1IYPA

Toho-1 beta-lactamase in complex with cephalothin
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
260
structure length
260
Chain Sequence
SVQQQLEALEKSSGGRLGVALINTADNSQILYRADERFAMCSTSKVMAAAAVLKQSESDKHLLNQRVEIKKSDLVNYNPIAEKHVNGTMTLAELGAAALQYSDNTAMNKLIAHLGGPDKVTAFARSLGDETFRLDRTAPTLNTAIPGDPRDTTTPLAMAQTLKNLTLGKALAETQRAQLVTWLKGNTTGSASIRAGLPKSWVVGDKTGSGDYGTTNDIAVIWPENHAPLVLVTYFTQPEQKAERRRDILAAAAKIVTHGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Acyl-intermediate Structures of the Extended-spectrum Class A beta -Lactamase, Toho-1, in Complex with Cefotaxime, Cephalothin, and Benzylpenicillin.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
molecule keywords Toho-1 beta-lactamase
total genus 89
structure length 260
sequence length 260
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2002-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 1iypA00
2Y2IA 2J8YA 4S2MA 1KGGA 1NY0A 4U0XA 3GTCA 2Y2OA 5FQQA 4EBLA 2Q9MA 4OQIA 5L2FA 5CTNA 4OP8A 4B4ZA 5CTMA 5KSHA 1RCJA 4OVDA 4Z9QA 4DE3A 2QMIA 5J8XA 2XGNA 3BRMA 3HLGA 1XPBA 4R1GA 3FKVA 3IT9A 3WRTA 1K6RA 4GD6A 4RVAA 5GHXA 4XXRA 4JXSA 3ZG8B 1GHMA 4GN2A 5FI2A 1O07A 1ES3A 2OSUA 3IXBA 4HBUA 1MXOA 5TGFA 3VP3A 3CG5A 4WBGA 4ZJ2A 1SHVA 4N9LA 2ZQ9A 3A3EA 4ZBEA 4F94A 1H8YA 5F83A 4Y0UA 1L0GA 1TDLA 4Q8IA 2WKHA 3MBZA 4Y0OA 5AQ9A 3TOIA 2Q9NA 4ZTKA 4KG6A 3NCKA 4OPQA 3V3SA 1ALQA 4S2KA 5FQJA 4OLGA 2XFTA 3WS4A 3CJMA 4WMCA 4XUXA 3OPHA 5EVLA 3PAGA 3ITBA 4E3MA 4NETA 3UPOA 2OLVA 1QMFA 2IWDA 1LI0A 3G2ZA 4FCFA 2HDRA 1ES2A 2ZM8A 5BOHA 1YLPA 1FSYA 5FAOA 5TR7A 2ZQ7A 3A3DA 3QNBA 1I2SA 4FD8A 4P0MA 3MXSA 5EVIC 5HFOA 2EX2A 5A91A 5A93A 5M18A 1K55C 3G2YA 4X68A 3SH9A 3GSGA 5E2FA 3TG9A 3ZVTA 4IBXA 1IEMA 3Q1FA 1O7EA 2RCXA 5JYPA 2Z2LB 1MWTA 4PM7A 2BLSA 3NBLA 5GL9A 4S2NA 4DDYA 1IYQA 1CEGA 3BFCA 4JXGA 4EBPA 3VFFA 5GHYA 3UE0A 2GDNA 3WS0A 3I7JA 4R23A 1GCEA 2WGWA 5CERA 3RXWA 1NRFA 4U0TA 4ID4A 3G30A 3MKEA 4X69A 3GVBA 1FQGA 5EE8A 1S6RA 1KE4A 3FYZA 1BUEA 1SDEA 4GDNA 4QY6A 3BFDA 4S2OA 4ZAMA 4BL2A 4XUZA 3FV7A 5HX9A 3VOYA 4GDBA 1Z6FA 2B5RA 2H5SA 4WZ4A 5CECA 5GLBA 3DWKA 3BLMA 1QMEA 1MY8A 1C3BA 2HDQA 3HVFA 4B88A 3OPRA 3WRZA 2J9OA 5M19A 1K4FA 1Q2PA 2P9VB 3IWIA 2VGKA 5DVAA 3VP2A 4IEDA 5E2EA 1K57A 3SOIA 5FSRA 3SS3A 3OZHA 4PMAA 3MKFA 3PBRA 2ZQDA 4OP5A 3V3RA 3IH8A 4JXWA 1LLBA 4PM9A 4EV4A 1ONHA 3VMAA 4UAAA 1BLHA 2EX9A 2WUQA 5FI6A 3BFFA 3SS5A 1PWGA 4PM8A 2HDSA 2J9PA 2Z2MB 2H10A 4KQRA 4RYEA 3HUMA 5GLCA 1IKIA 2WZZA 4OPZA 4RX3A 5CGXA 5E2GA 2ZC5B 1YM1A 5AQAA 5DTSA 1WE4A 2ZQAA 3HUOA 1WYBA 3V39A 2QPNA 5CGSA 3UDFA 4PM5A 1ERMA 3ZNYA 4GNUA 3S1YA 4QJGA 4BENA 4E3OA 5HL1A 2V20A 3FZCA 1LL9A 2WKEA 5E43A 1DJBA 3OPPA 4O7DA 3HLEA 1K57C 2Y2JA 1MPLA 1YT4A 3NY4A 2DCFA 3V5MA 3ZDJA 2CC1A 1ZG4A 4KZ5A 3E2KA 4JF5A 4R0QA 3W4QA 1LL5A 4R3JA 1TEMA 1I5QA 3EQVA 3ZVWA 3UO9A 1KDSA 2XD5A 5KSCA 2C6WB 1G6AA 3E2LA 3VP1A 3SH8A 1HTZA 3GR2A 1OMEA 4DDSA 1FR6A 4DKIA 1KVMA 1WYCA 1YLTA 4JF4A 1FCNA 4QD4A 1G68A 3FKWA 4OLDA 4N9KA 1NJ4A 1MBLA 3G35A 3ZCZA 3IH9A 4N92A 3AGDA 4WEKA 1KE0A 4GKUA 1W7FA 2ZM0A 5A92A 2DNSA 5CRFA 3M2KA 4WMCD 1K56A 4KG2A 5EVID 3Q7VB 4OQHA 2Y2LA 1M6KA 3ZGAB 3ZG5A 5EOOA 1TVFA 3QHYA 1E3UA 1FR1A 4DRTA 3G34A 1DJCA 3BFEA 3C5AA 3Q82A 5FAQA 2WAEA 3NC8A 4E3IA 4P85A 3LEZA 4C75A 3ZG7B 3UDXA 1KDWA 4IBRA 3G31A 4MBHA 5GLAA 4N1XA 4WZ5C 4DF6A 3IF6A 3VSLA 1SKFA 1CEFA 2E8IA 1K54C 3OPLA 3N4IA 4E6XA 1N9BA 2P74A 1PI5A 3UE1A 1Y54A 2Y59A 1ONGA 3BFGA 1IELA 3EQUA 5FA7A 3P98A 4BL3A 5HAPA 4C3QA 1GHIA 4S2LA 4NK3A 4QHCA 3RXXA 1BZAA 4FSFA 5JYOA 4JPMA 1U60A 3N8LA 5TFQA 2BG1A 3BM6A 1IYPA 4E3KA 1K38A 3DWZA 1PIOA 1RGYA 5CEBA 5EECA 5FQ9A 5U47A 2Y2HA 4LV1A 2X01A 1I2WA 1H5XA 1K6SA 2PU2A 2JBFA 2ZC4B 3IXDA 3MZEA 4LCLA 4RA7A 5A90A 3SH7A 1CI8A 1YMXA 4KZAA 5DF9A 1RGZA 3FWLA 3MZFA 4B4XA 3IHAA 2H0YA 4MNRA 4UA6A 1DJAA 4E3LA 4LV3A 2Y91A 2QZ6A 5HARA 5CHJA 1FOFA 3SS4A 4WELA 2A49A 3PBTA 4GOGA 1BSGA 1BTLA 3C7UA 4K0WA 5E2HA 3LY3A 5CEDA 3GQZA 1SCWA 3MXRA 4ZDXA 1L2SA 3Q07A 1PW8A 1HZOA 4S2JA 3N7WA 1XKZA 2WZXA 1E4DA 4JXVA 4S2IA 2ZLYA 3NDGA 5HAQA 1CI9A 1E25A 4MBFA 3VFHA 1L0DA 3N8RA 2EXAA 3AGEA 3VSKA 3UNWA 1S0WA 3WS1A 1NZUA 5EVIB 4E3NA 1YQSA 2Y2KA 1FCOA 3IXHA 4YINA 1VQQA 2Y2PA 5FQMA 5F1FA 4KZ7A 4FH4A 4MLLA 4L0LA 4OOYA 3HBRA 1M40A 1DY6A 3VOZA 4KZ4A 5F1GA 2VGJA 3O86A 2Y2MA 3G4PA 4KZ8A 1L0FA 1W8YA 1JTGA 4GB7A 4LENA 2A3UA 2WK0A 2JCHA 3LCEA 2XLNA 3HLBA 1BULA 4IVKA 2OV5A 3NIAA 4CJNA 5EUAA 3LY4A 5FATA 4DXCA 1JWVA 4EQIA 2ZJ9A 4UA9A 1PZOA 2FFFB 3N8SA 1YLYA 3PBQA 4OH0A 4KZBA 5AQ7A 3UY6A 2UWXA 1LI9A 2ZC6B 2V1ZA 4EUZA 3IQAA 1L0EA 4ZJ1A 4PPRA 4KENB 2J7VA 3M6BA 3BEBA 5HAIA 3W8KA 2XFSA 1MWRA 2DRWA 1VM1A 3GV9A 4CPKA 2EX6A 4S2NC 3C4PA 3HLFA 3ISGA 2IWCA 2X71A 3N6IA 5KMWA 3QNCA 5EVIA 1AXBA 4FH2A 3S4XA 1KGFA 1XA7A 3OCLA 4ZJ3A 3A3FA 2ZM2A 1GA0A 2XEPA 4X55A 3VP4A 4S2PA 5D3OA 2JE5A 2JC7A 3Q81A 4KG5A 4LV2A 1JVJA 4D2OA 4K0XA 1IKGA 2Y2GA 5EOEA 3UE3A 4YFMA 3UPNA 4DE0A 1XP4A 2HP5A 2P9VA 2Y55A 5CHMA 3PAEA 3ZHHA 3ZG0A 3UDIA 3O88A 2G2WA 3C7VA 4RX2A 1KE3A 3UN7A 2WKIA 3GMWA 4E6WA 3RJUA 4R4RA 1SDNA 2HP6A 1K55A 3PBOA 5FASA 4WEJA 2WGVA 1KVLA 2C5WB 4OPRA 1W8QA 1PYYA 3NDEA 2ZQCA 3Q7ZA 3HLDA 4X53A 3OC2A 4LCMA 1JWZA 5DTTA 1XXMA 5AQBA 3IF6B 3MZDA 1ESUA 1N4OA 2IWBA 1CK3A 2OLUA 1IYOA 2G2UA 3JYIA 4QB8A 1LHYA 3W4PA 4BD1A 4Y0TA 4OONA 3NI9A 1HVBA 4QU3A 2EXBA 2H0TA 3IF6C 3ZFZA 3W4OA 1XGJA 1FSWA 4HESA 3Q7VA 3WS5A 4UA7A 2X02A 4WM9A 2PU4A 4M3KA 1ZC2A 5EPHA 5IHVA 4R4SA 1ZKJA 4P87A 3IWQA 4EWFA 2RL3A 1BT5A 4KQOA 3PBNA 2ZMAA 4BJPA 3A3IA 1GA9A 1W79A 3B3XA 1H8ZA 1KGEA 3CMZA 2WADA 3IHBA 2V2FF 3HLCA 5F82A 3IWOA 5DF8A 1MWSA 5CXWA 3HREA 3PTEA 1RP5A 3O3VA 3BECA 3WWXA 1MWUA 1K4EA 3MFDA 4WZ5A 5FI7A 4R3BA 3BLSA 4JLFA 4JKTA 2R9XA 3IF5A 3AGFA 4JF6A 4IVIA 4N1HA 1PWCA 2Y2NA 1J9MA 3OCNA 3WS2A 4MBKA 1BLSA 5DF7A 5HW3A 1XX2A 3GRJA 1PI4A 2HP9A 3CZDA 2Y4AA 4OOLA 1NYMA 4MEZA 3HL9A 5M1AA 2XH9A 1K54A 3DW0A 1FCMA 5G18A 2EFUA 3HUNA 4BQMA 2WGIA 4UHUA 3V50A 1NXYA 3ZNTA 1PZPA 3IXGA 1YLZA 1JWPA 1JTDA 2Y2QA 4OOMA 4BD0A 4Y7PA 4KQQA 4KZ6A 4A5RA 2XQZA 5I94A 1PWDA 2XDMA 4KZ3A 2WGWB 2EX8A 4C6YA 5GHZA 4OQ0A 4JBFA 1HD8A 5FDHA 1ES4A 2ZD8A 3G32A 4OKPA 4DE2A 5KZHA 4P6BA 4E3JA 2FFYA 3DTMA 4OQGA 5DTKA 2XD1A 4WYYA 4U3TA 3C4OA 3ZG9B 5FQIA 4PM6A 3PBSA 1NZOA 1ES5A 1BLPA 2ZC3B 3A3JA 4X56A 3HLWA 1EROA 3M6HA 2EFXA 1E3UD 5FQKA 5FAPA 4HEFA 5GLDA 3D4FA 1XA1A 3VP0A 4GD8A 3ITAA 1MKIA 4LV0A 4K91A 1K56D 1YLJA 2XR0A 1TDGA 1K25A 2WYXA 5CHUA 1PW1A 2HPBA 4OPYA 4EBNA 4HBTA 1GHPA 4X6TA 1IYSA 1EWZA 1YMSA 1BLCA 1XGIA 1YLWA 3TSGA 1Q2QA 4DXBA 2ZC7A 2I72A 1NYYA 4H8RA 1ERQA 1W5DA 2PBYA 4GZBA 2XK1A 2WAFA 2XF3A 3BYDA 3O87A 1ZG6A 2R9WA 3S22A 4BLMA 2ZQ8A 3LO7A 4QY5A 5CGWA 3P09A 3M2JA 1EI5A 3UPPA 2HDUA 1ESIA 4KZ9A 4DE1A
chains in the Genus database with same CATH superfamily
2Y2IA 1Y4OA 2J8YA 1NY0A 4GLQA 2Y2OA 4HJ6A 1RCJA 4QWOA 2QMIA 1TD5A 3DTIA 1TS6A 1K6RA 5IU1A 5GHXA 1D1JA 1FILA 4Y17A 2OSUA 4HBUA 3VP3A 2ZQ9A 5F83A 3UB8A 2WKHA 3CPTB 5AQ9A 3V3SA 3WS4A 3CJMA 3T4JA 3K2NA 1LSVA 3IS2B 5HZHA 1ES2A 5BOHA 4LRZE 1FSYA 1ODVA 2ZQ7A 3A3DA 3QNBA 1I2SA 4H6JB 1V9ZA 4HQAA 5HFOA 4O0PA 3A0VA 3SH9A 4UQIS 4IBXA 3LYXA 1VEUA 2Z2LB 1MWTA 1DP6A 4PM7A 3NBLA 3E98A 5DJUA 1S1ZA 3BFCA 4EBPA 3CUEA 3UE0A 2GDNA 3LR4A 4R23A 2OOLA 4LFUA 1FQGA 1KE4A 2QJ7A 5HX9A 4BMWA 5CECA 1QMEA 2HDQA 4B88A 5M19A 4CLCA 1YAXA 1Q2PA 2JKTI 5HWTA 3NOPC 5E2EA 5FSRA 1EW0A 4PMAA 4EUVA 2GNXA 3IH8A 2QKPA 1MC0A 1BLHA 2WUQA 5MC7A 2J9PA 1VETA 3D72A 5GLCA 3JPUA 4OPZA 1WE4A 2L0WA 1WYBA 3LIAA 4PM5A 2PD7A 2K7SA 3S1YA 4BENA 3F1PB 2V20A 4ETZA 2D01A 5E43A 5HDSA 2Y2JA 2CC1A 3UO9A 4P6ZS 2J80A 2C6WB 3VP1A 4MN5A 1HTZA 1OMEA 1WYCA 2EWWA 1OTBA 4N9KA 1MBLA 3ZCZA 1KE0A 2ZM0A 5A92A 3Q7VB 2Y2LA 3ZGAB 4XT2A 3U4LP 3F1PA 1E3UA 4II7A 4DRTA 3BFEA 3Q82A 5FAQA 4E3IA 4P85A 3LEZA 1KDWA 2M7VA 4IJGA 4EW7A 2ZOHA 2E8IA 2P74A 4Y15A 2Y59A 1ONGA 4LRXC 3ZYTA 3BFGA 1F5MA 3L9KA 4X25A 4BL3A 3K3DA 3RXXA 2I9VA 4JPMA 1U60A 4PKYG 3BM6A 1SKOA 3DAVA 3DWZA 4LV1A 2X01A 2ZC4B 3MZEA 4LCLA 4RA7A 3SH7A 1CI8A 3MS6A 4WELA 2E8JA 4GOGA 1SCWA 4ZDXA 1L2SA 3QP4A 4JXVA 4S2IA 2ZLYA 1CI9A 3TE8A 3VSKA 3MQQA 3OBFA 4NXFA 2Y2KA 3V67A 3IXHA 4YINA 1VQQA 2V0UA 2WKQA 3R7WA 4HJ4A 3HLBA 3FC7A 4HH2A 2R78A 4NEED 4AFIA 1L0EA 4ZJ1A 4LGWA 4KENB 2J7VA 2UV0E 3W8KA 5HAIA 4CPKA 3C4PA 1NWZA 3ISGA 5KMWA 3IBRA 3QNCA 1AXBA 1XA7A 1YPRA 3A3FA 4Y5FA 5HD5A 1NLZA 2O9AA 2JE5A 4KG5A 1G6OA 3CWFA 5J3WA 3KYEA 3UE3A 3MQOA 4Q0HA 1XP4A 2P9VA 3ZHHA 4DE0A 1KE3A 1F2KA 2B95A 1KVLA 2C5WB 4LLOB 3NDEA 3HLDA 3OC2A 2XRNA 3MMHA 1N4OA 3U2AA 3LGOA 4Y0TA 3W4PA 4OONA 2HV1A 3Q7VA 2X02A 4WM9A 4M3KA 1ZC2A 2V1BA 1ZKJA 2NUTC 2XROA 4HHDA 1W79A 1KGEA 3IHBA 3HREA 3PTEA 1RP5A 3O3VA 5L10A 1MWUA 2PBDP 5DKKA 2J3TD 1T18A 4WLAA 2PT7A 2A2LA 2XA7M 1XJ2A 1BLSA 1OJGA 3GRJA 1NYMA 4MEZA 3HL9A 5M1AA 5CX7A 4FUWA 3H7WB 4R3AA 1N9NA 5C5KA 1X0OA 2WGIA 2W27A 1YLZA 1T19A 4A5RA 2XQZA 2HJEA 5GHZA 4JBFA 3KSFA 1PNEA 4D60A 3DTMA 5DTKA 4WYYA 3LFVA 1SZVA 3ZG9B 4ARZA 4IUKA 4PM6A 4RQ9A 1NZOA 4X56A 2A24B 1YSPA 3GDIA 2ACGA 3M6HA 1LSWA 1G5UA 3D4FA 4YWZA 3ZQ5A 4BWIA 2G7UA 3DTEA 2INWA 4GD8A 1K56D 1YLJA 2XR0A 3LIEA 1PW1A 2HPBA 4EBNA 1IYSA 1XGIA 4FTXA 1Q2QA 1NYYA 4EEPA 1MKMA 2WAFA 2GX5A 1ZG6A 3S22A 3LO7A 2B18A 4G3WA 1H3QA 4HNBA 1ESIA 4U0XA 5FQQA 5L2FA 5CTNA 4B4ZA 5CTMA 4OVDA 4DE3A 2XGNA 3BRMA 3HLGA 3FKVA 3IT9A 4RVAA 4JXSA 3EGDC 3ZG8B 1GHMA 4GN2A 3QP1A 3CG5A 1T1AA 4ZJ2A 1SHVA 1S1YA 4N9LA 3A3EA 2W0NA 1L0GA 3TOIA 5L07A 2Q9NA 4KG6A 5FQJA 2VLGA 5EVEA 2MJ6A 5K5BA 3UPOA 2IWDA 5FAOA 3MXSA 5LBRA 5A93A 3T4QA 1IEMA 1O7EA 5JYPA 1BYWA 4Y2FA 4F3LB 5GHYA 3I7JA 4WN5A 3RXWA 2PR6A 1NRFA 3MKEA 5EE8A 3FYZA 3MJQA 4GDNA 3BFDA 4S2OA 3VOYA 4ME4A 4GDBA 2B5RA 2H5SA 2XSSA 1PFLA 3BLMA 3TRCA 5AVEA 3OPRA 3BWLA 5DFYA 2PHYA 2VGKA 3VP2A 1ZHHB 3FG8A 3K3CA 3SS3A 3OZHA 3LEQA 2ZQDA 2BTFP 4JXWA 4F3LA 1LLBA 1VB6A 3NULA 2FH5A 1D06A 1PWGA 2HDSA 4FOFA 4KQRA 3VOLA 2WZZA 2ZC5B 5AQAA 3NECA 5CGSA 3UDFA 4JGOA 4E3OA 1LL9A 2OWJA 5L09A 1K57C 4Z1WA 2DCFA 3KSIA 1ZG4A 3E2KA 3W4QA 4R3JA 3EQVA 3ZVWA 3O5YA 2XD5A 1IOUA 1T1CA 3E2LA 3P7NA 5EM0A 4I38A 3HJKA 5IS1A 4OLDA 1NJ4A 1OTDA 3T12B 3EGXC 3A0SA 3F1NA 1W7FA 4BBTA 2LB9A 4WMCD 4KG2A 1G28A 4GS9A 3T4TA 1FR1A 1DJCA 5I5LA 3UMEA 5HWWA 2WAEA 3ZG7B 4N1XA 3KYZA 4WZ5C 3KSGA 4E6XA 1N9BA 3B33A 1PI5A 1Y54A 2QJ5A 1IELA 2Z6CA 3IS2A 4NK3A 4LPZA 1BZAA 2VEAA 4FSFA 4EERA 2KLIA 2EWVA 5EECA 5FQ9A 2Y2HA 4JGPA 2PU2A 3IXDA 5A90A 5DFXA 3FWLA 1GSVA 5HARA 2LB5A 5CHJA 3SS4A 1OPXA 2A49A 2XA7S 3PBTA 3SW1A 4K0WA 3LY3A 3GQZA 4R6LA 4B93A 3Q07A 2WZXA 3NJAA 5HAQA 4MBFA 3VFHA 1S0WA 1NZUA 1UGUA 1PRQA 1FCOA 3QP2A 5F1FA 4FH4A 4MLLA 4L0LA 3HBRA 3OLOA 2VGJA 4KZ8A 3G4PA 4GHIB 3CHWP 1JTGA 2JCHA 1BULA 5FATA 3LY4A 2FFFB 3N8SA 1YLYA 5F68A 3PBQA 4OH0A 5AQ7A 3CITA 2ZC6B 4EUZA 3KX0X 3QP6A 1CQAA 2VV6A 1H8MA 4M4XA 1H0MA 2JHEA 4S2NC 3UB5P 4Q0IA 2IWCA 4ZJ3A 2ZM2A 1GA0A 2XEPA 4X55A 4GS9B 5D3OA 3HCYA 3C30A 2JC7A 4D2OA 1JVJA 4K0XA 4Y3IA 1IKGA 5EOEA 2HP5A 3ZG0A 3PAEA 3UDIA 1P97A 4L9GA 3ULFA 3CAXA 2HP6A 3R4KA 4EU0A 5FASA 2WGVA 1W8QA 1S4RA 1PYYA 2ZQCA 1JWZA 2ZOIA 1XXMA 5AQBA 5KIZA 2JKFA 3A0RA 1IYOA 4QB8A 1STZA 2VK3A 3JYIA 3NI9A 2V8CA 3LR0A 2EXBA 3ZFZA 4HP4A 1XGJA 3UB9A 5EM1A 2PU4A 2GJ3A 4R4SA 4P87A 3PR6A 2RL3A 3A3IA 3GECA 5HDDA 2WADA 3HLCA 5F82A 3C38A 5F69A 3IWOA 4EEUA 1MWSA 3MFDA 5FL3A 4R3BA 4JLFA 4JKTA 3IF5A 3D3OA 4JF6A 4IVIA 3MXQA 4MBKA 3CZDA 4OOLA 4P6ZM 2XH9A 3S7NA 4KQDA 1T1BA 3ZNTA 3IXGA 2K31A 1JWPA 1JTDA 4OOMA 4GHIA 5I94A 1PWDA 2XDMA 4OQ0A 5L8MA 1HD8A 3CI6A 5FDHA 1ES4A 2ZD8A 4CQHA 4DE2A 5KZHA 5DJTA 4E3JA 4PHTA 5HDCA 1OT9A 5TBMA 3UE6A 1BLPA 4EESA 5GLDA 1XA1A 3VP0A 1MKIA 1TDGA 4X6TA 1YMSA 1BLCA 2QYBA 2VGLS 2PBYA 4GJ4A 1KOUA 2XF3A 2R9WA 5CGWA 3C2WA 3M2JA 2HDUA 4KZ9A 4YOFA 4DE1A 3DBAA 1P9WA 1KGGA 3RH8B 2PDRA 2Q9MA 4OP8A 2YKFA 1OT6A 4Z9QA 2VA0A 5J8XA 3S7PA 1K0KA 1XPBA 3WRTA 4GD6A 4ARZB 4EETB 4XXRA 4HOIA 2VX8A 2V0WA 3T1XA 1O07A 1ES3A 4QPRA 3UMDA 2O9BA 3EEAA 4F94A 1H8YA 3R7WB 3FPWA 3MBZA 4Y0OA 1ALQA 4S2KA 1P0ZA 4OLGA 2PYPA 4XUXA 1D7EA 3LI9A 2OLVA 3VE4A 2ZM8A 1YLPA 5TR7A 4FD8A 3PXPA 2Q0OA 5M18A 1K55C 3GSGA 5E2FA 3ZVTA 4R38A 3Q1FA 4ZRRA 1FIKA 1XFNA 3JVVA 4DDYA 2KOIA 1HLUP 4X69A 3GVBA 3FPVA 4NG2A 1MZUA 4XUZA 4O01A 1Z6FA 2PAVP 3DWKA 3RFBA 1MY8A 1C3BA 3HVFA 2J9OA 3EOIA 3LR3A 2VGLM 1K4FA 2P9VB 5DVAA 4IEDA 4KUOA 3SOIA 3KYQA 4UEYA 4PM9A 4EV4A 4UAAA 2Y79A 4KUKA 5FI6A 3BFFA 3SS5A 2Z2MB 2H10A 2P7JA 1IKIA 4RX3A 5E2GA 4MCWA 1YM1A 3DTKA 3HUOA 2QPNA 1ERMA 3ZNYA 4QJGA 3W2ZA 5HL1A 3FZCA 2WKEA 4DJ2A 2W3GA 1OJ5A 5HSQA 1MPLA 1YT4A 1TS7A 2K2NA 4R0QA 3UB6A 1LL5A 2JKRM 1S67L 3KSHA 1G6AA 3SH8A 1FR6A 1KVMA 4JF4A 1FCNA 2ZL1B 1G68A 2O9CA 2P08A 3FKWA 3IH9A 4GKUA 2DNSA 5CRFA 3M2KA 1K56A 2YKHA 4I3IA 2V1AA 3B42A 4C75A 2PD8A 3UDXA 2JKTM 1N9OA 2VZWA 5GLAA 3B47A 2KDKA 4L9EA 3IF6A 1S4SA 1SKFA 3VSLA 3N4IA 3S7QA 2EA9A 5FDSA 3EQUA 3IX3A 5FA7A 4C3QA 2OWHA 2JN7A 4QHCA 4K08A 5JYOA 5TFQA 4HY8A 2BG1A 3ICYA 1IYPA 1K38A 3QP5A 1RGYA 4HH3A 4DJ3A 5U47A 2W3FA 2JBFA 1W63M 5HPFA 5DF9A 1RGZA 3IHAA 2H0YA 4MNRA 4E3LA 2Y91A 2L1MA 3LICA 4X1LA 1BSGA 1BTLA 5E2HA 1TS8A 4S2JA 1E4DA 1L0DA 5F5YA 3AGEA 5EVIB 4E3NA 5FEFA 5FQMA 4KZ7A 3IX8A 1DRMA 1M40A 3VOZA 4KZ4A 5F1GA 3O86A 1W8YA 4LENA 2A3UA 2WK0A 2PYRA 2OV5A 5EUAA 5HL6A 4DXCA 3LR5A 2PR5A 4EQIA 2ZJ9A 1PZOA 4KZBA 2UWXA 1LI9A 3HJIA 1OTEA 4PPRA 2XFSA 1MWRA 1OTIA 2DRWA 2EX6A 3MSHA 3NHQA 5EVIA 4FH2A 4IUHA 3S4XA 4S2PA 5F6AA 3Q81A 4LV2A 2Y2GA 3UPNA 5EV0A 5CHMA 3T4SA 4B9OA 3O88A 3UN7A 2WKIA 3GMWA 4E6WA 4R4RA 2L4RA 1K55A 3PBOA 5G4ZA 4OPRA 1Y28A 1ZTUA 4Q0JA 1GSXA 3Q7ZA 2W1RA 4MN7A 2FZ0A 3IF6B 3T1RA 2ZL1A 1ESUA 2W1TB 5HD3A 1CK3A 1YSQA 2G2UA 4BD1A 1LHYA 3IF6C 1SKOB 1FSWA 4HESA 3WS5A 4UA7A 2ZBBA 3MR0A 4EWFA 1BT5A 4KQOA 4BJPA 2ZMAA 2KX6A 1H8ZA 1L3LA 2V2FF 2NUPC 1F98A 1NRJA 1DP8A 4X1MA 4JGQA 4DN0A 5IT5A 2M1CA 4JGRA 4GW9A 5DF7A 5HW3A 1PI4A 2HP9A 4HI4A 1K54A 4I39A 2OAQ1 2EFUA 3HUNA 4BQMA 4G3VA 4UHUA 1NXYA 1PZPA 4UQIM 2Y2QA 2VJWA 3E0YA 4KZ6A 4WUJA 2WGWB 2EX8A 5A8BA 1OTAA 3BY8A 4OKPA 4OQGA 4U3TA 3T4KA 5FQIA 3A3JA 2ZC3B 3HLWA 1E3UD 3JVUA 2WKRA 2GZAA 3ITAA 4K91A 1K25A 2WYXA 3T4LA 5CHUA 4HBTA 2ZC7A 4H8RA 1W5DA 4GZBA 2XK1A 3BYDA 3O87A 2ZQ8A 1XFQA 4QY5A 3BQ8A 3P09A 4H6JA 3UPPA 3MFXA 4S2MA 3GTCA 2JKRI 4EBLA 3E4OA 4OQIA 2J3WA 3T1QB 5KSHA 1J3WA 1LT0A 4R1GA 5FI2A 3LIFA 5TGFA 3IXBA 1MXOA 1IFQA 4WBGA 3NOTC 4ZBEA 4Y0UA 1TDLA 4Q8IA 4ZTKA 3NCKA 4OPQA 2XFTA 4WMCA 3OPHA 5EVLA 3E4PA 3ITBA 3PAGA 3PHYA 4E3MA 3P01A 4NETA 4NKPA 1QMFA 1LI0A 1NLYA 3BQAA 3G2ZA 2HDRA 4FCFA 4GCZA 4CLCD 2ZMVA 4P0MA 5EVIC 2EX2A 5A91A 2W3HA 3G2YA 4CLCC 4X68A 3TG9A 3D9YA 1AWIA 2RCXA 3H7WA 2BLSA 3BY9A 5GL9A 4S2NA 1IYQA 1CEGA 4JXGA 3VFFA 4I3JA 3WS0A 1GCEA 2WGWA 3F1OB 3QP8A 5CERA 1WA9A 4U0TA 4ID4A 3G30A 1S6RA 1BUEA 1SDEA 4ZAMA 4QY6A 4BL2A 3FV7A 4WZ4A 5GLBA 3WRZA 3T1SA 3IWIA 4WL9A 4NXGA 1LSXA 1K57A 4HIAA 3MKFA 3PBRA 3S7OA 4OP5A 1S66L 3V3RA 2H28A 3G6OA 2O99A 1ONHA 3VMAA 4XT2B 2EX9A 4PM8A 4RYEA 1F9IA 3HUMA 5CGXA 3TW8A 5DTSA 2ZQAA 3V39A 3LIBA 4GNUA 1DJBA 3OPPA 4O7DA 3HLEA 5AVFA 3NY4A 3V5MA 3T4OA 5G4YA 3ZDJA 4KZ5A 4JF5A 3BW6A 1TEMA 1I5QA 1XJ6A 4EQ1A 2W3EA 1KDSA 5KSCA 1N9LA 2M7UA 2VKSA 3GR2A 5TBMB 4DDSA 4DKIA 1YLTA 4QD4A 3G35A 3CLOA 2D02A 4N92A 3AGDA 4WEKA 5J4EA 3KO6A 5EVID 4OQHA 1V9YA 3LI8A 4NXEA 1M6KA 3ZG5A 5EOOA 4HJ3A 5HPIA 1TVFA 3QHYA 4I5SA 2VV7A 3G34A 3C5AA 3EEHA 3NC8A 4ESPA 4IBRA 1W63Q 3G31A 3IX4A 4MBHA 4LRYC 1VETB 4DF6A 3CUEC 2VV8A 1CEFA 3OPLA 1K54C 3UE1A 3T50A 3P98A 4YNRA 5HAPA 1GHIA 2AVXA 4S2LA 4MMNA 3E4QA 4R70A 3N8LA 4E3KA 2Y8HA 1PIOA 5CEBA 1I2WA 1H5XA 1K6SA 2O0YA 1YMXA 4KZAA 4B4XA 3MZFA 4UA6A 1DJAA 4LV3A 2QZ6A 1FOFA 5FEGA 4BBUA 2HJ9C 3C8CA 3C7UA 3H9WA 5CEDA 3MXRA 4MDZA 1PW8A 1HZOA 3N7WA 1XKZA 3NDGA 1E25A 4MN6A 3N8RA 2EXAA 3F1OA 3UNWA 3WS1A 4ETXA 1YQSA 2Y2PA 2BASA 4OOYA 3TJZC 1DY6A 2B02A 5J7EA 1XJ4A 2Y2MA 2IA2A 1L0FA 2J3TC 4GB7A 2A24A 3SZTA 3LCEA 2XLNA 1UWPX 3RTYA 4IVKA 3NIAA 4CJNA 1JWVA 4UA9A 1DP9A 3UY6A 2V1ZA 1P9RA 3IQAA 3M6BA 4IHQA 3BEBA 3VE3A 3GV9A 1VM1A 1ACFA 3HLFA 2X71A 3N6IA 4BBVA 1UWNX 1KGFA 3OCLA 3VP4A 1VEUB 4CLCE 5AJGA 4YFMA 2Y55A 2HF6A 2QHKA 2G2WA 3C7VA 4RX2A 3RJUA 3CPTA 3PYPA 1SDNA 5EFWA 4WEJA 2ZMFA 4X53A 4LCMA 5DTTA 1TF1A 3LUQA 3OOVA 3MZDA 2W3DA 2IWBA 4E04A 2OLUA 2V9AA 1JNUA 1HVBA 4QU3A 2DMWA 2H0TA 1Z09A 4I3AA 3W4OA 3MF0A 2PRFA 2P04A 5EPHA 5IHVA 3H82B 3IWQA 3PBNA 1GA9A 3B3XA 3CMZA 3IBJA 5DF8A 5CXWA 1CJFA 3BECA 3WWXA 4G3KA 1K4EA 4WZ5A 5FI7A 3BLSA 2R9XA 4WF0A 3AGFA 3LIDA 5HWVA 4N1HA 1PWCA 2Y2NA 1J9MA 3OCNA 3WS2A 1XX2A 2HZ5A 2Z6DA 2Y4AA 2WKPA 3DW0A 5G18A 1FCMA 4O8GA 3NOUC 3F1NB 3V50A 1YKDA 2W1TA 2HGVA 4BD0A 3H82A 4Y7PA 4KQQA 4KZ3A 3EWKA 4C6YA 2V8FA 3G32A 1VHMA 2OAP1 4P6BA 4PKYA 1LL8A 2FFYA 3MQ0A 2XD1A 3C4OA 3PBSA 1ES5A 5TJJA 1EROA 3UB7A 1A0KA 2EFXA 5FQKA 5DKLA 4HEFA 5FAPA 4CLCB 1CF0A 4L9FA 4LV0A 4NXBA 2QWSA 4OPYA 3L7HA 1GSWA 1GHPA 2JKGA 3VV4A 1EWZA 1YLWA 3TSGA 3BJNA 4PAUA 4DXBA 2I72A 1ERQA 1XJ3A 4BLMA 2CMNA 4EXOA 1EI5A 4DMZA 4HP9A 4Y13A 1TS0A
chains in the Genus database with same CATH topology
2Y2IA 2J8YA 4S2MA 1KGGA 1NY0A 4U0XA 3GTCA 2Y2OA 5FQQA 4EBLA 2Q9MA 4OQIA 5L2FA 5CTNA 4OP8A 4B4ZA 5CTMA 5KSHA 1RCJA 4OVDA 4Z9QA 4DE3A 2QMIA 5J8XA 2XGNA 3BRMA 3HLGA 1XPBA 4R1GA 3FKVA 3IT9A 3WRTA 1K6RA 4GD6A 4RVAA 5GHXA 4XXRA 4JXSA 3ZG8B 1GHMA 4GN2A 5FI2A 1O07A 1ES3A 2OSUA 3IXBA 4HBUA 1MXOA 5TGFA 3VP3A 3CG5A 4WBGA 4ZJ2A 1SHVA 4N9LA 2ZQ9A 3A3EA 4ZBEA 4F94A 1H8YA 5F83A 4Y0UA 1L0GA 1TDLA 4Q8IA 2WKHA 3MBZA 4Y0OA 5AQ9A 3TOIA 2Q9NA 4ZTKA 4KG6A 3NCKA 4OPQA 3V3SA 1ALQA 4S2KA 5FQJA 4OLGA 2XFTA 3WS4A 3CJMA 4WMCA 4XUXA 3OPHA 5EVLA 3PAGA 3ITBA 4E3MA 4NETA 3UPOA 2OLVA 1QMFA 2IWDA 1LI0A 3G2ZA 4FCFA 2HDRA 1ES2A 2ZM8A 5BOHA 1YLPA 1FSYA 5FAOA 5TR7A 2ZQ7A 3A3DA 3QNBA 1I2SA 4FD8A 4P0MA 3MXSA 5EVIC 5HFOA 2EX2A 5A91A 5A93A 5M18A 1K55C 3G2YA 4X68A 3SH9A 3GSGA 5E2FA 3TG9A 3ZVTA 4IBXA 1IEMA 3Q1FA 1O7EA 2RCXA 5JYPA 2Z2LB 1MWTA 4PM7A 2BLSA 3NBLA 5GL9A 4S2NA 4DDYA 1IYQA 1CEGA 3BFCA 4JXGA 4EBPA 3VFFA 5GHYA 3UE0A 2GDNA 3WS0A 3I7JA 4R23A 1GCEA 2WGWA 5CERA 3RXWA 1NRFA 4U0TA 4ID4A 3G30A 3MKEA 4X69A 3GVBA 1FQGA 5EE8A 1S6RA 1KE4A 3FYZA 1BUEA 1SDEA 4GDNA 4QY6A 3BFDA 4S2OA 4ZAMA 4BL2A 4XUZA 3FV7A 5HX9A 3VOYA 4GDBA 1Z6FA 2B5RA 2H5SA 4WZ4A 5CECA 5GLBA 3DWKA 3BLMA 1QMEA 1MY8A 1C3BA 2HDQA 3HVFA 4B88A 3OPRA 3WRZA 2J9OA 5M19A 1K4FA 1Q2PA 2P9VB 3IWIA 2VGKA 5DVAA 3VP2A 4IEDA 5E2EA 1K57A 3SOIA 5FSRA 3SS3A 3OZHA 4PMAA 3MKFA 3PBRA 2ZQDA 4OP5A 3V3RA 3IH8A 4JXWA 1LLBA 4PM9A 4EV4A 1ONHA 3VMAA 4UAAA 1BLHA 2EX9A 2WUQA 5FI6A 3BFFA 3SS5A 1PWGA 4PM8A 2HDSA 2J9PA 2Z2MB 2H10A 4KQRA 4RYEA 3HUMA 5GLCA 1IKIA 2WZZA 4OPZA 4RX3A 5CGXA 5E2GA 2ZC5B 1YM1A 5AQAA 5DTSA 1WE4A 2ZQAA 3HUOA 1WYBA 3V39A 2QPNA 5CGSA 3UDFA 4PM5A 1ERMA 3ZNYA 4GNUA 3S1YA 4QJGA 4BENA 4E3OA 5HL1A 2V20A 3FZCA 1LL9A 2WKEA 5E43A 1DJBA 3OPPA 4O7DA 3HLEA 1K57C 2Y2JA 1MPLA 1YT4A 3NY4A 2DCFA 3V5MA 3ZDJA 2CC1A 1ZG4A 4KZ5A 3E2KA 4JF5A 4R0QA 3W4QA 1LL5A 4R3JA 1TEMA 1I5QA 3EQVA 3ZVWA 3UO9A 1KDSA 2XD5A 5KSCA 2C6WB 1G6AA 3E2LA 3VP1A 3SH8A 1HTZA 3GR2A 1OMEA 4DDSA 1FR6A 4DKIA 1KVMA 1WYCA 1YLTA 4JF4A 1FCNA 4QD4A 1G68A 3FKWA 4OLDA 4N9KA 1NJ4A 1MBLA 3G35A 3ZCZA 3IH9A 4N92A 3AGDA 4WEKA 1KE0A 4GKUA 1W7FA 2ZM0A 5A92A 2DNSA 5CRFA 3M2KA 4WMCD 1K56A 4KG2A 5EVID 3Q7VB 4OQHA 2Y2LA 1M6KA 3ZGAB 3ZG5A 5EOOA 1TVFA 3QHYA 1E3UA 1FR1A 4DRTA 3G34A 1DJCA 3BFEA 3C5AA 3Q82A 5FAQA 2WAEA 3NC8A 4E3IA 4P85A 3LEZA 4C75A 3ZG7B 3UDXA 1KDWA 4IBRA 3G31A 4MBHA 5GLAA 4N1XA 4WZ5C 4DF6A 3IF6A 3VSLA 1SKFA 1CEFA 2E8IA 1K54C 3OPLA 3N4IA 4E6XA 1N9BA 2P74A 1PI5A 3UE1A 1Y54A 2Y59A 1ONGA 3BFGA 1IELA 3EQUA 5FA7A 3P98A 4BL3A 5HAPA 4C3QA 1GHIA 4S2LA 4NK3A 4QHCA 3RXXA 1BZAA 4FSFA 5JYOA 4JPMA 1U60A 3N8LA 5TFQA 2BG1A 3BM6A 1IYPA 4E3KA 1K38A 3DWZA 1PIOA 1RGYA 5CEBA 5EECA 5FQ9A 5U47A 2Y2HA 4LV1A 2X01A 1I2WA 1H5XA 1K6SA 2PU2A 2JBFA 2ZC4B 3IXDA 3MZEA 4LCLA 4RA7A 5A90A 3SH7A 1CI8A 1YMXA 4KZAA 5DF9A 1RGZA 3FWLA 3MZFA 4B4XA 3IHAA 2H0YA 4MNRA 4UA6A 1DJAA 4E3LA 4LV3A 2Y91A 2QZ6A 5HARA 5CHJA 1FOFA 3SS4A 4WELA 2A49A 3PBTA 4GOGA 1BSGA 1BTLA 3C7UA 4K0WA 5E2HA 3LY3A 5CEDA 3GQZA 1SCWA 3MXRA 4ZDXA 1L2SA 3Q07A 1PW8A 1HZOA 4S2JA 3N7WA 1XKZA 2WZXA 1E4DA 4JXVA 4S2IA 2ZLYA 3NDGA 5HAQA 1CI9A 1E25A 4MBFA 3VFHA 1L0DA 3N8RA 2EXAA 3AGEA 3VSKA 3UNWA 1S0WA 3WS1A 1NZUA 5EVIB 4E3NA 1YQSA 2Y2KA 1FCOA 3IXHA 4YINA 1VQQA 2Y2PA 5FQMA 5F1FA 4KZ7A 4FH4A 4MLLA 4L0LA 4OOYA 3HBRA 1M40A 1DY6A 3VOZA 4KZ4A 5F1GA 2VGJA 3O86A 2Y2MA 3G4PA 4KZ8A 1L0FA 1W8YA 1JTGA 4GB7A 4LENA 2A3UA 2WK0A 2JCHA 3LCEA 2XLNA 3HLBA 1BULA 4IVKA 2OV5A 3NIAA 4CJNA 5EUAA 3LY4A 5FATA 4DXCA 1JWVA 4EQIA 2ZJ9A 4UA9A 1PZOA 2FFFB 3N8SA 1YLYA 3PBQA 4OH0A 4KZBA 5AQ7A 3UY6A 2UWXA 1LI9A 2ZC6B 2V1ZA 4EUZA 3IQAA 1L0EA 4ZJ1A 4PPRA 4KENB 2J7VA 3M6BA 3BEBA 5HAIA 3W8KA 2XFSA 1MWRA 2DRWA 1VM1A 3GV9A 4CPKA 2EX6A 4S2NC 3C4PA 3HLFA 3ISGA 2IWCA 2X71A 3N6IA 5KMWA 3QNCA 5EVIA 1AXBA 4FH2A 3S4XA 1KGFA 1XA7A 3OCLA 4ZJ3A 3A3FA 2ZM2A 1GA0A 2XEPA 4X55A 3VP4A 4S2PA 5D3OA 2JE5A 2JC7A 3Q81A 4KG5A 4LV2A 1JVJA 4D2OA 4K0XA 1IKGA 2Y2GA 5EOEA 3UE3A 4YFMA 3UPNA 4DE0A 1XP4A 2HP5A 2P9VA 2Y55A 5CHMA 3PAEA 3ZHHA 3ZG0A 3UDIA 3O88A 2G2WA 3C7VA 4RX2A 1KE3A 3UN7A 2WKIA 3GMWA 4E6WA 3RJUA 4R4RA 1SDNA 2HP6A 1K55A 3PBOA 5FASA 4WEJA 2WGVA 1KVLA 2C5WB 4OPRA 1W8QA 1PYYA 3NDEA 2ZQCA 3Q7ZA 3HLDA 4X53A 3OC2A 4LCMA 1JWZA 5DTTA 1XXMA 5AQBA 3IF6B 3MZDA 1ESUA 1N4OA 2IWBA 1CK3A 2OLUA 1IYOA 2G2UA 3JYIA 4QB8A 1LHYA 3W4PA 4BD1A 4Y0TA 4OONA 3NI9A 1HVBA 4QU3A 2EXBA 2H0TA 3IF6C 3ZFZA 3W4OA 1XGJA 1FSWA 4HESA 3Q7VA 3WS5A 4UA7A 2X02A 4WM9A 2PU4A 4M3KA 1ZC2A 5EPHA 5IHVA 4R4SA 1ZKJA 4P87A 3IWQA 4EWFA 2RL3A 1BT5A 4KQOA 3PBNA 2ZMAA 4BJPA 3A3IA 1GA9A 1W79A 3B3XA 1H8ZA 1KGEA 3CMZA 2WADA 3IHBA 2V2FF 3HLCA 5F82A 3IWOA 5DF8A 1MWSA 5CXWA 3HREA 3PTEA 1RP5A 3O3VA 3BECA 3WWXA 1MWUA 1K4EA 3MFDA 4WZ5A 5FI7A 4R3BA 3BLSA 4JLFA 4JKTA 2R9XA 3IF5A 3AGFA 4JF6A 4IVIA 4N1HA 1PWCA 2Y2NA 1J9MA 3OCNA 3WS2A 4MBKA 1BLSA 5DF7A 5HW3A 1XX2A 3GRJA 1PI4A 2HP9A 3CZDA 2Y4AA 4OOLA 1NYMA 4MEZA 3HL9A 5M1AA 2XH9A 1K54A 3DW0A 1FCMA 5G18A 2EFUA 3HUNA 4BQMA 2WGIA 4UHUA 3V50A 1NXYA 3ZNTA 1PZPA 3IXGA 1YLZA 1JWPA 1JTDA 2Y2QA 4OOMA 4BD0A 4Y7PA 4KQQA 4KZ6A 4A5RA 2XQZA 5I94A 1PWDA 2XDMA 4KZ3A 2WGWB 2EX8A 4C6YA 5GHZA 4OQ0A 4JBFA 1HD8A 5FDHA 1ES4A 2ZD8A 3G32A 4OKPA 4DE2A 5KZHA 4P6BA 4E3JA 2FFYA 3DTMA 4OQGA 5DTKA 2XD1A 4WYYA 4U3TA 3C4OA 3ZG9B 5FQIA 4PM6A 3PBSA 1NZOA 1ES5A 1BLPA 2ZC3B 3A3JA 4X56A 3HLWA 1EROA 3M6HA 2EFXA 1E3UD 5FQKA 5FAPA 4HEFA 5GLDA 3D4FA 1XA1A 3VP0A 4GD8A 3ITAA 1MKIA 4LV0A 4K91A 1K56D 1YLJA 2XR0A 1TDGA 1K25A 2WYXA 5CHUA 1PW1A 2HPBA 4OPYA 4EBNA 4HBTA 1GHPA 4X6TA 1IYSA 1EWZA 1YMSA 1BLCA 1XGIA 1YLWA 3TSGA 1Q2QA 4DXBA 2ZC7A 2I72A 1NYYA 4H8RA 1ERQA 1W5DA 2PBYA 4GZBA 2XK1A 2WAFA 2XF3A 3BYDA 3O87A 1ZG6A 2R9WA 3S22A 4BLMA 2ZQ8A 3LO7A 4QY5A 5CGWA 3P09A 3M2JA 1EI5A 3UPPA 2HDUA 1ESIA 4KZ9A 4DE1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Y2I A;  2J8Y A;  4S2M A;  1KGG A;  1NY0 A;  4U0X A;  3GTC A;  2Y2O A;  5FQQ A;  4EBL A;  2Q9M A;  4OQI A;  5L2F A;  5CTN A;  4OP8 A;  4B4Z A;  5CTM A;  5KSH A;  1RCJ A;  4OVD A;  4Z9Q A;  4DE3 A;  2QMI A;  5J8X A;  2XGN A;  3BRM A;  3HLG A;  1XPB A;  4R1G A;  3FKV A;  3IT9 A;  3WRT A;  1K6R A;  4GD6 A;  4RVA A;  5GHX A;  4XXR A;  4JXS A;  3ZG8 B;  1GHM A;  4GN2 A;  5FI2 A;  1O07 A;  1ES3 A;  2OSU A;  3IXB A;  4HBU A;  1MXO A;  5TGF A;  3VP3 A;  3CG5 A;  4WBG A;  4ZJ2 A;  1SHV A;  4N9L A;  2ZQ9 A;  3A3E A;  4ZBE A;  4F94 A;  1H8Y A;  5F83 A;  4Y0U A;  1L0G A;  1TDL A;  4Q8I A;  2WKH A;  3MBZ A;  4Y0O A;  5AQ9 A;  3TOI A;  2Q9N A;  4ZTK A;  4KG6 A;  3NCK A;  4OPQ A;  3V3S A;  1ALQ A;  4S2K A;  5FQJ A;  4OLG A;  2XFT A;  3WS4 A;  3CJM A;  4WMC A;  4XUX A;  3OPH A;  5EVL A;  3PAG A;  3ITB A;  4E3M A;  4NET A;  3UPO A;  2OLV A;  1QMF A;  2IWD A;  1LI0 A;  3G2Z A;  4FCF A;  2HDR A;  1ES2 A;  2ZM8 A;  5BOH A;  1YLP A;  1FSY A;  5FAO A;  5TR7 A;  2ZQ7 A;  3A3D A;  3QNB A;  1I2S A;  4FD8 A;  4P0M A;  3MXS A;  5EVI C;  5HFO A;  2EX2 A;  5A91 A;  5A93 A;  5M18 A;  1K55 C;  3G2Y A;  4X68 A;  3SH9 A;  3GSG A;  5E2F A;  3TG9 A;  3ZVT A;  4IBX A;  1IEM A;  3Q1F A;  1O7E A;  2RCX A;  5JYP A;  2Z2L B;  1MWT A;  4PM7 A;  2BLS A;  3NBL A;  5GL9 A;  4S2N A;  4DDY A;  1IYQ A;  1CEG A;  3BFC A;  4JXG A;  4EBP A;  3VFF A;  5GHY A;  3UE0 A;  2GDN A;  3WS0 A;  3I7J A;  4R23 A;  1GCE A;  2WGW A;  5CER A;  3RXW A;  1NRF A;  4U0T A;  4ID4 A;  3G30 A;  3MKE A;  4X69 A;  3GVB A;  1FQG A;  5EE8 A;  1S6R A;  1KE4 A;  3FYZ A;  1BUE A;  1SDE A;  4GDN A;  4QY6 A;  3BFD A;  4S2O A;  4ZAM A;  4BL2 A;  4XUZ A;  3FV7 A;  5HX9 A;  3VOY A;  4GDB A;  1Z6F A;  2B5R A;  2H5S A;  4WZ4 A;  5CEC A;  5GLB A;  3DWK A;  3BLM A;  1QME A;  1MY8 A;  1C3B A;  2HDQ A;  3HVF A;  4B88 A;  3OPR A;  3WRZ A;  2J9O A;  5M19 A;  1K4F A;  1Q2P A;  2P9V B;  3IWI A;  2VGK A;  5DVA A;  3VP2 A;  4IED A;  5E2E A;  1K57 A;  3SOI A;  5FSR A;  3SS3 A;  3OZH A;  4PMA A;  3MKF A;  3PBR A;  2ZQD A;  4OP5 A;  3V3R A;  3IH8 A;  4JXW A;  1LLB A;  4PM9 A;  4EV4 A;  1ONH A;  3VMA A;  4UAA A;  1BLH A;  2EX9 A;  2WUQ A;  5FI6 A;  3BFF A;  3SS5 A;  1PWG A;  4PM8 A;  2HDS A;  2J9P A;  2Z2M B;  2H10 A;  4KQR A;  4RYE A;  3HUM A;  5GLC A;  1IKI A;  2WZZ A;  4OPZ A;  4RX3 A;  5CGX A;  5E2G A;  2ZC5 B;  1YM1 A;  5AQA A;  5DTS A;  1WE4 A;  2ZQA A;  3HUO A;  1WYB A;  3V39 A;  2QPN A;  5CGS A;  3UDF A;  4PM5 A;  1ERM A;  3ZNY A;  4GNU A;  3S1Y A;  4QJG A;  4BEN A;  4E3O A;  5HL1 A;  2V20 A;  3FZC A;  1LL9 A;  2WKE A;  5E43 A;  1DJB A;  3OPP A;  4O7D A;  3HLE A;  1K57 C;  2Y2J A;  1MPL A;  1YT4 A;  3NY4 A;  2DCF A;  3V5M A;  3ZDJ A;  2CC1 A;  1ZG4 A;  4KZ5 A;  3E2K A;  4JF5 A;  4R0Q A;  3W4Q A;  1LL5 A;  4R3J A;  1TEM A;  1I5Q A;  3EQV A;  3ZVW A;  3UO9 A;  1KDS A;  2XD5 A;  5KSC A;  2C6W B;  1G6A A;  3E2L A;  3VP1 A;  3SH8 A;  1HTZ A;  3GR2 A;  1OME A;  4DDS A;  1FR6 A;  4DKI A;  1KVM A;  1WYC A;  1YLT A;  4JF4 A;  1FCN A;  4QD4 A;  1G68 A;  3FKW A;  4OLD A;  4N9K A;  1NJ4 A;  1MBL A;  3G35 A;  3ZCZ A;  3IH9 A;  4N92 A;  3AGD A;  4WEK A;  1KE0 A;  4GKU A;  1W7F A;  2ZM0 A;  5A92 A;  2DNS A;  5CRF A;  3M2K A;  4WMC D;  1K56 A;  4KG2 A;  5EVI D;  3Q7V B;  4OQH A;  2Y2L A;  1M6K A;  3ZGA B;  3ZG5 A;  5EOO A;  1TVF A;  3QHY A;  1E3U A;  1FR1 A;  4DRT A;  3G34 A;  1DJC A;  3BFE A;  3C5A A;  3Q82 A;  5FAQ A;  2WAE A;  3NC8 A;  4E3I A;  4P85 A;  3LEZ A;  4C75 A;  3ZG7 B;  3UDX A;  1KDW A;  4IBR A;  3G31 A;  4MBH A;  5GLA A;  4N1X A;  4WZ5 C;  4DF6 A;  3IF6 A;  3VSL A;  1SKF A;  1CEF A;  2E8I A;  1K54 C;  3OPL A;  3N4I A;  4E6X A;  1N9B A;  2P74 A;  1PI5 A;  3UE1 A;  1Y54 A;  2Y59 A;  1ONG A;  3BFG A;  1IEL A;  3EQU A;  5FA7 A;  3P98 A;  4BL3 A;  5HAP A;  4C3Q A;  1GHI A;  4S2L A;  4NK3 A;  4QHC A;  3RXX A;  1BZA A;  4FSF A;  5JYO A;  4JPM A;  1U60 A;  3N8L A;  5TFQ A;  2BG1 A;  3BM6 A;  1IYP A;  4E3K A;  1K38 A;  3DWZ A;  1PIO A;  1RGY A;  5CEB A;  5EEC A;  5FQ9 A;  5U47 A;  2Y2H A;  4LV1 A;  2X01 A;  1I2W A;  1H5X A;  1K6S A;  2PU2 A;  2JBF A;  2ZC4 B;  3IXD A;  3MZE A;  4LCL A;  4RA7 A;  5A90 A;  3SH7 A;  1CI8 A;  1YMX A;  4KZA A;  5DF9 A;  1RGZ A;  3FWL A;  3MZF A;  4B4X A;  3IHA A;  2H0Y A;  4MNR A;  4UA6 A;  1DJA A;  4E3L A;  4LV3 A;  2Y91 A;  2QZ6 A;  5HAR A;  5CHJ A;  1FOF A;  3SS4 A;  4WEL A;  2A49 A;  3PBT A;  4GOG A;  1BSG A;  1BTL A;  3C7U A;  4K0W A;  5E2H A;  3LY3 A;  5CED A;  3GQZ A;  1SCW A;  3MXR A;  4ZDX A;  1L2S A;  3Q07 A;  1PW8 A;  1HZO A;  4S2J A;  3N7W A;  1XKZ A;  2WZX A;  1E4D A;  4JXV A;  4S2I A;  2ZLY A;  3NDG A;  5HAQ A;  1CI9 A;  1E25 A;  4MBF A;  3VFH A;  1L0D A;  3N8R A;  2EXA A;  3AGE A;  3VSK A;  3UNW A;  1S0W A;  3WS1 A;  1NZU A;  5EVI B;  4E3N A;  1YQS A;  2Y2K A;  1FCO A;  3IXH A;  4YIN A;  1VQQ A;  2Y2P A;  5FQM A;  5F1F A;  4KZ7 A;  4FH4 A;  4MLL A;  4L0L A;  4OOY A;  3HBR A;  1M40 A;  1DY6 A;  3VOZ A;  4KZ4 A;  5F1G A;  2VGJ A;  3O86 A;  2Y2M A;  3G4P A;  4KZ8 A;  1L0F A;  1W8Y A;  1JTG A;  4GB7 A;  4LEN A;  2A3U A;  2WK0 A;  2JCH A;  3LCE A;  2XLN A;  3HLB A;  1BUL A;  4IVK A;  2OV5 A;  3NIA A;  4CJN A;  5EUA A;  3LY4 A;  5FAT A;  4DXC A;  1JWV A;  4EQI A;  2ZJ9 A;  4UA9 A;  1PZO A;  2FFF B;  3N8S A;  1YLY A;  3PBQ A;  4OH0 A;  4KZB A;  5AQ7 A;  3UY6 A;  2UWX A;  1LI9 A;  2ZC6 B;  2V1Z A;  4EUZ A;  3IQA A;  1L0E A;  4ZJ1 A;  4PPR A;  4KEN B;  2J7V A;  3M6B A;  3BEB A;  5HAI A;  3W8K A;  2XFS A;  1MWR A;  2DRW A;  1VM1 A;  3GV9 A;  4CPK A;  2EX6 A;  4S2N C;  3C4P A;  3HLF A;  3ISG A;  2IWC A;  2X71 A;  3N6I A;  5KMW A;  3QNC A;  5EVI A;  1AXB A;  4FH2 A;  3S4X A;  1KGF A;  1XA7 A;  3OCL A;  4ZJ3 A;  3A3F A;  2ZM2 A;  1GA0 A;  2XEP A;  4X55 A;  3VP4 A;  4S2P A;  5D3O A;  2JE5 A;  2JC7 A;  3Q81 A;  4KG5 A;  4LV2 A;  1JVJ A;  4D2O A;  4K0X A;  1IKG A;  2Y2G A;  5EOE A;  3UE3 A;  4YFM A;  3UPN A;  4DE0 A;  1XP4 A;  2HP5 A;  2P9V A;  2Y55 A;  5CHM A;  3PAE A;  3ZHH A;  3ZG0 A;  3UDI A;  3O88 A;  2G2W A;  3C7V A;  4RX2 A;  1KE3 A;  3UN7 A;  2WKI A;  3GMW A;  4E6W A;  3RJU A;  4R4R A;  1SDN A;  2HP6 A;  1K55 A;  3PBO A;  5FAS A;  4WEJ A;  2WGV A;  1KVL A;  2C5W B;  4OPR A;  1W8Q A;  1PYY A;  3NDE A;  2ZQC A;  3Q7Z A;  3HLD A;  4X53 A;  3OC2 A;  4LCM A;  1JWZ A;  5DTT A;  1XXM A;  5AQB A;  3IF6 B;  3MZD A;  1ESU A;  1N4O A;  2IWB A;  1CK3 A;  2OLU A;  1IYO A;  2G2U A;  3JYI A;  4QB8 A;  1LHY A;  3W4P A;  4BD1 A;  4Y0T A;  4OON A;  3NI9 A;  1HVB A;  4QU3 A;  2EXB A;  2H0T A;  3IF6 C;  3ZFZ A;  3W4O A;  1XGJ A;  1FSW A;  4HES A;  3Q7V A;  3WS5 A;  4UA7 A;  2X02 A;  4WM9 A;  2PU4 A;  4M3K A;  1ZC2 A;  5EPH A;  5IHV A;  4R4S A;  1ZKJ A;  4P87 A;  3IWQ A;  4EWF A;  2RL3 A;  1BT5 A;  4KQO A;  3PBN A;  2ZMA A;  4BJP A;  3A3I A;  1GA9 A;  1W79 A;  3B3X A;  1H8Z A;  1KGE A;  3CMZ A;  2WAD A;  3IHB A;  2V2F F;  3HLC A;  5F82 A;  3IWO A;  5DF8 A;  1MWS A;  5CXW A;  3HRE A;  3PTE A;  1RP5 A;  3O3V A;  3BEC A;  3WWX A;  1MWU A;  1K4E A;  3MFD A;  4WZ5 A;  5FI7 A;  4R3B A;  3BLS A;  4JLF A;  4JKT A;  2R9X A;  3IF5 A;  3AGF A;  4JF6 A;  4IVI A;  4N1H A;  1PWC A;  2Y2N A;  1J9M A;  3OCN A;  3WS2 A;  4MBK A;  1BLS A;  5DF7 A;  5HW3 A;  1XX2 A;  3GRJ A;  1PI4 A;  2HP9 A;  3CZD A;  2Y4A A;  4OOL A;  1NYM A;  4MEZ A;  3HL9 A;  5M1A A;  2XH9 A;  1K54 A;  3DW0 A;  1FCM A;  5G18 A;  2EFU A;  3HUN A;  4BQM A;  2WGI A;  4UHU A;  3V50 A;  1NXY A;  3ZNT A;  1PZP A;  3IXG A;  1YLZ A;  1JWP A;  1JTD A;  2Y2Q A;  4OOM A;  4BD0 A;  4Y7P A;  4KQQ A;  4KZ6 A;  4A5R A;  2XQZ A;  5I94 A;  1PWD A;  2XDM A;  4KZ3 A;  2WGW B;  2EX8 A;  4C6Y A;  5GHZ A;  4OQ0 A;  4JBF A;  1HD8 A;  5FDH A;  1ES4 A;  2ZD8 A;  3G32 A;  4OKP A;  4DE2 A;  5KZH A;  4P6B A;  4E3J A;  2FFY A;  3DTM A;  4OQG A;  5DTK A;  2XD1 A;  4WYY A;  4U3T A;  3C4O A;  3ZG9 B;  5FQI A;  4PM6 A;  3PBS A;  1NZO A;  1ES5 A;  1BLP A;  2ZC3 B;  3A3J A;  4X56 A;  3HLW A;  1ERO A;  3M6H A;  2EFX A;  1E3U D;  5FQK A;  5FAP A;  4HEF A;  5GLD A;  3D4F A;  1XA1 A;  3VP0 A;  4GD8 A;  3ITA A;  1MKI A;  4LV0 A;  4K91 A;  1K56 D;  1YLJ A;  2XR0 A;  1TDG A;  1K25 A;  2WYX A;  5CHU A;  1PW1 A;  2HPB A;  4OPY A;  4EBN A;  4HBT A;  1GHP A;  4X6T A;  1IYS A;  1EWZ A;  1YMS A;  1BLC A;  1XGI A;  1YLW A;  3TSG A;  1Q2Q A;  4DXB A;  2ZC7 A;  2I72 A;  1NYY A;  4H8R A;  1ERQ A;  1W5D A;  2PBY A;  4GZB A;  2XK1 A;  2WAF A;  2XF3 A;  3BYD A;  3O87 A;  1ZG6 A;  2R9W A;  3S22 A;  4BLM A;  2ZQ8 A;  3LO7 A;  4QY5 A;  5CGW A;  3P09 A;  3M2J A;  1EI5 A;  3UPP A;  2HDU A;  1ESI A;  4KZ9 A;  4DE1 A; 
#chains in the Genus database with same CATH topology
 2Y2I A;  1Y4O A;  2J8Y A;  1NY0 A;  4GLQ A;  2Y2O A;  4HJ6 A;  1RCJ A;  4QWO A;  2QMI A;  1TD5 A;  3DTI A;  1TS6 A;  1K6R A;  5IU1 A;  5GHX A;  1D1J A;  1FIL A;  4Y17 A;  2OSU A;  4HBU A;  3VP3 A;  2ZQ9 A;  5F83 A;  3UB8 A;  2WKH A;  3CPT B;  5AQ9 A;  3V3S A;  3WS4 A;  3CJM A;  3T4J A;  3K2N A;  1LSV A;  3IS2 B;  5HZH A;  1ES2 A;  5BOH A;  4LRZ E;  1FSY A;  1ODV A;  2ZQ7 A;  3A3D A;  3QNB A;  1I2S A;  4H6J B;  1V9Z A;  4HQA A;  5HFO A;  4O0P A;  3A0V A;  3SH9 A;  4UQI S;  4IBX A;  3LYX A;  1VEU A;  2Z2L B;  1MWT A;  1DP6 A;  4PM7 A;  3NBL A;  3E98 A;  5DJU A;  1S1Z A;  3BFC A;  4EBP A;  3CUE A;  3UE0 A;  2GDN A;  3LR4 A;  4R23 A;  2OOL A;  4LFU A;  1FQG A;  1KE4 A;  2QJ7 A;  5HX9 A;  4BMW A;  5CEC A;  1QME A;  2HDQ A;  4B88 A;  5M19 A;  4CLC A;  1YAX A;  1Q2P A;  2JKT I;  5HWT A;  3NOP C;  5E2E A;  5FSR A;  1EW0 A;  4PMA A;  4EUV A;  2GNX A;  3IH8 A;  2QKP A;  1MC0 A;  1BLH A;  2WUQ A;  5MC7 A;  2J9P A;  1VET A;  3D72 A;  5GLC A;  3JPU A;  4OPZ A;  1WE4 A;  2L0W A;  1WYB A;  3LIA A;  4PM5 A;  2PD7 A;  2K7S A;  3S1Y A;  4BEN A;  3F1P B;  2V20 A;  4ETZ A;  2D01 A;  5E43 A;  5HDS A;  2Y2J A;  2CC1 A;  3UO9 A;  4P6Z S;  2J80 A;  2C6W B;  3VP1 A;  4MN5 A;  1HTZ A;  1OME A;  1WYC A;  2EWW A;  1OTB A;  4N9K A;  1MBL A;  3ZCZ A;  1KE0 A;  2ZM0 A;  5A92 A;  3Q7V B;  2Y2L A;  3ZGA B;  4XT2 A;  3U4L P;  3F1P A;  1E3U A;  4II7 A;  4DRT A;  3BFE A;  3Q82 A;  5FAQ A;  4E3I A;  4P85 A;  3LEZ A;  1KDW A;  2M7V A;  4IJG A;  4EW7 A;  2ZOH A;  2E8I A;  2P74 A;  4Y15 A;  2Y59 A;  1ONG A;  4LRX C;  3ZYT A;  3BFG A;  1F5M A;  3L9K A;  4X25 A;  4BL3 A;  3K3D A;  3RXX A;  2I9V A;  4JPM A;  1U60 A;  4PKY G;  3BM6 A;  1SKO A;  3DAV A;  3DWZ A;  4LV1 A;  2X01 A;  2ZC4 B;  3MZE A;  4LCL A;  4RA7 A;  3SH7 A;  1CI8 A;  3MS6 A;  4WEL A;  2E8J A;  4GOG A;  1SCW A;  4ZDX A;  1L2S A;  3QP4 A;  4JXV A;  4S2I A;  2ZLY A;  1CI9 A;  3TE8 A;  3VSK A;  3MQQ A;  3OBF A;  4NXF A;  2Y2K A;  3V67 A;  3IXH A;  4YIN A;  1VQQ A;  2V0U A;  2WKQ A;  3R7W A;  4HJ4 A;  3HLB A;  3FC7 A;  4HH2 A;  2R78 A;  4NEE D;  4AFI A;  1L0E A;  4ZJ1 A;  4LGW A;  4KEN B;  2J7V A;  2UV0 E;  3W8K A;  5HAI A;  4CPK A;  3C4P A;  1NWZ A;  3ISG A;  5KMW A;  3IBR A;  3QNC A;  1AXB A;  1XA7 A;  1YPR A;  3A3F A;  4Y5F A;  5HD5 A;  1NLZ A;  2O9A A;  2JE5 A;  4KG5 A;  1G6O A;  3CWF A;  5J3W A;  3KYE A;  3UE3 A;  3MQO A;  4Q0H A;  1XP4 A;  2P9V A;  3ZHH A;  4DE0 A;  1KE3 A;  1F2K A;  2B95 A;  1KVL A;  2C5W B;  4LLO B;  3NDE A;  3HLD A;  3OC2 A;  2XRN A;  3MMH A;  1N4O A;  3U2A A;  3LGO A;  4Y0T A;  3W4P A;  4OON A;  2HV1 A;  3Q7V A;  2X02 A;  4WM9 A;  4M3K A;  1ZC2 A;  2V1B A;  1ZKJ A;  2NUT C;  2XRO A;  4HHD A;  1W79 A;  1KGE A;  3IHB A;  3HRE A;  3PTE A;  1RP5 A;  3O3V A;  5L10 A;  1MWU A;  2PBD P;  5DKK A;  2J3T D;  1T18 A;  4WLA A;  2PT7 A;  2A2L A;  2XA7 M;  1XJ2 A;  1BLS A;  1OJG A;  3GRJ A;  1NYM A;  4MEZ A;  3HL9 A;  5M1A A;  5CX7 A;  4FUW A;  3H7W B;  4R3A A;  1N9N A;  5C5K A;  1X0O A;  2WGI A;  2W27 A;  1YLZ A;  1T19 A;  4A5R A;  2XQZ A;  2HJE A;  5GHZ A;  4JBF A;  3KSF A;  1PNE A;  4D60 A;  3DTM A;  5DTK A;  4WYY A;  3LFV A;  1SZV A;  3ZG9 B;  4ARZ A;  4IUK A;  4PM6 A;  4RQ9 A;  1NZO A;  4X56 A;  2A24 B;  1YSP A;  3GDI A;  2ACG A;  3M6H A;  1LSW A;  1G5U A;  3D4F A;  4YWZ A;  3ZQ5 A;  4BWI A;  2G7U A;  3DTE A;  2INW A;  4GD8 A;  1K56 D;  1YLJ A;  2XR0 A;  3LIE A;  1PW1 A;  2HPB A;  4EBN A;  1IYS A;  1XGI A;  4FTX A;  1Q2Q A;  1NYY A;  4EEP A;  1MKM A;  2WAF A;  2GX5 A;  1ZG6 A;  3S22 A;  3LO7 A;  2B18 A;  4G3W A;  1H3Q A;  4HNB A;  1ESI A;  4U0X A;  5FQQ A;  5L2F A;  5CTN A;  4B4Z A;  5CTM A;  4OVD A;  4DE3 A;  2XGN A;  3BRM A;  3HLG A;  3FKV A;  3IT9 A;  4RVA A;  4JXS A;  3EGD C;  3ZG8 B;  1GHM A;  4GN2 A;  3QP1 A;  3CG5 A;  1T1A A;  4ZJ2 A;  1SHV A;  1S1Y A;  4N9L A;  3A3E A;  2W0N A;  1L0G A;  3TOI A;  5L07 A;  2Q9N A;  4KG6 A;  5FQJ A;  2VLG A;  5EVE A;  2MJ6 A;  5K5B A;  3UPO A;  2IWD A;  5FAO A;  3MXS A;  5LBR A;  5A93 A;  3T4Q A;  1IEM A;  1O7E A;  5JYP A;  1BYW A;  4Y2F A;  4F3L B;  5GHY A;  3I7J A;  4WN5 A;  3RXW A;  2PR6 A;  1NRF A;  3MKE A;  5EE8 A;  3FYZ A;  3MJQ A;  4GDN A;  3BFD A;  4S2O A;  3VOY A;  4ME4 A;  4GDB A;  2B5R A;  2H5S A;  2XSS A;  1PFL A;  3BLM A;  3TRC A;  5AVE A;  3OPR A;  3BWL A;  5DFY A;  2PHY A;  2VGK A;  3VP2 A;  1ZHH B;  3FG8 A;  3K3C A;  3SS3 A;  3OZH A;  3LEQ A;  2ZQD A;  2BTF P;  4JXW A;  4F3L A;  1LLB A;  1VB6 A;  3NUL A;  2FH5 A;  1D06 A;  1PWG A;  2HDS A;  4FOF A;  4KQR A;  3VOL A;  2WZZ A;  2ZC5 B;  5AQA A;  3NEC A;  5CGS A;  3UDF A;  4JGO A;  4E3O A;  1LL9 A;  2OWJ A;  5L09 A;  1K57 C;  4Z1W A;  2DCF A;  3KSI A;  1ZG4 A;  3E2K A;  3W4Q A;  4R3J A;  3EQV A;  3ZVW A;  3O5Y A;  2XD5 A;  1IOU A;  1T1C A;  3E2L A;  3P7N A;  5EM0 A;  4I38 A;  3HJK A;  5IS1 A;  4OLD A;  1NJ4 A;  1OTD A;  3T12 B;  3EGX C;  3A0S A;  3F1N A;  1W7F A;  4BBT A;  2LB9 A;  4WMC D;  4KG2 A;  1G28 A;  4GS9 A;  3T4T A;  1FR1 A;  1DJC A;  5I5L A;  3UME A;  5HWW A;  2WAE A;  3ZG7 B;  4N1X A;  3KYZ A;  4WZ5 C;  3KSG A;  4E6X A;  1N9B A;  3B33 A;  1PI5 A;  1Y54 A;  2QJ5 A;  1IEL A;  2Z6C A;  3IS2 A;  4NK3 A;  4LPZ A;  1BZA A;  2VEA A;  4FSF A;  4EER A;  2KLI A;  2EWV A;  5EEC A;  5FQ9 A;  2Y2H A;  4JGP A;  2PU2 A;  3IXD A;  5A90 A;  5DFX A;  3FWL A;  1GSV A;  5HAR A;  2LB5 A;  5CHJ A;  3SS4 A;  1OPX A;  2A49 A;  2XA7 S;  3PBT A;  3SW1 A;  4K0W A;  3LY3 A;  3GQZ A;  4R6L A;  4B93 A;  3Q07 A;  2WZX A;  3NJA A;  5HAQ A;  4MBF A;  3VFH A;  1S0W A;  1NZU A;  1UGU A;  1PRQ A;  1FCO A;  3QP2 A;  5F1F A;  4FH4 A;  4MLL A;  4L0L A;  3HBR A;  3OLO A;  2VGJ A;  4KZ8 A;  3G4P A;  4GHI B;  3CHW P;  1JTG A;  2JCH A;  1BUL A;  5FAT A;  3LY4 A;  2FFF B;  3N8S A;  1YLY A;  5F68 A;  3PBQ A;  4OH0 A;  5AQ7 A;  3CIT A;  2ZC6 B;  4EUZ A;  3KX0 X;  3QP6 A;  1CQA A;  2VV6 A;  1H8M A;  4M4X A;  1H0M A;  2JHE A;  4S2N C;  3UB5 P;  4Q0I A;  2IWC A;  4ZJ3 A;  2ZM2 A;  1GA0 A;  2XEP A;  4X55 A;  4GS9 B;  5D3O A;  3HCY A;  3C30 A;  2JC7 A;  4D2O A;  1JVJ A;  4K0X A;  4Y3I A;  1IKG A;  5EOE A;  2HP5 A;  3ZG0 A;  3PAE A;  3UDI A;  1P97 A;  4L9G A;  3ULF A;  3CAX A;  2HP6 A;  3R4K A;  4EU0 A;  5FAS A;  2WGV A;  1W8Q A;  1S4R A;  1PYY A;  2ZQC A;  1JWZ A;  2ZOI A;  1XXM A;  5AQB A;  5KIZ A;  2JKF A;  3A0R A;  1IYO A;  4QB8 A;  1STZ A;  2VK3 A;  3JYI A;  3NI9 A;  2V8C A;  3LR0 A;  2EXB A;  3ZFZ A;  4HP4 A;  1XGJ A;  3UB9 A;  5EM1 A;  2PU4 A;  2GJ3 A;  4R4S A;  4P87 A;  3PR6 A;  2RL3 A;  3A3I A;  3GEC A;  5HDD A;  2WAD A;  3HLC A;  5F82 A;  3C38 A;  5F69 A;  3IWO A;  4EEU A;  1MWS A;  3MFD A;  5FL3 A;  4R3B A;  4JLF A;  4JKT A;  3IF5 A;  3D3O A;  4JF6 A;  4IVI A;  3MXQ A;  4MBK A;  3CZD A;  4OOL A;  4P6Z M;  2XH9 A;  3S7N A;  4KQD A;  1T1B A;  3ZNT A;  3IXG A;  2K31 A;  1JWP A;  1JTD A;  4OOM A;  4GHI A;  5I94 A;  1PWD A;  2XDM A;  4OQ0 A;  5L8M A;  1HD8 A;  3CI6 A;  5FDH A;  1ES4 A;  2ZD8 A;  4CQH A;  4DE2 A;  5KZH A;  5DJT A;  4E3J A;  4PHT A;  5HDC A;  1OT9 A;  5TBM A;  3UE6 A;  1BLP A;  4EES A;  5GLD A;  1XA1 A;  3VP0 A;  1MKI A;  1TDG A;  4X6T A;  1YMS A;  1BLC A;  2QYB A;  2VGL S;  2PBY A;  4GJ4 A;  1KOU A;  2XF3 A;  2R9W A;  5CGW A;  3C2W A;  3M2J A;  2HDU A;  4KZ9 A;  4YOF A;  4DE1 A;  3DBA A;  1P9W A;  1KGG A;  3RH8 B;  2PDR A;  2Q9M A;  4OP8 A;  2YKF A;  1OT6 A;  4Z9Q A;  2VA0 A;  5J8X A;  3S7P A;  1K0K A;  1XPB A;  3WRT A;  4GD6 A;  4ARZ B;  4EET B;  4XXR A;  4HOI A;  2VX8 A;  2V0W A;  3T1X A;  1O07 A;  1ES3 A;  4QPR A;  3UMD A;  2O9B A;  3EEA A;  4F94 A;  1H8Y A;  3R7W B;  3FPW A;  3MBZ A;  4Y0O A;  1ALQ A;  4S2K A;  1P0Z A;  4OLG A;  2PYP A;  4XUX A;  1D7E A;  3LI9 A;  2OLV A;  3VE4 A;  2ZM8 A;  1YLP A;  5TR7 A;  4FD8 A;  3PXP A;  2Q0O A;  5M18 A;  1K55 C;  3GSG A;  5E2F A;  3ZVT A;  4R38 A;  3Q1F A;  4ZRR A;  1FIK A;  1XFN A;  3JVV A;  4DDY A;  2KOI A;  1HLU P;  4X69 A;  3GVB A;  3FPV A;  4NG2 A;  1MZU A;  4XUZ A;  4O01 A;  1Z6F A;  2PAV P;  3DWK A;  3RFB A;  1MY8 A;  1C3B A;  3HVF A;  2J9O A;  3EOI A;  3LR3 A;  2VGL M;  1K4F A;  2P9V B;  5DVA A;  4IED A;  4KUO A;  3SOI A;  3KYQ A;  4UEY A;  4PM9 A;  4EV4 A;  4UAA A;  2Y79 A;  4KUK A;  5FI6 A;  3BFF A;  3SS5 A;  2Z2M B;  2H10 A;  2P7J A;  1IKI A;  4RX3 A;  5E2G A;  4MCW A;  1YM1 A;  3DTK A;  3HUO A;  2QPN A;  1ERM A;  3ZNY A;  4QJG A;  3W2Z A;  5HL1 A;  3FZC A;  2WKE A;  4DJ2 A;  2W3G A;  1OJ5 A;  5HSQ A;  1MPL A;  1YT4 A;  1TS7 A;  2K2N A;  4R0Q A;  3UB6 A;  1LL5 A;  2JKR M;  1S67 L;  3KSH A;  1G6A A;  3SH8 A;  1FR6 A;  1KVM A;  4JF4 A;  1FCN A;  2ZL1 B;  1G68 A;  2O9C A;  2P08 A;  3FKW A;  3IH9 A;  4GKU A;  2DNS A;  5CRF A;  3M2K A;  1K56 A;  2YKH A;  4I3I A;  2V1A A;  3B42 A;  4C75 A;  2PD8 A;  3UDX A;  2JKT M;  1N9O A;  2VZW A;  5GLA A;  3B47 A;  2KDK A;  4L9E A;  3IF6 A;  1S4S A;  1SKF A;  3VSL A;  3N4I A;  3S7Q A;  2EA9 A;  5FDS A;  3EQU A;  3IX3 A;  5FA7 A;  4C3Q A;  2OWH A;  2JN7 A;  4QHC A;  4K08 A;  5JYO A;  5TFQ A;  4HY8 A;  2BG1 A;  3ICY A;  1IYP A;  1K38 A;  3QP5 A;  1RGY A;  4HH3 A;  4DJ3 A;  5U47 A;  2W3F A;  2JBF A;  1W63 M;  5HPF A;  5DF9 A;  1RGZ A;  3IHA A;  2H0Y A;  4MNR A;  4E3L A;  2Y91 A;  2L1M A;  3LIC A;  4X1L A;  1BSG A;  1BTL A;  5E2H A;  1TS8 A;  4S2J A;  1E4D A;  1L0D A;  5F5Y A;  3AGE A;  5EVI B;  4E3N A;  5FEF A;  5FQM A;  4KZ7 A;  3IX8 A;  1DRM A;  1M40 A;  3VOZ A;  4KZ4 A;  5F1G A;  3O86 A;  1W8Y A;  4LEN A;  2A3U A;  2WK0 A;  2PYR A;  2OV5 A;  5EUA A;  5HL6 A;  4DXC A;  3LR5 A;  2PR5 A;  4EQI A;  2ZJ9 A;  1PZO A;  4KZB A;  2UWX A;  1LI9 A;  3HJI A;  1OTE A;  4PPR A;  2XFS A;  1MWR A;  1OTI A;  2DRW A;  2EX6 A;  3MSH A;  3NHQ A;  5EVI A;  4FH2 A;  4IUH A;  3S4X A;  4S2P A;  5F6A A;  3Q81 A;  4LV2 A;  2Y2G A;  3UPN A;  5EV0 A;  5CHM A;  3T4S A;  4B9O A;  3O88 A;  3UN7 A;  2WKI A;  3GMW A;  4E6W A;  4R4R A;  2L4R A;  1K55 A;  3PBO A;  5G4Z A;  4OPR A;  1Y28 A;  1ZTU A;  4Q0J A;  1GSX A;  3Q7Z A;  2W1R A;  4MN7 A;  2FZ0 A;  3IF6 B;  3T1R A;  2ZL1 A;  1ESU A;  2W1T B;  5HD3 A;  1CK3 A;  1YSQ A;  2G2U A;  4BD1 A;  1LHY A;  3IF6 C;  1SKO B;  1FSW A;  4HES A;  3WS5 A;  4UA7 A;  2ZBB A;  3MR0 A;  4EWF A;  1BT5 A;  4KQO A;  4BJP A;  2ZMA A;  2KX6 A;  1H8Z A;  1L3L A;  2V2F F;  2NUP C;  1F98 A;  1NRJ A;  1DP8 A;  4X1M A;  4JGQ A;  4DN0 A;  5IT5 A;  2M1C A;  4JGR A;  4GW9 A;  5DF7 A;  5HW3 A;  1PI4 A;  2HP9 A;  4HI4 A;  1K54 A;  4I39 A;  2OAQ 1;  2EFU A;  3HUN A;  4BQM A;  4G3V A;  4UHU A;  1NXY A;  1PZP A;  4UQI M;  2Y2Q A;  2VJW A;  3E0Y A;  4KZ6 A;  4WUJ A;  2WGW B;  2EX8 A;  5A8B A;  1OTA A;  3BY8 A;  4OKP A;  4OQG A;  4U3T A;  3T4K A;  5FQI A;  3A3J A;  2ZC3 B;  3HLW A;  1E3U D;  3JVU A;  2WKR A;  2GZA A;  3ITA A;  4K91 A;  1K25 A;  2WYX A;  3T4L A;  5CHU A;  4HBT A;  2ZC7 A;  4H8R A;  1W5D A;  4GZB A;  2XK1 A;  3BYD A;  3O87 A;  2ZQ8 A;  1XFQ A;  4QY5 A;  3BQ8 A;  3P09 A;  4H6J A;  3UPP A;  3MFX A;  4S2M A;  3GTC A;  2JKR I;  4EBL A;  3E4O A;  4OQI A;  2J3W A;  3T1Q B;  5KSH A;  1J3W A;  1LT0 A;  4R1G A;  5FI2 A;  3LIF A;  5TGF A;  3IXB A;  1MXO A;  1IFQ A;  4WBG A;  3NOT C;  4ZBE A;  4Y0U A;  1TDL A;  4Q8I A;  4ZTK A;  3NCK A;  4OPQ A;  2XFT A;  4WMC A;  3OPH A;  5EVL A;  3E4P A;  3ITB A;  3PAG A;  3PHY A;  4E3M A;  3P01 A;  4NET A;  4NKP A;  1QMF A;  1LI0 A;  1NLY A;  3BQA A;  3G2Z A;  2HDR A;  4FCF A;  4GCZ A;  4CLC D;  2ZMV A;  4P0M A;  5EVI C;  2EX2 A;  5A91 A;  2W3H A;  3G2Y A;  4CLC C;  4X68 A;  3TG9 A;  3D9Y A;  1AWI A;  2RCX A;  3H7W A;  2BLS A;  3BY9 A;  5GL9 A;  4S2N A;  1IYQ A;  1CEG A;  4JXG A;  3VFF A;  4I3J A;  3WS0 A;  1GCE A;  2WGW A;  3F1O B;  3QP8 A;  5CER A;  1WA9 A;  4U0T A;  4ID4 A;  3G30 A;  1S6R A;  1BUE A;  1SDE A;  4ZAM A;  4QY6 A;  4BL2 A;  3FV7 A;  4WZ4 A;  5GLB A;  3WRZ A;  3T1S A;  3IWI A;  4WL9 A;  4NXG A;  1LSX A;  1K57 A;  4HIA A;  3MKF A;  3PBR A;  3S7O A;  4OP5 A;  1S66 L;  3V3R A;  2H28 A;  3G6O A;  2O99 A;  1ONH A;  3VMA A;  4XT2 B;  2EX9 A;  4PM8 A;  4RYE A;  1F9I A;  3HUM A;  5CGX A;  3TW8 A;  5DTS A;  2ZQA A;  3V39 A;  3LIB A;  4GNU A;  1DJB A;  3OPP A;  4O7D A;  3HLE A;  5AVF A;  3NY4 A;  3V5M A;  3T4O A;  5G4Y A;  3ZDJ A;  4KZ5 A;  4JF5 A;  3BW6 A;  1TEM A;  1I5Q A;  1XJ6 A;  4EQ1 A;  2W3E A;  1KDS A;  5KSC A;  1N9L A;  2M7U A;  2VKS A;  3GR2 A;  5TBM B;  4DDS A;  4DKI A;  1YLT A;  4QD4 A;  3G35 A;  3CLO A;  2D02 A;  4N92 A;  3AGD A;  4WEK A;  5J4E A;  3KO6 A;  5EVI D;  4OQH A;  1V9Y A;  3LI8 A;  4NXE A;  1M6K A;  3ZG5 A;  5EOO A;  4HJ3 A;  5HPI A;  1TVF A;  3QHY A;  4I5S A;  2VV7 A;  3G34 A;  3C5A A;  3EEH A;  3NC8 A;  4ESP A;  4IBR A;  1W63 Q;  3G31 A;  3IX4 A;  4MBH A;  4LRY C;  1VET B;  4DF6 A;  3CUE C;  2VV8 A;  1CEF A;  3OPL A;  1K54 C;  3UE1 A;  3T50 A;  3P98 A;  4YNR A;  5HAP A;  1GHI A;  2AVX A;  4S2L A;  4MMN A;  3E4Q A;  4R70 A;  3N8L A;  4E3K A;  2Y8H A;  1PIO A;  5CEB A;  1I2W A;  1H5X A;  1K6S A;  2O0Y A;  1YMX A;  4KZA A;  4B4X A;  3MZF A;  4UA6 A;  1DJA A;  4LV3 A;  2QZ6 A;  1FOF A;  5FEG A;  4BBU A;  2HJ9 C;  3C8C A;  3C7U A;  3H9W A;  5CED A;  3MXR A;  4MDZ A;  1PW8 A;  1HZO A;  3N7W A;  1XKZ A;  3NDG A;  1E25 A;  4MN6 A;  3N8R A;  2EXA A;  3F1O A;  3UNW A;  3WS1 A;  4ETX A;  1YQS A;  2Y2P A;  2BAS A;  4OOY A;  3TJZ C;  1DY6 A;  2B02 A;  5J7E A;  1XJ4 A;  2Y2M A;  2IA2 A;  1L0F A;  2J3T C;  4GB7 A;  2A24 A;  3SZT A;  3LCE A;  2XLN A;  1UWP X;  3RTY A;  4IVK A;  3NIA A;  4CJN A;  1JWV A;  4UA9 A;  1DP9 A;  3UY6 A;  2V1Z A;  1P9R A;  3IQA A;  3M6B A;  4IHQ A;  3BEB A;  3VE3 A;  3GV9 A;  1VM1 A;  1ACF A;  3HLF A;  2X71 A;  3N6I A;  4BBV A;  1UWN X;  1KGF A;  3OCL A;  3VP4 A;  1VEU B;  4CLC E;  5AJG A;  4YFM A;  2Y55 A;  2HF6 A;  2QHK A;  2G2W A;  3C7V A;  4RX2 A;  3RJU A;  3CPT A;  3PYP A;  1SDN A;  5EFW A;  4WEJ A;  2ZMF A;  4X53 A;  4LCM A;  5DTT A;  1TF1 A;  3LUQ A;  3OOV A;  3MZD A;  2W3D A;  2IWB A;  4E04 A;  2OLU A;  2V9A A;  1JNU A;  1HVB A;  4QU3 A;  2DMW A;  2H0T A;  1Z09 A;  4I3A A;  3W4O A;  3MF0 A;  2PRF A;  2P04 A;  5EPH A;  5IHV A;  3H82 B;  3IWQ A;  3PBN A;  1GA9 A;  3B3X A;  3CMZ A;  3IBJ A;  5DF8 A;  5CXW A;  1CJF A;  3BEC A;  3WWX A;  4G3K A;  1K4E A;  4WZ5 A;  5FI7 A;  3BLS A;  2R9X A;  4WF0 A;  3AGF A;  3LID A;  5HWV A;  4N1H A;  1PWC A;  2Y2N A;  1J9M A;  3OCN A;  3WS2 A;  1XX2 A;  2HZ5 A;  2Z6D A;  2Y4A A;  2WKP A;  3DW0 A;  5G18 A;  1FCM A;  4O8G A;  3NOU C;  3F1N B;  3V50 A;  1YKD A;  2W1T A;  2HGV A;  4BD0 A;  3H82 A;  4Y7P A;  4KQQ A;  4KZ3 A;  3EWK A;  4C6Y A;  2V8F A;  3G32 A;  1VHM A;  2OAP 1;  4P6B A;  4PKY A;  1LL8 A;  2FFY A;  3MQ0 A;  2XD1 A;  3C4O A;  3PBS A;  1ES5 A;  5TJJ A;  1ERO A;  3UB7 A;  1A0K A;  2EFX A;  5FQK A;  5DKL A;  4HEF A;  5FAP A;  4CLC B;  1CF0 A;  4L9F A;  4LV0 A;  4NXB A;  2QWS A;  4OPY A;  3L7H A;  1GSW A;  1GHP A;  2JKG A;  3VV4 A;  1EWZ A;  1YLW A;  3TSG A;  3BJN A;  4PAU A;  4DXB A;  2I72 A;  1ERQ A;  1XJ3 A;  4BLM A;  2CMN A;  4EXO A;  1EI5 A;  4DMZ A;  4HP9 A;  4Y13 A;  1TS0 A; 
#chains in the Genus database with same CATH homology
 2Y2I A;  2J8Y A;  4S2M A;  1KGG A;  1NY0 A;  4U0X A;  3GTC A;  2Y2O A;  5FQQ A;  4EBL A;  2Q9M A;  4OQI A;  5L2F A;  5CTN A;  4OP8 A;  4B4Z A;  5CTM A;  5KSH A;  1RCJ A;  4OVD A;  4Z9Q A;  4DE3 A;  2QMI A;  5J8X A;  2XGN A;  3BRM A;  3HLG A;  1XPB A;  4R1G A;  3FKV A;  3IT9 A;  3WRT A;  1K6R A;  4GD6 A;  4RVA A;  5GHX A;  4XXR A;  4JXS A;  3ZG8 B;  1GHM A;  4GN2 A;  5FI2 A;  1O07 A;  1ES3 A;  2OSU A;  3IXB A;  4HBU A;  1MXO A;  5TGF A;  3VP3 A;  3CG5 A;  4WBG A;  4ZJ2 A;  1SHV A;  4N9L A;  2ZQ9 A;  3A3E A;  4ZBE A;  4F94 A;  1H8Y A;  5F83 A;  4Y0U A;  1L0G A;  1TDL A;  4Q8I A;  2WKH A;  3MBZ A;  4Y0O A;  5AQ9 A;  3TOI A;  2Q9N A;  4ZTK A;  4KG6 A;  3NCK A;  4OPQ A;  3V3S A;  1ALQ A;  4S2K A;  5FQJ A;  4OLG A;  2XFT A;  3WS4 A;  3CJM A;  4WMC A;  4XUX A;  3OPH A;  5EVL A;  3PAG A;  3ITB A;  4E3M A;  4NET A;  3UPO A;  2OLV A;  1QMF A;  2IWD A;  1LI0 A;  3G2Z A;  4FCF A;  2HDR A;  1ES2 A;  2ZM8 A;  5BOH A;  1YLP A;  1FSY A;  5FAO A;  5TR7 A;  2ZQ7 A;  3A3D A;  3QNB A;  1I2S A;  4FD8 A;  4P0M A;  3MXS A;  5EVI C;  5HFO A;  2EX2 A;  5A91 A;  5A93 A;  5M18 A;  1K55 C;  3G2Y A;  4X68 A;  3SH9 A;  3GSG A;  5E2F A;  3TG9 A;  3ZVT A;  4IBX A;  1IEM A;  3Q1F A;  1O7E A;  2RCX A;  5JYP A;  2Z2L B;  1MWT A;  4PM7 A;  2BLS A;  3NBL A;  5GL9 A;  4S2N A;  4DDY A;  1IYQ A;  1CEG A;  3BFC A;  4JXG A;  4EBP A;  3VFF A;  5GHY A;  3UE0 A;  2GDN A;  3WS0 A;  3I7J A;  4R23 A;  1GCE A;  2WGW A;  5CER A;  3RXW A;  1NRF A;  4U0T A;  4ID4 A;  3G30 A;  3MKE A;  4X69 A;  3GVB A;  1FQG A;  5EE8 A;  1S6R A;  1KE4 A;  3FYZ A;  1BUE A;  1SDE A;  4GDN A;  4QY6 A;  3BFD A;  4S2O A;  4ZAM A;  4BL2 A;  4XUZ A;  3FV7 A;  5HX9 A;  3VOY A;  4GDB A;  1Z6F A;  2B5R A;  2H5S A;  4WZ4 A;  5CEC A;  5GLB A;  3DWK A;  3BLM A;  1QME A;  1MY8 A;  1C3B A;  2HDQ A;  3HVF A;  4B88 A;  3OPR A;  3WRZ A;  2J9O A;  5M19 A;  1K4F A;  1Q2P A;  2P9V B;  3IWI A;  2VGK A;  5DVA A;  3VP2 A;  4IED A;  5E2E A;  1K57 A;  3SOI A;  5FSR A;  3SS3 A;  3OZH A;  4PMA A;  3MKF A;  3PBR A;  2ZQD A;  4OP5 A;  3V3R A;  3IH8 A;  4JXW A;  1LLB A;  4PM9 A;  4EV4 A;  1ONH A;  3VMA A;  4UAA A;  1BLH A;  2EX9 A;  2WUQ A;  5FI6 A;  3BFF A;  3SS5 A;  1PWG A;  4PM8 A;  2HDS A;  2J9P A;  2Z2M B;  2H10 A;  4KQR A;  4RYE A;  3HUM A;  5GLC A;  1IKI A;  2WZZ A;  4OPZ A;  4RX3 A;  5CGX A;  5E2G A;  2ZC5 B;  1YM1 A;  5AQA A;  5DTS A;  1WE4 A;  2ZQA A;  3HUO A;  1WYB A;  3V39 A;  2QPN A;  5CGS A;  3UDF A;  4PM5 A;  1ERM A;  3ZNY A;  4GNU A;  3S1Y A;  4QJG A;  4BEN A;  4E3O A;  5HL1 A;  2V20 A;  3FZC A;  1LL9 A;  2WKE A;  5E43 A;  1DJB A;  3OPP A;  4O7D A;  3HLE A;  1K57 C;  2Y2J A;  1MPL A;  1YT4 A;  3NY4 A;  2DCF A;  3V5M A;  3ZDJ A;  2CC1 A;  1ZG4 A;  4KZ5 A;  3E2K A;  4JF5 A;  4R0Q A;  3W4Q A;  1LL5 A;  4R3J A;  1TEM A;  1I5Q A;  3EQV A;  3ZVW A;  3UO9 A;  1KDS A;  2XD5 A;  5KSC A;  2C6W B;  1G6A A;  3E2L A;  3VP1 A;  3SH8 A;  1HTZ A;  3GR2 A;  1OME A;  4DDS A;  1FR6 A;  4DKI A;  1KVM A;  1WYC A;  1YLT A;  4JF4 A;  1FCN A;  4QD4 A;  1G68 A;  3FKW A;  4OLD A;  4N9K A;  1NJ4 A;  1MBL A;  3G35 A;  3ZCZ A;  3IH9 A;  4N92 A;  3AGD A;  4WEK A;  1KE0 A;  4GKU A;  1W7F A;  2ZM0 A;  5A92 A;  2DNS A;  5CRF A;  3M2K A;  4WMC D;  1K56 A;  4KG2 A;  5EVI D;  3Q7V B;  4OQH A;  2Y2L A;  1M6K A;  3ZGA B;  3ZG5 A;  5EOO A;  1TVF A;  3QHY A;  1E3U A;  1FR1 A;  4DRT A;  3G34 A;  1DJC A;  3BFE A;  3C5A A;  3Q82 A;  5FAQ A;  2WAE A;  3NC8 A;  4E3I A;  4P85 A;  3LEZ A;  4C75 A;  3ZG7 B;  3UDX A;  1KDW A;  4IBR A;  3G31 A;  4MBH A;  5GLA A;  4N1X A;  4WZ5 C;  4DF6 A;  3IF6 A;  3VSL A;  1SKF A;  1CEF A;  2E8I A;  1K54 C;  3OPL A;  3N4I A;  4E6X A;  1N9B A;  2P74 A;  1PI5 A;  3UE1 A;  1Y54 A;  2Y59 A;  1ONG A;  3BFG A;  1IEL A;  3EQU A;  5FA7 A;  3P98 A;  4BL3 A;  5HAP A;  4C3Q A;  1GHI A;  4S2L A;  4NK3 A;  4QHC A;  3RXX A;  1BZA A;  4FSF A;  5JYO A;  4JPM A;  1U60 A;  3N8L A;  5TFQ A;  2BG1 A;  3BM6 A;  1IYP A;  4E3K A;  1K38 A;  3DWZ A;  1PIO A;  1RGY A;  5CEB A;  5EEC A;  5FQ9 A;  5U47 A;  2Y2H A;  4LV1 A;  2X01 A;  1I2W A;  1H5X A;  1K6S A;  2PU2 A;  2JBF A;  2ZC4 B;  3IXD A;  3MZE A;  4LCL A;  4RA7 A;  5A90 A;  3SH7 A;  1CI8 A;  1YMX A;  4KZA A;  5DF9 A;  1RGZ A;  3FWL A;  3MZF A;  4B4X A;  3IHA A;  2H0Y A;  4MNR A;  4UA6 A;  1DJA A;  4E3L A;  4LV3 A;  2Y91 A;  2QZ6 A;  5HAR A;  5CHJ A;  1FOF A;  3SS4 A;  4WEL A;  2A49 A;  3PBT A;  4GOG A;  1BSG A;  1BTL A;  3C7U A;  4K0W A;  5E2H A;  3LY3 A;  5CED A;  3GQZ A;  1SCW A;  3MXR A;  4ZDX A;  1L2S A;  3Q07 A;  1PW8 A;  1HZO A;  4S2J A;  3N7W A;  1XKZ A;  2WZX A;  1E4D A;  4JXV A;  4S2I A;  2ZLY A;  3NDG A;  5HAQ A;  1CI9 A;  1E25 A;  4MBF A;  3VFH A;  1L0D A;  3N8R A;  2EXA A;  3AGE A;  3VSK A;  3UNW A;  1S0W A;  3WS1 A;  1NZU A;  5EVI B;  4E3N A;  1YQS A;  2Y2K A;  1FCO A;  3IXH A;  4YIN A;  1VQQ A;  2Y2P A;  5FQM A;  5F1F A;  4KZ7 A;  4FH4 A;  4MLL A;  4L0L A;  4OOY A;  3HBR A;  1M40 A;  1DY6 A;  3VOZ A;  4KZ4 A;  5F1G A;  2VGJ A;  3O86 A;  2Y2M A;  3G4P A;  4KZ8 A;  1L0F A;  1W8Y A;  1JTG A;  4GB7 A;  4LEN A;  2A3U A;  2WK0 A;  2JCH A;  3LCE A;  2XLN A;  3HLB A;  1BUL A;  4IVK A;  2OV5 A;  3NIA A;  4CJN A;  5EUA A;  3LY4 A;  5FAT A;  4DXC A;  1JWV A;  4EQI A;  2ZJ9 A;  4UA9 A;  1PZO A;  2FFF B;  3N8S A;  1YLY A;  3PBQ A;  4OH0 A;  4KZB A;  5AQ7 A;  3UY6 A;  2UWX A;  1LI9 A;  2ZC6 B;  2V1Z A;  4EUZ A;  3IQA A;  1L0E A;  4ZJ1 A;  4PPR A;  4KEN B;  2J7V A;  3M6B A;  3BEB A;  5HAI A;  3W8K A;  2XFS A;  1MWR A;  2DRW A;  1VM1 A;  3GV9 A;  4CPK A;  2EX6 A;  4S2N C;  3C4P A;  3HLF A;  3ISG A;  2IWC A;  2X71 A;  3N6I A;  5KMW A;  3QNC A;  5EVI A;  1AXB A;  4FH2 A;  3S4X A;  1KGF A;  1XA7 A;  3OCL A;  4ZJ3 A;  3A3F A;  2ZM2 A;  1GA0 A;  2XEP A;  4X55 A;  3VP4 A;  4S2P A;  5D3O A;  2JE5 A;  2JC7 A;  3Q81 A;  4KG5 A;  4LV2 A;  1JVJ A;  4D2O A;  4K0X A;  1IKG A;  2Y2G A;  5EOE A;  3UE3 A;  4YFM A;  3UPN A;  4DE0 A;  1XP4 A;  2HP5 A;  2P9V A;  2Y55 A;  5CHM A;  3PAE A;  3ZHH A;  3ZG0 A;  3UDI A;  3O88 A;  2G2W A;  3C7V A;  4RX2 A;  1KE3 A;  3UN7 A;  2WKI A;  3GMW A;  4E6W A;  3RJU A;  4R4R A;  1SDN A;  2HP6 A;  1K55 A;  3PBO A;  5FAS A;  4WEJ A;  2WGV A;  1KVL A;  2C5W B;  4OPR A;  1W8Q A;  1PYY A;  3NDE A;  2ZQC A;  3Q7Z A;  3HLD A;  4X53 A;  3OC2 A;  4LCM A;  1JWZ A;  5DTT A;  1XXM A;  5AQB A;  3IF6 B;  3MZD A;  1ESU A;  1N4O A;  2IWB A;  1CK3 A;  2OLU A;  1IYO A;  2G2U A;  3JYI A;  4QB8 A;  1LHY A;  3W4P A;  4BD1 A;  4Y0T A;  4OON A;  3NI9 A;  1HVB A;  4QU3 A;  2EXB A;  2H0T A;  3IF6 C;  3ZFZ A;  3W4O A;  1XGJ A;  1FSW A;  4HES A;  3Q7V A;  3WS5 A;  4UA7 A;  2X02 A;  4WM9 A;  2PU4 A;  4M3K A;  1ZC2 A;  5EPH A;  5IHV A;  4R4S A;  1ZKJ A;  4P87 A;  3IWQ A;  4EWF A;  2RL3 A;  1BT5 A;  4KQO A;  3PBN A;  2ZMA A;  4BJP A;  3A3I A;  1GA9 A;  1W79 A;  3B3X A;  1H8Z A;  1KGE A;  3CMZ A;  2WAD A;  3IHB A;  2V2F F;  3HLC A;  5F82 A;  3IWO A;  5DF8 A;  1MWS A;  5CXW A;  3HRE A;  3PTE A;  1RP5 A;  3O3V A;  3BEC A;  3WWX A;  1MWU A;  1K4E A;  3MFD A;  4WZ5 A;  5FI7 A;  4R3B A;  3BLS A;  4JLF A;  4JKT A;  2R9X A;  3IF5 A;  3AGF A;  4JF6 A;  4IVI A;  4N1H A;  1PWC A;  2Y2N A;  1J9M A;  3OCN A;  3WS2 A;  4MBK A;  1BLS A;  5DF7 A;  5HW3 A;  1XX2 A;  3GRJ A;  1PI4 A;  2HP9 A;  3CZD A;  2Y4A A;  4OOL A;  1NYM A;  4MEZ A;  3HL9 A;  5M1A A;  2XH9 A;  1K54 A;  3DW0 A;  1FCM A;  5G18 A;  2EFU A;  3HUN A;  4BQM A;  2WGI A;  4UHU A;  3V50 A;  1NXY A;  3ZNT A;  1PZP A;  3IXG A;  1YLZ A;  1JWP A;  1JTD A;  2Y2Q A;  4OOM A;  4BD0 A;  4Y7P A;  4KQQ A;  4KZ6 A;  4A5R A;  2XQZ A;  5I94 A;  1PWD A;  2XDM A;  4KZ3 A;  2WGW B;  2EX8 A;  4C6Y A;  5GHZ A;  4OQ0 A;  4JBF A;  1HD8 A;  5FDH A;  1ES4 A;  2ZD8 A;  3G32 A;  4OKP A;  4DE2 A;  5KZH A;  4P6B A;  4E3J A;  2FFY A;  3DTM A;  4OQG A;  5DTK A;  2XD1 A;  4WYY A;  4U3T A;  3C4O A;  3ZG9 B;  5FQI A;  4PM6 A;  3PBS A;  1NZO A;  1ES5 A;  1BLP A;  2ZC3 B;  3A3J A;  4X56 A;  3HLW A;  1ERO A;  3M6H A;  2EFX A;  1E3U D;  5FQK A;  5FAP A;  4HEF A;  5GLD A;  3D4F A;  1XA1 A;  3VP0 A;  4GD8 A;  3ITA A;  1MKI A;  4LV0 A;  4K91 A;  1K56 D;  1YLJ A;  2XR0 A;  1TDG A;  1K25 A;  2WYX A;  5CHU A;  1PW1 A;  2HPB A;  4OPY A;  4EBN A;  4HBT A;  1GHP A;  4X6T A;  1IYS A;  1EWZ A;  1YMS A;  1BLC A;  1XGI A;  1YLW A;  3TSG A;  1Q2Q A;  4DXB A;  2ZC7 A;  2I72 A;  1NYY A;  4H8R A;  1ERQ A;  1W5D A;  2PBY A;  4GZB A;  2XK1 A;  2WAF A;  2XF3 A;  3BYD A;  3O87 A;  1ZG6 A;  2R9W A;  3S22 A;  4BLM A;  2ZQ8 A;  3LO7 A;  4QY5 A;  5CGW A;  3P09 A;  3M2J A;  1EI5 A;  3UPP A;  2HDU A;  1ESI A;  4KZ9 A;  4DE1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...