1IYPA

Toho-1 beta-lactamase in complex with cephalothin
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
260
structure length
260
Chain Sequence
SVQQQLEALEKSSGGRLGVALINTADNSQILYRADERFAMCSTSKVMAAAAVLKQSESDKHLLNQRVEIKKSDLVNYNPIAEKHVNGTMTLAELGAAALQYSDNTAMNKLIAHLGGPDKVTAFARSLGDETFRLDRTAPTLNTAIPGDPRDTTTPLAMAQTLKNLTLGKALAETQRAQLVTWLKGNTTGSASIRAGLPKSWVVGDKTGSGDYGTTNDIAVIWPENHAPLVLVTYFTQPEQKAERRRDILAAAAKIVTHGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Toho-1 beta-lactamase
publication title Acyl-intermediate Structures of the Extended-spectrum Class A beta -Lactamase, Toho-1, in Complex with Cefotaxime, Cephalothin, and Benzylpenicillin.
pubmed doi rcsb
source organism Escherichia coli
total genus 89
structure length 260
sequence length 260
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2002-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 1iypA00
4R23A 2WYXA 2ZM8A 4PPRA 1E3UA 1NYYA 2XQZA 3HUMA 3PTEA 2ZC3B 4JPMA 5M19A 4ZJ2A 4GOGA 4OQGA 5F82A 3W4OA 2XDMA 4KG5A 5A91A 1PI4A 3SOIA 4R3JA 2Y2IA 2OSUA 3OPLA 4U0TA 5EVLA 5FQQA 2QMIA 1IYSA 1LI9A 4R4SA 5GLAA 1XPBA 4LCLA 4LV2A 1XP4A 3DTMA 4E3JA 4IBRA 3WS4A 4R0QA 1NY0A 4RX3A 4OP5A 2A49A 2C6WB 3A3FA 3CJMA 4IBXA 4WBGA 1TVFA 1ESUA 2RL3A 2WUQA 5EOOA 2BG1A 5HARA 3M2KA 3SH9A 4R3BA 4UHUA 3M6HA 3Q1FA 5E2GA 1NJ4A 2XH9A 4PMAA 4OPYA 3UPNA 2EX2A 3A3DA 4DRTA 4S2KA 4S2PA 3BM6A 3IWOA 3V5MA 4DXBA 1EWZA 1K4FA 4WYYA 1K6SA 1IYQA 3ZNYA 3FWLA 4N9KA 4LV3A 3V3RA 2XD5A 1ZC2A 3NBLA 3HREA 1KE0A 1PZPA 2OV5A 1K54C 2HDQA 3D4FA 2EX8A 3OPPA 4JF6A 2J8YA 4S2MA 4E3IA 4EQIA 4FH4A 5J8XA 1L2SA 4QU3A 4LV0A 1FOFA 3CMZA 4HBUA 4MBKA 4UA6A 4OLGA 1K6RA 3PBNA 1FR1A 1KE3A 1MXOA 3A3JA 4OVDA 3CZDA 1SDNA 1H5XA 4Y0UA 4DE3A 3RXXA 1ZG4A 4B88A 1YLYA 5EUAA 3RXWA 5DVAA 2Y2QA 3NDGA 3HLWA 5CHJA 5E2FA 2GDNA 1BLCA 3HUOA 3WS0A 3SS5A 3ZG8B 2XFSA 1SKFA 3OCNA 4EUZA 1MWRA 4ZAMA 1HZOA 4EWFA 5HAIA 4KZ8A 4B4XA 1KGFA 2IWBA 1K56A 1BZAA 1DJCA 2ZM0A 5FA7A 4Q8IA 3ZG9B 4R1GA 3UNWA 1VM1A 3IH8A 4KG2A 5TFQA 3ZGAB 5GHYA 4X55A 1W7FA 2WAEA 3TSGA 2R9XA 2E8IA 5CERA 1XA1A 5DTSA 2ZQ8A 2EFUA 3GTCA 1ES4A 4GZBA 3A3EA 4KZ4A 5CHMA 5EVIC 4BQMA 3EQUA 3V50A 2ZC5B 1BT5A 1K54A 4KG6A 4QB8A 4CJNA 1ZKJA 1SDEA 1E3UD 1O07A 2VGJA 4EBLA 1K55C 3UO9A 1PYYA 1JWPA 3N8RA 5DF7A 1FSWA 4KZBA 2A3UA 2H0YA 3O88A 1EROA 1QMEA 3ZG5A 3IF6C 2R9WA 2IWDA 2WK0A 2CC1A 5CGSA 4XUZA 4X6TA 5E2HA 2HDRA 2WKHA 5EOEA 5DF9A 4ZTKA 4OPRA 1YMSA 1YLTA 4MNRA 3GQZA 3O87A 3UE0A 3VSKA 3SS4A 1PI5A 3MZFA 4Y0TA 3C7VA 1XGJA 5EPHA 3Q81A 4RYEA 4C75A 3OPRA 4E3LA 1XA7A 4WEKA 3AGEA 3S4XA 1FCOA 3CG5A 5A92A 1LL5A 5FQKA 5FI6A 3G31A 3HLDA 3UY6A 1Y54A 3PBQA 2ZC4B 3W4QA 3SH7A 5U47A 2ZLYA 3G32A 3N8LA 2DNSA 1GHMA 4JXSA 4E3OA 2HDSA 3HVFA 3QNBA 4JF5A 1Q2PA 3WS5A 3ZG0A 5EVIB 4E6XA 1CEFA 4HBTA 4ZDXA 2ZQ7A 1I2SA 5EVIA 5GHZA 1MBLA 3HLCA 3IXHA 3W8KA 5CHUA 3LEZA 5CECA 1PW1A 5EE8A 5F1GA 3NY4A 1LLBA 4X68A 3BYDA 1K55A 1H8YA 2HPBA 1CEGA 1KVMA 1K25A 4N1HA 3LY4A 4JLFA 3ITAA 4WZ5C 2EX9A 2ZMAA 5FAPA 5TGFA 4UA7A 3IF6B 1W8YA 1FR6A 3IF6A 1Q2QA 2FFFB 5FI2A 3M2JA 1TDLA 3MKEA 3LY3A 5HFOA 1RP5A 2HP6A 5BOHA 1PWCA 2Y4AA 3WS1A 5IHVA 2HDUA 4JXVA 4P0MA 2ZM2A 4NK3A 2Q9NA 2Z2MB 4FD8A 5D3OA 3GR2A 3ZFZA 5GLDA 1I2WA 2ZC7A 2ZQAA 4S2IA 4EBNA 2WADA 4KENB 1W5DA 5CEDA 1NZUA 1WYBA 2IWCA 2P74A 4U3TA 3GRJA 4PM8A 4IVKA 1K56D 1L0FA 3RJUA 3HLGA 4CPKA 1YLZA 4MBHA 1H8ZA 3M6BA 4R4RA 1ZG6A 2FFYA 1S6RA 1LHYA 1KE4A 3N4IA 4BENA 1ONGA 4S2JA 4DF6A 3E2LA 1EI5A 1KDSA 3DWKA 4GNUA 4H8RA 4JKTA 4XUXA 3C4OA 4N92A 2PU2A 3BEBA 3PAGA 4KZ9A 1GHPA 3JYIA 4EBPA 3GSGA 1YMXA 4QJGA 3MZDA 5HL1A 1ES3A 3E2KA 3IF5A 3HL9A 4E6WA 3ZDJA 4WZ5A 4C6YA 5GL9A 3BFDA 5AQ7A 4S2NC 4OOMA 3FZCA 1PZOA 2Y2HA 4GDBA 4DDSA 3IH9A 4D2OA 2V2FF 5KZHA 3G4PA 1ES5A 3NI9A 4KZAA 1CI9A 3P09A 4MLLA 4Z9QA 2B5RA 4WM9A 4DKIA 2Y2JA 1IKIA 4UA9A 5FATA 1L0GA 1M40A 1IKGA 2XFTA 2Y55A 4JF4A 3S1YA 4A5RA 1FCMA 3N8SA 4Y7PA 3Q82A 4RA7A 1JVJA 3MXRA 3TOIA 3HUNA 3IQAA 2ZJ9A 4WMCA 1KVLA 1NXYA 3BECA 4BD1A 1PW8A 1TDGA 2WGVA 3MKFA 4GKUA 3IXGA 3B3XA 2WKIA 2WKEA 4QD4A 4LCMA 4KZ5A 1ONHA 3UE3A 1W79A 5CGWA 2JBFA 2Y2GA 2P9VB 3WS2A 2J9PA 2HP5A 1NZOA 3IXDA 1MWTA 2P9VA 4JXWA 1BTLA 3BFGA 1LL9A 5EVID 4HESA 4S2LA 1YLWA 3FYZA 5EECA 5KSHA 4U0XA 4OH0A 1YLPA 4OPQA 2OLVA 3Q07A 5KSCA 1FQGA 5M18A 2EXAA 4PM6A 3HLBA 1FSYA 5GLBA 3FKWA 4S2NA 1WE4A 4MEZA 1N9BA 3VFHA 1IYOA 2Y2OA 5DF8A 1G68A 4OQHA 2WAFA 3ZCZA 3EQVA 5HAPA 4RVAA 4BD0A 3IHBA 3Q7ZA 3G2ZA 1SHVA 3MFDA 1BUEA 2BLSA 3G30A 1XGIA 1JWZA 1MWSA 3MXSA 5JYOA 5A90A 5DTTA 1BLPA 2PU4A 1GA9A 1BLHA 1AXBA 3C7UA 2QPNA 3OZHA 4BJPA 4OP8A 1CI8A 5CGXA 1IEMA 2EXBA 2V1ZA 1XKZA 1BSGA 3PBSA 4ZJ1A 1OMEA 1I5QA 4PM9A 1MY8A 3G34A 4OKPA 3FKVA 3IWIA 3ZHHA 4QY5A 3VP1A 3TG9A 3IHAA 4IEDA 3VP2A 3ZNTA 4YFMA 1KDWA 3HBRA 3ISGA 4XXRA 1ES2A 4MBFA 4O7DA 1GCEA 4M3KA 1G6AA 3QHYA 3PAEA 2Y2KA 4K0WA 4P87A 4YINA 1TEMA 2Y2PA 1S0WA 5F83A 1HVBA 2XEPA 4DE0A 3V3SA 2Y2NA 1J9MA 3OC2A 4K0XA 4ZBEA 4KZ6A 2HP9A 1KGEA 1L0DA 4PM5A 2JCHA 1K38A 3G2YA 5G18A 3VMAA 1NRFA 5FAQA 2DRWA 3W4PA 3VP4A 2XD1A 3C5AA 4OONA 4DXCA 2WGIA 5CEBA 3OCLA 3NCKA 4JBFA 4E3KA 3ZG7B 2Y91A 4KZ7A 3IXBA 4JXGA 4WELA 4P6BA 1YQSA 2JE5A 4FH2A 5M1AA 3V39A 4BL2A 1JTGA 3NC8A 4N9LA 4WMCD 5FSRA 1MPLA 2PBYA 1RGYA 4S2OA 5FQMA 5HAQA 3BLMA 4L0LA 5FAOA 1BLSA 1YLJA 1MWUA 3MZEA 1NYMA 4QY6A 3ZVWA 2Y59A 4GD6A 4WZ4A 1BULA 4LV1A 3Q7VB 4KZ3A 2XK1A 2OLUA 4IVIA 1FCNA 3GMWA 3Q7VA 4BL3A 5AQBA 3N7WA 3VSLA 5TR7A 5CTNA 1K57C 3MBZA 1MKIA 4FCFA 2Z2LB 3VP0A 4LENA 2EFXA 3BLSA 3FV7A 3IWQA 3PBOA 3UDIA 2J9OA 3UPOA 1E4DA 4F94A 4WEJA 1DJBA 4PM7A 1U60A 2XF3A 1YM1A 3WRZA 3P98A 2VGKA 4P85A 5FQ9A 4ZJ3A 1ESIA 1IELA 3LCEA 1ERQA 4KQRA 5JYPA 3O3VA 3QNCA 1IYPA 5FDHA 2ZC6B 5FQIA 4OOYA 2WZZA 4DDYA 5FASA 2XGNA 4HEFA 4NETA 2UWXA 3GV9A 3AGDA 4N1XA 1XXMA 2XLNA 4KQQA 1HD8A 1ERMA 2WZXA 1E25A 3VFFA 2J7VA 3HLFA 1K4EA 2H10A 4Y0OA 3BFFA 4RX2A 3DWZA 5E43A 3SS3A 4EV4A 1HTZA 2XR0A 1L0EA 3O86A 5FQJA 3AGFA 1RGZA 2JC7A 1M6KA 4ID4A 3WRTA 4GB7A 4OPZA 1GHIA 3BFCA 1SCWA 1K57A 3UN7A 3NDEA 5AQ9A 3ZVTA 4GDNA 1N4OA 1W8QA 2ZQCA 1Z6FA 2X71A 4X69A 3DW0A 3UPPA 4GN2A 1QMFA 3VOYA 5CRFA 4BLMA 4DE2A 3BFEA 2C5WB 2H0TA 2G2WA 4FSFA 1DY6A 4B4ZA 4GD8A 1XX2A 3WWXA 1ALQA 3UDFA 1PIOA 4E3NA 5HW3A 3PBRA 5F1FA 1PWGA 4OQIA 3VOZA 4C3QA 5GLCA 5CTMA 5E2EA 5L2FA 3VP3A 2ZQ9A 3IT9A 2V20A 4K91A 1YT4A 4QHCA 2X02A 4X53A 4UAAA 2Y2LA 1GA0A 1LI0A 3OPHA 2WGWB 4E3MA 2H5SA 1JTDA 3UE1A 3NIAA 3LO7A 2WGWA 3A3IA 5GHXA 3C4PA 1CK3A 3SH8A 1PWDA 1DJAA 2QZ6A 5KMWA 3ITBA 1KGGA 5HX9A 2X01A 3N6IA 2RCXA 2DCFA 1C3BA 2ZQDA 4X56A 3S22A 3HLEA 4DE1A 4OOLA 3G35A 2G2UA 2Y2MA 2EX6A 1VQQA 1O7EA 2Q9MA 2ZD8A 5FI7A 3GVBA 5I94A 5CXWA 4OQ0A 1WYCA 5AQAA 3BRMA 1RCJA 5A93A 3PBTA 1JWVA 5DTKA 4OLDA 3UDXA 4KQOA 2I72A 3I7JA
chains in the Genus database with same CATH superfamily
4PPRA 4R6LA 4ZJ2A 4OQGA 5F82A 2XDMA 1PI4A 3SOIA 1OJGA 3LR0A 2OSUA 3QP1A 1XPBA 4LV2A 5HPIA 3WS4A 3LR5A 1NY0A 4RX3A 3SW1A 4IBXA 2WUQA 5EOOA 3LICA 1NJ4A 4OPYA 2P7JA 3EEHA 3IWOA 1EWZA 3LIFA 4WYYA 1K6SA 3L7HA 3ZNYA 3B33A 4R70A 4LV3A 1ZC2A 1KE0A 3QP8A 3S7NA 4R38A 3OPPA 2UV0E 2W3EA 4JF6A 4BMWA 2EA9A 4FH4A 4GJ4A 3CMZA 4UA6A 3PBNA 4ME4A 4OVDA 1H5XA 4Y5FA 1ZG4A 4AFIA 4O8GA 3UB6A 3LI8A 1D06A 1DP9A 4ZAMA 3E4QA 2V0UA 5TFQA 3KO6A 4HOIA 3E98A 1K54A 4KG6A 4QB8A 1SDEA 4EBLA 1K55C 5I5LA 1PYYA 2J3TD 5HD5A 2A3UA 3IF6C 4C3QA 4OPRA 1YMSA 3GQZA 1W63M 3UE0A 4O0PA 1PI5A 5HL6A 4Y0TA 3C7VA 1XGJA 5EPHA 2IA2A 5DJTA 3OPRA 4HJ6A 4WEKA 4GHIB 3W2ZA 5A92A 1VEUB 2J80A 3CPTB 3LEQA 4JXSA 3QNBA 4JF5A 1Q2PA 3ZG0A 4E6XA 4ZDXA 1I2SA 3CUEA 3HLCA 3W8KA 4NXFA 3NY4A 4X68A 3T1SA 2HPBA 2ZMAA 4UQIM 5HWTA 2FFFB 1EW0A 2HP6A 5BOHA 5IHVA 3B42A 2W3GA 2ZM2A 2Z2MB 3RFBA 5CEDA 1G28A 2KLIA 3R7WA 2V8CA 5EM1A 3RJUA 3IS2A 4R4RA 2FFYA 1S6RA 1LHYA 4BENA 3N4IA 1ONGA 3E2LA 2Z6CA 3E4OA 4H8RA 3JVVA 2L1MA 1N9OA 3BEBA 3PAGA 4KZ9A 1YSPA 1GHPA 5HL1A 3HL9A 4MCWA 3ZDJA 4WZ5A 4C6YA 4BBTA 4S2NC 1PZOA 5KZHA 4P6ZS 5IS1A 2Z6DA 3H7WB 4DKIA 3A0VA 3EGDC 1TS6A 3S1YA 1FCMA 4NXBA 3N8SA 3Q82A 3MXRA 3TOIA 1FILA 2ACGA 3IQAA 4PHTA 1TDGA 2WGVA 3IX8A 1T18A 2WKEA 1ONHA 1W79A 4BBVA 4ETZA 3WS2A 2JKFA 5L07A 1YPRA 3BFGA 4LRYC 4HESA 4S2LA 4Y13A 1SZVA 5EECA 3BWLA 2VV6A 1OTBA 5KSCA 3UB9A 1ACFA 3KSIA 3FKWA 3VFHA 1S67L 2Y2OA 4JGQA 4Q0JA 3ZCZA 5HAPA 4HJ3A 2PRFA 3IHBA 2JKTM 4CLCD 5A90A 2PU4A 3C7UA 4BJPA 4EQ1A 2OOLA 3PBSA 1I5QA 3G34A 1PFLA 3VP1A 3IHAA 4IEDA 4EEUA 3F1NA 3QHYA 4K0WA 1TEMA 1S66L 5F5YA 1S0WA 4LLOB 5F83A 4NKPA 3P7NA 1J9MA 4B9OA 4KZ6A 2HP9A 4GLQA 1KGEA 1L0DA 4R3AA 5G18A 2DRWA 5AVFA 3F1PA 5FEGA 4DXCA 2WGIA 3DTIA 4JXGA 1OPXA 3NC8A 1BLSA 3MZEA 2Y59A 3Q7VB 4KZ3A 2M7VA 2OLUA 4IVIA 3DBAA 3N7WA 1K57C 4LENA 4I5SA 1ZTUA 3WRZA 2EWVA 3OLOA 4P85A 1ESIA 3O3VA 4DJ2A 4HHDA 5FDHA 3ZQ5A 4DDYA 5FASA 4HEFA 1XXMA 5HDDA 1HD8A 1ERMA 1E25A 2H10A 4EV4A 1HTZA 3O86A 3AGFA 2O0YA 1RGZA 3WRTA 4GB7A 3UN7A 3NDEA 3ZVTA 4GDNA 3MS6A 2ZQCA 3FC7A 3UB5P 1QMFA 3MQQA 3BFEA 4EW7A 2VX8A 2WKRA 3DTKA 3MF0A 1PWGA 3IBJA 2NUTC 2ZQ9A 2V20A 4QHCA 4X53A 1BYWA 4NXEA 1LI0A 3OPHA 2H5SA 4I3IA 1VETA 2WGWA 1XFNA 2QJ7A 1DJAA 5KMWA 5HX9A 2X01A 5J3WA 2RCXA 1MC0A 4X56A 2Y2MA 2Q9MA 1VQQA 1O7EA 5FI7A 3GVBA 3R4KA 1WYCA 2O9AA 2B02A 3PBTA 4XT2A 1JWVA 2PBDP 4OLDA 3UDXA 2VGLS 1NYYA 2XQZA 2ZC3B 3W4OA 4KG5A 5A91A 5F68A 5FQQA 2QMIA 3NECA 4R4SA 4R0QA 4OP5A 3A3FA 3CJMA 4WF0A 4G3KA 3M2KA 3GECA 3M6HA 3Q1FA 4PMAA 4HI4A 2EX2A 2V1BA 4S2KA 4S2PA 2JN7A 4ESPA 4N9KA 4HH2A 4L9GA 2XD5A 3H82B 4MN6A 2J8YA 4S2MA 4E3IA 4CQHA 1DP8A 4HIAA 4EQIA 5J8XA 3T1XA 4LV0A 2JKRI 1FOFA 4HBUA 2W1TA 4HP9A 1H3QA 2OAP1 1SDNA 3RXXA 3RXWA 3LFVA 1VHMA 2Y2QA 3G6OA 3BQ8A 3HLWA 5E2FA 1BLCA 3ZG8B 2XFSA 2PD7A 3CITA 1MWRA 1HZOA 5HAIA 1MZUA 4KZ8A 3HJIA 4L9FA 3VV4A 2VV7A 3IH8A 2R9XA 5CERA 4MMNA 1XA1A 5DTSA 4Z1WA 1ES4A 4FTXA 3A3EA 4F3LA 4HQAA 4KZ4A 4LRXC 2VK3A 4MN5A 4CJNA 5J4EA 1O07A 2PR5A 3LI9A 3N8RA 3BJNA 3O88A 1EROA 1QMEA 2R9WA 4II7A 1UWNX 4Y17A 3O87A 3FPVA 3NULA 4E3LA 2PT7A 3CG5A 3SH7A 2ZLYA 1GHMA 2HGVA 3D3OA 4GW9A 5EVIB 2VZWA 1PNEA 1ODVA 2ZQ7A 3BW6A 3QP4A 4DMZA 3LEZA 5CECA 1K55A 3CAXA 4L9EA 3LY4A 3ITAA 5TGFA 1W8YA 3IF6A 3KSGA 1TF1A 3MKEA 1YKDA 1PWCA 4NK3A 4FD8A 4CLCA 1NZUA 1WYBA 4U3TA 1XJ4A 4PM8A 1YSQA 3M6BA 3CWFA 1KE4A 4DF6A 1ZHHB 1KDSA 4XUXA 4EXOA 2I9VA 4IUHA 3JYIA 4EBPA 1ES3A 3BFDA 3FZCA 4GDBA 1OT6A 4FUWA 5DFYA 4EUVA 4KZAA 3P09A 4MLLA 2B5RA 1IKIA 4UA9A 1L0GA 1M40A 4RQ9A 4I3AA 1P9RA 1JVJA 3HUNA 2ZJ9A 1GSVA 3T4QA 3MKFA 2WKIA 2A24A 1LT0A 2J9PA 4GS9B 1NZOA 3IXDA 3RH8B 2P9VA 4JXWA 1YLWA 4OH0A 2OWJA 3Q07A 2EXAA 1FSYA 5DKLA 5GLBA 4S2NA 2XA7M 1WE4A 4MEZA 1IYOA 3KSFA 1G68A 3MR0A 2WAFA 4H6JB 4RVAA 1DRMA 3Q7ZA 4CLCC 3UMDA 3MFDA 1BUEA 1XGIA 1JWZA 5L10A 4Q0IA 5JYOA 5DTTA 2P08A 2QPNA 5CGXA 5G4YA 4ZJ1A 1OMEA 3IWIA 3ZHHA 4QY5A 4X1MA 3K3CA 1KDWA 3HBRA 3ISGA 4B93A 4MBFA 4O7DA 2VEAA 3MFXA 5HPFA 1GCEA 4M3KA 1H8MA 1OT9A 2Y2PA 2HF6A 1HVBA 4DE0A 5TBMA 3S7OA 2WKQA 1SKOB 2JCHA 1K38A 5DJUA 4PM5A 2CMNA 1NRFA 3LR4A 4X1LA 3VP4A 2XD1A 2ZL1A 1STZA 3NCKA 4JBFA 3ZG7B 3MQ0A 3IXBA 1G5UA 4P6BA 2JE5A 5M1AA 4BL2A 1MPLA 2PBYA 1RGYA 4L0LA 5FAOA 1YLJA 1MWUA 4QY6A 3ZVWA 4GD6A 4WZ4A 2PDRA 4BL3A 5AQBA 3VSLA 2K7SA 1MKIA 3BLSA 3T1QB 3NHQA 4YOFA 2O9CA 3T4JA 3IWQA 4MDZA 3UDIA 2J9OA 4WEJA 1DJBA 3C30A 1YM1A 5FQ9A 1IELA 4YWZA 5JYPA 2KOIA 1IYPA 2ZC6B 2PAVP 4OOYA 2XGNA 3E4PA 3GV9A 4N1XA 4KQQA 3KYQA 3QP5A 3VFFA 2V8FA 3BFFA 2J3WA 4RX2A 1Y4OA 3CLOA 2XR0A 2Y8HA 1IOUA 2ZBBA 4CLCE 2ZOIA 2JC7A 3TE8A 3BFCA 1K57A 3BY8A 3DW0A 3VOYA 4DE2A 2H0TA 1DY6A 3TW8A 5HW3A 5A8BA 5F1FA 1F5MA 4OQIA 2O99A 1KOUA 5GLCA 5E2EA 5L2FA 2M7UA 2Y2LA 3MXQA 4UQIS 2W1RA 4E3MA 3UE1A 3LO7A 3A3IA 5GHXA 1D1JA 3LR3A 4ARZB 1PWDA 2QZ6A 4DJ3A 3LUQA 4DE1A 3HLEA 4OOLA 1K0KA 5CXWA 2QJ5A 4NXGA 1RCJA 5A93A 3TRCA 4KQOA 3UB7A 5HWWA 3I7JA 4R23A 3ULFA 3F1OA 2WYXA 1W63Q 5AJGA 3U4LP 3PTEA 5M19A 4NEED 1V9ZA 2Y2IA 5EVLA 1IYSA 1LI9A 5GLAA 1XP4A 2VKSA 3DTMA 4E3JA 3OOVA 1JNUA 2JKGA 2G7UA 1TVFA 1ESUA 2RL3A 2BG1A 3SH9A 2JHEA 4R3BA 1T1CA 5E2GA 3FG8A 1UWPX 3UPNA 3MSHA 3A3DA 1A0KA 3LYXA 4DXBA 3BM6A 1IYQA 4IHQA 2VGLM 3NBLA 2HDQA 3D4FA 1CQAA 2EX8A 2PHYA 4HY8A 1GSXA 1L2SA 4MBKA 2A2LA 4OLGA 1K6RA 5IU1A 1KE3A 5HWVA 1MXOA 1OTEA 3CZDA 4DE3A 3T1RA 5HSQA 2GDNA 3HUOA 3WS0A 3SS5A 1SKFA 3OCNA 4EWFA 1PRQA 4B4XA 3KYEA 2IWBA 4Q8IA 4R1GA 3UNWA 1VM1A 5GHYA 3TSGA 2E8IA 2ZQ8A 3GTCA 5EVIC 4GCZA 5AVEA 4BQMA 2ZC5B 1F2KA 1E3UD 3NOTC 3UO9A 2W3DA 1Z09A 5DF7A 3ZG5A 2OAQ1 3C8CA 2IWDA 2WK0A 4ZTKA 5EOEA 4XUZA 4X6TA 2HDRA 1YLTA 3VSKA 3B47A 3SS4A 3MZFA 3Q81A 4RYEA 3AGEA 1FCOA 1LL5A 4GHIA 5FI6A 3HLDA 3PBQA 2ZC4B 5U47A 1VEUA 5DKKA 3N8LA 3CPTA 5K5BA 3HVFA 2QWSA 4WUJA 3A0SA 3EWKA 4KQDA 1CEFA 4HBTA 3IXHA 3EGXC 1PW1A 1LLBA 1UGUA 3BYDA 1H8YA 1KVMA 4N1HA 5FAPA 2EX9A 3LIEA 1FR6A 1Q2QA 2VA0A 3LY3A 1GSWA 1RP5A 4QPRA 2WKPA 3WS1A 4JXVA 4P0MA 2Q9NA 4HJ4A 5GLDA 2ZC7A 4S2IA 2WADA 1V9YA 1W5DA 4KENB 2IWCA 3T4LA 2P74A 3R7WB 3GRJA 5L8MA 4IVKA 1K56D 3IS2B 2B18A 3HLGA 4CPKA 4MBHA 1H8ZA 1OTIA 1ZG6A 4S2JA 5F6AA 3S7QA 3DWKA 4JKTA 4N92A 5IT5A 3MZDA 4Y3IA 3E2KA 4E6WA 3QP6A 2Y2HA 4DDSA 4D2OA 2V2FF 1ES5A 3RTYA 4E04A 3NI9A 3H7WA 1FIKA 3SZTA 4A5RA 2XFTA 4JF4A 4Y7PA 4RA7A 3LIDA 2YKHA 1NXYA 2PYRA 3BECA 4BD1A 4EU0A 3B3XA 1J3WA 4QD4A 3UE3A 4HP4A 5CGWA 1DP6A 1BTLA 5EVID 3FYZA 4QWOA 5KSHA 4OPQA 5M18A 4PM6A 3HLBA 1N9BA 3C2WA 3FPWA 3DTEA 1T1AA 3EQVA 4BD0A 3G2ZA 1S1YA 2HZ5A 1SHVA 2VV8A 4ETXA 2BLSA 3G30A 2KDKA 1MWSA 3CI6A 1GA9A 1CF0A 1AXBA 4OP8A 3NJAA 2KX6A 1IEMA 2V1ZA 1XKZA 1BSGA 2GX5A 3PHYA 4PM9A 3FKVA 3LIBA 1LSVA 1G6OA 3TG9A 3VP2A 3ZNTA 4FOFA 4YFMA 2PR6A 4PKYG 3F1NB 4I38A 4Y15A 1G6AA 3MQOA 1P97A 3P01A 3PYPA 3V3SA 3OC2A 4ZBEA 3C38A 4X25A 5FL3A 3G2YA 3F1PB 3W4PA 5HDCA 3D72A 3C5AA 4OONA 4O01A 5CEBA 3OCLA 4WELA 2L0WA 4FH2A 4WMCD 4N9LA 2XROA 4S2OA 5FQMA 4BBUA 1TS0A 1NYMA 3V67A 1BULA 4LV1A 2LB9A 3GMWA 3Q7VA 3H9WA 5EVEA 5TR7A 1TS8A 5CTNA 3MBZA 4FCFA 2Z2LB 2EFXA 3BQAA 1NLZA 3LGOA 2FZ0A 3UPOA 4F94A 4PM7A 3ICYA 5L09A 2EWWA 1T1BA 3LCEA 1OTAA 1ERQA 4Q0HA 3QNCA 5FQIA 4JGPA 2WZZA 2D02A 3ZYTA 2UWXA 4IUKA 5F69A 3AGDA 3PXPA 2XLNA 3T4OA 2OWHA 3KSHA 2FH5A 3PR6A 2K2NA 2J7VA 3HLFA 4Y0OA 5E43A 3T4TA 5HDSA 1L0EA 4K08A 4PAUA 1VB6A 1M6KA 1GHIA 3K2NA 1F9IA 1W8QA 1Z6FA 2PYPA 4LRZE 3UPPA 4GN2A 4P6ZM 2DMWA 5CRFA 4BLMA 5TJJA 4FSFA 2G2WA 3U2AA 3T12B 4GD8A 3E0YA 3WWXA 1PIOA 4E3NA 3VOZA 5CTMA 3VP3A 3IT9A 4G3VA 4K91A 1YT4A 1S4RA 3S7PA 3JVUA 1VETB 2WGWB 1JTDA 3NIAA 4EEPA 3C4PA 1CK3A 3SH8A 3TJZC 2LB5A 3HCYA 3KX0X 2W3FA 2VJWA 3N6IA 4WL9A 2DCFA 1C3BA 2ZQDA 3G35A 2G2UA 4LFUA 5I94A 1MKMA 4XT2B 5AQAA 3HJKA 3BRMA 5CX7A 5DTKA 1LSWA 5EM0A 2ZM8A 1E3UA 1X0OA 2V0WA 3EEAA 3HUMA 4JPMA 4GOGA 4R3JA 5G4ZA 3OPLA 4U0TA 4LCLA 4IBRA 1F98A 3JPUA 2AVXA 5FDSA 2Y79A 2A49A 2C6WB 2QYBA 2W3HA 4WBGA 5HARA 2W0NA 4UHUA 2P04A 2XH9A 4G3WA 4DRTA 3V5MA 1K4FA 2JKTI 3FWLA 2L4RA 4Y2FA 1HLUP 3V3RA 3HREA 1PZPA 2OV5A 1K54C 2QHKA 3H82A 3D9YA 2W1TB 4QU3A 4LGWA 4D60A 1S1ZA 1FR1A 3A3JA 4Y0UA 2XA7S 4B88A 1YLYA 5EUAA 5DVAA 3NDGA 5CHJA 3NOPC 1YAXA 3VE4A 4EUZA 2VLGA 1KGFA 1K56A 1BZAA 1DJCA 2ZM0A 5FA7A 3ZG9B 4WLAA 3ZGAB 4KG2A 4X55A 1W7FA 2WAEA 4F3LB 2EFUA 4GZBA 5CHMA 1XFQA 1XJ6A 3CUEC 3EQUA 3V50A 1BT5A 2O9BA 4NG2A 1ZKJA 4KUOA 2VGJA 2GNXA 2XRNA 1IFQA 1JWPA 5MC7A 1FSWA 2H0YA 3NOUC 5CGSA 2CC1A 5E2HA 3GDIA 2WKHA 5DF9A 4MNRA 2ZMFA 1NRJA 4C75A 1H0MA 4EESA 1XA7A 1TS7A 3S4XA 5FQKA 3G31A 3UY6A 1Y54A 3LIAA 3W4QA 3G32A 5LBRA 4JGRA 4E3OA 2DNSA 2E8JA 2HDSA 3WS5A 4UEYA 4YNRA 5GHZA 5EVIA 4DN0A 1MBLA 5CHUA 5HD3A 5EE8A 5F1GA 2W27A 3UMEA 1CEGA 1K25A 4JLFA 4WZ5C 4UA7A 3IF6B 2K31A 5KIZA 5FI2A 3M2JA 1TDLA 5HZHA 3QP2A 5HFOA 2GZAA 2Y4AA 3L9KA 2HDUA 4CLCB 1N9LA 5D3OA 3GR2A 3ZFZA 1I2WA 2ZQAA 4EBNA 1LSXA 3IX3A 1OTDA 1XJ3A 1L0FA 1YLZA 1EI5A 4GNUA 3C4OA 2PU2A 3T4SA 4QJGA 3GSGA 1YMXA 3IF5A 1S4SA 5GL9A 5AQ7A 4OOMA 3IH9A 3G4PA 1CI9A 3OBFA 4Z9QA 4WM9A 2Y2JA 5FATA 5DFXA 3T50A 1IKGA 2Y55A 4I39A 4WMCA 1KVLA 1PW8A 4GKUA 3IXGA 4LCMA 2A24B 4KZ5A 2JBFA 2Y2GA 2P9VB 2HP5A 1MWTA 4GS9A 1LL9A 2NUPC 4EETB 4U0XA 1T19A 1YLPA 2OLVA 1FQGA 2H28A 5DF8A 1Y28A 4OQHA 2HV1A 4H6JA 5FEFA 3MXSA 3UE6A 1BLPA 1BLHA 3OZHA 1CI8A 1P0ZA 2EXBA 1NLYA 1MY8A 4OKPA 4XXRA 1ES2A 5C5KA 4KUKA 2PD8A 1LL8A 3IBRA 2Y2KA 3PAEA 4P87A 4YINA 1NWZA 4WN5A 2M1CA 1CJFA 1TD5A 3IX4A 5TBMB 4ZRRA 2XEPA 2Y2NA 4K0XA 3O5YA 3UB8A 3VMAA 2ZL1B 5FAQA 1SKOA 3EOIA 4E3KA 1L3LA 2Y91A 4KZ7A 2MJ6A 3MJQA 3V39A 1YQSA 1JTGA 5FSRA 1AWIA 4IJGA 5HAQA 3BLMA 3K3DA 2YKFA 2BTFP 4JGOA 2XK1A 1FCNA 4M4XA 3VP0A 1OJ5A 2ZMVA 3FV7A 3PBOA 1E4DA 1XJ2A 1U60A 2XF3A 5EFWA 3P98A 2V9AA 2VGKA 4ZJ3A 4KQRA 4NETA 3BY9A 2Q0OA 2HJ9C 3A0RA 2WZXA 1K4EA 3DWZA 2BASA 3SS3A 3KYZA 5FQJA 4ID4A 4OPZA 1SCWA 3VOLA 5AQ9A 4LPZA 3VE3A 1N4OA 2INWA 4EERA 2QKPA 2X71A 4HH3A 4X69A 2C5WB 1N9NA 2J3TC 2D01A 4B4ZA 1XX2A 1ALQA 3UDFA 2GJ3A 3PBRA 2HJEA 4MN7A 2X02A 4UAAA 1GA0A 3T4KA 3CHWP 5EV0A 2R78A 1D7EA 4BWIA 4HNBA 4PKYA 2ZOHA 3ITBA 4ARZA 1KGGA 1P9WA 2B95A 3S22A 2JKRM 2EX6A 2ZD8A 1WA9A 4OQ0A 3DAVA 2V1AA 4I3JA 5J7EA 3F1OB 2XSSA 2I72A 3MMHA 4KZBA
chains in the Genus database with same CATH topology
4R23A 2WYXA 2ZM8A 4PPRA 1E3UA 1NYYA 2XQZA 3HUMA 3PTEA 2ZC3B 4JPMA 5M19A 4ZJ2A 4GOGA 4OQGA 5F82A 3W4OA 2XDMA 4KG5A 5A91A 1PI4A 3SOIA 4R3JA 2Y2IA 2OSUA 3OPLA 4U0TA 5EVLA 5FQQA 2QMIA 1IYSA 1LI9A 4R4SA 5GLAA 1XPBA 4LCLA 4LV2A 1XP4A 3DTMA 4E3JA 4IBRA 3WS4A 4R0QA 1NY0A 4RX3A 4OP5A 2A49A 2C6WB 3A3FA 3CJMA 4IBXA 4WBGA 1TVFA 1ESUA 2RL3A 2WUQA 5EOOA 2BG1A 5HARA 3M2KA 3SH9A 4R3BA 4UHUA 3M6HA 3Q1FA 5E2GA 1NJ4A 2XH9A 4PMAA 4OPYA 3UPNA 2EX2A 3A3DA 4DRTA 4S2KA 4S2PA 3BM6A 3IWOA 3V5MA 4DXBA 1EWZA 1K4FA 4WYYA 1K6SA 1IYQA 3ZNYA 3FWLA 4N9KA 4LV3A 3V3RA 2XD5A 1ZC2A 3NBLA 3HREA 1KE0A 1PZPA 2OV5A 1K54C 2HDQA 3D4FA 2EX8A 3OPPA 4JF6A 2J8YA 4S2MA 4E3IA 4EQIA 4FH4A 5J8XA 1L2SA 4QU3A 4LV0A 1FOFA 3CMZA 4HBUA 4MBKA 4UA6A 4OLGA 1K6RA 3PBNA 1FR1A 1KE3A 1MXOA 3A3JA 4OVDA 3CZDA 1SDNA 1H5XA 4Y0UA 4DE3A 3RXXA 1ZG4A 4B88A 1YLYA 5EUAA 3RXWA 5DVAA 2Y2QA 3NDGA 3HLWA 5CHJA 5E2FA 2GDNA 1BLCA 3HUOA 3WS0A 3SS5A 3ZG8B 2XFSA 1SKFA 3OCNA 4EUZA 1MWRA 4ZAMA 1HZOA 4EWFA 5HAIA 4KZ8A 4B4XA 1KGFA 2IWBA 1K56A 1BZAA 1DJCA 2ZM0A 5FA7A 4Q8IA 3ZG9B 4R1GA 3UNWA 1VM1A 3IH8A 4KG2A 5TFQA 3ZGAB 5GHYA 4X55A 1W7FA 2WAEA 3TSGA 2R9XA 2E8IA 5CERA 1XA1A 5DTSA 2ZQ8A 2EFUA 3GTCA 1ES4A 4GZBA 3A3EA 4KZ4A 5CHMA 5EVIC 4BQMA 3EQUA 3V50A 2ZC5B 1BT5A 1K54A 4KG6A 4QB8A 4CJNA 1ZKJA 1SDEA 1E3UD 1O07A 2VGJA 4EBLA 1K55C 3UO9A 1PYYA 1JWPA 3N8RA 5DF7A 1FSWA 4KZBA 2A3UA 2H0YA 3O88A 1EROA 1QMEA 3ZG5A 3IF6C 2R9WA 2IWDA 2WK0A 2CC1A 5CGSA 4XUZA 4X6TA 5E2HA 2HDRA 2WKHA 5EOEA 5DF9A 4ZTKA 4OPRA 1YMSA 1YLTA 4MNRA 3GQZA 3O87A 3UE0A 3VSKA 3SS4A 1PI5A 3MZFA 4Y0TA 3C7VA 1XGJA 5EPHA 3Q81A 4RYEA 4C75A 3OPRA 4E3LA 1XA7A 4WEKA 3AGEA 3S4XA 1FCOA 3CG5A 5A92A 1LL5A 5FQKA 5FI6A 3G31A 3HLDA 3UY6A 1Y54A 3PBQA 2ZC4B 3W4QA 3SH7A 5U47A 2ZLYA 3G32A 3N8LA 2DNSA 1GHMA 4JXSA 4E3OA 2HDSA 3HVFA 3QNBA 4JF5A 1Q2PA 3WS5A 3ZG0A 5EVIB 4E6XA 1CEFA 4HBTA 4ZDXA 2ZQ7A 1I2SA 5EVIA 5GHZA 1MBLA 3HLCA 3IXHA 3W8KA 5CHUA 3LEZA 5CECA 1PW1A 5EE8A 5F1GA 3NY4A 1LLBA 4X68A 3BYDA 1K55A 1H8YA 2HPBA 1CEGA 1KVMA 1K25A 4N1HA 3LY4A 4JLFA 3ITAA 4WZ5C 2EX9A 2ZMAA 5FAPA 5TGFA 4UA7A 3IF6B 1W8YA 1FR6A 3IF6A 1Q2QA 2FFFB 5FI2A 3M2JA 1TDLA 3MKEA 3LY3A 5HFOA 1RP5A 2HP6A 5BOHA 1PWCA 2Y4AA 3WS1A 5IHVA 2HDUA 4JXVA 4P0MA 2ZM2A 4NK3A 2Q9NA 2Z2MB 4FD8A 5D3OA 3GR2A 3ZFZA 5GLDA 1I2WA 2ZC7A 2ZQAA 4S2IA 4EBNA 2WADA 4KENB 1W5DA 5CEDA 1NZUA 1WYBA 2IWCA 2P74A 4U3TA 3GRJA 4PM8A 4IVKA 1K56D 1L0FA 3RJUA 3HLGA 4CPKA 1YLZA 4MBHA 1H8ZA 3M6BA 4R4RA 1ZG6A 2FFYA 1S6RA 1LHYA 1KE4A 3N4IA 4BENA 1ONGA 4S2JA 4DF6A 3E2LA 1EI5A 1KDSA 3DWKA 4GNUA 4H8RA 4JKTA 4XUXA 3C4OA 4N92A 2PU2A 3BEBA 3PAGA 4KZ9A 1GHPA 3JYIA 4EBPA 3GSGA 1YMXA 4QJGA 3MZDA 5HL1A 1ES3A 3E2KA 3IF5A 3HL9A 4E6WA 3ZDJA 4WZ5A 4C6YA 5GL9A 3BFDA 5AQ7A 4S2NC 4OOMA 3FZCA 1PZOA 2Y2HA 4GDBA 4DDSA 3IH9A 4D2OA 2V2FF 5KZHA 3G4PA 1ES5A 3NI9A 4KZAA 1CI9A 3P09A 4MLLA 4Z9QA 2B5RA 4WM9A 4DKIA 2Y2JA 1IKIA 4UA9A 5FATA 1L0GA 1M40A 1IKGA 2XFTA 2Y55A 4JF4A 3S1YA 4A5RA 1FCMA 3N8SA 4Y7PA 3Q82A 4RA7A 1JVJA 3MXRA 3TOIA 3HUNA 3IQAA 2ZJ9A 4WMCA 1KVLA 1NXYA 3BECA 4BD1A 1PW8A 1TDGA 2WGVA 3MKFA 4GKUA 3IXGA 3B3XA 2WKIA 2WKEA 4QD4A 4LCMA 4KZ5A 1ONHA 3UE3A 1W79A 5CGWA 2JBFA 2Y2GA 2P9VB 3WS2A 2J9PA 2HP5A 1NZOA 3IXDA 1MWTA 2P9VA 4JXWA 1BTLA 3BFGA 1LL9A 5EVID 4HESA 4S2LA 1YLWA 3FYZA 5EECA 5KSHA 4U0XA 4OH0A 1YLPA 4OPQA 2OLVA 3Q07A 5KSCA 1FQGA 5M18A 2EXAA 4PM6A 3HLBA 1FSYA 5GLBA 3FKWA 4S2NA 1WE4A 4MEZA 1N9BA 3VFHA 1IYOA 2Y2OA 5DF8A 1G68A 4OQHA 2WAFA 3ZCZA 3EQVA 5HAPA 4RVAA 4BD0A 3IHBA 3Q7ZA 3G2ZA 1SHVA 3MFDA 1BUEA 2BLSA 3G30A 1XGIA 1JWZA 1MWSA 3MXSA 5JYOA 5A90A 5DTTA 1BLPA 2PU4A 1GA9A 1BLHA 1AXBA 3C7UA 2QPNA 3OZHA 4BJPA 4OP8A 1CI8A 5CGXA 1IEMA 2EXBA 2V1ZA 1XKZA 1BSGA 3PBSA 4ZJ1A 1OMEA 1I5QA 4PM9A 1MY8A 3G34A 4OKPA 3FKVA 3IWIA 3ZHHA 4QY5A 3VP1A 3TG9A 3IHAA 4IEDA 3VP2A 3ZNTA 4YFMA 1KDWA 3HBRA 3ISGA 4XXRA 1ES2A 4MBFA 4O7DA 1GCEA 4M3KA 1G6AA 3QHYA 3PAEA 2Y2KA 4K0WA 4P87A 4YINA 1TEMA 2Y2PA 1S0WA 5F83A 1HVBA 2XEPA 4DE0A 3V3SA 2Y2NA 1J9MA 3OC2A 4K0XA 4ZBEA 4KZ6A 2HP9A 1KGEA 1L0DA 4PM5A 2JCHA 1K38A 3G2YA 5G18A 3VMAA 1NRFA 5FAQA 2DRWA 3W4PA 3VP4A 2XD1A 3C5AA 4OONA 4DXCA 2WGIA 5CEBA 3OCLA 3NCKA 4JBFA 4E3KA 3ZG7B 2Y91A 4KZ7A 3IXBA 4JXGA 4WELA 4P6BA 1YQSA 2JE5A 4FH2A 5M1AA 3V39A 4BL2A 1JTGA 3NC8A 4N9LA 4WMCD 5FSRA 1MPLA 2PBYA 1RGYA 4S2OA 5FQMA 5HAQA 3BLMA 4L0LA 5FAOA 1BLSA 1YLJA 1MWUA 3MZEA 1NYMA 4QY6A 3ZVWA 2Y59A 4GD6A 4WZ4A 1BULA 4LV1A 3Q7VB 4KZ3A 2XK1A 2OLUA 4IVIA 1FCNA 3GMWA 3Q7VA 4BL3A 5AQBA 3N7WA 3VSLA 5TR7A 5CTNA 1K57C 3MBZA 1MKIA 4FCFA 2Z2LB 3VP0A 4LENA 2EFXA 3BLSA 3FV7A 3IWQA 3PBOA 3UDIA 2J9OA 3UPOA 1E4DA 4F94A 4WEJA 1DJBA 4PM7A 1U60A 2XF3A 1YM1A 3WRZA 3P98A 2VGKA 4P85A 5FQ9A 4ZJ3A 1ESIA 1IELA 3LCEA 1ERQA 4KQRA 5JYPA 3O3VA 3QNCA 1IYPA 5FDHA 2ZC6B 5FQIA 4OOYA 2WZZA 4DDYA 5FASA 2XGNA 4HEFA 4NETA 2UWXA 3GV9A 3AGDA 4N1XA 1XXMA 2XLNA 4KQQA 1HD8A 1ERMA 2WZXA 1E25A 3VFFA 2J7VA 3HLFA 1K4EA 2H10A 4Y0OA 3BFFA 4RX2A 3DWZA 5E43A 3SS3A 4EV4A 1HTZA 2XR0A 1L0EA 3O86A 5FQJA 3AGFA 1RGZA 2JC7A 1M6KA 4ID4A 3WRTA 4GB7A 4OPZA 1GHIA 3BFCA 1SCWA 1K57A 3UN7A 3NDEA 5AQ9A 3ZVTA 4GDNA 1N4OA 1W8QA 2ZQCA 1Z6FA 2X71A 4X69A 3DW0A 3UPPA 4GN2A 1QMFA 3VOYA 5CRFA 4BLMA 4DE2A 3BFEA 2C5WB 2H0TA 2G2WA 4FSFA 1DY6A 4B4ZA 4GD8A 1XX2A 3WWXA 1ALQA 3UDFA 1PIOA 4E3NA 5HW3A 3PBRA 5F1FA 1PWGA 4OQIA 3VOZA 4C3QA 5GLCA 5CTMA 5E2EA 5L2FA 3VP3A 2ZQ9A 3IT9A 2V20A 4K91A 1YT4A 4QHCA 2X02A 4X53A 4UAAA 2Y2LA 1GA0A 1LI0A 3OPHA 2WGWB 4E3MA 2H5SA 1JTDA 3UE1A 3NIAA 3LO7A 2WGWA 3A3IA 5GHXA 3C4PA 1CK3A 3SH8A 1PWDA 1DJAA 2QZ6A 5KMWA 3ITBA 1KGGA 5HX9A 2X01A 3N6IA 2RCXA 2DCFA 1C3BA 2ZQDA 4X56A 3S22A 3HLEA 4DE1A 4OOLA 3G35A 2G2UA 2Y2MA 2EX6A 1VQQA 1O7EA 2Q9MA 2ZD8A 5FI7A 3GVBA 5I94A 5CXWA 4OQ0A 1WYCA 5AQAA 3BRMA 1RCJA 5A93A 3PBTA 1JWVA 5DTKA 4OLDA 3UDXA 4KQOA 2I72A 3I7JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4R23 A;  2WYX A;  2ZM8 A;  4PPR A;  1E3U A;  1NYY A;  2XQZ A;  3HUM A;  3PTE A;  2ZC3 B;  4JPM A;  5M19 A;  4ZJ2 A;  4GOG A;  4OQG A;  5F82 A;  3W4O A;  2XDM A;  4KG5 A;  5A91 A;  1PI4 A;  3SOI A;  4R3J A;  2Y2I A;  2OSU A;  3OPL A;  4U0T A;  5EVL A;  5FQQ A;  2QMI A;  1IYS A;  1LI9 A;  4R4S A;  5GLA A;  1XPB A;  4LCL A;  4LV2 A;  1XP4 A;  3DTM A;  4E3J A;  4IBR A;  3WS4 A;  4R0Q A;  1NY0 A;  4RX3 A;  4OP5 A;  2A49 A;  2C6W B;  3A3F A;  3CJM A;  4IBX A;  4WBG A;  1TVF A;  1ESU A;  2RL3 A;  2WUQ A;  5EOO A;  2BG1 A;  5HAR A;  3M2K A;  3SH9 A;  4R3B A;  4UHU A;  3M6H A;  3Q1F A;  5E2G A;  1NJ4 A;  2XH9 A;  4PMA A;  4OPY A;  3UPN A;  2EX2 A;  3A3D A;  4DRT A;  4S2K A;  4S2P A;  3BM6 A;  3IWO A;  3V5M A;  4DXB A;  1EWZ A;  1K4F A;  4WYY A;  1K6S A;  1IYQ A;  3ZNY A;  3FWL A;  4N9K A;  4LV3 A;  3V3R A;  2XD5 A;  1ZC2 A;  3NBL A;  3HRE A;  1KE0 A;  1PZP A;  2OV5 A;  1K54 C;  2HDQ A;  3D4F A;  2EX8 A;  3OPP A;  4JF6 A;  2J8Y A;  4S2M A;  4E3I A;  4EQI A;  4FH4 A;  5J8X A;  1L2S A;  4QU3 A;  4LV0 A;  1FOF A;  3CMZ A;  4HBU A;  4MBK A;  4UA6 A;  4OLG A;  1K6R A;  3PBN A;  1FR1 A;  1KE3 A;  1MXO A;  3A3J A;  4OVD A;  3CZD A;  1SDN A;  1H5X A;  4Y0U A;  4DE3 A;  3RXX A;  1ZG4 A;  4B88 A;  1YLY A;  5EUA A;  3RXW A;  5DVA A;  2Y2Q A;  3NDG A;  3HLW A;  5CHJ A;  5E2F A;  2GDN A;  1BLC A;  3HUO A;  3WS0 A;  3SS5 A;  3ZG8 B;  2XFS A;  1SKF A;  3OCN A;  4EUZ A;  1MWR A;  4ZAM A;  1HZO A;  4EWF A;  5HAI A;  4KZ8 A;  4B4X A;  1KGF A;  2IWB A;  1K56 A;  1BZA A;  1DJC A;  2ZM0 A;  5FA7 A;  4Q8I A;  3ZG9 B;  4R1G A;  3UNW A;  1VM1 A;  3IH8 A;  4KG2 A;  5TFQ A;  3ZGA B;  5GHY A;  4X55 A;  1W7F A;  2WAE A;  3TSG A;  2R9X A;  2E8I A;  5CER A;  1XA1 A;  5DTS A;  2ZQ8 A;  2EFU A;  3GTC A;  1ES4 A;  4GZB A;  3A3E A;  4KZ4 A;  5CHM A;  5EVI C;  4BQM A;  3EQU A;  3V50 A;  2ZC5 B;  1BT5 A;  1K54 A;  4KG6 A;  4QB8 A;  4CJN A;  1ZKJ A;  1SDE A;  1E3U D;  1O07 A;  2VGJ A;  4EBL A;  1K55 C;  3UO9 A;  1PYY A;  1JWP A;  3N8R A;  5DF7 A;  1FSW A;  4KZB A;  2A3U A;  2H0Y A;  3O88 A;  1ERO A;  1QME A;  3ZG5 A;  3IF6 C;  2R9W A;  2IWD A;  2WK0 A;  2CC1 A;  5CGS A;  4XUZ A;  4X6T A;  5E2H A;  2HDR A;  2WKH A;  5EOE A;  5DF9 A;  4ZTK A;  4OPR A;  1YMS A;  1YLT A;  4MNR A;  3GQZ A;  3O87 A;  3UE0 A;  3VSK A;  3SS4 A;  1PI5 A;  3MZF A;  4Y0T A;  3C7V A;  1XGJ A;  5EPH A;  3Q81 A;  4RYE A;  4C75 A;  3OPR A;  4E3L A;  1XA7 A;  4WEK A;  3AGE A;  3S4X A;  1FCO A;  3CG5 A;  5A92 A;  1LL5 A;  5FQK A;  5FI6 A;  3G31 A;  3HLD A;  3UY6 A;  1Y54 A;  3PBQ A;  2ZC4 B;  3W4Q A;  3SH7 A;  5U47 A;  2ZLY A;  3G32 A;  3N8L A;  2DNS A;  1GHM A;  4JXS A;  4E3O A;  2HDS A;  3HVF A;  3QNB A;  4JF5 A;  1Q2P A;  3WS5 A;  3ZG0 A;  5EVI B;  4E6X A;  1CEF A;  4HBT A;  4ZDX A;  2ZQ7 A;  1I2S A;  5EVI A;  5GHZ A;  1MBL A;  3HLC A;  3IXH A;  3W8K A;  5CHU A;  3LEZ A;  5CEC A;  1PW1 A;  5EE8 A;  5F1G A;  3NY4 A;  1LLB A;  4X68 A;  3BYD A;  1K55 A;  1H8Y A;  2HPB A;  1CEG A;  1KVM A;  1K25 A;  4N1H A;  3LY4 A;  4JLF A;  3ITA A;  4WZ5 C;  2EX9 A;  2ZMA A;  5FAP A;  5TGF A;  4UA7 A;  3IF6 B;  1W8Y A;  1FR6 A;  3IF6 A;  1Q2Q A;  2FFF B;  5FI2 A;  3M2J A;  1TDL A;  3MKE A;  3LY3 A;  5HFO A;  1RP5 A;  2HP6 A;  5BOH A;  1PWC A;  2Y4A A;  3WS1 A;  5IHV A;  2HDU A;  4JXV A;  4P0M A;  2ZM2 A;  4NK3 A;  2Q9N A;  2Z2M B;  4FD8 A;  5D3O A;  3GR2 A;  3ZFZ A;  5GLD A;  1I2W A;  2ZC7 A;  2ZQA A;  4S2I A;  4EBN A;  2WAD A;  4KEN B;  1W5D A;  5CED A;  1NZU A;  1WYB A;  2IWC A;  2P74 A;  4U3T A;  3GRJ A;  4PM8 A;  4IVK A;  1K56 D;  1L0F A;  3RJU A;  3HLG A;  4CPK A;  1YLZ A;  4MBH A;  1H8Z A;  3M6B A;  4R4R A;  1ZG6 A;  2FFY A;  1S6R A;  1LHY A;  1KE4 A;  3N4I A;  4BEN A;  1ONG A;  4S2J A;  4DF6 A;  3E2L A;  1EI5 A;  1KDS A;  3DWK A;  4GNU A;  4H8R A;  4JKT A;  4XUX A;  3C4O A;  4N92 A;  2PU2 A;  3BEB A;  3PAG A;  4KZ9 A;  1GHP A;  3JYI A;  4EBP A;  3GSG A;  1YMX A;  4QJG A;  3MZD A;  5HL1 A;  1ES3 A;  3E2K A;  3IF5 A;  3HL9 A;  4E6W A;  3ZDJ A;  4WZ5 A;  4C6Y A;  5GL9 A;  3BFD A;  5AQ7 A;  4S2N C;  4OOM A;  3FZC A;  1PZO A;  2Y2H A;  4GDB A;  4DDS A;  3IH9 A;  4D2O A;  2V2F F;  5KZH A;  3G4P A;  1ES5 A;  3NI9 A;  4KZA A;  1CI9 A;  3P09 A;  4MLL A;  4Z9Q A;  2B5R A;  4WM9 A;  4DKI A;  2Y2J A;  1IKI A;  4UA9 A;  5FAT A;  1L0G A;  1M40 A;  1IKG A;  2XFT A;  2Y55 A;  4JF4 A;  3S1Y A;  4A5R A;  1FCM A;  3N8S A;  4Y7P A;  3Q82 A;  4RA7 A;  1JVJ A;  3MXR A;  3TOI A;  3HUN A;  3IQA A;  2ZJ9 A;  4WMC A;  1KVL A;  1NXY A;  3BEC A;  4BD1 A;  1PW8 A;  1TDG A;  2WGV A;  3MKF A;  4GKU A;  3IXG A;  3B3X A;  2WKI A;  2WKE A;  4QD4 A;  4LCM A;  4KZ5 A;  1ONH A;  3UE3 A;  1W79 A;  5CGW A;  2JBF A;  2Y2G A;  2P9V B;  3WS2 A;  2J9P A;  2HP5 A;  1NZO A;  3IXD A;  1MWT A;  2P9V A;  4JXW A;  1BTL A;  3BFG A;  1LL9 A;  5EVI D;  4HES A;  4S2L A;  1YLW A;  3FYZ A;  5EEC A;  5KSH A;  4U0X A;  4OH0 A;  1YLP A;  4OPQ A;  2OLV A;  3Q07 A;  5KSC A;  1FQG A;  5M18 A;  2EXA A;  4PM6 A;  3HLB A;  1FSY A;  5GLB A;  3FKW A;  4S2N A;  1WE4 A;  4MEZ A;  1N9B A;  3VFH A;  1IYO A;  2Y2O A;  5DF8 A;  1G68 A;  4OQH A;  2WAF A;  3ZCZ A;  3EQV A;  5HAP A;  4RVA A;  4BD0 A;  3IHB A;  3Q7Z A;  3G2Z A;  1SHV A;  3MFD A;  1BUE A;  2BLS A;  3G30 A;  1XGI A;  1JWZ A;  1MWS A;  3MXS A;  5JYO A;  5A90 A;  5DTT A;  1BLP A;  2PU4 A;  1GA9 A;  1BLH A;  1AXB A;  3C7U A;  2QPN A;  3OZH A;  4BJP A;  4OP8 A;  1CI8 A;  5CGX A;  1IEM A;  2EXB A;  2V1Z A;  1XKZ A;  1BSG A;  3PBS A;  4ZJ1 A;  1OME A;  1I5Q A;  4PM9 A;  1MY8 A;  3G34 A;  4OKP A;  3FKV A;  3IWI A;  3ZHH A;  4QY5 A;  3VP1 A;  3TG9 A;  3IHA A;  4IED A;  3VP2 A;  3ZNT A;  4YFM A;  1KDW A;  3HBR A;  3ISG A;  4XXR A;  1ES2 A;  4MBF A;  4O7D A;  1GCE A;  4M3K A;  1G6A A;  3QHY A;  3PAE A;  2Y2K A;  4K0W A;  4P87 A;  4YIN A;  1TEM A;  2Y2P A;  1S0W A;  5F83 A;  1HVB A;  2XEP A;  4DE0 A;  3V3S A;  2Y2N A;  1J9M A;  3OC2 A;  4K0X A;  4ZBE A;  4KZ6 A;  2HP9 A;  1KGE A;  1L0D A;  4PM5 A;  2JCH A;  1K38 A;  3G2Y A;  5G18 A;  3VMA A;  1NRF A;  5FAQ A;  2DRW A;  3W4P A;  3VP4 A;  2XD1 A;  3C5A A;  4OON A;  4DXC A;  2WGI A;  5CEB A;  3OCL A;  3NCK A;  4JBF A;  4E3K A;  3ZG7 B;  2Y91 A;  4KZ7 A;  3IXB A;  4JXG A;  4WEL A;  4P6B A;  1YQS A;  2JE5 A;  4FH2 A;  5M1A A;  3V39 A;  4BL2 A;  1JTG A;  3NC8 A;  4N9L A;  4WMC D;  5FSR A;  1MPL A;  2PBY A;  1RGY A;  4S2O A;  5FQM A;  5HAQ A;  3BLM A;  4L0L A;  5FAO A;  1BLS A;  1YLJ A;  1MWU A;  3MZE A;  1NYM A;  4QY6 A;  3ZVW A;  2Y59 A;  4GD6 A;  4WZ4 A;  1BUL A;  4LV1 A;  3Q7V B;  4KZ3 A;  2XK1 A;  2OLU A;  4IVI A;  1FCN A;  3GMW A;  3Q7V A;  4BL3 A;  5AQB A;  3N7W A;  3VSL A;  5TR7 A;  5CTN A;  1K57 C;  3MBZ A;  1MKI A;  4FCF A;  2Z2L B;  3VP0 A;  4LEN A;  2EFX A;  3BLS A;  3FV7 A;  3IWQ A;  3PBO A;  3UDI A;  2J9O A;  3UPO A;  1E4D A;  4F94 A;  4WEJ A;  1DJB A;  4PM7 A;  1U60 A;  2XF3 A;  1YM1 A;  3WRZ A;  3P98 A;  2VGK A;  4P85 A;  5FQ9 A;  4ZJ3 A;  1ESI A;  1IEL A;  3LCE A;  1ERQ A;  4KQR A;  5JYP A;  3O3V A;  3QNC A;  1IYP A;  5FDH A;  2ZC6 B;  5FQI A;  4OOY A;  2WZZ A;  4DDY A;  5FAS A;  2XGN A;  4HEF A;  4NET A;  2UWX A;  3GV9 A;  3AGD A;  4N1X A;  1XXM A;  2XLN A;  4KQQ A;  1HD8 A;  1ERM A;  2WZX A;  1E25 A;  3VFF A;  2J7V A;  3HLF A;  1K4E A;  2H10 A;  4Y0O A;  3BFF A;  4RX2 A;  3DWZ A;  5E43 A;  3SS3 A;  4EV4 A;  1HTZ A;  2XR0 A;  1L0E A;  3O86 A;  5FQJ A;  3AGF A;  1RGZ A;  2JC7 A;  1M6K A;  4ID4 A;  3WRT A;  4GB7 A;  4OPZ A;  1GHI A;  3BFC A;  1SCW A;  1K57 A;  3UN7 A;  3NDE A;  5AQ9 A;  3ZVT A;  4GDN A;  1N4O A;  1W8Q A;  2ZQC A;  1Z6F A;  2X71 A;  4X69 A;  3DW0 A;  3UPP A;  4GN2 A;  1QMF A;  3VOY A;  5CRF A;  4BLM A;  4DE2 A;  3BFE A;  2C5W B;  2H0T A;  2G2W A;  4FSF A;  1DY6 A;  4B4Z A;  4GD8 A;  1XX2 A;  3WWX A;  1ALQ A;  3UDF A;  1PIO A;  4E3N A;  5HW3 A;  3PBR A;  5F1F A;  1PWG A;  4OQI A;  3VOZ A;  4C3Q A;  5GLC A;  5CTM A;  5E2E A;  5L2F A;  3VP3 A;  2ZQ9 A;  3IT9 A;  2V20 A;  4K91 A;  1YT4 A;  4QHC A;  2X02 A;  4X53 A;  4UAA A;  2Y2L A;  1GA0 A;  1LI0 A;  3OPH A;  2WGW B;  4E3M A;  2H5S A;  1JTD A;  3UE1 A;  3NIA A;  3LO7 A;  2WGW A;  3A3I A;  5GHX A;  3C4P A;  1CK3 A;  3SH8 A;  1PWD A;  1DJA A;  2QZ6 A;  5KMW A;  3ITB A;  1KGG A;  5HX9 A;  2X01 A;  3N6I A;  2RCX A;  2DCF A;  1C3B A;  2ZQD A;  4X56 A;  3S22 A;  3HLE A;  4DE1 A;  4OOL A;  3G35 A;  2G2U A;  2Y2M A;  2EX6 A;  1VQQ A;  1O7E A;  2Q9M A;  2ZD8 A;  5FI7 A;  3GVB A;  5I94 A;  5CXW A;  4OQ0 A;  1WYC A;  5AQA A;  3BRM A;  1RCJ A;  5A93 A;  3PBT A;  1JWV A;  5DTK A;  4OLD A;  3UDX A;  4KQO A;  2I72 A;  3I7J A; 
#chains in the Genus database with same CATH topology
 4PPR A;  4R6L A;  4ZJ2 A;  4OQG A;  5F82 A;  2XDM A;  1PI4 A;  3SOI A;  1OJG A;  3LR0 A;  2OSU A;  3QP1 A;  1XPB A;  4LV2 A;  5HPI A;  3WS4 A;  3LR5 A;  1NY0 A;  4RX3 A;  3SW1 A;  4IBX A;  2WUQ A;  5EOO A;  3LIC A;  1NJ4 A;  4OPY A;  2P7J A;  3EEH A;  3IWO A;  1EWZ A;  3LIF A;  4WYY A;  1K6S A;  3L7H A;  3ZNY A;  3B33 A;  4R70 A;  4LV3 A;  1ZC2 A;  1KE0 A;  3QP8 A;  3S7N A;  4R38 A;  3OPP A;  2UV0 E;  2W3E A;  4JF6 A;  4BMW A;  2EA9 A;  4FH4 A;  4GJ4 A;  3CMZ A;  4UA6 A;  3PBN A;  4ME4 A;  4OVD A;  1H5X A;  4Y5F A;  1ZG4 A;  4AFI A;  4O8G A;  3UB6 A;  3LI8 A;  1D06 A;  1DP9 A;  4ZAM A;  3E4Q A;  2V0U A;  5TFQ A;  3KO6 A;  4HOI A;  3E98 A;  1K54 A;  4KG6 A;  4QB8 A;  1SDE A;  4EBL A;  1K55 C;  5I5L A;  1PYY A;  2J3T D;  5HD5 A;  2A3U A;  3IF6 C;  4C3Q A;  4OPR A;  1YMS A;  3GQZ A;  1W63 M;  3UE0 A;  4O0P A;  1PI5 A;  5HL6 A;  4Y0T A;  3C7V A;  1XGJ A;  5EPH A;  2IA2 A;  5DJT A;  3OPR A;  4HJ6 A;  4WEK A;  4GHI B;  3W2Z A;  5A92 A;  1VEU B;  2J80 A;  3CPT B;  3LEQ A;  4JXS A;  3QNB A;  4JF5 A;  1Q2P A;  3ZG0 A;  4E6X A;  4ZDX A;  1I2S A;  3CUE A;  3HLC A;  3W8K A;  4NXF A;  3NY4 A;  4X68 A;  3T1S A;  2HPB A;  2ZMA A;  4UQI M;  5HWT A;  2FFF B;  1EW0 A;  2HP6 A;  5BOH A;  5IHV A;  3B42 A;  2W3G A;  2ZM2 A;  2Z2M B;  3RFB A;  5CED A;  1G28 A;  2KLI A;  3R7W A;  2V8C A;  5EM1 A;  3RJU A;  3IS2 A;  4R4R A;  2FFY A;  1S6R A;  1LHY A;  4BEN A;  3N4I A;  1ONG A;  3E2L A;  2Z6C A;  3E4O A;  4H8R A;  3JVV A;  2L1M A;  1N9O A;  3BEB A;  3PAG A;  4KZ9 A;  1YSP A;  1GHP A;  5HL1 A;  3HL9 A;  4MCW A;  3ZDJ A;  4WZ5 A;  4C6Y A;  4BBT A;  4S2N C;  1PZO A;  5KZH A;  4P6Z S;  5IS1 A;  2Z6D A;  3H7W B;  4DKI A;  3A0V A;  3EGD C;  1TS6 A;  3S1Y A;  1FCM A;  4NXB A;  3N8S A;  3Q82 A;  3MXR A;  3TOI A;  1FIL A;  2ACG A;  3IQA A;  4PHT A;  1TDG A;  2WGV A;  3IX8 A;  1T18 A;  2WKE A;  1ONH A;  1W79 A;  4BBV A;  4ETZ A;  3WS2 A;  2JKF A;  5L07 A;  1YPR A;  3BFG A;  4LRY C;  4HES A;  4S2L A;  4Y13 A;  1SZV A;  5EEC A;  3BWL A;  2VV6 A;  1OTB A;  5KSC A;  3UB9 A;  1ACF A;  3KSI A;  3FKW A;  3VFH A;  1S67 L;  2Y2O A;  4JGQ A;  4Q0J A;  3ZCZ A;  5HAP A;  4HJ3 A;  2PRF A;  3IHB A;  2JKT M;  4CLC D;  5A90 A;  2PU4 A;  3C7U A;  4BJP A;  4EQ1 A;  2OOL A;  3PBS A;  1I5Q A;  3G34 A;  1PFL A;  3VP1 A;  3IHA A;  4IED A;  4EEU A;  3F1N A;  3QHY A;  4K0W A;  1TEM A;  1S66 L;  5F5Y A;  1S0W A;  4LLO B;  5F83 A;  4NKP A;  3P7N A;  1J9M A;  4B9O A;  4KZ6 A;  2HP9 A;  4GLQ A;  1KGE A;  1L0D A;  4R3A A;  5G18 A;  2DRW A;  5AVF A;  3F1P A;  5FEG A;  4DXC A;  2WGI A;  3DTI A;  4JXG A;  1OPX A;  3NC8 A;  1BLS A;  3MZE A;  2Y59 A;  3Q7V B;  4KZ3 A;  2M7V A;  2OLU A;  4IVI A;  3DBA A;  3N7W A;  1K57 C;  4LEN A;  4I5S A;  1ZTU A;  3WRZ A;  2EWV A;  3OLO A;  4P85 A;  1ESI A;  3O3V A;  4DJ2 A;  4HHD A;  5FDH A;  3ZQ5 A;  4DDY A;  5FAS A;  4HEF A;  1XXM A;  5HDD A;  1HD8 A;  1ERM A;  1E25 A;  2H10 A;  4EV4 A;  1HTZ A;  3O86 A;  3AGF A;  2O0Y A;  1RGZ A;  3WRT A;  4GB7 A;  3UN7 A;  3NDE A;  3ZVT A;  4GDN A;  3MS6 A;  2ZQC A;  3FC7 A;  3UB5 P;  1QMF A;  3MQQ A;  3BFE A;  4EW7 A;  2VX8 A;  2WKR A;  3DTK A;  3MF0 A;  1PWG A;  3IBJ A;  2NUT C;  2ZQ9 A;  2V20 A;  4QHC A;  4X53 A;  1BYW A;  4NXE A;  1LI0 A;  3OPH A;  2H5S A;  4I3I A;  1VET A;  2WGW A;  1XFN A;  2QJ7 A;  1DJA A;  5KMW A;  5HX9 A;  2X01 A;  5J3W A;  2RCX A;  1MC0 A;  4X56 A;  2Y2M A;  2Q9M A;  1VQQ A;  1O7E A;  5FI7 A;  3GVB A;  3R4K A;  1WYC A;  2O9A A;  2B02 A;  3PBT A;  4XT2 A;  1JWV A;  2PBD P;  4OLD A;  3UDX A;  2VGL S;  1NYY A;  2XQZ A;  2ZC3 B;  3W4O A;  4KG5 A;  5A91 A;  5F68 A;  5FQQ A;  2QMI A;  3NEC A;  4R4S A;  4R0Q A;  4OP5 A;  3A3F A;  3CJM A;  4WF0 A;  4G3K A;  3M2K A;  3GEC A;  3M6H A;  3Q1F A;  4PMA A;  4HI4 A;  2EX2 A;  2V1B A;  4S2K A;  4S2P A;  2JN7 A;  4ESP A;  4N9K A;  4HH2 A;  4L9G A;  2XD5 A;  3H82 B;  4MN6 A;  2J8Y A;  4S2M A;  4E3I A;  4CQH A;  1DP8 A;  4HIA A;  4EQI A;  5J8X A;  3T1X A;  4LV0 A;  2JKR I;  1FOF A;  4HBU A;  2W1T A;  4HP9 A;  1H3Q A;  2OAP 1;  1SDN A;  3RXX A;  3RXW A;  3LFV A;  1VHM A;  2Y2Q A;  3G6O A;  3BQ8 A;  3HLW A;  5E2F A;  1BLC A;  3ZG8 B;  2XFS A;  2PD7 A;  3CIT A;  1MWR A;  1HZO A;  5HAI A;  1MZU A;  4KZ8 A;  3HJI A;  4L9F A;  3VV4 A;  2VV7 A;  3IH8 A;  2R9X A;  5CER A;  4MMN A;  1XA1 A;  5DTS A;  4Z1W A;  1ES4 A;  4FTX A;  3A3E A;  4F3L A;  4HQA A;  4KZ4 A;  4LRX C;  2VK3 A;  4MN5 A;  4CJN A;  5J4E A;  1O07 A;  2PR5 A;  3LI9 A;  3N8R A;  3BJN A;  3O88 A;  1ERO A;  1QME A;  2R9W A;  4II7 A;  1UWN X;  4Y17 A;  3O87 A;  3FPV A;  3NUL A;  4E3L A;  2PT7 A;  3CG5 A;  3SH7 A;  2ZLY A;  1GHM A;  2HGV A;  3D3O A;  4GW9 A;  5EVI B;  2VZW A;  1PNE A;  1ODV A;  2ZQ7 A;  3BW6 A;  3QP4 A;  4DMZ A;  3LEZ A;  5CEC A;  1K55 A;  3CAX A;  4L9E A;  3LY4 A;  3ITA A;  5TGF A;  1W8Y A;  3IF6 A;  3KSG A;  1TF1 A;  3MKE A;  1YKD A;  1PWC A;  4NK3 A;  4FD8 A;  4CLC A;  1NZU A;  1WYB A;  4U3T A;  1XJ4 A;  4PM8 A;  1YSQ A;  3M6B A;  3CWF A;  1KE4 A;  4DF6 A;  1ZHH B;  1KDS A;  4XUX A;  4EXO A;  2I9V A;  4IUH A;  3JYI A;  4EBP A;  1ES3 A;  3BFD A;  3FZC A;  4GDB A;  1OT6 A;  4FUW A;  5DFY A;  4EUV A;  4KZA A;  3P09 A;  4MLL A;  2B5R A;  1IKI A;  4UA9 A;  1L0G A;  1M40 A;  4RQ9 A;  4I3A A;  1P9R A;  1JVJ A;  3HUN A;  2ZJ9 A;  1GSV A;  3T4Q A;  3MKF A;  2WKI A;  2A24 A;  1LT0 A;  2J9P A;  4GS9 B;  1NZO A;  3IXD A;  3RH8 B;  2P9V A;  4JXW A;  1YLW A;  4OH0 A;  2OWJ A;  3Q07 A;  2EXA A;  1FSY A;  5DKL A;  5GLB A;  4S2N A;  2XA7 M;  1WE4 A;  4MEZ A;  1IYO A;  3KSF A;  1G68 A;  3MR0 A;  2WAF A;  4H6J B;  4RVA A;  1DRM A;  3Q7Z A;  4CLC C;  3UMD A;  3MFD A;  1BUE A;  1XGI A;  1JWZ A;  5L10 A;  4Q0I A;  5JYO A;  5DTT A;  2P08 A;  2QPN A;  5CGX A;  5G4Y A;  4ZJ1 A;  1OME A;  3IWI A;  3ZHH A;  4QY5 A;  4X1M A;  3K3C A;  1KDW A;  3HBR A;  3ISG A;  4B93 A;  4MBF A;  4O7D A;  2VEA A;  3MFX A;  5HPF A;  1GCE A;  4M3K A;  1H8M A;  1OT9 A;  2Y2P A;  2HF6 A;  1HVB A;  4DE0 A;  5TBM A;  3S7O A;  2WKQ A;  1SKO B;  2JCH A;  1K38 A;  5DJU A;  4PM5 A;  2CMN A;  1NRF A;  3LR4 A;  4X1L A;  3VP4 A;  2XD1 A;  2ZL1 A;  1STZ A;  3NCK A;  4JBF A;  3ZG7 B;  3MQ0 A;  3IXB A;  1G5U A;  4P6B A;  2JE5 A;  5M1A A;  4BL2 A;  1MPL A;  2PBY A;  1RGY A;  4L0L A;  5FAO A;  1YLJ A;  1MWU A;  4QY6 A;  3ZVW A;  4GD6 A;  4WZ4 A;  2PDR A;  4BL3 A;  5AQB A;  3VSL A;  2K7S A;  1MKI A;  3BLS A;  3T1Q B;  3NHQ A;  4YOF A;  2O9C A;  3T4J A;  3IWQ A;  4MDZ A;  3UDI A;  2J9O A;  4WEJ A;  1DJB A;  3C30 A;  1YM1 A;  5FQ9 A;  1IEL A;  4YWZ A;  5JYP A;  2KOI A;  1IYP A;  2ZC6 B;  2PAV P;  4OOY A;  2XGN A;  3E4P A;  3GV9 A;  4N1X A;  4KQQ A;  3KYQ A;  3QP5 A;  3VFF A;  2V8F A;  3BFF A;  2J3W A;  4RX2 A;  1Y4O A;  3CLO A;  2XR0 A;  2Y8H A;  1IOU A;  2ZBB A;  4CLC E;  2ZOI A;  2JC7 A;  3TE8 A;  3BFC A;  1K57 A;  3BY8 A;  3DW0 A;  3VOY A;  4DE2 A;  2H0T A;  1DY6 A;  3TW8 A;  5HW3 A;  5A8B A;  5F1F A;  1F5M A;  4OQI A;  2O99 A;  1KOU A;  5GLC A;  5E2E A;  5L2F A;  2M7U A;  2Y2L A;  3MXQ A;  4UQI S;  2W1R A;  4E3M A;  3UE1 A;  3LO7 A;  3A3I A;  5GHX A;  1D1J A;  3LR3 A;  4ARZ B;  1PWD A;  2QZ6 A;  4DJ3 A;  3LUQ A;  4DE1 A;  3HLE A;  4OOL A;  1K0K A;  5CXW A;  2QJ5 A;  4NXG A;  1RCJ A;  5A93 A;  3TRC A;  4KQO A;  3UB7 A;  5HWW A;  3I7J A;  4R23 A;  3ULF A;  3F1O A;  2WYX A;  1W63 Q;  5AJG A;  3U4L P;  3PTE A;  5M19 A;  4NEE D;  1V9Z A;  2Y2I A;  5EVL A;  1IYS A;  1LI9 A;  5GLA A;  1XP4 A;  2VKS A;  3DTM A;  4E3J A;  3OOV A;  1JNU A;  2JKG A;  2G7U A;  1TVF A;  1ESU A;  2RL3 A;  2BG1 A;  3SH9 A;  2JHE A;  4R3B A;  1T1C A;  5E2G A;  3FG8 A;  1UWP X;  3UPN A;  3MSH A;  3A3D A;  1A0K A;  3LYX A;  4DXB A;  3BM6 A;  1IYQ A;  4IHQ A;  2VGL M;  3NBL A;  2HDQ A;  3D4F A;  1CQA A;  2EX8 A;  2PHY A;  4HY8 A;  1GSX A;  1L2S A;  4MBK A;  2A2L A;  4OLG A;  1K6R A;  5IU1 A;  1KE3 A;  5HWV A;  1MXO A;  1OTE A;  3CZD A;  4DE3 A;  3T1R A;  5HSQ A;  2GDN A;  3HUO A;  3WS0 A;  3SS5 A;  1SKF A;  3OCN A;  4EWF A;  1PRQ A;  4B4X A;  3KYE A;  2IWB A;  4Q8I A;  4R1G A;  3UNW A;  1VM1 A;  5GHY A;  3TSG A;  2E8I A;  2ZQ8 A;  3GTC A;  5EVI C;  4GCZ A;  5AVE A;  4BQM A;  2ZC5 B;  1F2K A;  1E3U D;  3NOT C;  3UO9 A;  2W3D A;  1Z09 A;  5DF7 A;  3ZG5 A;  2OAQ 1;  3C8C A;  2IWD A;  2WK0 A;  4ZTK A;  5EOE A;  4XUZ A;  4X6T A;  2HDR A;  1YLT A;  3VSK A;  3B47 A;  3SS4 A;  3MZF A;  3Q81 A;  4RYE A;  3AGE A;  1FCO A;  1LL5 A;  4GHI A;  5FI6 A;  3HLD A;  3PBQ A;  2ZC4 B;  5U47 A;  1VEU A;  5DKK A;  3N8L A;  3CPT A;  5K5B A;  3HVF A;  2QWS A;  4WUJ A;  3A0S A;  3EWK A;  4KQD A;  1CEF A;  4HBT A;  3IXH A;  3EGX C;  1PW1 A;  1LLB A;  1UGU A;  3BYD A;  1H8Y A;  1KVM A;  4N1H A;  5FAP A;  2EX9 A;  3LIE A;  1FR6 A;  1Q2Q A;  2VA0 A;  3LY3 A;  1GSW A;  1RP5 A;  4QPR A;  2WKP A;  3WS1 A;  4JXV A;  4P0M A;  2Q9N A;  4HJ4 A;  5GLD A;  2ZC7 A;  4S2I A;  2WAD A;  1V9Y A;  1W5D A;  4KEN B;  2IWC A;  3T4L A;  2P74 A;  3R7W B;  3GRJ A;  5L8M A;  4IVK A;  1K56 D;  3IS2 B;  2B18 A;  3HLG A;  4CPK A;  4MBH A;  1H8Z A;  1OTI A;  1ZG6 A;  4S2J A;  5F6A A;  3S7Q A;  3DWK A;  4JKT A;  4N92 A;  5IT5 A;  3MZD A;  4Y3I A;  3E2K A;  4E6W A;  3QP6 A;  2Y2H A;  4DDS A;  4D2O A;  2V2F F;  1ES5 A;  3RTY A;  4E04 A;  3NI9 A;  3H7W A;  1FIK A;  3SZT A;  4A5R A;  2XFT A;  4JF4 A;  4Y7P A;  4RA7 A;  3LID A;  2YKH A;  1NXY A;  2PYR A;  3BEC A;  4BD1 A;  4EU0 A;  3B3X A;  1J3W A;  4QD4 A;  3UE3 A;  4HP4 A;  5CGW A;  1DP6 A;  1BTL A;  5EVI D;  3FYZ A;  4QWO A;  5KSH A;  4OPQ A;  5M18 A;  4PM6 A;  3HLB A;  1N9B A;  3C2W A;  3FPW A;  3DTE A;  1T1A A;  3EQV A;  4BD0 A;  3G2Z A;  1S1Y A;  2HZ5 A;  1SHV A;  2VV8 A;  4ETX A;  2BLS A;  3G30 A;  2KDK A;  1MWS A;  3CI6 A;  1GA9 A;  1CF0 A;  1AXB A;  4OP8 A;  3NJA A;  2KX6 A;  1IEM A;  2V1Z A;  1XKZ A;  1BSG A;  2GX5 A;  3PHY A;  4PM9 A;  3FKV A;  3LIB A;  1LSV A;  1G6O A;  3TG9 A;  3VP2 A;  3ZNT A;  4FOF A;  4YFM A;  2PR6 A;  4PKY G;  3F1N B;  4I38 A;  4Y15 A;  1G6A A;  3MQO A;  1P97 A;  3P01 A;  3PYP A;  3V3S A;  3OC2 A;  4ZBE A;  3C38 A;  4X25 A;  5FL3 A;  3G2Y A;  3F1P B;  3W4P A;  5HDC A;  3D72 A;  3C5A A;  4OON A;  4O01 A;  5CEB A;  3OCL A;  4WEL A;  2L0W A;  4FH2 A;  4WMC D;  4N9L A;  2XRO A;  4S2O A;  5FQM A;  4BBU A;  1TS0 A;  1NYM A;  3V67 A;  1BUL A;  4LV1 A;  2LB9 A;  3GMW A;  3Q7V A;  3H9W A;  5EVE A;  5TR7 A;  1TS8 A;  5CTN A;  3MBZ A;  4FCF A;  2Z2L B;  2EFX A;  3BQA A;  1NLZ A;  3LGO A;  2FZ0 A;  3UPO A;  4F94 A;  4PM7 A;  3ICY A;  5L09 A;  2EWW A;  1T1B A;  3LCE A;  1OTA A;  1ERQ A;  4Q0H A;  3QNC A;  5FQI A;  4JGP A;  2WZZ A;  2D02 A;  3ZYT A;  2UWX A;  4IUK A;  5F69 A;  3AGD A;  3PXP A;  2XLN A;  3T4O A;  2OWH A;  3KSH A;  2FH5 A;  3PR6 A;  2K2N A;  2J7V A;  3HLF A;  4Y0O A;  5E43 A;  3T4T A;  5HDS A;  1L0E A;  4K08 A;  4PAU A;  1VB6 A;  1M6K A;  1GHI A;  3K2N A;  1F9I A;  1W8Q A;  1Z6F A;  2PYP A;  4LRZ E;  3UPP A;  4GN2 A;  4P6Z M;  2DMW A;  5CRF A;  4BLM A;  5TJJ A;  4FSF A;  2G2W A;  3U2A A;  3T12 B;  4GD8 A;  3E0Y A;  3WWX A;  1PIO A;  4E3N A;  3VOZ A;  5CTM A;  3VP3 A;  3IT9 A;  4G3V A;  4K91 A;  1YT4 A;  1S4R A;  3S7P A;  3JVU A;  1VET B;  2WGW B;  1JTD A;  3NIA A;  4EEP A;  3C4P A;  1CK3 A;  3SH8 A;  3TJZ C;  2LB5 A;  3HCY A;  3KX0 X;  2W3F A;  2VJW A;  3N6I A;  4WL9 A;  2DCF A;  1C3B A;  2ZQD A;  3G35 A;  2G2U A;  4LFU A;  5I94 A;  1MKM A;  4XT2 B;  5AQA A;  3HJK A;  3BRM A;  5CX7 A;  5DTK A;  1LSW A;  5EM0 A;  2ZM8 A;  1E3U A;  1X0O A;  2V0W A;  3EEA A;  3HUM A;  4JPM A;  4GOG A;  4R3J A;  5G4Z A;  3OPL A;  4U0T A;  4LCL A;  4IBR A;  1F98 A;  3JPU A;  2AVX A;  5FDS A;  2Y79 A;  2A49 A;  2C6W B;  2QYB A;  2W3H A;  4WBG A;  5HAR A;  2W0N A;  4UHU A;  2P04 A;  2XH9 A;  4G3W A;  4DRT A;  3V5M A;  1K4F A;  2JKT I;  3FWL A;  2L4R A;  4Y2F A;  1HLU P;  3V3R A;  3HRE A;  1PZP A;  2OV5 A;  1K54 C;  2QHK A;  3H82 A;  3D9Y A;  2W1T B;  4QU3 A;  4LGW A;  4D60 A;  1S1Z A;  1FR1 A;  3A3J A;  4Y0U A;  2XA7 S;  4B88 A;  1YLY A;  5EUA A;  5DVA A;  3NDG A;  5CHJ A;  3NOP C;  1YAX A;  3VE4 A;  4EUZ A;  2VLG A;  1KGF A;  1K56 A;  1BZA A;  1DJC A;  2ZM0 A;  5FA7 A;  3ZG9 B;  4WLA A;  3ZGA B;  4KG2 A;  4X55 A;  1W7F A;  2WAE A;  4F3L B;  2EFU A;  4GZB A;  5CHM A;  1XFQ A;  1XJ6 A;  3CUE C;  3EQU A;  3V50 A;  1BT5 A;  2O9B A;  4NG2 A;  1ZKJ A;  4KUO A;  2VGJ A;  2GNX A;  2XRN A;  1IFQ A;  1JWP A;  5MC7 A;  1FSW A;  2H0Y A;  3NOU C;  5CGS A;  2CC1 A;  5E2H A;  3GDI A;  2WKH A;  5DF9 A;  4MNR A;  2ZMF A;  1NRJ A;  4C75 A;  1H0M A;  4EES A;  1XA7 A;  1TS7 A;  3S4X A;  5FQK A;  3G31 A;  3UY6 A;  1Y54 A;  3LIA A;  3W4Q A;  3G32 A;  5LBR A;  4JGR A;  4E3O A;  2DNS A;  2E8J A;  2HDS A;  3WS5 A;  4UEY A;  4YNR A;  5GHZ A;  5EVI A;  4DN0 A;  1MBL A;  5CHU A;  5HD3 A;  5EE8 A;  5F1G A;  2W27 A;  3UME A;  1CEG A;  1K25 A;  4JLF A;  4WZ5 C;  4UA7 A;  3IF6 B;  2K31 A;  5KIZ A;  5FI2 A;  3M2J A;  1TDL A;  5HZH A;  3QP2 A;  5HFO A;  2GZA A;  2Y4A A;  3L9K A;  2HDU A;  4CLC B;  1N9L A;  5D3O A;  3GR2 A;  3ZFZ A;  1I2W A;  2ZQA A;  4EBN A;  1LSX A;  3IX3 A;  1OTD A;  1XJ3 A;  1L0F A;  1YLZ A;  1EI5 A;  4GNU A;  3C4O A;  2PU2 A;  3T4S A;  4QJG A;  3GSG A;  1YMX A;  3IF5 A;  1S4S A;  5GL9 A;  5AQ7 A;  4OOM A;  3IH9 A;  3G4P A;  1CI9 A;  3OBF A;  4Z9Q A;  4WM9 A;  2Y2J A;  5FAT A;  5DFX A;  3T50 A;  1IKG A;  2Y55 A;  4I39 A;  4WMC A;  1KVL A;  1PW8 A;  4GKU A;  3IXG A;  4LCM A;  2A24 B;  4KZ5 A;  2JBF A;  2Y2G A;  2P9V B;  2HP5 A;  1MWT A;  4GS9 A;  1LL9 A;  2NUP C;  4EET B;  4U0X A;  1T19 A;  1YLP A;  2OLV A;  1FQG A;  2H28 A;  5DF8 A;  1Y28 A;  4OQH A;  2HV1 A;  4H6J A;  5FEF A;  3MXS A;  3UE6 A;  1BLP A;  1BLH A;  3OZH A;  1CI8 A;  1P0Z A;  2EXB A;  1NLY A;  1MY8 A;  4OKP A;  4XXR A;  1ES2 A;  5C5K A;  4KUK A;  2PD8 A;  1LL8 A;  3IBR A;  2Y2K A;  3PAE A;  4P87 A;  4YIN A;  1NWZ A;  4WN5 A;  2M1C A;  1CJF A;  1TD5 A;  3IX4 A;  5TBM B;  4ZRR A;  2XEP A;  2Y2N A;  4K0X A;  3O5Y A;  3UB8 A;  3VMA A;  2ZL1 B;  5FAQ A;  1SKO A;  3EOI A;  4E3K A;  1L3L A;  2Y91 A;  4KZ7 A;  2MJ6 A;  3MJQ A;  3V39 A;  1YQS A;  1JTG A;  5FSR A;  1AWI A;  4IJG A;  5HAQ A;  3BLM A;  3K3D A;  2YKF A;  2BTF P;  4JGO A;  2XK1 A;  1FCN A;  4M4X A;  3VP0 A;  1OJ5 A;  2ZMV A;  3FV7 A;  3PBO A;  1E4D A;  1XJ2 A;  1U60 A;  2XF3 A;  5EFW A;  3P98 A;  2V9A A;  2VGK A;  4ZJ3 A;  4KQR A;  4NET A;  3BY9 A;  2Q0O A;  2HJ9 C;  3A0R A;  2WZX A;  1K4E A;  3DWZ A;  2BAS A;  3SS3 A;  3KYZ A;  5FQJ A;  4ID4 A;  4OPZ A;  1SCW A;  3VOL A;  5AQ9 A;  4LPZ A;  3VE3 A;  1N4O A;  2INW A;  4EER A;  2QKP A;  2X71 A;  4HH3 A;  4X69 A;  2C5W B;  1N9N A;  2J3T C;  2D01 A;  4B4Z A;  1XX2 A;  1ALQ A;  3UDF A;  2GJ3 A;  3PBR A;  2HJE A;  4MN7 A;  2X02 A;  4UAA A;  1GA0 A;  3T4K A;  3CHW P;  5EV0 A;  2R78 A;  1D7E A;  4BWI A;  4HNB A;  4PKY A;  2ZOH A;  3ITB A;  4ARZ A;  1KGG A;  1P9W A;  2B95 A;  3S22 A;  2JKR M;  2EX6 A;  2ZD8 A;  1WA9 A;  4OQ0 A;  3DAV A;  2V1A A;  4I3J A;  5J7E A;  3F1O B;  2XSS A;  2I72 A;  3MMH A;  4KZB A; 
#chains in the Genus database with same CATH homology
 4R23 A;  2WYX A;  2ZM8 A;  4PPR A;  1E3U A;  1NYY A;  2XQZ A;  3HUM A;  3PTE A;  2ZC3 B;  4JPM A;  5M19 A;  4ZJ2 A;  4GOG A;  4OQG A;  5F82 A;  3W4O A;  2XDM A;  4KG5 A;  5A91 A;  1PI4 A;  3SOI A;  4R3J A;  2Y2I A;  2OSU A;  3OPL A;  4U0T A;  5EVL A;  5FQQ A;  2QMI A;  1IYS A;  1LI9 A;  4R4S A;  5GLA A;  1XPB A;  4LCL A;  4LV2 A;  1XP4 A;  3DTM A;  4E3J A;  4IBR A;  3WS4 A;  4R0Q A;  1NY0 A;  4RX3 A;  4OP5 A;  2A49 A;  2C6W B;  3A3F A;  3CJM A;  4IBX A;  4WBG A;  1TVF A;  1ESU A;  2RL3 A;  2WUQ A;  5EOO A;  2BG1 A;  5HAR A;  3M2K A;  3SH9 A;  4R3B A;  4UHU A;  3M6H A;  3Q1F A;  5E2G A;  1NJ4 A;  2XH9 A;  4PMA A;  4OPY A;  3UPN A;  2EX2 A;  3A3D A;  4DRT A;  4S2K A;  4S2P A;  3BM6 A;  3IWO A;  3V5M A;  4DXB A;  1EWZ A;  1K4F A;  4WYY A;  1K6S A;  1IYQ A;  3ZNY A;  3FWL A;  4N9K A;  4LV3 A;  3V3R A;  2XD5 A;  1ZC2 A;  3NBL A;  3HRE A;  1KE0 A;  1PZP A;  2OV5 A;  1K54 C;  2HDQ A;  3D4F A;  2EX8 A;  3OPP A;  4JF6 A;  2J8Y A;  4S2M A;  4E3I A;  4EQI A;  4FH4 A;  5J8X A;  1L2S A;  4QU3 A;  4LV0 A;  1FOF A;  3CMZ A;  4HBU A;  4MBK A;  4UA6 A;  4OLG A;  1K6R A;  3PBN A;  1FR1 A;  1KE3 A;  1MXO A;  3A3J A;  4OVD A;  3CZD A;  1SDN A;  1H5X A;  4Y0U A;  4DE3 A;  3RXX A;  1ZG4 A;  4B88 A;  1YLY A;  5EUA A;  3RXW A;  5DVA A;  2Y2Q A;  3NDG A;  3HLW A;  5CHJ A;  5E2F A;  2GDN A;  1BLC A;  3HUO A;  3WS0 A;  3SS5 A;  3ZG8 B;  2XFS A;  1SKF A;  3OCN A;  4EUZ A;  1MWR A;  4ZAM A;  1HZO A;  4EWF A;  5HAI A;  4KZ8 A;  4B4X A;  1KGF A;  2IWB A;  1K56 A;  1BZA A;  1DJC A;  2ZM0 A;  5FA7 A;  4Q8I A;  3ZG9 B;  4R1G A;  3UNW A;  1VM1 A;  3IH8 A;  4KG2 A;  5TFQ A;  3ZGA B;  5GHY A;  4X55 A;  1W7F A;  2WAE A;  3TSG A;  2R9X A;  2E8I A;  5CER A;  1XA1 A;  5DTS A;  2ZQ8 A;  2EFU A;  3GTC A;  1ES4 A;  4GZB A;  3A3E A;  4KZ4 A;  5CHM A;  5EVI C;  4BQM A;  3EQU A;  3V50 A;  2ZC5 B;  1BT5 A;  1K54 A;  4KG6 A;  4QB8 A;  4CJN A;  1ZKJ A;  1SDE A;  1E3U D;  1O07 A;  2VGJ A;  4EBL A;  1K55 C;  3UO9 A;  1PYY A;  1JWP A;  3N8R A;  5DF7 A;  1FSW A;  4KZB A;  2A3U A;  2H0Y A;  3O88 A;  1ERO A;  1QME A;  3ZG5 A;  3IF6 C;  2R9W A;  2IWD A;  2WK0 A;  2CC1 A;  5CGS A;  4XUZ A;  4X6T A;  5E2H A;  2HDR A;  2WKH A;  5EOE A;  5DF9 A;  4ZTK A;  4OPR A;  1YMS A;  1YLT A;  4MNR A;  3GQZ A;  3O87 A;  3UE0 A;  3VSK A;  3SS4 A;  1PI5 A;  3MZF A;  4Y0T A;  3C7V A;  1XGJ A;  5EPH A;  3Q81 A;  4RYE A;  4C75 A;  3OPR A;  4E3L A;  1XA7 A;  4WEK A;  3AGE A;  3S4X A;  1FCO A;  3CG5 A;  5A92 A;  1LL5 A;  5FQK A;  5FI6 A;  3G31 A;  3HLD A;  3UY6 A;  1Y54 A;  3PBQ A;  2ZC4 B;  3W4Q A;  3SH7 A;  5U47 A;  2ZLY A;  3G32 A;  3N8L A;  2DNS A;  1GHM A;  4JXS A;  4E3O A;  2HDS A;  3HVF A;  3QNB A;  4JF5 A;  1Q2P A;  3WS5 A;  3ZG0 A;  5EVI B;  4E6X A;  1CEF A;  4HBT A;  4ZDX A;  2ZQ7 A;  1I2S A;  5EVI A;  5GHZ A;  1MBL A;  3HLC A;  3IXH A;  3W8K A;  5CHU A;  3LEZ A;  5CEC A;  1PW1 A;  5EE8 A;  5F1G A;  3NY4 A;  1LLB A;  4X68 A;  3BYD A;  1K55 A;  1H8Y A;  2HPB A;  1CEG A;  1KVM A;  1K25 A;  4N1H A;  3LY4 A;  4JLF A;  3ITA A;  4WZ5 C;  2EX9 A;  2ZMA A;  5FAP A;  5TGF A;  4UA7 A;  3IF6 B;  1W8Y A;  1FR6 A;  3IF6 A;  1Q2Q A;  2FFF B;  5FI2 A;  3M2J A;  1TDL A;  3MKE A;  3LY3 A;  5HFO A;  1RP5 A;  2HP6 A;  5BOH A;  1PWC A;  2Y4A A;  3WS1 A;  5IHV A;  2HDU A;  4JXV A;  4P0M A;  2ZM2 A;  4NK3 A;  2Q9N A;  2Z2M B;  4FD8 A;  5D3O A;  3GR2 A;  3ZFZ A;  5GLD A;  1I2W A;  2ZC7 A;  2ZQA A;  4S2I A;  4EBN A;  2WAD A;  4KEN B;  1W5D A;  5CED A;  1NZU A;  1WYB A;  2IWC A;  2P74 A;  4U3T A;  3GRJ A;  4PM8 A;  4IVK A;  1K56 D;  1L0F A;  3RJU A;  3HLG A;  4CPK A;  1YLZ A;  4MBH A;  1H8Z A;  3M6B A;  4R4R A;  1ZG6 A;  2FFY A;  1S6R A;  1LHY A;  1KE4 A;  3N4I A;  4BEN A;  1ONG A;  4S2J A;  4DF6 A;  3E2L A;  1EI5 A;  1KDS A;  3DWK A;  4GNU A;  4H8R A;  4JKT A;  4XUX A;  3C4O A;  4N92 A;  2PU2 A;  3BEB A;  3PAG A;  4KZ9 A;  1GHP A;  3JYI A;  4EBP A;  3GSG A;  1YMX A;  4QJG A;  3MZD A;  5HL1 A;  1ES3 A;  3E2K A;  3IF5 A;  3HL9 A;  4E6W A;  3ZDJ A;  4WZ5 A;  4C6Y A;  5GL9 A;  3BFD A;  5AQ7 A;  4S2N C;  4OOM A;  3FZC A;  1PZO A;  2Y2H A;  4GDB A;  4DDS A;  3IH9 A;  4D2O A;  2V2F F;  5KZH A;  3G4P A;  1ES5 A;  3NI9 A;  4KZA A;  1CI9 A;  3P09 A;  4MLL A;  4Z9Q A;  2B5R A;  4WM9 A;  4DKI A;  2Y2J A;  1IKI A;  4UA9 A;  5FAT A;  1L0G A;  1M40 A;  1IKG A;  2XFT A;  2Y55 A;  4JF4 A;  3S1Y A;  4A5R A;  1FCM A;  3N8S A;  4Y7P A;  3Q82 A;  4RA7 A;  1JVJ A;  3MXR A;  3TOI A;  3HUN A;  3IQA A;  2ZJ9 A;  4WMC A;  1KVL A;  1NXY A;  3BEC A;  4BD1 A;  1PW8 A;  1TDG A;  2WGV A;  3MKF A;  4GKU A;  3IXG A;  3B3X A;  2WKI A;  2WKE A;  4QD4 A;  4LCM A;  4KZ5 A;  1ONH A;  3UE3 A;  1W79 A;  5CGW A;  2JBF A;  2Y2G A;  2P9V B;  3WS2 A;  2J9P A;  2HP5 A;  1NZO A;  3IXD A;  1MWT A;  2P9V A;  4JXW A;  1BTL A;  3BFG A;  1LL9 A;  5EVI D;  4HES A;  4S2L A;  1YLW A;  3FYZ A;  5EEC A;  5KSH A;  4U0X A;  4OH0 A;  1YLP A;  4OPQ A;  2OLV A;  3Q07 A;  5KSC A;  1FQG A;  5M18 A;  2EXA A;  4PM6 A;  3HLB A;  1FSY A;  5GLB A;  3FKW A;  4S2N A;  1WE4 A;  4MEZ A;  1N9B A;  3VFH A;  1IYO A;  2Y2O A;  5DF8 A;  1G68 A;  4OQH A;  2WAF A;  3ZCZ A;  3EQV A;  5HAP A;  4RVA A;  4BD0 A;  3IHB A;  3Q7Z A;  3G2Z A;  1SHV A;  3MFD A;  1BUE A;  2BLS A;  3G30 A;  1XGI A;  1JWZ A;  1MWS A;  3MXS A;  5JYO A;  5A90 A;  5DTT A;  1BLP A;  2PU4 A;  1GA9 A;  1BLH A;  1AXB A;  3C7U A;  2QPN A;  3OZH A;  4BJP A;  4OP8 A;  1CI8 A;  5CGX A;  1IEM A;  2EXB A;  2V1Z A;  1XKZ A;  1BSG A;  3PBS A;  4ZJ1 A;  1OME A;  1I5Q A;  4PM9 A;  1MY8 A;  3G34 A;  4OKP A;  3FKV A;  3IWI A;  3ZHH A;  4QY5 A;  3VP1 A;  3TG9 A;  3IHA A;  4IED A;  3VP2 A;  3ZNT A;  4YFM A;  1KDW A;  3HBR A;  3ISG A;  4XXR A;  1ES2 A;  4MBF A;  4O7D A;  1GCE A;  4M3K A;  1G6A A;  3QHY A;  3PAE A;  2Y2K A;  4K0W A;  4P87 A;  4YIN A;  1TEM A;  2Y2P A;  1S0W A;  5F83 A;  1HVB A;  2XEP A;  4DE0 A;  3V3S A;  2Y2N A;  1J9M A;  3OC2 A;  4K0X A;  4ZBE A;  4KZ6 A;  2HP9 A;  1KGE A;  1L0D A;  4PM5 A;  2JCH A;  1K38 A;  3G2Y A;  5G18 A;  3VMA A;  1NRF A;  5FAQ A;  2DRW A;  3W4P A;  3VP4 A;  2XD1 A;  3C5A A;  4OON A;  4DXC A;  2WGI A;  5CEB A;  3OCL A;  3NCK A;  4JBF A;  4E3K A;  3ZG7 B;  2Y91 A;  4KZ7 A;  3IXB A;  4JXG A;  4WEL A;  4P6B A;  1YQS A;  2JE5 A;  4FH2 A;  5M1A A;  3V39 A;  4BL2 A;  1JTG A;  3NC8 A;  4N9L A;  4WMC D;  5FSR A;  1MPL A;  2PBY A;  1RGY A;  4S2O A;  5FQM A;  5HAQ A;  3BLM A;  4L0L A;  5FAO A;  1BLS A;  1YLJ A;  1MWU A;  3MZE A;  1NYM A;  4QY6 A;  3ZVW A;  2Y59 A;  4GD6 A;  4WZ4 A;  1BUL A;  4LV1 A;  3Q7V B;  4KZ3 A;  2XK1 A;  2OLU A;  4IVI A;  1FCN A;  3GMW A;  3Q7V A;  4BL3 A;  5AQB A;  3N7W A;  3VSL A;  5TR7 A;  5CTN A;  1K57 C;  3MBZ A;  1MKI A;  4FCF A;  2Z2L B;  3VP0 A;  4LEN A;  2EFX A;  3BLS A;  3FV7 A;  3IWQ A;  3PBO A;  3UDI A;  2J9O A;  3UPO A;  1E4D A;  4F94 A;  4WEJ A;  1DJB A;  4PM7 A;  1U60 A;  2XF3 A;  1YM1 A;  3WRZ A;  3P98 A;  2VGK A;  4P85 A;  5FQ9 A;  4ZJ3 A;  1ESI A;  1IEL A;  3LCE A;  1ERQ A;  4KQR A;  5JYP A;  3O3V A;  3QNC A;  1IYP A;  5FDH A;  2ZC6 B;  5FQI A;  4OOY A;  2WZZ A;  4DDY A;  5FAS A;  2XGN A;  4HEF A;  4NET A;  2UWX A;  3GV9 A;  3AGD A;  4N1X A;  1XXM A;  2XLN A;  4KQQ A;  1HD8 A;  1ERM A;  2WZX A;  1E25 A;  3VFF A;  2J7V A;  3HLF A;  1K4E A;  2H10 A;  4Y0O A;  3BFF A;  4RX2 A;  3DWZ A;  5E43 A;  3SS3 A;  4EV4 A;  1HTZ A;  2XR0 A;  1L0E A;  3O86 A;  5FQJ A;  3AGF A;  1RGZ A;  2JC7 A;  1M6K A;  4ID4 A;  3WRT A;  4GB7 A;  4OPZ A;  1GHI A;  3BFC A;  1SCW A;  1K57 A;  3UN7 A;  3NDE A;  5AQ9 A;  3ZVT A;  4GDN A;  1N4O A;  1W8Q A;  2ZQC A;  1Z6F A;  2X71 A;  4X69 A;  3DW0 A;  3UPP A;  4GN2 A;  1QMF A;  3VOY A;  5CRF A;  4BLM A;  4DE2 A;  3BFE A;  2C5W B;  2H0T A;  2G2W A;  4FSF A;  1DY6 A;  4B4Z A;  4GD8 A;  1XX2 A;  3WWX A;  1ALQ A;  3UDF A;  1PIO A;  4E3N A;  5HW3 A;  3PBR A;  5F1F A;  1PWG A;  4OQI A;  3VOZ A;  4C3Q A;  5GLC A;  5CTM A;  5E2E A;  5L2F A;  3VP3 A;  2ZQ9 A;  3IT9 A;  2V20 A;  4K91 A;  1YT4 A;  4QHC A;  2X02 A;  4X53 A;  4UAA A;  2Y2L A;  1GA0 A;  1LI0 A;  3OPH A;  2WGW B;  4E3M A;  2H5S A;  1JTD A;  3UE1 A;  3NIA A;  3LO7 A;  2WGW A;  3A3I A;  5GHX A;  3C4P A;  1CK3 A;  3SH8 A;  1PWD A;  1DJA A;  2QZ6 A;  5KMW A;  3ITB A;  1KGG A;  5HX9 A;  2X01 A;  3N6I A;  2RCX A;  2DCF A;  1C3B A;  2ZQD A;  4X56 A;  3S22 A;  3HLE A;  4DE1 A;  4OOL A;  3G35 A;  2G2U A;  2Y2M A;  2EX6 A;  1VQQ A;  1O7E A;  2Q9M A;  2ZD8 A;  5FI7 A;  3GVB A;  5I94 A;  5CXW A;  4OQ0 A;  1WYC A;  5AQA A;  3BRM A;  1RCJ A;  5A93 A;  3PBT A;  1JWV A;  5DTK A;  4OLD A;  3UDX A;  4KQO A;  2I72 A;  3I7J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...