4BLMA

Beta-lactamase of bacillus licheniformis 749(slash)c. refinement at 2 angstroms resolution and analysis of hydration
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
256
structure length
256
Chain Sequence
DDFAKLEEQFDAKLGIFALDTGTNRTVAYRPDERFAFASTIKALTVGVLLQQKSIEDLNQRITYTRDDLVNYNPITEKHVDTGMTLKELADASLRYSDNAAQNLILKQIGGPESLKKELRKIGDEVTNPERFEPELNEVNPGETQDTSTARALVTSLRAFALEDKLPSEKRELLIDWMKRNTTGDALIRAGVPDGWEVADKTGAASYGTRNDIAIIWPPKGDPVVLAVLSSRDKKDAKYDDKLIAEATKVVMKALN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase(acting in cyclic amides)
molecule keywords BETA-LACTAMASE
publication title Beta-lactamase of Bacillus licheniformis 749/C. Refinement at 2 A resolution and analysis of hydration.
pubmed doi rcsb
source organism Bacillus licheniformis
total genus 88
structure length 256
sequence length 256
chains with identical sequence B
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 1991-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00144 Beta-lactamase Beta-lactamase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 4blmA00
1K4EA 3O88A 3S22A 3G4PA 2Z2MB 2C6WB 3BYDA 3ITBA 4M3KA 3DWKA 3UPPA 3IWOA 4IBXA 5HAPA 1K6SA 3HUOA 5DTKA 1NZOA 3TOIA 1PWDA 4KQOA 3HLDA 4FCFA 3WWXA 1LL5A 4JF4A 3OCNA 1DJAA 1CK3A 2V20A 3Q07A 1L0FA 1JWZA 1IYQA 3BFCA 5E2FA 3N7WA 3Q7VA 1M40A 1BT5A 1FQGA 3O3VA 1GHPA 4BD0A 1IELA 1SCWA 2X01A 1KE0A 4FSFA 4FD8A 4OH0A 1ES5A 2XD5A 2ZM8A 5CGWA 1ONHA 3UPOA 4S2NC 3ZNYA 4UA6A 1ONGA 2Y59A 4X53A 4RA7A 1H8ZA 3FYZA 3QNBA 4BQMA 3Q1FA 5GLDA 1FSWA 1ZG6A 1K54C 4PM6A 2ZJ9A 1M6KA 4U3TA 5KZHA 3ITAA 1GA0A 3UPNA 3NDEA 1KVMA 3GR2A 1K55C 1PZPA 3CZDA 2E8IA 4WELA 2R9WA 4DRTA 2OLUA 5CTMA 4IBRA 1MPLA 3GTCA 4FH2A 4S2MA 1YLTA 3FKVA 4U0TA 3LY3A 5BOHA 3VFHA 3DTMA 3VP0A 3PAGA 4E6WA 1W8QA 3SOIA 1L0GA 1Q2QA 2VGJA 2Y2HA 1MWTA 3HBRA 2DRWA 4GD6A 3ZFZA 5CRFA 1SDEA 2ZD8A 1XKZA 4IEDA 2IWBA 1PI4A 3HLEA 1JVJA 4OPRA 3HUMA 1VQQA 2J9PA 4E3OA 4NETA 5D3OA 4XUZA 5FSRA 2P9VA 5JYPA 5E2HA 2ZM0A 4JPMA 4OKPA 4S2KA 5FI7A 1C3BA 4ZDXA 4BJPA 5EVIC 4Y0TA 2X71A 4K0XA 2Y4AA 3OPPA 3UDIA 1WYBA 2V1ZA 3Q7VB 3HLFA 4WMCD 1FCNA 2H10A 3A3FA 2XR0A 5AQ9A 3ZG8B 4PM7A 3M6HA 1BUEA 3BLMA 5DTTA 5FQMA 1IYOA 3OPHA 4KZ3A 3E2LA 1BTLA 5CHUA 3N6IA 5EECA 2WKIA 3V3SA 4E3JA 2ZQ7A 1LHYA 2WUQA 2JC7A 3BM6A 3OPRA 1ES4A 1S0WA 5E43A 4EBPA 1U60A 1FCMA 4S2OA 3E2KA 4MBFA 2XH9A 4LCLA 3M2JA 1J9MA 5CEDA 4Y0OA 2PBYA 3FV7A 3MZFA 4BLMA 2ZMAA 3HVFA 3HUNA 4JXVA 3VP1A 1NY0A 3BRMA 1QMEA 3O87A 4OP5A 3OZHA 4OONA 3WRTA 4KZAA 2Q9NA 1L0DA 2I72A 4OLDA 1G68A 4OOMA 5EUAA 1FR6A 2Y2OA 4KENB 4E6XA 2A49A 2WADA 1W79A 4KZ7A 1ES2A 1NRFA 5CERA 2XLNA 4Q8IA 3GMWA 3UDFA 4QJGA 5A91A 5FQKA 4BL2A 2XDMA 3UO9A 1LL9A 3P98A 1RCJA 3C5AA 2HP6A 1ERQA 4WBGA 3IF6B 4P0MA 1BULA 3SS5A 4QD4A 2WAFA 4S2LA 1O07A 2ZQCA 4DXCA 2XK1A 3ZCZA 4OPQA 4UA9A 5FDHA 4PMAA 2Y91A 4XUXA 5FI6A 5GHXA 4OP8A 4RYEA 1RGZA 1LLBA 1W8YA 1JTDA 3N8LA 3ZVWA 1K25A 3M6BA 4PPRA 4LV3A 4QY6A 2Y2LA 3OC2A 4KG2A 3ZDJA 1FOFA 5M19A 1ALQA 1YLZA 1ZKJA 4CJNA 1BZAA 5CHMA 3W4PA 1E4DA 2XGNA 4KZ6A 3NC8A 4BD1A 1ES3A 3VOYA 1I5QA 2UWXA 5J8XA 3HLWA 2V2FF 5GHYA 4ZJ3A 1H5XA 1KE4A 3V50A 2ZC7A 3V39A 4WYYA 2HDRA 2ZQDA 4GN2A 3SH8A 4OQGA 4LCMA 4DE0A 4H8RA 1W5DA 3Q82A 4RX2A 3ZVTA 2X02A 3ZG5A 3PBOA 3WS0A 1NZUA 4RVAA 2H0TA 1ERMA 1Y54A 3JYIA 5TGFA 2QZ6A 3NIAA 5U47A 4L0LA 2XFSA 4GB7A 3S4XA 1K56D 2DCFA 3BFGA 1TDGA 1MKIA 4R4RA 5DVAA 5HAQA 1BLHA 1PI5A 3SH9A 4F94A 1CEFA 2EX9A 5EOEA 4OPZA 1XX2A 1HD8A 3CJMA 4OQIA 3A3EA 5E2EA 4EWFA 4K91A 3ZHHA 4E3MA 3MXRA 4JXGA 5CHJA 5FQQA 3MXSA 5CECA 2PU4A 5KSHA 1DJCA 1E25A 2Y2IA 2ZM2A 5CEBA 1BLPA 1NJ4A 3IT9A 3G31A 1PWGA 4KQRA 4LENA 2Y2QA 2OLVA 5FQIA 2P74A 4OQ0A 3LY4A 1WYCA 3PTEA 4MNRA 3V3RA 4IVIA 5F82A 4WM9A 2J9OA 1YT4A 3P09A 5M18A 1K38A 3NY4A 3UE1A 3MZDA 3RJUA 3MKEA 1IEMA 4ZTKA 1L0EA 4KZ5A 3WRZA 3IXDA 4KZ8A 3SH7A 4IVKA 4GZBA 2ZC6B 4X6TA 1MWSA 4WMCA 5E2GA 5KMWA 3IF6A 2BG1A 1IKGA 3NCKA 4KZBA 4DDYA 3WS1A 5FQJA 4OQHA 3ISGA 2EXAA 2G2UA 3BECA 1L2SA 4N92A 4HESA 1GHMA 3N8SA 5M1AA 1FR1A 1XPBA 2ZLYA 3VP2A 2ZC4B 3O86A 3I7JA 2QMIA 2Y2GA 1I2SA 2EX8A 1YLPA 4KG6A 2EX6A 5JYOA 1I2WA 5A93A 4HBTA 4EBNA 3C4OA 3IHBA 4X68A 2R9XA 2BLSA 3EQVA 2Y2NA 1IYPA 3CG5A 3OPLA 5TFQA 3TSGA 3BFEA 4HEFA 4N9KA 4WEJA 3RXXA 4O7DA 3V5MA 4B4XA 3VFFA 2ZQAA 4WZ4A 5CTNA 1YMXA 3G34A 3ZG0A 4NK3A 4E3IA 3C7UA 5FQ9A 4JXSA 4LV0A 5KSCA 1EI5A 2XFTA 1YLYA 1BLCA 4EBLA 5FI2A 1IYSA 1HTZA 2OSUA 3M2KA 4LV2A 4PM8A 3B3XA 1JWVA 4DE1A 4QU3A 3GQZA 3IWQA 5G18A 5FASA 2WGVA 5CGSA 5F83A 4DE2A 1LI0A 4A5RA 3PBTA 2WKHA 5DF7A 2PU2A 4KZ9A 4S2PA 4B4ZA 4BL3A 1SDNA 3UNWA 2WZZA 2JCHA 3IH8A 4GOGA 2WGWA 4OPYA 4S2JA 4DF6A 4P85A 4WZ5A 2WGIA 3ZG7B 2RL3A 3A3JA 3HL9A 4S2IA 1HZOA 2WAEA 4E3LA 2JBFA 1ESUA 3IH9A 1GA9A 3HREA 3NBLA 3UE0A 5FATA 4E3KA 2JE5A 1O7EA 3W8KA 4XXRA 2XQZA 2XD1A 4EUZA 2J7VA 2DNSA 2RCXA 1PW8A 2Y2MA 1E3UD 5FA7A 3OCLA 4ID4A 2Y2PA 1QMFA 5TR7A 3VSLA 3IF6C 1Z6FA 1XXMA 2WKEA 3VP4A 1OMEA 2Y55A 3ZNTA 4ZJ1A 2H0YA 4KZ4A 2EX2A 5CXWA 3IQAA 3G2ZA 4ZAMA 3MBZA 3UY6A 3MZEA 2OV5A 3FWLA 3GV9A 1W7FA 3LCEA 1XA1A 3A3DA 4R4SA 3GSGA 4R3JA 1EROA 1PYYA 1TEMA 3G30A 4CPKA 4B88A 1SKFA 3NDGA 3WS4A 4Y0UA 4N1HA 4JF6A 5GLAA 1K56A 4PM9A 4RX3A 3BLSA 2WK0A 3S1YA 2ZQ8A 3LO7A 1FSYA 4KQQA 1KE3A 4KG5A 3AGEA 2WGWB 1N9BA 5A90A 4PM5A 1GCEA 1YLWA 3GVBA 1FCOA 2WYXA 4JBFA 5CGXA 4YINA 3WS2A 1RP5A 4D2OA 5HAIA 4HBUA 1YMSA 5EVID 1MWUA 3LEZA 2XEPA 4P87A 4R3BA 3HLCA 4ZJ2A 2B5RA 2G2WA 5AQ7A 1KGGA 4GKUA 1PW1A 4DDSA 3DW0A 4OLGA 3QHYA 2FFFB 4WZ5C 1ZG4A 1NYMA 3C7VA 2H5SA 3BFFA 3IXBA 5GL9A 4QY5A 1YM1A 5EE8A 3PBRA 3SS3A 3VSKA 2Z2LB 3N4IA 4UHUA 4JXWA 1S6RA 3PBSA 3NI9A 1SHVA 3Q81A 3AGFA 3IF5A 2GDNA 1G6AA 4WEKA 3A3IA 3BFDA 2EXBA 1KGFA 1PIOA 1K4FA 4EQIA 1Q2PA 2ZC5B 3HLBA 5F1FA 4GD8A 3Q7ZA 4R23A 3TG9A 1LI9A 4BENA 1VM1A 1XA7A 1K57A 3PBQA 4OOYA 4EV4A 1CEGA 1YQSA 1JWPA 4U0XA 5F1GA 4N1XA 5A92A 4UAAA 3VOZA 1MY8A 1WE4A 4LV1A 4GNUA 2IWCA 5DF9A 5EVIB 2HDUA 3EQUA 1PZOA 4QB8A 1JTGA 3CMZA 4FH4A 3PBNA 5DTSA 2A3UA 3G2YA 5HARA 4C3QA 4DKIA 1KVLA 3C4PA 2Y2KA 1XGIA 3MFDA 5L2FA 2J8YA 3UN7A 2Y2JA 4C6YA 2C5WB 4MBHA 1IKIA 1KDSA 3MKFA 1MWRA 1KGEA 5AQAA 2HPBA 2CC1A 1MXOA 4QHCA 5FAPA 5EOOA 4R0QA 4Z9QA 5FAOA 3W4OA 3WS5A 1ZC2A 3FZCA 1RGYA 3N8RA 2HDSA 4P6BA 5HX9A 4OVDA 3IWIA 4DXBA 5I94A 3ZGAB 4X69A 1BLSA 2WZXA 4R1GA 1AXBA 2HP5A 2EFUA 4UA7A 3RXWA 1E3UA 3AGDA 3UE3A 4S2NA 4OOLA 4E3NA 1TVFA 1DY6A 5HL1A 1YLJA 4MBKA 3UDXA 1K54A 4X56A 2EFXA 1CI9A 2HDQA 4K0WA 1CI8A 4C75A 4GDNA 3HLGA 4GDBA 5GHZA 1XP4A 4MEZA 4Y7PA 1BSGA 4JF5A 1K55A 3IXHA 3ZG9B 1EWZA 1HVBA 1DJBA 1K57C 2HP9A 3IXGA 1XGJA 4MLLA 4YFMA 5FAQA 5HW3A 1GHIA 2P9VB 3BEBA 3FKWA 5DF8A 3QNCA 2ZC3B 1NYYA 1K6RA 3PAEA 3GRJA 1KDWA 2FFYA 2ZQ9A 3IHAA 5EPHA 5EVLA 1H8YA 3SS4A 2XF3A 3D4FA 2Q9MA 1TDLA 5HFOA 2VGKA 3VMAA 5IHVA 1ESIA 4X55A 5AQBA 4JKTA 1PWCA 4ZBEA 3G35A 2IWDA 5GLCA 1N4OA 1MBLA 4N9LA 3W4QA 3G32A 3DWZA 5EVIA 5GLBA 4JLFA 3VP3A 2QPNA 1NXYA 4DE3A
chains in the Genus database with same CATH superfamily
1K4EA 1LT0A 5F6AA 3NECA 2L0WA 4ETXA 1CQAA 4KQOA 3HLDA 5FL3A 1DJAA 4WUJA 2V20A 1L0FA 1IYQA 2VV8A 3N7WA 2X01A 3UPOA 1ES5A 4UA6A 1ONGA 3FYZA 4PHTA 3Q1FA 1SZVA 3H7WB 3MS6A 5KZHA 2OAP1 4JGQA 3UPNA 3GR2A 1PZPA 2E8IA 2R9WA 5CTMA 4HH3A 4IBRA 5DKKA 5BOHA 4QWOA 4U0TA 3VFHA 5J4EA 1Q2QA 2VGJA 2Y2HA 5J3WA 3LEQA 3IX4A 4KUKA 3ZFZA 1XKZA 3HUMA 5FSRA 1G5UA 4I5SA 2ACGA 3S7QA 3UDIA 2H10A 4R38A 5AQ9A 3K2NA 4HH2A 1IYOA 3OPHA 3KX0X 1BTLA 2PD7A 2V9AA 3V3SA 5E43A 3BM6A 2WUQA 4EBPA 1ES4A 4S2OA 2VEAA 5CEDA 4G3VA 4BLMA 3GECA 3HVFA 2V1AA 3BRMA 4OP5A 4OONA 2JKGA 3UB7A 2VV6A 1VEUA 1L0DA 4OLDA 1NRFA 5F5YA 3GMWA 4QJGA 4BL2A 2OWHA 5F69A 2KLIA 3FG8A 1BULA 3O5YA 2HJEA 5AVEA 4OPQA 3OLOA 2Y91A 4XUXA 5FI6A 5GHXA 4OP8A 4O8GA 3ZVWA 5HDCA 1F9IA 4HNBA 4LV3A 5M19A 1ALQA 1YLZA 4RQ9A 4FOFA 4BD1A 3HLWA 5GHYA 4ZJ3A 1KE4A 1YKDA 4WYYA 2HDRA 4GN2A 4DE0A 2JKTI 3HJKA 4H8RA 4RX2A 1SKOA 1LSXA 1NZUA 2H0TA 1ERMA 1Y54A 2UV0E 1MZUA 3KYQA 1K56D 1TDGA 5DVAA 4R4RA 5EVEA 1S66L 1BLHA 4R6LA 2B18A 2VK3A 2H28A 4I3AA 1XX2A 3CJMA 4OQIA 3A3EA 3DTIA 3MXRA 2NUPC 3MFXA 1DJCA 5CEBA 2ZM2A 1BLPA 3T4QA 3IT9A 3BQ8A 5G4YA 1VETB 2OLVA 5FQIA 4MNRA 1S1YA 4IVIA 4HP4A 4ZTKA 1L0EA 4KZ5A 3IF6A 2BG1A 4KZBA 4DDYA 3WS1A 4I3IA 4OQHA 3ISGA 3EGXC 2ZOIA 2WKPA 3I7JA 2QWSA 4KG6A 2EX6A 3G6OA 2Y2NA 1IYPA 4WEJA 5HD5A 4HJ3A 2J3TD 5CTNA 1YMXA 5DFXA 2L1MA 3CUEA 2XFTA 4EBLA 5FI2A 1HTZA 2AVXA 3TE8A 4LV2A 4PM8A 1L3LA 3QP6A 3GQZA 3IWQA 3VOLA 4A5RA 4MN7A 1CJFA 4BL3A 3UNWA 2JCHA 3IH8A 4S2JA 4DF6A 4OPYA 5F68A 4WZ5A 3ZG7B 4S2IA 1HZOA 4E3LA 3R7WA 2JBFA 1GA9A 4E3KA 4NXFA 5IU1A 5FA7A 3OCLA 2Y2PA 2V1BA 3IF6C 4YWZA 3JVUA 2H0YA 4YNRA 4L9EA 3CLOA 1WA9A 3IS2B 1OTEA 4Y17A 3CAXA 3F1OB 4PKYG 4R4SA 1AWIA 1PYYA 1OTDA 4LRZE 4JF6A 2PYPA 3BLSA 3S1YA 4KQQA 1FSYA 4ARZB 4Y13A 3AGEA 2BTFP 3F1PB 1N9BA 5A90A 2J80A 4NXGA 3WS2A 5CGXA 1RP5A 4EESA 2FH5A 1YMSA 3LEZA 2XEPA 4ZJ2A 4R3BA 5AQ7A 1PW1A 1JNUA 1VHMA 1X0OA 4OLGA 2FFFB 5C5KA 4WZ5C 1NYMA 3BFFA 2A24A 4QY5A 1YM1A 2PDRA 1FIKA 3SS3A 3N4IA 1S6RA 3PBSA 3CPTA 3D72A 3E0YA 1K4FA 3T4SA 1Q2PA 5F1FA 1OJGA 4HI4A 3TG9A 2V8FA 4BENA 1XA7A 1K57A 1V9ZA 1YQSA 4N1XA 4UAAA 1MY8A 4YOFA 4GHIB 1OT9A 2ZL1B 3MMHA 4FH4A 5DTSA 4F3LB 2A3UA 5TBMA 1KVLA 3C4PA 1XGIA 5L2FA 3C2WA 3UN7A 2C5WB 3H9WA 2CC1A 3UE6A 4Y2FA 2HDSA 4DXBA 1BLSA 3T1XA 2EFUA 3RH8B 4E3NA 1DY6A 1YLJA 3UDXA 2MJ6A 2EFXA 1CI8A 3QP2A 4GDNA 4GDBA 5GHZA 2JN7A 1K55A 3IXHA 3ZG9B 1K57C 5FAQA 5HW3A 2HP9A 3IBJA 3KO6A 1K6RA 2Q9MA 2B02A 3TRCA 5HFOA 5IHVA 4PAUA 1PWCA 1ZTUA 1S67L 3NOPC 2PYRA 5L10A 3DWZA 5EVIA 4K91A 3VP3A 4BJPA 1NXYA 4DE3A 3O88A 3S22A 3G4PA 3ITBA 2C6WB 3DWKA 2R78A 3IWOA 4IBXA 4JF4A 1CK3A 1JWZA 5E2FA 5HZHA 1PNEA 1FQGA 2JKRM 1SCWA 4FSFA 4OH0A 2ZM8A 4IJGA 2Y59A 4PM6A 2ZJ9A 4U3TA 3OOVA 1KVMA 1K55C 3CZDA 4DRTA 1MPLA 4S2MA 1V9YA 3H82B 3VP0A 4BMWA 3K3DA 3HBRA 1G28A 5CRFA 2ZMFA 3HLEA 3JPUA 2PRFA 4E3OA 4XUZA 3HJIA 4II7A 3PYPA 5EV0A 2ZM0A 4JPMA 4OKPA 5FI7A 2XROA 5EVIC 1XJ6A 4Y0TA 2X71A 3UB9A 1WYBA 3UB6A 1DP8A 2BASA 2V1ZA 3Q7VB 1W63M 3A3FA 1UGUA 3M6HA 1BUEA 2P7JA 3BLMA 5FQMA 3BY9A 3N6IA 5EECA 3E2KA 1J9MA 4FTXA 3MZFA 3VP1A 3HUNA 2CMNA 2HGVA 1TF1A 1QMEA 4KZAA 4JGRA 2M1CA 2Q9NA 3MJQA 4G3WA 1G68A 2YKFA 3IX3A 1ES2A 2VGLM 3UDFA 4IUKA 2WKQA 3UO9A 1LL9A 3BJNA 2JKTM 3P98A 1RCJA 3C5AA 4P0MA 4HJ4A 3ZCZA 4UA9A 5FDHA 4PMAA 1JTDA 1K25A 4MDZA 2EWVA 1VETA 3LIEA 2Y2LA 3R4KA 1FOFA 1ZKJA 2W3DA 4CJNA 3W4PA 1E4DA 5J8XA 3A0RA 3PHYA 1P9WA 2V2FF 3MF0A 1TD5A 3SH8A 5FEGA 3ZVTA 1KOUA 3ZG5A 4RVAA 3NOTC 3S7PA 2QZ6A 1VB6A 2XFSA 1D7EA 3VE4A 2VLGA 5HAQA 2P04A 3SH9A 1CEFA 1ZHHB 1HD8A 2D01A 4G3KA 4E3MA 1E25A 3LR0A 5AJGA 3G31A 4GS9A 4OQ0A 3PTEA 5F82A 3P09A 1F5MA 3C30A 2JKRI 4R3AA 2ZC6B 4WMCA 2VJWA 3NCKA 2EXAA 3BECA 2PR6A 1FR1A 1XPBA 3D9YA 3VP2A 2Y2GA 1YLPA 4ZRRA 3MXQA 4HBTA 4X68A 3OPLA 3CG5A 3RXXA 3V5MA 2ZQAA 4H6JB 4NK3A 4E3IA 1XJ2A 5KSCA 4Q0JA 4EQ1A 2ZBBA 3B3XA 1JWVA 4DE1A 2YKHA 5AVFA 2O9CA 1N9NA 3PXPA 4DE2A 3F1NA 3L7HA 4B4ZA 1T1BA 3MR0A 2B95A 2WGIA 2RL3A 3A3JA 4BWIA 1ESUA 4E04A 3HREA 3NBLA 5FATA 3LIDA 2XQZA 4EUZA 2J7VA 2RCXA 4X1MA 2Y2MA 1E3UD 4Q0IA 5IS1A 5TR7A 2QJ5A 2VGLS 2WKEA 2VV7A 1OMEA 2Y55A 3ZNTA 4ZJ1A 4KZ4A 2Y79A 5CXWA 3E98A 3G2ZA 5HDDA 1W7FA 3LCEA 4FUWA 4LFUA 3A3DA 4R3JA 3T4TA 5I5LA 3WS4A 4Y0UA 4N1HA 5GLAA 3PR6A 3VE3A 2O9BA 1KE3A 2PAVP 4PM5A 4HBUA 1IFQA 3NULA 1MWUA 4GKUA 2D02A 3QHYA 1ZG4A 3C7VA 1XJ4A 1W63Q 3VSKA 3TW8A 2Z2LB 3A0VA 2GJ3A 3IF5A 4LRYC 5A8BA 1G6AA 3A3IA 3BFDA 1PIOA 1GSXA 4EQIA 3HLBA 3Q7ZA 1LI9A 3PBQA 4EV4A 3KSGA 1JWPA 5F1GA 1OJ5A 3QP1A 4GNUA 5DF9A 4X25A 3UB5P 3EQUA 1PZOA 3RTYA 2Z6CA 3CMZA 3PBNA 3G2YA 2W1TA 3MFDA 1N9OA 2J8YA 5HWTA 4MBHA 2EWWA 1KDSA 5LBRA 4HIAA 3MKFA 2OOLA 1MWRA 4EETB 5AQAA 2HPBA 1MXOA 4QHCA 4R0QA 4Z9QA 3W4OA 2OWJA 3FZCA 4P6BA 4B93A 3V67A 2QHKA 5I94A 4UA7A 1AXBA 3UE3A 4OOLA 4MBKA 2HDQA 3BWLA 4C75A 2V0WA 4MEZA 2XSSA 3IXGA 1FILA 1GHIA 3BEBA 3FKWA 3SZTA 3QNCA 2ZC3B 1NYYA 3HCYA 3PAEA 3GRJA 1KDWA 1N9LA 5EVLA 3SS4A 1H8YA 2XF3A 1T1AA 1ESIA 4X55A 4ZBEA 5GLCA 1N4OA 3CUEC 3G32A 5GLBA 4JLFA 2PD8A 3EEHA 2XA7M 2Z2MB 3MQQA 4M3KA 5EM0A 4EW7A 5HAPA 1K6SA 5DTKA 1NZOA 4CLCA 3LR3A 2QJ7A 4I3JA 2M7VA 2GZAA 2K2NA 3WWXA 1VEUB 1LL5A 3LIAA 3TJZC 3Q7VA 3O3VA 2PR5A 1IELA 1KE0A 5CGWA 1ONHA 1K0KA 4X53A 4RA7A 4BQMA 5GLDA 1FSWA 1M6KA 3ITAA 1GA0A 1J3WA 4CLCE 2OAQ1 4WELA 2Z6DA 2OLUA 3LY3A 4XT2B 1W8QA 4WLAA 3SOIA 3MQOA 2DRWA 4GD6A 2IWBA 3LYXA 1VQQA 3U4LP 4KUOA 4NETA 5HL6A 5D3OA 2P9VA 1Z09A 2DMWA 1SKOB 5E2HA 1C3BA 1TS6A 2KX6A 2ZMVA 4QPRA 3HLFA 3P7NA 4IUHA 4CLCC 5DTTA 1MKMA 4KZ3A 3E2LA 5CHUA 4Q0HA 4E3JA 2JC7A 1S0WA 5CX7A 5HWWA 1TS7A 1FCMA 2E8JA 4LCLA 4Y0OA 2PBYA 4WL9A 4JXVA 3O87A 4O0PA 3OZHA 3ULFA 3WRTA 3UMDA 2I72A 4OOMA 1T1CA 1FR6A 4ESPA 2Y2OA 4KENB 4E6XA 2A49A 2WADA 4KZ7A 2XLNA 4M4XA 4Q8IA 3UB8A 2HP6A 3IF6B 1T19A 3H7WA 4QD4A 2WAFA 4S2LA 2ZQCA 4DXCA 2LB9A 2W3EA 4D60A 1RGZA 1W8YA 4EERA 5L8MA 3ZYTA 3M6BA 4PPRA 2EA9A 5G4ZA 3LIBA 3ZDJA 5CHMA 1I5QA 2UWXA 4GW9A 1LSWA 1NLYA 3V50A 3V39A 2ZC7A 2ZQDA 1W5DA 3NOUC 2X02A 3S7NA 1DRMA 1H8MA 4KQDA 3WS0A 4NEED 3JYIA 4LLOB 3B33A 5TGFA 5HSQA 4L0LA 4GB7A 3S4XA 3BFGA 4EEUA 2WKRA 1XFQA 2XA7S 3JVVA 3T1QB 4EWFA 3ZHHA 3BQAA 1TS8A 3EOIA 5CHJA 1TS0A 5FQQA 5CECA 2PU4A 1YSQA 1H0MA 3ZQ5A 4KQRA 4LENA 4R70A 1GSVA 2P74A 1YT4A 1K38A 3NY4A 3UE1A 3MZDA 3WRZA 1IEMA 4KZ8A 3SH7A 1IOUA 1MWSA 3MSHA 4NXBA 1IKGA 5FQJA 2Y8HA 2HJ9C 1L2SA 1Y4OA 3LI8A 4HESA 2ZLYA 2LB5A 2QMIA 2VA0A 1I2SA 2EX8A 5JYOA 1I2WA 4L9GA 3C4OA 3IHBA 4EBNA 3EQVA 5TFQA 4N9KA 4O7DA 4B4XA 3VFFA 4WZ4A 3ZG0A 3E4PA 5FQ9A 4JXSA 1EI5A 5HDSA 1BLCA 2K31A 4HHDA 2VX8A 1IYSA 2A24B 2OSUA 4X1LA 4QU3A 3LI9A 2WGVA 3CPTB 5DF7A 2PU2A 3T1SA 1SDNA 4GOGA 1D06A 5KIZA 3HL9A 2WAEA 1F98A 1NRJA 3C8CA 3W8KA 2V8CA 4ID4A 1QMFA 3VSLA 1XXMA 5TBMB 4DN0A 3T4KA 3KSFA 3IQAA 5HWVA 4ZAMA 2OV5A 3GV9A 1GSWA 2JKFA 1TEMA 2J3WA 4B88A 1SKFA 3NDGA 1K56A 4PM9A 4EEPA 3ICYA 2PT7A 2ZQ8A 3LO7A 4KG5A 5DKLA 2WGWB 3LIFA 4MMNA 1GCEA 4D2OA 1FCOA 4JBFA 4YINA 5HAIA 5EVID 2B5RA 2G2WA 4JGPA 4DDSA 2Q0OA 3DW0A 4UQIM 3IXBA 3T4OA 5EE8A 1SHVA 3Q81A 3AGFA 3LFVA 1CF0A 4WEKA 1T18A 2EXBA 3W2ZA 2ZC5B 4DJ2A 4GD8A 1VM1A 4OOYA 2HZ5A 3VOZA 1BYWA 2IWCA 5EVIB 3T12B 2HDUA 1UWNX 3E4QA 1JTGA 4PKYA 3C38A 5HARA 3BW6A 4C3QA 3D3OA 2Y2KA 2PBDP 4C6YA 2W3FA 1IKIA 3IBRA 3IS2A 4I38A 4P6ZM 3F1OA 3DTKA 1ODVA 5FAPA 5EOOA 5FAOA 3WS5A 1ZC2A 1G6OA 1RGYA 4UEYA 3N8RA 5HX9A 4ARZA 4X69A 3F1PA 4R1GA 4MN5A 2HP5A 3RXWA 3FPVA 4EU0A 4S2NA 1TVFA 5HL1A 1K54A 4X56A 4LGWA 1CI9A 4K0WA 3LUQA 1XP4A 3EEAA 4Y7PA 1BSGA 1DJBA 1HVBA 4MLLA 5TJJA 1XGJA 5DF8A 4O01A 4L9FA 3E4OA 2J3TC 3DBAA 5EPHA 2O99A 2VGKA 3T4LA 3VMAA 3T4JA 4GJ4A 4XT2A 2IWDA 4N9LA 3W4QA 4GHIA 2ZL1A 3BYDA 4F3LA 3UPPA 3HUOA 3TOIA 1PWDA 5FEFA 4FCFA 4I39A 3OCNA 3Q07A 3S7OA 3BFCA 1M40A 1BT5A 4JGOA 4BD0A 1GHPA 4IHQA 4FD8A 2XD5A 4S2NC 3ZNYA 1H8ZA 3QNBA 1ZG6A 1K54C 1OPXA 4ME4A 3T1RA 3NDEA 2KDKA 2QKPA 4FH2A 3GTCA 1YLTA 3FKVA 3T50A 3DTMA 1S4RA 3PAGA 4UQIS 4E6WA 2I9VA 1P97A 1L0GA 1NLZA 1A0KA 1MWTA 1NWZA 1SDEA 2ZD8A 3FPWA 4IEDA 1PI4A 4OPRA 1JVJA 2J9PA 2K7SA 2L4RA 5JYPA 4K08A 4S2KA 4ZDXA 4K0XA 2Y4AA 3OPPA 4EXOA 4WMCD 1FCNA 1D1JA 2W3GA 2XR0A 3ZG8B 4PM7A 2WKIA 2ZQ7A 1LHYA 3OPRA 2VKSA 1U60A 1UWPX 4MBFA 1Y28A 2XH9A 1YPRA 3M2JA 3FV7A 2ZMAA 1NY0A 4P6ZS 1DP9A 4GS9B 1STZA 5EUAA 1W79A 5CERA 4HJ6A 5A91A 5FQKA 2XDMA 2W0NA 2GNXA 1ERQA 4NKPA 4WBGA 3SS5A 3U2AA 1XFNA 1O07A 3B42A 5HPIA 2XK1A 4RYEA 1LLBA 3H82A 3N8LA 3IX8A 4QY6A 1S4SA 2FZ0A 3OC2A 4KG2A 4HOIA 3P01A 3DTEA 1LSVA 1BZAA 1OT6A 2XGNA 3NC8A 4KZ6A 1ES3A 3VOYA 1H5XA 4Z1WA 4OQGA 4LCMA 2ZOHA 3Q82A 1YAXA 3PBOA 3LGOA 3F1NB 3NIAA 5U47A 2DCFA 3LR5A 1MKIA 4GCZA 4BBVA 3CHWP 3BY8A 3EGDC 3K3CA 1PI5A 4F94A 2EX9A 2VZWA 4OPZA 3CWFA 5EOEA 5E2EA 5L07A 4HY8A 2INWA 4JXGA 3MXSA 4AFIA 5KSHA 5DFYA 2Y2IA 2V0UA 1P0ZA 1NJ4A 1PWGA 5MC7A 2Y2QA 2NUTC 3LY4A 1WYCA 3V3RA 4DJ3A 3NHQA 4WM9A 2J9OA 5M18A 3RJUA 3MKEA 3IXDA 4IVKA 4GZBA 4X6TA 4LRXC 3VV4A 5E2GA 5KMWA 4GLQA 5FDSA 2G2UA 4N92A 1GHMA 3N8SA 2A2LA 5M1AA 2ZC4B 3O86A 5A93A 3B47A 2R9XA 2BLSA 3TSGA 3BFEA 3DAVA 4HEFA 1P9RA 3G34A 1PRQA 3C7UA 4LV0A 1YLYA 4Y15A 3M2KA 4HQAA 3SW1A 5G18A 5FASA 5CGSA 2QYBA 5F83A 1LI0A 3PBTA 2WKHA 4KZ9A 4S2PA 2WZZA 2WGWA 4CQHA 4P85A 5EM1A 2IA2A 3IH9A 3UE0A 3NJAA 2M7UA 2JE5A 1O7EA 4XXRA 2XD1A 5DJUA 2DNSA 4B9OA 1PW8A 4EUVA 1YSPA 4WF0A 1Z6FA 2W1TB 3VP4A 2O9AA 2EX2A 3MBZA 2XRNA 3UY6A 3MZEA 3CITA 3FWLA 1XA1A 2O0YA 4ETZA 3GSGA 1EROA 3G30A 4CPKA 4Y3IA 1MC0A 5L09A 4RX3A 5HPFA 2WK0A 3KYEA 2HV1A 1YLWA 3GVBA 2WYXA 4MN6A 3R7WB 3QP5A 2W1RA 4P87A 3HLCA 4H6JA 3EWKA 1KGGA 3KSHA 1XJ3A 5IT5A 3FC7A 2H5SA 4CLCD 5GL9A 4HP9A 3PBRA 3MQ0A 4UHUA 4JXWA 3NI9A 2PHYA 3QP8A 5HD3A 5J7EA 2GDNA 4BBTA 1KGFA 3KYZA 3OBFA 2P08A 4R23A 3A0SA 1CEGA 1PFLA 4U0XA 1DP6A 4DMZA 5A92A 1WE4A 4LV1A 1OTIA 1OTBA 3L9KA 4QB8A 1S1ZA 2KOIA 3QP4A 4DKIA 4CLCB 4BBUA 4NXEA 4Y5FA 5EFWA 2Y2JA 3UMEA 2HF6A 1KGEA 3RFBA 1HLUP 1ACFA 4OVDA 3IWIA 3ZGAB 2WZXA 5DJTA 1EW0A 4MCWA 1E3UA 1LL8A 3AGDA 4LPZA 1H3QA 2G7UA 1OTAA 2W27A 3HLGA 3LICA 4JF5A 3CI6A 4NG2A 1EWZA 4YFMA 2P9VB 3KSIA 2W3HA 4WN5A 2FFYA 2ZQ9A 3IHAA 3D4FA 5K5BA 1TDLA 2JHEA 5AQBA 4JKTA 3GDIA 3G35A 3LR4A 1MBLA 2GX5A 1F2KA 2QPNA
chains in the Genus database with same CATH topology
1K4EA 3O88A 3S22A 3G4PA 2Z2MB 2C6WB 3BYDA 3ITBA 4M3KA 3DWKA 3UPPA 3IWOA 4IBXA 5HAPA 1K6SA 3HUOA 5DTKA 1NZOA 3TOIA 1PWDA 4KQOA 3HLDA 4FCFA 3WWXA 1LL5A 4JF4A 3OCNA 1DJAA 1CK3A 2V20A 3Q07A 1L0FA 1JWZA 1IYQA 3BFCA 5E2FA 3N7WA 3Q7VA 1M40A 1BT5A 1FQGA 3O3VA 1GHPA 4BD0A 1IELA 1SCWA 2X01A 1KE0A 4FSFA 4FD8A 4OH0A 1ES5A 2XD5A 2ZM8A 5CGWA 1ONHA 3UPOA 4S2NC 3ZNYA 4UA6A 1ONGA 2Y59A 4X53A 4RA7A 1H8ZA 3FYZA 3QNBA 4BQMA 3Q1FA 5GLDA 1FSWA 1ZG6A 1K54C 4PM6A 2ZJ9A 1M6KA 4U3TA 5KZHA 3ITAA 1GA0A 3UPNA 3NDEA 1KVMA 3GR2A 1K55C 1PZPA 3CZDA 2E8IA 4WELA 2R9WA 4DRTA 2OLUA 5CTMA 4IBRA 1MPLA 3GTCA 4FH2A 4S2MA 1YLTA 3FKVA 4U0TA 3LY3A 5BOHA 3VFHA 3DTMA 3VP0A 3PAGA 4E6WA 1W8QA 3SOIA 1L0GA 1Q2QA 2VGJA 2Y2HA 1MWTA 3HBRA 2DRWA 4GD6A 3ZFZA 5CRFA 1SDEA 2ZD8A 1XKZA 4IEDA 2IWBA 1PI4A 3HLEA 1JVJA 4OPRA 3HUMA 1VQQA 2J9PA 4E3OA 4NETA 5D3OA 4XUZA 5FSRA 2P9VA 5JYPA 5E2HA 2ZM0A 4JPMA 4OKPA 4S2KA 5FI7A 1C3BA 4ZDXA 4BJPA 5EVIC 4Y0TA 2X71A 4K0XA 2Y4AA 3OPPA 3UDIA 1WYBA 2V1ZA 3Q7VB 3HLFA 4WMCD 1FCNA 2H10A 3A3FA 2XR0A 5AQ9A 3ZG8B 4PM7A 3M6HA 1BUEA 3BLMA 5DTTA 5FQMA 1IYOA 3OPHA 4KZ3A 3E2LA 1BTLA 5CHUA 3N6IA 5EECA 2WKIA 3V3SA 4E3JA 2ZQ7A 1LHYA 2WUQA 2JC7A 3BM6A 3OPRA 1ES4A 1S0WA 5E43A 4EBPA 1U60A 1FCMA 4S2OA 3E2KA 4MBFA 2XH9A 4LCLA 3M2JA 1J9MA 5CEDA 4Y0OA 2PBYA 3FV7A 3MZFA 4BLMA 2ZMAA 3HVFA 3HUNA 4JXVA 3VP1A 1NY0A 3BRMA 1QMEA 3O87A 4OP5A 3OZHA 4OONA 3WRTA 4KZAA 2Q9NA 1L0DA 2I72A 4OLDA 1G68A 4OOMA 5EUAA 1FR6A 2Y2OA 4KENB 4E6XA 2A49A 2WADA 1W79A 4KZ7A 1ES2A 1NRFA 5CERA 2XLNA 4Q8IA 3GMWA 3UDFA 4QJGA 5A91A 5FQKA 4BL2A 2XDMA 3UO9A 1LL9A 3P98A 1RCJA 3C5AA 2HP6A 1ERQA 4WBGA 3IF6B 4P0MA 1BULA 3SS5A 4QD4A 2WAFA 4S2LA 1O07A 2ZQCA 4DXCA 2XK1A 3ZCZA 4OPQA 4UA9A 5FDHA 4PMAA 2Y91A 4XUXA 5FI6A 5GHXA 4OP8A 4RYEA 1RGZA 1LLBA 1W8YA 1JTDA 3N8LA 3ZVWA 1K25A 3M6BA 4PPRA 4LV3A 4QY6A 2Y2LA 3OC2A 4KG2A 3ZDJA 1FOFA 5M19A 1ALQA 1YLZA 1ZKJA 4CJNA 1BZAA 5CHMA 3W4PA 1E4DA 2XGNA 4KZ6A 3NC8A 4BD1A 1ES3A 3VOYA 1I5QA 2UWXA 5J8XA 3HLWA 2V2FF 5GHYA 4ZJ3A 1H5XA 1KE4A 3V50A 2ZC7A 3V39A 4WYYA 2HDRA 2ZQDA 4GN2A 3SH8A 4OQGA 4LCMA 4DE0A 4H8RA 1W5DA 3Q82A 4RX2A 3ZVTA 2X02A 3ZG5A 3PBOA 3WS0A 1NZUA 4RVAA 2H0TA 1ERMA 1Y54A 3JYIA 5TGFA 2QZ6A 3NIAA 5U47A 4L0LA 2XFSA 4GB7A 3S4XA 1K56D 2DCFA 3BFGA 1TDGA 1MKIA 4R4RA 5DVAA 5HAQA 1BLHA 1PI5A 3SH9A 4F94A 1CEFA 2EX9A 5EOEA 4OPZA 1XX2A 1HD8A 3CJMA 4OQIA 3A3EA 5E2EA 4EWFA 4K91A 3ZHHA 4E3MA 3MXRA 4JXGA 5CHJA 5FQQA 3MXSA 5CECA 2PU4A 5KSHA 1DJCA 1E25A 2Y2IA 2ZM2A 5CEBA 1BLPA 1NJ4A 3IT9A 3G31A 1PWGA 4KQRA 4LENA 2Y2QA 2OLVA 5FQIA 2P74A 4OQ0A 3LY4A 1WYCA 3PTEA 4MNRA 3V3RA 4IVIA 5F82A 4WM9A 2J9OA 1YT4A 3P09A 5M18A 1K38A 3NY4A 3UE1A 3MZDA 3RJUA 3MKEA 1IEMA 4ZTKA 1L0EA 4KZ5A 3WRZA 3IXDA 4KZ8A 3SH7A 4IVKA 4GZBA 2ZC6B 4X6TA 1MWSA 4WMCA 5E2GA 5KMWA 3IF6A 2BG1A 1IKGA 3NCKA 4KZBA 4DDYA 3WS1A 5FQJA 4OQHA 3ISGA 2EXAA 2G2UA 3BECA 1L2SA 4N92A 4HESA 1GHMA 3N8SA 5M1AA 1FR1A 1XPBA 2ZLYA 3VP2A 2ZC4B 3O86A 3I7JA 2QMIA 2Y2GA 1I2SA 2EX8A 1YLPA 4KG6A 2EX6A 5JYOA 1I2WA 5A93A 4HBTA 4EBNA 3C4OA 3IHBA 4X68A 2R9XA 2BLSA 3EQVA 2Y2NA 1IYPA 3CG5A 3OPLA 5TFQA 3TSGA 3BFEA 4HEFA 4N9KA 4WEJA 3RXXA 4O7DA 3V5MA 4B4XA 3VFFA 2ZQAA 4WZ4A 5CTNA 1YMXA 3G34A 3ZG0A 4NK3A 4E3IA 3C7UA 5FQ9A 4JXSA 4LV0A 5KSCA 1EI5A 2XFTA 1YLYA 1BLCA 4EBLA 5FI2A 1IYSA 1HTZA 2OSUA 3M2KA 4LV2A 4PM8A 3B3XA 1JWVA 4DE1A 4QU3A 3GQZA 3IWQA 5G18A 5FASA 2WGVA 5CGSA 5F83A 4DE2A 1LI0A 4A5RA 3PBTA 2WKHA 5DF7A 2PU2A 4KZ9A 4S2PA 4B4ZA 4BL3A 1SDNA 3UNWA 2WZZA 2JCHA 3IH8A 4GOGA 2WGWA 4OPYA 4S2JA 4DF6A 4P85A 4WZ5A 2WGIA 3ZG7B 2RL3A 3A3JA 3HL9A 4S2IA 1HZOA 2WAEA 4E3LA 2JBFA 1ESUA 3IH9A 1GA9A 3HREA 3NBLA 3UE0A 5FATA 4E3KA 2JE5A 1O7EA 3W8KA 4XXRA 2XQZA 2XD1A 4EUZA 2J7VA 2DNSA 2RCXA 1PW8A 2Y2MA 1E3UD 5FA7A 3OCLA 4ID4A 2Y2PA 1QMFA 5TR7A 3VSLA 3IF6C 1Z6FA 1XXMA 2WKEA 3VP4A 1OMEA 2Y55A 3ZNTA 4ZJ1A 2H0YA 4KZ4A 2EX2A 5CXWA 3IQAA 3G2ZA 4ZAMA 3MBZA 3UY6A 3MZEA 2OV5A 3FWLA 3GV9A 1W7FA 3LCEA 1XA1A 3A3DA 4R4SA 3GSGA 4R3JA 1EROA 1PYYA 1TEMA 3G30A 4CPKA 4B88A 1SKFA 3NDGA 3WS4A 4Y0UA 4N1HA 4JF6A 5GLAA 1K56A 4PM9A 4RX3A 3BLSA 2WK0A 3S1YA 2ZQ8A 3LO7A 1FSYA 4KQQA 1KE3A 4KG5A 3AGEA 2WGWB 1N9BA 5A90A 4PM5A 1GCEA 1YLWA 3GVBA 1FCOA 2WYXA 4JBFA 5CGXA 4YINA 3WS2A 1RP5A 4D2OA 5HAIA 4HBUA 1YMSA 5EVID 1MWUA 3LEZA 2XEPA 4P87A 4R3BA 3HLCA 4ZJ2A 2B5RA 2G2WA 5AQ7A 1KGGA 4GKUA 1PW1A 4DDSA 3DW0A 4OLGA 3QHYA 2FFFB 4WZ5C 1ZG4A 1NYMA 3C7VA 2H5SA 3BFFA 3IXBA 5GL9A 4QY5A 1YM1A 5EE8A 3PBRA 3SS3A 3VSKA 2Z2LB 3N4IA 4UHUA 4JXWA 1S6RA 3PBSA 3NI9A 1SHVA 3Q81A 3AGFA 3IF5A 2GDNA 1G6AA 4WEKA 3A3IA 3BFDA 2EXBA 1KGFA 1PIOA 1K4FA 4EQIA 1Q2PA 2ZC5B 3HLBA 5F1FA 4GD8A 3Q7ZA 4R23A 3TG9A 1LI9A 4BENA 1VM1A 1XA7A 1K57A 3PBQA 4OOYA 4EV4A 1CEGA 1YQSA 1JWPA 4U0XA 5F1GA 4N1XA 5A92A 4UAAA 3VOZA 1MY8A 1WE4A 4LV1A 4GNUA 2IWCA 5DF9A 5EVIB 2HDUA 3EQUA 1PZOA 4QB8A 1JTGA 3CMZA 4FH4A 3PBNA 5DTSA 2A3UA 3G2YA 5HARA 4C3QA 4DKIA 1KVLA 3C4PA 2Y2KA 1XGIA 3MFDA 5L2FA 2J8YA 3UN7A 2Y2JA 4C6YA 2C5WB 4MBHA 1IKIA 1KDSA 3MKFA 1MWRA 1KGEA 5AQAA 2HPBA 2CC1A 1MXOA 4QHCA 5FAPA 5EOOA 4R0QA 4Z9QA 5FAOA 3W4OA 3WS5A 1ZC2A 3FZCA 1RGYA 3N8RA 2HDSA 4P6BA 5HX9A 4OVDA 3IWIA 4DXBA 5I94A 3ZGAB 4X69A 1BLSA 2WZXA 4R1GA 1AXBA 2HP5A 2EFUA 4UA7A 3RXWA 1E3UA 3AGDA 3UE3A 4S2NA 4OOLA 4E3NA 1TVFA 1DY6A 5HL1A 1YLJA 4MBKA 3UDXA 1K54A 4X56A 2EFXA 1CI9A 2HDQA 4K0WA 1CI8A 4C75A 4GDNA 3HLGA 4GDBA 5GHZA 1XP4A 4MEZA 4Y7PA 1BSGA 4JF5A 1K55A 3IXHA 3ZG9B 1EWZA 1HVBA 1DJBA 1K57C 2HP9A 3IXGA 1XGJA 4MLLA 4YFMA 5FAQA 5HW3A 1GHIA 2P9VB 3BEBA 3FKWA 5DF8A 3QNCA 2ZC3B 1NYYA 1K6RA 3PAEA 3GRJA 1KDWA 2FFYA 2ZQ9A 3IHAA 5EPHA 5EVLA 1H8YA 3SS4A 2XF3A 3D4FA 2Q9MA 1TDLA 5HFOA 2VGKA 3VMAA 5IHVA 1ESIA 4X55A 5AQBA 4JKTA 1PWCA 4ZBEA 3G35A 2IWDA 5GLCA 1N4OA 1MBLA 4N9LA 3W4QA 3G32A 3DWZA 5EVIA 5GLBA 4JLFA 3VP3A 2QPNA 1NXYA 4DE3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K4E A;  3O88 A;  3S22 A;  3G4P A;  2Z2M B;  2C6W B;  3BYD A;  3ITB A;  4M3K A;  3DWK A;  3UPP A;  3IWO A;  4IBX A;  5HAP A;  1K6S A;  3HUO A;  5DTK A;  1NZO A;  3TOI A;  1PWD A;  4KQO A;  3HLD A;  4FCF A;  3WWX A;  1LL5 A;  4JF4 A;  3OCN A;  1DJA A;  1CK3 A;  2V20 A;  3Q07 A;  1L0F A;  1JWZ A;  1IYQ A;  3BFC A;  5E2F A;  3N7W A;  3Q7V A;  1M40 A;  1BT5 A;  1FQG A;  3O3V A;  1GHP A;  4BD0 A;  1IEL A;  1SCW A;  2X01 A;  1KE0 A;  4FSF A;  4FD8 A;  4OH0 A;  1ES5 A;  2XD5 A;  2ZM8 A;  5CGW A;  1ONH A;  3UPO A;  4S2N C;  3ZNY A;  4UA6 A;  1ONG A;  2Y59 A;  4X53 A;  4RA7 A;  1H8Z A;  3FYZ A;  3QNB A;  4BQM A;  3Q1F A;  5GLD A;  1FSW A;  1ZG6 A;  1K54 C;  4PM6 A;  2ZJ9 A;  1M6K A;  4U3T A;  5KZH A;  3ITA A;  1GA0 A;  3UPN A;  3NDE A;  1KVM A;  3GR2 A;  1K55 C;  1PZP A;  3CZD A;  2E8I A;  4WEL A;  2R9W A;  4DRT A;  2OLU A;  5CTM A;  4IBR A;  1MPL A;  3GTC A;  4FH2 A;  4S2M A;  1YLT A;  3FKV A;  4U0T A;  3LY3 A;  5BOH A;  3VFH A;  3DTM A;  3VP0 A;  3PAG A;  4E6W A;  1W8Q A;  3SOI A;  1L0G A;  1Q2Q A;  2VGJ A;  2Y2H A;  1MWT A;  3HBR A;  2DRW A;  4GD6 A;  3ZFZ A;  5CRF A;  1SDE A;  2ZD8 A;  1XKZ A;  4IED A;  2IWB A;  1PI4 A;  3HLE A;  1JVJ A;  4OPR A;  3HUM A;  1VQQ A;  2J9P A;  4E3O A;  4NET A;  5D3O A;  4XUZ A;  5FSR A;  2P9V A;  5JYP A;  5E2H A;  2ZM0 A;  4JPM A;  4OKP A;  4S2K A;  5FI7 A;  1C3B A;  4ZDX A;  4BJP A;  5EVI C;  4Y0T A;  2X71 A;  4K0X A;  2Y4A A;  3OPP A;  3UDI A;  1WYB A;  2V1Z A;  3Q7V B;  3HLF A;  4WMC D;  1FCN A;  2H10 A;  3A3F A;  2XR0 A;  5AQ9 A;  3ZG8 B;  4PM7 A;  3M6H A;  1BUE A;  3BLM A;  5DTT A;  5FQM A;  1IYO A;  3OPH A;  4KZ3 A;  3E2L A;  1BTL A;  5CHU A;  3N6I A;  5EEC A;  2WKI A;  3V3S A;  4E3J A;  2ZQ7 A;  1LHY A;  2WUQ A;  2JC7 A;  3BM6 A;  3OPR A;  1ES4 A;  1S0W A;  5E43 A;  4EBP A;  1U60 A;  1FCM A;  4S2O A;  3E2K A;  4MBF A;  2XH9 A;  4LCL A;  3M2J A;  1J9M A;  5CED A;  4Y0O A;  2PBY A;  3FV7 A;  3MZF A;  4BLM A;  2ZMA A;  3HVF A;  3HUN A;  4JXV A;  3VP1 A;  1NY0 A;  3BRM A;  1QME A;  3O87 A;  4OP5 A;  3OZH A;  4OON A;  3WRT A;  4KZA A;  2Q9N A;  1L0D A;  2I72 A;  4OLD A;  1G68 A;  4OOM A;  5EUA A;  1FR6 A;  2Y2O A;  4KEN B;  4E6X A;  2A49 A;  2WAD A;  1W79 A;  4KZ7 A;  1ES2 A;  1NRF A;  5CER A;  2XLN A;  4Q8I A;  3GMW A;  3UDF A;  4QJG A;  5A91 A;  5FQK A;  4BL2 A;  2XDM A;  3UO9 A;  1LL9 A;  3P98 A;  1RCJ A;  3C5A A;  2HP6 A;  1ERQ A;  4WBG A;  3IF6 B;  4P0M A;  1BUL A;  3SS5 A;  4QD4 A;  2WAF A;  4S2L A;  1O07 A;  2ZQC A;  4DXC A;  2XK1 A;  3ZCZ A;  4OPQ A;  4UA9 A;  5FDH A;  4PMA A;  2Y91 A;  4XUX A;  5FI6 A;  5GHX A;  4OP8 A;  4RYE A;  1RGZ A;  1LLB A;  1W8Y A;  1JTD A;  3N8L A;  3ZVW A;  1K25 A;  3M6B A;  4PPR A;  4LV3 A;  4QY6 A;  2Y2L A;  3OC2 A;  4KG2 A;  3ZDJ A;  1FOF A;  5M19 A;  1ALQ A;  1YLZ A;  1ZKJ A;  4CJN A;  1BZA A;  5CHM A;  3W4P A;  1E4D A;  2XGN A;  4KZ6 A;  3NC8 A;  4BD1 A;  1ES3 A;  3VOY A;  1I5Q A;  2UWX A;  5J8X A;  3HLW A;  2V2F F;  5GHY A;  4ZJ3 A;  1H5X A;  1KE4 A;  3V50 A;  2ZC7 A;  3V39 A;  4WYY A;  2HDR A;  2ZQD A;  4GN2 A;  3SH8 A;  4OQG A;  4LCM A;  4DE0 A;  4H8R A;  1W5D A;  3Q82 A;  4RX2 A;  3ZVT A;  2X02 A;  3ZG5 A;  3PBO A;  3WS0 A;  1NZU A;  4RVA A;  2H0T A;  1ERM A;  1Y54 A;  3JYI A;  5TGF A;  2QZ6 A;  3NIA A;  5U47 A;  4L0L A;  2XFS A;  4GB7 A;  3S4X A;  1K56 D;  2DCF A;  3BFG A;  1TDG A;  1MKI A;  4R4R A;  5DVA A;  5HAQ A;  1BLH A;  1PI5 A;  3SH9 A;  4F94 A;  1CEF A;  2EX9 A;  5EOE A;  4OPZ A;  1XX2 A;  1HD8 A;  3CJM A;  4OQI A;  3A3E A;  5E2E A;  4EWF A;  4K91 A;  3ZHH A;  4E3M A;  3MXR A;  4JXG A;  5CHJ A;  5FQQ A;  3MXS A;  5CEC A;  2PU4 A;  5KSH A;  1DJC A;  1E25 A;  2Y2I A;  2ZM2 A;  5CEB A;  1BLP A;  1NJ4 A;  3IT9 A;  3G31 A;  1PWG A;  4KQR A;  4LEN A;  2Y2Q A;  2OLV A;  5FQI A;  2P74 A;  4OQ0 A;  3LY4 A;  1WYC A;  3PTE A;  4MNR A;  3V3R A;  4IVI A;  5F82 A;  4WM9 A;  2J9O A;  1YT4 A;  3P09 A;  5M18 A;  1K38 A;  3NY4 A;  3UE1 A;  3MZD A;  3RJU A;  3MKE A;  1IEM A;  4ZTK A;  1L0E A;  4KZ5 A;  3WRZ A;  3IXD A;  4KZ8 A;  3SH7 A;  4IVK A;  4GZB A;  2ZC6 B;  4X6T A;  1MWS A;  4WMC A;  5E2G A;  5KMW A;  3IF6 A;  2BG1 A;  1IKG A;  3NCK A;  4KZB A;  4DDY A;  3WS1 A;  5FQJ A;  4OQH A;  3ISG A;  2EXA A;  2G2U A;  3BEC A;  1L2S A;  4N92 A;  4HES A;  1GHM A;  3N8S A;  5M1A A;  1FR1 A;  1XPB A;  2ZLY A;  3VP2 A;  2ZC4 B;  3O86 A;  3I7J A;  2QMI A;  2Y2G A;  1I2S A;  2EX8 A;  1YLP A;  4KG6 A;  2EX6 A;  5JYO A;  1I2W A;  5A93 A;  4HBT A;  4EBN A;  3C4O A;  3IHB A;  4X68 A;  2R9X A;  2BLS A;  3EQV A;  2Y2N A;  1IYP A;  3CG5 A;  3OPL A;  5TFQ A;  3TSG A;  3BFE A;  4HEF A;  4N9K A;  4WEJ A;  3RXX A;  4O7D A;  3V5M A;  4B4X A;  3VFF A;  2ZQA A;  4WZ4 A;  5CTN A;  1YMX A;  3G34 A;  3ZG0 A;  4NK3 A;  4E3I A;  3C7U A;  5FQ9 A;  4JXS A;  4LV0 A;  5KSC A;  1EI5 A;  2XFT A;  1YLY A;  1BLC A;  4EBL A;  5FI2 A;  1IYS A;  1HTZ A;  2OSU A;  3M2K A;  4LV2 A;  4PM8 A;  3B3X A;  1JWV A;  4DE1 A;  4QU3 A;  3GQZ A;  3IWQ A;  5G18 A;  5FAS A;  2WGV A;  5CGS A;  5F83 A;  4DE2 A;  1LI0 A;  4A5R A;  3PBT A;  2WKH A;  5DF7 A;  2PU2 A;  4KZ9 A;  4S2P A;  4B4Z A;  4BL3 A;  1SDN A;  3UNW A;  2WZZ A;  2JCH A;  3IH8 A;  4GOG A;  2WGW A;  4OPY A;  4S2J A;  4DF6 A;  4P85 A;  4WZ5 A;  2WGI A;  3ZG7 B;  2RL3 A;  3A3J A;  3HL9 A;  4S2I A;  1HZO A;  2WAE A;  4E3L A;  2JBF A;  1ESU A;  3IH9 A;  1GA9 A;  3HRE A;  3NBL A;  3UE0 A;  5FAT A;  4E3K A;  2JE5 A;  1O7E A;  3W8K A;  4XXR A;  2XQZ A;  2XD1 A;  4EUZ A;  2J7V A;  2DNS A;  2RCX A;  1PW8 A;  2Y2M A;  1E3U D;  5FA7 A;  3OCL A;  4ID4 A;  2Y2P A;  1QMF A;  5TR7 A;  3VSL A;  3IF6 C;  1Z6F A;  1XXM A;  2WKE A;  3VP4 A;  1OME A;  2Y55 A;  3ZNT A;  4ZJ1 A;  2H0Y A;  4KZ4 A;  2EX2 A;  5CXW A;  3IQA A;  3G2Z A;  4ZAM A;  3MBZ A;  3UY6 A;  3MZE A;  2OV5 A;  3FWL A;  3GV9 A;  1W7F A;  3LCE A;  1XA1 A;  3A3D A;  4R4S A;  3GSG A;  4R3J A;  1ERO A;  1PYY A;  1TEM A;  3G30 A;  4CPK A;  4B88 A;  1SKF A;  3NDG A;  3WS4 A;  4Y0U A;  4N1H A;  4JF6 A;  5GLA A;  1K56 A;  4PM9 A;  4RX3 A;  3BLS A;  2WK0 A;  3S1Y A;  2ZQ8 A;  3LO7 A;  1FSY A;  4KQQ A;  1KE3 A;  4KG5 A;  3AGE A;  2WGW B;  1N9B A;  5A90 A;  4PM5 A;  1GCE A;  1YLW A;  3GVB A;  1FCO A;  2WYX A;  4JBF A;  5CGX A;  4YIN A;  3WS2 A;  1RP5 A;  4D2O A;  5HAI A;  4HBU A;  1YMS A;  5EVI D;  1MWU A;  3LEZ A;  2XEP A;  4P87 A;  4R3B A;  3HLC A;  4ZJ2 A;  2B5R A;  2G2W A;  5AQ7 A;  1KGG A;  4GKU A;  1PW1 A;  4DDS A;  3DW0 A;  4OLG A;  3QHY A;  2FFF B;  4WZ5 C;  1ZG4 A;  1NYM A;  3C7V A;  2H5S A;  3BFF A;  3IXB A;  5GL9 A;  4QY5 A;  1YM1 A;  5EE8 A;  3PBR A;  3SS3 A;  3VSK A;  2Z2L B;  3N4I A;  4UHU A;  4JXW A;  1S6R A;  3PBS A;  3NI9 A;  1SHV A;  3Q81 A;  3AGF A;  3IF5 A;  2GDN A;  1G6A A;  4WEK A;  3A3I A;  3BFD A;  2EXB A;  1KGF A;  1PIO A;  1K4F A;  4EQI A;  1Q2P A;  2ZC5 B;  3HLB A;  5F1F A;  4GD8 A;  3Q7Z A;  4R23 A;  3TG9 A;  1LI9 A;  4BEN A;  1VM1 A;  1XA7 A;  1K57 A;  3PBQ A;  4OOY A;  4EV4 A;  1CEG A;  1YQS A;  1JWP A;  4U0X A;  5F1G A;  4N1X A;  5A92 A;  4UAA A;  3VOZ A;  1MY8 A;  1WE4 A;  4LV1 A;  4GNU A;  2IWC A;  5DF9 A;  5EVI B;  2HDU A;  3EQU A;  1PZO A;  4QB8 A;  1JTG A;  3CMZ A;  4FH4 A;  3PBN A;  5DTS A;  2A3U A;  3G2Y A;  5HAR A;  4C3Q A;  4DKI A;  1KVL A;  3C4P A;  2Y2K A;  1XGI A;  3MFD A;  5L2F A;  2J8Y A;  3UN7 A;  2Y2J A;  4C6Y A;  2C5W B;  4MBH A;  1IKI A;  1KDS A;  3MKF A;  1MWR A;  1KGE A;  5AQA A;  2HPB A;  2CC1 A;  1MXO A;  4QHC A;  5FAP A;  5EOO A;  4R0Q A;  4Z9Q A;  5FAO A;  3W4O A;  3WS5 A;  1ZC2 A;  3FZC A;  1RGY A;  3N8R A;  2HDS A;  4P6B A;  5HX9 A;  4OVD A;  3IWI A;  4DXB A;  5I94 A;  3ZGA B;  4X69 A;  1BLS A;  2WZX A;  4R1G A;  1AXB A;  2HP5 A;  2EFU A;  4UA7 A;  3RXW A;  1E3U A;  3AGD A;  3UE3 A;  4S2N A;  4OOL A;  4E3N A;  1TVF A;  1DY6 A;  5HL1 A;  1YLJ A;  4MBK A;  3UDX A;  1K54 A;  4X56 A;  2EFX A;  1CI9 A;  2HDQ A;  4K0W A;  1CI8 A;  4C75 A;  4GDN A;  3HLG A;  4GDB A;  5GHZ A;  1XP4 A;  4MEZ A;  4Y7P A;  1BSG A;  4JF5 A;  1K55 A;  3IXH A;  3ZG9 B;  1EWZ A;  1HVB A;  1DJB A;  1K57 C;  2HP9 A;  3IXG A;  1XGJ A;  4MLL A;  4YFM A;  5FAQ A;  5HW3 A;  1GHI A;  2P9V B;  3BEB A;  3FKW A;  5DF8 A;  3QNC A;  2ZC3 B;  1NYY A;  1K6R A;  3PAE A;  3GRJ A;  1KDW A;  2FFY A;  2ZQ9 A;  3IHA A;  5EPH A;  5EVL A;  1H8Y A;  3SS4 A;  2XF3 A;  3D4F A;  2Q9M A;  1TDL A;  5HFO A;  2VGK A;  3VMA A;  5IHV A;  1ESI A;  4X55 A;  5AQB A;  4JKT A;  1PWC A;  4ZBE A;  3G35 A;  2IWD A;  5GLC A;  1N4O A;  1MBL A;  4N9L A;  3W4Q A;  3G32 A;  3DWZ A;  5EVI A;  5GLB A;  4JLF A;  3VP3 A;  2QPN A;  1NXY A;  4DE3 A; 
#chains in the Genus database with same CATH topology
 1K4E A;  1LT0 A;  5F6A A;  3NEC A;  2L0W A;  4ETX A;  1CQA A;  4KQO A;  3HLD A;  5FL3 A;  1DJA A;  4WUJ A;  2V20 A;  1L0F A;  1IYQ A;  2VV8 A;  3N7W A;  2X01 A;  3UPO A;  1ES5 A;  4UA6 A;  1ONG A;  3FYZ A;  4PHT A;  3Q1F A;  1SZV A;  3H7W B;  3MS6 A;  5KZH A;  2OAP 1;  4JGQ A;  3UPN A;  3GR2 A;  1PZP A;  2E8I A;  2R9W A;  5CTM A;  4HH3 A;  4IBR A;  5DKK A;  5BOH A;  4QWO A;  4U0T A;  3VFH A;  5J4E A;  1Q2Q A;  2VGJ A;  2Y2H A;  5J3W A;  3LEQ A;  3IX4 A;  4KUK A;  3ZFZ A;  1XKZ A;  3HUM A;  5FSR A;  1G5U A;  4I5S A;  2ACG A;  3S7Q A;  3UDI A;  2H10 A;  4R38 A;  5AQ9 A;  3K2N A;  4HH2 A;  1IYO A;  3OPH A;  3KX0 X;  1BTL A;  2PD7 A;  2V9A A;  3V3S A;  5E43 A;  3BM6 A;  2WUQ A;  4EBP A;  1ES4 A;  4S2O A;  2VEA A;  5CED A;  4G3V A;  4BLM A;  3GEC A;  3HVF A;  2V1A A;  3BRM A;  4OP5 A;  4OON A;  2JKG A;  3UB7 A;  2VV6 A;  1VEU A;  1L0D A;  4OLD A;  1NRF A;  5F5Y A;  3GMW A;  4QJG A;  4BL2 A;  2OWH A;  5F69 A;  2KLI A;  3FG8 A;  1BUL A;  3O5Y A;  2HJE A;  5AVE A;  4OPQ A;  3OLO A;  2Y91 A;  4XUX A;  5FI6 A;  5GHX A;  4OP8 A;  4O8G A;  3ZVW A;  5HDC A;  1F9I A;  4HNB A;  4LV3 A;  5M19 A;  1ALQ A;  1YLZ A;  4RQ9 A;  4FOF A;  4BD1 A;  3HLW A;  5GHY A;  4ZJ3 A;  1KE4 A;  1YKD A;  4WYY A;  2HDR A;  4GN2 A;  4DE0 A;  2JKT I;  3HJK A;  4H8R A;  4RX2 A;  1SKO A;  1LSX A;  1NZU A;  2H0T A;  1ERM A;  1Y54 A;  2UV0 E;  1MZU A;  3KYQ A;  1K56 D;  1TDG A;  5DVA A;  4R4R A;  5EVE A;  1S66 L;  1BLH A;  4R6L A;  2B18 A;  2VK3 A;  2H28 A;  4I3A A;  1XX2 A;  3CJM A;  4OQI A;  3A3E A;  3DTI A;  3MXR A;  2NUP C;  3MFX A;  1DJC A;  5CEB A;  2ZM2 A;  1BLP A;  3T4Q A;  3IT9 A;  3BQ8 A;  5G4Y A;  1VET B;  2OLV A;  5FQI A;  4MNR A;  1S1Y A;  4IVI A;  4HP4 A;  4ZTK A;  1L0E A;  4KZ5 A;  3IF6 A;  2BG1 A;  4KZB A;  4DDY A;  3WS1 A;  4I3I A;  4OQH A;  3ISG A;  3EGX C;  2ZOI A;  2WKP A;  3I7J A;  2QWS A;  4KG6 A;  2EX6 A;  3G6O A;  2Y2N A;  1IYP A;  4WEJ A;  5HD5 A;  4HJ3 A;  2J3T D;  5CTN A;  1YMX A;  5DFX A;  2L1M A;  3CUE A;  2XFT A;  4EBL A;  5FI2 A;  1HTZ A;  2AVX A;  3TE8 A;  4LV2 A;  4PM8 A;  1L3L A;  3QP6 A;  3GQZ A;  3IWQ A;  3VOL A;  4A5R A;  4MN7 A;  1CJF A;  4BL3 A;  3UNW A;  2JCH A;  3IH8 A;  4S2J A;  4DF6 A;  4OPY A;  5F68 A;  4WZ5 A;  3ZG7 B;  4S2I A;  1HZO A;  4E3L A;  3R7W A;  2JBF A;  1GA9 A;  4E3K A;  4NXF A;  5IU1 A;  5FA7 A;  3OCL A;  2Y2P A;  2V1B A;  3IF6 C;  4YWZ A;  3JVU A;  2H0Y A;  4YNR A;  4L9E A;  3CLO A;  1WA9 A;  3IS2 B;  1OTE A;  4Y17 A;  3CAX A;  3F1O B;  4PKY G;  4R4S A;  1AWI A;  1PYY A;  1OTD A;  4LRZ E;  4JF6 A;  2PYP A;  3BLS A;  3S1Y A;  4KQQ A;  1FSY A;  4ARZ B;  4Y13 A;  3AGE A;  2BTF P;  3F1P B;  1N9B A;  5A90 A;  2J80 A;  4NXG A;  3WS2 A;  5CGX A;  1RP5 A;  4EES A;  2FH5 A;  1YMS A;  3LEZ A;  2XEP A;  4ZJ2 A;  4R3B A;  5AQ7 A;  1PW1 A;  1JNU A;  1VHM A;  1X0O A;  4OLG A;  2FFF B;  5C5K A;  4WZ5 C;  1NYM A;  3BFF A;  2A24 A;  4QY5 A;  1YM1 A;  2PDR A;  1FIK A;  3SS3 A;  3N4I A;  1S6R A;  3PBS A;  3CPT A;  3D72 A;  3E0Y A;  1K4F A;  3T4S A;  1Q2P A;  5F1F A;  1OJG A;  4HI4 A;  3TG9 A;  2V8F A;  4BEN A;  1XA7 A;  1K57 A;  1V9Z A;  1YQS A;  4N1X A;  4UAA A;  1MY8 A;  4YOF A;  4GHI B;  1OT9 A;  2ZL1 B;  3MMH A;  4FH4 A;  5DTS A;  4F3L B;  2A3U A;  5TBM A;  1KVL A;  3C4P A;  1XGI A;  5L2F A;  3C2W A;  3UN7 A;  2C5W B;  3H9W A;  2CC1 A;  3UE6 A;  4Y2F A;  2HDS A;  4DXB A;  1BLS A;  3T1X A;  2EFU A;  3RH8 B;  4E3N A;  1DY6 A;  1YLJ A;  3UDX A;  2MJ6 A;  2EFX A;  1CI8 A;  3QP2 A;  4GDN A;  4GDB A;  5GHZ A;  2JN7 A;  1K55 A;  3IXH A;  3ZG9 B;  1K57 C;  5FAQ A;  5HW3 A;  2HP9 A;  3IBJ A;  3KO6 A;  1K6R A;  2Q9M A;  2B02 A;  3TRC A;  5HFO A;  5IHV A;  4PAU A;  1PWC A;  1ZTU A;  1S67 L;  3NOP C;  2PYR A;  5L10 A;  3DWZ A;  5EVI A;  4K91 A;  3VP3 A;  4BJP A;  1NXY A;  4DE3 A;  3O88 A;  3S22 A;  3G4P A;  3ITB A;  2C6W B;  3DWK A;  2R78 A;  3IWO A;  4IBX A;  4JF4 A;  1CK3 A;  1JWZ A;  5E2F A;  5HZH A;  1PNE A;  1FQG A;  2JKR M;  1SCW A;  4FSF A;  4OH0 A;  2ZM8 A;  4IJG A;  2Y59 A;  4PM6 A;  2ZJ9 A;  4U3T A;  3OOV A;  1KVM A;  1K55 C;  3CZD A;  4DRT A;  1MPL A;  4S2M A;  1V9Y A;  3H82 B;  3VP0 A;  4BMW A;  3K3D A;  3HBR A;  1G28 A;  5CRF A;  2ZMF A;  3HLE A;  3JPU A;  2PRF A;  4E3O A;  4XUZ A;  3HJI A;  4II7 A;  3PYP A;  5EV0 A;  2ZM0 A;  4JPM A;  4OKP A;  5FI7 A;  2XRO A;  5EVI C;  1XJ6 A;  4Y0T A;  2X71 A;  3UB9 A;  1WYB A;  3UB6 A;  1DP8 A;  2BAS A;  2V1Z A;  3Q7V B;  1W63 M;  3A3F A;  1UGU A;  3M6H A;  1BUE A;  2P7J A;  3BLM A;  5FQM A;  3BY9 A;  3N6I A;  5EEC A;  3E2K A;  1J9M A;  4FTX A;  3MZF A;  3VP1 A;  3HUN A;  2CMN A;  2HGV A;  1TF1 A;  1QME A;  4KZA A;  4JGR A;  2M1C A;  2Q9N A;  3MJQ A;  4G3W A;  1G68 A;  2YKF A;  3IX3 A;  1ES2 A;  2VGL M;  3UDF A;  4IUK A;  2WKQ A;  3UO9 A;  1LL9 A;  3BJN A;  2JKT M;  3P98 A;  1RCJ A;  3C5A A;  4P0M A;  4HJ4 A;  3ZCZ A;  4UA9 A;  5FDH A;  4PMA A;  1JTD A;  1K25 A;  4MDZ A;  2EWV A;  1VET A;  3LIE A;  2Y2L A;  3R4K A;  1FOF A;  1ZKJ A;  2W3D A;  4CJN A;  3W4P A;  1E4D A;  5J8X A;  3A0R A;  3PHY A;  1P9W A;  2V2F F;  3MF0 A;  1TD5 A;  3SH8 A;  5FEG A;  3ZVT A;  1KOU A;  3ZG5 A;  4RVA A;  3NOT C;  3S7P A;  2QZ6 A;  1VB6 A;  2XFS A;  1D7E A;  3VE4 A;  2VLG A;  5HAQ A;  2P04 A;  3SH9 A;  1CEF A;  1ZHH B;  1HD8 A;  2D01 A;  4G3K A;  4E3M A;  1E25 A;  3LR0 A;  5AJG A;  3G31 A;  4GS9 A;  4OQ0 A;  3PTE A;  5F82 A;  3P09 A;  1F5M A;  3C30 A;  2JKR I;  4R3A A;  2ZC6 B;  4WMC A;  2VJW A;  3NCK A;  2EXA A;  3BEC A;  2PR6 A;  1FR1 A;  1XPB A;  3D9Y A;  3VP2 A;  2Y2G A;  1YLP A;  4ZRR A;  3MXQ A;  4HBT A;  4X68 A;  3OPL A;  3CG5 A;  3RXX A;  3V5M A;  2ZQA A;  4H6J B;  4NK3 A;  4E3I A;  1XJ2 A;  5KSC A;  4Q0J A;  4EQ1 A;  2ZBB A;  3B3X A;  1JWV A;  4DE1 A;  2YKH A;  5AVF A;  2O9C A;  1N9N A;  3PXP A;  4DE2 A;  3F1N A;  3L7H A;  4B4Z A;  1T1B A;  3MR0 A;  2B95 A;  2WGI A;  2RL3 A;  3A3J A;  4BWI A;  1ESU A;  4E04 A;  3HRE A;  3NBL A;  5FAT A;  3LID A;  2XQZ A;  4EUZ A;  2J7V A;  2RCX A;  4X1M A;  2Y2M A;  1E3U D;  4Q0I A;  5IS1 A;  5TR7 A;  2QJ5 A;  2VGL S;  2WKE A;  2VV7 A;  1OME A;  2Y55 A;  3ZNT A;  4ZJ1 A;  4KZ4 A;  2Y79 A;  5CXW A;  3E98 A;  3G2Z A;  5HDD A;  1W7F A;  3LCE A;  4FUW A;  4LFU A;  3A3D A;  4R3J A;  3T4T A;  5I5L A;  3WS4 A;  4Y0U A;  4N1H A;  5GLA A;  3PR6 A;  3VE3 A;  2O9B A;  1KE3 A;  2PAV P;  4PM5 A;  4HBU A;  1IFQ A;  3NUL A;  1MWU A;  4GKU A;  2D02 A;  3QHY A;  1ZG4 A;  3C7V A;  1XJ4 A;  1W63 Q;  3VSK A;  3TW8 A;  2Z2L B;  3A0V A;  2GJ3 A;  3IF5 A;  4LRY C;  5A8B A;  1G6A A;  3A3I A;  3BFD A;  1PIO A;  1GSX A;  4EQI A;  3HLB A;  3Q7Z A;  1LI9 A;  3PBQ A;  4EV4 A;  3KSG A;  1JWP A;  5F1G A;  1OJ5 A;  3QP1 A;  4GNU A;  5DF9 A;  4X25 A;  3UB5 P;  3EQU A;  1PZO A;  3RTY A;  2Z6C A;  3CMZ A;  3PBN A;  3G2Y A;  2W1T A;  3MFD A;  1N9O A;  2J8Y A;  5HWT A;  4MBH A;  2EWW A;  1KDS A;  5LBR A;  4HIA A;  3MKF A;  2OOL A;  1MWR A;  4EET B;  5AQA A;  2HPB A;  1MXO A;  4QHC A;  4R0Q A;  4Z9Q A;  3W4O A;  2OWJ A;  3FZC A;  4P6B A;  4B93 A;  3V67 A;  2QHK A;  5I94 A;  4UA7 A;  1AXB A;  3UE3 A;  4OOL A;  4MBK A;  2HDQ A;  3BWL A;  4C75 A;  2V0W A;  4MEZ A;  2XSS A;  3IXG A;  1FIL A;  1GHI A;  3BEB A;  3FKW A;  3SZT A;  3QNC A;  2ZC3 B;  1NYY A;  3HCY A;  3PAE A;  3GRJ A;  1KDW A;  1N9L A;  5EVL A;  3SS4 A;  1H8Y A;  2XF3 A;  1T1A A;  1ESI A;  4X55 A;  4ZBE A;  5GLC A;  1N4O A;  3CUE C;  3G32 A;  5GLB A;  4JLF A;  2PD8 A;  3EEH A;  2XA7 M;  2Z2M B;  3MQQ A;  4M3K A;  5EM0 A;  4EW7 A;  5HAP A;  1K6S A;  5DTK A;  1NZO A;  4CLC A;  3LR3 A;  2QJ7 A;  4I3J A;  2M7V A;  2GZA A;  2K2N A;  3WWX A;  1VEU B;  1LL5 A;  3LIA A;  3TJZ C;  3Q7V A;  3O3V A;  2PR5 A;  1IEL A;  1KE0 A;  5CGW A;  1ONH A;  1K0K A;  4X53 A;  4RA7 A;  4BQM A;  5GLD A;  1FSW A;  1M6K A;  3ITA A;  1GA0 A;  1J3W A;  4CLC E;  2OAQ 1;  4WEL A;  2Z6D A;  2OLU A;  3LY3 A;  4XT2 B;  1W8Q A;  4WLA A;  3SOI A;  3MQO A;  2DRW A;  4GD6 A;  2IWB A;  3LYX A;  1VQQ A;  3U4L P;  4KUO A;  4NET A;  5HL6 A;  5D3O A;  2P9V A;  1Z09 A;  2DMW A;  1SKO B;  5E2H A;  1C3B A;  1TS6 A;  2KX6 A;  2ZMV A;  4QPR A;  3HLF A;  3P7N A;  4IUH A;  4CLC C;  5DTT A;  1MKM A;  4KZ3 A;  3E2L A;  5CHU A;  4Q0H A;  4E3J A;  2JC7 A;  1S0W A;  5CX7 A;  5HWW A;  1TS7 A;  1FCM A;  2E8J A;  4LCL A;  4Y0O A;  2PBY A;  4WL9 A;  4JXV A;  3O87 A;  4O0P A;  3OZH A;  3ULF A;  3WRT A;  3UMD A;  2I72 A;  4OOM A;  1T1C A;  1FR6 A;  4ESP A;  2Y2O A;  4KEN B;  4E6X A;  2A49 A;  2WAD A;  4KZ7 A;  2XLN A;  4M4X A;  4Q8I A;  3UB8 A;  2HP6 A;  3IF6 B;  1T19 A;  3H7W A;  4QD4 A;  2WAF A;  4S2L A;  2ZQC A;  4DXC A;  2LB9 A;  2W3E A;  4D60 A;  1RGZ A;  1W8Y A;  4EER A;  5L8M A;  3ZYT A;  3M6B A;  4PPR A;  2EA9 A;  5G4Z A;  3LIB A;  3ZDJ A;  5CHM A;  1I5Q A;  2UWX A;  4GW9 A;  1LSW A;  1NLY A;  3V50 A;  3V39 A;  2ZC7 A;  2ZQD A;  1W5D A;  3NOU C;  2X02 A;  3S7N A;  1DRM A;  1H8M A;  4KQD A;  3WS0 A;  4NEE D;  3JYI A;  4LLO B;  3B33 A;  5TGF A;  5HSQ A;  4L0L A;  4GB7 A;  3S4X A;  3BFG A;  4EEU A;  2WKR A;  1XFQ A;  2XA7 S;  3JVV A;  3T1Q B;  4EWF A;  3ZHH A;  3BQA A;  1TS8 A;  3EOI A;  5CHJ A;  1TS0 A;  5FQQ A;  5CEC A;  2PU4 A;  1YSQ A;  1H0M A;  3ZQ5 A;  4KQR A;  4LEN A;  4R70 A;  1GSV A;  2P74 A;  1YT4 A;  1K38 A;  3NY4 A;  3UE1 A;  3MZD A;  3WRZ A;  1IEM A;  4KZ8 A;  3SH7 A;  1IOU A;  1MWS A;  3MSH A;  4NXB A;  1IKG A;  5FQJ A;  2Y8H A;  2HJ9 C;  1L2S A;  1Y4O A;  3LI8 A;  4HES A;  2ZLY A;  2LB5 A;  2QMI A;  2VA0 A;  1I2S A;  2EX8 A;  5JYO A;  1I2W A;  4L9G A;  3C4O A;  3IHB A;  4EBN A;  3EQV A;  5TFQ A;  4N9K A;  4O7D A;  4B4X A;  3VFF A;  4WZ4 A;  3ZG0 A;  3E4P A;  5FQ9 A;  4JXS A;  1EI5 A;  5HDS A;  1BLC A;  2K31 A;  4HHD A;  2VX8 A;  1IYS A;  2A24 B;  2OSU A;  4X1L A;  4QU3 A;  3LI9 A;  2WGV A;  3CPT B;  5DF7 A;  2PU2 A;  3T1S A;  1SDN A;  4GOG A;  1D06 A;  5KIZ A;  3HL9 A;  2WAE A;  1F98 A;  1NRJ A;  3C8C A;  3W8K A;  2V8C A;  4ID4 A;  1QMF A;  3VSL A;  1XXM A;  5TBM B;  4DN0 A;  3T4K A;  3KSF A;  3IQA A;  5HWV A;  4ZAM A;  2OV5 A;  3GV9 A;  1GSW A;  2JKF A;  1TEM A;  2J3W A;  4B88 A;  1SKF A;  3NDG A;  1K56 A;  4PM9 A;  4EEP A;  3ICY A;  2PT7 A;  2ZQ8 A;  3LO7 A;  4KG5 A;  5DKL A;  2WGW B;  3LIF A;  4MMN A;  1GCE A;  4D2O A;  1FCO A;  4JBF A;  4YIN A;  5HAI A;  5EVI D;  2B5R A;  2G2W A;  4JGP A;  4DDS A;  2Q0O A;  3DW0 A;  4UQI M;  3IXB A;  3T4O A;  5EE8 A;  1SHV A;  3Q81 A;  3AGF A;  3LFV A;  1CF0 A;  4WEK A;  1T18 A;  2EXB A;  3W2Z A;  2ZC5 B;  4DJ2 A;  4GD8 A;  1VM1 A;  4OOY A;  2HZ5 A;  3VOZ A;  1BYW A;  2IWC A;  5EVI B;  3T12 B;  2HDU A;  1UWN X;  3E4Q A;  1JTG A;  4PKY A;  3C38 A;  5HAR A;  3BW6 A;  4C3Q A;  3D3O A;  2Y2K A;  2PBD P;  4C6Y A;  2W3F A;  1IKI A;  3IBR A;  3IS2 A;  4I38 A;  4P6Z M;  3F1O A;  3DTK A;  1ODV A;  5FAP A;  5EOO A;  5FAO A;  3WS5 A;  1ZC2 A;  1G6O A;  1RGY A;  4UEY A;  3N8R A;  5HX9 A;  4ARZ A;  4X69 A;  3F1P A;  4R1G A;  4MN5 A;  2HP5 A;  3RXW A;  3FPV A;  4EU0 A;  4S2N A;  1TVF A;  5HL1 A;  1K54 A;  4X56 A;  4LGW A;  1CI9 A;  4K0W A;  3LUQ A;  1XP4 A;  3EEA A;  4Y7P A;  1BSG A;  1DJB A;  1HVB A;  4MLL A;  5TJJ A;  1XGJ A;  5DF8 A;  4O01 A;  4L9F A;  3E4O A;  2J3T C;  3DBA A;  5EPH A;  2O99 A;  2VGK A;  3T4L A;  3VMA A;  3T4J A;  4GJ4 A;  4XT2 A;  2IWD A;  4N9L A;  3W4Q A;  4GHI A;  2ZL1 A;  3BYD A;  4F3L A;  3UPP A;  3HUO A;  3TOI A;  1PWD A;  5FEF A;  4FCF A;  4I39 A;  3OCN A;  3Q07 A;  3S7O A;  3BFC A;  1M40 A;  1BT5 A;  4JGO A;  4BD0 A;  1GHP A;  4IHQ A;  4FD8 A;  2XD5 A;  4S2N C;  3ZNY A;  1H8Z A;  3QNB A;  1ZG6 A;  1K54 C;  1OPX A;  4ME4 A;  3T1R A;  3NDE A;  2KDK A;  2QKP A;  4FH2 A;  3GTC A;  1YLT A;  3FKV A;  3T50 A;  3DTM A;  1S4R A;  3PAG A;  4UQI S;  4E6W A;  2I9V A;  1P97 A;  1L0G A;  1NLZ A;  1A0K A;  1MWT A;  1NWZ A;  1SDE A;  2ZD8 A;  3FPW A;  4IED A;  1PI4 A;  4OPR A;  1JVJ A;  2J9P A;  2K7S A;  2L4R A;  5JYP A;  4K08 A;  4S2K A;  4ZDX A;  4K0X A;  2Y4A A;  3OPP A;  4EXO A;  4WMC D;  1FCN A;  1D1J A;  2W3G A;  2XR0 A;  3ZG8 B;  4PM7 A;  2WKI A;  2ZQ7 A;  1LHY A;  3OPR A;  2VKS A;  1U60 A;  1UWP X;  4MBF A;  1Y28 A;  2XH9 A;  1YPR A;  3M2J A;  3FV7 A;  2ZMA A;  1NY0 A;  4P6Z S;  1DP9 A;  4GS9 B;  1STZ A;  5EUA A;  1W79 A;  5CER A;  4HJ6 A;  5A91 A;  5FQK A;  2XDM A;  2W0N A;  2GNX A;  1ERQ A;  4NKP A;  4WBG A;  3SS5 A;  3U2A A;  1XFN A;  1O07 A;  3B42 A;  5HPI A;  2XK1 A;  4RYE A;  1LLB A;  3H82 A;  3N8L A;  3IX8 A;  4QY6 A;  1S4S A;  2FZ0 A;  3OC2 A;  4KG2 A;  4HOI A;  3P01 A;  3DTE A;  1LSV A;  1BZA A;  1OT6 A;  2XGN A;  3NC8 A;  4KZ6 A;  1ES3 A;  3VOY A;  1H5X A;  4Z1W A;  4OQG A;  4LCM A;  2ZOH A;  3Q82 A;  1YAX A;  3PBO A;  3LGO A;  3F1N B;  3NIA A;  5U47 A;  2DCF A;  3LR5 A;  1MKI A;  4GCZ A;  4BBV A;  3CHW P;  3BY8 A;  3EGD C;  3K3C A;  1PI5 A;  4F94 A;  2EX9 A;  2VZW A;  4OPZ A;  3CWF A;  5EOE A;  5E2E A;  5L07 A;  4HY8 A;  2INW A;  4JXG A;  3MXS A;  4AFI A;  5KSH A;  5DFY A;  2Y2I A;  2V0U A;  1P0Z A;  1NJ4 A;  1PWG A;  5MC7 A;  2Y2Q A;  2NUT C;  3LY4 A;  1WYC A;  3V3R A;  4DJ3 A;  3NHQ A;  4WM9 A;  2J9O A;  5M18 A;  3RJU A;  3MKE A;  3IXD A;  4IVK A;  4GZB A;  4X6T A;  4LRX C;  3VV4 A;  5E2G A;  5KMW A;  4GLQ A;  5FDS A;  2G2U A;  4N92 A;  1GHM A;  3N8S A;  2A2L A;  5M1A A;  2ZC4 B;  3O86 A;  5A93 A;  3B47 A;  2R9X A;  2BLS A;  3TSG A;  3BFE A;  3DAV A;  4HEF A;  1P9R A;  3G34 A;  1PRQ A;  3C7U A;  4LV0 A;  1YLY A;  4Y15 A;  3M2K A;  4HQA A;  3SW1 A;  5G18 A;  5FAS A;  5CGS A;  2QYB A;  5F83 A;  1LI0 A;  3PBT A;  2WKH A;  4KZ9 A;  4S2P A;  2WZZ A;  2WGW A;  4CQH A;  4P85 A;  5EM1 A;  2IA2 A;  3IH9 A;  3UE0 A;  3NJA A;  2M7U A;  2JE5 A;  1O7E A;  4XXR A;  2XD1 A;  5DJU A;  2DNS A;  4B9O A;  1PW8 A;  4EUV A;  1YSP A;  4WF0 A;  1Z6F A;  2W1T B;  3VP4 A;  2O9A A;  2EX2 A;  3MBZ A;  2XRN A;  3UY6 A;  3MZE A;  3CIT A;  3FWL A;  1XA1 A;  2O0Y A;  4ETZ A;  3GSG A;  1ERO A;  3G30 A;  4CPK A;  4Y3I A;  1MC0 A;  5L09 A;  4RX3 A;  5HPF A;  2WK0 A;  3KYE A;  2HV1 A;  1YLW A;  3GVB A;  2WYX A;  4MN6 A;  3R7W B;  3QP5 A;  2W1R A;  4P87 A;  3HLC A;  4H6J A;  3EWK A;  1KGG A;  3KSH A;  1XJ3 A;  5IT5 A;  3FC7 A;  2H5S A;  4CLC D;  5GL9 A;  4HP9 A;  3PBR A;  3MQ0 A;  4UHU A;  4JXW A;  3NI9 A;  2PHY A;  3QP8 A;  5HD3 A;  5J7E A;  2GDN A;  4BBT A;  1KGF A;  3KYZ A;  3OBF A;  2P08 A;  4R23 A;  3A0S A;  1CEG A;  1PFL A;  4U0X A;  1DP6 A;  4DMZ A;  5A92 A;  1WE4 A;  4LV1 A;  1OTI A;  1OTB A;  3L9K A;  4QB8 A;  1S1Z A;  2KOI A;  3QP4 A;  4DKI A;  4CLC B;  4BBU A;  4NXE A;  4Y5F A;  5EFW A;  2Y2J A;  3UME A;  2HF6 A;  1KGE A;  3RFB A;  1HLU P;  1ACF A;  4OVD A;  3IWI A;  3ZGA B;  2WZX A;  5DJT A;  1EW0 A;  4MCW A;  1E3U A;  1LL8 A;  3AGD A;  4LPZ A;  1H3Q A;  2G7U A;  1OTA A;  2W27 A;  3HLG A;  3LIC A;  4JF5 A;  3CI6 A;  4NG2 A;  1EWZ A;  4YFM A;  2P9V B;  3KSI A;  2W3H A;  4WN5 A;  2FFY A;  2ZQ9 A;  3IHA A;  3D4F A;  5K5B A;  1TDL A;  2JHE A;  5AQB A;  4JKT A;  3GDI A;  3G35 A;  3LR4 A;  1MBL A;  2GX5 A;  1F2K A;  2QPN A; 
#chains in the Genus database with same CATH homology
 1K4E A;  3O88 A;  3S22 A;  3G4P A;  2Z2M B;  2C6W B;  3BYD A;  3ITB A;  4M3K A;  3DWK A;  3UPP A;  3IWO A;  4IBX A;  5HAP A;  1K6S A;  3HUO A;  5DTK A;  1NZO A;  3TOI A;  1PWD A;  4KQO A;  3HLD A;  4FCF A;  3WWX A;  1LL5 A;  4JF4 A;  3OCN A;  1DJA A;  1CK3 A;  2V20 A;  3Q07 A;  1L0F A;  1JWZ A;  1IYQ A;  3BFC A;  5E2F A;  3N7W A;  3Q7V A;  1M40 A;  1BT5 A;  1FQG A;  3O3V A;  1GHP A;  4BD0 A;  1IEL A;  1SCW A;  2X01 A;  1KE0 A;  4FSF A;  4FD8 A;  4OH0 A;  1ES5 A;  2XD5 A;  2ZM8 A;  5CGW A;  1ONH A;  3UPO A;  4S2N C;  3ZNY A;  4UA6 A;  1ONG A;  2Y59 A;  4X53 A;  4RA7 A;  1H8Z A;  3FYZ A;  3QNB A;  4BQM A;  3Q1F A;  5GLD A;  1FSW A;  1ZG6 A;  1K54 C;  4PM6 A;  2ZJ9 A;  1M6K A;  4U3T A;  5KZH A;  3ITA A;  1GA0 A;  3UPN A;  3NDE A;  1KVM A;  3GR2 A;  1K55 C;  1PZP A;  3CZD A;  2E8I A;  4WEL A;  2R9W A;  4DRT A;  2OLU A;  5CTM A;  4IBR A;  1MPL A;  3GTC A;  4FH2 A;  4S2M A;  1YLT A;  3FKV A;  4U0T A;  3LY3 A;  5BOH A;  3VFH A;  3DTM A;  3VP0 A;  3PAG A;  4E6W A;  1W8Q A;  3SOI A;  1L0G A;  1Q2Q A;  2VGJ A;  2Y2H A;  1MWT A;  3HBR A;  2DRW A;  4GD6 A;  3ZFZ A;  5CRF A;  1SDE A;  2ZD8 A;  1XKZ A;  4IED A;  2IWB A;  1PI4 A;  3HLE A;  1JVJ A;  4OPR A;  3HUM A;  1VQQ A;  2J9P A;  4E3O A;  4NET A;  5D3O A;  4XUZ A;  5FSR A;  2P9V A;  5JYP A;  5E2H A;  2ZM0 A;  4JPM A;  4OKP A;  4S2K A;  5FI7 A;  1C3B A;  4ZDX A;  4BJP A;  5EVI C;  4Y0T A;  2X71 A;  4K0X A;  2Y4A A;  3OPP A;  3UDI A;  1WYB A;  2V1Z A;  3Q7V B;  3HLF A;  4WMC D;  1FCN A;  2H10 A;  3A3F A;  2XR0 A;  5AQ9 A;  3ZG8 B;  4PM7 A;  3M6H A;  1BUE A;  3BLM A;  5DTT A;  5FQM A;  1IYO A;  3OPH A;  4KZ3 A;  3E2L A;  1BTL A;  5CHU A;  3N6I A;  5EEC A;  2WKI A;  3V3S A;  4E3J A;  2ZQ7 A;  1LHY A;  2WUQ A;  2JC7 A;  3BM6 A;  3OPR A;  1ES4 A;  1S0W A;  5E43 A;  4EBP A;  1U60 A;  1FCM A;  4S2O A;  3E2K A;  4MBF A;  2XH9 A;  4LCL A;  3M2J A;  1J9M A;  5CED A;  4Y0O A;  2PBY A;  3FV7 A;  3MZF A;  4BLM A;  2ZMA A;  3HVF A;  3HUN A;  4JXV A;  3VP1 A;  1NY0 A;  3BRM A;  1QME A;  3O87 A;  4OP5 A;  3OZH A;  4OON A;  3WRT A;  4KZA A;  2Q9N A;  1L0D A;  2I72 A;  4OLD A;  1G68 A;  4OOM A;  5EUA A;  1FR6 A;  2Y2O A;  4KEN B;  4E6X A;  2A49 A;  2WAD A;  1W79 A;  4KZ7 A;  1ES2 A;  1NRF A;  5CER A;  2XLN A;  4Q8I A;  3GMW A;  3UDF A;  4QJG A;  5A91 A;  5FQK A;  4BL2 A;  2XDM A;  3UO9 A;  1LL9 A;  3P98 A;  1RCJ A;  3C5A A;  2HP6 A;  1ERQ A;  4WBG A;  3IF6 B;  4P0M A;  1BUL A;  3SS5 A;  4QD4 A;  2WAF A;  4S2L A;  1O07 A;  2ZQC A;  4DXC A;  2XK1 A;  3ZCZ A;  4OPQ A;  4UA9 A;  5FDH A;  4PMA A;  2Y91 A;  4XUX A;  5FI6 A;  5GHX A;  4OP8 A;  4RYE A;  1RGZ A;  1LLB A;  1W8Y A;  1JTD A;  3N8L A;  3ZVW A;  1K25 A;  3M6B A;  4PPR A;  4LV3 A;  4QY6 A;  2Y2L A;  3OC2 A;  4KG2 A;  3ZDJ A;  1FOF A;  5M19 A;  1ALQ A;  1YLZ A;  1ZKJ A;  4CJN A;  1BZA A;  5CHM A;  3W4P A;  1E4D A;  2XGN A;  4KZ6 A;  3NC8 A;  4BD1 A;  1ES3 A;  3VOY A;  1I5Q A;  2UWX A;  5J8X A;  3HLW A;  2V2F F;  5GHY A;  4ZJ3 A;  1H5X A;  1KE4 A;  3V50 A;  2ZC7 A;  3V39 A;  4WYY A;  2HDR A;  2ZQD A;  4GN2 A;  3SH8 A;  4OQG A;  4LCM A;  4DE0 A;  4H8R A;  1W5D A;  3Q82 A;  4RX2 A;  3ZVT A;  2X02 A;  3ZG5 A;  3PBO A;  3WS0 A;  1NZU A;  4RVA A;  2H0T A;  1ERM A;  1Y54 A;  3JYI A;  5TGF A;  2QZ6 A;  3NIA A;  5U47 A;  4L0L A;  2XFS A;  4GB7 A;  3S4X A;  1K56 D;  2DCF A;  3BFG A;  1TDG A;  1MKI A;  4R4R A;  5DVA A;  5HAQ A;  1BLH A;  1PI5 A;  3SH9 A;  4F94 A;  1CEF A;  2EX9 A;  5EOE A;  4OPZ A;  1XX2 A;  1HD8 A;  3CJM A;  4OQI A;  3A3E A;  5E2E A;  4EWF A;  4K91 A;  3ZHH A;  4E3M A;  3MXR A;  4JXG A;  5CHJ A;  5FQQ A;  3MXS A;  5CEC A;  2PU4 A;  5KSH A;  1DJC A;  1E25 A;  2Y2I A;  2ZM2 A;  5CEB A;  1BLP A;  1NJ4 A;  3IT9 A;  3G31 A;  1PWG A;  4KQR A;  4LEN A;  2Y2Q A;  2OLV A;  5FQI A;  2P74 A;  4OQ0 A;  3LY4 A;  1WYC A;  3PTE A;  4MNR A;  3V3R A;  4IVI A;  5F82 A;  4WM9 A;  2J9O A;  1YT4 A;  3P09 A;  5M18 A;  1K38 A;  3NY4 A;  3UE1 A;  3MZD A;  3RJU A;  3MKE A;  1IEM A;  4ZTK A;  1L0E A;  4KZ5 A;  3WRZ A;  3IXD A;  4KZ8 A;  3SH7 A;  4IVK A;  4GZB A;  2ZC6 B;  4X6T A;  1MWS A;  4WMC A;  5E2G A;  5KMW A;  3IF6 A;  2BG1 A;  1IKG A;  3NCK A;  4KZB A;  4DDY A;  3WS1 A;  5FQJ A;  4OQH A;  3ISG A;  2EXA A;  2G2U A;  3BEC A;  1L2S A;  4N92 A;  4HES A;  1GHM A;  3N8S A;  5M1A A;  1FR1 A;  1XPB A;  2ZLY A;  3VP2 A;  2ZC4 B;  3O86 A;  3I7J A;  2QMI A;  2Y2G A;  1I2S A;  2EX8 A;  1YLP A;  4KG6 A;  2EX6 A;  5JYO A;  1I2W A;  5A93 A;  4HBT A;  4EBN A;  3C4O A;  3IHB A;  4X68 A;  2R9X A;  2BLS A;  3EQV A;  2Y2N A;  1IYP A;  3CG5 A;  3OPL A;  5TFQ A;  3TSG A;  3BFE A;  4HEF A;  4N9K A;  4WEJ A;  3RXX A;  4O7D A;  3V5M A;  4B4X A;  3VFF A;  2ZQA A;  4WZ4 A;  5CTN A;  1YMX A;  3G34 A;  3ZG0 A;  4NK3 A;  4E3I A;  3C7U A;  5FQ9 A;  4JXS A;  4LV0 A;  5KSC A;  1EI5 A;  2XFT A;  1YLY A;  1BLC A;  4EBL A;  5FI2 A;  1IYS A;  1HTZ A;  2OSU A;  3M2K A;  4LV2 A;  4PM8 A;  3B3X A;  1JWV A;  4DE1 A;  4QU3 A;  3GQZ A;  3IWQ A;  5G18 A;  5FAS A;  2WGV A;  5CGS A;  5F83 A;  4DE2 A;  1LI0 A;  4A5R A;  3PBT A;  2WKH A;  5DF7 A;  2PU2 A;  4KZ9 A;  4S2P A;  4B4Z A;  4BL3 A;  1SDN A;  3UNW A;  2WZZ A;  2JCH A;  3IH8 A;  4GOG A;  2WGW A;  4OPY A;  4S2J A;  4DF6 A;  4P85 A;  4WZ5 A;  2WGI A;  3ZG7 B;  2RL3 A;  3A3J A;  3HL9 A;  4S2I A;  1HZO A;  2WAE A;  4E3L A;  2JBF A;  1ESU A;  3IH9 A;  1GA9 A;  3HRE A;  3NBL A;  3UE0 A;  5FAT A;  4E3K A;  2JE5 A;  1O7E A;  3W8K A;  4XXR A;  2XQZ A;  2XD1 A;  4EUZ A;  2J7V A;  2DNS A;  2RCX A;  1PW8 A;  2Y2M A;  1E3U D;  5FA7 A;  3OCL A;  4ID4 A;  2Y2P A;  1QMF A;  5TR7 A;  3VSL A;  3IF6 C;  1Z6F A;  1XXM A;  2WKE A;  3VP4 A;  1OME A;  2Y55 A;  3ZNT A;  4ZJ1 A;  2H0Y A;  4KZ4 A;  2EX2 A;  5CXW A;  3IQA A;  3G2Z A;  4ZAM A;  3MBZ A;  3UY6 A;  3MZE A;  2OV5 A;  3FWL A;  3GV9 A;  1W7F A;  3LCE A;  1XA1 A;  3A3D A;  4R4S A;  3GSG A;  4R3J A;  1ERO A;  1PYY A;  1TEM A;  3G30 A;  4CPK A;  4B88 A;  1SKF A;  3NDG A;  3WS4 A;  4Y0U A;  4N1H A;  4JF6 A;  5GLA A;  1K56 A;  4PM9 A;  4RX3 A;  3BLS A;  2WK0 A;  3S1Y A;  2ZQ8 A;  3LO7 A;  1FSY A;  4KQQ A;  1KE3 A;  4KG5 A;  3AGE A;  2WGW B;  1N9B A;  5A90 A;  4PM5 A;  1GCE A;  1YLW A;  3GVB A;  1FCO A;  2WYX A;  4JBF A;  5CGX A;  4YIN A;  3WS2 A;  1RP5 A;  4D2O A;  5HAI A;  4HBU A;  1YMS A;  5EVI D;  1MWU A;  3LEZ A;  2XEP A;  4P87 A;  4R3B A;  3HLC A;  4ZJ2 A;  2B5R A;  2G2W A;  5AQ7 A;  1KGG A;  4GKU A;  1PW1 A;  4DDS A;  3DW0 A;  4OLG A;  3QHY A;  2FFF B;  4WZ5 C;  1ZG4 A;  1NYM A;  3C7V A;  2H5S A;  3BFF A;  3IXB A;  5GL9 A;  4QY5 A;  1YM1 A;  5EE8 A;  3PBR A;  3SS3 A;  3VSK A;  2Z2L B;  3N4I A;  4UHU A;  4JXW A;  1S6R A;  3PBS A;  3NI9 A;  1SHV A;  3Q81 A;  3AGF A;  3IF5 A;  2GDN A;  1G6A A;  4WEK A;  3A3I A;  3BFD A;  2EXB A;  1KGF A;  1PIO A;  1K4F A;  4EQI A;  1Q2P A;  2ZC5 B;  3HLB A;  5F1F A;  4GD8 A;  3Q7Z A;  4R23 A;  3TG9 A;  1LI9 A;  4BEN A;  1VM1 A;  1XA7 A;  1K57 A;  3PBQ A;  4OOY A;  4EV4 A;  1CEG A;  1YQS A;  1JWP A;  4U0X A;  5F1G A;  4N1X A;  5A92 A;  4UAA A;  3VOZ A;  1MY8 A;  1WE4 A;  4LV1 A;  4GNU A;  2IWC A;  5DF9 A;  5EVI B;  2HDU A;  3EQU A;  1PZO A;  4QB8 A;  1JTG A;  3CMZ A;  4FH4 A;  3PBN A;  5DTS A;  2A3U A;  3G2Y A;  5HAR A;  4C3Q A;  4DKI A;  1KVL A;  3C4P A;  2Y2K A;  1XGI A;  3MFD A;  5L2F A;  2J8Y A;  3UN7 A;  2Y2J A;  4C6Y A;  2C5W B;  4MBH A;  1IKI A;  1KDS A;  3MKF A;  1MWR A;  1KGE A;  5AQA A;  2HPB A;  2CC1 A;  1MXO A;  4QHC A;  5FAP A;  5EOO A;  4R0Q A;  4Z9Q A;  5FAO A;  3W4O A;  3WS5 A;  1ZC2 A;  3FZC A;  1RGY A;  3N8R A;  2HDS A;  4P6B A;  5HX9 A;  4OVD A;  3IWI A;  4DXB A;  5I94 A;  3ZGA B;  4X69 A;  1BLS A;  2WZX A;  4R1G A;  1AXB A;  2HP5 A;  2EFU A;  4UA7 A;  3RXW A;  1E3U A;  3AGD A;  3UE3 A;  4S2N A;  4OOL A;  4E3N A;  1TVF A;  1DY6 A;  5HL1 A;  1YLJ A;  4MBK A;  3UDX A;  1K54 A;  4X56 A;  2EFX A;  1CI9 A;  2HDQ A;  4K0W A;  1CI8 A;  4C75 A;  4GDN A;  3HLG A;  4GDB A;  5GHZ A;  1XP4 A;  4MEZ A;  4Y7P A;  1BSG A;  4JF5 A;  1K55 A;  3IXH A;  3ZG9 B;  1EWZ A;  1HVB A;  1DJB A;  1K57 C;  2HP9 A;  3IXG A;  1XGJ A;  4MLL A;  4YFM A;  5FAQ A;  5HW3 A;  1GHI A;  2P9V B;  3BEB A;  3FKW A;  5DF8 A;  3QNC A;  2ZC3 B;  1NYY A;  1K6R A;  3PAE A;  3GRJ A;  1KDW A;  2FFY A;  2ZQ9 A;  3IHA A;  5EPH A;  5EVL A;  1H8Y A;  3SS4 A;  2XF3 A;  3D4F A;  2Q9M A;  1TDL A;  5HFO A;  2VGK A;  3VMA A;  5IHV A;  1ESI A;  4X55 A;  5AQB A;  4JKT A;  1PWC A;  4ZBE A;  3G35 A;  2IWD A;  5GLC A;  1N4O A;  1MBL A;  4N9L A;  3W4Q A;  3G32 A;  3DWZ A;  5EVI A;  5GLB A;  4JLF A;  3VP3 A;  2QPN A;  1NXY A;  4DE3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...