1IYPA

Toho-1 beta-lactamase in complex with cephalothin
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
260
structure length
260
Chain Sequence
SVQQQLEALEKSSGGRLGVALINTADNSQILYRADERFAMCSTSKVMAAAAVLKQSESDKHLLNQRVEIKKSDLVNYNPIAEKHVNGTMTLAELGAAALQYSDNTAMNKLIAHLGGPDKVTAFARSLGDETFRLDRTAPTLNTAIPGDPRDTTTPLAMAQTLKNLTLGKALAETQRAQLVTWLKGNTTGSASIRAGLPKSWVVGDKTGSGDYGTTNDIAVIWPENHAPLVLVTYFTQPEQKAERRRDILAAAAKIVTHGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Toho-1 beta-lactamase
publication title Acyl-intermediate Structures of the Extended-spectrum Class A beta -Lactamase, Toho-1, in Complex with Cefotaxime, Cephalothin, and Benzylpenicillin.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 89
structure length 260
sequence length 260
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2002-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 1iypA00
1N4OA 2J9PA 1L0FA 4GD6A 4JXSA 2X01A 2J9OA 5AQ9A 2BG1A 2WYXA 1EROA 1HTZA 3HLWA 3SS4A 1MY8A 1EI5A 4OQ0A 2JE5A 3WS5A 4EUZA 2Y2JA 3S1YA 3NDGA 1ZG4A 1S6RA 3WS2A 4DE3A 1MWRA 1ES2A 3FKVA 3OC2A 5GHXA 4DKIA 2VGKA 4S2PA 1K6RA 2P74A 3BFCA 5JYPA 4OOMA 5FQKA 5GLAA 3WRTA 1KE4A 4WEKA 5FASA 5EVIC 5G18A 2XGNA 3V3SA 4B4XA 4WEJA 1TDGA 4FCFA 4K0XA 5FQ9A 4DF6A 4E6WA 1HVBA 3ZCZA 5HW3A 5L2FA 2ZC7A 2QMIA 2WGIA 4UAAA 4D2OA 1XGJA 5EVID 4O7DA 2Y2GA 3WS1A 1M6KA 4WMCA 2ZQDA 1LLBA 1I5QA 4HBTA 5EE8A 3TG9A 2Y2LA 3HUNA 1CK3A 4N1XA 4KQRA 2WKEA 5HAIA 1H5XA 3WS4A 1FCNA 1KE3A 4DRTA 4LV3A 2FFYA 2PU4A 3AGEA 4S2OA 5KSHA 1K56D 1FSYA 1RGYA 2WAFA 3ZG7B 4OP5A 3CJMA 5TR7A 3G31A 5HL1A 4S2NC 3SS5A 3VMAA 3ZFZA 4GZBA 3UDXA 2I72A 3BEBA 2Y2PA 3O86A 3FWLA 3VP0A 4JF6A 3VOZA 1LI0A 3RJUA 4KENB 4OPQA 4RX3A 4H8RA 3FV7A 2Y2QA 5HX9A 1JTDA 4X53A 2B5RA 4L0LA 4ZJ3A 1BLSA 1QMEA 3G2YA 1TVFA 4K0WA 2XFTA 5CHUA 1Y54A 3HLDA 4Y0TA 4X56A 1DJAA 4ZDXA 3BFEA 1J9MA 4C3QA 5DF8A 2XEPA 5DF7A 2XF3A 1YLZA 2ZQ8A 3ISGA 1BUEA 1CEFA 4GN2A 3GQZA 2V20A 5GHYA 4IVKA 5CHMA 4OOLA 4MLLA 4QHCA 1PI5A 5CXWA 3W4PA 4PM8A 3HLEA 1XKZA 5CEDA 2ZMAA 3MKEA 4JXVA 4C75A 1E25A 5U47A 4KZ5A 2WAEA 2Y2MA 2Y4AA 3MFDA 1O7EA 5E2FA 1L0GA 3VP2A 3WS0A 3S4XA 3G2ZA 3QNBA 1YMSA 1XGIA 4OKPA 5GL9A 4KZ3A 1LI9A 3G4PA 4U3TA 2EXAA 4XUXA 1ES3A 5EOOA 5CERA 3GTCA 1C3BA 4E6XA 3ZGAB 4R0QA 2Y2OA 3HLGA 3UE3A 1IYSA 3N7WA 5GLBA 1KDWA 1NZUA 4KZ7A 5GHZA 2J7VA 4UA6A 4EQIA 2G2WA 1GHPA 2EX6A 4RX2A 4OLDA 4FH4A 1MWTA 4RVAA 4FSFA 2PBYA 5D3OA 1GCEA 3Q7VA 2G2UA 3VP3A 1G6AA 3D4FA 3IXGA 3PBQA 2HPBA 2Z2LB 1PW1A 1KVLA 1XPBA 1XX2A 2PU2A 2WGWA 1FR6A 3HVFA 2XD1A 3IXBA 3IF6B 5IHVA 4JF4A 3ZVWA 3C4PA 2OLUA 1YQSA 4GDNA 1K38A 5TFQA 3LY3A 4KG2A 1U60A 2Y2HA 3M2KA 1CI8A 3N8LA 5CHJA 3FZCA 1PWCA 1FCOA 1YLWA 3CZDA 3JYIA 4LV0A 1GA9A 4DE1A 2C5WB 3N8SA 1FQGA 4KZBA 1K57A 1WYBA 2XH9A 3ZNYA 3UPOA 5A91A 1YT4A 4CJNA 1ES5A 1L0DA 4BLMA 3O87A 1E3UD 5FQIA 3SH8A 1K55C 1MKIA 4DXBA 5FAOA 2DNSA 4MBHA 4KZ6A 4Y7PA 1XXMA 3GMWA 4OQIA 1MBLA 3C5AA 4KG5A 4UHUA 3NDEA 3OCLA 3M2JA 5EECA 4E3IA 3DWZA 2IWCA 5TGFA 3VP4A 4OPRA 2BLSA 2R9XA 4BQMA 4CPKA 4BD1A 1NYMA 3Q81A 3I7JA 1K25A 1W79A 4ZBEA 3SOIA 2RCXA 3QHYA 3PBTA 1ES4A 2HDQA 4PMAA 4YINA 1IEMA 2HP9A 2VGJA 3NCKA 2Q9NA 4MNRA 5A92A 5EVIA 4WELA 3TSGA 4U0TA 2WZXA 2XQZA 4PM9A 2QZ6A 3GVBA 1ESUA 1I2WA 3MXRA 3N8RA 3RXWA 3BLSA 3M6BA 2HP5A 4JKTA 2OLVA 2EXBA 3UN7A 3IWQA 1NY0A 4UA9A 1RCJA 4LV1A 1K56A 1PZOA 4A5RA 3ZG9B 2ZC6B 4DDYA 4MBFA 1ERMA 1ERQA 1LL5A 4MBKA 4X69A 4B88A 3LY4A 4BD0A 4E3JA 2WGWB 1SDNA 3DW0A 5E2EA 5DF9A 2EX8A 2Y2IA 2HDSA 1TDLA 5CGXA 1VM1A 3IF6C 3MKFA 4S2NA 1YLPA 2ZC4B 5CTNA 3P09A 4OVDA 2Y2NA 5JYOA 5KMWA 2OV5A 5A93A 5FI6A 3A3FA 3PAGA 4NK3A 2ZM8A 2XLNA 3E2LA 4WZ4A 3HL9A 2ZC5B 1W8YA 5HAQA 4E3LA 4DE2A 2Z2MB 5HFOA 1ONHA 1BTLA 4KG6A 4KQQA 3SH7A 2DCFA 1IYQA 3AGFA 4U0XA 3MZEA 3UY6A 3O88A 1CI9A 5FAPA 2X02A 4QU3A 1GA0A 1ESIA 3V5MA 3W8KA 2WGVA 4OQHA 4EBNA 3BRMA 5AQBA 5FQJA 3VOYA 2H10A 1FOFA 3MZFA 4OP8A 4QY6A 1ZKJA 2R9WA 3IWOA 4YFMA 3O3VA 2V1ZA 4GB7A 1BZAA 4N92A 1W7FA 3FKWA 3G35A 1IYOA 3GRJA 1HZOA 3E2KA 1JVJA 1SKFA 3NI9A 1NYYA 5FAQA 3Q1FA 5CGWA 3CMZA 3Q07A 4DE0A 5EVLA 3OPLA 3CG5A 4IVIA 1PI4A 4X55A 4EBLA 4K91A 4WYYA 3V39A 4ID4A 4KQOA 3GV9A 3IT9A 5FI2A 4PPRA 1NJ4A 4JXGA 3LEZA 4Q8IA 1K54C 1JWVA 4WZ5C 4OONA 3WRZA 4EBPA 1CEGA 1W5DA 2ZQAA 4ZTKA 4R3JA 5CEBA 1PZPA 2V2FF 4LCMA 5EUAA 4EWFA 2ZLYA 5FQQA 3IH9A 4Y0UA 5GLCA 3V3RA 3A3JA 1BULA 2WZZA 4X6TA 1IKIA 1VQQA 3BFGA 3G34A 4QB8A 1PWGA 2ZC3B 5EOEA 4WZ5A 4Z9QA 3UPNA 5F1GA 2HDUA 3HLCA 1GHIA 4BJPA 4S2LA 4HBUA 2OSUA 2Y55A 2E8IA 5FI7A 4BL2A 5M18A 1YM1A 2EX2A 4OOYA 3UPPA 4KZ9A 1L2SA 4LV2A 1JWPA 2ZD8A 4N9KA 2GDNA 3DWKA 4WBGA 3N6IA 4JBFA 4RYEA 3GSGA 4M3KA 2RL3A 2XD5A 1KGGA 1YLTA 2ZM0A 3UNWA 3W4OA 3ZG8B 1KDSA 3UO9A 4HESA 1KVMA 3HLBA 1KE0A 1KGEA 1H8ZA 1JWZA 4FH2A 4JF5A 4R4SA 2P9VA 4UA7A 5HARA 2H0YA 1IKGA 3V50A 3ZDJA 3ZHHA 5KZHA 2ZQ7A 3LCEA 5E43A 3MBZA 5FATA 3GR2A 3IHBA 3UDIA 5J8XA 3UDFA 4E3MA 5GLDA 3C7UA 2J8YA 1E3UA 2WKHA 3ZVTA 2C6WB 5F82A 1YLYA 3BECA 2QPNA 3NIAA 3TOIA 1BLCA 3NY4A 3A3EA 3IHAA 4HEFA 3HUMA 2ZM2A 3C7VA 3PBNA 1K55A 5FQMA 4RA7A 5A90A 4GDBA 3HREA 5E2GA 3SS3A 3MXSA 3HLFA 3ZNTA 2EFXA 3UE0A 4E3NA 1KGFA 1SCWA 3C4OA 1XA1A 1BLPA 4P6BA 2EX9A 1YLJA 5AQAA 2Q9MA 5CTMA 5M1AA 4BENA 2EFUA 1BSGA 3VSKA 1L0EA 1MWSA 5DTSA 3DTMA 3ITAA 2IWBA 4EV4A 1Q2QA 1WYCA 3Q7VB 4OQGA 2FFFB 4WMCD 1N9BA 3HBRA 3P98A 2JCHA 1OMEA 1XP4A 2XK1A 4E3OA 3N4IA 2ZQCA 3OZHA 3G32A 1MXOA 3NC8A 2WADA 3ZG0A 2IWDA 3IXDA 3LO7A 3FYZA 3PBSA 3PBOA 2WUQA 4DXCA 2CC1A 3IQAA 1PIOA 3M6HA 4P85A 3VFHA 3OCNA 5AQ7A 4DDSA 1K6SA 3W4QA 4GOGA 4PM6A 4JXWA 1G68A 2JBFA 4S2IA 4X68A 3BLMA 3Q82A 5DTTA 4LCLA 3A3DA 4IBXA 2XFSA 3IF5A 1NXYA 3IF6A 4PM7A 4R23A 2WKIA 1K4EA 2P9VB 3EQVA 5FDHA 1ALQA 1I2SA 1GHMA 4GD8A 5F83A 3SH9A 4NETA 1YMXA 1MWUA 1EWZA 4JLFA 3PTEA 2DRWA 2H0TA 3NBLA 1LL9A 5EPHA 4WM9A 3ZG5A 3EQUA 4KZAA 1PWDA 3OPPA 3IWIA 4XXRA 5E2HA 2XDMA 5DTKA 1PYYA 4MEZA 4BL3A 1K4FA 3RXXA 1S0WA 2A49A 1ZG6A 1SHVA 3OPHA 4P87A 5FSRA 3VP1A 2UWXA 5DVAA 4IEDA 1WE4A 4C6YA 2XR0A 2Y2KA 3IXHA 4PM5A 4OH0A 4OPZA 1DJCA 4KZ4A 4S2MA 4Y0OA 5EVIB 5CGSA 1FCMA 1W8QA 1DJBA 1TEMA 3G30A 3BFDA 4ZJ2A 1MPLA 5I94A 3HUOA 3Q7ZA 1Z6FA 3S22A 1FR1A 5M19A 1PW8A 4ZJ1A 1E4DA 1LHYA 1AXBA 1ZC2A 3QNCA 4QY5A 1Q2PA 5CECA 4FD8A 4GKUA 5CRFA 5BOHA 2H5SA 4B4ZA 4IBRA 4R3BA 4OLGA 3VSLA 4N9LA 5KSCA 5HAPA 1ONGA 2A3UA 1K54A 5FA7A 4LENA 4OPYA 1IYPA 1H8YA 1NRFA 4GNUA 3BFFA 2X71A 1O07A 4S2KA 4ZAMA 3VFFA 4QD4A 3B3XA 3MZDA 3BM6A 1XA7A 3A3IA 3AGDA 5F1FA 4E3KA 1RP5A 2ZQ9A 1IELA 4S2JA 2Y91A 3IH8A 4XUZA 4KZ8A 4P0MA 1SDEA 2HP6A 1FSWA 1HD8A 1NZOA 1BT5A 3PBRA 3UE1A 2Y59A 1DY6A 1M40A 3PAEA 1K57C 4QJGA 1QMFA 4F94A 4JPMA 3BYDA 3OPRA 1JTGA 2WK0A 2ZJ9A 4N1HA 3WWXA 4R4RA 2JC7A 1RGZA 3ITBA 1BLHA 2HDRA 4R1GA
chains in the Genus database with same CATH superfamily
3JVUA 3VV4A 2B18A 5HWTA 2WYXA 1EROA 1ZHHB 3SS4A 1MY8A 1EI5A 4OQ0A 3WS5A 4ETXA 1MWRA 3FKVA 4PKYA 3BFCA 1KE4A 5EVIC 4WEJA 1TDGA 5FQ9A 4DF6A 1HVBA 5L2FA 2ZC7A 2QMIA 2WGIA 4B93A 3T1QB 3BY9A 3K2NA 4HBTA 5EE8A 3TG9A 4N1XA 4KQRA 5HAIA 1FCNA 3R4KA 1TS6A 3D9YA 1RGYA 2WAFA 2LB9A 3ZG7B 5TR7A 5L10A 1S1ZA 4GZBA 2I72A 3RFBA 2Y2PA 3IBJA 3VP0A 4JF6A 4KENB 4OPQA 1T1AA 4H8RA 2Y2QA 3V67A 3GECA 3VOLA 2GJ3A 5TBMB 4MMNA 3PYPA 4ZJ3A 1GSVA 1OT6A 5CHUA 3VE4A 1J9MA 4C3QA 2XF3A 3ISGA 4GN2A 2QJ5A 5GHYA 2W3DA 4MLLA 5CXWA 4PM8A 1G28A 3R7WA 4KZ5A 2WAEA 3MFDA 3VP2A 1LT0A 1XJ6A 3QNBA 4AFIA 4KZ3A 2B95A 1LI9A 2GZAA 2JKGA 3C30A 4U3TA 4XUXA 3CUEC 3ZGAB 4HY8A 3HCYA 5DKKA 4G3KA 4RX2A 1P9RA 4FH4A 1CJFA 4HP9A 5FL3A 1PW1A 5IU1A 1XPBA 3MMHA 1FR6A 4II7A 3HVFA 3IXBA 3BW6A 4JF4A 3ZVWA 2W3EA 4GDNA 3UMEA 2MJ6A 2Y2HA 3N8LA 1YSPA 1VETB 3CZDA 1CF0A 3IX8A 1GA9A 4DE1A 3ZNYA 4BLMA 3T12B 3JPUA 5FQIA 2DNSA 1V9YA 3B42A 4MBHA 4CLCB 3GMWA 2VKSA 3UB6A 5J4EA 4E3IA 5TGFA 3ZYTA 4CPKA 1NYMA 3Q81A 4ZBEA 2V9AA 2V8FA 1UGUA 2VGJA 2Q9NA 2ZMFA 2XROA 3N8RA 3RXWA 2EXBA 2PR6A 2PHYA 1RCJA 4LV1A 1PZOA 4EUVA 3OOVA 3ZG9B 4DDYA 1ERMA 4MBKA 3LY4A 2V1BA 1SDNA 3DW0A 1V9ZA 4H6JA 1VM1A 1OTAA 4S2NA 4EQ1A 2PD7A 5CTNA 2Y2NA 1FIKA 2OV5A 1SZVA 1H8MA 5MC7A 2ZM8A 2QJ7A 1NLYA 2D01A 4G3WA 5FAPA 2VJWA 2K7SA 4YWZA 4MN5A 1ESIA 5C5KA 5FQJA 3MXQA 5HZHA 4FTXA 4GB7A 1Y28A 1IYOA 3E2KA 1JVJA 1SKFA 3NI9A 3Q1FA 4MN6A 4DMZA 5EVLA 3T4OA 3CG5A 3V39A 5FI2A 2O9AA 4KUKA 3LEZA 3WRZA 4ZTKA 5EUAA 4Q0HA 4X6TA 2OWHA 2UV0E 4Z9QA 5F1GA 1P97A 4BJPA 3E4QA 4HBUA 2Y55A 4BL2A 1YM1A 3UPPA 1XJ4A 1L2SA 4LV2A 1JWPA 2ZD8A 2GDNA 3DWKA 3N6IA 4L9FA 1KGGA 1KDSA 1H8ZA 5KZHA 2H0YA 2ZQ7A 3LCEA 4BBTA 1P0ZA 5HSQA 4E3MA 1MZUA 3QP1A 1T1CA 2WKHA 4QPRA 3ZVTA 3TOIA 3NY4A 1F9IA 3HUMA 2J3TD 1K55A 3HREA 4L9EA 5E2GA 4K08A 1KGFA 4P6BA 2EX9A 3KX0X 3SW1A 1BSGA 3VSKA 2P7JA 3ITAA 1Q2QA 4EEUA 3HBRA 3OBFA 1NRJA 2YKHA 2XA7M 3N4IA 3IXDA 3LO7A 3FYZA 3T4JA 3PBSA 3PBOA 1ODVA 3NJAA 3M6HA 3OCNA 4IJGA 5AQ7A 4HNBA 4JXWA 1TS0A 2HF6A 4S2IA 2VZWA 3CI6A 2XFSA 2PAVP 2ZOHA 1K4EA 3EQVA 5FDHA 3KSIA 2VGLM 2NUPC 3T4KA 4HHDA 3EQUA 4KZAA 1PWDA 2XDMA 1PYYA 4BL3A 3S7NA 2A49A 3KYZA 1YKDA 5FSRA 1Z09A 4JGRA 1WE4A 4C6YA 2Y2KA 4OH0A 1DJCA 2V0UA 1FCMA 4R70A 1W8QA 1DJBA 4L9GA 4ZJ2A 4Y2FA 1AXBA 2H5SA 2J3WA 4Q0JA 3KYQA 5HAPA 1ONGA 1K54A 3EGXC 4OPYA 1NRFA 3BFFA 3B3XA 1XA7A 3AGDA 4H6JB 5F1FA 3IH8A 4P0MA 1D1JA 2VEAA 1BT5A 1M40A 4QJGA 4F3LA 2H28A 1BLHA 4Y17A 1OTDA 4GD6A 3HLWA 4EUZA 2JE5A 2Y2JA 2JN7A 1L3LA 1SKOA 2O9CA 1ZG4A 3GDIA 5G4YA 5GHXA 2VGKA 4S2PA 2PD8A 5FQKA 5GLAA 4WEKA 4FCFA 4E6WA 2JKFA 4WMCA 2WKPA 1LLBA 1CK3A 4R3AA 4DRTA 4LV3A 2DMWA 5L09A 4I3AA 4S2NC 1P9WA 3SS5A 3VMAA 3L7HA 3O86A 1H3QA 1LI0A 1N9OA 1G6OA 2B5RA 4L0LA 3G2YA 1QMEA 3B33A 1TVFA 4Y0TA 5DF8A 2W27A 2XEPA 1YLZA 2ZQ8A 5CHMA 4OOLA 4QHCA 4CLCA 1T1BA 3W4PA 3HLEA 4C75A 3KSFA 5F68A 2JKTM 4MN7A 3E4PA 3EEHA 2Y2MA 3EGDC 1O7EA 5E2FA 1L0GA 3WS0A 4OKPA 2EXAA 5CERA 4E6XA 3IBRA 2Y2OA 3HLGA 3UE3A 3SZTA 5GLBA 1KDWA 4DJ3A 5AVFA 2J7VA 3IX4A 4UA6A 5GHZA 4EEPA 4EQIA 2EX6A 4ME4A 4OLDA 1K0KA 4RVAA 2G2UA 1G6AA 2PT7A 1KVLA 5HDSA 3BQAA 5EM1A 2XD1A 3TRCA 1W63Q 3LFVA 3M2KA 2G7UA 2C5WB 1FQGA 3F1PB 4KZBA 1WYBA 2XH9A 5A91A 3T1SA 4Q0IA 1ES5A 5FEGA 3O87A 2ZMVA 1E3UD 3F1OA 3SH8A 1K55C 4GCZA 1DRMA 3C5AA 3FPWA 3DWZA 4BQMA 4BD1A 3LYXA 3I7JA 1K25A 1W79A 4PAUA 2RCXA 4JGOA 3NCKA 4MNRA 3T1RA 2XQZA 4PM9A 3BLSA 3IWQA 4UA9A 5HPFA 4A5RA 1YSQA 4MBFA 1ERQA 4B88A 3LGOA 2EX8A 2HDSA 1TDLA 2V0WA 4F3LB 1ACFA 5FI6A 3A3FA 3LIBA 2LB5A 5HFOA 3O5YA 3SH7A 1IYQA 1SKOB 3O88A 2A24B 2X02A 3V5MA 3IX3A 3VOYA 3U4LP 4QY6A 2R9WA 2ZL1A 3O3VA 2V1ZA 3GRJA 2ACGA 4D60A 4P6ZS 2XRNA 3ULFA 2PRFA 3CMZA 3Q07A 5DKLA 4DE0A 3OPLA 4IVIA 4EBLA 4K91A 4WYYA 4JXGA 1K54C 2OOLA 4EBPA 2ZQAA 2A2LA 1PZPA 5FQQA 3IH9A 4Y0UA 3A3JA 3BFGA 3G34A 3QP5A 1PWGA 4UQIM 4WZ5A 2Z6DA 3E0YA 3UPNA 2HDUA 4S2LA 5FI7A 1T19A 4N9KA 5J7EA 2M1CA 4E04A 2XD5A 3B47A 2HV1A 5AVEA 4NXBA 3UO9A 1YAXA 4HESA 4JF5A 4FH2A 5E43A 3GR2A 3UDIA 3C7UA 4Y13A 5F82A 3BECA 2QPNA 5EM0A 4HEFA 4HH2A 2ZM2A 2JKRM 5FQMA 4NEED 2V8CA 4GDBA 2CMNA 3MSHA 3HLFA 3ZNTA 3UE0A 1VEUB 4E3NA 1XA1A 3LICA 5CTMA 3QP4A 5M1AA 2EFUA 4WLAA 5DTSA 2VA0A 2IWBA 1UWPX 1TF1A 2HJEA 3K3CA 4I3JA 1WYCA 4LPZA 4OQGA 1N9BA 3P98A 4R38A 2JCHA 2VK3A 4E3OA 2ZQCA 3G32A 5HPIA 3NC8A 3ZG0A 3TE8A 1S4RA 3LI8A 1PIOA 2L0WA 4P85A 2PDRA 4DDSA 1K6SA 4GOGA 2JBFA 3HJKA 5DTTA 3MQQA 4NXFA 1YPRA 2WKIA 2P9VB 1ALQA 4HIAA 3LUQA 3F1OB 3OLOA 4GD8A 4WUJA 5F83A 3SH9A 4NETA 5EPHA 3PTEA 2DRWA 4CLCC 3D72A 3IWIA 1XFNA 4O01A 1K4FA 3RXXA 1S0WA 3NULA 1KOUA 4P87A 3VP1A 4EERA 3RTYA 4OPZA 1IFQA 1TEMA 1Z6FA 1ZC2A 1Q2PA 4FD8A 1DP9A 4B4ZA 3VSLA 3BWLA 4N9LA 5KSCA 3MFXA 2OWJA 2PYPA 5F69A 5FA7A 2FZ0A 1H8YA 3VFFA 1O07A 4ZAMA 4R6LA 2JHEA 3T4SA 1RP5A 3UB9A 3HJIA 2BASA 2HP6A 3MF0A 3IS2B 3PAEA 4JPMA 3UE6A 4N1HA 2JC7A 2J9PA 3NHQA 1L0FA 4EXOA 2X01A 2J9OA 2ZL1B 1LSWA 4CQHA 4ETZA 1JNUA 3S1YA 3NDGA 1S6RA 3WS2A 2ZOIA 1ES2A 3OC2A 4DKIA 5JYPA 4OOMA 5FASA 4HH3A 2XGNA 3V3SA 4K0XA 3ZCZA 5HW3A 4D2OA 4UAAA 1XGJA 5EVID 2R78A 1I5QA 3LR4A 3HUNA 3W2ZA 4Y3IA 1D06A 1KE3A 2FFYA 2PU4A 4S2OA 2HZ5A 5KSHA 1K56D 4OP5A 3ZFZA 3UDXA 4GS9B 3CHWP 3VOZA 2VV6A 3RJUA 4RX3A 4IUKA 3RH8B 1JTDA 4X53A 3LR5A 3F1PA 1Y54A 3HLDA 5G4ZA 1DJAA 3BFEA 5DF7A 1BUEA 1CEFA 4YOFA 4X1LA 3EEAA 3NECA 1PI5A 3C8CA 4B9OA 5CEDA 2ZMAA 4WN5A 1S66L 4EETB 2D02A 2Y4AA 1X0OA 3S4XA 3G2ZA 1XGIA 5GL9A 3ICYA 3G4PA 3K3DA 1ES3A 3GTCA 1C3BA 1HLUP 4EU0A 1IYSA 1NZUA 5EV0A 3BQ8A 1MWTA 4FSFA 1GCEA 3Q7VA 3IXGA 2HPBA 2Z2LB 3G6OA 4HI4A 1XX2A 5EVEA 2QYBA 1LL8A 2OLUA 1N9LA 3LY3A 1U60A 3P7NA 1CI8A 5A8BA 3FZCA 3N8SA 1K57A 5I5LA 3UPOA 5DJUA 1YT4A 1L0DA 3JVVA 5F6AA 2A24A 4DXBA 5FAOA 1MC0A 1XXMA 1MBLA 4NG2A 4UHUA 3NDEA 3OCLA 5EECA 3P01A 1FILA 5LBRA 3VP4A 3MQ0A 4OPRA 2R9XA 1S67L 2HP9A 3NOTC 4GJ4A 5K5BA 2WZXA 1DP6A 1S4SA 3GVBA 1ESUA 3MXRA 4GW9A 3M6BA 3E4OA 4JKTA 2W1RA 1NY0A 2WKRA 1BYWA 2ZC6B 1AWIA 2VLGA 4X69A 2Z6CA 2WGWB 3DBAA 4E3JA 5CGXA 3MKFA 2E8JA 1F5MA 2ZC4B 3A0VA 5KMWA 2V1AA 5A93A 4NK3A 2QHKA 3E2LA 4WZ4A 3HL9A 1W8YA 4E3LA 4DE2A 2XA7S 1A0KA 3LI9A 2NUTC 1ONHA 1BTLA 4KQQA 4U0XA 3LR3A 3MZEA 3UY6A 4QU3A 1GA0A 4EBNA 3BRMA 3C38A 1FOFA 3MZFA 1ZKJA 3LEQA 4YFMA 4N92A 4CLCD 3FKWA 1VEUA 4EESA 2O99A 2VGLS 5FAQA 1VHMA 3NOPC 2JKTI 5CGWA 2PYRA 2HJ9C 5IT5A 3IT9A 1GSXA 4PPRA 1NJ4A 4Q8IA 1JWVA 2KDKA 4R3JA 5CEBA 2V2FF 4LCMA 4EWFA 2O9BA 3T50A 2ZLYA 3V3RA 1VQQA 4BBVA 4HJ4A 5L8MA 3HLCA 3ITBA 2OSUA 5M18A 2E8IA 4OOYA 4KZ9A 4WBGA 4JBFA 4RYEA 3GSGA 4KUOA 2RL3A 2B02A 1J3WA 3UNWA 3W4OA 3ZG8B 3HLBA 1KE0A 1KGEA 5HARA 2P9VA 1IKGA 3ZDJA 3ZHHA 3NOUC 3MBZA 3MR0A 4HJ3A 5FATA 5J8XA 2P04A 5GLDA 2ZBBA 2KOIA 2J8YA 1E3UA 2J3TC 2C6WB 2VV8A 5L07A 1BLCA 1PFLA 2L1MA 5A90A 2EFXA 1BLPA 4HP4A 4PKYG 3KYEA 4XT2A 3L9KA 5AQAA 4BENA 5CX7A 3TW8A 3A0SA 3DTMA 2KLIA 1TD5A 2AVXA 4EV4A 3Q7VB 3ZQ5A 2FFFB 3LIFA 1OMEA 1XP4A 2XK1A 1CQAA 3OZHA 4BMWA 1MXOA 3H9WA 2WADA 3QP2A 5HL6A 2WUQA 4DXCA 3IQAA 5HWWA 4PM6A 1G68A 4WF0A 3BLMA 3Q82A 4LCLA 3A3DA 2I9VA 3IS2A 1NXYA 3IF6A 4R23A 3PHYA 1I2SA 5HDCA 1MWUA 1EWZA 4JLFA 5AJGA 4MCWA 1LL9A 2W0NA 3OPPA 4XXRA 5DTKA 4MEZA 3EOIA 2L4RA 3FG8A 3T4TA 2Q0OA 2UWXA 4IEDA 5EFWA 2XR0A 4PM5A 4Y0OA 4S2MA 2KX6A 3G30A 3BFDA 1MPLA 5I94A 3S22A 5M19A 1PW8A 1E4DA 1OTBA 3QNCA 2EWVA 4Z1WA 5BOHA 3H7WB 3S7QA 2A3UA 3MQOA 4LENA 4S2KA 5TJJA 1GSWA 4QD4A 3MZDA 3A3IA 3EWKA 4E3KA 4S2JA 1IELA 2Y91A 2VV7A 4XUZA 4GS9A 1HD8A 3PBRA 3UE1A 1DY6A 1K57C 1QMFA 4O0PA 3BYDA 3OPRA 3WWXA 2M7VA 1RGZA 1N4OA 3KSGA 4JXSA 5AQ9A 2BG1A 4BBUA 1HTZA 4DN0A 3FC7A 4DE3A 3LIEA 4ARZA 1K6RA 2P74A 2JKRI 3WRTA 5G18A 4B4XA 3PR6A 3F1NB 1NWZA 4O7DA 2W3GA 2Y2GA 2QWSA 3UB7A 3WS1A 1M6KA 2ZQDA 2Y2LA 3E98A 2WKEA 1H5XA 3WS4A 2EWWA 3QP8A 3AGEA 3S7PA 1FSYA 3CJMA 2W3FA 3G31A 5HL1A 3H82A 4GLQA 3BEBA 4DJ2A 3FWLA 3FV7A 5HX9A 1BLSA 4ZRRA 4K0WA 2XFTA 3S7OA 3DTIA 4X56A 4ZDXA 3CWFA 5DJTA 3GQZA 2V20A 2J80A 4IVKA 2K2NA 4BWIA 1XKZA 3MKEA 4JXVA 4NKPA 4XT2B 1E25A 5U47A 5DFXA 2VX8A 1YMSA 1S1YA 1T18A 5EOOA 4R0QA 4EW7A 3N7WA 4GHIA 3DTKA 4JGPA 4KZ7A 3T1XA 1GHPA 2G2WA 2OAQ1 1WA9A 2PBYA 5D3OA 3VP3A 2OAP1 3D4FA 3PXPA 3PBQA 1H0MA 1OJGA 4FUWA 2PU2A 2WGWA 3A0RA 3IF6B 5IHVA 3C4PA 1OTIA 1YQSA 1K38A 5TFQA 4HOIA 4KG2A 3CITA 5CHJA 5HD3A 1PWCA 1FCOA 1YLWA 2XSSA 3JYIA 4LV0A 2GNXA 3MS6A 4RQ9A 1LSXA 2W3HA 4CJNA 4UQIS 1MKIA 3D3OA 4KZ6A 4Y7PA 4OQIA 4KG5A 2W1TA 3C2WA 3M2JA 4MDZA 2IWCA 1IOUA 3R7WB 3LIDA 2BLSA 4LGWA 3SOIA 4I38A 3QHYA 2Y79A 3PBTA 4PMAA 1ES4A 1NLZA 2HDQA 1F98A 1IEMA 4YINA 5A92A 5EVIA 4WELA 3TSGA 4U0TA 1XFQA 3CPTA 2QZ6A 1I2WA 2HP5A 2OLVA 3UN7A 1PNEA 4IUHA 1K56A 1LL5A 4BD0A 3BY8A 5DF9A 4Y5FA 5E2EA 2Y2IA 2PR5A 3IF6C 1YLPA 2M7UA 5HD5A 3P09A 4OVDA 5JYOA 3KSHA 1OPXA 2PBDP 3PAGA 1F2KA 2XLNA 2ZC5B 5HAQA 4UEYA 2Z2MB 5HWVA 4KG6A 5FDSA 3CAXA 1DP8A 2DCFA 3AGFA 1CI9A 3T4QA 2WGVA 3W8KA 4NXEA 4OQHA 4ARZB 4CLCE 5AQBA 2FH5A 5F5YA 2H10A 5HDDA 4OP8A 4LLOB 3IWOA 4KQDA 1BZAA 1W7FA 3G35A 1HZOA 4I3IA 1NYYA 5IS1A 1G5UA 3TJZC 1PI4A 4X55A 4JGQA 4ID4A 4KQOA 3GV9A 4WZ5C 4OONA 1CEGA 1W5DA 3CUEA 3T4LA 4WL9A 4X25A 5GLCA 1BULA 2WZZA 1IKIA 1Y4OA 4QB8A 3H82B 3DTEA 2ZC3B 5EOEA 1XJ3A 1GHIA 4G3VA 2EX2A 3KO6A 4M3KA 1STZA 1YLTA 2ZM0A 1TS8A 1KVMA 4R4SA 1D7EA 1JWZA 4UA7A 3V50A 3UMDA 1LSVA 3IHBA 5TBMA 3UDFA 4O8GA 1YLYA 3NIAA 4IHQA 1XJ2A 4QWOA 3U2AA 3A3EA 3IHAA 3C7VA 2INWA 3PBNA 4RA7A 3LR0A 3SS3A 3MXSA 3BJNA 1SCWA 3C4OA 1YLJA 2Q9MA 1MKMA 4GHIB 3CLOA 4I5SA 4LRYC 1L0EA 1MWSA 3FPVA 5DFYA 4ESPA 3H7WA 4LRZE 4WMCD 4I39A 2IWDA 4M4XA 1ZTUA 2CC1A 5FEFA 2IA2A 5KIZA 3VFHA 3W4QA 4X68A 1OT9A 3VE3A 1PRQA 4IBXA 3IF5A 4X1MA 4PM7A 2YKFA 4P6ZM 1GHMA 1UWNX 1VETA 1YMXA 1TS7A 2H0TA 3NBLA 3ZG5A 4WM9A 4LFUA 2W1TB 4PHTA 5E2HA 5J3WA 1ZG6A 1SHVA 3DAVA 3OPHA 3MJQA 5DVAA 3IXHA 4KZ4A 1EW0A 5EVIB 5CGSA 4NXGA 4LRXC 3HUOA 3Q7ZA 2GX5A 2EA9A 1FR1A 4ZJ1A 3CPTB 1LHYA 4QY5A 2HGVA 3F1NA 5CECA 4GKUA 5CRFA 4IBRA 4HQAA 4OLGA 4R3BA 3LIAA 2O0YA 2WKQA 2Y8HA 4FOFA 2P08A 1IYPA 4GNUA 2X71A 3UB8A 3BM6A 2BTFP 2ZQ9A 4KZ8A 1SDEA 1VB6A 1FSWA 3QP6A 1OJ5A 4HJ6A 1N9NA 1NZOA 2Y59A 1W63M 1OTEA 4F94A 3UB5P 4YNRA 1JTGA 2WK0A 2ZJ9A 2K31A 4R4RA 2QKPA 4Y15A 2HDRA 4R1GA
chains in the Genus database with same CATH topology
1N4OA 2J9PA 1L0FA 4GD6A 4JXSA 2X01A 2J9OA 5AQ9A 2BG1A 2WYXA 1EROA 1HTZA 3HLWA 3SS4A 1MY8A 1EI5A 4OQ0A 2JE5A 3WS5A 4EUZA 2Y2JA 3S1YA 3NDGA 1ZG4A 1S6RA 3WS2A 4DE3A 1MWRA 1ES2A 3FKVA 3OC2A 5GHXA 4DKIA 2VGKA 4S2PA 1K6RA 2P74A 3BFCA 5JYPA 4OOMA 5FQKA 5GLAA 3WRTA 1KE4A 4WEKA 5FASA 5EVIC 5G18A 2XGNA 3V3SA 4B4XA 4WEJA 1TDGA 4FCFA 4K0XA 5FQ9A 4DF6A 4E6WA 1HVBA 3ZCZA 5HW3A 5L2FA 2ZC7A 2QMIA 2WGIA 4UAAA 4D2OA 1XGJA 5EVID 4O7DA 2Y2GA 3WS1A 1M6KA 4WMCA 2ZQDA 1LLBA 1I5QA 4HBTA 5EE8A 3TG9A 2Y2LA 3HUNA 1CK3A 4N1XA 4KQRA 2WKEA 5HAIA 1H5XA 3WS4A 1FCNA 1KE3A 4DRTA 4LV3A 2FFYA 2PU4A 3AGEA 4S2OA 5KSHA 1K56D 1FSYA 1RGYA 2WAFA 3ZG7B 4OP5A 3CJMA 5TR7A 3G31A 5HL1A 4S2NC 3SS5A 3VMAA 3ZFZA 4GZBA 3UDXA 2I72A 3BEBA 2Y2PA 3O86A 3FWLA 3VP0A 4JF6A 3VOZA 1LI0A 3RJUA 4KENB 4OPQA 4RX3A 4H8RA 3FV7A 2Y2QA 5HX9A 1JTDA 4X53A 2B5RA 4L0LA 4ZJ3A 1BLSA 1QMEA 3G2YA 1TVFA 4K0WA 2XFTA 5CHUA 1Y54A 3HLDA 4Y0TA 4X56A 1DJAA 4ZDXA 3BFEA 1J9MA 4C3QA 5DF8A 2XEPA 5DF7A 2XF3A 1YLZA 2ZQ8A 3ISGA 1BUEA 1CEFA 4GN2A 3GQZA 2V20A 5GHYA 4IVKA 5CHMA 4OOLA 4MLLA 4QHCA 1PI5A 5CXWA 3W4PA 4PM8A 3HLEA 1XKZA 5CEDA 2ZMAA 3MKEA 4JXVA 4C75A 1E25A 5U47A 4KZ5A 2WAEA 2Y2MA 2Y4AA 3MFDA 1O7EA 5E2FA 1L0GA 3VP2A 3WS0A 3S4XA 3G2ZA 3QNBA 1YMSA 1XGIA 4OKPA 5GL9A 4KZ3A 1LI9A 3G4PA 4U3TA 2EXAA 4XUXA 1ES3A 5EOOA 5CERA 3GTCA 1C3BA 4E6XA 3ZGAB 4R0QA 2Y2OA 3HLGA 3UE3A 1IYSA 3N7WA 5GLBA 1KDWA 1NZUA 4KZ7A 5GHZA 2J7VA 4UA6A 4EQIA 2G2WA 1GHPA 2EX6A 4RX2A 4OLDA 4FH4A 1MWTA 4RVAA 4FSFA 2PBYA 5D3OA 1GCEA 3Q7VA 2G2UA 3VP3A 1G6AA 3D4FA 3IXGA 3PBQA 2HPBA 2Z2LB 1PW1A 1KVLA 1XPBA 1XX2A 2PU2A 2WGWA 1FR6A 3HVFA 2XD1A 3IXBA 3IF6B 5IHVA 4JF4A 3ZVWA 3C4PA 2OLUA 1YQSA 4GDNA 1K38A 5TFQA 3LY3A 4KG2A 1U60A 2Y2HA 3M2KA 1CI8A 3N8LA 5CHJA 3FZCA 1PWCA 1FCOA 1YLWA 3CZDA 3JYIA 4LV0A 1GA9A 4DE1A 2C5WB 3N8SA 1FQGA 4KZBA 1K57A 1WYBA 2XH9A 3ZNYA 3UPOA 5A91A 1YT4A 4CJNA 1ES5A 1L0DA 4BLMA 3O87A 1E3UD 5FQIA 3SH8A 1K55C 1MKIA 4DXBA 5FAOA 2DNSA 4MBHA 4KZ6A 4Y7PA 1XXMA 3GMWA 4OQIA 1MBLA 3C5AA 4KG5A 4UHUA 3NDEA 3OCLA 3M2JA 5EECA 4E3IA 3DWZA 2IWCA 5TGFA 3VP4A 4OPRA 2BLSA 2R9XA 4BQMA 4CPKA 4BD1A 1NYMA 3Q81A 3I7JA 1K25A 1W79A 4ZBEA 3SOIA 2RCXA 3QHYA 3PBTA 1ES4A 2HDQA 4PMAA 4YINA 1IEMA 2HP9A 2VGJA 3NCKA 2Q9NA 4MNRA 5A92A 5EVIA 4WELA 3TSGA 4U0TA 2WZXA 2XQZA 4PM9A 2QZ6A 3GVBA 1ESUA 1I2WA 3MXRA 3N8RA 3RXWA 3BLSA 3M6BA 2HP5A 4JKTA 2OLVA 2EXBA 3UN7A 3IWQA 1NY0A 4UA9A 1RCJA 4LV1A 1K56A 1PZOA 4A5RA 3ZG9B 2ZC6B 4DDYA 4MBFA 1ERMA 1ERQA 1LL5A 4MBKA 4X69A 4B88A 3LY4A 4BD0A 4E3JA 2WGWB 1SDNA 3DW0A 5E2EA 5DF9A 2EX8A 2Y2IA 2HDSA 1TDLA 5CGXA 1VM1A 3IF6C 3MKFA 4S2NA 1YLPA 2ZC4B 5CTNA 3P09A 4OVDA 2Y2NA 5JYOA 5KMWA 2OV5A 5A93A 5FI6A 3A3FA 3PAGA 4NK3A 2ZM8A 2XLNA 3E2LA 4WZ4A 3HL9A 2ZC5B 1W8YA 5HAQA 4E3LA 4DE2A 2Z2MB 5HFOA 1ONHA 1BTLA 4KG6A 4KQQA 3SH7A 2DCFA 1IYQA 3AGFA 4U0XA 3MZEA 3UY6A 3O88A 1CI9A 5FAPA 2X02A 4QU3A 1GA0A 1ESIA 3V5MA 3W8KA 2WGVA 4OQHA 4EBNA 3BRMA 5AQBA 5FQJA 3VOYA 2H10A 1FOFA 3MZFA 4OP8A 4QY6A 1ZKJA 2R9WA 3IWOA 4YFMA 3O3VA 2V1ZA 4GB7A 1BZAA 4N92A 1W7FA 3FKWA 3G35A 1IYOA 3GRJA 1HZOA 3E2KA 1JVJA 1SKFA 3NI9A 1NYYA 5FAQA 3Q1FA 5CGWA 3CMZA 3Q07A 4DE0A 5EVLA 3OPLA 3CG5A 4IVIA 1PI4A 4X55A 4EBLA 4K91A 4WYYA 3V39A 4ID4A 4KQOA 3GV9A 3IT9A 5FI2A 4PPRA 1NJ4A 4JXGA 3LEZA 4Q8IA 1K54C 1JWVA 4WZ5C 4OONA 3WRZA 4EBPA 1CEGA 1W5DA 2ZQAA 4ZTKA 4R3JA 5CEBA 1PZPA 2V2FF 4LCMA 5EUAA 4EWFA 2ZLYA 5FQQA 3IH9A 4Y0UA 5GLCA 3V3RA 3A3JA 1BULA 2WZZA 4X6TA 1IKIA 1VQQA 3BFGA 3G34A 4QB8A 1PWGA 2ZC3B 5EOEA 4WZ5A 4Z9QA 3UPNA 5F1GA 2HDUA 3HLCA 1GHIA 4BJPA 4S2LA 4HBUA 2OSUA 2Y55A 2E8IA 5FI7A 4BL2A 5M18A 1YM1A 2EX2A 4OOYA 3UPPA 4KZ9A 1L2SA 4LV2A 1JWPA 2ZD8A 4N9KA 2GDNA 3DWKA 4WBGA 3N6IA 4JBFA 4RYEA 3GSGA 4M3KA 2RL3A 2XD5A 1KGGA 1YLTA 2ZM0A 3UNWA 3W4OA 3ZG8B 1KDSA 3UO9A 4HESA 1KVMA 3HLBA 1KE0A 1KGEA 1H8ZA 1JWZA 4FH2A 4JF5A 4R4SA 2P9VA 4UA7A 5HARA 2H0YA 1IKGA 3V50A 3ZDJA 3ZHHA 5KZHA 2ZQ7A 3LCEA 5E43A 3MBZA 5FATA 3GR2A 3IHBA 3UDIA 5J8XA 3UDFA 4E3MA 5GLDA 3C7UA 2J8YA 1E3UA 2WKHA 3ZVTA 2C6WB 5F82A 1YLYA 3BECA 2QPNA 3NIAA 3TOIA 1BLCA 3NY4A 3A3EA 3IHAA 4HEFA 3HUMA 2ZM2A 3C7VA 3PBNA 1K55A 5FQMA 4RA7A 5A90A 4GDBA 3HREA 5E2GA 3SS3A 3MXSA 3HLFA 3ZNTA 2EFXA 3UE0A 4E3NA 1KGFA 1SCWA 3C4OA 1XA1A 1BLPA 4P6BA 2EX9A 1YLJA 5AQAA 2Q9MA 5CTMA 5M1AA 4BENA 2EFUA 1BSGA 3VSKA 1L0EA 1MWSA 5DTSA 3DTMA 3ITAA 2IWBA 4EV4A 1Q2QA 1WYCA 3Q7VB 4OQGA 2FFFB 4WMCD 1N9BA 3HBRA 3P98A 2JCHA 1OMEA 1XP4A 2XK1A 4E3OA 3N4IA 2ZQCA 3OZHA 3G32A 1MXOA 3NC8A 2WADA 3ZG0A 2IWDA 3IXDA 3LO7A 3FYZA 3PBSA 3PBOA 2WUQA 4DXCA 2CC1A 3IQAA 1PIOA 3M6HA 4P85A 3VFHA 3OCNA 5AQ7A 4DDSA 1K6SA 3W4QA 4GOGA 4PM6A 4JXWA 1G68A 2JBFA 4S2IA 4X68A 3BLMA 3Q82A 5DTTA 4LCLA 3A3DA 4IBXA 2XFSA 3IF5A 1NXYA 3IF6A 4PM7A 4R23A 2WKIA 1K4EA 2P9VB 3EQVA 5FDHA 1ALQA 1I2SA 1GHMA 4GD8A 5F83A 3SH9A 4NETA 1YMXA 1MWUA 1EWZA 4JLFA 3PTEA 2DRWA 2H0TA 3NBLA 1LL9A 5EPHA 4WM9A 3ZG5A 3EQUA 4KZAA 1PWDA 3OPPA 3IWIA 4XXRA 5E2HA 2XDMA 5DTKA 1PYYA 4MEZA 4BL3A 1K4FA 3RXXA 1S0WA 2A49A 1ZG6A 1SHVA 3OPHA 4P87A 5FSRA 3VP1A 2UWXA 5DVAA 4IEDA 1WE4A 4C6YA 2XR0A 2Y2KA 3IXHA 4PM5A 4OH0A 4OPZA 1DJCA 4KZ4A 4S2MA 4Y0OA 5EVIB 5CGSA 1FCMA 1W8QA 1DJBA 1TEMA 3G30A 3BFDA 4ZJ2A 1MPLA 5I94A 3HUOA 3Q7ZA 1Z6FA 3S22A 1FR1A 5M19A 1PW8A 4ZJ1A 1E4DA 1LHYA 1AXBA 1ZC2A 3QNCA 4QY5A 1Q2PA 5CECA 4FD8A 4GKUA 5CRFA 5BOHA 2H5SA 4B4ZA 4IBRA 4R3BA 4OLGA 3VSLA 4N9LA 5KSCA 5HAPA 1ONGA 2A3UA 1K54A 5FA7A 4LENA 4OPYA 1IYPA 1H8YA 1NRFA 4GNUA 3BFFA 2X71A 1O07A 4S2KA 4ZAMA 3VFFA 4QD4A 3B3XA 3MZDA 3BM6A 1XA7A 3A3IA 3AGDA 5F1FA 4E3KA 1RP5A 2ZQ9A 1IELA 4S2JA 2Y91A 3IH8A 4XUZA 4KZ8A 4P0MA 1SDEA 2HP6A 1FSWA 1HD8A 1NZOA 1BT5A 3PBRA 3UE1A 2Y59A 1DY6A 1M40A 3PAEA 1K57C 4QJGA 1QMFA 4F94A 4JPMA 3BYDA 3OPRA 1JTGA 2WK0A 2ZJ9A 4N1HA 3WWXA 4R4RA 2JC7A 1RGZA 3ITBA 1BLHA 2HDRA 4R1GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N4O A;  2J9P A;  1L0F A;  4GD6 A;  4JXS A;  2X01 A;  2J9O A;  5AQ9 A;  2BG1 A;  2WYX A;  1ERO A;  1HTZ A;  3HLW A;  3SS4 A;  1MY8 A;  1EI5 A;  4OQ0 A;  2JE5 A;  3WS5 A;  4EUZ A;  2Y2J A;  3S1Y A;  3NDG A;  1ZG4 A;  1S6R A;  3WS2 A;  4DE3 A;  1MWR A;  1ES2 A;  3FKV A;  3OC2 A;  5GHX A;  4DKI A;  2VGK A;  4S2P A;  1K6R A;  2P74 A;  3BFC A;  5JYP A;  4OOM A;  5FQK A;  5GLA A;  3WRT A;  1KE4 A;  4WEK A;  5FAS A;  5EVI C;  5G18 A;  2XGN A;  3V3S A;  4B4X A;  4WEJ A;  1TDG A;  4FCF A;  4K0X A;  5FQ9 A;  4DF6 A;  4E6W A;  1HVB A;  3ZCZ A;  5HW3 A;  5L2F A;  2ZC7 A;  2QMI A;  2WGI A;  4UAA A;  4D2O A;  1XGJ A;  5EVI D;  4O7D A;  2Y2G A;  3WS1 A;  1M6K A;  4WMC A;  2ZQD A;  1LLB A;  1I5Q A;  4HBT A;  5EE8 A;  3TG9 A;  2Y2L A;  3HUN A;  1CK3 A;  4N1X A;  4KQR A;  2WKE A;  5HAI A;  1H5X A;  3WS4 A;  1FCN A;  1KE3 A;  4DRT A;  4LV3 A;  2FFY A;  2PU4 A;  3AGE A;  4S2O A;  5KSH A;  1K56 D;  1FSY A;  1RGY A;  2WAF A;  3ZG7 B;  4OP5 A;  3CJM A;  5TR7 A;  3G31 A;  5HL1 A;  4S2N C;  3SS5 A;  3VMA A;  3ZFZ A;  4GZB A;  3UDX A;  2I72 A;  3BEB A;  2Y2P A;  3O86 A;  3FWL A;  3VP0 A;  4JF6 A;  3VOZ A;  1LI0 A;  3RJU A;  4KEN B;  4OPQ A;  4RX3 A;  4H8R A;  3FV7 A;  2Y2Q A;  5HX9 A;  1JTD A;  4X53 A;  2B5R A;  4L0L A;  4ZJ3 A;  1BLS A;  1QME A;  3G2Y A;  1TVF A;  4K0W A;  2XFT A;  5CHU A;  1Y54 A;  3HLD A;  4Y0T A;  4X56 A;  1DJA A;  4ZDX A;  3BFE A;  1J9M A;  4C3Q A;  5DF8 A;  2XEP A;  5DF7 A;  2XF3 A;  1YLZ A;  2ZQ8 A;  3ISG A;  1BUE A;  1CEF A;  4GN2 A;  3GQZ A;  2V20 A;  5GHY A;  4IVK A;  5CHM A;  4OOL A;  4MLL A;  4QHC A;  1PI5 A;  5CXW A;  3W4P A;  4PM8 A;  3HLE A;  1XKZ A;  5CED A;  2ZMA A;  3MKE A;  4JXV A;  4C75 A;  1E25 A;  5U47 A;  4KZ5 A;  2WAE A;  2Y2M A;  2Y4A A;  3MFD A;  1O7E A;  5E2F A;  1L0G A;  3VP2 A;  3WS0 A;  3S4X A;  3G2Z A;  3QNB A;  1YMS A;  1XGI A;  4OKP A;  5GL9 A;  4KZ3 A;  1LI9 A;  3G4P A;  4U3T A;  2EXA A;  4XUX A;  1ES3 A;  5EOO A;  5CER A;  3GTC A;  1C3B A;  4E6X A;  3ZGA B;  4R0Q A;  2Y2O A;  3HLG A;  3UE3 A;  1IYS A;  3N7W A;  5GLB A;  1KDW A;  1NZU A;  4KZ7 A;  5GHZ A;  2J7V A;  4UA6 A;  4EQI A;  2G2W A;  1GHP A;  2EX6 A;  4RX2 A;  4OLD A;  4FH4 A;  1MWT A;  4RVA A;  4FSF A;  2PBY A;  5D3O A;  1GCE A;  3Q7V A;  2G2U A;  3VP3 A;  1G6A A;  3D4F A;  3IXG A;  3PBQ A;  2HPB A;  2Z2L B;  1PW1 A;  1KVL A;  1XPB A;  1XX2 A;  2PU2 A;  2WGW A;  1FR6 A;  3HVF A;  2XD1 A;  3IXB A;  3IF6 B;  5IHV A;  4JF4 A;  3ZVW A;  3C4P A;  2OLU A;  1YQS A;  4GDN A;  1K38 A;  5TFQ A;  3LY3 A;  4KG2 A;  1U60 A;  2Y2H A;  3M2K A;  1CI8 A;  3N8L A;  5CHJ A;  3FZC A;  1PWC A;  1FCO A;  1YLW A;  3CZD A;  3JYI A;  4LV0 A;  1GA9 A;  4DE1 A;  2C5W B;  3N8S A;  1FQG A;  4KZB A;  1K57 A;  1WYB A;  2XH9 A;  3ZNY A;  3UPO A;  5A91 A;  1YT4 A;  4CJN A;  1ES5 A;  1L0D A;  4BLM A;  3O87 A;  1E3U D;  5FQI A;  3SH8 A;  1K55 C;  1MKI A;  4DXB A;  5FAO A;  2DNS A;  4MBH A;  4KZ6 A;  4Y7P A;  1XXM A;  3GMW A;  4OQI A;  1MBL A;  3C5A A;  4KG5 A;  4UHU A;  3NDE A;  3OCL A;  3M2J A;  5EEC A;  4E3I A;  3DWZ A;  2IWC A;  5TGF A;  3VP4 A;  4OPR A;  2BLS A;  2R9X A;  4BQM A;  4CPK A;  4BD1 A;  1NYM A;  3Q81 A;  3I7J A;  1K25 A;  1W79 A;  4ZBE A;  3SOI A;  2RCX A;  3QHY A;  3PBT A;  1ES4 A;  2HDQ A;  4PMA A;  4YIN A;  1IEM A;  2HP9 A;  2VGJ A;  3NCK A;  2Q9N A;  4MNR A;  5A92 A;  5EVI A;  4WEL A;  3TSG A;  4U0T A;  2WZX A;  2XQZ A;  4PM9 A;  2QZ6 A;  3GVB A;  1ESU A;  1I2W A;  3MXR A;  3N8R A;  3RXW A;  3BLS A;  3M6B A;  2HP5 A;  4JKT A;  2OLV A;  2EXB A;  3UN7 A;  3IWQ A;  1NY0 A;  4UA9 A;  1RCJ A;  4LV1 A;  1K56 A;  1PZO A;  4A5R A;  3ZG9 B;  2ZC6 B;  4DDY A;  4MBF A;  1ERM A;  1ERQ A;  1LL5 A;  4MBK A;  4X69 A;  4B88 A;  3LY4 A;  4BD0 A;  4E3J A;  2WGW B;  1SDN A;  3DW0 A;  5E2E A;  5DF9 A;  2EX8 A;  2Y2I A;  2HDS A;  1TDL A;  5CGX A;  1VM1 A;  3IF6 C;  3MKF A;  4S2N A;  1YLP A;  2ZC4 B;  5CTN A;  3P09 A;  4OVD A;  2Y2N A;  5JYO A;  5KMW A;  2OV5 A;  5A93 A;  5FI6 A;  3A3F A;  3PAG A;  4NK3 A;  2ZM8 A;  2XLN A;  3E2L A;  4WZ4 A;  3HL9 A;  2ZC5 B;  1W8Y A;  5HAQ A;  4E3L A;  4DE2 A;  2Z2M B;  5HFO A;  1ONH A;  1BTL A;  4KG6 A;  4KQQ A;  3SH7 A;  2DCF A;  1IYQ A;  3AGF A;  4U0X A;  3MZE A;  3UY6 A;  3O88 A;  1CI9 A;  5FAP A;  2X02 A;  4QU3 A;  1GA0 A;  1ESI A;  3V5M A;  3W8K A;  2WGV A;  4OQH A;  4EBN A;  3BRM A;  5AQB A;  5FQJ A;  3VOY A;  2H10 A;  1FOF A;  3MZF A;  4OP8 A;  4QY6 A;  1ZKJ A;  2R9W A;  3IWO A;  4YFM A;  3O3V A;  2V1Z A;  4GB7 A;  1BZA A;  4N92 A;  1W7F A;  3FKW A;  3G35 A;  1IYO A;  3GRJ A;  1HZO A;  3E2K A;  1JVJ A;  1SKF A;  3NI9 A;  1NYY A;  5FAQ A;  3Q1F A;  5CGW A;  3CMZ A;  3Q07 A;  4DE0 A;  5EVL A;  3OPL A;  3CG5 A;  4IVI A;  1PI4 A;  4X55 A;  4EBL A;  4K91 A;  4WYY A;  3V39 A;  4ID4 A;  4KQO A;  3GV9 A;  3IT9 A;  5FI2 A;  4PPR A;  1NJ4 A;  4JXG A;  3LEZ A;  4Q8I A;  1K54 C;  1JWV A;  4WZ5 C;  4OON A;  3WRZ A;  4EBP A;  1CEG A;  1W5D A;  2ZQA A;  4ZTK A;  4R3J A;  5CEB A;  1PZP A;  2V2F F;  4LCM A;  5EUA A;  4EWF A;  2ZLY A;  5FQQ A;  3IH9 A;  4Y0U A;  5GLC A;  3V3R A;  3A3J A;  1BUL A;  2WZZ A;  4X6T A;  1IKI A;  1VQQ A;  3BFG A;  3G34 A;  4QB8 A;  1PWG A;  2ZC3 B;  5EOE A;  4WZ5 A;  4Z9Q A;  3UPN A;  5F1G A;  2HDU A;  3HLC A;  1GHI A;  4BJP A;  4S2L A;  4HBU A;  2OSU A;  2Y55 A;  2E8I A;  5FI7 A;  4BL2 A;  5M18 A;  1YM1 A;  2EX2 A;  4OOY A;  3UPP A;  4KZ9 A;  1L2S A;  4LV2 A;  1JWP A;  2ZD8 A;  4N9K A;  2GDN A;  3DWK A;  4WBG A;  3N6I A;  4JBF A;  4RYE A;  3GSG A;  4M3K A;  2RL3 A;  2XD5 A;  1KGG A;  1YLT A;  2ZM0 A;  3UNW A;  3W4O A;  3ZG8 B;  1KDS A;  3UO9 A;  4HES A;  1KVM A;  3HLB A;  1KE0 A;  1KGE A;  1H8Z A;  1JWZ A;  4FH2 A;  4JF5 A;  4R4S A;  2P9V A;  4UA7 A;  5HAR A;  2H0Y A;  1IKG A;  3V50 A;  3ZDJ A;  3ZHH A;  5KZH A;  2ZQ7 A;  3LCE A;  5E43 A;  3MBZ A;  5FAT A;  3GR2 A;  3IHB A;  3UDI A;  5J8X A;  3UDF A;  4E3M A;  5GLD A;  3C7U A;  2J8Y A;  1E3U A;  2WKH A;  3ZVT A;  2C6W B;  5F82 A;  1YLY A;  3BEC A;  2QPN A;  3NIA A;  3TOI A;  1BLC A;  3NY4 A;  3A3E A;  3IHA A;  4HEF A;  3HUM A;  2ZM2 A;  3C7V A;  3PBN A;  1K55 A;  5FQM A;  4RA7 A;  5A90 A;  4GDB A;  3HRE A;  5E2G A;  3SS3 A;  3MXS A;  3HLF A;  3ZNT A;  2EFX A;  3UE0 A;  4E3N A;  1KGF A;  1SCW A;  3C4O A;  1XA1 A;  1BLP A;  4P6B A;  2EX9 A;  1YLJ A;  5AQA A;  2Q9M A;  5CTM A;  5M1A A;  4BEN A;  2EFU A;  1BSG A;  3VSK A;  1L0E A;  1MWS A;  5DTS A;  3DTM A;  3ITA A;  2IWB A;  4EV4 A;  1Q2Q A;  1WYC A;  3Q7V B;  4OQG A;  2FFF B;  4WMC D;  1N9B A;  3HBR A;  3P98 A;  2JCH A;  1OME A;  1XP4 A;  2XK1 A;  4E3O A;  3N4I A;  2ZQC A;  3OZH A;  3G32 A;  1MXO A;  3NC8 A;  2WAD A;  3ZG0 A;  2IWD A;  3IXD A;  3LO7 A;  3FYZ A;  3PBS A;  3PBO A;  2WUQ A;  4DXC A;  2CC1 A;  3IQA A;  1PIO A;  3M6H A;  4P85 A;  3VFH A;  3OCN A;  5AQ7 A;  4DDS A;  1K6S A;  3W4Q A;  4GOG A;  4PM6 A;  4JXW A;  1G68 A;  2JBF A;  4S2I A;  4X68 A;  3BLM A;  3Q82 A;  5DTT A;  4LCL A;  3A3D A;  4IBX A;  2XFS A;  3IF5 A;  1NXY A;  3IF6 A;  4PM7 A;  4R23 A;  2WKI A;  1K4E A;  2P9V B;  3EQV A;  5FDH A;  1ALQ A;  1I2S A;  1GHM A;  4GD8 A;  5F83 A;  3SH9 A;  4NET A;  1YMX A;  1MWU A;  1EWZ A;  4JLF A;  3PTE A;  2DRW A;  2H0T A;  3NBL A;  1LL9 A;  5EPH A;  4WM9 A;  3ZG5 A;  3EQU A;  4KZA A;  1PWD A;  3OPP A;  3IWI A;  4XXR A;  5E2H A;  2XDM A;  5DTK A;  1PYY A;  4MEZ A;  4BL3 A;  1K4F A;  3RXX A;  1S0W A;  2A49 A;  1ZG6 A;  1SHV A;  3OPH A;  4P87 A;  5FSR A;  3VP1 A;  2UWX A;  5DVA A;  4IED A;  1WE4 A;  4C6Y A;  2XR0 A;  2Y2K A;  3IXH A;  4PM5 A;  4OH0 A;  4OPZ A;  1DJC A;  4KZ4 A;  4S2M A;  4Y0O A;  5EVI B;  5CGS A;  1FCM A;  1W8Q A;  1DJB A;  1TEM A;  3G30 A;  3BFD A;  4ZJ2 A;  1MPL A;  5I94 A;  3HUO A;  3Q7Z A;  1Z6F A;  3S22 A;  1FR1 A;  5M19 A;  1PW8 A;  4ZJ1 A;  1E4D A;  1LHY A;  1AXB A;  1ZC2 A;  3QNC A;  4QY5 A;  1Q2P A;  5CEC A;  4FD8 A;  4GKU A;  5CRF A;  5BOH A;  2H5S A;  4B4Z A;  4IBR A;  4R3B A;  4OLG A;  3VSL A;  4N9L A;  5KSC A;  5HAP A;  1ONG A;  2A3U A;  1K54 A;  5FA7 A;  4LEN A;  4OPY A;  1IYP A;  1H8Y A;  1NRF A;  4GNU A;  3BFF A;  2X71 A;  1O07 A;  4S2K A;  4ZAM A;  3VFF A;  4QD4 A;  3B3X A;  3MZD A;  3BM6 A;  1XA7 A;  3A3I A;  3AGD A;  5F1F A;  4E3K A;  1RP5 A;  2ZQ9 A;  1IEL A;  4S2J A;  2Y91 A;  3IH8 A;  4XUZ A;  4KZ8 A;  4P0M A;  1SDE A;  2HP6 A;  1FSW A;  1HD8 A;  1NZO A;  1BT5 A;  3PBR A;  3UE1 A;  2Y59 A;  1DY6 A;  1M40 A;  3PAE A;  1K57 C;  4QJG A;  1QMF A;  4F94 A;  4JPM A;  3BYD A;  3OPR A;  1JTG A;  2WK0 A;  2ZJ9 A;  4N1H A;  3WWX A;  4R4R A;  2JC7 A;  1RGZ A;  3ITB A;  1BLH A;  2HDR A;  4R1G A; 
#chains in the Genus database with same CATH topology
 3JVU A;  3VV4 A;  2B18 A;  5HWT A;  2WYX A;  1ERO A;  1ZHH B;  3SS4 A;  1MY8 A;  1EI5 A;  4OQ0 A;  3WS5 A;  4ETX A;  1MWR A;  3FKV A;  4PKY A;  3BFC A;  1KE4 A;  5EVI C;  4WEJ A;  1TDG A;  5FQ9 A;  4DF6 A;  1HVB A;  5L2F A;  2ZC7 A;  2QMI A;  2WGI A;  4B93 A;  3T1Q B;  3BY9 A;  3K2N A;  4HBT A;  5EE8 A;  3TG9 A;  4N1X A;  4KQR A;  5HAI A;  1FCN A;  3R4K A;  1TS6 A;  3D9Y A;  1RGY A;  2WAF A;  2LB9 A;  3ZG7 B;  5TR7 A;  5L10 A;  1S1Z A;  4GZB A;  2I72 A;  3RFB A;  2Y2P A;  3IBJ A;  3VP0 A;  4JF6 A;  4KEN B;  4OPQ A;  1T1A A;  4H8R A;  2Y2Q A;  3V67 A;  3GEC A;  3VOL A;  2GJ3 A;  5TBM B;  4MMN A;  3PYP A;  4ZJ3 A;  1GSV A;  1OT6 A;  5CHU A;  3VE4 A;  1J9M A;  4C3Q A;  2XF3 A;  3ISG A;  4GN2 A;  2QJ5 A;  5GHY A;  2W3D A;  4MLL A;  5CXW A;  4PM8 A;  1G28 A;  3R7W A;  4KZ5 A;  2WAE A;  3MFD A;  3VP2 A;  1LT0 A;  1XJ6 A;  3QNB A;  4AFI A;  4KZ3 A;  2B95 A;  1LI9 A;  2GZA A;  2JKG A;  3C30 A;  4U3T A;  4XUX A;  3CUE C;  3ZGA B;  4HY8 A;  3HCY A;  5DKK A;  4G3K A;  4RX2 A;  1P9R A;  4FH4 A;  1CJF A;  4HP9 A;  5FL3 A;  1PW1 A;  5IU1 A;  1XPB A;  3MMH A;  1FR6 A;  4II7 A;  3HVF A;  3IXB A;  3BW6 A;  4JF4 A;  3ZVW A;  2W3E A;  4GDN A;  3UME A;  2MJ6 A;  2Y2H A;  3N8L A;  1YSP A;  1VET B;  3CZD A;  1CF0 A;  3IX8 A;  1GA9 A;  4DE1 A;  3ZNY A;  4BLM A;  3T12 B;  3JPU A;  5FQI A;  2DNS A;  1V9Y A;  3B42 A;  4MBH A;  4CLC B;  3GMW A;  2VKS A;  3UB6 A;  5J4E A;  4E3I A;  5TGF A;  3ZYT A;  4CPK A;  1NYM A;  3Q81 A;  4ZBE A;  2V9A A;  2V8F A;  1UGU A;  2VGJ A;  2Q9N A;  2ZMF A;  2XRO A;  3N8R A;  3RXW A;  2EXB A;  2PR6 A;  2PHY A;  1RCJ A;  4LV1 A;  1PZO A;  4EUV A;  3OOV A;  3ZG9 B;  4DDY A;  1ERM A;  4MBK A;  3LY4 A;  2V1B A;  1SDN A;  3DW0 A;  1V9Z A;  4H6J A;  1VM1 A;  1OTA A;  4S2N A;  4EQ1 A;  2PD7 A;  5CTN A;  2Y2N A;  1FIK A;  2OV5 A;  1SZV A;  1H8M A;  5MC7 A;  2ZM8 A;  2QJ7 A;  1NLY A;  2D01 A;  4G3W A;  5FAP A;  2VJW A;  2K7S A;  4YWZ A;  4MN5 A;  1ESI A;  5C5K A;  5FQJ A;  3MXQ A;  5HZH A;  4FTX A;  4GB7 A;  1Y28 A;  1IYO A;  3E2K A;  1JVJ A;  1SKF A;  3NI9 A;  3Q1F A;  4MN6 A;  4DMZ A;  5EVL A;  3T4O A;  3CG5 A;  3V39 A;  5FI2 A;  2O9A A;  4KUK A;  3LEZ A;  3WRZ A;  4ZTK A;  5EUA A;  4Q0H A;  4X6T A;  2OWH A;  2UV0 E;  4Z9Q A;  5F1G A;  1P97 A;  4BJP A;  3E4Q A;  4HBU A;  2Y55 A;  4BL2 A;  1YM1 A;  3UPP A;  1XJ4 A;  1L2S A;  4LV2 A;  1JWP A;  2ZD8 A;  2GDN A;  3DWK A;  3N6I A;  4L9F A;  1KGG A;  1KDS A;  1H8Z A;  5KZH A;  2H0Y A;  2ZQ7 A;  3LCE A;  4BBT A;  1P0Z A;  5HSQ A;  4E3M A;  1MZU A;  3QP1 A;  1T1C A;  2WKH A;  4QPR A;  3ZVT A;  3TOI A;  3NY4 A;  1F9I A;  3HUM A;  2J3T D;  1K55 A;  3HRE A;  4L9E A;  5E2G A;  4K08 A;  1KGF A;  4P6B A;  2EX9 A;  3KX0 X;  3SW1 A;  1BSG A;  3VSK A;  2P7J A;  3ITA A;  1Q2Q A;  4EEU A;  3HBR A;  3OBF A;  1NRJ A;  2YKH A;  2XA7 M;  3N4I A;  3IXD A;  3LO7 A;  3FYZ A;  3T4J A;  3PBS A;  3PBO A;  1ODV A;  3NJA A;  3M6H A;  3OCN A;  4IJG A;  5AQ7 A;  4HNB A;  4JXW A;  1TS0 A;  2HF6 A;  4S2I A;  2VZW A;  3CI6 A;  2XFS A;  2PAV P;  2ZOH A;  1K4E A;  3EQV A;  5FDH A;  3KSI A;  2VGL M;  2NUP C;  3T4K A;  4HHD A;  3EQU A;  4KZA A;  1PWD A;  2XDM A;  1PYY A;  4BL3 A;  3S7N A;  2A49 A;  3KYZ A;  1YKD A;  5FSR A;  1Z09 A;  4JGR A;  1WE4 A;  4C6Y A;  2Y2K A;  4OH0 A;  1DJC A;  2V0U A;  1FCM A;  4R70 A;  1W8Q A;  1DJB A;  4L9G A;  4ZJ2 A;  4Y2F A;  1AXB A;  2H5S A;  2J3W A;  4Q0J A;  3KYQ A;  5HAP A;  1ONG A;  1K54 A;  3EGX C;  4OPY A;  1NRF A;  3BFF A;  3B3X A;  1XA7 A;  3AGD A;  4H6J B;  5F1F A;  3IH8 A;  4P0M A;  1D1J A;  2VEA A;  1BT5 A;  1M40 A;  4QJG A;  4F3L A;  2H28 A;  1BLH A;  4Y17 A;  1OTD A;  4GD6 A;  3HLW A;  4EUZ A;  2JE5 A;  2Y2J A;  2JN7 A;  1L3L A;  1SKO A;  2O9C A;  1ZG4 A;  3GDI A;  5G4Y A;  5GHX A;  2VGK A;  4S2P A;  2PD8 A;  5FQK A;  5GLA A;  4WEK A;  4FCF A;  4E6W A;  2JKF A;  4WMC A;  2WKP A;  1LLB A;  1CK3 A;  4R3A A;  4DRT A;  4LV3 A;  2DMW A;  5L09 A;  4I3A A;  4S2N C;  1P9W A;  3SS5 A;  3VMA A;  3L7H A;  3O86 A;  1H3Q A;  1LI0 A;  1N9O A;  1G6O A;  2B5R A;  4L0L A;  3G2Y A;  1QME A;  3B33 A;  1TVF A;  4Y0T A;  5DF8 A;  2W27 A;  2XEP A;  1YLZ A;  2ZQ8 A;  5CHM A;  4OOL A;  4QHC A;  4CLC A;  1T1B A;  3W4P A;  3HLE A;  4C75 A;  3KSF A;  5F68 A;  2JKT M;  4MN7 A;  3E4P A;  3EEH A;  2Y2M A;  3EGD C;  1O7E A;  5E2F A;  1L0G A;  3WS0 A;  4OKP A;  2EXA A;  5CER A;  4E6X A;  3IBR A;  2Y2O A;  3HLG A;  3UE3 A;  3SZT A;  5GLB A;  1KDW A;  4DJ3 A;  5AVF A;  2J7V A;  3IX4 A;  4UA6 A;  5GHZ A;  4EEP A;  4EQI A;  2EX6 A;  4ME4 A;  4OLD A;  1K0K A;  4RVA A;  2G2U A;  1G6A A;  2PT7 A;  1KVL A;  5HDS A;  3BQA A;  5EM1 A;  2XD1 A;  3TRC A;  1W63 Q;  3LFV A;  3M2K A;  2G7U A;  2C5W B;  1FQG A;  3F1P B;  4KZB A;  1WYB A;  2XH9 A;  5A91 A;  3T1S A;  4Q0I A;  1ES5 A;  5FEG A;  3O87 A;  2ZMV A;  1E3U D;  3F1O A;  3SH8 A;  1K55 C;  4GCZ A;  1DRM A;  3C5A A;  3FPW A;  3DWZ A;  4BQM A;  4BD1 A;  3LYX A;  3I7J A;  1K25 A;  1W79 A;  4PAU A;  2RCX A;  4JGO A;  3NCK A;  4MNR A;  3T1R A;  2XQZ A;  4PM9 A;  3BLS A;  3IWQ A;  4UA9 A;  5HPF A;  4A5R A;  1YSQ A;  4MBF A;  1ERQ A;  4B88 A;  3LGO A;  2EX8 A;  2HDS A;  1TDL A;  2V0W A;  4F3L B;  1ACF A;  5FI6 A;  3A3F A;  3LIB A;  2LB5 A;  5HFO A;  3O5Y A;  3SH7 A;  1IYQ A;  1SKO B;  3O88 A;  2A24 B;  2X02 A;  3V5M A;  3IX3 A;  3VOY A;  3U4L P;  4QY6 A;  2R9W A;  2ZL1 A;  3O3V A;  2V1Z A;  3GRJ A;  2ACG A;  4D60 A;  4P6Z S;  2XRN A;  3ULF A;  2PRF A;  3CMZ A;  3Q07 A;  5DKL A;  4DE0 A;  3OPL A;  4IVI A;  4EBL A;  4K91 A;  4WYY A;  4JXG A;  1K54 C;  2OOL A;  4EBP A;  2ZQA A;  2A2L A;  1PZP A;  5FQQ A;  3IH9 A;  4Y0U A;  3A3J A;  3BFG A;  3G34 A;  3QP5 A;  1PWG A;  4UQI M;  4WZ5 A;  2Z6D A;  3E0Y A;  3UPN A;  2HDU A;  4S2L A;  5FI7 A;  1T19 A;  4N9K A;  5J7E A;  2M1C A;  4E04 A;  2XD5 A;  3B47 A;  2HV1 A;  5AVE A;  4NXB A;  3UO9 A;  1YAX A;  4HES A;  4JF5 A;  4FH2 A;  5E43 A;  3GR2 A;  3UDI A;  3C7U A;  4Y13 A;  5F82 A;  3BEC A;  2QPN A;  5EM0 A;  4HEF A;  4HH2 A;  2ZM2 A;  2JKR M;  5FQM A;  4NEE D;  2V8C A;  4GDB A;  2CMN A;  3MSH A;  3HLF A;  3ZNT A;  3UE0 A;  1VEU B;  4E3N A;  1XA1 A;  3LIC A;  5CTM A;  3QP4 A;  5M1A A;  2EFU A;  4WLA A;  5DTS A;  2VA0 A;  2IWB A;  1UWP X;  1TF1 A;  2HJE A;  3K3C A;  4I3J A;  1WYC A;  4LPZ A;  4OQG A;  1N9B A;  3P98 A;  4R38 A;  2JCH A;  2VK3 A;  4E3O A;  2ZQC A;  3G32 A;  5HPI A;  3NC8 A;  3ZG0 A;  3TE8 A;  1S4R A;  3LI8 A;  1PIO A;  2L0W A;  4P85 A;  2PDR A;  4DDS A;  1K6S A;  4GOG A;  2JBF A;  3HJK A;  5DTT A;  3MQQ A;  4NXF A;  1YPR A;  2WKI A;  2P9V B;  1ALQ A;  4HIA A;  3LUQ A;  3F1O B;  3OLO A;  4GD8 A;  4WUJ A;  5F83 A;  3SH9 A;  4NET A;  5EPH A;  3PTE A;  2DRW A;  4CLC C;  3D72 A;  3IWI A;  1XFN A;  4O01 A;  1K4F A;  3RXX A;  1S0W A;  3NUL A;  1KOU A;  4P87 A;  3VP1 A;  4EER A;  3RTY A;  4OPZ A;  1IFQ A;  1TEM A;  1Z6F A;  1ZC2 A;  1Q2P A;  4FD8 A;  1DP9 A;  4B4Z A;  3VSL A;  3BWL A;  4N9L A;  5KSC A;  3MFX A;  2OWJ A;  2PYP A;  5F69 A;  5FA7 A;  2FZ0 A;  1H8Y A;  3VFF A;  1O07 A;  4ZAM A;  4R6L A;  2JHE A;  3T4S A;  1RP5 A;  3UB9 A;  3HJI A;  2BAS A;  2HP6 A;  3MF0 A;  3IS2 B;  3PAE A;  4JPM A;  3UE6 A;  4N1H A;  2JC7 A;  2J9P A;  3NHQ A;  1L0F A;  4EXO A;  2X01 A;  2J9O A;  2ZL1 B;  1LSW A;  4CQH A;  4ETZ A;  1JNU A;  3S1Y A;  3NDG A;  1S6R A;  3WS2 A;  2ZOI A;  1ES2 A;  3OC2 A;  4DKI A;  5JYP A;  4OOM A;  5FAS A;  4HH3 A;  2XGN A;  3V3S A;  4K0X A;  3ZCZ A;  5HW3 A;  4D2O A;  4UAA A;  1XGJ A;  5EVI D;  2R78 A;  1I5Q A;  3LR4 A;  3HUN A;  3W2Z A;  4Y3I A;  1D06 A;  1KE3 A;  2FFY A;  2PU4 A;  4S2O A;  2HZ5 A;  5KSH A;  1K56 D;  4OP5 A;  3ZFZ A;  3UDX A;  4GS9 B;  3CHW P;  3VOZ A;  2VV6 A;  3RJU A;  4RX3 A;  4IUK A;  3RH8 B;  1JTD A;  4X53 A;  3LR5 A;  3F1P A;  1Y54 A;  3HLD A;  5G4Z A;  1DJA A;  3BFE A;  5DF7 A;  1BUE A;  1CEF A;  4YOF A;  4X1L A;  3EEA A;  3NEC A;  1PI5 A;  3C8C A;  4B9O A;  5CED A;  2ZMA A;  4WN5 A;  1S66 L;  4EET B;  2D02 A;  2Y4A A;  1X0O A;  3S4X A;  3G2Z A;  1XGI A;  5GL9 A;  3ICY A;  3G4P A;  3K3D A;  1ES3 A;  3GTC A;  1C3B A;  1HLU P;  4EU0 A;  1IYS A;  1NZU A;  5EV0 A;  3BQ8 A;  1MWT A;  4FSF A;  1GCE A;  3Q7V A;  3IXG A;  2HPB A;  2Z2L B;  3G6O A;  4HI4 A;  1XX2 A;  5EVE A;  2QYB A;  1LL8 A;  2OLU A;  1N9L A;  3LY3 A;  1U60 A;  3P7N A;  1CI8 A;  5A8B A;  3FZC A;  3N8S A;  1K57 A;  5I5L A;  3UPO A;  5DJU A;  1YT4 A;  1L0D A;  3JVV A;  5F6A A;  2A24 A;  4DXB A;  5FAO A;  1MC0 A;  1XXM A;  1MBL A;  4NG2 A;  4UHU A;  3NDE A;  3OCL A;  5EEC A;  3P01 A;  1FIL A;  5LBR A;  3VP4 A;  3MQ0 A;  4OPR A;  2R9X A;  1S67 L;  2HP9 A;  3NOT C;  4GJ4 A;  5K5B A;  2WZX A;  1DP6 A;  1S4S A;  3GVB A;  1ESU A;  3MXR A;  4GW9 A;  3M6B A;  3E4O A;  4JKT A;  2W1R A;  1NY0 A;  2WKR A;  1BYW A;  2ZC6 B;  1AWI A;  2VLG A;  4X69 A;  2Z6C A;  2WGW B;  3DBA A;  4E3J A;  5CGX A;  3MKF A;  2E8J A;  1F5M A;  2ZC4 B;  3A0V A;  5KMW A;  2V1A A;  5A93 A;  4NK3 A;  2QHK A;  3E2L A;  4WZ4 A;  3HL9 A;  1W8Y A;  4E3L A;  4DE2 A;  2XA7 S;  1A0K A;  3LI9 A;  2NUT C;  1ONH A;  1BTL A;  4KQQ A;  4U0X A;  3LR3 A;  3MZE A;  3UY6 A;  4QU3 A;  1GA0 A;  4EBN A;  3BRM A;  3C38 A;  1FOF A;  3MZF A;  1ZKJ A;  3LEQ A;  4YFM A;  4N92 A;  4CLC D;  3FKW A;  1VEU A;  4EES A;  2O99 A;  2VGL S;  5FAQ A;  1VHM A;  3NOP C;  2JKT I;  5CGW A;  2PYR A;  2HJ9 C;  5IT5 A;  3IT9 A;  1GSX A;  4PPR A;  1NJ4 A;  4Q8I A;  1JWV A;  2KDK A;  4R3J A;  5CEB A;  2V2F F;  4LCM A;  4EWF A;  2O9B A;  3T50 A;  2ZLY A;  3V3R A;  1VQQ A;  4BBV A;  4HJ4 A;  5L8M A;  3HLC A;  3ITB A;  2OSU A;  5M18 A;  2E8I A;  4OOY A;  4KZ9 A;  4WBG A;  4JBF A;  4RYE A;  3GSG A;  4KUO A;  2RL3 A;  2B02 A;  1J3W A;  3UNW A;  3W4O A;  3ZG8 B;  3HLB A;  1KE0 A;  1KGE A;  5HAR A;  2P9V A;  1IKG A;  3ZDJ A;  3ZHH A;  3NOU C;  3MBZ A;  3MR0 A;  4HJ3 A;  5FAT A;  5J8X A;  2P04 A;  5GLD A;  2ZBB A;  2KOI A;  2J8Y A;  1E3U A;  2J3T C;  2C6W B;  2VV8 A;  5L07 A;  1BLC A;  1PFL A;  2L1M A;  5A90 A;  2EFX A;  1BLP A;  4HP4 A;  4PKY G;  3KYE A;  4XT2 A;  3L9K A;  5AQA A;  4BEN A;  5CX7 A;  3TW8 A;  3A0S A;  3DTM A;  2KLI A;  1TD5 A;  2AVX A;  4EV4 A;  3Q7V B;  3ZQ5 A;  2FFF B;  3LIF A;  1OME A;  1XP4 A;  2XK1 A;  1CQA A;  3OZH A;  4BMW A;  1MXO A;  3H9W A;  2WAD A;  3QP2 A;  5HL6 A;  2WUQ A;  4DXC A;  3IQA A;  5HWW A;  4PM6 A;  1G68 A;  4WF0 A;  3BLM A;  3Q82 A;  4LCL A;  3A3D A;  2I9V A;  3IS2 A;  1NXY A;  3IF6 A;  4R23 A;  3PHY A;  1I2S A;  5HDC A;  1MWU A;  1EWZ A;  4JLF A;  5AJG A;  4MCW A;  1LL9 A;  2W0N A;  3OPP A;  4XXR A;  5DTK A;  4MEZ A;  3EOI A;  2L4R A;  3FG8 A;  3T4T A;  2Q0O A;  2UWX A;  4IED A;  5EFW A;  2XR0 A;  4PM5 A;  4Y0O A;  4S2M A;  2KX6 A;  3G30 A;  3BFD A;  1MPL A;  5I94 A;  3S22 A;  5M19 A;  1PW8 A;  1E4D A;  1OTB A;  3QNC A;  2EWV A;  4Z1W A;  5BOH A;  3H7W B;  3S7Q A;  2A3U A;  3MQO A;  4LEN A;  4S2K A;  5TJJ A;  1GSW A;  4QD4 A;  3MZD A;  3A3I A;  3EWK A;  4E3K A;  4S2J A;  1IEL A;  2Y91 A;  2VV7 A;  4XUZ A;  4GS9 A;  1HD8 A;  3PBR A;  3UE1 A;  1DY6 A;  1K57 C;  1QMF A;  4O0P A;  3BYD A;  3OPR A;  3WWX A;  2M7V A;  1RGZ A;  1N4O A;  3KSG A;  4JXS A;  5AQ9 A;  2BG1 A;  4BBU A;  1HTZ A;  4DN0 A;  3FC7 A;  4DE3 A;  3LIE A;  4ARZ A;  1K6R A;  2P74 A;  2JKR I;  3WRT A;  5G18 A;  4B4X A;  3PR6 A;  3F1N B;  1NWZ A;  4O7D A;  2W3G A;  2Y2G A;  2QWS A;  3UB7 A;  3WS1 A;  1M6K A;  2ZQD A;  2Y2L A;  3E98 A;  2WKE A;  1H5X A;  3WS4 A;  2EWW A;  3QP8 A;  3AGE A;  3S7P A;  1FSY A;  3CJM A;  2W3F A;  3G31 A;  5HL1 A;  3H82 A;  4GLQ A;  3BEB A;  4DJ2 A;  3FWL A;  3FV7 A;  5HX9 A;  1BLS A;  4ZRR A;  4K0W A;  2XFT A;  3S7O A;  3DTI A;  4X56 A;  4ZDX A;  3CWF A;  5DJT A;  3GQZ A;  2V20 A;  2J80 A;  4IVK A;  2K2N A;  4BWI A;  1XKZ A;  3MKE A;  4JXV A;  4NKP A;  4XT2 B;  1E25 A;  5U47 A;  5DFX A;  2VX8 A;  1YMS A;  1S1Y A;  1T18 A;  5EOO A;  4R0Q A;  4EW7 A;  3N7W A;  4GHI A;  3DTK A;  4JGP A;  4KZ7 A;  3T1X A;  1GHP A;  2G2W A;  2OAQ 1;  1WA9 A;  2PBY A;  5D3O A;  3VP3 A;  2OAP 1;  3D4F A;  3PXP A;  3PBQ A;  1H0M A;  1OJG A;  4FUW A;  2PU2 A;  2WGW A;  3A0R A;  3IF6 B;  5IHV A;  3C4P A;  1OTI A;  1YQS A;  1K38 A;  5TFQ A;  4HOI A;  4KG2 A;  3CIT A;  5CHJ A;  5HD3 A;  1PWC A;  1FCO A;  1YLW A;  2XSS A;  3JYI A;  4LV0 A;  2GNX A;  3MS6 A;  4RQ9 A;  1LSX A;  2W3H A;  4CJN A;  4UQI S;  1MKI A;  3D3O A;  4KZ6 A;  4Y7P A;  4OQI A;  4KG5 A;  2W1T A;  3C2W A;  3M2J A;  4MDZ A;  2IWC A;  1IOU A;  3R7W B;  3LID A;  2BLS A;  4LGW A;  3SOI A;  4I38 A;  3QHY A;  2Y79 A;  3PBT A;  4PMA A;  1ES4 A;  1NLZ A;  2HDQ A;  1F98 A;  1IEM A;  4YIN A;  5A92 A;  5EVI A;  4WEL A;  3TSG A;  4U0T A;  1XFQ A;  3CPT A;  2QZ6 A;  1I2W A;  2HP5 A;  2OLV A;  3UN7 A;  1PNE A;  4IUH A;  1K56 A;  1LL5 A;  4BD0 A;  3BY8 A;  5DF9 A;  4Y5F A;  5E2E A;  2Y2I A;  2PR5 A;  3IF6 C;  1YLP A;  2M7U A;  5HD5 A;  3P09 A;  4OVD A;  5JYO A;  3KSH A;  1OPX A;  2PBD P;  3PAG A;  1F2K A;  2XLN A;  2ZC5 B;  5HAQ A;  4UEY A;  2Z2M B;  5HWV A;  4KG6 A;  5FDS A;  3CAX A;  1DP8 A;  2DCF A;  3AGF A;  1CI9 A;  3T4Q A;  2WGV A;  3W8K A;  4NXE A;  4OQH A;  4ARZ B;  4CLC E;  5AQB A;  2FH5 A;  5F5Y A;  2H10 A;  5HDD A;  4OP8 A;  4LLO B;  3IWO A;  4KQD A;  1BZA A;  1W7F A;  3G35 A;  1HZO A;  4I3I A;  1NYY A;  5IS1 A;  1G5U A;  3TJZ C;  1PI4 A;  4X55 A;  4JGQ A;  4ID4 A;  4KQO A;  3GV9 A;  4WZ5 C;  4OON A;  1CEG A;  1W5D A;  3CUE A;  3T4L A;  4WL9 A;  4X25 A;  5GLC A;  1BUL A;  2WZZ A;  1IKI A;  1Y4O A;  4QB8 A;  3H82 B;  3DTE A;  2ZC3 B;  5EOE A;  1XJ3 A;  1GHI A;  4G3V A;  2EX2 A;  3KO6 A;  4M3K A;  1STZ A;  1YLT A;  2ZM0 A;  1TS8 A;  1KVM A;  4R4S A;  1D7E A;  1JWZ A;  4UA7 A;  3V50 A;  3UMD A;  1LSV A;  3IHB A;  5TBM A;  3UDF A;  4O8G A;  1YLY A;  3NIA A;  4IHQ A;  1XJ2 A;  4QWO A;  3U2A A;  3A3E A;  3IHA A;  3C7V A;  2INW A;  3PBN A;  4RA7 A;  3LR0 A;  3SS3 A;  3MXS A;  3BJN A;  1SCW A;  3C4O A;  1YLJ A;  2Q9M A;  1MKM A;  4GHI B;  3CLO A;  4I5S A;  4LRY C;  1L0E A;  1MWS A;  3FPV A;  5DFY A;  4ESP A;  3H7W A;  4LRZ E;  4WMC D;  4I39 A;  2IWD A;  4M4X A;  1ZTU A;  2CC1 A;  5FEF A;  2IA2 A;  5KIZ A;  3VFH A;  3W4Q A;  4X68 A;  1OT9 A;  3VE3 A;  1PRQ A;  4IBX A;  3IF5 A;  4X1M A;  4PM7 A;  2YKF A;  4P6Z M;  1GHM A;  1UWN X;  1VET A;  1YMX A;  1TS7 A;  2H0T A;  3NBL A;  3ZG5 A;  4WM9 A;  4LFU A;  2W1T B;  4PHT A;  5E2H A;  5J3W A;  1ZG6 A;  1SHV A;  3DAV A;  3OPH A;  3MJQ A;  5DVA A;  3IXH A;  4KZ4 A;  1EW0 A;  5EVI B;  5CGS A;  4NXG A;  4LRX C;  3HUO A;  3Q7Z A;  2GX5 A;  2EA9 A;  1FR1 A;  4ZJ1 A;  3CPT B;  1LHY A;  4QY5 A;  2HGV A;  3F1N A;  5CEC A;  4GKU A;  5CRF A;  4IBR A;  4HQA A;  4OLG A;  4R3B A;  3LIA A;  2O0Y A;  2WKQ A;  2Y8H A;  4FOF A;  2P08 A;  1IYP A;  4GNU A;  2X71 A;  3UB8 A;  3BM6 A;  2BTF P;  2ZQ9 A;  4KZ8 A;  1SDE A;  1VB6 A;  1FSW A;  3QP6 A;  1OJ5 A;  4HJ6 A;  1N9N A;  1NZO A;  2Y59 A;  1W63 M;  1OTE A;  4F94 A;  3UB5 P;  4YNR A;  1JTG A;  2WK0 A;  2ZJ9 A;  2K31 A;  4R4R A;  2QKP A;  4Y15 A;  2HDR A;  4R1G A; 
#chains in the Genus database with same CATH homology
 1N4O A;  2J9P A;  1L0F A;  4GD6 A;  4JXS A;  2X01 A;  2J9O A;  5AQ9 A;  2BG1 A;  2WYX A;  1ERO A;  1HTZ A;  3HLW A;  3SS4 A;  1MY8 A;  1EI5 A;  4OQ0 A;  2JE5 A;  3WS5 A;  4EUZ A;  2Y2J A;  3S1Y A;  3NDG A;  1ZG4 A;  1S6R A;  3WS2 A;  4DE3 A;  1MWR A;  1ES2 A;  3FKV A;  3OC2 A;  5GHX A;  4DKI A;  2VGK A;  4S2P A;  1K6R A;  2P74 A;  3BFC A;  5JYP A;  4OOM A;  5FQK A;  5GLA A;  3WRT A;  1KE4 A;  4WEK A;  5FAS A;  5EVI C;  5G18 A;  2XGN A;  3V3S A;  4B4X A;  4WEJ A;  1TDG A;  4FCF A;  4K0X A;  5FQ9 A;  4DF6 A;  4E6W A;  1HVB A;  3ZCZ A;  5HW3 A;  5L2F A;  2ZC7 A;  2QMI A;  2WGI A;  4UAA A;  4D2O A;  1XGJ A;  5EVI D;  4O7D A;  2Y2G A;  3WS1 A;  1M6K A;  4WMC A;  2ZQD A;  1LLB A;  1I5Q A;  4HBT A;  5EE8 A;  3TG9 A;  2Y2L A;  3HUN A;  1CK3 A;  4N1X A;  4KQR A;  2WKE A;  5HAI A;  1H5X A;  3WS4 A;  1FCN A;  1KE3 A;  4DRT A;  4LV3 A;  2FFY A;  2PU4 A;  3AGE A;  4S2O A;  5KSH A;  1K56 D;  1FSY A;  1RGY A;  2WAF A;  3ZG7 B;  4OP5 A;  3CJM A;  5TR7 A;  3G31 A;  5HL1 A;  4S2N C;  3SS5 A;  3VMA A;  3ZFZ A;  4GZB A;  3UDX A;  2I72 A;  3BEB A;  2Y2P A;  3O86 A;  3FWL A;  3VP0 A;  4JF6 A;  3VOZ A;  1LI0 A;  3RJU A;  4KEN B;  4OPQ A;  4RX3 A;  4H8R A;  3FV7 A;  2Y2Q A;  5HX9 A;  1JTD A;  4X53 A;  2B5R A;  4L0L A;  4ZJ3 A;  1BLS A;  1QME A;  3G2Y A;  1TVF A;  4K0W A;  2XFT A;  5CHU A;  1Y54 A;  3HLD A;  4Y0T A;  4X56 A;  1DJA A;  4ZDX A;  3BFE A;  1J9M A;  4C3Q A;  5DF8 A;  2XEP A;  5DF7 A;  2XF3 A;  1YLZ A;  2ZQ8 A;  3ISG A;  1BUE A;  1CEF A;  4GN2 A;  3GQZ A;  2V20 A;  5GHY A;  4IVK A;  5CHM A;  4OOL A;  4MLL A;  4QHC A;  1PI5 A;  5CXW A;  3W4P A;  4PM8 A;  3HLE A;  1XKZ A;  5CED A;  2ZMA A;  3MKE A;  4JXV A;  4C75 A;  1E25 A;  5U47 A;  4KZ5 A;  2WAE A;  2Y2M A;  2Y4A A;  3MFD A;  1O7E A;  5E2F A;  1L0G A;  3VP2 A;  3WS0 A;  3S4X A;  3G2Z A;  3QNB A;  1YMS A;  1XGI A;  4OKP A;  5GL9 A;  4KZ3 A;  1LI9 A;  3G4P A;  4U3T A;  2EXA A;  4XUX A;  1ES3 A;  5EOO A;  5CER A;  3GTC A;  1C3B A;  4E6X A;  3ZGA B;  4R0Q A;  2Y2O A;  3HLG A;  3UE3 A;  1IYS A;  3N7W A;  5GLB A;  1KDW A;  1NZU A;  4KZ7 A;  5GHZ A;  2J7V A;  4UA6 A;  4EQI A;  2G2W A;  1GHP A;  2EX6 A;  4RX2 A;  4OLD A;  4FH4 A;  1MWT A;  4RVA A;  4FSF A;  2PBY A;  5D3O A;  1GCE A;  3Q7V A;  2G2U A;  3VP3 A;  1G6A A;  3D4F A;  3IXG A;  3PBQ A;  2HPB A;  2Z2L B;  1PW1 A;  1KVL A;  1XPB A;  1XX2 A;  2PU2 A;  2WGW A;  1FR6 A;  3HVF A;  2XD1 A;  3IXB A;  3IF6 B;  5IHV A;  4JF4 A;  3ZVW A;  3C4P A;  2OLU A;  1YQS A;  4GDN A;  1K38 A;  5TFQ A;  3LY3 A;  4KG2 A;  1U60 A;  2Y2H A;  3M2K A;  1CI8 A;  3N8L A;  5CHJ A;  3FZC A;  1PWC A;  1FCO A;  1YLW A;  3CZD A;  3JYI A;  4LV0 A;  1GA9 A;  4DE1 A;  2C5W B;  3N8S A;  1FQG A;  4KZB A;  1K57 A;  1WYB A;  2XH9 A;  3ZNY A;  3UPO A;  5A91 A;  1YT4 A;  4CJN A;  1ES5 A;  1L0D A;  4BLM A;  3O87 A;  1E3U D;  5FQI A;  3SH8 A;  1K55 C;  1MKI A;  4DXB A;  5FAO A;  2DNS A;  4MBH A;  4KZ6 A;  4Y7P A;  1XXM A;  3GMW A;  4OQI A;  1MBL A;  3C5A A;  4KG5 A;  4UHU A;  3NDE A;  3OCL A;  3M2J A;  5EEC A;  4E3I A;  3DWZ A;  2IWC A;  5TGF A;  3VP4 A;  4OPR A;  2BLS A;  2R9X A;  4BQM A;  4CPK A;  4BD1 A;  1NYM A;  3Q81 A;  3I7J A;  1K25 A;  1W79 A;  4ZBE A;  3SOI A;  2RCX A;  3QHY A;  3PBT A;  1ES4 A;  2HDQ A;  4PMA A;  4YIN A;  1IEM A;  2HP9 A;  2VGJ A;  3NCK A;  2Q9N A;  4MNR A;  5A92 A;  5EVI A;  4WEL A;  3TSG A;  4U0T A;  2WZX A;  2XQZ A;  4PM9 A;  2QZ6 A;  3GVB A;  1ESU A;  1I2W A;  3MXR A;  3N8R A;  3RXW A;  3BLS A;  3M6B A;  2HP5 A;  4JKT A;  2OLV A;  2EXB A;  3UN7 A;  3IWQ A;  1NY0 A;  4UA9 A;  1RCJ A;  4LV1 A;  1K56 A;  1PZO A;  4A5R A;  3ZG9 B;  2ZC6 B;  4DDY A;  4MBF A;  1ERM A;  1ERQ A;  1LL5 A;  4MBK A;  4X69 A;  4B88 A;  3LY4 A;  4BD0 A;  4E3J A;  2WGW B;  1SDN A;  3DW0 A;  5E2E A;  5DF9 A;  2EX8 A;  2Y2I A;  2HDS A;  1TDL A;  5CGX A;  1VM1 A;  3IF6 C;  3MKF A;  4S2N A;  1YLP A;  2ZC4 B;  5CTN A;  3P09 A;  4OVD A;  2Y2N A;  5JYO A;  5KMW A;  2OV5 A;  5A93 A;  5FI6 A;  3A3F A;  3PAG A;  4NK3 A;  2ZM8 A;  2XLN A;  3E2L A;  4WZ4 A;  3HL9 A;  2ZC5 B;  1W8Y A;  5HAQ A;  4E3L A;  4DE2 A;  2Z2M B;  5HFO A;  1ONH A;  1BTL A;  4KG6 A;  4KQQ A;  3SH7 A;  2DCF A;  1IYQ A;  3AGF A;  4U0X A;  3MZE A;  3UY6 A;  3O88 A;  1CI9 A;  5FAP A;  2X02 A;  4QU3 A;  1GA0 A;  1ESI A;  3V5M A;  3W8K A;  2WGV A;  4OQH A;  4EBN A;  3BRM A;  5AQB A;  5FQJ A;  3VOY A;  2H10 A;  1FOF A;  3MZF A;  4OP8 A;  4QY6 A;  1ZKJ A;  2R9W A;  3IWO A;  4YFM A;  3O3V A;  2V1Z A;  4GB7 A;  1BZA A;  4N92 A;  1W7F A;  3FKW A;  3G35 A;  1IYO A;  3GRJ A;  1HZO A;  3E2K A;  1JVJ A;  1SKF A;  3NI9 A;  1NYY A;  5FAQ A;  3Q1F A;  5CGW A;  3CMZ A;  3Q07 A;  4DE0 A;  5EVL A;  3OPL A;  3CG5 A;  4IVI A;  1PI4 A;  4X55 A;  4EBL A;  4K91 A;  4WYY A;  3V39 A;  4ID4 A;  4KQO A;  3GV9 A;  3IT9 A;  5FI2 A;  4PPR A;  1NJ4 A;  4JXG A;  3LEZ A;  4Q8I A;  1K54 C;  1JWV A;  4WZ5 C;  4OON A;  3WRZ A;  4EBP A;  1CEG A;  1W5D A;  2ZQA A;  4ZTK A;  4R3J A;  5CEB A;  1PZP A;  2V2F F;  4LCM A;  5EUA A;  4EWF A;  2ZLY A;  5FQQ A;  3IH9 A;  4Y0U A;  5GLC A;  3V3R A;  3A3J A;  1BUL A;  2WZZ A;  4X6T A;  1IKI A;  1VQQ A;  3BFG A;  3G34 A;  4QB8 A;  1PWG A;  2ZC3 B;  5EOE A;  4WZ5 A;  4Z9Q A;  3UPN A;  5F1G A;  2HDU A;  3HLC A;  1GHI A;  4BJP A;  4S2L A;  4HBU A;  2OSU A;  2Y55 A;  2E8I A;  5FI7 A;  4BL2 A;  5M18 A;  1YM1 A;  2EX2 A;  4OOY A;  3UPP A;  4KZ9 A;  1L2S A;  4LV2 A;  1JWP A;  2ZD8 A;  4N9K A;  2GDN A;  3DWK A;  4WBG A;  3N6I A;  4JBF A;  4RYE A;  3GSG A;  4M3K A;  2RL3 A;  2XD5 A;  1KGG A;  1YLT A;  2ZM0 A;  3UNW A;  3W4O A;  3ZG8 B;  1KDS A;  3UO9 A;  4HES A;  1KVM A;  3HLB A;  1KE0 A;  1KGE A;  1H8Z A;  1JWZ A;  4FH2 A;  4JF5 A;  4R4S A;  2P9V A;  4UA7 A;  5HAR A;  2H0Y A;  1IKG A;  3V50 A;  3ZDJ A;  3ZHH A;  5KZH A;  2ZQ7 A;  3LCE A;  5E43 A;  3MBZ A;  5FAT A;  3GR2 A;  3IHB A;  3UDI A;  5J8X A;  3UDF A;  4E3M A;  5GLD A;  3C7U A;  2J8Y A;  1E3U A;  2WKH A;  3ZVT A;  2C6W B;  5F82 A;  1YLY A;  3BEC A;  2QPN A;  3NIA A;  3TOI A;  1BLC A;  3NY4 A;  3A3E A;  3IHA A;  4HEF A;  3HUM A;  2ZM2 A;  3C7V A;  3PBN A;  1K55 A;  5FQM A;  4RA7 A;  5A90 A;  4GDB A;  3HRE A;  5E2G A;  3SS3 A;  3MXS A;  3HLF A;  3ZNT A;  2EFX A;  3UE0 A;  4E3N A;  1KGF A;  1SCW A;  3C4O A;  1XA1 A;  1BLP A;  4P6B A;  2EX9 A;  1YLJ A;  5AQA A;  2Q9M A;  5CTM A;  5M1A A;  4BEN A;  2EFU A;  1BSG A;  3VSK A;  1L0E A;  1MWS A;  5DTS A;  3DTM A;  3ITA A;  2IWB A;  4EV4 A;  1Q2Q A;  1WYC A;  3Q7V B;  4OQG A;  2FFF B;  4WMC D;  1N9B A;  3HBR A;  3P98 A;  2JCH A;  1OME A;  1XP4 A;  2XK1 A;  4E3O A;  3N4I A;  2ZQC A;  3OZH A;  3G32 A;  1MXO A;  3NC8 A;  2WAD A;  3ZG0 A;  2IWD A;  3IXD A;  3LO7 A;  3FYZ A;  3PBS A;  3PBO A;  2WUQ A;  4DXC A;  2CC1 A;  3IQA A;  1PIO A;  3M6H A;  4P85 A;  3VFH A;  3OCN A;  5AQ7 A;  4DDS A;  1K6S A;  3W4Q A;  4GOG A;  4PM6 A;  4JXW A;  1G68 A;  2JBF A;  4S2I A;  4X68 A;  3BLM A;  3Q82 A;  5DTT A;  4LCL A;  3A3D A;  4IBX A;  2XFS A;  3IF5 A;  1NXY A;  3IF6 A;  4PM7 A;  4R23 A;  2WKI A;  1K4E A;  2P9V B;  3EQV A;  5FDH A;  1ALQ A;  1I2S A;  1GHM A;  4GD8 A;  5F83 A;  3SH9 A;  4NET A;  1YMX A;  1MWU A;  1EWZ A;  4JLF A;  3PTE A;  2DRW A;  2H0T A;  3NBL A;  1LL9 A;  5EPH A;  4WM9 A;  3ZG5 A;  3EQU A;  4KZA A;  1PWD A;  3OPP A;  3IWI A;  4XXR A;  5E2H A;  2XDM A;  5DTK A;  1PYY A;  4MEZ A;  4BL3 A;  1K4F A;  3RXX A;  1S0W A;  2A49 A;  1ZG6 A;  1SHV A;  3OPH A;  4P87 A;  5FSR A;  3VP1 A;  2UWX A;  5DVA A;  4IED A;  1WE4 A;  4C6Y A;  2XR0 A;  2Y2K A;  3IXH A;  4PM5 A;  4OH0 A;  4OPZ A;  1DJC A;  4KZ4 A;  4S2M A;  4Y0O A;  5EVI B;  5CGS A;  1FCM A;  1W8Q A;  1DJB A;  1TEM A;  3G30 A;  3BFD A;  4ZJ2 A;  1MPL A;  5I94 A;  3HUO A;  3Q7Z A;  1Z6F A;  3S22 A;  1FR1 A;  5M19 A;  1PW8 A;  4ZJ1 A;  1E4D A;  1LHY A;  1AXB A;  1ZC2 A;  3QNC A;  4QY5 A;  1Q2P A;  5CEC A;  4FD8 A;  4GKU A;  5CRF A;  5BOH A;  2H5S A;  4B4Z A;  4IBR A;  4R3B A;  4OLG A;  3VSL A;  4N9L A;  5KSC A;  5HAP A;  1ONG A;  2A3U A;  1K54 A;  5FA7 A;  4LEN A;  4OPY A;  1IYP A;  1H8Y A;  1NRF A;  4GNU A;  3BFF A;  2X71 A;  1O07 A;  4S2K A;  4ZAM A;  3VFF A;  4QD4 A;  3B3X A;  3MZD A;  3BM6 A;  1XA7 A;  3A3I A;  3AGD A;  5F1F A;  4E3K A;  1RP5 A;  2ZQ9 A;  1IEL A;  4S2J A;  2Y91 A;  3IH8 A;  4XUZ A;  4KZ8 A;  4P0M A;  1SDE A;  2HP6 A;  1FSW A;  1HD8 A;  1NZO A;  1BT5 A;  3PBR A;  3UE1 A;  2Y59 A;  1DY6 A;  1M40 A;  3PAE A;  1K57 C;  4QJG A;  1QMF A;  4F94 A;  4JPM A;  3BYD A;  3OPR A;  1JTG A;  2WK0 A;  2ZJ9 A;  4N1H A;  3WWX A;  4R4R A;  2JC7 A;  1RGZ A;  3ITB A;  1BLH A;  2HDR A;  4R1G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...