A;  3VE3 A;  4HQA A;  1ZG6 A;  3UB9 A;  4OPY A;  4DXB A;  1VEU A;  3H82 B;  3N4I A;  1F9I A;  5DVA A;  4B88 A;  2D01 A;  1ZG4 A;  3BQ8 A;  4HH2 A;  1OT6 A;  4HBU A;  2P74 A;  3C7U A;  4KZ5 A;  4H8R A;  4WMC A;  5HL1 A;  1DY6 A;  3BFD A;  3LR5 A;  1ERQ A;  1O7E A;  2O9B A;  4XUZ A;  2L1M A;  2ZL1 B;  4GN2 A;  3T4S A;  1T19 A;  4GDN A;  5DTS A;  3O5Y A;  3E98 A;  2XF3 A;  5GLB A;  1JWP A;  1VEU B;  1BUE A;  1K54 A;  4OH0 A;  4S2K A;  3MZE A;  3G35 A;  4QD4 A;  1XXM A;  3ICY A;  1SHV A;  4P6Z S;  4GD8 A;  2HF6 A;  2O99 A;  2ACG A;  2G2U A;  4KQO A;  1N9B A;  2LB9 A;  1ESI A;  4S2I A;  3ZCZ A;  1UGU A;  2XDM A;  2J3W A;  4MDZ A;  3ZNT A;  2XGN A;  1BUL A;  1KOU A;  2OWJ A;  1G5U A;  3DWK A;  5AQ7 A;  2J9O A;  1YKD A;  2EXB A;  4L9F A;  5EEC A;  4CLC A;  5J4E A;  3B42 A;  4BBU A;  2VK3 A;  4Q0J A;  1SCW A;  1ERO A;  5C5K A;  3H7W A;  2ZMV A;  3KYZ A;  4KG5 A;  4R3B A;  5EOO A;  3QP8 A;  4JGP A;  3DBA A;  3MKF A;  1D06 A;  2A49 A;  2OLU A;  3CAX A;  4OQG A;  4EWF A;  1L0G A;  3NHQ A;  3ZYT A;  5HAQ A;  3SW1 A;  2PR5 A;  5GHY A;  1F98 A;  4CJN A;  5HPF A;  3S7N A;  3LYX A;  3T1X A;  1BT5 A;  3BFG A;  4HIA A;  4WEK A;  4OQI A;  2XFS A;  2JC7 A;  4CLC B;  1KE3 A;  5FDS A;  1P9W A;  2WGW A;  2QJ7 A;  3PBR A;  2W3G A;  4EQ1 A;  1FSW A;  3HUM A;  3W4O A;  3S4X A;  2QMI A;  4Y3I A;  2I9V A;  4G3K A;  1LI9 A;  1STZ A;  4DF6 A;  3IF6 A;  1GSX A;  3A0V A;  4EV4 A;  4YIN A;  3CI6 A;  1XJ2 A;  1M40 A;  5CED A;  4E6X A;  1WYB A;  3N8L A;  3PBN A;  4NXG A;  3KO6 A;  4AFI A;  3MFD A;  4KZ8 A;  4NEE D;  2XLN A;  3CIT A;  2WGW B;  1TDG A;  3VSK A;  1K56 D;  1TD5 A;  5E2F A;  4B4X A;  1MC0 A;  1YMS A;  3C30 A;  1O07 A;  2V8F A;  5J3W A;  2W1T A;  1KVL A;  1NZU A;  2ZQA A;  3LGO A;  4XXR A;  3IF6 B;  1K55 A;  5FAT A;  5CRF A;  4QWO A;  1J9M A;  5KSH A;  4IVK A;  1PNE A;  5CHJ A;  2HDR A;  5KMW A;  1PWG A;  2PHY A;  1PWD A;  3A3D A;  3MXQ A;  3WWX A;  3MXR A;  1DP9 A;  1ONG A;  1CJF A;  4ESP A;  5CGS A;  2EFU A;  1VET B;  1VM1 A;  3UE6 A;  1V9Z A;  5CHM A;  2J8Y A;  4E3K A;  2HJ9 C;  4GDB A;  5HDD A;  4WM9 A;  2Y2H A;  1K25 A;  2M7V A;  1BLH A;  1XA7 A;  2V9A A;  4S2N C;  3DWZ A;  3E4O A;  4ID4 A;  1ESU A;  2AVX A;  1E3U D;  2GDN A;  4XT2 B;  4UQI M;  3SZT A;  3PAE A;  4S2L A;  3LIE A;  5FQK A;  5DF7 A;  4FUW A;  4F3L A;  3Q7Z A;  2PBY A;  2EFX A;  3UN7 A;  4IVI A;  1WE4 A;  5D3O A;  4LV3 A;  2Y2L A;  1DP6 A;  5AVE A;  4X68 A;  1T18 A;  2LB5 A;  4KZ6 A;  1NLZ A;  2P08 A;  2VV7 A;  1SDE A;  2A24 A;  1V9Y A;  2WKR A;  5J7E A;  3G34 A;  1W63 M;  1ZHH B;  5DTK A;  3LIF A;  4M4X A;  4GS9 B;  1NRJ A;  4JBF A;  3Q81 A;  1K4F A;  2I72 A;  4ETZ A;  2V0U A;  3IX8 A;  5EOE A;  3VMA A;  4F3L B;  3GV9 A;  5AQA A;  3RJU A;  2QZ6 A;  4L0L A;  4R23 A;  2K2N A;  1GSV A;  2XD1 A;  5CXW A;  2ZQ7 A;  4IJG A;  2WUQ A;  2W27 A;  3HLB A;  1L0F A;  2A24 B;  4JGQ A;  4ZJ3 A;  2EX9 A;  2VLG A;  1YT4 A;  4WLA A;  3GDI A;  5L2F A;  3PTE A;  5GLC A;  5A90 A;  3BWL A;  3FC7 A;  1MWS A;  3LIB A;  1KE0 A;  2GZA A;  3IWO A;  3EWK A;  2JKR I;  3AGD A;  5AJG A;  4X6T A;  2IA2 A;  4JF6 A;  4PM6 A;  1LSW A;  3C5A A;  1RGY A;  3KSI A;  4P6Z M;  4I5S A;  3UB6 A;  1IEL A;  2ZD8 A;  3KX0 X;  1WA9 A;  5EUA A;  5FL3 A;  3E0Y A;  4S2J A;  3VOL A;  2B02 A;  1BYW A;  3K3C A;  3HJI A;  4GB7 A;  4CLC D;  3V67 A;  3N6I A;  4MBK A;  3O88 A;  4E3N A;  3W4P A;  2K31 A;  3T4L A;  1XGI A;  4IBR A;  4Y2F A;  4KZA A;  1LI0 A;  4Y17 A;  2PD7 A;  1YM1 A;  4R0Q A;  4JGO A;  3G32 A;  1OTE A;  1W5D A;  3ULF A;  2P9V A;  2ZM2 A;  1BTL A;  1L2S A;  3T4T A;  3M6H A;  1MKM A;  2G2W A;  2VX8 A;  5FA7 A;  4R3A A;  3PXP A;  5TR7 A;  1M6K A;  3UE1 A;  5FEF A;  3DTK A;  4DXC A;  2ZBB A;  1Y4O A;  1W63 Q;  5MC7 A;  4R38 A;  2DNS A;  3HBR A;  2JCH A;  5FAQ A;  4OKP A;  3D3O A;  4HJ3 A;  3FV7 A;  4JXV A;  1CF0 A;  1K0K A;  1WYC A;  4LEN A;  5TBM B;  5GLD A;  2NUT C;  1PFL A;  4OOM A;  3Q1F A;  4KQD A;  2PBD P;  5IT5 A;  4EBL A;  2QKP A;  4MBF A;  3IQA A;  1F2K A;  3W8K A;  4MLL A;  2PU2 A;  4EEU A;  1K56 A;  5IU1 A;  4X1L A;  5F5Y A;  1H8Z A;  1DJA A;  5F1F A;  3BEC A;  1S0W A;  1FCM A;  3T1S A;  4R4R A;  4K91 A;  3IT9 A;  5DKK A;  5EFW A;  1PZP A;  4X1M A;  3LR3 A;  2WKI A;  3CWF A;  3R7W A;  3BY8 A;  4GD6 A;  1XJ4 A;  3BY9 A;  2WAE A;  1Q2P A;  1PYY A;  4X53 A;  2HJE A;  1SKO A;  3UNW A;  1TS6 A;  4BEN A;  4WN5 A;  1K57 A;  4L9E A;  3HLE A;  2BG1 A;  1YMX A;  4MN6 A;  1YSP A;  1KDS A;  4H6J A;  3QNC A;  4I39 A;  2VJW A;  2ZC5 B;  1YLY A;  3G30 A;  1JTD A;  3ZG0 A;  5KSC A;  3WS1 A;  4WZ5 C;  4D2O A;  2Y2M A;  3GVB A;  2HP6 A;  3R7W B;  1E3U A;  3HUN A;  4FTX A;  2Z2L B;  1YLZ A;  2D02 A;  4Q0I A;  3WS4 A;  4I38 A;  3IS2 A;  4BD0 A;  5HWW A;  1JTG A;  2Z2M B;  4RX2 A;  4NXE A;  5BOH A;  2Y59 A;  3FPW A;  3AGF A;  1HZO A;  1IYQ A;  3UPP A;  5HPI A;  3I7J A;  5CX7 A;  4B9O A;  5CGW A;  1P97 A;  2JBF A;  3HLG A;  4EUV A;  1N9L A;  3BRM A;  3PBQ A;  2W3H A;  2JKT I;  3O86 A;  4OOL A;  2OV5 A;  3VP2 A;  4WL9 A;  3T1Q B;  2E8J A;  3CUE A;  2O9A A;  5GHZ A;  4DDY A;  3VFF A;  2M7U A;  1XP4 A;  2EA9 A;  1DP8 A;  2R9W A;  1KDW A;  5KZH A;  1GHI A;  4HNB A;  5AQ9 A;  4WZ4 A;  2VGL M;  2HZ5 A;  4MNR A;  2ZMF A;  4BL2 A;  2OOL A;  1CK3 A;  4PMA A;  4HP4 A;  3U2A A;  3EQU A;  4MBH A;  3MR0 A;  3IBR A;  3MZF A;  5FQI A;  1Z09 A;  5IHV A;  1MBL A;  3V3R A;  1GA9 A;  3F1N A;  2J3T C;  4P0M A;  1XFN A;  2R9X A;  2OAQ 1;  2WAF A;  3TOI A;  3LI9 A;  2R78 A;  3WS2 A;  3G6O A;  3NOP C;  4PHT A;  4XUX A;  3BFF A;  2KX6 A;  3C2W A;  5L09 A;  4JKT A;  3MBZ A;  1I2W A;  4JF4 A;  1XPB A;  3B47 A;  5A93 A;  3JVU A;  1LHY A;  5HAP A;  4HEF A;  2KLI A;  3EGD C;  1G68 A;  3PYP A;  1K6R A;  5HAI A;  1IKI A;  4RA7 A;  1TVF A;  1TS7 A;  3IH9 A;  1XJ6 A;  3V3S A;  2Y91 A;  2PR6 A;  4GHI A;  3FYZ A;  3B33 A;  2JHE A;  2VKS A;  3IBJ A;  4DMZ A;  2ZOH A;  5DF9 A;  4NK3 A;  2L4R A;  3NIA A;  5DFX A;  3OPH A;  2W0N A;  3IXG A;  4EBN A;  3WS0 A;  4E3I A;  1FQG A;  4EET B;  5HSQ A;  4DJ3 A;  3E2K A;  1BLC A;  3U4L P;  1X0O A;  1Y28 A;  3EEA A;  5M19 A;  1HVB A;  3ZHH A;  2DMW A;  3IH8 A;  1G28 A;  3RTY A;  2UWX A;  4GHI B;  2X02 A;  4JGR A;  3FPV A;  4E6W A;  5DJU A;  3P98 A;  3H7W B;  3VV4 A;  4R70 A;  2WAD A;  4MMN A;  4E3L A;  4BBT A;  2VGJ A;  3RXW A;  4GNU A;  1LL9 A;  1H8Y A;  3CZD A;  4DE0 A;  4HES A;  1K6S A;  2WKE A;  4LFU A;  2G7U A;  4BBV A;  2X71 A;  3IXH A;  3F1O A;  4JXS A;  3MQ0 A;  1UWN X;  4KZB A;  3UPO A;  1TS8 A;  1NJ4 A;  3C7V A;  3MFX A;  2PYP A;  4YFM A;  4KUK A;  5EVI C;  3OPL A;  2WKQ A;  5E2E A;  2HGV A;  2PYR A;  2Q0O A;  1LL5 A;  4L9G A;  2QWS A;  1IEM A;  2W3F A;  5HZH A;  3CHW P;  3OPP A;  3UDI A;  4CPK A;  4KZ4 A;  4FSF A;  3M6B A;  5A91 A;  3EQV A;  3F1O B;  5AVF A;  4OP5 A;  4JXG A;  3UDX A;  3K3D A;  3CMZ A;  4UA6 A;  3ZVT A;  2V1Z A;  3JPU A;  4MN5 A;  5FI7 A;  2QYB A;  1ONH A;  4LV1 A;  3A0R A;  1ES2 A;  2Y2N A;  3BFC A;  4PAU A;  1CEG A;  4R4S A;  2BAS A;  3HLF A;  3W2Z A;  4Y13 A;  4JF5 A;  3ZGA B;  3MS6 A;  3DTE A;  2GNX A;  2FZ0 A;  2WGV A;  2W1T B;  1AXB A;  5A92 A;  4LLO B;  1PWC A;  3IXB A;  1GCE A;  1FIK A;  3UME A;  5J8X A;  2P7J A;  4KZ3 A;  5TJJ A;  3NUL A;  2QJ5 A;  4R3J A;  1XFQ A;  1RP5 A;  5HX9 A;  3HJK A;  4QU3 A;  1NRF A;  4KZ9 A;  4RYE A;  3FZC A;  4UA7 A;  5FI2 A;  3WRZ A;  4JLF A;  1TEM A;  1OPX A;  2XK1 A;  3ZG5 A;  3KSH A;  4LCM A;  4HI4 A;  4PKY A;  3BYD A;  1SDN A;  4ZJ2 A;  2ZJ9 A;  1KE4 A;  4GJ4 A;  3P09 A;  2VA0 A;  4BQM A;  2VGK A;  1YPR A;  1SKF A;  3A3F A;  1XKZ A;  5CHU A;  3LEQ A;  1IYS A;  2H10 A;  5EE8 A;  4C75 A;  4HJ6 A;  4OPQ A;  2GX5 A;  2Y2Q A;  1DJC A;  5L8M A;  1MPL A;  2V20 A;  2WKH A;  3IF5 A;  1GHP A;  3W4Q A;  1Y54 A;  4YNR A;  1CI9 A;  2GJ3 A;  3QP6 A;  3SH8 A;  4WYY A;  2PDR A;  3HLW A;  5L10 A;  1T1C A;  1XJ3 A;  2V1B A;  1G6A A;  4ZDX A;  2KOI A;  2XRN A;  3T1R A;  4HBT A;  1HLU P;  3HLC A;  4KZ7 A;  1GSW A;  3MQQ A;  5HD3 A;  1P0Z A;  1FIL A;  2Y2P A;  3RH8 B;  3VP1 A;  3T50 A;  3NEC A;  2J80 A;  3OBF A;  4G3W A;  2Y8H A;  2M1C A;  3VFH A;  3LI8 A;  1W8Y A;  4E3J A;  2WZZ A;  4P87 A;  4ZAM A;  3EOI A;  5HWV A;  2H0Y A;  2B5R A;  4CLC E;  4QY6 A;  4Z9Q A;  5HFO A;  1J3W A;  5F68 A;  1EI5 A;  1TS0 A;  2FH5 A;  3O3V A;  1NYY A;  3QP2 A;  4HJ4 A;  3TSG A;  1DJB A;  1PW8 A;  3IWI A;  2JN7 A;  3A3E A;  4HOI A;  1ZKJ A;  3A3I A;  2ZQD A;  5DJT A;  4D60 A;  4GW9 A;  4HY8 A;  2XA7 S;  1E25 A;  2XQZ A;  3CLO A;  1NLY A;  2B95 A;  4QJG A;  4LPZ A;  3V5M A;  2RL3 A;  3DAV A;  3JVV A;  3T12 B;  2ZOI A;  1N9N A;  4BWI A;  3IX4 A;  1GHM A;  1OT9 A;  3F1P A;  1AWI A;  1RCJ A;  3ZFZ A;  3CPT A;  1MZU A;  2Y2J A;  1G6O A;  5LBR A;  5CTN A;  4QPR A;  1LLB A;  5HW3 A;  2Y2O A;  2IWC A;  2VV8 A;  3ZVW A;  5I5L A;  4OLD A;  1K54 C;  1PW1 A;  2W1R A;  4DDS A;  1XA1 A;  5DTT A;  1VQQ A;  2P9V B;  4S2N A;  1D7E A;  3QHY A;  1S4R A;  2E8I A;  4I3A A;  1KGE A;  3HLD A;  2CMN A;  2W3E A;  3GEC A;  3OPR A;  3OC2 A;  4GKU A;  5HDC A;  2EX2 A;  3LFV A;  3MKE A;  2NUP C;  2PD8 A;  1XX2 A;  1TDL A;  3E4Q A;  1NY0 A;  3E4P A;  3S1Y A;  3CPT B;  4O8G A;  1IKG A;  4LRZ E;  4WUJ A;  3BW6 A;  2XSS A;  5FI6 A;  3GSG A;  3G2Y A;  4NET A;  2WZX A;  5EM1 A;  3UE3 A;  1L0E A;  4CLC C;  3PR6 A;  4MN7 A;  1K4E A;  1D1J A;  4X55 A;  2ZM0 A;  2ZC7 A;  4OON A;  4Y7P A;  1ZTU A;  3ZG9 B;  4BMW A;  4ZJ1 A;  3LY3 A;  2P04 A;  2Y55 A;  1F5M A;  5HWT A;  3UMD A;  3IX3 A;  3NDG A;  4UHU A;  2CC1 A;  2JKR M;  3NCK A;  4OP8 A;  4ME4 A;  2HDQ A;  2JE5 A;  1IYO A;  4N1H A;  4EES A;  3OZH A;  2ZC6 B;  1BSG A;  2PT7 A;  2PU4 A;  4Q8I A;  4K08 A;  1SKO B;  1SZV A;  2ZC4 B;  4N92 A;  2XD5 A;  4O0P A;  3IF6 C;  3VSL A;  5E2H A;  2HDU A;  3LY4 A;  5DKL A;  2IWD A;  4H6J B;  5FQ9 A;  5L07 A;  3NY4 A;  2DRW A;  4S2O A;  1QME A;  2ZQ8 A;  2J7V A;  1KVM A;  1BLP A;  3OLO A;  1IYP A;  4OVD A;  2H0T A;  3BJN A;  3NC8 A;  3SH7 A;  3NOT C;  1HD8 A;  4Q0H A;  4GOG A;  1OJG A;  3LCE A;  1KGG A;  3V50 A;  3IS2 B;  3KYE A;  1Z6F A;  1ZC2 A;  1FCO A;  4S2P A;  1K55 C;  1LSV A;  2WKP A;  3WRT A;  2OAP 1;  2Y4A A;  3PHY A;  4UEY A;  1MKI A;  1I2S A;  2OWH A;  4N1X A;  3BFE A;  3NBL A;  5HDS A;  4ZTK A;  2EX8 A;  3NOU C;  1PI5 A;  4BD1 A;  3TG9 A;  4G3V A;  2Q9M A;  3MXS A;  4U0X A;  3UB7 A;  3TW8 A;  4E3O A;  1S1Z A;  4OQ0 A;  1EWZ A;  1JNU A;  3M2K A;  4WEL A;  1K38 A;  3QP4 A;  1NXY A;  1YAX A;  1PIO A;  2V1A A;  4KG2 A;  2V0W A;  5FAP A;  5GHX A;  2Z6D A;  3C8C A;  1CEF A;  3F1N B;  2OSU A;  3IXD A;  3HUO A;  1NZO A;  4OQH A;  1H0M A;  3C38 A;  3LIC A;  1QMF A;  4KG6 A;  3FKW A;  5G4Z A;  3HCY A;  3UDF A;  4FD8 A;  5EVI D;  3VP4 A;  4FH4 A;  3T4K A;  4OPZ A;  2K7S A;  3D72 A;  2FFY A;  3P7N A;  2HP5 A;  4EXO A;  1L0D A;  2HP9 A;  1MY8 A;  1W8Q A;  4WF0 A;  4A5R A;  3LR4 A;  1NYM A;  1N9O A;  4PM9 A;  2BTF P;  3SS4 A;  4IUK A;  4CQH A;  1YQS A;  4FOF A;  2JKF A;  5E43 A;  5CEC A;  3UPN A;  4EER A;  2XA7 M;  3NDE A;  4EQI A;  4Y0U A;  4ETX A;  3O87 A;  5F1G A;  3LID A;  4NKP A;  3DTI A;  2H28 A;  4I3I A;  2IWB A;  5F6A A;  4PM7 A;  1LL8 A;  3UB8 A;  3UE0 A;  3D9Y A; 
#chains in the Genus database with same CATH homology
 5FAQ A;  3DW0 A;  5GL9 A;  4C3Q A;  3A3F A;  4K0W A;  1XKZ A;  4OKP A;  4WEJ A;  3FV7 A;  2Y2G A;  5CHU A;  4JXV A;  1IYS A;  1ERM A;  4WZ5 A;  5HAP A;  2H10 A;  1WYC A;  4LEN A;  1ALQ A;  5EE8 A;  4C75 A;  1ZG6 A;  5GLD A;  4OPQ A;  3HVF A;  1FSY A;  4LV0 A;  3SOI A;  2Y2K A;  2Y2Q A;  4OPY A;  5FAO A;  1DJC A;  3A3J A;  4DXB A;  4OOM A;  4E3M A;  3Q1F A;  4FH2 A;  1MPL A;  2V20 A;  2WKH A;  3IF5 A;  1GHP A;  4M3K A;  5CER A;  1Y54 A;  3PBS A;  3W4Q A;  3N4I A;  4EBL A;  5DVA A;  4B88 A;  1CI9 A;  1H5X A;  1ZG4 A;  4F94 A;  3SH8 A;  3V39 A;  4MBF A;  4WYY A;  3IQA A;  3HLW A;  3W8K A;  3PAG A;  4HBU A;  2P74 A;  3C7U A;  4KZ5 A;  4MLL A;  2PU2 A;  4H8R A;  1SKF A;  4WMC A;  5HL1 A;  1DY6 A;  3BFD A;  1MWR A;  1G6A A;  1K56 A;  2ZLY A;  4ZDX A;  1ERQ A;  1O7E A;  1YLW A;  4XUZ A;  4HBT A;  2WK0 A;  1H8Z A;  5GLA A;  3HLC A;  4S2M A;  1DJA A;  5F1F A;  4GN2 A;  4KZ7 A;  3BEC A;  3IWQ A;  1S0W A;  1FCM A;  3OCN A;  4R4R A;  4K91 A;  5DF8 A;  4DE1 A;  3IT9 A;  4GDN A;  3ISG A;  5DTS A;  4N9K A;  1PZP A;  5F83 A;  2XF3 A;  5FDH A;  5GLB A;  1JWP A;  1MWT A;  2WKI A;  2Y2P A;  3BEB A;  1BUE A;  1YLT A;  1K54 A;  4GD6 A;  4OH0 A;  4S2K A;  3VP1 A;  3MZE A;  1JVJ A;  2WAE A;  4P85 A;  1HTZ A;  3LEZ A;  3Q7V A;  3G35 A;  1Q2P A;  4QD4 A;  1PYY A;  1XXM A;  4X53 A;  3VFH A;  1SHV A;  3UNW A;  1BZA A;  4BEN A;  4GD8 A;  1W8Y A;  4DE3 A;  4E3J A;  1K57 A;  2G2U A;  2WZZ A;  4P87 A;  1YLJ A;  4KQO A;  1N9B A;  4ZAM A;  1ESI A;  2WYX A;  3HLE A;  2BG1 A;  4S2I A;  3ZCZ A;  1YMX A;  2XDM A;  4P6B A;  1BLS A;  2H0Y A;  2B5R A;  3ZNY A;  3ZNT A;  4QY6 A;  3ZG8 B;  2XGN A;  1BUL A;  1MWU A;  4Z9Q A;  3JYI A;  5HFO A;  1KDS A;  3QNC A;  1EI5 A;  4K0X A;  3N8S A;  2ZC5 B;  3DWK A;  2J9O A;  1YLY A;  3G30 A;  4UA9 A;  1JTD A;  5AQ7 A;  3O3V A;  2EXB A;  1NYY A;  1FCN A;  4KQQ A;  3ZG0 A;  5KSC A;  3WS1 A;  5EEC A;  4C6Y A;  4WZ5 C;  4D2O A;  2Y2M A;  3GVB A;  2HP6 A;  3TSG A;  1DJB A;  1E3U A;  1PW8 A;  1ERO A;  1SCW A;  3HUN A;  3IWI A;  1ES3 A;  1Q2Q A;  3Q7V B;  2Z2L B;  3A3E A;  1OME A;  1YLP A;  1CI8 A;  1ZKJ A;  5HAR A;  3FKV A;  3A3I A;  4KG5 A;  2ZQD A;  1YLZ A;  4R3B A;  1RGZ A;  5EOO A;  3WS4 A;  5JYP A;  3MKF A;  1E25 A;  2BLS A;  2A49 A;  4BD0 A;  5I94 A;  2XQZ A;  1JTG A;  2Z2M B;  2OLU A;  4RX2 A;  4OQG A;  4PM8 A;  4EWF A;  1L0G A;  5AQB A;  5BOH A;  2Y59 A;  4IED A;  3AGF A;  5HAQ A;  4QJG A;  1HZO A;  3V5M A;  5GHY A;  3C4O A;  1IYQ A;  4CJN A;  2RL3 A;  4JXW A;  3UPP A;  3I7J A;  3VP3 A;  4EUZ A;  1GHM A;  5FSR A;  1BT5 A;  3IHA A;  3BFG A;  3D4F A;  5CGW A;  1RCJ A;  3ZFZ A;  2JBF A;  4WEK A;  2FFF B;  3HLG A;  2Y2J A;  3G31 A;  3N7W A;  4OQI A;  2XFS A;  2JC7 A;  4LCL A;  1KE3 A;  3G2Z A;  3BRM A;  3PBQ A;  5CTN A;  5TGF A;  1LLB A;  5HW3 A;  3LO7 A;  2Y2O A;  3O86 A;  2IWC A;  4OOL A;  2WGW A;  2OV5 A;  3VP2 A;  3ZVW A;  4EBP A;  4OLD A;  3VP0 A;  3PBR A;  1K54 C;  1PW1 A;  4DDS A;  1FSW A;  1XA1 A;  3HUM A;  1VQQ A;  2P9V B;  5DTT A;  3W4O A;  3S4X A;  2QMI A;  4S2N A;  5EVL A;  3QHY A;  2E8I A;  5GHZ A;  1KGE A;  5FQM A;  4DDY A;  3VFF A;  1K57 C;  3DTM A;  3HLD A;  4JPM A;  1LI9 A;  1XP4 A;  4DF6 A;  3IF6 A;  4RX3 A;  3OPR A;  4EV4 A;  2HPB A;  2R9W A;  3OC2 A;  1KDW A;  4GKU A;  2XFT A;  4KQR A;  1GHI A;  5KZH A;  4YIN A;  4PPR A;  5AQ9 A;  2EX2 A;  3MKE A;  4WZ4 A;  1M40 A;  5CED A;  4U3T A;  4E6X A;  1WYB A;  1XX2 A;  3N8L A;  1TDL A;  2J9P A;  4BLM A;  4MNR A;  1NY0 A;  4RVA A;  3PBN A;  4BL2 A;  1CK3 A;  2ZQ9 A;  4LV2 A;  4PMA A;  3S1Y A;  1IKG A;  3MFD A;  4KZ8 A;  5FI6 A;  3GSG A;  3EQU A;  4MBH A;  2XLN A;  3G2Y A;  3MZF A;  4NET A;  5FQI A;  5IHV A;  1MBL A;  2WZX A;  1ES5 A;  1N4O A;  3V3R A;  1GA9 A;  2WGW B;  1TDG A;  4WMC D;  3UE3 A;  2ZM8 A;  4P0M A;  3VSK A;  1K56 D;  1L0E A;  2R9X A;  5E2F A;  2WAF A;  4B4X A;  3TOI A;  2X01 A;  4BL3 A;  3MZD A;  1K4E A;  1YMS A;  3WS2 A;  4X55 A;  2ZM0 A;  1O07 A;  2ZC7 A;  4OON A;  4Y7P A;  4XUX A;  1KVL A;  1NZU A;  5M1A A;  2ZQA A;  3ZG9 B;  4XXR A;  3IF6 B;  5EPH A;  1K55 A;  3HRE A;  4U0T A;  5CRF A;  5FAT A;  4OPR A;  2XR0 A;  1J9M A;  3BFF A;  4ZJ1 A;  3LY3 A;  4IVK A;  2Y55 A;  5KSH A;  3BM6 A;  3SH9 A;  5FAS A;  1W7F A;  4JKT A;  5CHJ A;  3SS5 A;  2HDR A;  3GMW A;  3MBZ A;  3NDG A;  2ZQC A;  1I2W A;  4JF4 A;  5KMW A;  1PWG A;  1XPB A;  3PBT A;  2CC1 A;  4UHU A;  5A93 A;  1PWD A;  1LHY A;  4QHC A;  3A3D A;  1MXO A;  3NCK A;  4HEF A;  4OP8 A;  3WWX A;  1G68 A;  3ZDJ A;  3MXR A;  1I5Q A;  1K6R A;  1PI4 A;  3N8R A;  1ONG A;  2ZC3 B;  5HAI A;  3S22 A;  1IKI A;  2HDQ A;  4RA7 A;  1TVF A;  2JE5 A;  1IYO A;  1W79 A;  2EX6 A;  2HDS A;  3IH9 A;  2EFU A;  3OZH A;  4GZB A;  4N1H A;  5CGS A;  5EVI A;  1VM1 A;  1E4D A;  2ZC6 B;  3V3S A;  5CHM A;  2Y91 A;  1BSG A;  2J8Y A;  4E3K A;  3FYZ A;  4GDB A;  2OLV A;  4WM9 A;  5DF9 A;  2PU4 A;  2Y2H A;  1K25 A;  4B4Z A;  4NK3 A;  2ZMA A;  3NIA A;  1BLH A;  3OPH A;  4Q8I A;  1XA7 A;  2ZC4 B;  1PZO A;  4S2N C;  4N92 A;  3DWZ A;  3IXG A;  4ID4 A;  1ESU A;  3QNB A;  4EBN A;  3WS0 A;  4E3I A;  1E3U D;  2GDN A;  2XD5 A;  1FQG A;  3IF6 C;  3VSL A;  5E2H A;  2HDU A;  3E2K A;  1BLC A;  3LY4 A;  3GTC A;  5M19 A;  3CJM A;  3PAE A;  1HVB A;  4S2L A;  2IWD A;  5M18 A;  3UY6 A;  5FQ9 A;  3B3X A;  5FQK A;  5DF7 A;  3NY4 A;  3UO9 A;  2DRW A;  4S2O A;  1QME A;  3Q7Z A;  2ZQ8 A;  2PBY A;  2EFX A;  5EVI B;  3UN7 A;  2J7V A;  4IVI A;  1WE4 A;  3ZHH A;  3IH8 A;  1KVM A;  3GR2 A;  1BLP A;  5D3O A;  1IYP A;  2UWX A;  4OVD A;  4LV3 A;  4QY5 A;  2WGI A;  2X02 A;  2Y2L A;  2H0T A;  3NC8 A;  3SH7 A;  4X68 A;  4E6W A;  3AGE A;  1FOF A;  1HD8 A;  3P98 A;  4KZ6 A;  5CTM A;  3GQZ A;  4DE2 A;  4GOG A;  2WAD A;  3WS5 A;  1SDE A;  3LCE A;  1KGG A;  3V50 A;  3G4P A;  4E3L A;  3FWL A;  1KGF A;  1Z6F A;  1ZC2 A;  2VGJ A;  4X56 A;  1FCO A;  3RXW A;  4GNU A;  3C4P A;  3G34 A;  4WBG A;  1ES4 A;  1LL9 A;  1C3B A;  4S2P A;  1H8Y A;  3CZD A;  4FCF A;  1K55 C;  5DTK A;  4DE0 A;  4JBF A;  3Q82 A;  4DKI A;  4HES A;  3Q81 A;  1K4F A;  2C5W B;  2I72 A;  4OOY A;  1FR1 A;  4R1G A;  1K6S A;  3WRT A;  2WKE A;  2C6W B;  4ZBE A;  2Y4A A;  2X71 A;  3IXH A;  4JXS A;  5JYO A;  5EOE A;  3VMA A;  4KZB A;  3UPO A;  3C7V A;  1NJ4 A;  3GV9 A;  5AQA A;  3RJU A;  4BJP A;  1MKI A;  1I2S A;  2QZ6 A;  5E2G A;  3IHB A;  2V2F F;  4Y0T A;  4YFM A;  4L0L A;  1JWZ A;  4R23 A;  4N1X A;  1XGJ A;  2Y2I A;  3SS3 A;  3BFE A;  3NBL A;  4ZTK A;  2EX8 A;  5EVI C;  4PM5 A;  2XD1 A;  3OPL A;  5CXW A;  3Q07 A;  2ZQ7 A;  5E2E A;  1PI5 A;  2WUQ A;  4BD1 A;  3TG9 A;  1LL5 A;  3VOZ A;  4KEN B;  1IEM A;  3HLB A;  3OPP A;  1L0F A;  2Q9M A;  3UDI A;  4ZJ3 A;  3MXS A;  2EX9 A;  4CPK A;  1YT4 A;  5F82 A;  4U0X A;  5L2F A;  3PTE A;  5GLC A;  2A3U A;  1U60 A;  3ITB A;  5A90 A;  5FQQ A;  4KZ4 A;  4E3O A;  1MWS A;  4FSF A;  3M6B A;  1KE0 A;  4OQ0 A;  3IWO A;  4QB8 A;  3CG5 A;  3ZG7 B;  5CEB A;  1EWZ A;  5A91 A;  3EQV A;  4OP5 A;  4JXG A;  3UDX A;  3CMZ A;  2XH9 A;  4UA6 A;  3ZVT A;  2V1Z A;  3M2K A;  1K38 A;  3AGD A;  4WEL A;  5FI7 A;  3VOY A;  1NXY A;  3HL9 A;  1ONH A;  4LV1 A;  2H5S A;  5G18 A;  4X6T A;  1ES2 A;  1PIO A;  4JF6 A;  2Y2N A;  4PM6 A;  3BFC A;  3C5A A;  4KG2 A;  1RGY A;  5FAP A;  1CEG A;  5GHX A;  2EXA A;  4R4S A;  1CEF A;  2OSU A;  3HLF A;  3IXD A;  3HUO A;  1IEL A;  2ZD8 A;  2DCF A;  3RXX A;  3NI9 A;  5EUA A;  4JF5 A;  3ZGA B;  3BLM A;  1NZO A;  4OQH A;  4Y0O A;  1QMF A;  4KG6 A;  4S2J A;  3FKW A;  5U47 A;  3UDF A;  4FD8 A;  5EVI D;  2WGV A;  1AXB A;  5A92 A;  1GA0 A;  1JWV A;  3VP4 A;  4IBX A;  1FR6 A;  4FH4 A;  1PWC A;  3GRJ A;  3IXB A;  3M2J A;  3PBO A;  3E2L A;  1GCE A;  4OPZ A;  5J8X A;  1S6R A;  4OLG A;  4GB7 A;  2FFY A;  2Q9N A;  4KZ3 A;  3N6I A;  4MBK A;  2HP5 A;  3O88 A;  3OCL A;  4O7D A;  1L0D A;  2HP9 A;  4R3J A;  1RP5 A;  1MY8 A;  5HX9 A;  1W8Q A;  4E3N A;  5FQJ A;  4A5R A;  3W4P A;  4QU3 A;  1NRF A;  4KZ9 A;  1NYM A;  1XGI A;  4RYE A;  4IBR A;  4MEZ A;  3FZC A;  4KZA A;  4PM9 A;  2XEP A;  4UA7 A;  5CGX A;  4JLF A;  5FI2 A;  3SS4 A;  3WRZ A;  1YQS A;  1TEM A;  3ITA A;  1LI0 A;  5TFQ A;  2XK1 A;  5E43 A;  1YM1 A;  4R0Q A;  5CEC A;  3UPN A;  3G32 A;  4DRT A;  1W5D A;  4X69 A;  3ZG5 A;  2P9V A;  2ZM2 A;  1BTL A;  4LCM A;  1L2S A;  4N9L A;  3NDE A;  3M6H A;  4EQI A;  4Y0U A;  2G2W A;  3O87 A;  5F1G A;  5FA7 A;  3BYD A;  1SDN A;  2QPN A;  4ZJ2 A;  2ZJ9 A;  1KE4 A;  2RCX A;  3P09 A;  4UAA A;  2IWB A;  4BQM A;  5TR7 A;  1M6K A;  2VGK A;  4PM7 A;  3UE1 A;  4DXC A;  3BLS A;  3UE0 A;  2DNS A;  3HBR A;  2JCH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...