5CTNA

Structure of bpu1 beta-lactamase
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
233
structure length
233
Chain Sequence
SIAWSVDEFFKNREGTFVIQEVKEKSPWVYNKKRAKERFAPQSTFKVANALIGLQTGAVRDEYDIKYWDGVKREIDNWNRDHTLGSGMRDSVVWYYQAMARDIGEERMNHWVKAIHYGNKDISGGIDQFWLSSTLRISPIEQVRFLKQLYEETLPFDLKNMRTVKRMMVQEEEKHATLYGKTGSGSDIGWYVGFIKHEHKTYILATNIKGTGIEAKDITYRILKKYHLMEASV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactamase
publication title Class D beta-lactamases do exist in Gram-positive bacteria.
pubmed doi rcsb
source organism Bacillus pumilus
molecule tags Hydrolase
total genus 89
structure length 233
sequence length 233
chains with identical sequence B
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2015-07-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 5ctnA00
2G2UA 2Y91A 1GA9A 1H5XA 3A3EA 1VQQA 4R0QA 2WAEA 1ES3A 4EV4A 2WGIA 3NDEA 4FD8A 4WBGA 4ZBEA 4K0WA 1WE4A 2JE5A 4OOMA 2CC1A 4EWFA 3IXHA 2ZMAA 4PM9A 2ZQAA 3W4PA 3C5AA 3HVFA 3ZG9B 2R9WA 4BL2A 4N1XA 5FAOA 5KZHA 2ZLYA 4XUXA 2Q9MA 3IHBA 2Y59A 1KDSA 4KZ4A 2P9VB 4ZJ1A 3VSLA 4R4RA 4BJPA 3OPLA 1MY8A 1IYPA 1K57C 1TDLA 5CGWA 3V3SA 3WS1A 3ZCZA 1TEMA 4GB7A 3UPOA 3SOIA 2RCXA 1JWPA 5JYOA 5FA7A 4Y0TA 1OMEA 1E4DA 3IF5A 1K56D 3C4PA 5A91A 1PYYA 3G31A 1JVJA 1JWZA 1NYMA 1ONHA 2WKIA 3M2JA 2PBYA 4MEZA 1BLCA 1K38A 1W5DA 1BTLA 3N8RA 4B4XA 3E2LA 4IVIA 4KENB 1SHVA 2IWCA 2ZC3B 2IWBA 3SH7A 3EQVA 2J8YA 4EQIA 1K6SA 3G35A 2BLSA 1IEMA 4BQMA 3BM6A 1JTDA 5M1AA 4MBFA 1NXYA 4N92A 1QMEA 1PIOA 1L0DA 5G18A 4DE1A 3LY3A 5HAPA 4QY6A 3TG9A 1KGGA 2DNSA 4E3LA 2ZQ9A 5FQQA 4EUZA 3G34A 4E6WA 3AGFA 3HLEA 1MWRA 1YLWA 4UHUA 3ZVWA 1MXOA 5EVLA 4MBKA 5GL9A 5HARA 1TDGA 4RA7A 3VP0A 1PW1A 3Q7VA 2P74A 1IYOA 3HUOA 4LCMA 1BULA 3IXDA 1BSGA 2JCHA 5E2GA 3GMWA 4UAAA 4KG5A 1K55C 4ID4A 5DVAA 5E2HA 3PAGA 5AQBA 5FI2A 3IWIA 3WRZA 3BECA 4H8RA 5FI6A 3BEBA 3HLFA 2ZM8A 3QNBA 1PI5A 1VM1A 2XFTA 4RX2A 1I2SA 3NBLA 2Y2KA 5CGXA 1BZAA 4X6TA 1BLPA 1FOFA 3MBZA 3GRJA 2JBFA 3D4FA 4R3BA 1W8QA 3OPPA 3PAEA 4M3KA 1BUEA 4KG2A 4OQ0A 4ZAMA 2HDQA 3HLBA 3BFEA 3GTCA 3HLDA 5FASA 4S2IA 1YLYA 2A49A 2EXBA 2ZQDA 4P87A 3UE1A 4KZ8A 4OKPA 2HP5A 4E3IA 3LEZA 2DCFA 1K25A 3VP1A 2EX6A 2J9OA 4KQQA 4PM7A 2EFXA 4LCLA 3VP2A 3BYDA 4KZ6A 4HESA 2ZM2A 2Z2LB 3GV9A 4JLFA 4PM6A 1K57A 3MKFA 2WUQA 1ERQA 1ERMA 4Y7PA 1HVBA 4E3NA 2XDMA 3IH9A 3W8KA 3UE0A 1KE3A 3VP3A 4DF6A 3FKVA 1K4EA 1RGZA 2UWXA 2XR0A 4FH4A 5CHUA 4DXBA 3MZEA 1YLJA 4IBRA 3IWOA 4IEDA 1WYCA 4S2PA 4C3QA 2E8IA 3UE3A 3W4QA 4F94A 3C4OA 3MZDA 4X68A 2WKHA 4GDNA 4RX3A 3MXRA 1XP4A 1BT5A 3CMZA 4KQOA 3Q1FA 5DF9A 1KE0A 1NYYA 3B3XA 2WGWB 1ESUA 4DE3A 3CZDA 2VGKA 3OZHA 3E2KA 3A3FA 4P0MA 1GHPA 2ZC6B 5FAPA 2Y2LA 4JXWA 4FCFA 1C3BA 1FSWA 3EQUA 4LV3A 4WZ5C 4Z9QA 1NJ4A 1L0GA 1K6RA 3VP4A 4KZAA 2Q9NA 3UN7A 3BRMA 4WM9A 3O87A 1DJAA 1SCWA 5M18A 4EBNA 3DTMA 2C5WB 5DTKA 1GCEA 1O07A 3GR2A 2V20A 3IH8A 3O3VA 3BFCA 3Q07A 1PZOA 2J9PA 2P9VA 3IT9A 3MZFA 4QU3A 1CEGA 1K55A 1PW8A 5A92A 4OQIA 1XKZA 3Q7ZA 3WS5A 2OLUA 4QB8A 3NI9A 5DTSA 1KVLA 3ITAA 4K91A 5GLDA 5TR7A 1RP5A 2H10A 4S2LA 4KZBA 3ZFZA 3OCNA 4NETA 3IXBA 1XX2A 1YT4A 1ES2A 3NCKA 5A90A 5CRFA 3IHAA 2OV5A 2ZC5B 3IF6B 4N9LA 2ZQCA 2ZM0A 1LI9A 4MNRA 1ZG6A 3PBTA 3N6IA 4IBXA 1BLSA 1RGYA 3S4XA 2V1ZA 1LHYA 3OPRA 3IQAA 4BD1A 3FV7A 3JYIA 2G2WA 4IVKA 5GHYA 1GHMA 2Y2PA 3UY6A 1U60A 4OOLA 1PWCA 4GNUA 1MBLA 3ZNYA 1KGEA 1XA1A 1PWGA 4OPQA 3WS0A 2Y2JA 4OPYA 5U47A 2A3UA 2XQZA 2EX2A 1XXMA 4WYYA 1N4OA 1MPLA 1KE4A 3UPPA 3CG5A 4ZJ3A 5FQMA 4BD0A 2X02A 5FQJA 3WWXA 4OPRA 2WAFA 2X71A 3N4IA 1S0WA 3QNCA 2H0YA 1ZC2A 2OLVA 5EOEA 3TOIA 2B5RA 1CI8A 3HREA 4BL3A 2XD5A 2HPBA 3QHYA 4KZ9A 1L0FA 1SKFA 4WMCA 5IHVA 3ZNTA 5J8XA 2QPNA 3S1YA 4OQHA 3ZGAB 5E43A 1PZPA 2EX9A 3G2YA 4GKUA 1H8ZA 1H8YA 4JXSA 1ALQA 1JWVA 2XLNA 5L2FA 4OQGA 3UDIA 3UO9A 1BLHA 5FAQA 1MWUA 5CECA 4N9KA 3UDFA 2FFYA 1K54C 4WZ5A 3ZG0A 2PU2A 2Y2NA 1FQGA 4YINA 3S22A 5KSHA 1K4FA 2OSUA 2ZC7A 1S6RA 3LO7A 4DKIA 3IF6C 1Q2PA 3IXGA 4HBTA 1XPBA 2XK1A 2Y4AA 3FKWA 3LY4A 3G32A 4GD6A 1Q2QA 4WELA 2ZQ7A 4HBUA 1HZOA 5CGSA 4BENA 3ZVTA 3I7JA 1IKGA 1IELA 4DE2A 1NY0A 4OPZA 1I2WA 4X56A 5EVIB 1CI9A 1XGIA 4DXCA 2RL3A 4S2KA 3G4PA 4JF6A 2ZQ8A 5CXWA 3G30A 1YM1A 4OLDA 4UA9A 2HP6A 3PBRA 1RCJA 4ZTKA 3G2ZA 4UA7A 4FSFA 5FQKA 3VOZA 1KVMA 3ITBA 3FYZA 1PWDA 4GDBA 3V5MA 3A3DA 4WMCD 4OP5A 4E3MA 4R4SA 1ES5A 2FFFB 3MFDA 5CEDA 4GN2A 2WYXA 2Y2OA 4C6YA 3MKEA 1LLBA 3VMAA 5CTNA 2EXAA 5F1GA 2H5SA 4S2NC 5EUAA 4PM8A 4PM5A 1QMFA 2HDRA 4L0LA 4KQRA 1SDEA 4QY5A 5EECA 5GHXA 5HX9A 2WGWA 3NIAA 1PI4A 2XGNA 3N7WA 2EFUA 3ZG5A 4R3JA 2XH9A 4E3KA 3O88A 3NY4A 5EOOA 4GOGA 2HDUA 3WRTA 1FCOA 4JPMA 1M6KA 3WS4A 1O7EA 3HLWA 5CTMA 4Q8IA 3VOYA 3VFHA 2Y2GA 3OC2A 3PBQA 3DWKA 5F83A 1KDWA 5D3OA 1LL9A 3GQZA 3DW0A 4RYEA 3SH9A 2ZJ9A 3BLSA 2PU4A 3NC8A 1Z6FA 3PTEA 1NZUA 3HL9A 3HUMA 1ZG4A 4OOYA 4PPRA 2GDNA 5FDHA 5TFQA 4S2OA 4U3TA 1KGFA 5A93A 5EVID 3GVBA 4JF4A 1J9MA 3N8LA 4GD8A 5CERA 2HP9A 5F1FA 2WZZA 4U0TA 1HD8A 1ZKJA 2XFSA 5EVIC 5HFOA 4XUZA 4CJNA 3Q81A 4ZJ2A 2ZC4B 3M6HA 4R23A 3C7UA 3FZCA 1YMSA 1YMXA 3BFFA 3OCLA 5AQ7A 3SS4A 1W8YA 2XEPA 1AXBA 1FCMA 1NRFA 1YLTA 4DE0A 2X01A 4KZ7A 1IKIA 4X53A 1K54A 4Y0UA 2J7VA 2EX8A 1FCNA 2DRWA 4B88A 4EBPA 1YLPA 4JF5A 3RXWA 3IF6A 5CEBA 4S2MA 2Y2QA 4LV1A 5HW3A 2WKEA 1Y54A 2HDSA 5GLCA 3HBRA 5GLAA 5HL1A 5DF7A 5CHJA 3FWLA 5F82A 5TGFA 2QMIA 1YQSA 4JBFA 2VGJA 1XGJA 3ISGA 3WS2A 4JKTA 5FI7A 5GLBA 3SS3A 2I72A 4MLLA 4O7DA 3MXSA 3GSGA 3HLGA 1I5QA 3HLCA 5FQIA 4OLGA 2Y2HA 3C7VA 2Y2IA 4P85A 2WZXA 1TVFA 4B4ZA 2XD1A 3BFGA 4OVDA 1IYSA 5EE8A 3LCEA 3PBNA 3NDGA 3V50A 5E2FA 1ONGA 1CK3A 3N8SA 4HEFA 2XF3A 2IWDA 4CPKA 1M40A 4DDYA 4NK3A 5DF8A 2R9XA 4QHCA 1MWTA 3Q7VB 3IWQA 4RVAA 4XXRA 3ZDJA 1L0EA 1LI0A 5CHMA 1WYBA 1E3UA 4OONA 4X69A 4K0XA 1NZOA 4EBLA 4S2NA 4D2OA 3M6BA 5KSCA 1YLZA 1G68A 1LL5A 3A3JA 4U0XA 3RXXA 4DRTA 4E3JA 3TSGA 1EI5A 1IYQA 4FH2A 3VFFA 4E3OA 3CJMA 4N1HA 1FSYA 5AQ9A 1ESIA 1JTGA 5M19A 4LV0A 2Z2MB 4BLMA 5FSRA 3PBSA 5DTTA 3UNWA 3ZG7B 1W7FA 1L2SA 4ZDXA 1FR1A 4MBHA 2WADA 2BG1A 4YFMA 3BLMA 1ES4A 3UPNA 4DDSA 2ZD8A 4KZ3A 3V39A 4E6XA 4UA6A 1GA0A 3AGDA 1CEFA 3O86A 4PMAA 5JYPA 4LENA 1MWSA 3VSKA 1N9BA 1DJCA 4C75A 3AGEA 4P6BA 4S2JA 3V3RA 3HUNA 1DJBA 5FQ9A 4KG6A 1XA7A 2WK0A 4QD4A 5EVIA 2V2FF 5BOHA 4GZBA 1W79A 2C6WB 4OH0A 1GHIA 5AQAA 1HTZA 2Y2MA 5GHZA 3UDXA 1E3UD 1EROA 2QZ6A 5KMWA 1E25A 1EWZA 5EPHA 4JXGA 1DY6A 4X55A 1G6AA 5HAIA 3M2KA 4JXVA 3ZG8B 5HAQA 4OP8A 2WGVA 4WEJA 1SDNA 3P98A 5I94A 4WEKA 3DWZA 3ZHHA 3A3IA 3SS5A 3SH8A 1K56A 3PBOA 5E2EA 4A5RA 1MKIA 4QJGA 3OPHA 3P09A 2JC7A 5FATA 1FR6A 3W4OA 4R1GA 2Y55A 3RJUA 4LV2A 4WZ4A 3BFDA 4KZ5A 2H0TA 3Q82A 4Y0OA
chains in the Genus database with same CATH superfamily
3NULA 3MS6A 1H5XA 2I9VA 1ES3A 4EV4A 4WBGA 1TF1A 2EWVA 2ZMAA 1D1JA 4O01A 2HJEA 1UWNX 1L3LA 4N1XA 2ZLYA 1KDSA 4BJPA 3V67A 3OPLA 2V1BA 2R78A 3TRCA 3V3SA 1TEMA 2O9AA 2VV7A 5JYOA 1YAXA 1P9WA 1K56D 1PYYA 1KOUA 3QP5A 3M2JA 2PBYA 4MEZA 1BLCA 1K38A 4B4XA 3E2LA 4IVIA 4CLCB 2IWCA 2ZC3B 3SH7A 3EQVA 2J8YA 1TS7A 2HF6A 5HPIA 4UQIM 1QMEA 1PIOA 3IS2B 4I3JA 5HAPA 4QY6A 5HL6A 2DNSA 1ZTUA 1IFQA 1P9RA 1TDGA 1PW1A 3Q7VA 1N9NA 2ZMFA 3CLOA 3BQAA 4GS9A 2PD7A 3LYXA 1XFQA 3WRZA 5FI6A 3HLFA 2ZM8A 5HWTA 4RX2A 3H82B 3NBLA 4HIAA 4R3BA 4M3KA 4MN5A 4KUOA 4PAUA 1JNUA 2PAVP 4B9OA 2B95A 3CHWP 4KZ8A 2HP5A 3LEZA 2DCFA 4D60A 4KQQA 3OBFA 4KZ6A 4IUKA 1D7EA 2D02A 3G6OA 3RTYA 5L09A 2XDMA 3IH9A 3UE0A 3K3CA 3S7OA 3U4LP 1RGZA 2UWXA 4IBRA 2BTFP 3IWOA 3VE4A 1WYCA 2JHEA 4S2PA 3UE3A 4F94A 3L9KA 4X68A 2WKHA 4GDNA 2O0YA 2ZL1A 4NEED 1XP4A 1NYYA 4I38A 4DE3A 3CZDA 2VGKA 4P0MA 1GSWA 5DJUA 3TE8A 1H0MA 4WM9A 2C5WB 5DKKA 1O07A 3Q07A 3IT9A 5FEGA 4KQDA 2QYBA 1K55A 2O99A 2JKRM 5DTSA 1KVLA 4EXOA 2H10A 4KZBA 1ES2A 3PHYA 2OV5A 4Z1WA 2ZC5B 2ZM0A 3ULFA 1HLUP 4MNRA 3MFXA 1ZG6A 3N6IA 1LHYA 4I3AA 4CLCA 3FV7A 3JYIA 5I5LA 2Y2PA 4OOLA 5LBRA 1PWCA 4GNUA 4EW7A 2W27A 1XA1A 2Y2JA 5U47A 2A3UA 2XQZA 2EX2A 3IS2A 1OTEA 1MPLA 5FQMA 3T4OA 5FQJA 4OPRA 2WAFA 1OT6A 1S0WA 4ARZB 1G6OA 2VX8A 1NLZA 3FPWA 1XJ3A 3HREA 4BL3A 2HPBA 1MC0A 4WMCA 3ZNTA 1SKFA 4LPZA 3EEAA 2QPNA 3G2YA 4N9KA 2EA9A 4WZ5A 3ZG0A 2Y2NA 1FQGA 3IF6C 3UB8A 1Q2PA 4UQIS 3LY4A 2ZMVA 4WELA 2L1MA 1HZOA 1YKDA 1XJ6A 5FEFA 2VGLM 4JF6A 5CXWA 4UA9A 2W3FA 5J4EA 1RCJA 2O9CA 1IOUA 2GX5A 1KVMA 3ITBA 4JGOA 1PWDA 3V5MA 3A3DA 2KOIA 3LIAA 3LIBA 1LLBA 5FDSA 1QMFA 4L0LA 5HX9A 2PT7A 5GHXA 4Q0IA 3C8CA 3NIAA 4E3KA 2EFUA 4R3JA 3KYEA 4FOFA 5CTMA 1VB6A 3DWKA 4ME4A 3FPVA 1KDWA 2IA2A 3OOVA 3GQZA 4RYEA 4BBVA 1NZUA 4GD8A 5CERA 2VK3A 3SS4A 2XEPA 4O8GA 4DE0A 4KZ7A 3LGOA 1TS8A 1K54A 4Y0UA 2J7VA 1YLPA 4S2MA 2Y2QA 2JKFA 5HW3A 5GLCA 3EEHA 3HBRA 5HL1A 1OT9A 1OJ5A 3BWLA 5TGFA 2VV8A 2VGJA 3B42A 4JKTA 5FI7A 5GLBA 3SS3A 3GSGA 4I3IA 4L9FA 1I5QA 5FQIA 4ESPA 1T18A 2XD1A 4OVDA 1IYSA 2Q0OA 1H8MA 3LCEA 3PBNA 3DTEA 3V50A 4CPKA 5HD5A 2XF3A 5DF8A 2R9XA 3E4OA 1L0EA 1LI0A 5IS1A 4ARZA 4K0XA 2FH5A 5KSCA 3A3JA 2VEAA 3MQ0A 3TJZC 2OWJA 1FSYA 1ESIA 2Z2MB 4BLMA 5DTTA 3UNWA 3ZG7B 5HDSA 3CITA 4YFMA 4G3KA 4DDSA 4KZ3A 1V9YA 4UA6A 5DFYA 1CEFA 2EWWA 5JYPA 1N9BA 3F1NB 3AGEA 4FTXA 5CX7A 4LFUA 1DJBA 4BMWA 1NLYA 4OH0A 2PD8A 3UDXA 2Y2MA 4MMNA 2QZ6A 5KMWA 4QPRA 1MKMA 4GJ4A 4JXVA 5HAQA 4OP8A 2WGVA 3OLOA 1SDNA 1S67L 2A24B 2GNXA 5I94A 2DMWA 4WEKA 3DWZA 3SH8A 1MKIA 2OOLA 1FR6A 3UMEA 4LV2A 4WZ4A 4IJGA 4KZ5A 1GA9A 3LIDA 2WAEA 3O5YA 2WGIA 1WE4A 2JE5A 4AFIA 2ZQAA 3C5AA 2R9WA 2Y59A 4KZ4A 3VSLA 2ACGA 5CGWA 3DTKA 3ZCZA 4GB7A 4HI4A 3T1XA 2W3GA 3IX8A 5FA7A 3HJIA 1OMEA 1E4DA 1NWZA 3C4PA 3G31A 1JVJA 1JWZA 1ONHA 4HY8A 3B33A 1W63Q 2ZOIA 2LB5A 2FZ0A 5EM0A 4IHQA 1BTLA 1STZA 2QKPA 3N8RA 1S4RA 2IWBA 1K6SA 3PXPA 2BLSA 1JTDA 5M1AA 4MN6A 4N92A 3C2WA 3T1RA 1L0DA 3CWFA 1KGGA 2ZQ9A 5FQQA 3T4QA 3HLEA 1MXOA 5GL9A 5HARA 4RA7A 1AWIA 3VP0A 2A2LA 1IYOA 2P74A 4LCMA 5E2GA 2J3WA 3F1OB 3BW6A 4KG5A 1K55C 4ID4A 5DVAA 3H7WB 3KSHA 4H8RA 3BEBA 1VM1A 2XFTA 5CGXA 4LLOB 1BZAA 1T19A 4RQ9A 3MBZA 3GRJA 3S7NA 3PAEA 4ZAMA 4X1LA 3BFEA 2OWHA 3QP1A 3T4LA 4S2IA 4P87A 1K25A 2EX6A 3F1NA 4WLAA 4CLCC 4HESA 1T1BA 4PM6A 3S7PA 4CQHA 1KE3A 5CHUA 3MSHA 3E98A 2E8IA 3E4PA 3W4QA 3MZDA 2A24A 5DF9A 3VOLA 3B3XA 2WGWB 4NXEA 1GHPA 3A0SA 4WZ5C 1NJ4A 1K6RA 3UN7A 3BRMA 1ACFA 3W2ZA 1YSPA 5DTKA 1TS6A 4GHIB 3MJQA 4QU3A 3EOIA 5HWVA 1CEGA 3UE6A 1PRQA 1PFLA 1PW8A 1XKZA 3NI9A 3ITAA 4K91A 2M1CA 1RP5A 3OCNA 1P0ZA 4R6LA 5A90A 2QHKA 4N9LA 3C38A 3PBTA 2V1ZA 3OPRA 3IQAA 1T1CA 1GHMA 1PWGA 4OPQA 1XXMA 4DN0A 3MQQA 3UPPA 3CG5A 2VLGA 1S66L 2X71A 3N4IA 2E8JA 2H0YA 1FIKA 1BYWA 3F1OA 1F2KA 1L0FA 5AVEA 5J8XA 3H7WA 5E43A 2EX9A 1H8ZA 4JXSA 1ALQA 2XLNA 4M4XA 5L2FA 1OJGA 4DMZA 3UDFA 5CECA 2FFYA 1K54C 2PU2A 5KSHA 3S22A 1K4FA 3LO7A 1XPBA 2XK1A 2Y4AA 3EGXC 4BENA 3I7JA 3ZQ5A 2KX6A 4DE2A 4HJ3A 5EVIB 3GDIA 1TS0A 1XGIA 2HJ9C 4S2KA 4OLDA 3PBRA 1PNEA 3G2ZA 2W1TB 4DJ2A 4E3MA 2FFFB 5CEDA 2JKTM 4FUWA 4C6YA 3MKEA 4P6ZS 2EXAA 5F1GA 1P97A 5EUAA 4PM8A 2HDRA 4KQRA 5EECA 2WGWA 2XGNA 3ZG5A 2V0WA 5EOOA 4GOGA 3WRTA 3IBJA 3BY9A 3HLWA 2Y2GA 3PBQA 5D3OA 4I39A 3SH9A 2ZJ9A 4EESA 2PU4A 3NC8A 4WF0A 1Z6FA 4F3LB 3HUMA 3HL9A 4GHIA 4X25A 3LICA 2BASA 1KGFA 3N8LA 4E04A 2HGVA 2WZZA 1HD8A 4CJNA 4HP4A 2ZC4B 3M6HA 5IT5A 4R23A 3C7UA 3FZCA 2ZBBA 3BFFA 3OCLA 5AQ7A 1AXBA 5F69A 2EX8A 1FCNA 4B88A 4EBPA 3RXWA 5CEBA 1WA9A 5K5BA 1Y54A 3SZTA 5F82A 3RH8B 1YQSA 1XGJA 3WS2A 3NOTC 5F5YA 4Y15A 3MXSA 4DJ3A 3C7VA 2Y2IA 4B4ZA 2Z6DA 3ZYTA 3NECA 3IX4A 1LSVA 1ONGA 3N8SA 3KSGA 4HEFA 1M40A 4QHCA 1SZVA 3IWQA 5CHMA 4NG2A 4EUVA 1WYBA 1E3UA 4X69A 4EBLA 4D2OA 3M6BA 1LL5A 4E3JA 3H82A 3VFFA 2QWSA 3CJMA 3T1SA 2XA7S 1JTGA 4LV0A 2K2NA 3KYQA 3PBSA 4LRXC 1W7FA 1L2SA 4MBHA 2BG1A 3EGDC 3BLMA 1ES4A 3UPNA 2CMNA 2ZD8A 3V39A 2V0UA 4E6XA 1GA0A 3AGDA 3E0YA 1MWSA 3V3RA 4Y3IA 5FQ9A 2WK0A 5EVIA 2V2FF 4GZBA 3JPUA 5G4YA 1W79A 4HH3A 2C6WB 5FL3A 1GHIA 5EFWA 5GHZA 3BJNA 1EROA 1EWZA 5EPHA 5HDCA 2W1TA 4X55A 1G6AA 5J3WA 5HAIA 2Y79A 1VEUB 2K7SA 5KIZA 1K56A 2V9AA 2H28A 2HV1A 2JC7A 3NJAA 2JN7A 4R1GA 1VHMA 3BFDA 2V8CA 3A0RA 2H0TA 4HHDA 2LB9A 1D06A 5G4ZA 3NDEA 4ZBEA 4MCWA 4K0WA 2CC1A 2W3EA 3IXHA 4EWFA 4PM9A 4HH2A 1A0KA 3ZG9B 1UWPX 2JKTI 4BL2A 3UB9A 3IHBA 4F3LA 4R4RA 1F9IA 3KSIA 3MQOA 3UPOA 3SOIA 1CJFA 2RCXA 3UB6A 3QP4A 1YPRA 3C30A 2QJ5A 2WKIA 1W5DA 2OAQ1 1OTIA 4KENB 1H3QA 1FILA 3IBRA 4MBFA 5HDDA 2M7UA 2XSSA 1CF0A 1NXYA 2W3DA 2ZOHA 4QWOA 4DE1A 1N9LA 4E3LA 4EUZA 2NUTC 5HSQA 1LT0A 1W63M 3AGFA 1NRJA 1MWRA 4MBKA 4II7A 1BULA 3IXDA 1BSGA 3LEQA 3GMWA 3VE3A 3A0VA 2UV0E 5AQBA 5FI2A 1OTDA 3UMDA 3QNBA 1PI5A 2Y2KA 4Y13A 1FOFA 3DBAA 2JBFA 3OPPA 1XFNA 1BUEA 5L8MA 3P7NA 2O9BA 3GTCA 1YLYA 2A49A 2EXBA 3UE1A 3PYPA 3RFBA 3VP1A 2J9OA 4I5SA 3L7HA 4LCLA 1DP6A 3GV9A 4JLFA 1K57A 2WUQA 4PHTA 1V9ZA 3W8KA 4CLCE 1GSXA 4DF6A 2W3HA 4DXBA 2XR0A 3MZEA 1YLJA 4H6JB 4IEDA 4C3QA 3C4OA 4HJ4A 1VEUA 1BT5A 3CMZA 3U2AA 4KQOA 1KE0A 1ESUA 3D9YA 1SKOB 3OZHA 4R38A 4LV3A 1L0GA 3VP4A 2Q9NA 4HP9A 1DJAA 5M18A 3DTMA 1GCEA 2V20A 3IH8A 3BFCA 3T12B 1GSVA 4B93A 3MZFA 3LR3A 3LIEA 5EV0A 3Q7ZA 2OLUA 4QB8A 3FC7A 4NKPA 4HQAA 4R3AA 3ZFZA 3IXBA 3NCKA 5CRFA 3IHAA 4XT2B 1LI9A 1ZHHB 4NXFA 4IBXA 1RGYA 1DRMA 3S4XA 4BD1A 3CI6A 5J7EA 2J80A 1U60A 1MBLA 3BY8A 3ZNYA 1KGEA 3IX3A 2XRNA 3WS0A 4OPYA 1N4OA 3S7QA 1KE4A 4ZJ3A 4MDZA 1S4SA 4BD0A 2X02A 3QNCA 3MXQA 2V8FA 1F5MA 1ZC2A 2OLVA 5EOEA 3TOIA 1CI8A 2XD5A 3QHYA 4KZ9A 5IHVA 3S1YA 3ZGAB 4HNBA 4P6ZM 4OQGA 3UDIA 3UO9A 4L9EA 1MWUA 4HOIA 2WKPA 3T4SA 4EU0A 4CLCD 2OSUA 2ZC7A 1S6RA 3FG8A 2QJ7A 3CUEA 4GD6A 3G32A 1Q2QA 2VV6A 5CGSA 3ZVTA 1IELA 1NY0A 3KYZA 4ETZA 1I2WA 4X56A 2GJ3A 2OAP1 4DXCA 2RL3A 3G4PA 3G30A 1YM1A 3LR0A 4UA7A 4FSFA 3VOZA 2V1AA 4H6JA 4GDBA 4WMCD 4GN2A 2WYXA 2Y2OA 5CTNA 3HCYA 1F98A 4QY5A 2G7UA 3BQ8A 3NY4A 1SKOA 1FCOA 1M6KA 1O7EA 4NXBA 4Q8IA 3VOYA 1VETB 4K08A 3OC2A 5F83A 5DKLA 3DW0A 2B02A 2D01A 4Y5FA 3PTEA 4OOYA 4PPRA 2GDNA 4EEUA 3H9WA 4U3TA 5EVID 3GVBA 4JF4A 2HP9A 1ZKJA 5EVIC 4XUZA 3Q81A 2PYPA 3T1QB 1YMSA 1YMXA 2PR5A 1G5UA 4GLQA 2VA0A 2X01A 1IKIA 2DRWA 2XA7M 4LRYC 4LV1A 4XT2A 5MC7A 5DF7A 2PR6A 3VV4A 1ODVA 2QMIA 3ISGA 3KO6A 4O7DA 4OLGA 2Y2HA 2WZXA 5E2FA 1CK3A 4DDYA 4NK3A 1MWTA 1CQAA 4X1MA 1MZUA 4OONA 4S2NA 5HWWA 4U0XA 4DRTA 4Y17A 4E3OA 2Z6CA 1YSQA 5AQ9A 5M19A 3UB7A 5FSRA 1TD5A 3LR5A 2WADA 2J3TD 5AJGA 2VJWA 4JGRA 2J3TC 1LSXA 2L0WA 4LENA 4YNRA 3VSKA 4C75A 4BBTA 3F1PB 3K3DA 1XA7A 5BOHA 3CPTB 2YKHA 3LUQA 3M2KA 3ZG8B 3UB5P 3P98A 3SS5A 4A5RA 3PBOA 3OPHA 3P09A 2XROA 2Y55A 3RJUA 5L10A 3Q82A 5FDHA 2G2UA 3LR4A 2Y91A 3A3EA 3E4QA 1VQQA 4R0QA 4BWIA 1VETA 4FD8A 3LFVA 4OOMA 3SW1A 3W4PA 3HVFA 4R70A 1OPXA 5FAOA 5KZHA 4XUXA 2Q9MA 2P9VB 3P01A 4ZJ1A 1MY8A 3LI9A 1IYPA 1K57C 1TDLA 3WS1A 4JGQA 3T4TA 1JWPA 5C5KA 4Y0TA 3IF5A 4PKYA 5A91A 4Q0HA 1NYMA 4Y2FA 1XJ4A 3KSFA 1SHVA 2HZ5A 3JVVA 4EQIA 3G35A 1IEMA 4BQMA 2P7JA 3BM6A 5TJJA 2PBDP 4ZRRA 5HD3A 5G18A 3LY3A 3TG9A 5TBMB 3G34A 4E6WA 3ZVWA 1YLWA 3JVUA 4UHUA 5EVLA 3KX0X 3MR0A 1Y28A 3HUOA 2JCHA 3D3OA 4UAAA 2AVXA 5E2HA 3PAGA 3IWIA 4JGPA 3BECA 3QP2A 2WKRA 2L4RA 1I2SA 4X6TA 3NOUC 1BLPA 1UGUA 3D4FA 1W8QA 4OQ0A 4KG2A 2HDQA 3HLBA 2PYRA 3HLDA 5FASA 2ZQDA 5DFXA 4WUJA 3B47A 4OKPA 4E3IA 5F68A 1S1YA 4PM7A 4Q0JA 2EFXA 3VP2A 3F1PA 1XJ2A 3BYDA 2ZM2A 2Z2LB 4O0PA 3MKFA 1ERQA 3CPTA 1ERMA 3LIFA 4Y7PA 1HVBA 4E3NA 3VP3A 3FKVA 1K4EA 4FH4A 4YWZA 4IUHA 2WKQA 4RX3A 3MXRA 3Q1FA 4YOFA 3E2KA 3A3FA 2ZC6B 5FAPA 2Y2LA 4JXWA 4FCFA 1C3BA 1FSWA 3EQUA 4Z9QA 4G3WA 1J3WA 4KZAA 2KDKA 3O87A 1SCWA 4EBNA 3CUEC 3TW8A 3GR2A 3PR6A 3O3VA 5F6AA 4HJ6A 1PZOA 2J9PA 2P9VA 3LI8A 1LSWA 5A92A 4OQIA 3WS5A 5GLDA 1Z09A 5TR7A 4S2LA 4NETA 1XX2A 1YT4A 3IF6B 2ZQCA 1EW0A 4EQ1A 1LL8A 1BLSA 3R7WB 2PHYA 2G2WA 4IVKA 5GHYA 3UY6A 4EEPA 3GECA 2JKRI 3DTIA 3DAVA 3CAXA 2M7VA 5TBMA 4ETXA 3WWXA 4BBUA 1DP8A 2B5RA 4PKYG 5AVFA 3HJKA 4OQHA 1PZPA 4GKUA 1H8YA 1JWVA 1BLHA 2K31A 5FAQA 3MMHA 4YINA 4DKIA 3IXGA 4HBTA 2P08A 3FKWA 3QP6A 2ZQ7A 4HBUA 2YKFA 4LGWA 1IKGA 1T1AA 4OPZA 2VKSA 1CI9A 4L9GA 2ZQ8A 5EVEA 2HP6A 4ZTKA 5FQKA 3FYZA 2P04A 4OP5A 4R4SA 2NUPC 1ES5A 3MFDA 3T4JA 3VMAA 3EWKA 2H5SA 4S2NC 1N9OA 4UEYA 4PM5A 1SDEA 1PI4A 3N7WA 2VZWA 2XH9A 3O88A 2HDUA 4JPMA 3WS4A 5DJTA 3VFHA 2Y8HA 1DP9A 3T4KA 1LL9A 3BLSA 1ZG4A 3ICYA 2VGLS 5TFQA 4S2OA 5A93A 4EERA 1J9MA 5F1FA 3NOPC 4U0TA 5HFOA 2XFSA 4ZJ2A 4G3VA 1W8YA 3T50A 5IU1A 1FCMA 1NRFA 1YLTA 4X53A 4JF5A 3IF6A 5EM1A 2WKEA 2HDSA 1S1ZA 2W0NA 2B18A 5GLAA 1K0KA 5CHJA 3R7WA 2GZAA 3FWLA 4WL9A 4JBFA 2I72A 4MLLA 3HLGA 3HLCA 4P85A 1TVFA 3BFGA 5EE8A 4LRZE 1Y4OA 3NDGA 2MJ6A 3MF0A 2IWDA 3Q7VB 4RVAA 4XXRA 3R4KA 3ZDJA 3NHQA 1OTBA 2PDRA 1NZOA 4GS9B 4WN5A 1YLZA 1G68A 3RXXA 3TSGA 1EI5A 1IYQA 2PRFA 4FH2A 5HPFA 4N1HA 3K2NA 2INWA 4ZDXA 1FR1A 5A8BA 3D72A 3O86A 4PMAA 1DJCA 4GW9A 4P6BA 4S2JA 1OTAA 3HUNA 2KLIA 4KG6A 1G28A 4QD4A 2W1RA 2JKGA 5AQAA 1HTZA 1X0OA 1E3UD 1E25A 4JXGA 4MN7A 1DY6A 5HZHA 4WEJA 3QP8A 4GCZA 2ZL1B 4EETB 4KUKA 3ZHHA 3A3IA 5E2EA 4QJGA 5FATA 4NXGA 3W4OA 5L07A 4WYYA 4Y0OA
chains in the Genus database with same CATH topology
2G2UA 2Y91A 1GA9A 1H5XA 3A3EA 1VQQA 4R0QA 2WAEA 1ES3A 4EV4A 2WGIA 3NDEA 4FD8A 4WBGA 4ZBEA 4K0WA 1WE4A 2JE5A 4OOMA 2CC1A 4EWFA 3IXHA 2ZMAA 4PM9A 2ZQAA 3W4PA 3C5AA 3HVFA 3ZG9B 2R9WA 4BL2A 4N1XA 5FAOA 5KZHA 2ZLYA 4XUXA 2Q9MA 3IHBA 2Y59A 1KDSA 4KZ4A 2P9VB 4ZJ1A 3VSLA 4R4RA 4BJPA 3OPLA 1MY8A 1IYPA 1K57C 1TDLA 5CGWA 3V3SA 3WS1A 3ZCZA 1TEMA 4GB7A 3UPOA 3SOIA 2RCXA 1JWPA 5JYOA 5FA7A 4Y0TA 1OMEA 1E4DA 3IF5A 1K56D 3C4PA 5A91A 1PYYA 3G31A 1JVJA 1JWZA 1NYMA 1ONHA 2WKIA 3M2JA 2PBYA 4MEZA 1BLCA 1K38A 1W5DA 1BTLA 3N8RA 4B4XA 3E2LA 4IVIA 4KENB 1SHVA 2IWCA 2ZC3B 2IWBA 3SH7A 3EQVA 2J8YA 4EQIA 1K6SA 3G35A 2BLSA 1IEMA 4BQMA 3BM6A 1JTDA 5M1AA 4MBFA 1NXYA 4N92A 1QMEA 1PIOA 1L0DA 5G18A 4DE1A 3LY3A 5HAPA 4QY6A 3TG9A 1KGGA 2DNSA 4E3LA 2ZQ9A 5FQQA 4EUZA 3G34A 4E6WA 3AGFA 3HLEA 1MWRA 1YLWA 4UHUA 3ZVWA 1MXOA 5EVLA 4MBKA 5GL9A 5HARA 1TDGA 4RA7A 3VP0A 1PW1A 3Q7VA 2P74A 1IYOA 3HUOA 4LCMA 1BULA 3IXDA 1BSGA 2JCHA 5E2GA 3GMWA 4UAAA 4KG5A 1K55C 4ID4A 5DVAA 5E2HA 3PAGA 5AQBA 5FI2A 3IWIA 3WRZA 3BECA 4H8RA 5FI6A 3BEBA 3HLFA 2ZM8A 3QNBA 1PI5A 1VM1A 2XFTA 4RX2A 1I2SA 3NBLA 2Y2KA 5CGXA 1BZAA 4X6TA 1BLPA 1FOFA 3MBZA 3GRJA 2JBFA 3D4FA 4R3BA 1W8QA 3OPPA 3PAEA 4M3KA 1BUEA 4KG2A 4OQ0A 4ZAMA 2HDQA 3HLBA 3BFEA 3GTCA 3HLDA 5FASA 4S2IA 1YLYA 2A49A 2EXBA 2ZQDA 4P87A 3UE1A 4KZ8A 4OKPA 2HP5A 4E3IA 3LEZA 2DCFA 1K25A 3VP1A 2EX6A 2J9OA 4KQQA 4PM7A 2EFXA 4LCLA 3VP2A 3BYDA 4KZ6A 4HESA 2ZM2A 2Z2LB 3GV9A 4JLFA 4PM6A 1K57A 3MKFA 2WUQA 1ERQA 1ERMA 4Y7PA 1HVBA 4E3NA 2XDMA 3IH9A 3W8KA 3UE0A 1KE3A 3VP3A 4DF6A 3FKVA 1K4EA 1RGZA 2UWXA 2XR0A 4FH4A 5CHUA 4DXBA 3MZEA 1YLJA 4IBRA 3IWOA 4IEDA 1WYCA 4S2PA 4C3QA 2E8IA 3UE3A 3W4QA 4F94A 3C4OA 3MZDA 4X68A 2WKHA 4GDNA 4RX3A 3MXRA 1XP4A 1BT5A 3CMZA 4KQOA 3Q1FA 5DF9A 1KE0A 1NYYA 3B3XA 2WGWB 1ESUA 4DE3A 3CZDA 2VGKA 3OZHA 3E2KA 3A3FA 4P0MA 1GHPA 2ZC6B 5FAPA 2Y2LA 4JXWA 4FCFA 1C3BA 1FSWA 3EQUA 4LV3A 4WZ5C 4Z9QA 1NJ4A 1L0GA 1K6RA 3VP4A 4KZAA 2Q9NA 3UN7A 3BRMA 4WM9A 3O87A 1DJAA 1SCWA 5M18A 4EBNA 3DTMA 2C5WB 5DTKA 1GCEA 1O07A 3GR2A 2V20A 3IH8A 3O3VA 3BFCA 3Q07A 1PZOA 2J9PA 2P9VA 3IT9A 3MZFA 4QU3A 1CEGA 1K55A 1PW8A 5A92A 4OQIA 1XKZA 3Q7ZA 3WS5A 2OLUA 4QB8A 3NI9A 5DTSA 1KVLA 3ITAA 4K91A 5GLDA 5TR7A 1RP5A 2H10A 4S2LA 4KZBA 3ZFZA 3OCNA 4NETA 3IXBA 1XX2A 1YT4A 1ES2A 3NCKA 5A90A 5CRFA 3IHAA 2OV5A 2ZC5B 3IF6B 4N9LA 2ZQCA 2ZM0A 1LI9A 4MNRA 1ZG6A 3PBTA 3N6IA 4IBXA 1BLSA 1RGYA 3S4XA 2V1ZA 1LHYA 3OPRA 3IQAA 4BD1A 3FV7A 3JYIA 2G2WA 4IVKA 5GHYA 1GHMA 2Y2PA 3UY6A 1U60A 4OOLA 1PWCA 4GNUA 1MBLA 3ZNYA 1KGEA 1XA1A 1PWGA 4OPQA 3WS0A 2Y2JA 4OPYA 5U47A 2A3UA 2XQZA 2EX2A 1XXMA 4WYYA 1N4OA 1MPLA 1KE4A 3UPPA 3CG5A 4ZJ3A 5FQMA 4BD0A 2X02A 5FQJA 3WWXA 4OPRA 2WAFA 2X71A 3N4IA 1S0WA 3QNCA 2H0YA 1ZC2A 2OLVA 5EOEA 3TOIA 2B5RA 1CI8A 3HREA 4BL3A 2XD5A 2HPBA 3QHYA 4KZ9A 1L0FA 1SKFA 4WMCA 5IHVA 3ZNTA 5J8XA 2QPNA 3S1YA 4OQHA 3ZGAB 5E43A 1PZPA 2EX9A 3G2YA 4GKUA 1H8ZA 1H8YA 4JXSA 1ALQA 1JWVA 2XLNA 5L2FA 4OQGA 3UDIA 3UO9A 1BLHA 5FAQA 1MWUA 5CECA 4N9KA 3UDFA 2FFYA 1K54C 4WZ5A 3ZG0A 2PU2A 2Y2NA 1FQGA 4YINA 3S22A 5KSHA 1K4FA 2OSUA 2ZC7A 1S6RA 3LO7A 4DKIA 3IF6C 1Q2PA 3IXGA 4HBTA 1XPBA 2XK1A 2Y4AA 3FKWA 3LY4A 3G32A 4GD6A 1Q2QA 4WELA 2ZQ7A 4HBUA 1HZOA 5CGSA 4BENA 3ZVTA 3I7JA 1IKGA 1IELA 4DE2A 1NY0A 4OPZA 1I2WA 4X56A 5EVIB 1CI9A 1XGIA 4DXCA 2RL3A 4S2KA 3G4PA 4JF6A 2ZQ8A 5CXWA 3G30A 1YM1A 4OLDA 4UA9A 2HP6A 3PBRA 1RCJA 4ZTKA 3G2ZA 4UA7A 4FSFA 5FQKA 3VOZA 1KVMA 3ITBA 3FYZA 1PWDA 4GDBA 3V5MA 3A3DA 4WMCD 4OP5A 4E3MA 4R4SA 1ES5A 2FFFB 3MFDA 5CEDA 4GN2A 2WYXA 2Y2OA 4C6YA 3MKEA 1LLBA 3VMAA 5CTNA 2EXAA 5F1GA 2H5SA 4S2NC 5EUAA 4PM8A 4PM5A 1QMFA 2HDRA 4L0LA 4KQRA 1SDEA 4QY5A 5EECA 5GHXA 5HX9A 2WGWA 3NIAA 1PI4A 2XGNA 3N7WA 2EFUA 3ZG5A 4R3JA 2XH9A 4E3KA 3O88A 3NY4A 5EOOA 4GOGA 2HDUA 3WRTA 1FCOA 4JPMA 1M6KA 3WS4A 1O7EA 3HLWA 5CTMA 4Q8IA 3VOYA 3VFHA 2Y2GA 3OC2A 3PBQA 3DWKA 5F83A 1KDWA 5D3OA 1LL9A 3GQZA 3DW0A 4RYEA 3SH9A 2ZJ9A 3BLSA 2PU4A 3NC8A 1Z6FA 3PTEA 1NZUA 3HL9A 3HUMA 1ZG4A 4OOYA 4PPRA 2GDNA 5FDHA 5TFQA 4S2OA 4U3TA 1KGFA 5A93A 5EVID 3GVBA 4JF4A 1J9MA 3N8LA 4GD8A 5CERA 2HP9A 5F1FA 2WZZA 4U0TA 1HD8A 1ZKJA 2XFSA 5EVIC 5HFOA 4XUZA 4CJNA 3Q81A 4ZJ2A 2ZC4B 3M6HA 4R23A 3C7UA 3FZCA 1YMSA 1YMXA 3BFFA 3OCLA 5AQ7A 3SS4A 1W8YA 2XEPA 1AXBA 1FCMA 1NRFA 1YLTA 4DE0A 2X01A 4KZ7A 1IKIA 4X53A 1K54A 4Y0UA 2J7VA 2EX8A 1FCNA 2DRWA 4B88A 4EBPA 1YLPA 4JF5A 3RXWA 3IF6A 5CEBA 4S2MA 2Y2QA 4LV1A 5HW3A 2WKEA 1Y54A 2HDSA 5GLCA 3HBRA 5GLAA 5HL1A 5DF7A 5CHJA 3FWLA 5F82A 5TGFA 2QMIA 1YQSA 4JBFA 2VGJA 1XGJA 3ISGA 3WS2A 4JKTA 5FI7A 5GLBA 3SS3A 2I72A 4MLLA 4O7DA 3MXSA 3GSGA 3HLGA 1I5QA 3HLCA 5FQIA 4OLGA 2Y2HA 3C7VA 2Y2IA 4P85A 2WZXA 1TVFA 4B4ZA 2XD1A 3BFGA 4OVDA 1IYSA 5EE8A 3LCEA 3PBNA 3NDGA 3V50A 5E2FA 1ONGA 1CK3A 3N8SA 4HEFA 2XF3A 2IWDA 4CPKA 1M40A 4DDYA 4NK3A 5DF8A 2R9XA 4QHCA 1MWTA 3Q7VB 3IWQA 4RVAA 4XXRA 3ZDJA 1L0EA 1LI0A 5CHMA 1WYBA 1E3UA 4OONA 4X69A 4K0XA 1NZOA 4EBLA 4S2NA 4D2OA 3M6BA 5KSCA 1YLZA 1G68A 1LL5A 3A3JA 4U0XA 3RXXA 4DRTA 4E3JA 3TSGA 1EI5A 1IYQA 4FH2A 3VFFA 4E3OA 3CJMA 4N1HA 1FSYA 5AQ9A 1ESIA 1JTGA 5M19A 4LV0A 2Z2MB 4BLMA 5FSRA 3PBSA 5DTTA 3UNWA 3ZG7B 1W7FA 1L2SA 4ZDXA 1FR1A 4MBHA 2WADA 2BG1A 4YFMA 3BLMA 1ES4A 3UPNA 4DDSA 2ZD8A 4KZ3A 3V39A 4E6XA 4UA6A 1GA0A 3AGDA 1CEFA 3O86A 4PMAA 5JYPA 4LENA 1MWSA 3VSKA 1N9BA 1DJCA 4C75A 3AGEA 4P6BA 4S2JA 3V3RA 3HUNA 1DJBA 5FQ9A 4KG6A 1XA7A 2WK0A 4QD4A 5EVIA 2V2FF 5BOHA 4GZBA 1W79A 2C6WB 4OH0A 1GHIA 5AQAA 1HTZA 2Y2MA 5GHZA 3UDXA 1E3UD 1EROA 2QZ6A 5KMWA 1E25A 1EWZA 5EPHA 4JXGA 1DY6A 4X55A 1G6AA 5HAIA 3M2KA 4JXVA 3ZG8B 5HAQA 4OP8A 2WGVA 4WEJA 1SDNA 3P98A 5I94A 4WEKA 3DWZA 3ZHHA 3A3IA 3SS5A 3SH8A 1K56A 3PBOA 5E2EA 4A5RA 1MKIA 4QJGA 3OPHA 3P09A 2JC7A 5FATA 1FR6A 3W4OA 4R1GA 2Y55A 3RJUA 4LV2A 4WZ4A 3BFDA 4KZ5A 2H0TA 3Q82A 4Y0OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2G2U A;  2Y91 A;  1GA9 A;  1H5X A;  3A3E A;  1VQQ A;  4R0Q A;  2WAE A;  1ES3 A;  4EV4 A;  2WGI A;  3NDE A;  4FD8 A;  4WBG A;  4ZBE A;  4K0W A;  1WE4 A;  2JE5 A;  4OOM A;  2CC1 A;  4EWF A;  3IXH A;  2ZMA A;  4PM9 A;  2ZQA A;  3W4P A;  3C5A A;  3HVF A;  3ZG9 B;  2R9W A;  4BL2 A;  4N1X A;  5FAO A;  5KZH A;  2ZLY A;  4XUX A;  2Q9M A;  3IHB A;  2Y59 A;  1KDS A;  4KZ4 A;  2P9V B;  4ZJ1 A;  3VSL A;  4R4R A;  4BJP A;  3OPL A;  1MY8 A;  1IYP A;  1K57 C;  1TDL A;  5CGW A;  3V3S A;  3WS1 A;  3ZCZ A;  1TEM A;  4GB7 A;  3UPO A;  3SOI A;  2RCX A;  1JWP A;  5JYO A;  5FA7 A;  4Y0T A;  1OME A;  1E4D A;  3IF5 A;  1K56 D;  3C4P A;  5A91 A;  1PYY A;  3G31 A;  1JVJ A;  1JWZ A;  1NYM A;  1ONH A;  2WKI A;  3M2J A;  2PBY A;  4MEZ A;  1BLC A;  1K38 A;  1W5D A;  1BTL A;  3N8R A;  4B4X A;  3E2L A;  4IVI A;  4KEN B;  1SHV A;  2IWC A;  2ZC3 B;  2IWB A;  3SH7 A;  3EQV A;  2J8Y A;  4EQI A;  1K6S A;  3G35 A;  2BLS A;  1IEM A;  4BQM A;  3BM6 A;  1JTD A;  5M1A A;  4MBF A;  1NXY A;  4N92 A;  1QME A;  1PIO A;  1L0D A;  5G18 A;  4DE1 A;  3LY3 A;  5HAP A;  4QY6 A;  3TG9 A;  1KGG A;  2DNS A;  4E3L A;  2ZQ9 A;  5FQQ A;  4EUZ A;  3G34 A;  4E6W A;  3AGF A;  3HLE A;  1MWR A;  1YLW A;  4UHU A;  3ZVW A;  1MXO A;  5EVL A;  4MBK A;  5GL9 A;  5HAR A;  1TDG A;  4RA7 A;  3VP0 A;  1PW1 A;  3Q7V A;  2P74 A;  1IYO A;  3HUO A;  4LCM A;  1BUL A;  3IXD A;  1BSG A;  2JCH A;  5E2G A;  3GMW A;  4UAA A;  4KG5 A;  1K55 C;  4ID4 A;  5DVA A;  5E2H A;  3PAG A;  5AQB A;  5FI2 A;  3IWI A;  3WRZ A;  3BEC A;  4H8R A;  5FI6 A;  3BEB A;  3HLF A;  2ZM8 A;  3QNB A;  1PI5 A;  1VM1 A;  2XFT A;  4RX2 A;  1I2S A;  3NBL A;  2Y2K A;  5CGX A;  1BZA A;  4X6T A;  1BLP A;  1FOF A;  3MBZ A;  3GRJ A;  2JBF A;  3D4F A;  4R3B A;  1W8Q A;  3OPP A;  3PAE A;  4M3K A;  1BUE A;  4KG2 A;  4OQ0 A;  4ZAM A;  2HDQ A;  3HLB A;  3BFE A;  3GTC A;  3HLD A;  5FAS A;  4S2I A;  1YLY A;  2A49 A;  2EXB A;  2ZQD A;  4P87 A;  3UE1 A;  4KZ8 A;  4OKP A;  2HP5 A;  4E3I A;  3LEZ A;  2DCF A;  1K25 A;  3VP1 A;  2EX6 A;  2J9O A;  4KQQ A;  4PM7 A;  2EFX A;  4LCL A;  3VP2 A;  3BYD A;  4KZ6 A;  4HES A;  2ZM2 A;  2Z2L B;  3GV9 A;  4JLF A;  4PM6 A;  1K57 A;  3MKF A;  2WUQ A;  1ERQ A;  1ERM A;  4Y7P A;  1HVB A;  4E3N A;  2XDM A;  3IH9 A;  3W8K A;  3UE0 A;  1KE3 A;  3VP3 A;  4DF6 A;  3FKV A;  1K4E A;  1RGZ A;  2UWX A;  2XR0 A;  4FH4 A;  5CHU A;  4DXB A;  3MZE A;  1YLJ A;  4IBR A;  3IWO A;  4IED A;  1WYC A;  4S2P A;  4C3Q A;  2E8I A;  3UE3 A;  3W4Q A;  4F94 A;  3C4O A;  3MZD A;  4X68 A;  2WKH A;  4GDN A;  4RX3 A;  3MXR A;  1XP4 A;  1BT5 A;  3CMZ A;  4KQO A;  3Q1F A;  5DF9 A;  1KE0 A;  1NYY A;  3B3X A;  2WGW B;  1ESU A;  4DE3 A;  3CZD A;  2VGK A;  3OZH A;  3E2K A;  3A3F A;  4P0M A;  1GHP A;  2ZC6 B;  5FAP A;  2Y2L A;  4JXW A;  4FCF A;  1C3B A;  1FSW A;  3EQU A;  4LV3 A;  4WZ5 C;  4Z9Q A;  1NJ4 A;  1L0G A;  1K6R A;  3VP4 A;  4KZA A;  2Q9N A;  3UN7 A;  3BRM A;  4WM9 A;  3O87 A;  1DJA A;  1SCW A;  5M18 A;  4EBN A;  3DTM A;  2C5W B;  5DTK A;  1GCE A;  1O07 A;  3GR2 A;  2V20 A;  3IH8 A;  3O3V A;  3BFC A;  3Q07 A;  1PZO A;  2J9P A;  2P9V A;  3IT9 A;  3MZF A;  4QU3 A;  1CEG A;  1K55 A;  1PW8 A;  5A92 A;  4OQI A;  1XKZ A;  3Q7Z A;  3WS5 A;  2OLU A;  4QB8 A;  3NI9 A;  5DTS A;  1KVL A;  3ITA A;  4K91 A;  5GLD A;  5TR7 A;  1RP5 A;  2H10 A;  4S2L A;  4KZB A;  3ZFZ A;  3OCN A;  4NET A;  3IXB A;  1XX2 A;  1YT4 A;  1ES2 A;  3NCK A;  5A90 A;  5CRF A;  3IHA A;  2OV5 A;  2ZC5 B;  3IF6 B;  4N9L A;  2ZQC A;  2ZM0 A;  1LI9 A;  4MNR A;  1ZG6 A;  3PBT A;  3N6I A;  4IBX A;  1BLS A;  1RGY A;  3S4X A;  2V1Z A;  1LHY A;  3OPR A;  3IQA A;  4BD1 A;  3FV7 A;  3JYI A;  2G2W A;  4IVK A;  5GHY A;  1GHM A;  2Y2P A;  3UY6 A;  1U60 A;  4OOL A;  1PWC A;  4GNU A;  1MBL A;  3ZNY A;  1KGE A;  1XA1 A;  1PWG A;  4OPQ A;  3WS0 A;  2Y2J A;  4OPY A;  5U47 A;  2A3U A;  2XQZ A;  2EX2 A;  1XXM A;  4WYY A;  1N4O A;  1MPL A;  1KE4 A;  3UPP A;  3CG5 A;  4ZJ3 A;  5FQM A;  4BD0 A;  2X02 A;  5FQJ A;  3WWX A;  4OPR A;  2WAF A;  2X71 A;  3N4I A;  1S0W A;  3QNC A;  2H0Y A;  1ZC2 A;  2OLV A;  5EOE A;  3TOI A;  2B5R A;  1CI8 A;  3HRE A;  4BL3 A;  2XD5 A;  2HPB A;  3QHY A;  4KZ9 A;  1L0F A;  1SKF A;  4WMC A;  5IHV A;  3ZNT A;  5J8X A;  2QPN A;  3S1Y A;  4OQH A;  3ZGA B;  5E43 A;  1PZP A;  2EX9 A;  3G2Y A;  4GKU A;  1H8Z A;  1H8Y A;  4JXS A;  1ALQ A;  1JWV A;  2XLN A;  5L2F A;  4OQG A;  3UDI A;  3UO9 A;  1BLH A;  5FAQ A;  1MWU A;  5CEC A;  4N9K A;  3UDF A;  2FFY A;  1K54 C;  4WZ5 A;  3ZG0 A;  2PU2 A;  2Y2N A;  1FQG A;  4YIN A;  3S22 A;  5KSH A;  1K4F A;  2OSU A;  2ZC7 A;  1S6R A;  3LO7 A;  4DKI A;  3IF6 C;  1Q2P A;  3IXG A;  4HBT A;  1XPB A;  2XK1 A;  2Y4A A;  3FKW A;  3LY4 A;  3G32 A;  4GD6 A;  1Q2Q A;  4WEL A;  2ZQ7 A;  4HBU A;  1HZO A;  5CGS A;  4BEN A;  3ZVT A;  3I7J A;  1IKG A;  1IEL A;  4DE2 A;  1NY0 A;  4OPZ A;  1I2W A;  4X56 A;  5EVI B;  1CI9 A;  1XGI A;  4DXC A;  2RL3 A;  4S2K A;  3G4P A;  4JF6 A;  2ZQ8 A;  5CXW A;  3G30 A;  1YM1 A;  4OLD A;  4UA9 A;  2HP6 A;  3PBR A;  1RCJ A;  4ZTK A;  3G2Z A;  4UA7 A;  4FSF A;  5FQK A;  3VOZ A;  1KVM A;  3ITB A;  3FYZ A;  1PWD A;  4GDB A;  3V5M A;  3A3D A;  4WMC D;  4OP5 A;  4E3M A;  4R4S A;  1ES5 A;  2FFF B;  3MFD A;  5CED A;  4GN2 A;  2WYX A;  2Y2O A;  4C6Y A;  3MKE A;  1LLB A;  3VMA A;  5CTN A;  2EXA A;  5F1G A;  2H5S A;  4S2N C;  5EUA A;  4PM8 A;  4PM5 A;  1QMF A;  2HDR A;  4L0L A;  4KQR A;  1SDE A;  4QY5 A;  5EEC A;  5GHX A;  5HX9 A;  2WGW A;  3NIA A;  1PI4 A;  2XGN A;  3N7W A;  2EFU A;  3ZG5 A;  4R3J A;  2XH9 A;  4E3K A;  3O88 A;  3NY4 A;  5EOO A;  4GOG A;  2HDU A;  3WRT A;  1FCO A;  4JPM A;  1M6K A;  3WS4 A;  1O7E A;  3HLW A;  5CTM A;  4Q8I A;  3VOY A;  3VFH A;  2Y2G A;  3OC2 A;  3PBQ A;  3DWK A;  5F83 A;  1KDW A;  5D3O A;  1LL9 A;  3GQZ A;  3DW0 A;  4RYE A;  3SH9 A;  2ZJ9 A;  3BLS A;  2PU4 A;  3NC8 A;  1Z6F A;  3PTE A;  1NZU A;  3HL9 A;  3HUM A;  1ZG4 A;  4OOY A;  4PPR A;  2GDN A;  5FDH A;  5TFQ A;  4S2O A;  4U3T A;  1KGF A;  5A93 A;  5EVI D;  3GVB A;  4JF4 A;  1J9M A;  3N8L A;  4GD8 A;  5CER A;  2HP9 A;  5F1F A;  2WZZ A;  4U0T A;  1HD8 A;  1ZKJ A;  2XFS A;  5EVI C;  5HFO A;  4XUZ A;  4CJN A;  3Q81 A;  4ZJ2 A;  2ZC4 B;  3M6H A;  4R23 A;  3C7U A;  3FZC A;  1YMS A;  1YMX A;  3BFF A;  3OCL A;  5AQ7 A;  3SS4 A;  1W8Y A;  2XEP A;  1AXB A;  1FCM A;  1NRF A;  1YLT A;  4DE0 A;  2X01 A;  4KZ7 A;  1IKI A;  4X53 A;  1K54 A;  4Y0U A;  2J7V A;  2EX8 A;  1FCN A;  2DRW A;  4B88 A;  4EBP A;  1YLP A;  4JF5 A;  3RXW A;  3IF6 A;  5CEB A;  4S2M A;  2Y2Q A;  4LV1 A;  5HW3 A;  2WKE A;  1Y54 A;  2HDS A;  5GLC A;  3HBR A;  5GLA A;  5HL1 A;  5DF7 A;  5CHJ A;  3FWL A;  5F82 A;  5TGF A;  2QMI A;  1YQS A;  4JBF A;  2VGJ A;  1XGJ A;  3ISG A;  3WS2 A;  4JKT A;  5FI7 A;  5GLB A;  3SS3 A;  2I72 A;  4MLL A;  4O7D A;  3MXS A;  3GSG A;  3HLG A;  1I5Q A;  3HLC A;  5FQI A;  4OLG A;  2Y2H A;  3C7V A;  2Y2I A;  4P85 A;  2WZX A;  1TVF A;  4B4Z A;  2XD1 A;  3BFG A;  4OVD A;  1IYS A;  5EE8 A;  3LCE A;  3PBN A;  3NDG A;  3V50 A;  5E2F A;  1ONG A;  1CK3 A;  3N8S A;  4HEF A;  2XF3 A;  2IWD A;  4CPK A;  1M40 A;  4DDY A;  4NK3 A;  5DF8 A;  2R9X A;  4QHC A;  1MWT A;  3Q7V B;  3IWQ A;  4RVA A;  4XXR A;  3ZDJ A;  1L0E A;  1LI0 A;  5CHM A;  1WYB A;  1E3U A;  4OON A;  4X69 A;  4K0X A;  1NZO A;  4EBL A;  4S2N A;  4D2O A;  3M6B A;  5KSC A;  1YLZ A;  1G68 A;  1LL5 A;  3A3J A;  4U0X A;  3RXX A;  4DRT A;  4E3J A;  3TSG A;  1EI5 A;  1IYQ A;  4FH2 A;  3VFF A;  4E3O A;  3CJM A;  4N1H A;  1FSY A;  5AQ9 A;  1ESI A;  1JTG A;  5M19 A;  4LV0 A;  2Z2M B;  4BLM A;  5FSR A;  3PBS A;  5DTT A;  3UNW A;  3ZG7 B;  1W7F A;  1L2S A;  4ZDX A;  1FR1 A;  4MBH A;  2WAD A;  2BG1 A;  4YFM A;  3BLM A;  1ES4 A;  3UPN A;  4DDS A;  2ZD8 A;  4KZ3 A;  3V39 A;  4E6X A;  4UA6 A;  1GA0 A;  3AGD A;  1CEF A;  3O86 A;  4PMA A;  5JYP A;  4LEN A;  1MWS A;  3VSK A;  1N9B A;  1DJC A;  4C75 A;  3AGE A;  4P6B A;  4S2J A;  3V3R A;  3HUN A;  1DJB A;  5FQ9 A;  4KG6 A;  1XA7 A;  2WK0 A;  4QD4 A;  5EVI A;  2V2F F;  5BOH A;  4GZB A;  1W79 A;  2C6W B;  4OH0 A;  1GHI A;  5AQA A;  1HTZ A;  2Y2M A;  5GHZ A;  3UDX A;  1E3U D;  1ERO A;  2QZ6 A;  5KMW A;  1E25 A;  1EWZ A;  5EPH A;  4JXG A;  1DY6 A;  4X55 A;  1G6A A;  5HAI A;  3M2K A;  4JXV A;  3ZG8 B;  5HAQ A;  4OP8 A;  2WGV A;  4WEJ A;  1SDN A;  3P98 A;  5I94 A;  4WEK A;  3DWZ A;  3ZHH A;  3A3I A;  3SS5 A;  3SH8 A;  1K56 A;  3PBO A;  5E2E A;  4A5R A;  1MKI A;  4QJG A;  3OPH A;  3P09 A;  2JC7 A;  5FAT A;  1FR6 A;  3W4O A;  4R1G A;  2Y55 A;  3RJU A;  4LV2 A;  4WZ4 A;  3BFD A;  4KZ5 A;  2H0T A;  3Q82 A;  4Y0O A; 
#chains in the Genus database with same CATH topology
 3NUL A;  3MS6 A;  1H5X A;  2I9V A;  1ES3 A;  4EV4 A;  4WBG A;  1TF1 A;  2EWV A;  2ZMA A;  1D1J A;  4O01 A;  2HJE A;  1UWN X;  1L3L A;  4N1X A;  2ZLY A;  1KDS A;  4BJP A;  3V67 A;  3OPL A;  2V1B A;  2R78 A;  3TRC A;  3V3S A;  1TEM A;  2O9A A;  2VV7 A;  5JYO A;  1YAX A;  1P9W A;  1K56 D;  1PYY A;  1KOU A;  3QP5 A;  3M2J A;  2PBY A;  4MEZ A;  1BLC A;  1K38 A;  4B4X A;  3E2L A;  4IVI A;  4CLC B;  2IWC A;  2ZC3 B;  3SH7 A;  3EQV A;  2J8Y A;  1TS7 A;  2HF6 A;  5HPI A;  4UQI M;  1QME A;  1PIO A;  3IS2 B;  4I3J A;  5HAP A;  4QY6 A;  5HL6 A;  2DNS A;  1ZTU A;  1IFQ A;  1P9R A;  1TDG A;  1PW1 A;  3Q7V A;  1N9N A;  2ZMF A;  3CLO A;  3BQA A;  4GS9 A;  2PD7 A;  3LYX A;  1XFQ A;  3WRZ A;  5FI6 A;  3HLF A;  2ZM8 A;  5HWT A;  4RX2 A;  3H82 B;  3NBL A;  4HIA A;  4R3B A;  4M3K A;  4MN5 A;  4KUO A;  4PAU A;  1JNU A;  2PAV P;  4B9O A;  2B95 A;  3CHW P;  4KZ8 A;  2HP5 A;  3LEZ A;  2DCF A;  4D60 A;  4KQQ A;  3OBF A;  4KZ6 A;  4IUK A;  1D7E A;  2D02 A;  3G6O A;  3RTY A;  5L09 A;  2XDM A;  3IH9 A;  3UE0 A;  3K3C A;  3S7O A;  3U4L P;  1RGZ A;  2UWX A;  4IBR A;  2BTF P;  3IWO A;  3VE4 A;  1WYC A;  2JHE A;  4S2P A;  3UE3 A;  4F94 A;  3L9K A;  4X68 A;  2WKH A;  4GDN A;  2O0Y A;  2ZL1 A;  4NEE D;  1XP4 A;  1NYY A;  4I38 A;  4DE3 A;  3CZD A;  2VGK A;  4P0M A;  1GSW A;  5DJU A;  3TE8 A;  1H0M A;  4WM9 A;  2C5W B;  5DKK A;  1O07 A;  3Q07 A;  3IT9 A;  5FEG A;  4KQD A;  2QYB A;  1K55 A;  2O99 A;  2JKR M;  5DTS A;  1KVL A;  4EXO A;  2H10 A;  4KZB A;  1ES2 A;  3PHY A;  2OV5 A;  4Z1W A;  2ZC5 B;  2ZM0 A;  3ULF A;  1HLU P;  4MNR A;  3MFX A;  1ZG6 A;  3N6I A;  1LHY A;  4I3A A;  4CLC A;  3FV7 A;  3JYI A;  5I5L A;  2Y2P A;  4OOL A;  5LBR A;  1PWC A;  4GNU A;  4EW7 A;  2W27 A;  1XA1 A;  2Y2J A;  5U47 A;  2A3U A;  2XQZ A;  2EX2 A;  3IS2 A;  1OTE A;  1MPL A;  5FQM A;  3T4O A;  5FQJ A;  4OPR A;  2WAF A;  1OT6 A;  1S0W A;  4ARZ B;  1G6O A;  2VX8 A;  1NLZ A;  3FPW A;  1XJ3 A;  3HRE A;  4BL3 A;  2HPB A;  1MC0 A;  4WMC A;  3ZNT A;  1SKF A;  4LPZ A;  3EEA A;  2QPN A;  3G2Y A;  4N9K A;  2EA9 A;  4WZ5 A;  3ZG0 A;  2Y2N A;  1FQG A;  3IF6 C;  3UB8 A;  1Q2P A;  4UQI S;  3LY4 A;  2ZMV A;  4WEL A;  2L1M A;  1HZO A;  1YKD A;  1XJ6 A;  5FEF A;  2VGL M;  4JF6 A;  5CXW A;  4UA9 A;  2W3F A;  5J4E A;  1RCJ A;  2O9C A;  1IOU A;  2GX5 A;  1KVM A;  3ITB A;  4JGO A;  1PWD A;  3V5M A;  3A3D A;  2KOI A;  3LIA A;  3LIB A;  1LLB A;  5FDS A;  1QMF A;  4L0L A;  5HX9 A;  2PT7 A;  5GHX A;  4Q0I A;  3C8C A;  3NIA A;  4E3K A;  2EFU A;  4R3J A;  3KYE A;  4FOF A;  5CTM A;  1VB6 A;  3DWK A;  4ME4 A;  3FPV A;  1KDW A;  2IA2 A;  3OOV A;  3GQZ A;  4RYE A;  4BBV A;  1NZU A;  4GD8 A;  5CER A;  2VK3 A;  3SS4 A;  2XEP A;  4O8G A;  4DE0 A;  4KZ7 A;  3LGO A;  1TS8 A;  1K54 A;  4Y0U A;  2J7V A;  1YLP A;  4S2M A;  2Y2Q A;  2JKF A;  5HW3 A;  5GLC A;  3EEH A;  3HBR A;  5HL1 A;  1OT9 A;  1OJ5 A;  3BWL A;  5TGF A;  2VV8 A;  2VGJ A;  3B42 A;  4JKT A;  5FI7 A;  5GLB A;  3SS3 A;  3GSG A;  4I3I A;  4L9F A;  1I5Q A;  5FQI A;  4ESP A;  1T18 A;  2XD1 A;  4OVD A;  1IYS A;  2Q0O A;  1H8M A;  3LCE A;  3PBN A;  3DTE A;  3V50 A;  4CPK A;  5HD5 A;  2XF3 A;  5DF8 A;  2R9X A;  3E4O A;  1L0E A;  1LI0 A;  5IS1 A;  4ARZ A;  4K0X A;  2FH5 A;  5KSC A;  3A3J A;  2VEA A;  3MQ0 A;  3TJZ C;  2OWJ A;  1FSY A;  1ESI A;  2Z2M B;  4BLM A;  5DTT A;  3UNW A;  3ZG7 B;  5HDS A;  3CIT A;  4YFM A;  4G3K A;  4DDS A;  4KZ3 A;  1V9Y A;  4UA6 A;  5DFY A;  1CEF A;  2EWW A;  5JYP A;  1N9B A;  3F1N B;  3AGE A;  4FTX A;  5CX7 A;  4LFU A;  1DJB A;  4BMW A;  1NLY A;  4OH0 A;  2PD8 A;  3UDX A;  2Y2M A;  4MMN A;  2QZ6 A;  5KMW A;  4QPR A;  1MKM A;  4GJ4 A;  4JXV A;  5HAQ A;  4OP8 A;  2WGV A;  3OLO A;  1SDN A;  1S67 L;  2A24 B;  2GNX A;  5I94 A;  2DMW A;  4WEK A;  3DWZ A;  3SH8 A;  1MKI A;  2OOL A;  1FR6 A;  3UME A;  4LV2 A;  4WZ4 A;  4IJG A;  4KZ5 A;  1GA9 A;  3LID A;  2WAE A;  3O5Y A;  2WGI A;  1WE4 A;  2JE5 A;  4AFI A;  2ZQA A;  3C5A A;  2R9W A;  2Y59 A;  4KZ4 A;  3VSL A;  2ACG A;  5CGW A;  3DTK A;  3ZCZ A;  4GB7 A;  4HI4 A;  3T1X A;  2W3G A;  3IX8 A;  5FA7 A;  3HJI A;  1OME A;  1E4D A;  1NWZ A;  3C4P A;  3G31 A;  1JVJ A;  1JWZ A;  1ONH A;  4HY8 A;  3B33 A;  1W63 Q;  2ZOI A;  2LB5 A;  2FZ0 A;  5EM0 A;  4IHQ A;  1BTL A;  1STZ A;  2QKP A;  3N8R A;  1S4R A;  2IWB A;  1K6S A;  3PXP A;  2BLS A;  1JTD A;  5M1A A;  4MN6 A;  4N92 A;  3C2W A;  3T1R A;  1L0D A;  3CWF A;  1KGG A;  2ZQ9 A;  5FQQ A;  3T4Q A;  3HLE A;  1MXO A;  5GL9 A;  5HAR A;  4RA7 A;  1AWI A;  3VP0 A;  2A2L A;  1IYO A;  2P74 A;  4LCM A;  5E2G A;  2J3W A;  3F1O B;  3BW6 A;  4KG5 A;  1K55 C;  4ID4 A;  5DVA A;  3H7W B;  3KSH A;  4H8R A;  3BEB A;  1VM1 A;  2XFT A;  5CGX A;  4LLO B;  1BZA A;  1T19 A;  4RQ9 A;  3MBZ A;  3GRJ A;  3S7N A;  3PAE A;  4ZAM A;  4X1L A;  3BFE A;  2OWH A;  3QP1 A;  3T4L A;  4S2I A;  4P87 A;  1K25 A;  2EX6 A;  3F1N A;  4WLA A;  4CLC C;  4HES A;  1T1B A;  4PM6 A;  3S7P A;  4CQH A;  1KE3 A;  5CHU A;  3MSH A;  3E98 A;  2E8I A;  3E4P A;  3W4Q A;  3MZD A;  2A24 A;  5DF9 A;  3VOL A;  3B3X A;  2WGW B;  4NXE A;  1GHP A;  3A0S A;  4WZ5 C;  1NJ4 A;  1K6R A;  3UN7 A;  3BRM A;  1ACF A;  3W2Z A;  1YSP A;  5DTK A;  1TS6 A;  4GHI B;  3MJQ A;  4QU3 A;  3EOI A;  5HWV A;  1CEG A;  3UE6 A;  1PRQ A;  1PFL A;  1PW8 A;  1XKZ A;  3NI9 A;  3ITA A;  4K91 A;  2M1C A;  1RP5 A;  3OCN A;  1P0Z A;  4R6L A;  5A90 A;  2QHK A;  4N9L A;  3C38 A;  3PBT A;  2V1Z A;  3OPR A;  3IQA A;  1T1C A;  1GHM A;  1PWG A;  4OPQ A;  1XXM A;  4DN0 A;  3MQQ A;  3UPP A;  3CG5 A;  2VLG A;  1S66 L;  2X71 A;  3N4I A;  2E8J A;  2H0Y A;  1FIK A;  1BYW A;  3F1O A;  1F2K A;  1L0F A;  5AVE A;  5J8X A;  3H7W A;  5E43 A;  2EX9 A;  1H8Z A;  4JXS A;  1ALQ A;  2XLN A;  4M4X A;  5L2F A;  1OJG A;  4DMZ A;  3UDF A;  5CEC A;  2FFY A;  1K54 C;  2PU2 A;  5KSH A;  3S22 A;  1K4F A;  3LO7 A;  1XPB A;  2XK1 A;  2Y4A A;  3EGX C;  4BEN A;  3I7J A;  3ZQ5 A;  2KX6 A;  4DE2 A;  4HJ3 A;  5EVI B;  3GDI A;  1TS0 A;  1XGI A;  2HJ9 C;  4S2K A;  4OLD A;  3PBR A;  1PNE A;  3G2Z A;  2W1T B;  4DJ2 A;  4E3M A;  2FFF B;  5CED A;  2JKT M;  4FUW A;  4C6Y A;  3MKE A;  4P6Z S;  2EXA A;  5F1G A;  1P97 A;  5EUA A;  4PM8 A;  2HDR A;  4KQR A;  5EEC A;  2WGW A;  2XGN A;  3ZG5 A;  2V0W A;  5EOO A;  4GOG A;  3WRT A;  3IBJ A;  3BY9 A;  3HLW A;  2Y2G A;  3PBQ A;  5D3O A;  4I39 A;  3SH9 A;  2ZJ9 A;  4EES A;  2PU4 A;  3NC8 A;  4WF0 A;  1Z6F A;  4F3L B;  3HUM A;  3HL9 A;  4GHI A;  4X25 A;  3LIC A;  2BAS A;  1KGF A;  3N8L A;  4E04 A;  2HGV A;  2WZZ A;  1HD8 A;  4CJN A;  4HP4 A;  2ZC4 B;  3M6H A;  5IT5 A;  4R23 A;  3C7U A;  3FZC A;  2ZBB A;  3BFF A;  3OCL A;  5AQ7 A;  1AXB A;  5F69 A;  2EX8 A;  1FCN A;  4B88 A;  4EBP A;  3RXW A;  5CEB A;  1WA9 A;  5K5B A;  1Y54 A;  3SZT A;  5F82 A;  3RH8 B;  1YQS A;  1XGJ A;  3WS2 A;  3NOT C;  5F5Y A;  4Y15 A;  3MXS A;  4DJ3 A;  3C7V A;  2Y2I A;  4B4Z A;  2Z6D A;  3ZYT A;  3NEC A;  3IX4 A;  1LSV A;  1ONG A;  3N8S A;  3KSG A;  4HEF A;  1M40 A;  4QHC A;  1SZV A;  3IWQ A;  5CHM A;  4NG2 A;  4EUV A;  1WYB A;  1E3U A;  4X69 A;  4EBL A;  4D2O A;  3M6B A;  1LL5 A;  4E3J A;  3H82 A;  3VFF A;  2QWS A;  3CJM A;  3T1S A;  2XA7 S;  1JTG A;  4LV0 A;  2K2N A;  3KYQ A;  3PBS A;  4LRX C;  1W7F A;  1L2S A;  4MBH A;  2BG1 A;  3EGD C;  3BLM A;  1ES4 A;  3UPN A;  2CMN A;  2ZD8 A;  3V39 A;  2V0U A;  4E6X A;  1GA0 A;  3AGD A;  3E0Y A;  1MWS A;  3V3R A;  4Y3I A;  5FQ9 A;  2WK0 A;  5EVI A;  2V2F F;  4GZB A;  3JPU A;  5G4Y A;  1W79 A;  4HH3 A;  2C6W B;  5FL3 A;  1GHI A;  5EFW A;  5GHZ A;  3BJN A;  1ERO A;  1EWZ A;  5EPH A;  5HDC A;  2W1T A;  4X55 A;  1G6A A;  5J3W A;  5HAI A;  2Y79 A;  1VEU B;  2K7S A;  5KIZ A;  1K56 A;  2V9A A;  2H28 A;  2HV1 A;  2JC7 A;  3NJA A;  2JN7 A;  4R1G A;  1VHM A;  3BFD A;  2V8C A;  3A0R A;  2H0T A;  4HHD A;  2LB9 A;  1D06 A;  5G4Z A;  3NDE A;  4ZBE A;  4MCW A;  4K0W A;  2CC1 A;  2W3E A;  3IXH A;  4EWF A;  4PM9 A;  4HH2 A;  1A0K A;  3ZG9 B;  1UWP X;  2JKT I;  4BL2 A;  3UB9 A;  3IHB A;  4F3L A;  4R4R A;  1F9I A;  3KSI A;  3MQO A;  3UPO A;  3SOI A;  1CJF A;  2RCX A;  3UB6 A;  3QP4 A;  1YPR A;  3C30 A;  2QJ5 A;  2WKI A;  1W5D A;  2OAQ 1;  1OTI A;  4KEN B;  1H3Q A;  1FIL A;  3IBR A;  4MBF A;  5HDD A;  2M7U A;  2XSS A;  1CF0 A;  1NXY A;  2W3D A;  2ZOH A;  4QWO A;  4DE1 A;  1N9L A;  4E3L A;  4EUZ A;  2NUT C;  5HSQ A;  1LT0 A;  1W63 M;  3AGF A;  1NRJ A;  1MWR A;  4MBK A;  4II7 A;  1BUL A;  3IXD A;  1BSG A;  3LEQ A;  3GMW A;  3VE3 A;  3A0V A;  2UV0 E;  5AQB A;  5FI2 A;  1OTD A;  3UMD A;  3QNB A;  1PI5 A;  2Y2K A;  4Y13 A;  1FOF A;  3DBA A;  2JBF A;  3OPP A;  1XFN A;  1BUE A;  5L8M A;  3P7N A;  2O9B A;  3GTC A;  1YLY A;  2A49 A;  2EXB A;  3UE1 A;  3PYP A;  3RFB A;  3VP1 A;  2J9O A;  4I5S A;  3L7H A;  4LCL A;  1DP6 A;  3GV9 A;  4JLF A;  1K57 A;  2WUQ A;  4PHT A;  1V9Z A;  3W8K A;  4CLC E;  1GSX A;  4DF6 A;  2W3H A;  4DXB A;  2XR0 A;  3MZE A;  1YLJ A;  4H6J B;  4IED A;  4C3Q A;  3C4O A;  4HJ4 A;  1VEU A;  1BT5 A;  3CMZ A;  3U2A A;  4KQO A;  1KE0 A;  1ESU A;  3D9Y A;  1SKO B;  3OZH A;  4R38 A;  4LV3 A;  1L0G A;  3VP4 A;  2Q9N A;  4HP9 A;  1DJA A;  5M18 A;  3DTM A;  1GCE A;  2V20 A;  3IH8 A;  3BFC A;  3T12 B;  1GSV A;  4B93 A;  3MZF A;  3LR3 A;  3LIE A;  5EV0 A;  3Q7Z A;  2OLU A;  4QB8 A;  3FC7 A;  4NKP A;  4HQA A;  4R3A A;  3ZFZ A;  3IXB A;  3NCK A;  5CRF A;  3IHA A;  4XT2 B;  1LI9 A;  1ZHH B;  4NXF A;  4IBX A;  1RGY A;  1DRM A;  3S4X A;  4BD1 A;  3CI6 A;  5J7E A;  2J80 A;  1U60 A;  1MBL A;  3BY8 A;  3ZNY A;  1KGE A;  3IX3 A;  2XRN A;  3WS0 A;  4OPY A;  1N4O A;  3S7Q A;  1KE4 A;  4ZJ3 A;  4MDZ A;  1S4S A;  4BD0 A;  2X02 A;  3QNC A;  3MXQ A;  2V8F A;  1F5M A;  1ZC2 A;  2OLV A;  5EOE A;  3TOI A;  1CI8 A;  2XD5 A;  3QHY A;  4KZ9 A;  5IHV A;  3S1Y A;  3ZGA B;  4HNB A;  4P6Z M;  4OQG A;  3UDI A;  3UO9 A;  4L9E A;  1MWU A;  4HOI A;  2WKP A;  3T4S A;  4EU0 A;  4CLC D;  2OSU A;  2ZC7 A;  1S6R A;  3FG8 A;  2QJ7 A;  3CUE A;  4GD6 A;  3G32 A;  1Q2Q A;  2VV6 A;  5CGS A;  3ZVT A;  1IEL A;  1NY0 A;  3KYZ A;  4ETZ A;  1I2W A;  4X56 A;  2GJ3 A;  2OAP 1;  4DXC A;  2RL3 A;  3G4P A;  3G30 A;  1YM1 A;  3LR0 A;  4UA7 A;  4FSF A;  3VOZ A;  2V1A A;  4H6J A;  4GDB A;  4WMC D;  4GN2 A;  2WYX A;  2Y2O A;  5CTN A;  3HCY A;  1F98 A;  4QY5 A;  2G7U A;  3BQ8 A;  3NY4 A;  1SKO A;  1FCO A;  1M6K A;  1O7E A;  4NXB A;  4Q8I A;  3VOY A;  1VET B;  4K08 A;  3OC2 A;  5F83 A;  5DKL A;  3DW0 A;  2B02 A;  2D01 A;  4Y5F A;  3PTE A;  4OOY A;  4PPR A;  2GDN A;  4EEU A;  3H9W A;  4U3T A;  5EVI D;  3GVB A;  4JF4 A;  2HP9 A;  1ZKJ A;  5EVI C;  4XUZ A;  3Q81 A;  2PYP A;  3T1Q B;  1YMS A;  1YMX A;  2PR5 A;  1G5U A;  4GLQ A;  2VA0 A;  2X01 A;  1IKI A;  2DRW A;  2XA7 M;  4LRY C;  4LV1 A;  4XT2 A;  5MC7 A;  5DF7 A;  2PR6 A;  3VV4 A;  1ODV A;  2QMI A;  3ISG A;  3KO6 A;  4O7D A;  4OLG A;  2Y2H A;  2WZX A;  5E2F A;  1CK3 A;  4DDY A;  4NK3 A;  1MWT A;  1CQA A;  4X1M A;  1MZU A;  4OON A;  4S2N A;  5HWW A;  4U0X A;  4DRT A;  4Y17 A;  4E3O A;  2Z6C A;  1YSQ A;  5AQ9 A;  5M19 A;  3UB7 A;  5FSR A;  1TD5 A;  3LR5 A;  2WAD A;  2J3T D;  5AJG A;  2VJW A;  4JGR A;  2J3T C;  1LSX A;  2L0W A;  4LEN A;  4YNR A;  3VSK A;  4C75 A;  4BBT A;  3F1P B;  3K3D A;  1XA7 A;  5BOH A;  3CPT B;  2YKH A;  3LUQ A;  3M2K A;  3ZG8 B;  3UB5 P;  3P98 A;  3SS5 A;  4A5R A;  3PBO A;  3OPH A;  3P09 A;  2XRO A;  2Y55 A;  3RJU A;  5L10 A;  3Q82 A;  5FDH A;  2G2U A;  3LR4 A;  2Y91 A;  3A3E A;  3E4Q A;  1VQQ A;  4R0Q A;  4BWI A;  1VET A;  4FD8 A;  3LFV A;  4OOM A;  3SW1 A;  3W4P A;  3HVF A;  4R70 A;  1OPX A;  5FAO A;  5KZH A;  4XUX A;  2Q9M A;  2P9V B;  3P01 A;  4ZJ1 A;  1MY8 A;  3LI9 A;  1IYP A;  1K57 C;  1TDL A;  3WS1 A;  4JGQ A;  3T4T A;  1JWP A;  5C5K A;  4Y0T A;  3IF5 A;  4PKY A;  5A91 A;  4Q0H A;  1NYM A;  4Y2F A;  1XJ4 A;  3KSF A;  1SHV A;  2HZ5 A;  3JVV A;  4EQI A;  3G35 A;  1IEM A;  4BQM A;  2P7J A;  3BM6 A;  5TJJ A;  2PBD P;  4ZRR A;  5HD3 A;  5G18 A;  3LY3 A;  3TG9 A;  5TBM B;  3G34 A;  4E6W A;  3ZVW A;  1YLW A;  3JVU A;  4UHU A;  5EVL A;  3KX0 X;  3MR0 A;  1Y28 A;  3HUO A;  2JCH A;  3D3O A;  4UAA A;  2AVX A;  5E2H A;  3PAG A;  3IWI A;  4JGP A;  3BEC A;  3QP2 A;  2WKR A;  2L4R A;  1I2S A;  4X6T A;  3NOU C;  1BLP A;  1UGU A;  3D4F A;  1W8Q A;  4OQ0 A;  4KG2 A;  2HDQ A;  3HLB A;  2PYR A;  3HLD A;  5FAS A;  2ZQD A;  5DFX A;  4WUJ A;  3B47 A;  4OKP A;  4E3I A;  5F68 A;  1S1Y A;  4PM7 A;  4Q0J A;  2EFX A;  3VP2 A;  3F1P A;  1XJ2 A;  3BYD A;  2ZM2 A;  2Z2L B;  4O0P A;  3MKF A;  1ERQ A;  3CPT A;  1ERM A;  3LIF A;  4Y7P A;  1HVB A;  4E3N A;  3VP3 A;  3FKV A;  1K4E A;  4FH4 A;  4YWZ A;  4IUH A;  2WKQ A;  4RX3 A;  3MXR A;  3Q1F A;  4YOF A;  3E2K A;  3A3F A;  2ZC6 B;  5FAP A;  2Y2L A;  4JXW A;  4FCF A;  1C3B A;  1FSW A;  3EQU A;  4Z9Q A;  4G3W A;  1J3W A;  4KZA A;  2KDK A;  3O87 A;  1SCW A;  4EBN A;  3CUE C;  3TW8 A;  3GR2 A;  3PR6 A;  3O3V A;  5F6A A;  4HJ6 A;  1PZO A;  2J9P A;  2P9V A;  3LI8 A;  1LSW A;  5A92 A;  4OQI A;  3WS5 A;  5GLD A;  1Z09 A;  5TR7 A;  4S2L A;  4NET A;  1XX2 A;  1YT4 A;  3IF6 B;  2ZQC A;  1EW0 A;  4EQ1 A;  1LL8 A;  1BLS A;  3R7W B;  2PHY A;  2G2W A;  4IVK A;  5GHY A;  3UY6 A;  4EEP A;  3GEC A;  2JKR I;  3DTI A;  3DAV A;  3CAX A;  2M7V A;  5TBM A;  4ETX A;  3WWX A;  4BBU A;  1DP8 A;  2B5R A;  4PKY G;  5AVF A;  3HJK A;  4OQH A;  1PZP A;  4GKU A;  1H8Y A;  1JWV A;  1BLH A;  2K31 A;  5FAQ A;  3MMH A;  4YIN A;  4DKI A;  3IXG A;  4HBT A;  2P08 A;  3FKW A;  3QP6 A;  2ZQ7 A;  4HBU A;  2YKF A;  4LGW A;  1IKG A;  1T1A A;  4OPZ A;  2VKS A;  1CI9 A;  4L9G A;  2ZQ8 A;  5EVE A;  2HP6 A;  4ZTK A;  5FQK A;  3FYZ A;  2P04 A;  4OP5 A;  4R4S A;  2NUP C;  1ES5 A;  3MFD A;  3T4J A;  3VMA A;  3EWK A;  2H5S A;  4S2N C;  1N9O A;  4UEY A;  4PM5 A;  1SDE A;  1PI4 A;  3N7W A;  2VZW A;  2XH9 A;  3O88 A;  2HDU A;  4JPM A;  3WS4 A;  5DJT A;  3VFH A;  2Y8H A;  1DP9 A;  3T4K A;  1LL9 A;  3BLS A;  1ZG4 A;  3ICY A;  2VGL S;  5TFQ A;  4S2O A;  5A93 A;  4EER A;  1J9M A;  5F1F A;  3NOP C;  4U0T A;  5HFO A;  2XFS A;  4ZJ2 A;  4G3V A;  1W8Y A;  3T50 A;  5IU1 A;  1FCM A;  1NRF A;  1YLT A;  4X53 A;  4JF5 A;  3IF6 A;  5EM1 A;  2WKE A;  2HDS A;  1S1Z A;  2W0N A;  2B18 A;  5GLA A;  1K0K A;  5CHJ A;  3R7W A;  2GZA A;  3FWL A;  4WL9 A;  4JBF A;  2I72 A;  4MLL A;  3HLG A;  3HLC A;  4P85 A;  1TVF A;  3BFG A;  5EE8 A;  4LRZ E;  1Y4O A;  3NDG A;  2MJ6 A;  3MF0 A;  2IWD A;  3Q7V B;  4RVA A;  4XXR A;  3R4K A;  3ZDJ A;  3NHQ A;  1OTB A;  2PDR A;  1NZO A;  4GS9 B;  4WN5 A;  1YLZ A;  1G68 A;  3RXX A;  3TSG A;  1EI5 A;  1IYQ A;  2PRF A;  4FH2 A;  5HPF A;  4N1H A;  3K2N A;  2INW A;  4ZDX A;  1FR1 A;  5A8B A;  3D72 A;  3O86 A;  4PMA A;  1DJC A;  4GW9 A;  4P6B A;  4S2J A;  1OTA A;  3HUN A;  2KLI A;  4KG6 A;  1G28 A;  4QD4 A;  2W1R A;  2JKG A;  5AQA A;  1HTZ A;  1X0O A;  1E3U D;  1E25 A;  4JXG A;  4MN7 A;  1DY6 A;  5HZH A;  4WEJ A;  3QP8 A;  4GCZ A;  2ZL1 B;  4EET B;  4KUK A;  3ZHH A;  3A3I A;  5E2E A;  4QJG A;  5FAT A;  4NXG A;  3W4O A;  5L07 A;  4WYY A;  4Y0O A; 
#chains in the Genus database with same CATH homology
 2G2U A;  2Y91 A;  1GA9 A;  1H5X A;  3A3E A;  1VQQ A;  4R0Q A;  2WAE A;  1ES3 A;  4EV4 A;  2WGI A;  3NDE A;  4FD8 A;  4WBG A;  4ZBE A;  4K0W A;  1WE4 A;  2JE5 A;  4OOM A;  2CC1 A;  4EWF A;  3IXH A;  2ZMA A;  4PM9 A;  2ZQA A;  3W4P A;  3C5A A;  3HVF A;  3ZG9 B;  2R9W A;  4BL2 A;  4N1X A;  5FAO A;  5KZH A;  2ZLY A;  4XUX A;  2Q9M A;  3IHB A;  2Y59 A;  1KDS A;  4KZ4 A;  2P9V B;  4ZJ1 A;  3VSL A;  4R4R A;  4BJP A;  3OPL A;  1MY8 A;  1IYP A;  1K57 C;  1TDL A;  5CGW A;  3V3S A;  3WS1 A;  3ZCZ A;  1TEM A;  4GB7 A;  3UPO A;  3SOI A;  2RCX A;  1JWP A;  5JYO A;  5FA7 A;  4Y0T A;  1OME A;  1E4D A;  3IF5 A;  1K56 D;  3C4P A;  5A91 A;  1PYY A;  3G31 A;  1JVJ A;  1JWZ A;  1NYM A;  1ONH A;  2WKI A;  3M2J A;  2PBY A;  4MEZ A;  1BLC A;  1K38 A;  1W5D A;  1BTL A;  3N8R A;  4B4X A;  3E2L A;  4IVI A;  4KEN B;  1SHV A;  2IWC A;  2ZC3 B;  2IWB A;  3SH7 A;  3EQV A;  2J8Y A;  4EQI A;  1K6S A;  3G35 A;  2BLS A;  1IEM A;  4BQM A;  3BM6 A;  1JTD A;  5M1A A;  4MBF A;  1NXY A;  4N92 A;  1QME A;  1PIO A;  1L0D A;  5G18 A;  4DE1 A;  3LY3 A;  5HAP A;  4QY6 A;  3TG9 A;  1KGG A;  2DNS A;  4E3L A;  2ZQ9 A;  5FQQ A;  4EUZ A;  3G34 A;  4E6W A;  3AGF A;  3HLE A;  1MWR A;  1YLW A;  4UHU A;  3ZVW A;  1MXO A;  5EVL A;  4MBK A;  5GL9 A;  5HAR A;  1TDG A;  4RA7 A;  3VP0 A;  1PW1 A;  3Q7V A;  2P74 A;  1IYO A;  3HUO A;  4LCM A;  1BUL A;  3IXD A;  1BSG A;  2JCH A;  5E2G A;  3GMW A;  4UAA A;  4KG5 A;  1K55 C;  4ID4 A;  5DVA A;  5E2H A;  3PAG A;  5AQB A;  5FI2 A;  3IWI A;  3WRZ A;  3BEC A;  4H8R A;  5FI6 A;  3BEB A;  3HLF A;  2ZM8 A;  3QNB A;  1PI5 A;  1VM1 A;  2XFT A;  4RX2 A;  1I2S A;  3NBL A;  2Y2K A;  5CGX A;  1BZA A;  4X6T A;  1BLP A;  1FOF A;  3MBZ A;  3GRJ A;  2JBF A;  3D4F A;  4R3B A;  1W8Q A;  3OPP A;  3PAE A;  4M3K A;  1BUE A;  4KG2 A;  4OQ0 A;  4ZAM A;  2HDQ A;  3HLB A;  3BFE A;  3GTC A;  3HLD A;  5FAS A;  4S2I A;  1YLY A;  2A49 A;  2EXB A;  2ZQD A;  4P87 A;  3UE1 A;  4KZ8 A;  4OKP A;  2HP5 A;  4E3I A;  3LEZ A;  2DCF A;  1K25 A;  3VP1 A;  2EX6 A;  2J9O A;  4KQQ A;  4PM7 A;  2EFX A;  4LCL A;  3VP2 A;  3BYD A;  4KZ6 A;  4HES A;  2ZM2 A;  2Z2L B;  3GV9 A;  4JLF A;  4PM6 A;  1K57 A;  3MKF A;  2WUQ A;  1ERQ A;  1ERM A;  4Y7P A;  1HVB A;  4E3N A;  2XDM A;  3IH9 A;  3W8K A;  3UE0 A;  1KE3 A;  3VP3 A;  4DF6 A;  3FKV A;  1K4E A;  1RGZ A;  2UWX A;  2XR0 A;  4FH4 A;  5CHU A;  4DXB A;  3MZE A;  1YLJ A;  4IBR A;  3IWO A;  4IED A;  1WYC A;  4S2P A;  4C3Q A;  2E8I A;  3UE3 A;  3W4Q A;  4F94 A;  3C4O A;  3MZD A;  4X68 A;  2WKH A;  4GDN A;  4RX3 A;  3MXR A;  1XP4 A;  1BT5 A;  3CMZ A;  4KQO A;  3Q1F A;  5DF9 A;  1KE0 A;  1NYY A;  3B3X A;  2WGW B;  1ESU A;  4DE3 A;  3CZD A;  2VGK A;  3OZH A;  3E2K A;  3A3F A;  4P0M A;  1GHP A;  2ZC6 B;  5FAP A;  2Y2L A;  4JXW A;  4FCF A;  1C3B A;  1FSW A;  3EQU A;  4LV3 A;  4WZ5 C;  4Z9Q A;  1NJ4 A;  1L0G A;  1K6R A;  3VP4 A;  4KZA A;  2Q9N A;  3UN7 A;  3BRM A;  4WM9 A;  3O87 A;  1DJA A;  1SCW A;  5M18 A;  4EBN A;  3DTM A;  2C5W B;  5DTK A;  1GCE A;  1O07 A;  3GR2 A;  2V20 A;  3IH8 A;  3O3V A;  3BFC A;  3Q07 A;  1PZO A;  2J9P A;  2P9V A;  3IT9 A;  3MZF A;  4QU3 A;  1CEG A;  1K55 A;  1PW8 A;  5A92 A;  4OQI A;  1XKZ A;  3Q7Z A;  3WS5 A;  2OLU A;  4QB8 A;  3NI9 A;  5DTS A;  1KVL A;  3ITA A;  4K91 A;  5GLD A;  5TR7 A;  1RP5 A;  2H10 A;  4S2L A;  4KZB A;  3ZFZ A;  3OCN A;  4NET A;  3IXB A;  1XX2 A;  1YT4 A;  1ES2 A;  3NCK A;  5A90 A;  5CRF A;  3IHA A;  2OV5 A;  2ZC5 B;  3IF6 B;  4N9L A;  2ZQC A;  2ZM0 A;  1LI9 A;  4MNR A;  1ZG6 A;  3PBT A;  3N6I A;  4IBX A;  1BLS A;  1RGY A;  3S4X A;  2V1Z A;  1LHY A;  3OPR A;  3IQA A;  4BD1 A;  3FV7 A;  3JYI A;  2G2W A;  4IVK A;  5GHY A;  1GHM A;  2Y2P A;  3UY6 A;  1U60 A;  4OOL A;  1PWC A;  4GNU A;  1MBL A;  3ZNY A;  1KGE A;  1XA1 A;  1PWG A;  4OPQ A;  3WS0 A;  2Y2J A;  4OPY A;  5U47 A;  2A3U A;  2XQZ A;  2EX2 A;  1XXM A;  4WYY A;  1N4O A;  1MPL A;  1KE4 A;  3UPP A;  3CG5 A;  4ZJ3 A;  5FQM A;  4BD0 A;  2X02 A;  5FQJ A;  3WWX A;  4OPR A;  2WAF A;  2X71 A;  3N4I A;  1S0W A;  3QNC A;  2H0Y A;  1ZC2 A;  2OLV A;  5EOE A;  3TOI A;  2B5R A;  1CI8 A;  3HRE A;  4BL3 A;  2XD5 A;  2HPB A;  3QHY A;  4KZ9 A;  1L0F A;  1SKF A;  4WMC A;  5IHV A;  3ZNT A;  5J8X A;  2QPN A;  3S1Y A;  4OQH A;  3ZGA B;  5E43 A;  1PZP A;  2EX9 A;  3G2Y A;  4GKU A;  1H8Z A;  1H8Y A;  4JXS A;  1ALQ A;  1JWV A;  2XLN A;  5L2F A;  4OQG A;  3UDI A;  3UO9 A;  1BLH A;  5FAQ A;  1MWU A;  5CEC A;  4N9K A;  3UDF A;  2FFY A;  1K54 C;  4WZ5 A;  3ZG0 A;  2PU2 A;  2Y2N A;  1FQG A;  4YIN A;  3S22 A;  5KSH A;  1K4F A;  2OSU A;  2ZC7 A;  1S6R A;  3LO7 A;  4DKI A;  3IF6 C;  1Q2P A;  3IXG A;  4HBT A;  1XPB A;  2XK1 A;  2Y4A A;  3FKW A;  3LY4 A;  3G32 A;  4GD6 A;  1Q2Q A;  4WEL A;  2ZQ7 A;  4HBU A;  1HZO A;  5CGS A;  4BEN A;  3ZVT A;  3I7J A;  1IKG A;  1IEL A;  4DE2 A;  1NY0 A;  4OPZ A;  1I2W A;  4X56 A;  5EVI B;  1CI9 A;  1XGI A;  4DXC A;  2RL3 A;  4S2K A;  3G4P A;  4JF6 A;  2ZQ8 A;  5CXW A;  3G30 A;  1YM1 A;  4OLD A;  4UA9 A;  2HP6 A;  3PBR A;  1RCJ A;  4ZTK A;  3G2Z A;  4UA7 A;  4FSF A;  5FQK A;  3VOZ A;  1KVM A;  3ITB A;  3FYZ A;  1PWD A;  4GDB A;  3V5M A;  3A3D A;  4WMC D;  4OP5 A;  4E3M A;  4R4S A;  1ES5 A;  2FFF B;  3MFD A;  5CED A;  4GN2 A;  2WYX A;  2Y2O A;  4C6Y A;  3MKE A;  1LLB A;  3VMA A;  5CTN A;  2EXA A;  5F1G A;  2H5S A;  4S2N C;  5EUA A;  4PM8 A;  4PM5 A;  1QMF A;  2HDR A;  4L0L A;  4KQR A;  1SDE A;  4QY5 A;  5EEC A;  5GHX A;  5HX9 A;  2WGW A;  3NIA A;  1PI4 A;  2XGN A;  3N7W A;  2EFU A;  3ZG5 A;  4R3J A;  2XH9 A;  4E3K A;  3O88 A;  3NY4 A;  5EOO A;  4GOG A;  2HDU A;  3WRT A;  1FCO A;  4JPM A;  1M6K A;  3WS4 A;  1O7E A;  3HLW A;  5CTM A;  4Q8I A;  3VOY A;  3VFH A;  2Y2G A;  3OC2 A;  3PBQ A;  3DWK A;  5F83 A;  1KDW A;  5D3O A;  1LL9 A;  3GQZ A;  3DW0 A;  4RYE A;  3SH9 A;  2ZJ9 A;  3BLS A;  2PU4 A;  3NC8 A;  1Z6F A;  3PTE A;  1NZU A;  3HL9 A;  3HUM A;  1ZG4 A;  4OOY A;  4PPR A;  2GDN A;  5FDH A;  5TFQ A;  4S2O A;  4U3T A;  1KGF A;  5A93 A;  5EVI D;  3GVB A;  4JF4 A;  1J9M A;  3N8L A;  4GD8 A;  5CER A;  2HP9 A;  5F1F A;  2WZZ A;  4U0T A;  1HD8 A;  1ZKJ A;  2XFS A;  5EVI C;  5HFO A;  4XUZ A;  4CJN A;  3Q81 A;  4ZJ2 A;  2ZC4 B;  3M6H A;  4R23 A;  3C7U A;  3FZC A;  1YMS A;  1YMX A;  3BFF A;  3OCL A;  5AQ7 A;  3SS4 A;  1W8Y A;  2XEP A;  1AXB A;  1FCM A;  1NRF A;  1YLT A;  4DE0 A;  2X01 A;  4KZ7 A;  1IKI A;  4X53 A;  1K54 A;  4Y0U A;  2J7V A;  2EX8 A;  1FCN A;  2DRW A;  4B88 A;  4EBP A;  1YLP A;  4JF5 A;  3RXW A;  3IF6 A;  5CEB A;  4S2M A;  2Y2Q A;  4LV1 A;  5HW3 A;  2WKE A;  1Y54 A;  2HDS A;  5GLC A;  3HBR A;  5GLA A;  5HL1 A;  5DF7 A;  5CHJ A;  3FWL A;  5F82 A;  5TGF A;  2QMI A;  1YQS A;  4JBF A;  2VGJ A;  1XGJ A;  3ISG A;  3WS2 A;  4JKT A;  5FI7 A;  5GLB A;  3SS3 A;  2I72 A;  4MLL A;  4O7D A;  3MXS A;  3GSG A;  3HLG A;  1I5Q A;  3HLC A;  5FQI A;  4OLG A;  2Y2H A;  3C7V A;  2Y2I A;  4P85 A;  2WZX A;  1TVF A;  4B4Z A;  2XD1 A;  3BFG A;  4OVD A;  1IYS A;  5EE8 A;  3LCE A;  3PBN A;  3NDG A;  3V50 A;  5E2F A;  1ONG A;  1CK3 A;  3N8S A;  4HEF A;  2XF3 A;  2IWD A;  4CPK A;  1M40 A;  4DDY A;  4NK3 A;  5DF8 A;  2R9X A;  4QHC A;  1MWT A;  3Q7V B;  3IWQ A;  4RVA A;  4XXR A;  3ZDJ A;  1L0E A;  1LI0 A;  5CHM A;  1WYB A;  1E3U A;  4OON A;  4X69 A;  4K0X A;  1NZO A;  4EBL A;  4S2N A;  4D2O A;  3M6B A;  5KSC A;  1YLZ A;  1G68 A;  1LL5 A;  3A3J A;  4U0X A;  3RXX A;  4DRT A;  4E3J A;  3TSG A;  1EI5 A;  1IYQ A;  4FH2 A;  3VFF A;  4E3O A;  3CJM A;  4N1H A;  1FSY A;  5AQ9 A;  1ESI A;  1JTG A;  5M19 A;  4LV0 A;  2Z2M B;  4BLM A;  5FSR A;  3PBS A;  5DTT A;  3UNW A;  3ZG7 B;  1W7F A;  1L2S A;  4ZDX A;  1FR1 A;  4MBH A;  2WAD A;  2BG1 A;  4YFM A;  3BLM A;  1ES4 A;  3UPN A;  4DDS A;  2ZD8 A;  4KZ3 A;  3V39 A;  4E6X A;  4UA6 A;  1GA0 A;  3AGD A;  1CEF A;  3O86 A;  4PMA A;  5JYP A;  4LEN A;  1MWS A;  3VSK A;  1N9B A;  1DJC A;  4C75 A;  3AGE A;  4P6B A;  4S2J A;  3V3R A;  3HUN A;  1DJB A;  5FQ9 A;  4KG6 A;  1XA7 A;  2WK0 A;  4QD4 A;  5EVI A;  2V2F F;  5BOH A;  4GZB A;  1W79 A;  2C6W B;  4OH0 A;  1GHI A;  5AQA A;  1HTZ A;  2Y2M A;  5GHZ A;  3UDX A;  1E3U D;  1ERO A;  2QZ6 A;  5KMW A;  1E25 A;  1EWZ A;  5EPH A;  4JXG A;  1DY6 A;  4X55 A;  1G6A A;  5HAI A;  3M2K A;  4JXV A;  3ZG8 B;  5HAQ A;  4OP8 A;  2WGV A;  4WEJ A;  1SDN A;  3P98 A;  5I94 A;  4WEK A;  3DWZ A;  3ZHH A;  3A3I A;  3SS5 A;  3SH8 A;  1K56 A;  3PBO A;  5E2E A;  4A5R A;  1MKI A;  4QJG A;  3OPH A;  3P09 A;  2JC7 A;  5FAT A;  1FR6 A;  3W4O A;  4R1G A;  2Y55 A;  3RJU A;  4LV2 A;  4WZ4 A;  3BFD A;  4KZ5 A;  2H0T A;  3Q82 A;  4Y0O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...