4BLMA

Beta-lactamase of bacillus licheniformis 749(slash)c. refinement at 2 angstroms resolution and analysis of hydration
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
256
structure length
256
Chain Sequence
b'DDFAKLEEQFDAKLGIFALDTGTNRTVAYRPDERFAFASTIKALTVGVLLQQKSIEDLNQRITYTRDDLVNYNPITEKHVDTGMTLKELADASLRYSDNAAQNLILKQIGGPESLKKELRKIGDEVTNPERFEPELNEVNPGETQDTSTARALVTSLRAFALEDKLPSEKRELLIDWMKRNTTGDALIRAGVPDGWEVADKTGAASYGTRNDIAIIWPPKGDPVVLAVLSSRDKKDAKYDDKLIAEATKVVMKALN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA-LACTAMASE
molecule tags Hydrolase(acting in cyclic amides)
source organism Bacillus licheniformis
publication title Beta-lactamase of Bacillus licheniformis 749/C. Refinement at 2 A resolution and analysis of hydration.
pubmed doi rcsb
total genus 88
structure length 256
sequence length 256
chains with identical sequence B
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 1991-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00144 Beta-lactamase Beta-lactamase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 4blmA00
4WEKA 4OKPA 3WRTA 1K57A 1W8YA 1NRFA 4BJPA 2WYXA 2WGWB 3WS5A 2WAEA 1YLYA 2ZC4B 4E3JA 4ZJ2A 1EROA 3O86A 5HW3A 4B4XA 4DXCA 4QJGA 1DJAA 4OQIA 2PBYA 2XFTA 3MXRA 4N92A 1PI5A 4Y0TA 4PM9A 2PU4A 1ONHA 1G68A 5A93A 1K38A 1PW1A 5CEBA 1K6SA 3PAEA 4FD8A 1BZAA 1YMSA 1DJCA 4M3KA 5CHUA 2Q9NA 3OC2A 2EXBA 5FAPA 4N1HA 5DVAA 5GHXA 5F82A 2VGKA 2EXAA 2FFFB 5JYOA 4RX3A 4S2NC 3BFGA 3ZHHA 4JF6A 4NK3A 2V1ZA 2XR0A 1NYMA 1WYBA 1ES5A 2Y91A 3PBOA 1HZOA 3MFDA 2OSUA 1MPLA 3A3EA 1FCMA 3UDFA 3NY4A 3HLDA 5GLCA 1RP5A 1U60A 3VMAA 4ZBEA 3OPLA 2XQZA 3G4PA 3OPRA 4Y7PA 5GHYA 4UAAA 4EQIA 4KENB 2EFXA 2WZZA 4DE0A 4IVKA 3IXHA 2WKEA 4GD6A 1BLPA 4IEDA 1WYCA 2QZ6A 5FQMA 3O87A 1SKFA 4LV1A 2OLVA 5AQ7A 3UDXA 4DF6A 4R0QA 4GDNA 2G2WA 2DNSA 2ZQDA 1W5DA 2XD5A 4JF5A 1L0GA 3C4PA 1ZG6A 2ZC7A 3JYIA 1YLZA 1K54A 4KZ4A 5CERA 3SH9A 3SS5A 4KZ7A 2J7VA 3A3DA 3EQVA 5EE8A 1GHPA 3FKVA 3IHAA 4OOMA 3G2ZA 4R3JA 1FR1A 2FFYA 2HDRA 1AXBA 1ES4A 1FCOA 3BM6A 5E2GA 1JWVA 5FAOA 3V3SA 4OP5A 3UPOA 3BLMA 1PI4A 5A90A 4YINA 1SHVA 2J9OA 5FDHA 5FASA 3Q82A 5EVLA 2ZLYA 4K91A 2EX8A 3N7WA 4QB8A 3S4XA 1Z6FA 4A5RA 2Y2LA 3M6BA 2WZXA 3PBRA 3LO7A 3AGFA 3PBQA 1PWGA 5FA7A 2ZQAA 4IVIA 4PM8A 4P85A 2ZQ9A 3UO9A 5E2HA 3RJUA 4E3MA 3WS0A 2I72A 1L0DA 3UE1A 1I2WA 2EX2A 1MWRA 1N4OA 4R3BA 4X55A 1W79A 3SS3A 3BLSA 3HBRA 3HLWA 2G2UA 1TEMA 4ZTKA 4BL2A 4BENA 4F94A 4E3KA 4BD1A 4KZ3A 1QMFA 4OPRA 3HLBA 2CC1A 3V5MA 1LLBA 4C75A 3BFCA 1ESIA 4X68A 4WZ4A 3M6HA 1ALQA 4ZJ3A 3NCKA 2XGNA 4HBTA 4MBFA 1SDNA 2Y2KA 1PZPA 3BFDA 3FZCA 3GV9A 3IQAA 5E43A 1MWSA 2C6WB 3W4OA 5EVIA 4UHUA 4P6BA 3CMZA 3P98A 2EFUA 3GVBA 5CEDA 5L2FA 4OONA 4O7DA 1CEGA 4C3QA 2Y2MA 5AQ9A 1SCWA 3M2JA 3HLFA 4KQRA 5EUAA 1JWPA 1GA0A 1OMEA 4JBFA 5HFOA 4C6YA 4D2OA 3OCNA 1ZKJA 4YFMA 3LY4A 4S2LA 1IYPA 1KGFA 1PW8A 2P74A 4LV0A 4XXRA 5HAQA 1NY0A 5HARA 1IYQA 1KE3A 3QHYA 2BLSA 3Q7ZA 5DF8A 3WS4A 3VP3A 4EBPA 5KZHA 4WZ5A 2HDSA 3BFEA 4RX2A 2Y2IA 1XP4A 3D4FA 3UPNA 4OQGA 3HLGA 3Q81A 1IYSA 4U0XA 4X56A 4DRTA 4LV2A 3ISGA 2H10A 4S2PA 3VP1A 4CJNA 1S6RA 5FATA 1PYYA 2XH9A 3HVFA 4OLGA 4RA7A 3O3VA 4EBNA 1IKIA 4MBHA 1C3BA 5HAPA 2IWDA 5EPHA 3ZGAB 4NETA 1CI9A 3G30A 4MNRA 5CRFA 4QD4A 4S2IA 2XDMA 3IF5A 1E3UA 4KG6A 3GSGA 1LL5A 1KE4A 3AGEA 4OH0A 1JVJA 3PBSA 2Y2QA 4JXWA 3MBZA 2IWBA 2WGIA 1RCJA 3ZVTA 3C7VA 5EVIC 1FCNA 2P9VB 3G31A 4S2KA 1XX2A 4P87A 3LCEA 3N4IA 1KE0A 5CTNA 4KG2A 3MZDA 4KZ6A 3Q1FA 4S2NA 4B88A 3ZFZA 3WRZA 1FSYA 3ZNTA 4CPKA 2ZC5B 1O07A 2JCHA 1QMEA 2XEPA 4QU3A 3QNBA 4FH4A 1LL9A 4HESA 4XUZA 3DWZA 5A92A 1L0FA 1MY8A 4LCMA 5GLAA 1K56A 1MXOA 2P9VA 4PPRA 3ZG0A 5F1FA 3OZHA 4K0XA 2ZJ9A 3IF6B 3ZNYA 3IWIA 3IXBA 3IXDA 4DKIA 2QPNA 3M2KA 4OOLA 3TG9A 5HX9A 1XPBA 5FAQA 4WMCA 1EWZA 1MKIA 1TVFA 3AGDA 3ZCZA 4GOGA 1KVMA 3NDEA 1I5QA 2IWCA 2WUQA 3UY6A 2Y4AA 1RGZA 3S22A 4MLLA 4GDBA 1CI8A 1DJBA 4JLFA 5TFQA 4S2OA 4S2MA 5F1GA 2XD1A 1PWCA 5JYPA 2ZD8A 1CEFA 4WELA 3VFHA 3MZFA 5U47A 4E6XA 4S2JA 1Q2QA 4WEJA 4B4ZA 3IH9A 2R9XA 4HBUA 3V50A 5F83A 3HUNA 4OPZA 4KZ5A 3OCLA 1K57C 4U0TA 2Y2HA 5GLBA 2XK1A 3FKWA 3GTCA 1PWDA 3W8KA 1K4EA 1IYOA 4N1XA 2WAFA 1LI0A 5FQJA 2Y2NA 3PTEA 1L2SA 2ZM8A 3CG5A 1K25A 1ES3A 4LCLA 3IF6A 3LY3A 4RYEA 4UA7A 3UDIA 2HP5A 2HP9A 4MEZA 3WWXA 5CGXA 3NBLA 4Y0UA 5M19A 2Y2PA 3MXSA 5DTSA 5EOOA 3PBNA 3CZDA 4ZAMA 1NYYA 1IELA 1ONGA 3RXXA 3BECA 2HDQA 3O88A 3WS1A 2Y2GA 3G32A 5FQ9A 5FQKA 1K4FA 3BRMA 2ZC6B 1K6RA 5M18A 3SH8A 5DTTA 4KG5A 3NIAA 2DCFA 1GHMA 3UE3A 4DE3A 1BUEA 1WE4A 2X01A 3A3JA 3E2LA 3VSLA 5E2FA 3BYDA 3N6IA 3LEZA 3P09A 4GZBA 3W4PA 4FCFA 3Q7VA 2WKIA 2V20A 4KQOA 3GR2A 1S0WA 2VGJA 3N8SA 3V39A 4BL3A 1E3UD 3NC8A 2H0YA 3IF6C 5GL9A 1BLSA 5I94A 2ZQ8A 3UPPA 3CJMA 3UN7A 5TGFA 2J9PA 4UA9A 3DW0A 3MKEA 3VSKA 3G35A 2WKHA 4BD0A 1O7EA 1NJ4A 1FR6A 1HVBA 1W7FA 2ZQ7A 1H5XA 4FSFA 2HDUA 3BEBA 4L0LA 4MBKA 5DF7A 5AQBA 1SDEA 4UA6A 4EUZA 1ZG4A 1JTDA 5CGWA 3FYZA 3MZEA 1HTZA 4WZ5C 1BSGA 1MBLA 2V2FF 3QNCA 3PAGA 2ZC3B 5CHMA 5HAIA 4IBXA 2ZQCA 3ZG7B 1N9BA 4JXSA 4X6TA 2X02A 2Y2OA 4KZ8A 1DY6A 1BT5A 2XFSA 1XKZA 1XXMA 1LI9A 4DXBA 3GQZA 3IWOA 1BULA 2DRWA 2PU2A 3A3IA 3SS4A 5KSHA 1M6KA 4DDYA 1GCEA 1YLPA 1L0EA 2Y2JA 2HP6A 4GN2A 3IHBA 3HUOA 1YQSA 2QMIA 3ZDJA 4GNUA 3S1YA 2WGWA 1E4DA 3C4OA 1MWUA 4OP8A 4OPYA 5FI6A 1K55A 5FI7A 5M1AA 5KSCA 1YMXA 3VP2A 3HLCA 2HPBA 1NZUA 1W8QA 3GMWA 4OPQA 1ESUA 4ZDXA 1M40A 4KZAA 4JXGA 1KVLA 2H5SA 4WMCD 2UWXA 5EECA 3HUMA 4DDSA 1K55C 2Y59A 3EQUA 1XA1A 2RCXA 4KZBA 1BTLA 1Q2PA 4GD8A 5FQIA 4WM9A 5G18A 4U3TA 5EVIB 4BQMA 4EV4A 3GRJA 1TDLA 1H8ZA 1KDWA 4EWFA 4HEFA 4E3LA 1YT4A 5J8XA 1I2SA 1ERQA 2WGVA 3IWQA 4DE2A 1LHYA 2WADA 4JF4A 4JXVA 3RXWA 2ZM0A 1VQQA 3NDGA 2Q9MA 3OPHA 4E3OA 3VP4A 3C5AA 3ZG8B 1FOFA 4OQHA 3ITAA 5D3OA 1IKGA 1J9MA 1YLJA 1ZC2A 3HL9A 4PM6A 1E25A 1JTGA 4R23A 4Z9QA 3VP0A 4H8RA 3FV7A 1JWZA 2H0TA 3TSGA 5CTMA 3ZG5A 4PM7A 5KMWA 2Y55A 3FWLA 4LV3A 3ZG9B 4BLMA 2A49A 4DE1A 1FSWA 3IXGA 1RGYA 4JPMA 1NZOA 1CK3A 5CECA 4Q8IA 4PMAA 1KGEA 4ZJ1A 2A3UA 5FSRA 4PM5A 2WK0A 2OV5A 3VFFA 1PZOA 4R4RA 5CXWA 4P0MA 3N8LA 4R1GA 1KGGA 4Y0OA 5IHVA 3VOYA 5EVID 4N9LA 1EI5A 3BFFA 3G34A 2EX9A 4R4SA 3V3RA 2X71A 4QY5A 3W4QA 2RL3A 2OLUA 1YLTA 3TOIA 3E2KA 3SH7A 4EBLA 4N9KA 3Q07A 5HL1A 3N8RA 4LENA 1G6AA 1IEMA 1K54C 1XA7A 2R9WA 4GB7A 1VM1A 1BLCA 5CHJA 2B5RA 4XUXA 5FQQA 1GHIA 2XLNA 4ID4A 4KQQA 2JE5A 3IH8A 4JKTA 4X69A 4FH2A 1Y54A 1YLWA 2GDNA 1ES2A 3UNWA 3VOZA 4KZ9A 5FI2A 3DTMA 4QY6A 1FQGA 1XGJA 3HREA 4OVDA 2E8IA 2Z2MB 2C5WB 5BOHA 1TDGA 5E2EA 5TR7A 1PIOA 5DF9A 1K56D 4GKUA 3MKFA 3OPPA 4OOYA 1H8YA 3ITBA 1XGIA 3ZVWA 4OQ0A 2JBFA 2Z2LB 1KDSA 4WYYA 3IT9A 3SOIA 5DTKA 1ERMA 4RVAA 4QHCA 1GA9A 3PBTA 4X53A 2EX6A 2J8YA 3UE0A 2ZMAA 4OLDA 3Q7VB 1MWTA 4E6WA 3A3FA 3G2YA 4WBGA 5CGSA 5GHZA 3WS2A 5AQAA 4E3NA 1HD8A 2BG1A 2JC7A 3NI9A 2ZM2A 5A91A 3C7UA 3I7JA 4IBRA 5GLDA 3B3XA 5EOEA 1BLHA 3HLEA 1YM1A 4K0WA 4E3IA 2XF3A 3DWKA 1NXYA
chains in the Genus database with same CATH superfamily
1OJ5A 4M4XA 3VV4A 2WYXA 3WS5A 3IBRA 5HWVA 3FPWA 5HW3A 1P9WA 2PBYA 4PM9A 2PU4A 1G68A 5CEBA 1K6SA 4FD8A 1STZA 5FAPA 3W2ZA 5F82A 1OTBA 2DMWA 2EWVA 3ZHHA 4I38A 4JF6A 2XR0A 4HP9A 5IS1A 3PBOA 4Y3IA 3OPRA 4UAAA 4KENB 2R78A 4IVKA 4GD6A 1N9OA 1WYCA 5DJTA 5FQMA 2DNSA 4CLCA 1ZG6A 2ZC7A 2VX8A 4UQIM 2XA7M 3A3DA 3EQVA 3KX0X 4OOMA 1ES4A 4OP5A 4YINA 5EVLA 5FDSA 4A5RA 3PBQA 1PWGA 2K7SA 4PM8A 4KUKA 2I72A 3UE1A 1W63M 3K2NA 2EX2A 1MWRA 1N4OA 2KLIA 4NXFA 3HBRA 3HLWA 2G2UA 4KZ3A 3HLBA 5J3WA 1LLBA 4C75A 3BFCA 3JVVA 1ALQA 5F6AA 2W27A 3NCKA 1OPXA 3IQAA 2EFUA 5CEDA 4O7DA 1H0MA 3UB5P 2V8CA 2A24B 3V67A 3HLFA 3LIBA 1GA0A 1JWPA 4KUOA 1ZKJA 4YFMA 3KO6A 3RH8B 4XXRA 5HAQA 1IYQA 3QHYA 3Q7ZA 3LR5A 4HH2A 1P9RA 1IOUA 3OBFA 3Q81A 2QWSA 4LV2A 2O9BA 5FATA 4OLGA 1IKIA 4MBHA 1C3BA 3UMEA 5EPHA 4P6ZS 4Y5FA 3ZYTA 4S2IA 2XDMA 2JKRM 1S1ZA 1OT9A 3PBSA 2Y2QA 3MBZA 2IWBA 3Q1FA 4S2NA 4CQHA 5J7EA 3WRZA 5LBRA 3T1SA 1S4RA 2JCHA 4QU3A 3QNBA 4XUZA 3DWZA 5GLAA 3QP8A 3OZHA 1FIKA 4G3VA 2QPNA 3M2KA 4PKYA 1XPBA 5EV0A 4GOGA 1KVMA 1SKOB 4MLLA 4JLFA 4S2MA 2XD1A 1CEFA 4WEJA 3IH9A 3KSGA 3TRCA 5DFYA 3V50A 1S66L 2W3HA 3CLOA 2Z6CA 5F83A 4KZ5A 4U0TA 1K57C 5GLBA 3FKWA 3L7HA 2HGVA 3L9KA 4NG2A 4I3AA 2PR5A 2INWA 1ES3A 5EM0A 3IF6A 3DTKA 5L8MA 3WWXA 2Y2PA 3MXSA 5DTSA 4LRXC 3CZDA 1H3QA 2Y2GA 4GLQA 3OLOA 3SH8A 4DE3A 4HP4A 1WE4A 3VSLA 4EXOA 1G5UA 1OTIA 3E98A 1OTAA 2ZBBA 3GR2A 1S0WA 3V39A 3JPUA 4ARZB 2H0YA 1BLSA 5I94A 2XRNA 3CJMA 3A0SA 3G35A 3U2AA 1HVBA 4D60A 1H5XA 2HDUA 3BEBA 2FZ0A 4EUZA 4F3LB 2M7VA 1LT0A 1BSGA 2ZC3B 1N9BA 2Y2OA 4KZ8A 1XXMA 4DXBA 3GQZA 4HOIA 3A3IA 3SS4A 4DDYA 5M1AA 1VETA 5FI6A 5FI7A 1YMXA 3GMWA 1ESUA 1M40A 4MN7A 4JXGA 2H5SA 2UWXA 3EQUA 4GD8A 5FQIA 5G18A 1MKMA 5EVIB 4BQMA 4EV4A 3MQOA 1KDWA 4EWFA 3LIDA 5J8XA 2VGLS 1I2SA 2WGVA 4IUHA 1LHYA 1NLYA 4JF4A 2ZM0A 1VQQA 3NDGA 3VP4A 3C5AA 3ZG8B 1FOFA 3QP1A 4OQHA 4PM6A 1IKGA 4ME4A 2KX6A 4G3WA 3FV7A 1T1AA 1JWZA 2GZAA 2H0TA 5CTMA 3T1QB 3LICA 3FWLA 2M7UA 3ZG9B 4DE1A 1RGYA 4FTXA 4Q8IA 3UB7A 4ZJ1A 3B42A 5L07A 1PZOA 4BBUA 5CXWA 2PD7A 1KGGA 4NKPA 4Y0OA 3VOYA 5EVID 3BFFA 2X71A 3D3OA 2GJ3A 3DBAA 1IEMA 1K54C 1VM1A 1DRMA 2B5RA 1GHIA 3T4OA 1XJ2A 3IH8A 5TBMA 1Y54A 4PHTA 5TBMB 2GDNA 3MJQA 4KZ9A 4JGQA 2E8IA 5BOHA 5E2EA 5TR7A 1PIOA 3OPPA 3BY9A 4Y17A 4OOYA 2J3TC 4GW9A 4Q0JA 5DTKA 2LB5A 1YSQA 3UB6A 4LFUA 3EGDC 4OLDA 2J80A 5A91A 2PAVP 5GLDA 1VB6A 5EOEA 1P97A 4CLCD 2W3DA 1F98A 1OT6A 3DWKA 2W1TB 4WEKA 3T4JA 1K57A 3E4OA 4E3JA 3K3DA 4ETZA 2XFTA 4N92A 4Y0TA 5HWTA 5A93A 3UE6A 5CHUA 2Q9NA 2EXBA 2VKSA 1JNUA 5GHXA 2EXAA 2FFFB 5HDDA 1NYMA 1WYBA 1ES5A 3ZQ5A 4NXGA 4WF0A 1U60A 3VMAA 1BYWA 2XQZA 2LB9A 2EFXA 5MC7A 4DE0A 3PR6A 2WKEA 4IEDA 3O87A 4DF6A 4R0QA 2PYPA 1W5DA 3E4QA 3ULFA 1MZUA 3K3CA 3JYIA 3KSFA 5CERA 1K54A 4KZ7A 4LRZE 4R3AA 3FKVA 2VA0A 3IHAA 3G2ZA 2A2LA 4R3JA 5HDSA 2W3EA 1SHVA 5FDHA 5FASA 5J4EA 3Q82A 3IX8A 2ZLYA 4K91A 3LIEA 2K2NA 3M6BA 5FA7A 3UO9A 4F3LA 5E2HA 3LEQA 3ICYA 5EFWA 1I2WA 4R3BA 1TEMA 2VJWA 4ZTKA 4BL2A 4E3KA 2XA7S 1QMFA 4WZ4A 4ZJ3A 1Z09A 4HBTA 4UHUA 3CMZA 4OONA 4C3QA 2Y2MA 5AQ9A 5EUAA 1OMEA 5HFOA 4D2OA 3FC7A 4X1MA 2WKRA 1NY0A 2P08A 1KE3A 5DF8A 1N9NA 3WS4A 3VP3A 4EBPA 5KZHA 3MQQA 1CJFA 2Y2IA 2Y8HA 3G6OA 4X56A 3CITA 3E4PA 4CJNA 1DP8A 1PYYA 2XH9A 4RA7A 5IT5A 2W1TA 4NETA 1CI9A 3G30A 4MNRA 5CRFA 3LR3A 4KG6A 1LL5A 2BTFP 1KE4A 4OH0A 1JVJA 4JXWA 3NOTC 2XROA 2WGIA 1N9LA 3C7VA 5FL3A 2EWWA 4H6JA 3EEHA 4HQAA 4L9GA 3LCEA 3ZFZA 1FSYA 5F69A 5IU1A 1QMEA 1S67L 4FH4A 1LL9A 5A92A 1L0FA 1MY8A 4LCMA 1K56A 4K0XA 1NLZA 3IF6B 1TS6A 2O0YA 3IWIA 3IXDA 3TG9A 1EWZA 1S1YA 1MKIA 1SZVA 3ZCZA 3NDEA 2WUQA 2ZOHA 2Y4AA 1D7EA 3S22A 3MXQA 4R6LA 1OTEA 4GDBA 1DJBA 1PWCA 2ZD8A 4WELA 3MZFA 4E6XA 1Q2QA 3HJIA 4YOFA 1PWDA 1IYOA 2A24A 5FQJA 3R7WB 4HJ6A 4EQ1A 1K25A 4LCLA 4RYEA 3MQ0A 5M19A 5AVFA 4ZAMA 4BWIA 1ONGA 3EOIA 2HDQA 3WS1A 3G32A 4Q0IA 3BRMA 1K6RA 3CUEA 5M18A 3UE3A 1YAXA 1BUEA 2VK3A 2X01A 3A3JA 3BYDA 3C38A 3P09A 3LEZA 4WUJA 3W4PA 3Q7VA 2V20A 5EVEA 3A0RA 2VGJA 3N8SA 2VV8A 4O8GA 2YKFA 3BJNA 3BWLA 3T4TA 3UN7A 2J9PA 4UA9A 3DW0A 3VSKA 2JKTI 4BD0A 1NJ4A 1FR6A 1W7FA 2ZQ7A 4YNRA 4FSFA 3LI9A 4MBKA 2PHYA 2L1MA 3MZEA 2V2FF 3QNCA 5CHMA 4IBXA 3NHQA 2Z6DA 3ZG7B 2WKPA 1DY6A 2XFSA 2PU2A 1AWIA 1YLPA 2HP6A 5AVEA 3C4OA 4OPYA 1MWUA 1D1JA 3KYEA 3VP2A 2HPBA 1W8QA 4PAUA 4EU0A 5EECA 3MR0A 4KZBA 2W3FA 3C8CA 4DJ3A 3O5YA 1T18A 3GRJA 1H8ZA 4HEFA 1YT4A 2V1BA 1J3WA 1ERQA 2H28A 1P0ZA 3F1NB 1LSWA 3RXWA 2I9VA 2Q0OA 3ITAA 2QYBA 4R23A 1IFQA 4BBTA 3TSGA 3ZG5A 2Y55A 4LV3A 4BLMA 1FSWA 3IXGA 1NZOA 4QPRA 4PMAA 4XT2A 5FSRA 1LL8A 2WK0A 2OV5A 3VFFA 4P0MA 3MF0A 4ZRRA 2W1RA 2EX9A 5HD3A 4R4SA 4E04A 3BW6A 3W4QA 5HPIA 3E2KA 2OOLA 4EBLA 4N9KA 5HL1A 3JVUA 3N8RA 1TS7A 4IHQA 1BLCA 5FQQA 5L10A 4JKTA 4X69A 1ES2A 3UNWA 3DTMA 3HREA 4JGPA 3GDIA 1XGIA 3ZVWA 2PT7A 2JBFA 3PYPA 4WYYA 3SOIA 4RVAA 3PBTA 4Y13A 4L9FA 4GS9A 3Q7VB 3G2YA 4WBGA 5CGSA 5GHZA 3WS2A 4E3NA 4AFIA 2BG1A 2ZM2A 3FG8A 2ZOIA 2VEAA 3VE4A 1G6OA 3OC2A 5F68A 4OKPA 1H8MA 1W8YA 2WAEA 4CLCE 1YLYA 2ZC4B 4B4XA 1SKOA 1YSPA 3TJZC 4DXCA 4QJGA 3IX4A 4OQIA 2PR6A 1V9ZA 1K38A 1PW1A 1BZAA 1G28A 1YMSA 1DJCA 5G4ZA 4EERA 4FOFA 2VGKA 1YPRA 3LIFA 4RX3A 4S2NC 3BFGA 3BQAA 2Y91A 1HZOA 3H7WA 3NY4A 3HLDA 5GLCA 3QP4A 2ZL1B 3NECA 4ZBEA 5GHYA 4EQIA 3KSIA 4HY8A 2WZZA 5HD5A 4II7A 1BLPA 2QZ6A 2PRFA 3LYXA 3CI6A 4LV1A 5AQ7A 2OLVA 3B33A 4NXEA 3UDXA 4GDNA 2G2WA 2ZQDA 2XD5A 4JF5A 4GHIA 1L0GA 3SH9A 3SS5A 1FILA 5EE8A 1FR1A 5E2GA 1AXBA 1FCOA 3BM6A 3V3SA 4JGOA 4MN6A 4QB8A 3S4XA 1Z6FA 4Z1WA 2Y2LA 4HNBA 3LO7A 3AGFA 3S7QA 4ARZA 2ZQAA 3LUQA 4IVIA 3OOVA 2KDKA 1L0DA 2NUPC 2PD8A 2UV0E 1W79A 3MFXA 1VHMA 2O99A 2CC1A 1A0KA 3V5MA 3LR4A 1ESIA 2VLGA 1W63Q 3M6HA 2XGNA 3BFDA 5E43A 3FZCA 3GV9A 3T4QA 3GVBA 3D72A 5L2FA 1CEGA 4HJ3A 4DMZA 3P7NA 2IA2A 4KQRA 4C6YA 3OCNA 4S2LA 1XFQA 1KGFA 2QJ5A 1XJ4A 2BLSA 1NWZA 3UPNA 3BFEA 2QKPA 4U0XA 2H10A 3VP1A 3HVFA 3O3VA 1VEUB 4EBNA 4RQ9A 3ZGAB 2D01A 2JKGA 3S7NA 2V1AA 3IF5A 1E3UA 4YWZA 3AGEA 4WLAA 1FCNA 2P9VB 1XFNA 3B47A 4P87A 3N4IA 1KE0A 4KG2A 4B88A 3ZNTA 2ZC5B 1V9YA 4JGRA 2B02A 5EM1A 4HESA 2HJEA 4PPRA 4ETXA 2P9VA 1XJ6A 5DJUA 1GSWA 3ZNYA 4OOLA 3D9YA 3AGDA 4EETB 1ZTUA 1Y4OA 2IWCA 3UY6A 3KSHA 5TFQA 4FUWA 2JHEA 5F1GA 5U47A 4B4ZA 2R9XA 3LR0A 4HBUA 3TW8A 2Y2HA 2XK1A 3GTCA 3W8KA 1K4EA 2WAFA 2Y2NA 3H9WA 2ZM8A 3LY3A 1YKDA 3LI8A 3UDIA 4MEZA 5CGXA 3EGXC 4Y0UA 4R70A 2HJ9C 3PXPA 1NYYA 3RXXA 3BECA 4MDZA 3O88A 5FQKA 4I3JA 1K4FA 2ZC6B 3GECA 5DTTA 3NIAA 3CWFA 2JKTM 4BBVA 3N6IA 4X25A 4FCFA 5L09A 4BL3A 1E3UD 1UGUA 4I3IA 3F1OA 2XSSA 5TGFA 4PKYG 3MKEA 2WKHA 5CX7A 1O7EA 4CLCB 3BQ8A 3F1PA 4HH3A 4P6ZM 4H6JB 3UB8A 4L0LA 3T1XA 1JTDA 5CGWA 4Y2FA 3FYZA 3RFBA 4WZ5C 3MMHA 3PAGA 5HAIA 1K0KA 2QJ7A 2ZQCA 2X02A 2P7JA 1BT5A 1XKZA 1LI9A 3IWOA 2GNXA 1TF1A 1DP6A 2YKHA 1L0EA 2Y2JA 2W3GA 3U4LP 4GN2A 3S7PA 1YQSA 2QMIA 2WGWA 1K55A 5KSCA 2VV7A 4OPQA 4KZAA 4WMCD 3HUMA 2RCXA 1BTLA 1Q2PA 2PBDP 2E8JA 2B95A 3DTIA 4E3LA 3IWQA 4DE2A 3F1NA 4JXVA 2AVXA 3OPHA 2Q9MA 4LRYC 3MS6A 1HLUP 1YLJA 3HL9A 1ZC2A 3HJKA 3VP0A 4Z9QA 3E0YA 5KMWA 4HJ4A 2A3UA 1GSVA 3NULA 2J3TD 2WKQA 3N8LA 4IJGA 5IHVA 3NOPC 2L4RA 3SW1A 3V3RA 2EA9A 5HSQA 1YLTA 2V0WA 3Q07A 3IS2B 1G6AA 2R9WA 4GB7A 4XUXA 2XLNA 4FH2A 2O9AA 3VOZA 3BY8A 2JKFA 4QY6A 1XGJA 4OVDA 2Z2MB 1F9IA 2C5WB 3C30A 1ODVA 5DF9A 1K56D 2PDRA 3ITBA 4OQ0A 3DTEA 1Y28A 2Z2LB 4QHCA 1GA9A 4X53A 2J8YA 2KOIA 3CPTB 3PHYA 3UE0A 4E6WA 2P04A 1HD8A 2JC7A 3H82B 3C7UA 3B3XA 1VEUA 1BLHA 4K0WA 4KQDA 2XF3A 1NXYA 3WRTA 1NRFA 4BJPA 2WGWB 1TD5A 4ZJ2A 1EROA 3VOLA 3CPTA 3O86A 3HCYA 5DFXA 1T1BA 1DJAA 3MSHA 3MXRA 2O9CA 1ZHHB 1PI5A 1KOUA 1ONHA 5DKKA 3PAEA 4M3KA 5G4YA 4L9EA 4GHIB 4N1HA 5DVAA 5JYOA 3EWKA 3UMDA 3R7WA 4NK3A 2V1ZA 3IX3A 2ZMFA 3MFDA 2OSUA 1MPLA 3A3EA 1FCMA 3UDFA 2ZMVA 1RP5A 4B9OA 3T1RA 3OPLA 4Y7PA 3G4PA 4MN5A 1D06A 5C5KA 4UEYA 3IXHA 1SKFA 4G3KA 3TE8A 1VETB 3C4PA 1YLZA 4KZ4A 3IS2A 2J7VA 1GHPA 4NXBA 4LLOB 2FFYA 2HDRA 5FAOA 1JWVA 3UPOA 3BLMA 1PI4A 5A90A 2J9OA 3NOUC 2VV6A 2EX8A 3N7WA 1T19A 2OWJA 2WZXA 3PBRA 4I39A 3QP5A 4P85A 2ZQ9A 3RJUA 4E3MA 3WS0A 1CF0A 2V8FA 4X55A 3EEAA 3T4KA 3SS3A 3BLSA 2G7UA 5HZHA 4BENA 3CHWP 4F94A 4BD1A 4BMWA 3UB9A 4OPRA 4EW7A 4X68A 1LSXA 4MBFA 4B93A 2GX5A 1SDNA 2Y2KA 1PZPA 3W4OA 1MWSA 2C6WB 5EVIA 1EW0A 2HF6A 4P6BA 3P98A 1SCWA 3M2JA 2VZWA 4JBFA 3LY4A 1IYPA 1PW8A 2P74A 4LV0A 5HARA 4DN0A 4LPZA 4WZ5A 2HDSA 4RX2A 1XP4A 3D4FA 4O01A 4OQGA 3HLGA 1IYSA 4DRTA 4MCWA 1XJ3A 3ISGA 4IUKA 4S2PA 1S6RA 4MMNA 5I5LA 3T50A 3H7WB 5HAPA 2IWDA 4HHDA 4QD4A 3SZTA 3GSGA 1PFLA 3LGOA 5AJGA 1RCJA 3ZVTA 5EVIC 2V9AA 3R4KA 3G31A 4S2KA 4GCZA 1XX2A 5CTNA 3MZDA 4KZ6A 2J3WA 4CPKA 4LGWA 1O07A 2XEPA 2NUTC 4XT2B 3QP2A 1MXOA 3ZG0A 5F1FA 2ZJ9A 3IXBA 4DKIA 5HX9A 5FEGA 1LSVA 5FAQA 4WMCA 2D02A 1TVFA 1I5QA 4GS9B 2BASA 1RGZA 4QWOA 1CI8A 5KIZA 4S2OA 5JYPA 3VFHA 4S2JA 1OTDA 1ACFA 3HUNA 4OPZA 3OCLA 4CLCC 4N1XA 4EUVA 1LI0A 4R38A 3PTEA 1L2SA 3CG5A 5TJJA 4UA7A 2HP5A 2HP9A 3NBLA 1F5MA 1PRQA 5EOOA 3PBNA 1IELA 1GSXA 4WN5A 5FQ9A 4EESA 4KG5A 3F1OB 2DCFA 1GHMA 3DAVA 3E2LA 5E2FA 3VE3A 4GZBA 3FPVA 2WKIA 4KQOA 3KYZA 5HDCA 3NC8A 3IF6C 5GL9A 2ZQ8A 3UPPA 1MC0A 5F5YA 2QHKA 3A0VA 2ZL1A 2FH5A 3CAXA 5AQBA 5DF7A 1SDEA 4UA6A 1ZG4A 2Y79A 4Y15A 1HTZA 1MBLA 4X1LA 1S4SA 4JXSA 2HZ5A 1UWNX 4X6TA 5A8BA 2JKRI 1BULA 2DRWA 5KSHA 1M6KA 1GCEA 2PYRA 4HIAA 2OWHA 2ACGA 3HUOA 3IHBA 2OAP1 3ZDJA 4GNUA 3S1YA 1E4DA 4OP8A 4EEUA 3HLCA 1NZUA 4ZDXA 3QP6A 2HV1A 2MJ6A 3T4SA 5DKLA 3T12B 1KVLA 3P01A 4DDSA 2M1CA 1K55C 2Y59A 1XA1A 2JN7A 4WM9A 2L0WA 4U3TA 1T1CA 2CMNA 1TDLA 5HWWA 3LFVA 1CQAA 2WADA 4K08A 5HL6A 4EEPA 4E3OA 4GJ4A 2B18A 3RTYA 5D3OA 1J9MA 2K31A 1E25A 1JTGA 2W0NA 4H8RA 4PM7A 5FEFA 2A49A 4JPMA 5CECA 1CK3A 3F1PB 1KGEA 1UWPX 4PM5A 4R4RA 1X0OA 2OAQ1 4R1GA 4N9LA 3NJAA 1EI5A 3G34A 4NEED 4QY5A 2RL3A 2OLUA 3KYQA 3TOIA 3S7OA 2VGLM 3SH7A 4O0PA 1F2KA 4LENA 1XA7A 5CHJA 1OJGA 2V0UA 4ID4A 4WL9A 4KQQA 2JE5A 1YLWA 5HPFA 1NRJA 1DP9A 5FI2A 1FQGA 3CUEC 4Q0HA 1TDGA 3LIAA 5K5BA 4GKUA 3MKFA 4DJ2A 1H8YA 3T4LA 1KDSA 3IT9A 1ERMA 3C2WA 2EX6A 4HI4A 1L3LA 2ZMAA 3IBJA 1MWTA 3A3FA 1WA9A 5AQAA 1TS0A 3NI9A 1TS8A 3I7JA 3H82A 4I5SA 4IBRA 4ESPA 3HLEA 1YM1A 4E3IA 1PNEA 4UQIS
chains in the Genus database with same CATH topology
4WEKA 4OKPA 3WRTA 1K57A 1W8YA 1NRFA 4BJPA 2WYXA 2WGWB 3WS5A 2WAEA 1YLYA 2ZC4B 4E3JA 4ZJ2A 1EROA 3O86A 5HW3A 4B4XA 4DXCA 4QJGA 1DJAA 4OQIA 2PBYA 2XFTA 3MXRA 4N92A 1PI5A 4Y0TA 4PM9A 2PU4A 1ONHA 1G68A 5A93A 1K38A 1PW1A 5CEBA 1K6SA 3PAEA 4FD8A 1BZAA 1YMSA 1DJCA 4M3KA 5CHUA 2Q9NA 3OC2A 2EXBA 5FAPA 4N1HA 5DVAA 5GHXA 5F82A 2VGKA 2EXAA 2FFFB 5JYOA 4RX3A 4S2NC 3BFGA 3ZHHA 4JF6A 4NK3A 2V1ZA 2XR0A 1NYMA 1WYBA 1ES5A 2Y91A 3PBOA 1HZOA 3MFDA 2OSUA 1MPLA 3A3EA 1FCMA 3UDFA 3NY4A 3HLDA 5GLCA 1RP5A 1U60A 3VMAA 4ZBEA 3OPLA 2XQZA 3G4PA 3OPRA 4Y7PA 5GHYA 4UAAA 4EQIA 4KENB 2EFXA 2WZZA 4DE0A 4IVKA 3IXHA 2WKEA 4GD6A 1BLPA 4IEDA 1WYCA 2QZ6A 5FQMA 3O87A 1SKFA 4LV1A 2OLVA 5AQ7A 3UDXA 4DF6A 4R0QA 4GDNA 2G2WA 2DNSA 2ZQDA 1W5DA 2XD5A 4JF5A 1L0GA 3C4PA 1ZG6A 2ZC7A 3JYIA 1YLZA 1K54A 4KZ4A 5CERA 3SH9A 3SS5A 4KZ7A 2J7VA 3A3DA 3EQVA 5EE8A 1GHPA 3FKVA 3IHAA 4OOMA 3G2ZA 4R3JA 1FR1A 2FFYA 2HDRA 1AXBA 1ES4A 1FCOA 3BM6A 5E2GA 1JWVA 5FAOA 3V3SA 4OP5A 3UPOA 3BLMA 1PI4A 5A90A 4YINA 1SHVA 2J9OA 5FDHA 5FASA 3Q82A 5EVLA 2ZLYA 4K91A 2EX8A 3N7WA 4QB8A 3S4XA 1Z6FA 4A5RA 2Y2LA 3M6BA 2WZXA 3PBRA 3LO7A 3AGFA 3PBQA 1PWGA 5FA7A 2ZQAA 4IVIA 4PM8A 4P85A 2ZQ9A 3UO9A 5E2HA 3RJUA 4E3MA 3WS0A 2I72A 1L0DA 3UE1A 1I2WA 2EX2A 1MWRA 1N4OA 4R3BA 4X55A 1W79A 3SS3A 3BLSA 3HBRA 3HLWA 2G2UA 1TEMA 4ZTKA 4BL2A 4BENA 4F94A 4E3KA 4BD1A 4KZ3A 1QMFA 4OPRA 3HLBA 2CC1A 3V5MA 1LLBA 4C75A 3BFCA 1ESIA 4X68A 4WZ4A 3M6HA 1ALQA 4ZJ3A 3NCKA 2XGNA 4HBTA 4MBFA 1SDNA 2Y2KA 1PZPA 3BFDA 3FZCA 3GV9A 3IQAA 5E43A 1MWSA 2C6WB 3W4OA 5EVIA 4UHUA 4P6BA 3CMZA 3P98A 2EFUA 3GVBA 5CEDA 5L2FA 4OONA 4O7DA 1CEGA 4C3QA 2Y2MA 5AQ9A 1SCWA 3M2JA 3HLFA 4KQRA 5EUAA 1JWPA 1GA0A 1OMEA 4JBFA 5HFOA 4C6YA 4D2OA 3OCNA 1ZKJA 4YFMA 3LY4A 4S2LA 1IYPA 1KGFA 1PW8A 2P74A 4LV0A 4XXRA 5HAQA 1NY0A 5HARA 1IYQA 1KE3A 3QHYA 2BLSA 3Q7ZA 5DF8A 3WS4A 3VP3A 4EBPA 5KZHA 4WZ5A 2HDSA 3BFEA 4RX2A 2Y2IA 1XP4A 3D4FA 3UPNA 4OQGA 3HLGA 3Q81A 1IYSA 4U0XA 4X56A 4DRTA 4LV2A 3ISGA 2H10A 4S2PA 3VP1A 4CJNA 1S6RA 5FATA 1PYYA 2XH9A 3HVFA 4OLGA 4RA7A 3O3VA 4EBNA 1IKIA 4MBHA 1C3BA 5HAPA 2IWDA 5EPHA 3ZGAB 4NETA 1CI9A 3G30A 4MNRA 5CRFA 4QD4A 4S2IA 2XDMA 3IF5A 1E3UA 4KG6A 3GSGA 1LL5A 1KE4A 3AGEA 4OH0A 1JVJA 3PBSA 2Y2QA 4JXWA 3MBZA 2IWBA 2WGIA 1RCJA 3ZVTA 3C7VA 5EVIC 1FCNA 2P9VB 3G31A 4S2KA 1XX2A 4P87A 3LCEA 3N4IA 1KE0A 5CTNA 4KG2A 3MZDA 4KZ6A 3Q1FA 4S2NA 4B88A 3ZFZA 3WRZA 1FSYA 3ZNTA 4CPKA 2ZC5B 1O07A 2JCHA 1QMEA 2XEPA 4QU3A 3QNBA 4FH4A 1LL9A 4HESA 4XUZA 3DWZA 5A92A 1L0FA 1MY8A 4LCMA 5GLAA 1K56A 1MXOA 2P9VA 4PPRA 3ZG0A 5F1FA 3OZHA 4K0XA 2ZJ9A 3IF6B 3ZNYA 3IWIA 3IXBA 3IXDA 4DKIA 2QPNA 3M2KA 4OOLA 3TG9A 5HX9A 1XPBA 5FAQA 4WMCA 1EWZA 1MKIA 1TVFA 3AGDA 3ZCZA 4GOGA 1KVMA 3NDEA 1I5QA 2IWCA 2WUQA 3UY6A 2Y4AA 1RGZA 3S22A 4MLLA 4GDBA 1CI8A 1DJBA 4JLFA 5TFQA 4S2OA 4S2MA 5F1GA 2XD1A 1PWCA 5JYPA 2ZD8A 1CEFA 4WELA 3VFHA 3MZFA 5U47A 4E6XA 4S2JA 1Q2QA 4WEJA 4B4ZA 3IH9A 2R9XA 4HBUA 3V50A 5F83A 3HUNA 4OPZA 4KZ5A 3OCLA 1K57C 4U0TA 2Y2HA 5GLBA 2XK1A 3FKWA 3GTCA 1PWDA 3W8KA 1K4EA 1IYOA 4N1XA 2WAFA 1LI0A 5FQJA 2Y2NA 3PTEA 1L2SA 2ZM8A 3CG5A 1K25A 1ES3A 4LCLA 3IF6A 3LY3A 4RYEA 4UA7A 3UDIA 2HP5A 2HP9A 4MEZA 3WWXA 5CGXA 3NBLA 4Y0UA 5M19A 2Y2PA 3MXSA 5DTSA 5EOOA 3PBNA 3CZDA 4ZAMA 1NYYA 1IELA 1ONGA 3RXXA 3BECA 2HDQA 3O88A 3WS1A 2Y2GA 3G32A 5FQ9A 5FQKA 1K4FA 3BRMA 2ZC6B 1K6RA 5M18A 3SH8A 5DTTA 4KG5A 3NIAA 2DCFA 1GHMA 3UE3A 4DE3A 1BUEA 1WE4A 2X01A 3A3JA 3E2LA 3VSLA 5E2FA 3BYDA 3N6IA 3LEZA 3P09A 4GZBA 3W4PA 4FCFA 3Q7VA 2WKIA 2V20A 4KQOA 3GR2A 1S0WA 2VGJA 3N8SA 3V39A 4BL3A 1E3UD 3NC8A 2H0YA 3IF6C 5GL9A 1BLSA 5I94A 2ZQ8A 3UPPA 3CJMA 3UN7A 5TGFA 2J9PA 4UA9A 3DW0A 3MKEA 3VSKA 3G35A 2WKHA 4BD0A 1O7EA 1NJ4A 1FR6A 1HVBA 1W7FA 2ZQ7A 1H5XA 4FSFA 2HDUA 3BEBA 4L0LA 4MBKA 5DF7A 5AQBA 1SDEA 4UA6A 4EUZA 1ZG4A 1JTDA 5CGWA 3FYZA 3MZEA 1HTZA 4WZ5C 1BSGA 1MBLA 2V2FF 3QNCA 3PAGA 2ZC3B 5CHMA 5HAIA 4IBXA 2ZQCA 3ZG7B 1N9BA 4JXSA 4X6TA 2X02A 2Y2OA 4KZ8A 1DY6A 1BT5A 2XFSA 1XKZA 1XXMA 1LI9A 4DXBA 3GQZA 3IWOA 1BULA 2DRWA 2PU2A 3A3IA 3SS4A 5KSHA 1M6KA 4DDYA 1GCEA 1YLPA 1L0EA 2Y2JA 2HP6A 4GN2A 3IHBA 3HUOA 1YQSA 2QMIA 3ZDJA 4GNUA 3S1YA 2WGWA 1E4DA 3C4OA 1MWUA 4OP8A 4OPYA 5FI6A 1K55A 5FI7A 5M1AA 5KSCA 1YMXA 3VP2A 3HLCA 2HPBA 1NZUA 1W8QA 3GMWA 4OPQA 1ESUA 4ZDXA 1M40A 4KZAA 4JXGA 1KVLA 2H5SA 4WMCD 2UWXA 5EECA 3HUMA 4DDSA 1K55C 2Y59A 3EQUA 1XA1A 2RCXA 4KZBA 1BTLA 1Q2PA 4GD8A 5FQIA 4WM9A 5G18A 4U3TA 5EVIB 4BQMA 4EV4A 3GRJA 1TDLA 1H8ZA 1KDWA 4EWFA 4HEFA 4E3LA 1YT4A 5J8XA 1I2SA 1ERQA 2WGVA 3IWQA 4DE2A 1LHYA 2WADA 4JF4A 4JXVA 3RXWA 2ZM0A 1VQQA 3NDGA 2Q9MA 3OPHA 4E3OA 3VP4A 3C5AA 3ZG8B 1FOFA 4OQHA 3ITAA 5D3OA 1IKGA 1J9MA 1YLJA 1ZC2A 3HL9A 4PM6A 1E25A 1JTGA 4R23A 4Z9QA 3VP0A 4H8RA 3FV7A 1JWZA 2H0TA 3TSGA 5CTMA 3ZG5A 4PM7A 5KMWA 2Y55A 3FWLA 4LV3A 3ZG9B 4BLMA 2A49A 4DE1A 1FSWA 3IXGA 1RGYA 4JPMA 1NZOA 1CK3A 5CECA 4Q8IA 4PMAA 1KGEA 4ZJ1A 2A3UA 5FSRA 4PM5A 2WK0A 2OV5A 3VFFA 1PZOA 4R4RA 5CXWA 4P0MA 3N8LA 4R1GA 1KGGA 4Y0OA 5IHVA 3VOYA 5EVID 4N9LA 1EI5A 3BFFA 3G34A 2EX9A 4R4SA 3V3RA 2X71A 4QY5A 3W4QA 2RL3A 2OLUA 1YLTA 3TOIA 3E2KA 3SH7A 4EBLA 4N9KA 3Q07A 5HL1A 3N8RA 4LENA 1G6AA 1IEMA 1K54C 1XA7A 2R9WA 4GB7A 1VM1A 1BLCA 5CHJA 2B5RA 4XUXA 5FQQA 1GHIA 2XLNA 4ID4A 4KQQA 2JE5A 3IH8A 4JKTA 4X69A 4FH2A 1Y54A 1YLWA 2GDNA 1ES2A 3UNWA 3VOZA 4KZ9A 5FI2A 3DTMA 4QY6A 1FQGA 1XGJA 3HREA 4OVDA 2E8IA 2Z2MB 2C5WB 5BOHA 1TDGA 5E2EA 5TR7A 1PIOA 5DF9A 1K56D 4GKUA 3MKFA 3OPPA 4OOYA 1H8YA 3ITBA 1XGIA 3ZVWA 4OQ0A 2JBFA 2Z2LB 1KDSA 4WYYA 3IT9A 3SOIA 5DTKA 1ERMA 4RVAA 4QHCA 1GA9A 3PBTA 4X53A 2EX6A 2J8YA 3UE0A 2ZMAA 4OLDA 3Q7VB 1MWTA 4E6WA 3A3FA 3G2YA 4WBGA 5CGSA 5GHZA 3WS2A 5AQAA 4E3NA 1HD8A 2BG1A 2JC7A 3NI9A 2ZM2A 5A91A 3C7UA 3I7JA 4IBRA 5GLDA 3B3XA 5EOEA 1BLHA 3HLEA 1YM1A 4K0WA 4E3IA 2XF3A 3DWKA 1NXYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WEK A;  4OKP A;  3WRT A;  1K57 A;  1W8Y A;  1NRF A;  4BJP A;  2WYX A;  2WGW B;  3WS5 A;  2WAE A;  1YLY A;  2ZC4 B;  4E3J A;  4ZJ2 A;  1ERO A;  3O86 A;  5HW3 A;  4B4X A;  4DXC A;  4QJG A;  1DJA A;  4OQI A;  2PBY A;  2XFT A;  3MXR A;  4N92 A;  1PI5 A;  4Y0T A;  4PM9 A;  2PU4 A;  1ONH A;  1G68 A;  5A93 A;  1K38 A;  1PW1 A;  5CEB A;  1K6S A;  3PAE A;  4FD8 A;  1BZA A;  1YMS A;  1DJC A;  4M3K A;  5CHU A;  2Q9N A;  3OC2 A;  2EXB A;  5FAP A;  4N1H A;  5DVA A;  5GHX A;  5F82 A;  2VGK A;  2EXA A;  2FFF B;  5JYO A;  4RX3 A;  4S2N C;  3BFG A;  3ZHH A;  4JF6 A;  4NK3 A;  2V1Z A;  2XR0 A;  1NYM A;  1WYB A;  1ES5 A;  2Y91 A;  3PBO A;  1HZO A;  3MFD A;  2OSU A;  1MPL A;  3A3E A;  1FCM A;  3UDF A;  3NY4 A;  3HLD A;  5GLC A;  1RP5 A;  1U60 A;  3VMA A;  4ZBE A;  3OPL A;  2XQZ A;  3G4P A;  3OPR A;  4Y7P A;  5GHY A;  4UAA A;  4EQI A;  4KEN B;  2EFX A;  2WZZ A;  4DE0 A;  4IVK A;  3IXH A;  2WKE A;  4GD6 A;  1BLP A;  4IED A;  1WYC A;  2QZ6 A;  5FQM A;  3O87 A;  1SKF A;  4LV1 A;  2OLV A;  5AQ7 A;  3UDX A;  4DF6 A;  4R0Q A;  4GDN A;  2G2W A;  2DNS A;  2ZQD A;  1W5D A;  2XD5 A;  4JF5 A;  1L0G A;  3C4P A;  1ZG6 A;  2ZC7 A;  3JYI A;  1YLZ A;  1K54 A;  4KZ4 A;  5CER A;  3SH9 A;  3SS5 A;  4KZ7 A;  2J7V A;  3A3D A;  3EQV A;  5EE8 A;  1GHP A;  3FKV A;  3IHA A;  4OOM A;  3G2Z A;  4R3J A;  1FR1 A;  2FFY A;  2HDR A;  1AXB A;  1ES4 A;  1FCO A;  3BM6 A;  5E2G A;  1JWV A;  5FAO A;  3V3S A;  4OP5 A;  3UPO A;  3BLM A;  1PI4 A;  5A90 A;  4YIN A;  1SHV A;  2J9O A;  5FDH A;  5FAS A;  3Q82 A;  5EVL A;  2ZLY A;  4K91 A;  2EX8 A;  3N7W A;  4QB8 A;  3S4X A;  1Z6F A;  4A5R A;  2Y2L A;  3M6B A;  2WZX A;  3PBR A;  3LO7 A;  3AGF A;  3PBQ A;  1PWG A;  5FA7 A;  2ZQA A;  4IVI A;  4PM8 A;  4P85 A;  2ZQ9 A;  3UO9 A;  5E2H A;  3RJU A;  4E3M A;  3WS0 A;  2I72 A;  1L0D A;  3UE1 A;  1I2W A;  2EX2 A;  1MWR A;  1N4O A;  4R3B A;  4X55 A;  1W79 A;  3SS3 A;  3BLS A;  3HBR A;  3HLW A;  2G2U A;  1TEM A;  4ZTK A;  4BL2 A;  4BEN A;  4F94 A;  4E3K A;  4BD1 A;  4KZ3 A;  1QMF A;  4OPR A;  3HLB A;  2CC1 A;  3V5M A;  1LLB A;  4C75 A;  3BFC A;  1ESI A;  4X68 A;  4WZ4 A;  3M6H A;  1ALQ A;  4ZJ3 A;  3NCK A;  2XGN A;  4HBT A;  4MBF A;  1SDN A;  2Y2K A;  1PZP A;  3BFD A;  3FZC A;  3GV9 A;  3IQA A;  5E43 A;  1MWS A;  2C6W B;  3W4O A;  5EVI A;  4UHU A;  4P6B A;  3CMZ A;  3P98 A;  2EFU A;  3GVB A;  5CED A;  5L2F A;  4OON A;  4O7D A;  1CEG A;  4C3Q A;  2Y2M A;  5AQ9 A;  1SCW A;  3M2J A;  3HLF A;  4KQR A;  5EUA A;  1JWP A;  1GA0 A;  1OME A;  4JBF A;  5HFO A;  4C6Y A;  4D2O A;  3OCN A;  1ZKJ A;  4YFM A;  3LY4 A;  4S2L A;  1IYP A;  1KGF A;  1PW8 A;  2P74 A;  4LV0 A;  4XXR A;  5HAQ A;  1NY0 A;  5HAR A;  1IYQ A;  1KE3 A;  3QHY A;  2BLS A;  3Q7Z A;  5DF8 A;  3WS4 A;  3VP3 A;  4EBP A;  5KZH A;  4WZ5 A;  2HDS A;  3BFE A;  4RX2 A;  2Y2I A;  1XP4 A;  3D4F A;  3UPN A;  4OQG A;  3HLG A;  3Q81 A;  1IYS A;  4U0X A;  4X56 A;  4DRT A;  4LV2 A;  3ISG A;  2H10 A;  4S2P A;  3VP1 A;  4CJN A;  1S6R A;  5FAT A;  1PYY A;  2XH9 A;  3HVF A;  4OLG A;  4RA7 A;  3O3V A;  4EBN A;  1IKI A;  4MBH A;  1C3B A;  5HAP A;  2IWD A;  5EPH A;  3ZGA B;  4NET A;  1CI9 A;  3G30 A;  4MNR A;  5CRF A;  4QD4 A;  4S2I A;  2XDM A;  3IF5 A;  1E3U A;  4KG6 A;  3GSG A;  1LL5 A;  1KE4 A;  3AGE A;  4OH0 A;  1JVJ A;  3PBS A;  2Y2Q A;  4JXW A;  3MBZ A;  2IWB A;  2WGI A;  1RCJ A;  3ZVT A;  3C7V A;  5EVI C;  1FCN A;  2P9V B;  3G31 A;  4S2K A;  1XX2 A;  4P87 A;  3LCE A;  3N4I A;  1KE0 A;  5CTN A;  4KG2 A;  3MZD A;  4KZ6 A;  3Q1F A;  4S2N A;  4B88 A;  3ZFZ A;  3WRZ A;  1FSY A;  3ZNT A;  4CPK A;  2ZC5 B;  1O07 A;  2JCH A;  1QME A;  2XEP A;  4QU3 A;  3QNB A;  4FH4 A;  1LL9 A;  4HES A;  4XUZ A;  3DWZ A;  5A92 A;  1L0F A;  1MY8 A;  4LCM A;  5GLA A;  1K56 A;  1MXO A;  2P9V A;  4PPR A;  3ZG0 A;  5F1F A;  3OZH A;  4K0X A;  2ZJ9 A;  3IF6 B;  3ZNY A;  3IWI A;  3IXB A;  3IXD A;  4DKI A;  2QPN A;  3M2K A;  4OOL A;  3TG9 A;  5HX9 A;  1XPB A;  5FAQ A;  4WMC A;  1EWZ A;  1MKI A;  1TVF A;  3AGD A;  3ZCZ A;  4GOG A;  1KVM A;  3NDE A;  1I5Q A;  2IWC A;  2WUQ A;  3UY6 A;  2Y4A A;  1RGZ A;  3S22 A;  4MLL A;  4GDB A;  1CI8 A;  1DJB A;  4JLF A;  5TFQ A;  4S2O A;  4S2M A;  5F1G A;  2XD1 A;  1PWC A;  5JYP A;  2ZD8 A;  1CEF A;  4WEL A;  3VFH A;  3MZF A;  5U47 A;  4E6X A;  4S2J A;  1Q2Q A;  4WEJ A;  4B4Z A;  3IH9 A;  2R9X A;  4HBU A;  3V50 A;  5F83 A;  3HUN A;  4OPZ A;  4KZ5 A;  3OCL A;  1K57 C;  4U0T A;  2Y2H A;  5GLB A;  2XK1 A;  3FKW A;  3GTC A;  1PWD A;  3W8K A;  1K4E A;  1IYO A;  4N1X A;  2WAF A;  1LI0 A;  5FQJ A;  2Y2N A;  3PTE A;  1L2S A;  2ZM8 A;  3CG5 A;  1K25 A;  1ES3 A;  4LCL A;  3IF6 A;  3LY3 A;  4RYE A;  4UA7 A;  3UDI A;  2HP5 A;  2HP9 A;  4MEZ A;  3WWX A;  5CGX A;  3NBL A;  4Y0U A;  5M19 A;  2Y2P A;  3MXS A;  5DTS A;  5EOO A;  3PBN A;  3CZD A;  4ZAM A;  1NYY A;  1IEL A;  1ONG A;  3RXX A;  3BEC A;  2HDQ A;  3O88 A;  3WS1 A;  2Y2G A;  3G32 A;  5FQ9 A;  5FQK A;  1K4F A;  3BRM A;  2ZC6 B;  1K6R A;  5M18 A;  3SH8 A;  5DTT A;  4KG5 A;  3NIA A;  2DCF A;  1GHM A;  3UE3 A;  4DE3 A;  1BUE A;  1WE4 A;  2X01 A;  3A3J A;  3E2L A;  3VSL A;  5E2F A;  3BYD A;  3N6I A;  3LEZ A;  3P09 A;  4GZB A;  3W4P A;  4FCF A;  3Q7V A;  2WKI A;  2V20 A;  4KQO A;  3GR2 A;  1S0W A;  2VGJ A;  3N8S A;  3V39 A;  4BL3 A;  1E3U D;  3NC8 A;  2H0Y A;  3IF6 C;  5GL9 A;  1BLS A;  5I94 A;  2ZQ8 A;  3UPP A;  3CJM A;  3UN7 A;  5TGF A;  2J9P A;  4UA9 A;  3DW0 A;  3MKE A;  3VSK A;  3G35 A;  2WKH A;  4BD0 A;  1O7E A;  1NJ4 A;  1FR6 A;  1HVB A;  1W7F A;  2ZQ7 A;  1H5X A;  4FSF A;  2HDU A;  3BEB A;  4L0L A;  4MBK A;  5DF7 A;  5AQB A;  1SDE A;  4UA6 A;  4EUZ A;  1ZG4 A;  1JTD A;  5CGW A;  3FYZ A;  3MZE A;  1HTZ A;  4WZ5 C;  1BSG A;  1MBL A;  2V2F F;  3QNC A;  3PAG A;  2ZC3 B;  5CHM A;  5HAI A;  4IBX A;  2ZQC A;  3ZG7 B;  1N9B A;  4JXS A;  4X6T A;  2X02 A;  2Y2O A;  4KZ8 A;  1DY6 A;  1BT5 A;  2XFS A;  1XKZ A;  1XXM A;  1LI9 A;  4DXB A;  3GQZ A;  3IWO A;  1BUL A;  2DRW A;  2PU2 A;  3A3I A;  3SS4 A;  5KSH A;  1M6K A;  4DDY A;  1GCE A;  1YLP A;  1L0E A;  2Y2J A;  2HP6 A;  4GN2 A;  3IHB A;  3HUO A;  1YQS A;  2QMI A;  3ZDJ A;  4GNU A;  3S1Y A;  2WGW A;  1E4D A;  3C4O A;  1MWU A;  4OP8 A;  4OPY A;  5FI6 A;  1K55 A;  5FI7 A;  5M1A A;  5KSC A;  1YMX A;  3VP2 A;  3HLC A;  2HPB A;  1NZU A;  1W8Q A;  3GMW A;  4OPQ A;  1ESU A;  4ZDX A;  1M40 A;  4KZA A;  4JXG A;  1KVL A;  2H5S A;  4WMC D;  2UWX A;  5EEC A;  3HUM A;  4DDS A;  1K55 C;  2Y59 A;  3EQU A;  1XA1 A;  2RCX A;  4KZB A;  1BTL A;  1Q2P A;  4GD8 A;  5FQI A;  4WM9 A;  5G18 A;  4U3T A;  5EVI B;  4BQM A;  4EV4 A;  3GRJ A;  1TDL A;  1H8Z A;  1KDW A;  4EWF A;  4HEF A;  4E3L A;  1YT4 A;  5J8X A;  1I2S A;  1ERQ A;  2WGV A;  3IWQ A;  4DE2 A;  1LHY A;  2WAD A;  4JF4 A;  4JXV A;  3RXW A;  2ZM0 A;  1VQQ A;  3NDG A;  2Q9M A;  3OPH A;  4E3O A;  3VP4 A;  3C5A A;  3ZG8 B;  1FOF A;  4OQH A;  3ITA A;  5D3O A;  1IKG A;  1J9M A;  1YLJ A;  1ZC2 A;  3HL9 A;  4PM6 A;  1E25 A;  1JTG A;  4R23 A;  4Z9Q A;  3VP0 A;  4H8R A;  3FV7 A;  1JWZ A;  2H0T A;  3TSG A;  5CTM A;  3ZG5 A;  4PM7 A;  5KMW A;  2Y55 A;  3FWL A;  4LV3 A;  3ZG9 B;  4BLM A;  2A49 A;  4DE1 A;  1FSW A;  3IXG A;  1RGY A;  4JPM A;  1NZO A;  1CK3 A;  5CEC A;  4Q8I A;  4PMA A;  1KGE A;  4ZJ1 A;  2A3U A;  5FSR A;  4PM5 A;  2WK0 A;  2OV5 A;  3VFF A;  1PZO A;  4R4R A;  5CXW A;  4P0M A;  3N8L A;  4R1G A;  1KGG A;  4Y0O A;  5IHV A;  3VOY A;  5EVI D;  4N9L A;  1EI5 A;  3BFF A;  3G34 A;  2EX9 A;  4R4S A;  3V3R A;  2X71 A;  4QY5 A;  3W4Q A;  2RL3 A;  2OLU A;  1YLT A;  3TOI A;  3E2K A;  3SH7 A;  4EBL A;  4N9K A;  3Q07 A;  5HL1 A;  3N8R A;  4LEN A;  1G6A A;  1IEM A;  1K54 C;  1XA7 A;  2R9W A;  4GB7 A;  1VM1 A;  1BLC A;  5CHJ A;  2B5R A;  4XUX A;  5FQQ A;  1GHI A;  2XLN A;  4ID4 A;  4KQQ A;  2JE5 A;  3IH8 A;  4JKT A;  4X69 A;  4FH2 A;  1Y54 A;  1YLW A;  2GDN A;  1ES2 A;  3UNW A;  3VOZ A;  4KZ9 A;  5FI2 A;  3DTM A;  4QY6 A;  1FQG A;  1XGJ A;  3HRE A;  4OVD A;  2E8I A;  2Z2M B;  2C5W B;  5BOH A;  1TDG A;  5E2E A;  5TR7 A;  1PIO A;  5DF9 A;  1K56 D;  4GKU A;  3MKF A;  3OPP A;  4OOY A;  1H8Y A;  3ITB A;  1XGI A;  3ZVW A;  4OQ0 A;  2JBF A;  2Z2L B;  1KDS A;  4WYY A;  3IT9 A;  3SOI A;  5DTK A;  1ERM A;  4RVA A;  4QHC A;  1GA9 A;  3PBT A;  4X53 A;  2EX6 A;  2J8Y A;  3UE0 A;  2ZMA A;  4OLD A;  3Q7V B;  1MWT A;  4E6W A;  3A3F A;  3G2Y A;  4WBG A;  5CGS A;  5GHZ A;  3WS2 A;  5AQA A;  4E3N A;  1HD8 A;  2BG1 A;  2JC7 A;  3NI9 A;  2ZM2 A;  5A91 A;  3C7U A;  3I7J A;  4IBR A;  5GLD A;  3B3X A;  5EOE A;  1BLH A;  3HLE A;  1YM1 A;  4K0W A;  4E3I A;  2XF3 A;  3DWK A;  1NXY A; 
#chains in the Genus database with same CATH topology
 1OJ5 A;  4M4X A;  3VV4 A;  2WYX A;  3WS5 A;  3IBR A;  5HWV A;  3FPW A;  5HW3 A;  1P9W A;  2PBY A;  4PM9 A;  2PU4 A;  1G68 A;  5CEB A;  1K6S A;  4FD8 A;  1STZ A;  5FAP A;  3W2Z A;  5F82 A;  1OTB A;  2DMW A;  2EWV A;  3ZHH A;  4I38 A;  4JF6 A;  2XR0 A;  4HP9 A;  5IS1 A;  3PBO A;  4Y3I A;  3OPR A;  4UAA A;  4KEN B;  2R78 A;  4IVK A;  4GD6 A;  1N9O A;  1WYC A;  5DJT A;  5FQM A;  2DNS A;  4CLC A;  1ZG6 A;  2ZC7 A;  2VX8 A;  4UQI M;  2XA7 M;  3A3D A;  3EQV A;  3KX0 X;  4OOM A;  1ES4 A;  4OP5 A;  4YIN A;  5EVL A;  5FDS A;  4A5R A;  3PBQ A;  1PWG A;  2K7S A;  4PM8 A;  4KUK A;  2I72 A;  3UE1 A;  1W63 M;  3K2N A;  2EX2 A;  1MWR A;  1N4O A;  2KLI A;  4NXF A;  3HBR A;  3HLW A;  2G2U A;  4KZ3 A;  3HLB A;  5J3W A;  1LLB A;  4C75 A;  3BFC A;  3JVV A;  1ALQ A;  5F6A A;  2W27 A;  3NCK A;  1OPX A;  3IQA A;  2EFU A;  5CED A;  4O7D A;  1H0M A;  3UB5 P;  2V8C A;  2A24 B;  3V67 A;  3HLF A;  3LIB A;  1GA0 A;  1JWP A;  4KUO A;  1ZKJ A;  4YFM A;  3KO6 A;  3RH8 B;  4XXR A;  5HAQ A;  1IYQ A;  3QHY A;  3Q7Z A;  3LR5 A;  4HH2 A;  1P9R A;  1IOU A;  3OBF A;  3Q81 A;  2QWS A;  4LV2 A;  2O9B A;  5FAT A;  4OLG A;  1IKI A;  4MBH A;  1C3B A;  3UME A;  5EPH A;  4P6Z S;  4Y5F A;  3ZYT A;  4S2I A;  2XDM A;  2JKR M;  1S1Z A;  1OT9 A;  3PBS A;  2Y2Q A;  3MBZ A;  2IWB A;  3Q1F A;  4S2N A;  4CQH A;  5J7E A;  3WRZ A;  5LBR A;  3T1S A;  1S4R A;  2JCH A;  4QU3 A;  3QNB A;  4XUZ A;  3DWZ A;  5GLA A;  3QP8 A;  3OZH A;  1FIK A;  4G3V A;  2QPN A;  3M2K A;  4PKY A;  1XPB A;  5EV0 A;  4GOG A;  1KVM A;  1SKO B;  4MLL A;  4JLF A;  4S2M A;  2XD1 A;  1CEF A;  4WEJ A;  3IH9 A;  3KSG A;  3TRC A;  5DFY A;  3V50 A;  1S66 L;  2W3H A;  3CLO A;  2Z6C A;  5F83 A;  4KZ5 A;  4U0T A;  1K57 C;  5GLB A;  3FKW A;  3L7H A;  2HGV A;  3L9K A;  4NG2 A;  4I3A A;  2PR5 A;  2INW A;  1ES3 A;  5EM0 A;  3IF6 A;  3DTK A;  5L8M A;  3WWX A;  2Y2P A;  3MXS A;  5DTS A;  4LRX C;  3CZD A;  1H3Q A;  2Y2G A;  4GLQ A;  3OLO A;  3SH8 A;  4DE3 A;  4HP4 A;  1WE4 A;  3VSL A;  4EXO A;  1G5U A;  1OTI A;  3E98 A;  1OTA A;  2ZBB A;  3GR2 A;  1S0W A;  3V39 A;  3JPU A;  4ARZ B;  2H0Y A;  1BLS A;  5I94 A;  2XRN A;  3CJM A;  3A0S A;  3G35 A;  3U2A A;  1HVB A;  4D60 A;  1H5X A;  2HDU A;  3BEB A;  2FZ0 A;  4EUZ A;  4F3L B;  2M7V A;  1LT0 A;  1BSG A;  2ZC3 B;  1N9B A;  2Y2O A;  4KZ8 A;  1XXM A;  4DXB A;  3GQZ A;  4HOI A;  3A3I A;  3SS4 A;  4DDY A;  5M1A A;  1VET A;  5FI6 A;  5FI7 A;  1YMX A;  3GMW A;  1ESU A;  1M40 A;  4MN7 A;  4JXG A;  2H5S A;  2UWX A;  3EQU A;  4GD8 A;  5FQI A;  5G18 A;  1MKM A;  5EVI B;  4BQM A;  4EV4 A;  3MQO A;  1KDW A;  4EWF A;  3LID A;  5J8X A;  2VGL S;  1I2S A;  2WGV A;  4IUH A;  1LHY A;  1NLY A;  4JF4 A;  2ZM0 A;  1VQQ A;  3NDG A;  3VP4 A;  3C5A A;  3ZG8 B;  1FOF A;  3QP1 A;  4OQH A;  4PM6 A;  1IKG A;  4ME4 A;  2KX6 A;  4G3W A;  3FV7 A;  1T1A A;  1JWZ A;  2GZA A;  2H0T A;  5CTM A;  3T1Q B;  3LIC A;  3FWL A;  2M7U A;  3ZG9 B;  4DE1 A;  1RGY A;  4FTX A;  4Q8I A;  3UB7 A;  4ZJ1 A;  3B42 A;  5L07 A;  1PZO A;  4BBU A;  5CXW A;  2PD7 A;  1KGG A;  4NKP A;  4Y0O A;  3VOY A;  5EVI D;  3BFF A;  2X71 A;  3D3O A;  2GJ3 A;  3DBA A;  1IEM A;  1K54 C;  1VM1 A;  1DRM A;  2B5R A;  1GHI A;  3T4O A;  1XJ2 A;  3IH8 A;  5TBM A;  1Y54 A;  4PHT A;  5TBM B;  2GDN A;  3MJQ A;  4KZ9 A;  4JGQ A;  2E8I A;  5BOH A;  5E2E A;  5TR7 A;  1PIO A;  3OPP A;  3BY9 A;  4Y17 A;  4OOY A;  2J3T C;  4GW9 A;  4Q0J A;  5DTK A;  2LB5 A;  1YSQ A;  3UB6 A;  4LFU A;  3EGD C;  4OLD A;  2J80 A;  5A91 A;  2PAV P;  5GLD A;  1VB6 A;  5EOE A;  1P97 A;  4CLC D;  2W3D A;  1F98 A;  1OT6 A;  3DWK A;  2W1T B;  4WEK A;  3T4J A;  1K57 A;  3E4O A;  4E3J A;  3K3D A;  4ETZ A;  2XFT A;  4N92 A;  4Y0T A;  5HWT A;  5A93 A;  3UE6 A;  5CHU A;  2Q9N A;  2EXB A;  2VKS A;  1JNU A;  5GHX A;  2EXA A;  2FFF B;  5HDD A;  1NYM A;  1WYB A;  1ES5 A;  3ZQ5 A;  4NXG A;  4WF0 A;  1U60 A;  3VMA A;  1BYW A;  2XQZ A;  2LB9 A;  2EFX A;  5MC7 A;  4DE0 A;  3PR6 A;  2WKE A;  4IED A;  3O87 A;  4DF6 A;  4R0Q A;  2PYP A;  1W5D A;  3E4Q A;  3ULF A;  1MZU A;  3K3C A;  3JYI A;  3KSF A;  5CER A;  1K54 A;  4KZ7 A;  4LRZ E;  4R3A A;  3FKV A;  2VA0 A;  3IHA A;  3G2Z A;  2A2L A;  4R3J A;  5HDS A;  2W3E A;  1SHV A;  5FDH A;  5FAS A;  5J4E A;  3Q82 A;  3IX8 A;  2ZLY A;  4K91 A;  3LIE A;  2K2N A;  3M6B A;  5FA7 A;  3UO9 A;  4F3L A;  5E2H A;  3LEQ A;  3ICY A;  5EFW A;  1I2W A;  4R3B A;  1TEM A;  2VJW A;  4ZTK A;  4BL2 A;  4E3K A;  2XA7 S;  1QMF A;  4WZ4 A;  4ZJ3 A;  1Z09 A;  4HBT A;  4UHU A;  3CMZ A;  4OON A;  4C3Q A;  2Y2M A;  5AQ9 A;  5EUA A;  1OME A;  5HFO A;  4D2O A;  3FC7 A;  4X1M A;  2WKR A;  1NY0 A;  2P08 A;  1KE3 A;  5DF8 A;  1N9N A;  3WS4 A;  3VP3 A;  4EBP A;  5KZH A;  3MQQ A;  1CJF A;  2Y2I A;  2Y8H A;  3G6O A;  4X56 A;  3CIT A;  3E4P A;  4CJN A;  1DP8 A;  1PYY A;  2XH9 A;  4RA7 A;  5IT5 A;  2W1T A;  4NET A;  1CI9 A;  3G30 A;  4MNR A;  5CRF A;  3LR3 A;  4KG6 A;  1LL5 A;  2BTF P;  1KE4 A;  4OH0 A;  1JVJ A;  4JXW A;  3NOT C;  2XRO A;  2WGI A;  1N9L A;  3C7V A;  5FL3 A;  2EWW A;  4H6J A;  3EEH A;  4HQA A;  4L9G A;  3LCE A;  3ZFZ A;  1FSY A;  5F69 A;  5IU1 A;  1QME A;  1S67 L;  4FH4 A;  1LL9 A;  5A92 A;  1L0F A;  1MY8 A;  4LCM A;  1K56 A;  4K0X A;  1NLZ A;  3IF6 B;  1TS6 A;  2O0Y A;  3IWI A;  3IXD A;  3TG9 A;  1EWZ A;  1S1Y A;  1MKI A;  1SZV A;  3ZCZ A;  3NDE A;  2WUQ A;  2ZOH A;  2Y4A A;  1D7E A;  3S22 A;  3MXQ A;  4R6L A;  1OTE A;  4GDB A;  1DJB A;  1PWC A;  2ZD8 A;  4WEL A;  3MZF A;  4E6X A;  1Q2Q A;  3HJI A;  4YOF A;  1PWD A;  1IYO A;  2A24 A;  5FQJ A;  3R7W B;  4HJ6 A;  4EQ1 A;  1K25 A;  4LCL A;  4RYE A;  3MQ0 A;  5M19 A;  5AVF A;  4ZAM A;  4BWI A;  1ONG A;  3EOI A;  2HDQ A;  3WS1 A;  3G32 A;  4Q0I A;  3BRM A;  1K6R A;  3CUE A;  5M18 A;  3UE3 A;  1YAX A;  1BUE A;  2VK3 A;  2X01 A;  3A3J A;  3BYD A;  3C38 A;  3P09 A;  3LEZ A;  4WUJ A;  3W4P A;  3Q7V A;  2V20 A;  5EVE A;  3A0R A;  2VGJ A;  3N8S A;  2VV8 A;  4O8G A;  2YKF A;  3BJN A;  3BWL A;  3T4T A;  3UN7 A;  2J9P A;  4UA9 A;  3DW0 A;  3VSK A;  2JKT I;  4BD0 A;  1NJ4 A;  1FR6 A;  1W7F A;  2ZQ7 A;  4YNR A;  4FSF A;  3LI9 A;  4MBK A;  2PHY A;  2L1M A;  3MZE A;  2V2F F;  3QNC A;  5CHM A;  4IBX A;  3NHQ A;  2Z6D A;  3ZG7 B;  2WKP A;  1DY6 A;  2XFS A;  2PU2 A;  1AWI A;  1YLP A;  2HP6 A;  5AVE A;  3C4O A;  4OPY A;  1MWU A;  1D1J A;  3KYE A;  3VP2 A;  2HPB A;  1W8Q A;  4PAU A;  4EU0 A;  5EEC A;  3MR0 A;  4KZB A;  2W3F A;  3C8C A;  4DJ3 A;  3O5Y A;  1T18 A;  3GRJ A;  1H8Z A;  4HEF A;  1YT4 A;  2V1B A;  1J3W A;  1ERQ A;  2H28 A;  1P0Z A;  3F1N B;  1LSW A;  3RXW A;  2I9V A;  2Q0O A;  3ITA A;  2QYB A;  4R23 A;  1IFQ A;  4BBT A;  3TSG A;  3ZG5 A;  2Y55 A;  4LV3 A;  4BLM A;  1FSW A;  3IXG A;  1NZO A;  4QPR A;  4PMA A;  4XT2 A;  5FSR A;  1LL8 A;  2WK0 A;  2OV5 A;  3VFF A;  4P0M A;  3MF0 A;  4ZRR A;  2W1R A;  2EX9 A;  5HD3 A;  4R4S A;  4E04 A;  3BW6 A;  3W4Q A;  5HPI A;  3E2K A;  2OOL A;  4EBL A;  4N9K A;  5HL1 A;  3JVU A;  3N8R A;  1TS7 A;  4IHQ A;  1BLC A;  5FQQ A;  5L10 A;  4JKT A;  4X69 A;  1ES2 A;  3UNW A;  3DTM A;  3HRE A;  4JGP A;  3GDI A;  1XGI A;  3ZVW A;  2PT7 A;  2JBF A;  3PYP A;  4WYY A;  3SOI A;  4RVA A;  3PBT A;  4Y13 A;  4L9F A;  4GS9 A;  3Q7V B;  3G2Y A;  4WBG A;  5CGS A;  5GHZ A;  3WS2 A;  4E3N A;  4AFI A;  2BG1 A;  2ZM2 A;  3FG8 A;  2ZOI A;  2VEA A;  3VE4 A;  1G6O A;  3OC2 A;  5F68 A;  4OKP A;  1H8M A;  1W8Y A;  2WAE A;  4CLC E;  1YLY A;  2ZC4 B;  4B4X A;  1SKO A;  1YSP A;  3TJZ C;  4DXC A;  4QJG A;  3IX4 A;  4OQI A;  2PR6 A;  1V9Z A;  1K38 A;  1PW1 A;  1BZA A;  1G28 A;  1YMS A;  1DJC A;  5G4Z A;  4EER A;  4FOF A;  2VGK A;  1YPR A;  3LIF A;  4RX3 A;  4S2N C;  3BFG A;  3BQA A;  2Y91 A;  1HZO A;  3H7W A;  3NY4 A;  3HLD A;  5GLC A;  3QP4 A;  2ZL1 B;  3NEC A;  4ZBE A;  5GHY A;  4EQI A;  3KSI A;  4HY8 A;  2WZZ A;  5HD5 A;  4II7 A;  1BLP A;  2QZ6 A;  2PRF A;  3LYX A;  3CI6 A;  4LV1 A;  5AQ7 A;  2OLV A;  3B33 A;  4NXE A;  3UDX A;  4GDN A;  2G2W A;  2ZQD A;  2XD5 A;  4JF5 A;  4GHI A;  1L0G A;  3SH9 A;  3SS5 A;  1FIL A;  5EE8 A;  1FR1 A;  5E2G A;  1AXB A;  1FCO A;  3BM6 A;  3V3S A;  4JGO A;  4MN6 A;  4QB8 A;  3S4X A;  1Z6F A;  4Z1W A;  2Y2L A;  4HNB A;  3LO7 A;  3AGF A;  3S7Q A;  4ARZ A;  2ZQA A;  3LUQ A;  4IVI A;  3OOV A;  2KDK A;  1L0D A;  2NUP C;  2PD8 A;  2UV0 E;  1W79 A;  3MFX A;  1VHM A;  2O99 A;  2CC1 A;  1A0K A;  3V5M A;  3LR4 A;  1ESI A;  2VLG A;  1W63 Q;  3M6H A;  2XGN A;  3BFD A;  5E43 A;  3FZC A;  3GV9 A;  3T4Q A;  3GVB A;  3D72 A;  5L2F A;  1CEG A;  4HJ3 A;  4DMZ A;  3P7N A;  2IA2 A;  4KQR A;  4C6Y A;  3OCN A;  4S2L A;  1XFQ A;  1KGF A;  2QJ5 A;  1XJ4 A;  2BLS A;  1NWZ A;  3UPN A;  3BFE A;  2QKP A;  4U0X A;  2H10 A;  3VP1 A;  3HVF A;  3O3V A;  1VEU B;  4EBN A;  4RQ9 A;  3ZGA B;  2D01 A;  2JKG A;  3S7N A;  2V1A A;  3IF5 A;  1E3U A;  4YWZ A;  3AGE A;  4WLA A;  1FCN A;  2P9V B;  1XFN A;  3B47 A;  4P87 A;  3N4I A;  1KE0 A;  4KG2 A;  4B88 A;  3ZNT A;  2ZC5 B;  1V9Y A;  4JGR A;  2B02 A;  5EM1 A;  4HES A;  2HJE A;  4PPR A;  4ETX A;  2P9V A;  1XJ6 A;  5DJU A;  1GSW A;  3ZNY A;  4OOL A;  3D9Y A;  3AGD A;  4EET B;  1ZTU A;  1Y4O A;  2IWC A;  3UY6 A;  3KSH A;  5TFQ A;  4FUW A;  2JHE A;  5F1G A;  5U47 A;  4B4Z A;  2R9X A;  3LR0 A;  4HBU A;  3TW8 A;  2Y2H A;  2XK1 A;  3GTC A;  3W8K A;  1K4E A;  2WAF A;  2Y2N A;  3H9W A;  2ZM8 A;  3LY3 A;  1YKD A;  3LI8 A;  3UDI A;  4MEZ A;  5CGX A;  3EGX C;  4Y0U A;  4R70 A;  2HJ9 C;  3PXP A;  1NYY A;  3RXX A;  3BEC A;  4MDZ A;  3O88 A;  5FQK A;  4I3J A;  1K4F A;  2ZC6 B;  3GEC A;  5DTT A;  3NIA A;  3CWF A;  2JKT M;  4BBV A;  3N6I A;  4X25 A;  4FCF A;  5L09 A;  4BL3 A;  1E3U D;  1UGU A;  4I3I A;  3F1O A;  2XSS A;  5TGF A;  4PKY G;  3MKE A;  2WKH A;  5CX7 A;  1O7E A;  4CLC B;  3BQ8 A;  3F1P A;  4HH3 A;  4P6Z M;  4H6J B;  3UB8 A;  4L0L A;  3T1X A;  1JTD A;  5CGW A;  4Y2F A;  3FYZ A;  3RFB A;  4WZ5 C;  3MMH A;  3PAG A;  5HAI A;  1K0K A;  2QJ7 A;  2ZQC A;  2X02 A;  2P7J A;  1BT5 A;  1XKZ A;  1LI9 A;  3IWO A;  2GNX A;  1TF1 A;  1DP6 A;  2YKH A;  1L0E A;  2Y2J A;  2W3G A;  3U4L P;  4GN2 A;  3S7P A;  1YQS A;  2QMI A;  2WGW A;  1K55 A;  5KSC A;  2VV7 A;  4OPQ A;  4KZA A;  4WMC D;  3HUM A;  2RCX A;  1BTL A;  1Q2P A;  2PBD P;  2E8J A;  2B95 A;  3DTI A;  4E3L A;  3IWQ A;  4DE2 A;  3F1N A;  4JXV A;  2AVX A;  3OPH A;  2Q9M A;  4LRY C;  3MS6 A;  1HLU P;  1YLJ A;  3HL9 A;  1ZC2 A;  3HJK A;  3VP0 A;  4Z9Q A;  3E0Y A;  5KMW A;  4HJ4 A;  2A3U A;  1GSV A;  3NUL A;  2J3T D;  2WKQ A;  3N8L A;  4IJG A;  5IHV A;  3NOP C;  2L4R A;  3SW1 A;  3V3R A;  2EA9 A;  5HSQ A;  1YLT A;  2V0W A;  3Q07 A;  3IS2 B;  1G6A A;  2R9W A;  4GB7 A;  4XUX A;  2XLN A;  4FH2 A;  2O9A A;  3VOZ A;  3BY8 A;  2JKF A;  4QY6 A;  1XGJ A;  4OVD A;  2Z2M B;  1F9I A;  2C5W B;  3C30 A;  1ODV A;  5DF9 A;  1K56 D;  2PDR A;  3ITB A;  4OQ0 A;  3DTE A;  1Y28 A;  2Z2L B;  4QHC A;  1GA9 A;  4X53 A;  2J8Y A;  2KOI A;  3CPT B;  3PHY A;  3UE0 A;  4E6W A;  2P04 A;  1HD8 A;  2JC7 A;  3H82 B;  3C7U A;  3B3X A;  1VEU A;  1BLH A;  4K0W A;  4KQD A;  2XF3 A;  1NXY A;  3WRT A;  1NRF A;  4BJP A;  2WGW B;  1TD5 A;  4ZJ2 A;  1ERO A;  3VOL A;  3CPT A;  3O86 A;  3HCY A;  5DFX A;  1T1B A;  1DJA A;  3MSH A;  3MXR A;  2O9C A;  1ZHH B;  1PI5 A;  1KOU A;  1ONH A;  5DKK A;  3PAE A;  4M3K A;  5G4Y A;  4L9E A;  4GHI B;  4N1H A;  5DVA A;  5JYO A;  3EWK A;  3UMD A;  3R7W A;  4NK3 A;  2V1Z A;  3IX3 A;  2ZMF A;  3MFD A;  2OSU A;  1MPL A;  3A3E A;  1FCM A;  3UDF A;  2ZMV A;  1RP5 A;  4B9O A;  3T1R A;  3OPL A;  4Y7P A;  3G4P A;  4MN5 A;  1D06 A;  5C5K A;  4UEY A;  3IXH A;  1SKF A;  4G3K A;  3TE8 A;  1VET B;  3C4P A;  1YLZ A;  4KZ4 A;  3IS2 A;  2J7V A;  1GHP A;  4NXB A;  4LLO B;  2FFY A;  2HDR A;  5FAO A;  1JWV A;  3UPO A;  3BLM A;  1PI4 A;  5A90 A;  2J9O A;  3NOU C;  2VV6 A;  2EX8 A;  3N7W A;  1T19 A;  2OWJ A;  2WZX A;  3PBR A;  4I39 A;  3QP5 A;  4P85 A;  2ZQ9 A;  3RJU A;  4E3M A;  3WS0 A;  1CF0 A;  2V8F A;  4X55 A;  3EEA A;  3T4K A;  3SS3 A;  3BLS A;  2G7U A;  5HZH A;  4BEN A;  3CHW P;  4F94 A;  4BD1 A;  4BMW A;  3UB9 A;  4OPR A;  4EW7 A;  4X68 A;  1LSX A;  4MBF A;  4B93 A;  2GX5 A;  1SDN A;  2Y2K A;  1PZP A;  3W4O A;  1MWS A;  2C6W B;  5EVI A;  1EW0 A;  2HF6 A;  4P6B A;  3P98 A;  1SCW A;  3M2J A;  2VZW A;  4JBF A;  3LY4 A;  1IYP A;  1PW8 A;  2P74 A;  4LV0 A;  5HAR A;  4DN0 A;  4LPZ A;  4WZ5 A;  2HDS A;  4RX2 A;  1XP4 A;  3D4F A;  4O01 A;  4OQG A;  3HLG A;  1IYS A;  4DRT A;  4MCW A;  1XJ3 A;  3ISG A;  4IUK A;  4S2P A;  1S6R A;  4MMN A;  5I5L A;  3T50 A;  3H7W B;  5HAP A;  2IWD A;  4HHD A;  4QD4 A;  3SZT A;  3GSG A;  1PFL A;  3LGO A;  5AJG A;  1RCJ A;  3ZVT A;  5EVI C;  2V9A A;  3R4K A;  3G31 A;  4S2K A;  4GCZ A;  1XX2 A;  5CTN A;  3MZD A;  4KZ6 A;  2J3W A;  4CPK A;  4LGW A;  1O07 A;  2XEP A;  2NUT C;  4XT2 B;  3QP2 A;  1MXO A;  3ZG0 A;  5F1F A;  2ZJ9 A;  3IXB A;  4DKI A;  5HX9 A;  5FEG A;  1LSV A;  5FAQ A;  4WMC A;  2D02 A;  1TVF A;  1I5Q A;  4GS9 B;  2BAS A;  1RGZ A;  4QWO A;  1CI8 A;  5KIZ A;  4S2O A;  5JYP A;  3VFH A;  4S2J A;  1OTD A;  1ACF A;  3HUN A;  4OPZ A;  3OCL A;  4CLC C;  4N1X A;  4EUV A;  1LI0 A;  4R38 A;  3PTE A;  1L2S A;  3CG5 A;  5TJJ A;  4UA7 A;  2HP5 A;  2HP9 A;  3NBL A;  1F5M A;  1PRQ A;  5EOO A;  3PBN A;  1IEL A;  1GSX A;  4WN5 A;  5FQ9 A;  4EES A;  4KG5 A;  3F1O B;  2DCF A;  1GHM A;  3DAV A;  3E2L A;  5E2F A;  3VE3 A;  4GZB A;  3FPV A;  2WKI A;  4KQO A;  3KYZ A;  5HDC A;  3NC8 A;  3IF6 C;  5GL9 A;  2ZQ8 A;  3UPP A;  1MC0 A;  5F5Y A;  2QHK A;  3A0V A;  2ZL1 A;  2FH5 A;  3CAX A;  5AQB A;  5DF7 A;  1SDE A;  4UA6 A;  1ZG4 A;  2Y79 A;  4Y15 A;  1HTZ A;  1MBL A;  4X1L A;  1S4S A;  4JXS A;  2HZ5 A;  1UWN X;  4X6T A;  5A8B A;  2JKR I;  1BUL A;  2DRW A;  5KSH A;  1M6K A;  1GCE A;  2PYR A;  4HIA A;  2OWH A;  2ACG A;  3HUO A;  3IHB A;  2OAP 1;  3ZDJ A;  4GNU A;  3S1Y A;  1E4D A;  4OP8 A;  4EEU A;  3HLC A;  1NZU A;  4ZDX A;  3QP6 A;  2HV1 A;  2MJ6 A;  3T4S A;  5DKL A;  3T12 B;  1KVL A;  3P01 A;  4DDS A;  2M1C A;  1K55 C;  2Y59 A;  1XA1 A;  2JN7 A;  4WM9 A;  2L0W A;  4U3T A;  1T1C A;  2CMN A;  1TDL A;  5HWW A;  3LFV A;  1CQA A;  2WAD A;  4K08 A;  5HL6 A;  4EEP A;  4E3O A;  4GJ4 A;  2B18 A;  3RTY A;  5D3O A;  1J9M A;  2K31 A;  1E25 A;  1JTG A;  2W0N A;  4H8R A;  4PM7 A;  5FEF A;  2A49 A;  4JPM A;  5CEC A;  1CK3 A;  3F1P B;  1KGE A;  1UWP X;  4PM5 A;  4R4R A;  1X0O A;  2OAQ 1;  4R1G A;  4N9L A;  3NJA A;  1EI5 A;  3G34 A;  4NEE D;  4QY5 A;  2RL3 A;  2OLU A;  3KYQ A;  3TOI A;  3S7O A;  2VGL M;  3SH7 A;  4O0P A;  1F2K A;  4LEN A;  1XA7 A;  5CHJ A;  1OJG A;  2V0U A;  4ID4 A;  4WL9 A;  4KQQ A;  2JE5 A;  1YLW A;  5HPF A;  1NRJ A;  1DP9 A;  5FI2 A;  1FQG A;  3CUE C;  4Q0H A;  1TDG A;  3LIA A;  5K5B A;  4GKU A;  3MKF A;  4DJ2 A;  1H8Y A;  3T4L A;  1KDS A;  3IT9 A;  1ERM A;  3C2W A;  2EX6 A;  4HI4 A;  1L3L A;  2ZMA A;  3IBJ A;  1MWT A;  3A3F A;  1WA9 A;  5AQA A;  1TS0 A;  3NI9 A;  1TS8 A;  3I7J A;  3H82 A;  4I5S A;  4IBR A;  4ESP A;  3HLE A;  1YM1 A;  4E3I A;  1PNE A;  4UQI S; 
#chains in the Genus database with same CATH homology
 4WEK A;  4OKP A;  3WRT A;  1K57 A;  1W8Y A;  1NRF A;  4BJP A;  2WYX A;  2WGW B;  3WS5 A;  2WAE A;  1YLY A;  2ZC4 B;  4E3J A;  4ZJ2 A;  1ERO A;  3O86 A;  5HW3 A;  4B4X A;  4DXC A;  4QJG A;  1DJA A;  4OQI A;  2PBY A;  2XFT A;  3MXR A;  4N92 A;  1PI5 A;  4Y0T A;  4PM9 A;  2PU4 A;  1ONH A;  1G68 A;  5A93 A;  1K38 A;  1PW1 A;  5CEB A;  1K6S A;  3PAE A;  4FD8 A;  1BZA A;  1YMS A;  1DJC A;  4M3K A;  5CHU A;  2Q9N A;  3OC2 A;  2EXB A;  5FAP A;  4N1H A;  5DVA A;  5GHX A;  5F82 A;  2VGK A;  2EXA A;  2FFF B;  5JYO A;  4RX3 A;  4S2N C;  3BFG A;  3ZHH A;  4JF6 A;  4NK3 A;  2V1Z A;  2XR0 A;  1NYM A;  1WYB A;  1ES5 A;  2Y91 A;  3PBO A;  1HZO A;  3MFD A;  2OSU A;  1MPL A;  3A3E A;  1FCM A;  3UDF A;  3NY4 A;  3HLD A;  5GLC A;  1RP5 A;  1U60 A;  3VMA A;  4ZBE A;  3OPL A;  2XQZ A;  3G4P A;  3OPR A;  4Y7P A;  5GHY A;  4UAA A;  4EQI A;  4KEN B;  2EFX A;  2WZZ A;  4DE0 A;  4IVK A;  3IXH A;  2WKE A;  4GD6 A;  1BLP A;  4IED A;  1WYC A;  2QZ6 A;  5FQM A;  3O87 A;  1SKF A;  4LV1 A;  2OLV A;  5AQ7 A;  3UDX A;  4DF6 A;  4R0Q A;  4GDN A;  2G2W A;  2DNS A;  2ZQD A;  1W5D A;  2XD5 A;  4JF5 A;  1L0G A;  3C4P A;  1ZG6 A;  2ZC7 A;  3JYI A;  1YLZ A;  1K54 A;  4KZ4 A;  5CER A;  3SH9 A;  3SS5 A;  4KZ7 A;  2J7V A;  3A3D A;  3EQV A;  5EE8 A;  1GHP A;  3FKV A;  3IHA A;  4OOM A;  3G2Z A;  4R3J A;  1FR1 A;  2FFY A;  2HDR A;  1AXB A;  1ES4 A;  1FCO A;  3BM6 A;  5E2G A;  1JWV A;  5FAO A;  3V3S A;  4OP5 A;  3UPO A;  3BLM A;  1PI4 A;  5A90 A;  4YIN A;  1SHV A;  2J9O A;  5FDH A;  5FAS A;  3Q82 A;  5EVL A;  2ZLY A;  4K91 A;  2EX8 A;  3N7W A;  4QB8 A;  3S4X A;  1Z6F A;  4A5R A;  2Y2L A;  3M6B A;  2WZX A;  3PBR A;  3LO7 A;  3AGF A;  3PBQ A;  1PWG A;  5FA7 A;  2ZQA A;  4IVI A;  4PM8 A;  4P85 A;  2ZQ9 A;  3UO9 A;  5E2H A;  3RJU A;  4E3M A;  3WS0 A;  2I72 A;  1L0D A;  3UE1 A;  1I2W A;  2EX2 A;  1MWR A;  1N4O A;  4R3B A;  4X55 A;  1W79 A;  3SS3 A;  3BLS A;  3HBR A;  3HLW A;  2G2U A;  1TEM A;  4ZTK A;  4BL2 A;  4BEN A;  4F94 A;  4E3K A;  4BD1 A;  4KZ3 A;  1QMF A;  4OPR A;  3HLB A;  2CC1 A;  3V5M A;  1LLB A;  4C75 A;  3BFC A;  1ESI A;  4X68 A;  4WZ4 A;  3M6H A;  1ALQ A;  4ZJ3 A;  3NCK A;  2XGN A;  4HBT A;  4MBF A;  1SDN A;  2Y2K A;  1PZP A;  3BFD A;  3FZC A;  3GV9 A;  3IQA A;  5E43 A;  1MWS A;  2C6W B;  3W4O A;  5EVI A;  4UHU A;  4P6B A;  3CMZ A;  3P98 A;  2EFU A;  3GVB A;  5CED A;  5L2F A;  4OON A;  4O7D A;  1CEG A;  4C3Q A;  2Y2M A;  5AQ9 A;  1SCW A;  3M2J A;  3HLF A;  4KQR A;  5EUA A;  1JWP A;  1GA0 A;  1OME A;  4JBF A;  5HFO A;  4C6Y A;  4D2O A;  3OCN A;  1ZKJ A;  4YFM A;  3LY4 A;  4S2L A;  1IYP A;  1KGF A;  1PW8 A;  2P74 A;  4LV0 A;  4XXR A;  5HAQ A;  1NY0 A;  5HAR A;  1IYQ A;  1KE3 A;  3QHY A;  2BLS A;  3Q7Z A;  5DF8 A;  3WS4 A;  3VP3 A;  4EBP A;  5KZH A;  4WZ5 A;  2HDS A;  3BFE A;  4RX2 A;  2Y2I A;  1XP4 A;  3D4F A;  3UPN A;  4OQG A;  3HLG A;  3Q81 A;  1IYS A;  4U0X A;  4X56 A;  4DRT A;  4LV2 A;  3ISG A;  2H10 A;  4S2P A;  3VP1 A;  4CJN A;  1S6R A;  5FAT A;  1PYY A;  2XH9 A;  3HVF A;  4OLG A;  4RA7 A;  3O3V A;  4EBN A;  1IKI A;  4MBH A;  1C3B A;  5HAP A;  2IWD A;  5EPH A;  3ZGA B;  4NET A;  1CI9 A;  3G30 A;  4MNR A;  5CRF A;  4QD4 A;  4S2I A;  2XDM A;  3IF5 A;  1E3U A;  4KG6 A;  3GSG A;  1LL5 A;  1KE4 A;  3AGE A;  4OH0 A;  1JVJ A;  3PBS A;  2Y2Q A;  4JXW A;  3MBZ A;  2IWB A;  2WGI A;  1RCJ A;  3ZVT A;  3C7V A;  5EVI C;  1FCN A;  2P9V B;  3G31 A;  4S2K A;  1XX2 A;  4P87 A;  3LCE A;  3N4I A;  1KE0 A;  5CTN A;  4KG2 A;  3MZD A;  4KZ6 A;  3Q1F A;  4S2N A;  4B88 A;  3ZFZ A;  3WRZ A;  1FSY A;  3ZNT A;  4CPK A;  2ZC5 B;  1O07 A;  2JCH A;  1QME A;  2XEP A;  4QU3 A;  3QNB A;  4FH4 A;  1LL9 A;  4HES A;  4XUZ A;  3DWZ A;  5A92 A;  1L0F A;  1MY8 A;  4LCM A;  5GLA A;  1K56 A;  1MXO A;  2P9V A;  4PPR A;  3ZG0 A;  5F1F A;  3OZH A;  4K0X A;  2ZJ9 A;  3IF6 B;  3ZNY A;  3IWI A;  3IXB A;  3IXD A;  4DKI A;  2QPN A;  3M2K A;  4OOL A;  3TG9 A;  5HX9 A;  1XPB A;  5FAQ A;  4WMC A;  1EWZ A;  1MKI A;  1TVF A;  3AGD A;  3ZCZ A;  4GOG A;  1KVM A;  3NDE A;  1I5Q A;  2IWC A;  2WUQ A;  3UY6 A;  2Y4A A;  1RGZ A;  3S22 A;  4MLL A;  4GDB A;  1CI8 A;  1DJB A;  4JLF A;  5TFQ A;  4S2O A;  4S2M A;  5F1G A;  2XD1 A;  1PWC A;  5JYP A;  2ZD8 A;  1CEF A;  4WEL A;  3VFH A;  3MZF A;  5U47 A;  4E6X A;  4S2J A;  1Q2Q A;  4WEJ A;  4B4Z A;  3IH9 A;  2R9X A;  4HBU A;  3V50 A;  5F83 A;  3HUN A;  4OPZ A;  4KZ5 A;  3OCL A;  1K57 C;  4U0T A;  2Y2H A;  5GLB A;  2XK1 A;  3FKW A;  3GTC A;  1PWD A;  3W8K A;  1K4E A;  1IYO A;  4N1X A;  2WAF A;  1LI0 A;  5FQJ A;  2Y2N A;  3PTE A;  1L2S A;  2ZM8 A;  3CG5 A;  1K25 A;  1ES3 A;  4LCL A;  3IF6 A;  3LY3 A;  4RYE A;  4UA7 A;  3UDI A;  2HP5 A;  2HP9 A;  4MEZ A;  3WWX A;  5CGX A;  3NBL A;  4Y0U A;  5M19 A;  2Y2P A;  3MXS A;  5DTS A;  5EOO A;  3PBN A;  3CZD A;  4ZAM A;  1NYY A;  1IEL A;  1ONG A;  3RXX A;  3BEC A;  2HDQ A;  3O88 A;  3WS1 A;  2Y2G A;  3G32 A;  5FQ9 A;  5FQK A;  1K4F A;  3BRM A;  2ZC6 B;  1K6R A;  5M18 A;  3SH8 A;  5DTT A;  4KG5 A;  3NIA A;  2DCF A;  1GHM A;  3UE3 A;  4DE3 A;  1BUE A;  1WE4 A;  2X01 A;  3A3J A;  3E2L A;  3VSL A;  5E2F A;  3BYD A;  3N6I A;  3LEZ A;  3P09 A;  4GZB A;  3W4P A;  4FCF A;  3Q7V A;  2WKI A;  2V20 A;  4KQO A;  3GR2 A;  1S0W A;  2VGJ A;  3N8S A;  3V39 A;  4BL3 A;  1E3U D;  3NC8 A;  2H0Y A;  3IF6 C;  5GL9 A;  1BLS A;  5I94 A;  2ZQ8 A;  3UPP A;  3CJM A;  3UN7 A;  5TGF A;  2J9P A;  4UA9 A;  3DW0 A;  3MKE A;  3VSK A;  3G35 A;  2WKH A;  4BD0 A;  1O7E A;  1NJ4 A;  1FR6 A;  1HVB A;  1W7F A;  2ZQ7 A;  1H5X A;  4FSF A;  2HDU A;  3BEB A;  4L0L A;  4MBK A;  5DF7 A;  5AQB A;  1SDE A;  4UA6 A;  4EUZ A;  1ZG4 A;  1JTD A;  5CGW A;  3FYZ A;  3MZE A;  1HTZ A;  4WZ5 C;  1BSG A;  1MBL A;  2V2F F;  3QNC A;  3PAG A;  2ZC3 B;  5CHM A;  5HAI A;  4IBX A;  2ZQC A;  3ZG7 B;  1N9B A;  4JXS A;  4X6T A;  2X02 A;  2Y2O A;  4KZ8 A;  1DY6 A;  1BT5 A;  2XFS A;  1XKZ A;  1XXM A;  1LI9 A;  4DXB A;  3GQZ A;  3IWO A;  1BUL A;  2DRW A;  2PU2 A;  3A3I A;  3SS4 A;  5KSH A;  1M6K A;  4DDY A;  1GCE A;  1YLP A;  1L0E A;  2Y2J A;  2HP6 A;  4GN2 A;  3IHB A;  3HUO A;  1YQS A;  2QMI A;  3ZDJ A;  4GNU A;  3S1Y A;  2WGW A;  1E4D A;  3C4O A;  1MWU A;  4OP8 A;  4OPY A;  5FI6 A;  1K55 A;  5FI7 A;  5M1A A;  5KSC A;  1YMX A;  3VP2 A;  3HLC A;  2HPB A;  1NZU A;  1W8Q A;  3GMW A;  4OPQ A;  1ESU A;  4ZDX A;  1M40 A;  4KZA A;  4JXG A;  1KVL A;  2H5S A;  4WMC D;  2UWX A;  5EEC A;  3HUM A;  4DDS A;  1K55 C;  2Y59 A;  3EQU A;  1XA1 A;  2RCX A;  4KZB A;  1BTL A;  1Q2P A;  4GD8 A;  5FQI A;  4WM9 A;  5G18 A;  4U3T A;  5EVI B;  4BQM A;  4EV4 A;  3GRJ A;  1TDL A;  1H8Z A;  1KDW A;  4EWF A;  4HEF A;  4E3L A;  1YT4 A;  5J8X A;  1I2S A;  1ERQ A;  2WGV A;  3IWQ A;  4DE2 A;  1LHY A;  2WAD A;  4JF4 A;  4JXV A;  3RXW A;  2ZM0 A;  1VQQ A;  3NDG A;  2Q9M A;  3OPH A;  4E3O A;  3VP4 A;  3C5A A;  3ZG8 B;  1FOF A;  4OQH A;  3ITA A;  5D3O A;  1IKG A;  1J9M A;  1YLJ A;  1ZC2 A;  3HL9 A;  4PM6 A;  1E25 A;  1JTG A;  4R23 A;  4Z9Q A;  3VP0 A;  4H8R A;  3FV7 A;  1JWZ A;  2H0T A;  3TSG A;  5CTM A;  3ZG5 A;  4PM7 A;  5KMW A;  2Y55 A;  3FWL A;  4LV3 A;  3ZG9 B;  4BLM A;  2A49 A;  4DE1 A;  1FSW A;  3IXG A;  1RGY A;  4JPM A;  1NZO A;  1CK3 A;  5CEC A;  4Q8I A;  4PMA A;  1KGE A;  4ZJ1 A;  2A3U A;  5FSR A;  4PM5 A;  2WK0 A;  2OV5 A;  3VFF A;  1PZO A;  4R4R A;  5CXW A;  4P0M A;  3N8L A;  4R1G A;  1KGG A;  4Y0O A;  5IHV A;  3VOY A;  5EVI D;  4N9L A;  1EI5 A;  3BFF A;  3G34 A;  2EX9 A;  4R4S A;  3V3R A;  2X71 A;  4QY5 A;  3W4Q A;  2RL3 A;  2OLU A;  1YLT A;  3TOI A;  3E2K A;  3SH7 A;  4EBL A;  4N9K A;  3Q07 A;  5HL1 A;  3N8R A;  4LEN A;  1G6A A;  1IEM A;  1K54 C;  1XA7 A;  2R9W A;  4GB7 A;  1VM1 A;  1BLC A;  5CHJ A;  2B5R A;  4XUX A;  5FQQ A;  1GHI A;  2XLN A;  4ID4 A;  4KQQ A;  2JE5 A;  3IH8 A;  4JKT A;  4X69 A;  4FH2 A;  1Y54 A;  1YLW A;  2GDN A;  1ES2 A;  3UNW A;  3VOZ A;  4KZ9 A;  5FI2 A;  3DTM A;  4QY6 A;  1FQG A;  1XGJ A;  3HRE A;  4OVD A;  2E8I A;  2Z2M B;  2C5W B;  5BOH A;  1TDG A;  5E2E A;  5TR7 A;  1PIO A;  5DF9 A;  1K56 D;  4GKU A;  3MKF A;  3OPP A;  4OOY A;  1H8Y A;  3ITB A;  1XGI A;  3ZVW A;  4OQ0 A;  2JBF A;  2Z2L B;  1KDS A;  4WYY A;  3IT9 A;  3SOI A;  5DTK A;  1ERM A;  4RVA A;  4QHC A;  1GA9 A;  3PBT A;  4X53 A;  2EX6 A;  2J8Y A;  3UE0 A;  2ZMA A;  4OLD A;  3Q7V B;  1MWT A;  4E6W A;  3A3F A;  3G2Y A;  4WBG A;  5CGS A;  5GHZ A;  3WS2 A;  5AQA A;  4E3N A;  1HD8 A;  2BG1 A;  2JC7 A;  3NI9 A;  2ZM2 A;  5A91 A;  3C7U A;  3I7J A;  4IBR A;  5GLD A;  3B3X A;  5EOE A;  1BLH A;  3HLE A;  1YM1 A;  4K0W A;  4E3I A;  2XF3 A;  3DWK A;  1NXY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...