5CTNA

Structure of bpu1 beta-lactamase
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
233
structure length
233
Chain Sequence
SIAWSVDEFFKNREGTFVIQEVKEKSPWVYNKKRAKERFAPQSTFKVANALIGLQTGAVRDEYDIKYWDGVKREIDNWNRDHTLGSGMRDSVVWYYQAMARDIGEERMNHWVKAIHYGNKDISGGIDQFWLSSTLRISPIEQVRFLKQLYEETLPFDLKNMRTVKRMMVQEEEKHATLYGKTGSGSDIGWYVGFIKHEHKTYILATNIKGTGIEAKDITYRILKKYHLMEASV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Beta-lactamase
publication title Class D beta-lactamases do exist in Gram-positive bacteria.
pubmed doi rcsb
source organism Bacillus pumilus
total genus 89
structure length 233
sequence length 233
chains with identical sequence B
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2015-07-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 5ctnA00
3B3XA 3V39A 2Y2GA 2Y4AA 1GHPA 4C3QA 5KMWA 3Q81A 3QHYA 3I7JA 3ZNTA 1KE4A 2R9WA 3UPOA 1K25A 1N4OA 4WZ4A 4HBTA 4YFMA 4E3JA 1IKGA 4OOYA 3UDFA 3DWKA 1MWUA 4Y0OA 5CHJA 3PAEA 2Q9MA 2ZM2A 2H0YA 1I2WA 5FAPA 1U60A 4OOLA 5HAPA 4GD8A 3VOYA 2XQZA 2FFYA 2WGWB 1NZUA 3QNCA 2GDNA 3O86A 1Z6FA 3S4XA 1LI0A 4WEKA 2QZ6A 5EVLA 3C7VA 4KZ6A 4U3TA 5CGSA 2Y55A 3TSGA 5I94A 1PIOA 5EECA 4JF4A 1LL9A 2Y2LA 5F1GA 1K54A 4X53A 5FQ9A 5FI7A 3GRJA 1OMEA 3RXWA 4LENA 4PM6A 1WYBA 3MXSA 4N9KA 5FQJA 1L0GA 2FFFB 4KQQA 3OCLA 4LV1A 1I5QA 3PAGA 3VMAA 4EWFA 5FQQA 1BT5A 1K54C 4FH4A 4E3MA 1C3BA 3ZDJA 1KDSA 4EUZA 3AGFA 1VM1A 3IHBA 2OV5A 1GA0A 3N7WA 3O88A 4HESA 1ES3A 1Q2QA 4R0QA 3HUNA 1AXBA 4M3KA 4BLMA 1KGEA 4DDSA 2J8YA 3A3JA 5F1FA 4K0WA 3CMZA 2EFXA 5HAIA 3NY4A 1JTGA 5HARA 4OQHA 1NRFA 3MXRA 1PI4A 4QHCA 4WBGA 4DE3A 3SH7A 1GA9A 1MWSA 4Z9QA 2X02A 4R3JA 2ZQAA 3HL9A 1SDNA 4WZ5A 1L0DA 2HDQA 3IF6A 3UDXA 4QJGA 4OPQA 3OPLA 1NY0A 5HX9A 1ERMA 3Q7VB 2Y2KA 2ZC4B 5EOEA 1IYPA 5FI6A 1L0EA 2A49A 2ZC3B 3IXHA 5BOHA 5GHZA 2J7VA 4N92A 1NJ4A 4ZDXA 1ALQA 3GMWA 3GTCA 3UPNA 4GNUA 5GL9A 1YLTA 4OONA 1XGIA 1HVBA 5FI2A 4E3KA 5DF8A 3CZDA 2I72A 1K56A 2Y2PA 3NBLA 3NDGA 4RX3A 2DCFA 5A92A 3FKVA 3VSLA 2HDRA 2XH9A 3M6BA 2CC1A 3BLMA 4C6YA 5CECA 1H5XA 4KENB 1KGGA 3Q1FA 4DF6A 4OP8A 1BLPA 1YT4A 2H10A 3MZFA 5CRFA 5KSHA 2E8IA 2WUQA 2G2UA 4PM7A 3GR2A 1YLWA 2HP6A 5AQ9A 1PWCA 4B4ZA 1NXYA 3IXGA 3N8RA 5E2EA 1FOFA 1WYCA 3BYDA 4IBXA 4OPZA 1XA1A 1RCJA 4R1GA 3VP3A 1M6KA 1YLYA 5A91A 3FZCA 4KZ8A 4DE2A 2P9VA 1QMFA 3PTEA 2Y2JA 4X6TA 4K0XA 3BM6A 2PU2A 3C5AA 2EX8A 5EUAA 4UA6A 3NCKA 4S2NA 3UDIA 2ZQDA 4R4SA 5FA7A 3GVBA 4YINA 5EVIB 3HLBA 1K55A 1G68A 3G30A 4KZ4A 4ZJ2A 4MBKA 3VFFA 5GHYA 4JF5A 3ZNYA 3LY4A 5E2FA 3IH8A 5CEDA 4WM9A 2WAFA 1H8YA 2WGIA 4ZAMA 2P74A 4IVIA 5EOOA 1BTLA 3MKFA 2BLSA 2ZC5B 4S2MA 4R4RA 1PZPA 3IWOA 4E3NA 3IWQA 1FQGA 1HTZA 1XX2A 3IXBA 1NYMA 3OPRA 3PBQA 5EVID 1TVFA 4QB8A 4XXRA 3A3IA 1GHMA 2EX2A 3Q7ZA 2C5WB 1W79A 3P09A 1S6RA 1JVJA 5FQIA 1QMEA 4OH0A 4GD6A 2ZLYA 4KZ5A 1L2SA 1FSWA 3GSGA 3CG5A 4WEJA 3WS5A 1N9BA 3G32A 1RP5A 1CEGA 3HUOA 2DRWA 3N8LA 1BULA 3HLCA 3IWIA 2Z2LB 5DF9A 4E3LA 5G18A 1DJCA 3G35A 2XD1A 5E2HA 1PI5A 1IKIA 1E3UD 1K6SA 3BEBA 4BD1A 4DXBA 3MFDA 3WS4A 4KZAA 4JPMA 4UA9A 2HP9A 2BG1A 4OPRA 1XXMA 4OPYA 3W8KA 3BECA 1PW1A 1FR6A 1K38A 3ITBA 3SS5A 4FCFA 4MBHA 4PM5A 2Y2IA 1HD8A 1FSYA 1M40A 2RCXA 3BFGA 1DY6A 3OZHA 3PBOA 4GZBA 4ID4A 4MBFA 5E43A 1EROA 4LV0A 4WMCD 1MBLA 5U47A 3EQVA 2HPBA 4P85A 4DDYA 5CERA 4KZ9A 1TEMA 5L2FA 2B5RA 3MKEA 4NK3A 2WZZA 4KZ7A 4BL3A 4DXCA 4QY5A 1W8YA 5FQKA 3O87A 1Q2PA 2XFTA 4IEDA 1FCMA 3N8SA 3D4FA 5CTMA 5M19A 4QY6A 2EXAA 4LCLA 4S2IA 1BUEA 3V50A 2EFUA 2ZJ9A 1LI9A 3SS4A 3HREA 1SDEA 2OSUA 2V1ZA 5HW3A 1CK3A 3BLSA 1K4EA 4P0MA 3W4PA 4R23A 2WKHA 3GQZA 1YLJA 3UE1A 5CHMA 4Y7PA 1WE4A 2R9XA 3NDEA 2JBFA 1ESUA 3ZVTA 1FCNA 4RX2A 3M6HA 3NC8A 1KDWA 1LL5A 4WZ5C 1E4DA 3IF6C 4GN2A 1S0WA 3A3DA 4O7DA 4DKIA 1ES4A 5DTKA 4B88A 5FDHA 1XPBA 3DW0A 2H0TA 4ZJ3A 1MKIA 3UY6A 4JLFA 3G4PA 4XUXA 5FAQA 1XGJA 3LO7A 2Y2OA 3LEZA 4HBUA 3S1YA 1VQQA 2ZQCA 4NETA 1L0FA 5TFQA 5GLDA 2EX9A 1TDGA 1ZKJA 5A90A 2A3UA 2WGWA 3M2KA 3ZG5A 3UN7A 4OLDA 4CJNA 5AQ7A 4LCMA 1K57A 4D2OA 4FSFA 3C4OA 3WWXA 2HP5A 4ZTKA 1IYOA 3BFDA 3FKWA 5IHVA 5GLAA 3C7UA 3IXDA 1YMSA 4GDBA 3LCEA 4GOGA 4UA7A 1ZG6A 4MLLA 1FCOA 5HFOA 2X71A 1K57C 3EQUA 1W8QA 4JXWA 4GKUA 3BFEA 2J9PA 4RYEA 4H8RA 5CGXA 2IWCA 5FQMA 1PWGA 3GV9A 2Y2QA 4K91A 3HUMA 5TGFA 4PMAA 1KE0A 3PBTA 2WGVA 2Y2MA 5DVAA 3ZHHA 2WZXA 4CPKA 1SHVA 3A3EA 1ONHA 3AGDA 1HZOA 1IEMA 1ERQA 4BL2A 4IVKA 4S2KA 4S2NC 4OLGA 3FV7A 1CI8A 1K55C 5CGWA 3QNBA 4KZ3A 3V3RA 4OKPA 4F94A 4KQOA 3VSKA 4BENA 2WKIA 4JXGA 1LHYA 5F82A 3IT9A 2X01A 3VOZA 3MZDA 4X69A 2ZD8A 3JYIA 1IYSA 4LV2A 2JCHA 3G2ZA 4WYYA 5HAQA 3Q7VA 1GCEA 3SH8A 3VFHA 3C4PA 5GLBA 3TOIA 4E6WA 2ZQ7A 2WAEA 3S22A 4JF6A 3ITAA 4JXSA 1YLZA 1NZOA 2VGKA 2Z2MB 4X68A 5F83A 1SCWA 1BLCA 2EX6A 3ZG8B 1O7EA 4JBFA 3UNWA 1JTDA 2WYXA 5DF7A 2XFSA 3UE3A 1GHIA 3NIAA 4OQGA 1G6AA 4KG2A 4Y0TA 3TG9A 3OCNA 3CJMA 5J8XA 3BFFA 4N1XA 2WADA 5M1AA 3WRZA 4IBRA 4EQIA 1YQSA 4PM9A 5AQBA 1LLBA 3HVFA 3Q82A 3DWZA 1MPLA 3HLFA 5A93A 2JE5A 5FATA 4ZJ1A 1PW8A 3ZGAB 4S2LA 3E2LA 3G31A 1NYYA 4WELA 3M2JA 1J9MA 3VP1A 5KZHA 2JC7A 2ZQ9A 3N6IA 4QU3A 5CTNA 3HLEA 3WRTA 3W4QA 1ES5A 1EWZA 1ZC2A 4EBLA 1K56D 2J9OA 1SKFA 3ZFZA 3ZG0A 1BLSA 3SS3A 2XEPA 3G34A 2V2FF 3MZEA 3LY3A 4S2JA 1BZAA 2P9VB 2VGJA 1FR1A 5EVIA 3BFCA 4S2PA 1H8ZA 3ZG7B 3DTMA 3SOIA 2Y2NA 2HDUA 5JYPA 1IYQA 1K4FA 4DE1A 3PBSA 3ZVWA 3RJUA 3SH9A 2ZMAA 4U0XA 3VP2A 2UWXA 3O3VA 5EVIC 4JKTA 1CEFA 3OPPA 1MWRA 4GDNA 2G2WA 1XA7A 1EI5A 2QMIA 3AGEA 2QPNA 1ESIA 1IELA 4R3BA 1YLPA 3MBZA 1KVLA 2ZQ8A 3FYZA 4E3OA 1E3UA 1ZG4A 3V3SA 5FAOA 3HLGA 4X56A 3NI9A 4DE0A 4MNRA 4EV4A 5FASA 1XKZA 3UE0A 3WS0A 3PBRA 4GB7A 1YMXA 1PYYA 1BSGA 3BRMA 4N9LA 1W5DA 3UPPA 1O07A 4FD8A 3N4IA 4JXVA 1ONGA 3HLWA 2XK1A 4WMCA 2ZM0A 3IHAA 2IWDA 5DTTA 5M18A 1ES2A 4S2OA 5DTSA 4BD0A 1PZOA 4P87A 4PPRA 5KSCA 4UAAA 4EBNA 2XLNA 4P6BA 3Q07A 2XD5A 1W7FA 4OQ0A 4RVAA 4OVDA 2XF3A 5TR7A 3HBRA 3IF5A 4UHUA 4BJPA 4PM8A 4E3IA 1E25A 1K6RA 5GLCA 3FWLA 3RXXA 2Y59A 2ZC6B 4Y0UA 5AQAA 4HEFA 2PBYA 1KVMA 2HDSA 1KE3A 2C6WB 1JWZA 4U0TA 4EBPA 1PWDA 4DRTA 5JYOA 5FSRA 1I2SA 4ZBEA 5HL1A 2Y2HA 1DJBA 1MWTA 3WS1A 2Q9NA 2WK0A 3V5MA 3IQAA 1DJAA 4N1HA 3HLDA 4MEZA 4X55A 4XUZA 2EXBA 5D3OA 3VP4A 4B4XA 3E2KA 3UO9A 1MXOA 4Q8IA 4OP5A 3WS2A 1RGZA 2XDMA 2H5SA 2XR0A 5EE8A 1RGYA 3ZCZA 1JWPA 4L0LA 4RA7A 1TDLA 5GHXA 2IWBA 3OPHA 3PBNA 5CHUA 4FH2A 4KG6A 1CI9A 3IH9A 1YM1A 1BLHA 4KG5A 5E2GA 2DNSA 3W4OA 2ZC7A 4QD4A 3A3FA 4BQMA 3P98A 1Y54A 4C75A 5CEBA 2XGNA 2V20A 4OQIA 4KZBA 4E6XA 1MY8A 1KGFA 2OLVA 2ZM8A 3VP0A 3IF6B 5EPHA 2WKEA 2PU4A 4OOMA 4A5RA 1XP4A 1JWVA 3G2YA 5CXWA 4KQRA 2OLUA 2RL3A 4LV3A 3ZG9B 2Y91A 3ISGA 3OC2A
chains in the Genus database with same CATH superfamily
3B3XA 3V39A 2Y2GA 3Q81A 4OOYA 3UDFA 1MWUA 4Y0OA 5CHJA 4D60A 1U60A 5HAPA 2FFYA 1NZUA 2HV1A 1Z6FA 4DN0A 2W27A 4U3TA 1PIOA 2A24B 4JF4A 1OT9A 3LIAA 4LRXC 4IUHA 3VV4A 4X53A 5FI7A 3RXWA 3MXSA 1L0GA 2FFFB 5FQQA 1BT5A 3F1OB 3IHBA 1GA0A 3N7WA 1ES3A 1Q2QA 2R78A 5HWWA 2GZAA 1AXBA 3HUNA 4DDSA 1KGEA 5F1FA 3A3JA 2L0WA 2EFXA 3OOVA 4QHCA 4Z9QA 2ZQAA 3HL9A 1L0DA 4OPQA 2B95A 3W2ZA 1L0EA 2A49A 2ZC3B 3IXHA 4WLAA 1NLYA 2PYRA 1YKDA 4E3KA 4I38A 3NDGA 3CAXA 4HJ6A 2CC1A 3RTYA 4KENB 1KGGA 3Q1FA 2H10A 1F98A 2E8IA 1DP6A 1NXYA 3QP2A 3IXGA 3N8RA 3CUEC 4I3JA 1WYCA 1L3LA 3VP3A 1N9OA 3FZCA 4KZ8A 4DE2A 2P9VA 1NLZA 1XFNA 1ODVA 1H8MA 5EVIB 3HLBA 1OPXA 3G30A 4MBKA 3LY4A 3IH8A 2WAFA 1H8YA 1BTLA 3MKFA 2BLSA 4E3NA 3LR0A 4I3AA 3OPRA 3PBQA 5EVID 2LB9A 4XXRA 1QMEA 4OH0A 2PDRA 3BQAA 2ACGA 1SZVA 1N9BA 2V0WA 4F3LA 4AFIA 4NXBA 5G18A 3G35A 5E2HA 3WS4A 3ZHHA 3E4QA 4UA9A 1XXMA 5TBMA 1TS8A 2KOIA 3RFBA 4CLCC 1HD8A 2RCXA 3IBRA 4ID4A 5U47A 3E4OA 3RH8B 3EQVA 5CERA 3DTEA 4PKYA 3CPTB 4NK3A 3EEHA 1N9NA 1Q2PA 2JKRI 3O87A 3D4FA 5CTMA 4LCLA 3CWFA 3SS4A 3B42A 3TE8A 3UB6A 1SDEA 5HW3A 3W4PA 4R23A 3GQZA 3UMDA 5CHMA 4Y7PA 3NJAA 3KSHA 1FCNA 4WZ5C 1KDWA 4I39A 3IF6C 2V1AA 3A3DA 4GN2A 5DTKA 1XPBA 3DW0A 3UY6A 4R3AA 3JPUA 1XGJA 4HBUA 4EESA 2ZQCA 4BMWA 3A0SA 5A90A 4YOFA 5EM0A 2JKGA 4WN5A 1K57A 4FSFA 2HP5A 5IHVA 4MN6A 4FOFA 3LCEA 4UA7A 2X71A 1K57C 5CGXA 4RYEA 3GV9A 5TGFA 4HH2A 2VX8A 2WZXA 1HZOA 1ERQA 3LFVA 2INWA 4OLGA 1OJ5A 3NOTC 1K55C 4P6ZM 4F94A 1D1JA 2X01A 5HAQA 1IYSA 3QP6A 3Q7VA 3VFHA 5GLBA 3ITAA 4EEUA 1YLZA 3VE3A 4X68A 1YSPA 1BLCA 1O7EA 1JTDA 4XT2B 4UQIS 3GDIA 5J8XA 4QWOA 2O9BA 3H7WA 1CJFA 1YQSA 5AVFA 3F1PB 1MPLA 2JE5A 4Y17A 3ZGAB 3E2LA 3G31A 4WELA 3M2JA 3VP1A 4QU3A 3N6IA 5AVEA 3W4QA 1ES5A 4EETB 3ZFZA 1OTAA 2XEPA 2V2FF 1G6OA 3TW8A 2P9VB 2VGJA 4NXFA 1TS7A 3SOIA 4DJ2A 5EV0A 4U0XA 4JKTA 3OPPA 3QP5A 4LPZA 2QMIA 1EI5A 3AGEA 1IELA 4R3BA 1GSVA 4NKPA 3F1NA 1IFQA 5FAOA 4EV4A 5FASA 1XKZA 1HLUP 1G5UA 4GB7A 3BRMA 1W63Q 2NUPC 3N4IA 3H82A 2FZ0A 2G7UA 4S2OA 4P87A 2J80A 3FG8A 4F3LB 4P6BA 3S7PA 1W7FA 4OVDA 2XF3A 5TR7A 3IF5A 3MSHA 5GLCA 2ZC6B 4HEFA 2ZL1A 1KE3A 3T4KA 5TBMB 3R4KA 1PWDA 4DRTA 1VEUA 5FSRA 5JYOA 2Y2HA 2WK0A 4MEZA 3TRCA 4Q0IA 1JWPA 3IX4A 5GHXA 1OJGA 4FH2A 1SKOA 4KG5A 2DNSA 3A3FA 3P98A 1Y54A 4C75A 3T4LA 5EM1A 4KZBA 2E8JA 1TD5A 4E6XA 5FEFA 1KGFA 1S1YA 3IF6B 5EPHA 1OTIA 1F9IA 1FIKA 5CXWA 4KQRA 3ISGA 5EFWA 2R9WA 3UPOA 4YFMA 4DMZA 2Q9MA 2H0YA 5FAPA 4GD8A 3VOYA 3LIDA 2GDNA 2BASA 3S4XA 4KZ6A 3IBJA 5CGSA 2VJWA 1LL9A 3IS2A 1K54A 2JKTI 4LENA 4N9KA 5FQJA 4EWFA 3PAGA 4WF0A 1K54C 3CI6A 3LR4A 4QPRA 1C3BA 3ZDJA 1VM1A 2OOLA 4BLMA 3LYXA 2J8YA 4K0WA 5HAIA 3NY4A 5HARA 5G4ZA 1N9LA 4DE3A 1MWSA 1ZTUA 2X02A 4R3JA 2FH5A 2XROA 2HF6A 1NY0A 5HX9A 1ERMA 3Q7VB 1A0KA 5EOEA 2O9CA 3GMWA 3GTCA 2W1RA 1YLTA 2P04A 1P9WA 4GW9A 5FI2A 2ZOIA 3FPWA 2DCFA 3VSLA 5CECA 1H3QA 3BLMA 4C6YA 2PRFA 4DF6A 3H7WB 3UB5P 3EEAA 1BLPA 1TS0A 3GR2A 5AQ9A 1PWCA 3R7WB 1S66L 1XA1A 1RCJA 4MN5A 3JVUA 1M6KA 4JGOA 1Z09A 3V67A 4HH3A 4X6TA 3BM6A 4R4SA 3VOLA 1G68A 4KZ4A 2VK3A 3ZNYA 3HJIA 4IVIA 3ZYTA 3S7OA 2ZC5B 4S2MA 3IWOA 3IWQA 1FQGA 3F1NB 1TVFA 2CMNA 3MR0A 1S6RA 1JVJA 1FILA 3BJNA 1XFQA 2KX6A 1FSWA 4WEJA 3WS5A 2EWVA 3G6OA 3G32A 1RP5A 1CEGA 2DRWA 4HOIA 2XD1A 4BD1A 4KZAA 4JPMA 2BG1A 1DP8A 1PW1A 1K38A 4YWZA 4EXOA 4O01A 3B33A 1M40A 4MBFA 1EROA 3CITA 4P85A 2ZL1B 4KZ9A 4JGRA 2WZZA 4KZ7A 1VEUB 4QY5A 5FQKA 4IEDA 2L1MA 4QY6A 5FL3A 4S2IA 1WA9A 3PYPA 2ZJ9A 1LI9A 1K4EA 4P0MA 4ETXA 4HJ3A 1T1CA 2WKHA 1SKOB 3UE1A 4M4XA 2PR6A 1WE4A 3ZVTA 1E4DA 4DKIA 1ES4A 3LUQA 5FDHA 4ZJ3A 1GSWA 2P08A 5LBRA 2V1BA 1ZKJA 3T4QA 2WGWA 3ZG5A 4CJNA 5F6AA 3WWXA 1IYOA 3O5YA 3T50A 3FKWA 2K2NA 4GDBA 4GOGA 1FCOA 5HFOA 3EQUA 3BY8A 3P01A 4GKUA 2QJ5A 1YAXA 3IS2B 3KO6A 2B18A 2Z6DA 2Q0OA 4GS9A 3MMHA 3QP8A 4R70A 3KYQA 3E0YA 2V0UA 3FV7A 5CGWA 4G3KA 3VSKA 4BENA 1LSWA 1LHYA 3MZDA 4H6JA 3G2ZA 1GCEA 5HDCA 2M7VA 4JF6A 3S22A 3MQ0A 5K5BA 4PHTA 1T1AA 5CX7A 2EX6A 3D9YA 3UNWA 2XFSA 3UE3A 1G6AA 4KG2A 1W63M 1J3WA 3BFFA 1Y4OA 1D7EA 1VETA 4PM9A 1LLBA 3LEQA 4Q0JA 4LFUA 2V8CA 3KSGA 1V9ZA 5KZHA 2XA7S 2JC7A 2ZQ9A 3HLEA 3HCYA 3U4LP 1EWZA 4EBLA 3DTKA 3T4JA 3LR5A 1BLSA 3SS3A 3G34A 2VV7A 5IS1A 4PAUA 3BFCA 4S2PA 1H8ZA 4DE1A 3SH9A 2ZMAA 4UQIM 3L7HA 3O3VA 3A0RA 1MWRA 4GDNA 2G2WA 1NWZA 3FYZA 4E3OA 2GNXA 4MMNA 1BYWA 4DE0A 3UE0A 5EVEA 4L9FA 4N9LA 1PYYA 1BSGA 3UPPA 3MQOA 2OWHA 3HLWA 4WMCA 5M18A 3H9WA 4HP4A 1PZOA 4HJ4A 5MC7A 4FUWA 2W0NA 3K3DA 4RVAA 4UHUA 2QYBA 2HGVA 3RXXA 3PR6A 4BBUA 1JWZA 4K08A 5HL1A 3T4TA 3V5MA 2PYPA 4N1HA 4X55A 5D3OA 3VP4A 4B4XA 4Q8IA 1OT6A 3E4PA 2B02A 2XDMA 2XR0A 5EE8A 2HZ5A 3ZCZA 1T1BA 4L0LA 5F69A 4GHIA 3PBNA 5CHUA 3PXPA 1YM1A 5J3WA 2VV8A 5CEBA 2XGNA 2V20A 4OQIA 2OLVA 5L07A 4OOMA 4Y5FA 2OLUA 5TJJA 1P97A 1VB6A 1S4RA 2Y4AA 4L9GA 3KX0X 3ZNTA 3I7JA 1KE4A 1K25A 1N4OA 4WZ4A 4HBTA 1IKGA 4RQ9A 2ZM2A 2HJ9C 1I2WA 2WGWB 3LIBA 4WEKA 4L9EA 3A0VA 5EVLA 5I5LA 3C7VA 2KDKA 2Y55A 3TSGA 2K31A 5I94A 5EECA 4FTXA 4GLQA 5AJGA 5FQ9A 1NRJA 3GRJA 4PM6A 2LB5A 4KQQA 3VMAA 4E3MA 5HD5A 1KDSA 4EUZA 2OV5A 4GS9B 4HESA 5F68A 4R0QA 2JHEA 4M3KA 1EW0A 1JTGA 3D72A 4OQHA 3MXRA 1PI4A 4WBGA 1GA9A 4Y15A 2WKPA 3P7NA 1SDNA 4H6JB 3OPLA 2Y2KA 1IYPA 5FI6A 5GHZA 2J7VA 1NJ4A 4ZDXA 4OONA 5DF8A 1XJ4A 5J7EA 3FKVA 3S7NA 3M6BA 2K7SA 2I9VA 4O8GA 4WL9A 4OP8A 2WUQA 2G2UA 4PM7A 3LI9A 1YLWA 2HP6A 4B4ZA 2M7UA 1FOFA 5A91A 2Y2JA 4K0XA 4EUVA 3C5AA 4DJ3A 4CQHA 3NCKA 4S2NA 3UDIA 5FA7A 3GVBA 3ULFA 4EW7A 3VFFA 4WM9A 2WGIA 2P74A 1T18A 2VA0A 1LL8A 5EOOA 2PAVP 1MC0A 4R4RA 1PZPA 3MJQA 3IXBA 1G28A 4QB8A 3C30A 3C38A 4X1MA 5IT5A 1D06A 3Q7ZA 1S4SA 2H28A 3T12B 2ZLYA 4KZ5A 1L2SA 4JGQA 3GSGA 2J3WA 3HUOA 3N8LA 2Z2LB 1DJCA 1PI5A 2P7JA 3BEBA 3ZQ5A 4UEYA 2HP9A 3IX8A 4OPRA 4OPYA 3MS6A 5HDSA 1OTDA 3SS5A 2HJEA 3DTIA 4FCFA 4MBHA 5HWTA 1ACFA 3EWKA 1FSYA 3BFGA 1DY6A 3OZHA 3PBOA 4GZBA 5E43A 4LV0A 4WMCD 1MBLA 2HPBA 1TEMA 5L2FA 2B5RA 3QP4A 3KSIA 4BL3A 4DXCA 1W8YA 4E04A 1FCMA 5DJTA 5F5YA 5M19A 4HNBA 2EXAA 2VEAA 3BWLA 5DKKA 1PFLA 1BUEA 3V50A 2BTFP 2EFUA 1LT0A 3C2WA 2OSUA 2V1ZA 3OBFA 5HL6A 2JKFA 1CK3A 3BLSA 4GHIB 2YKFA 5A8BA 3T1XA 1YLJA 2ZOHA 2J3TC 1TF1A 2JBFA 1ESUA 3SZTA 4RX2A 1S0WA 4O7DA 3U2AA 4NEED 1MKIA 4JLFA 5L8MA 3G4PA 5FAQA 4KQDA 2Y2OA 3S1YA 4ME4A 2EX9A 2A3UA 3UN7A 4HP9A 4LCMA 1YSQA 3C4OA 3FC7A 3C7UA 3NOPC 2Z6CA 4KUOA 1ZG6A 4MCWA 4HQAA 3BFEA 2J9PA 5FQMA 1PWGA 2Y2QA 4K91A 3T1QB 5HPIA 2WGVA 2Y2MA 2W3DA 4CPKA 1V9YA 2XSSA 3A3EA 2Y79A 3EGXC 1IEMA 4BL2A 5DFYA 1CI8A 4IHQA 3QNBA 3V3RA 4KQOA 2WKIA 3TJZC 5F82A 1UGUA 3VOZA 1XJ3A 3T4SA 4X69A 2ZD8A 4LV2A 2JCHA 3D3OA 3C4PA 4ESPA 4HY8A 2WAEA 1NZOA 2VLGA 2Z2MB 5F83A 1SCWA 3H82B 4JBFA 2VGLM 2QJ7A 5DF7A 4ARZA 2O9AA 3NIAA 4OQGA 4Y0TA 1IOUA 3NOUC 4N1XA 5HSQA 3LIEA 5M1AA 3WRZA 3BW6A 1CF0A 5AQBA 4II7A 4ZJ1A 2WKQA 4B9OA 4S2LA 1CQAA 4YNRA 1J9MA 2ZBBA 4LRZE 5CTNA 3LR3A 1VHMA 1F2KA 4MDZA 1ZC2A 3B47A 1LSXA 3ZG0A 1PNEA 3MZEA 3SW1A 3ZG7B 3DTMA 2Y2NA 2HDUA 3KYZA 3RJUA 3VP2A 2UWXA 2UV0E 2QPNA 1ESIA 1YLPA 3MBZA 2ZQ8A 1E3UA 1ZG4A 3V3SA 3HLGA 1STZA 2OAQ1 5L10A 4Y3IA 3WS0A 4Y2FA 2W3FA 3VE4A 2XA7M 1O07A 3L9KA 2W3GA 1ONGA 1MZUA 2ZM0A 4LLOB 3IHAA 2IWDA 5DTTA 4XT2A 4BD0A 5KSCA 4UAAA 2XLNA 3Q07A 4OQ0A 3LI8A 4LGWA 3EGDC 4BJPA 3F1PA 4PM8A 3GECA 2Y59A 3LICA 4Y0UA 5AQAA 2VGLS 1T19A 3CUEA 2O0YA 4ZBEA 3C8CA 4R38A 3WS1A 2Q9NA 5HPFA 3HLDA 1Y28A 3UO9A 2L4RA 2PR5A 4OP5A 3WS2A 1RGZA 2H5SA 3LIFA 4CLCE 1TDLA 2IWBA 4KG6A 1CI9A 2W3HA 5C5KA 2VV6A 1GSXA 1BLHA 5E2GA 2D01A 3W4OA 2O99A 3BQ8A 2PD8A 2ZM8A 3VP0A 2OAP1 2PU4A 4A5RA 5HWVA 1XP4A 1JWVA 3G2YA 5DJUA 1DP9A 2W1TA 3K3CA 2W3EA 3KYEA 1GHPA 4C3QA 5KMWA 2J3TD 3QHYA 4E3JA 4EERA 2V8FA 3DWKA 3PAEA 1YPRA 1S67L 3OLOA 4OOLA 4GCZA 2XQZA 3QNCA 4NXEA 3BY9A 3T1SA 1XJ2A 3K2NA 3O86A 4CLCA 2M1CA 1LI0A 1K0KA 2QZ6A 3MQQA 1KOUA 2Y2LA 5F1GA 4JGPA 2XRNA 1OMEA 3JVVA 1WYBA 4ETZA 3OCLA 4LV1A 1I5QA 3NHQA 4FH4A 5L09A 2A2LA 3UB9A 3AGFA 3PHYA 1OTEA 3O88A 4IJGA 4EQ1A 3CMZA 1NRFA 4G3VA 3SH7A 4NXGA 4WZ5A 2HDQA 3IF6A 3UDXA 4QJGA 2ZC4B 2GX5A 5BOHA 5HZHA 4N92A 1ALQA 3UPNA 4GNUA 5GL9A 1XGIA 4I5SA 1HVBA 3CZDA 1MKMA 2I72A 2JN7A 2WKRA 1K56A 2Y2PA 4ARZB 3NBLA 4RX3A 5J4EA 5A92A 2HDRA 2XH9A 1H5XA 4EEPA 3UB8A 5HD3A 1YT4A 3MZFA 5CRFA 5KSHA 3NECA 4R6LA 2ZMFA 5E2EA 4IBXA 3BYDA 4OPZA 4R1GA 1YLYA 4HHDA 1QMFA 3PTEA 2PU2A 3UB7A 2PT7A 2EX8A 5EUAA 4UA6A 1X0OA 4HIAA 2ZQDA 4X25A 4YINA 1K55A 4ZJ2A 5GHYA 4JF5A 5E2FA 3LGOA 5CEDA 1UWNX 1PRQA 4ZAMA 3T4OA 3ICYA 1HTZA 1XX2A 1NYMA 2ZMVA 3UE6A 3DBAA 3A3IA 1GHMA 1S1ZA 2EX2A 2VZWA 2C5WB 4BWIA 1W79A 3P09A 5FQIA 4GD6A 2JKTM 3CG5A 4BBTA 1BULA 3HLCA 3IWIA 3HJKA 3EOIA 5DF9A 4E3LA 4WUJA 2QKPA 1IKIA 1E3UD 1K6SA 4DXBA 3MFDA 3W8KA 3BECA 1FR6A 3ITBA 3MF0A 4PM5A 2IA2A 2Y2IA 1AWIA 4PKYG 2QWSA 2Y8HA 4DDYA 3E98A 3R7WA 1LSVA 3MKEA 2OWJA 4IUKA 2XFTA 3N8SA 1TS6A 3HREA 4GJ4A 1UWPX 2R9XA 5G4YA 3NDEA 3M6HA 3NC8A 1LL5A 2QHKA 4B88A 2H0TA 4XUXA 2NUTC 3LO7A 3LEZA 2W1TB 1VQQA 4NETA 1L0FA 5TFQA 5GLDA 4P6ZS 2EA9A 1TDGA 4HI4A 1VETB 3M2KA 4I3IA 4OLDA 5AQ7A 1H0MA 5DFXA 4D2OA 1JNUA 4ZTKA 3BFDA 5GLAA 3IXDA 2A24A 1YMSA 2YKHA 4MLLA 4CLCB 1W8QA 4JXWA 4Q0HA 1XJ6A 4KUKA 4MN7A 4H8RA 2IWCA 3HUMA 4PMAA 1KE0A 3PBTA 3F1OA 5DVAA 2MJ6A 1SHVA 1ONHA 3AGDA 4CLCD 4IVKA 4S2KA 4S2NC 4KZ3A 4OKPA 2KLIA 4JXGA 3IT9A 3JYIA 4WYYA 3SH8A 3T1RA 4E6WA 4NG2A 3TOIA 2ZQ7A 4JXSA 2VGKA 3ZG8B 2WYXA 1GHIA 3CHWP 3TG9A 4B93A 2V9AA 3OCNA 3CJMA 2PHYA 2WADA 4Y13A 4IBRA 4EQIA 3HVFA 3FPVA 3DWZA 3Q82A 5FEGA 3HLFA 4LRYC 5A93A 5FATA 1PW8A 4BBVA 1NYYA 1OTBA 3DAVA 3WRTA 2GJ3A 1K56D 2J9OA 1SKFA 3S7QA 3LY3A 4S2JA 1BZAA 4X1LA 1FR1A 4Z1WA 5EVIA 3MXQA 5FDSA 5JYPA 1IYQA 1K4FA 3PBSA 3ZVWA 3KSFA 5EVIC 4G3WA 1CEFA 4EU0A 1XA7A 1DRMA 5IU1A 1KVLA 4X56A 3NI9A 4MNRA 1P9RA 3PBRA 3IX3A 1YMXA 2PD7A 1W5DA 4FD8A 4JXVA 1F5MA 2VKSA 2XK1A 1ES2A 5DTSA 4PPRA 2PBDP 4EBNA 2XD5A 5DKLA 3HBRA 2D02A 5HDDA 4E3IA 1E25A 1K6RA 3FWLA 2PBYA 2AVXA 3CLOA 1KVMA 2HDSA 2C6WB 3NULA 3CPTA 4U0TA 4EBPA 1I2SA 2DMWA 1DJBA 1MWTA 3MFXA 2EWWA 3IQAA 1DJAA 4XUZA 2EXBA 3E2KA 1MXOA 1ZHHB 1RGYA 3UMEA 4RA7A 3OPHA 5KIZA 3IH9A 1P0ZA 2ZC7A 4QD4A 4BQMA 4O0PA 1MY8A 2WKEA 4ZRRA 2JKRM 3QP1A 2RL3A 4LV3A 3ZG9B 2Y91A 3OC2A
chains in the Genus database with same CATH topology
3B3XA 3V39A 2Y2GA 2Y4AA 1GHPA 4C3QA 5KMWA 3Q81A 3QHYA 3I7JA 3ZNTA 1KE4A 2R9WA 3UPOA 1K25A 1N4OA 4WZ4A 4HBTA 4YFMA 4E3JA 1IKGA 4OOYA 3UDFA 3DWKA 1MWUA 4Y0OA 5CHJA 3PAEA 2Q9MA 2ZM2A 2H0YA 1I2WA 5FAPA 1U60A 4OOLA 5HAPA 4GD8A 3VOYA 2XQZA 2FFYA 2WGWB 1NZUA 3QNCA 2GDNA 3O86A 1Z6FA 3S4XA 1LI0A 4WEKA 2QZ6A 5EVLA 3C7VA 4KZ6A 4U3TA 5CGSA 2Y55A 3TSGA 5I94A 1PIOA 5EECA 4JF4A 1LL9A 2Y2LA 5F1GA 1K54A 4X53A 5FQ9A 5FI7A 3GRJA 1OMEA 3RXWA 4LENA 4PM6A 1WYBA 3MXSA 4N9KA 5FQJA 1L0GA 2FFFB 4KQQA 3OCLA 4LV1A 1I5QA 3PAGA 3VMAA 4EWFA 5FQQA 1BT5A 1K54C 4FH4A 4E3MA 1C3BA 3ZDJA 1KDSA 4EUZA 3AGFA 1VM1A 3IHBA 2OV5A 1GA0A 3N7WA 3O88A 4HESA 1ES3A 1Q2QA 4R0QA 3HUNA 1AXBA 4M3KA 4BLMA 1KGEA 4DDSA 2J8YA 3A3JA 5F1FA 4K0WA 3CMZA 2EFXA 5HAIA 3NY4A 1JTGA 5HARA 4OQHA 1NRFA 3MXRA 1PI4A 4QHCA 4WBGA 4DE3A 3SH7A 1GA9A 1MWSA 4Z9QA 2X02A 4R3JA 2ZQAA 3HL9A 1SDNA 4WZ5A 1L0DA 2HDQA 3IF6A 3UDXA 4QJGA 4OPQA 3OPLA 1NY0A 5HX9A 1ERMA 3Q7VB 2Y2KA 2ZC4B 5EOEA 1IYPA 5FI6A 1L0EA 2A49A 2ZC3B 3IXHA 5BOHA 5GHZA 2J7VA 4N92A 1NJ4A 4ZDXA 1ALQA 3GMWA 3GTCA 3UPNA 4GNUA 5GL9A 1YLTA 4OONA 1XGIA 1HVBA 5FI2A 4E3KA 5DF8A 3CZDA 2I72A 1K56A 2Y2PA 3NBLA 3NDGA 4RX3A 2DCFA 5A92A 3FKVA 3VSLA 2HDRA 2XH9A 3M6BA 2CC1A 3BLMA 4C6YA 5CECA 1H5XA 4KENB 1KGGA 3Q1FA 4DF6A 4OP8A 1BLPA 1YT4A 2H10A 3MZFA 5CRFA 5KSHA 2E8IA 2WUQA 2G2UA 4PM7A 3GR2A 1YLWA 2HP6A 5AQ9A 1PWCA 4B4ZA 1NXYA 3IXGA 3N8RA 5E2EA 1FOFA 1WYCA 3BYDA 4IBXA 4OPZA 1XA1A 1RCJA 4R1GA 3VP3A 1M6KA 1YLYA 5A91A 3FZCA 4KZ8A 4DE2A 2P9VA 1QMFA 3PTEA 2Y2JA 4X6TA 4K0XA 3BM6A 2PU2A 3C5AA 2EX8A 5EUAA 4UA6A 3NCKA 4S2NA 3UDIA 2ZQDA 4R4SA 5FA7A 3GVBA 4YINA 5EVIB 3HLBA 1K55A 1G68A 3G30A 4KZ4A 4ZJ2A 4MBKA 3VFFA 5GHYA 4JF5A 3ZNYA 3LY4A 5E2FA 3IH8A 5CEDA 4WM9A 2WAFA 1H8YA 2WGIA 4ZAMA 2P74A 4IVIA 5EOOA 1BTLA 3MKFA 2BLSA 2ZC5B 4S2MA 4R4RA 1PZPA 3IWOA 4E3NA 3IWQA 1FQGA 1HTZA 1XX2A 3IXBA 1NYMA 3OPRA 3PBQA 5EVID 1TVFA 4QB8A 4XXRA 3A3IA 1GHMA 2EX2A 3Q7ZA 2C5WB 1W79A 3P09A 1S6RA 1JVJA 5FQIA 1QMEA 4OH0A 4GD6A 2ZLYA 4KZ5A 1L2SA 1FSWA 3GSGA 3CG5A 4WEJA 3WS5A 1N9BA 3G32A 1RP5A 1CEGA 3HUOA 2DRWA 3N8LA 1BULA 3HLCA 3IWIA 2Z2LB 5DF9A 4E3LA 5G18A 1DJCA 3G35A 2XD1A 5E2HA 1PI5A 1IKIA 1E3UD 1K6SA 3BEBA 4BD1A 4DXBA 3MFDA 3WS4A 4KZAA 4JPMA 4UA9A 2HP9A 2BG1A 4OPRA 1XXMA 4OPYA 3W8KA 3BECA 1PW1A 1FR6A 1K38A 3ITBA 3SS5A 4FCFA 4MBHA 4PM5A 2Y2IA 1HD8A 1FSYA 1M40A 2RCXA 3BFGA 1DY6A 3OZHA 3PBOA 4GZBA 4ID4A 4MBFA 5E43A 1EROA 4LV0A 4WMCD 1MBLA 5U47A 3EQVA 2HPBA 4P85A 4DDYA 5CERA 4KZ9A 1TEMA 5L2FA 2B5RA 3MKEA 4NK3A 2WZZA 4KZ7A 4BL3A 4DXCA 4QY5A 1W8YA 5FQKA 3O87A 1Q2PA 2XFTA 4IEDA 1FCMA 3N8SA 3D4FA 5CTMA 5M19A 4QY6A 2EXAA 4LCLA 4S2IA 1BUEA 3V50A 2EFUA 2ZJ9A 1LI9A 3SS4A 3HREA 1SDEA 2OSUA 2V1ZA 5HW3A 1CK3A 3BLSA 1K4EA 4P0MA 3W4PA 4R23A 2WKHA 3GQZA 1YLJA 3UE1A 5CHMA 4Y7PA 1WE4A 2R9XA 3NDEA 2JBFA 1ESUA 3ZVTA 1FCNA 4RX2A 3M6HA 3NC8A 1KDWA 1LL5A 4WZ5C 1E4DA 3IF6C 4GN2A 1S0WA 3A3DA 4O7DA 4DKIA 1ES4A 5DTKA 4B88A 5FDHA 1XPBA 3DW0A 2H0TA 4ZJ3A 1MKIA 3UY6A 4JLFA 3G4PA 4XUXA 5FAQA 1XGJA 3LO7A 2Y2OA 3LEZA 4HBUA 3S1YA 1VQQA 2ZQCA 4NETA 1L0FA 5TFQA 5GLDA 2EX9A 1TDGA 1ZKJA 5A90A 2A3UA 2WGWA 3M2KA 3ZG5A 3UN7A 4OLDA 4CJNA 5AQ7A 4LCMA 1K57A 4D2OA 4FSFA 3C4OA 3WWXA 2HP5A 4ZTKA 1IYOA 3BFDA 3FKWA 5IHVA 5GLAA 3C7UA 3IXDA 1YMSA 4GDBA 3LCEA 4GOGA 4UA7A 1ZG6A 4MLLA 1FCOA 5HFOA 2X71A 1K57C 3EQUA 1W8QA 4JXWA 4GKUA 3BFEA 2J9PA 4RYEA 4H8RA 5CGXA 2IWCA 5FQMA 1PWGA 3GV9A 2Y2QA 4K91A 3HUMA 5TGFA 4PMAA 1KE0A 3PBTA 2WGVA 2Y2MA 5DVAA 3ZHHA 2WZXA 4CPKA 1SHVA 3A3EA 1ONHA 3AGDA 1HZOA 1IEMA 1ERQA 4BL2A 4IVKA 4S2KA 4S2NC 4OLGA 3FV7A 1CI8A 1K55C 5CGWA 3QNBA 4KZ3A 3V3RA 4OKPA 4F94A 4KQOA 3VSKA 4BENA 2WKIA 4JXGA 1LHYA 5F82A 3IT9A 2X01A 3VOZA 3MZDA 4X69A 2ZD8A 3JYIA 1IYSA 4LV2A 2JCHA 3G2ZA 4WYYA 5HAQA 3Q7VA 1GCEA 3SH8A 3VFHA 3C4PA 5GLBA 3TOIA 4E6WA 2ZQ7A 2WAEA 3S22A 4JF6A 3ITAA 4JXSA 1YLZA 1NZOA 2VGKA 2Z2MB 4X68A 5F83A 1SCWA 1BLCA 2EX6A 3ZG8B 1O7EA 4JBFA 3UNWA 1JTDA 2WYXA 5DF7A 2XFSA 3UE3A 1GHIA 3NIAA 4OQGA 1G6AA 4KG2A 4Y0TA 3TG9A 3OCNA 3CJMA 5J8XA 3BFFA 4N1XA 2WADA 5M1AA 3WRZA 4IBRA 4EQIA 1YQSA 4PM9A 5AQBA 1LLBA 3HVFA 3Q82A 3DWZA 1MPLA 3HLFA 5A93A 2JE5A 5FATA 4ZJ1A 1PW8A 3ZGAB 4S2LA 3E2LA 3G31A 1NYYA 4WELA 3M2JA 1J9MA 3VP1A 5KZHA 2JC7A 2ZQ9A 3N6IA 4QU3A 5CTNA 3HLEA 3WRTA 3W4QA 1ES5A 1EWZA 1ZC2A 4EBLA 1K56D 2J9OA 1SKFA 3ZFZA 3ZG0A 1BLSA 3SS3A 2XEPA 3G34A 2V2FF 3MZEA 3LY3A 4S2JA 1BZAA 2P9VB 2VGJA 1FR1A 5EVIA 3BFCA 4S2PA 1H8ZA 3ZG7B 3DTMA 3SOIA 2Y2NA 2HDUA 5JYPA 1IYQA 1K4FA 4DE1A 3PBSA 3ZVWA 3RJUA 3SH9A 2ZMAA 4U0XA 3VP2A 2UWXA 3O3VA 5EVIC 4JKTA 1CEFA 3OPPA 1MWRA 4GDNA 2G2WA 1XA7A 1EI5A 2QMIA 3AGEA 2QPNA 1ESIA 1IELA 4R3BA 1YLPA 3MBZA 1KVLA 2ZQ8A 3FYZA 4E3OA 1E3UA 1ZG4A 3V3SA 5FAOA 3HLGA 4X56A 3NI9A 4DE0A 4MNRA 4EV4A 5FASA 1XKZA 3UE0A 3WS0A 3PBRA 4GB7A 1YMXA 1PYYA 1BSGA 3BRMA 4N9LA 1W5DA 3UPPA 1O07A 4FD8A 3N4IA 4JXVA 1ONGA 3HLWA 2XK1A 4WMCA 2ZM0A 3IHAA 2IWDA 5DTTA 5M18A 1ES2A 4S2OA 5DTSA 4BD0A 1PZOA 4P87A 4PPRA 5KSCA 4UAAA 4EBNA 2XLNA 4P6BA 3Q07A 2XD5A 1W7FA 4OQ0A 4RVAA 4OVDA 2XF3A 5TR7A 3HBRA 3IF5A 4UHUA 4BJPA 4PM8A 4E3IA 1E25A 1K6RA 5GLCA 3FWLA 3RXXA 2Y59A 2ZC6B 4Y0UA 5AQAA 4HEFA 2PBYA 1KVMA 2HDSA 1KE3A 2C6WB 1JWZA 4U0TA 4EBPA 1PWDA 4DRTA 5JYOA 5FSRA 1I2SA 4ZBEA 5HL1A 2Y2HA 1DJBA 1MWTA 3WS1A 2Q9NA 2WK0A 3V5MA 3IQAA 1DJAA 4N1HA 3HLDA 4MEZA 4X55A 4XUZA 2EXBA 5D3OA 3VP4A 4B4XA 3E2KA 3UO9A 1MXOA 4Q8IA 4OP5A 3WS2A 1RGZA 2XDMA 2H5SA 2XR0A 5EE8A 1RGYA 3ZCZA 1JWPA 4L0LA 4RA7A 1TDLA 5GHXA 2IWBA 3OPHA 3PBNA 5CHUA 4FH2A 4KG6A 1CI9A 3IH9A 1YM1A 1BLHA 4KG5A 5E2GA 2DNSA 3W4OA 2ZC7A 4QD4A 3A3FA 4BQMA 3P98A 1Y54A 4C75A 5CEBA 2XGNA 2V20A 4OQIA 4KZBA 4E6XA 1MY8A 1KGFA 2OLVA 2ZM8A 3VP0A 3IF6B 5EPHA 2WKEA 2PU4A 4OOMA 4A5RA 1XP4A 1JWVA 3G2YA 5CXWA 4KQRA 2OLUA 2RL3A 4LV3A 3ZG9B 2Y91A 3ISGA 3OC2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3B3X A;  3V39 A;  2Y2G A;  2Y4A A;  1GHP A;  4C3Q A;  5KMW A;  3Q81 A;  3QHY A;  3I7J A;  3ZNT A;  1KE4 A;  2R9W A;  3UPO A;  1K25 A;  1N4O A;  4WZ4 A;  4HBT A;  4YFM A;  4E3J A;  1IKG A;  4OOY A;  3UDF A;  3DWK A;  1MWU A;  4Y0O A;  5CHJ A;  3PAE A;  2Q9M A;  2ZM2 A;  2H0Y A;  1I2W A;  5FAP A;  1U60 A;  4OOL A;  5HAP A;  4GD8 A;  3VOY A;  2XQZ A;  2FFY A;  2WGW B;  1NZU A;  3QNC A;  2GDN A;  3O86 A;  1Z6F A;  3S4X A;  1LI0 A;  4WEK A;  2QZ6 A;  5EVL A;  3C7V A;  4KZ6 A;  4U3T A;  5CGS A;  2Y55 A;  3TSG A;  5I94 A;  1PIO A;  5EEC A;  4JF4 A;  1LL9 A;  2Y2L A;  5F1G A;  1K54 A;  4X53 A;  5FQ9 A;  5FI7 A;  3GRJ A;  1OME A;  3RXW A;  4LEN A;  4PM6 A;  1WYB A;  3MXS A;  4N9K A;  5FQJ A;  1L0G A;  2FFF B;  4KQQ A;  3OCL A;  4LV1 A;  1I5Q A;  3PAG A;  3VMA A;  4EWF A;  5FQQ A;  1BT5 A;  1K54 C;  4FH4 A;  4E3M A;  1C3B A;  3ZDJ A;  1KDS A;  4EUZ A;  3AGF A;  1VM1 A;  3IHB A;  2OV5 A;  1GA0 A;  3N7W A;  3O88 A;  4HES A;  1ES3 A;  1Q2Q A;  4R0Q A;  3HUN A;  1AXB A;  4M3K A;  4BLM A;  1KGE A;  4DDS A;  2J8Y A;  3A3J A;  5F1F A;  4K0W A;  3CMZ A;  2EFX A;  5HAI A;  3NY4 A;  1JTG A;  5HAR A;  4OQH A;  1NRF A;  3MXR A;  1PI4 A;  4QHC A;  4WBG A;  4DE3 A;  3SH7 A;  1GA9 A;  1MWS A;  4Z9Q A;  2X02 A;  4R3J A;  2ZQA A;  3HL9 A;  1SDN A;  4WZ5 A;  1L0D A;  2HDQ A;  3IF6 A;  3UDX A;  4QJG A;  4OPQ A;  3OPL A;  1NY0 A;  5HX9 A;  1ERM A;  3Q7V B;  2Y2K A;  2ZC4 B;  5EOE A;  1IYP A;  5FI6 A;  1L0E A;  2A49 A;  2ZC3 B;  3IXH A;  5BOH A;  5GHZ A;  2J7V A;  4N92 A;  1NJ4 A;  4ZDX A;  1ALQ A;  3GMW A;  3GTC A;  3UPN A;  4GNU A;  5GL9 A;  1YLT A;  4OON A;  1XGI A;  1HVB A;  5FI2 A;  4E3K A;  5DF8 A;  3CZD A;  2I72 A;  1K56 A;  2Y2P A;  3NBL A;  3NDG A;  4RX3 A;  2DCF A;  5A92 A;  3FKV A;  3VSL A;  2HDR A;  2XH9 A;  3M6B A;  2CC1 A;  3BLM A;  4C6Y A;  5CEC A;  1H5X A;  4KEN B;  1KGG A;  3Q1F A;  4DF6 A;  4OP8 A;  1BLP A;  1YT4 A;  2H10 A;  3MZF A;  5CRF A;  5KSH A;  2E8I A;  2WUQ A;  2G2U A;  4PM7 A;  3GR2 A;  1YLW A;  2HP6 A;  5AQ9 A;  1PWC A;  4B4Z A;  1NXY A;  3IXG A;  3N8R A;  5E2E A;  1FOF A;  1WYC A;  3BYD A;  4IBX A;  4OPZ A;  1XA1 A;  1RCJ A;  4R1G A;  3VP3 A;  1M6K A;  1YLY A;  5A91 A;  3FZC A;  4KZ8 A;  4DE2 A;  2P9V A;  1QMF A;  3PTE A;  2Y2J A;  4X6T A;  4K0X A;  3BM6 A;  2PU2 A;  3C5A A;  2EX8 A;  5EUA A;  4UA6 A;  3NCK A;  4S2N A;  3UDI A;  2ZQD A;  4R4S A;  5FA7 A;  3GVB A;  4YIN A;  5EVI B;  3HLB A;  1K55 A;  1G68 A;  3G30 A;  4KZ4 A;  4ZJ2 A;  4MBK A;  3VFF A;  5GHY A;  4JF5 A;  3ZNY A;  3LY4 A;  5E2F A;  3IH8 A;  5CED A;  4WM9 A;  2WAF A;  1H8Y A;  2WGI A;  4ZAM A;  2P74 A;  4IVI A;  5EOO A;  1BTL A;  3MKF A;  2BLS A;  2ZC5 B;  4S2M A;  4R4R A;  1PZP A;  3IWO A;  4E3N A;  3IWQ A;  1FQG A;  1HTZ A;  1XX2 A;  3IXB A;  1NYM A;  3OPR A;  3PBQ A;  5EVI D;  1TVF A;  4QB8 A;  4XXR A;  3A3I A;  1GHM A;  2EX2 A;  3Q7Z A;  2C5W B;  1W79 A;  3P09 A;  1S6R A;  1JVJ A;  5FQI A;  1QME A;  4OH0 A;  4GD6 A;  2ZLY A;  4KZ5 A;  1L2S A;  1FSW A;  3GSG A;  3CG5 A;  4WEJ A;  3WS5 A;  1N9B A;  3G32 A;  1RP5 A;  1CEG A;  3HUO A;  2DRW A;  3N8L A;  1BUL A;  3HLC A;  3IWI A;  2Z2L B;  5DF9 A;  4E3L A;  5G18 A;  1DJC A;  3G35 A;  2XD1 A;  5E2H A;  1PI5 A;  1IKI A;  1E3U D;  1K6S A;  3BEB A;  4BD1 A;  4DXB A;  3MFD A;  3WS4 A;  4KZA A;  4JPM A;  4UA9 A;  2HP9 A;  2BG1 A;  4OPR A;  1XXM A;  4OPY A;  3W8K A;  3BEC A;  1PW1 A;  1FR6 A;  1K38 A;  3ITB A;  3SS5 A;  4FCF A;  4MBH A;  4PM5 A;  2Y2I A;  1HD8 A;  1FSY A;  1M40 A;  2RCX A;  3BFG A;  1DY6 A;  3OZH A;  3PBO A;  4GZB A;  4ID4 A;  4MBF A;  5E43 A;  1ERO A;  4LV0 A;  4WMC D;  1MBL A;  5U47 A;  3EQV A;  2HPB A;  4P85 A;  4DDY A;  5CER A;  4KZ9 A;  1TEM A;  5L2F A;  2B5R A;  3MKE A;  4NK3 A;  2WZZ A;  4KZ7 A;  4BL3 A;  4DXC A;  4QY5 A;  1W8Y A;  5FQK A;  3O87 A;  1Q2P A;  2XFT A;  4IED A;  1FCM A;  3N8S A;  3D4F A;  5CTM A;  5M19 A;  4QY6 A;  2EXA A;  4LCL A;  4S2I A;  1BUE A;  3V50 A;  2EFU A;  2ZJ9 A;  1LI9 A;  3SS4 A;  3HRE A;  1SDE A;  2OSU A;  2V1Z A;  5HW3 A;  1CK3 A;  3BLS A;  1K4E A;  4P0M A;  3W4P A;  4R23 A;  2WKH A;  3GQZ A;  1YLJ A;  3UE1 A;  5CHM A;  4Y7P A;  1WE4 A;  2R9X A;  3NDE A;  2JBF A;  1ESU A;  3ZVT A;  1FCN A;  4RX2 A;  3M6H A;  3NC8 A;  1KDW A;  1LL5 A;  4WZ5 C;  1E4D A;  3IF6 C;  4GN2 A;  1S0W A;  3A3D A;  4O7D A;  4DKI A;  1ES4 A;  5DTK A;  4B88 A;  5FDH A;  1XPB A;  3DW0 A;  2H0T A;  4ZJ3 A;  1MKI A;  3UY6 A;  4JLF A;  3G4P A;  4XUX A;  5FAQ A;  1XGJ A;  3LO7 A;  2Y2O A;  3LEZ A;  4HBU A;  3S1Y A;  1VQQ A;  2ZQC A;  4NET A;  1L0F A;  5TFQ A;  5GLD A;  2EX9 A;  1TDG A;  1ZKJ A;  5A90 A;  2A3U A;  2WGW A;  3M2K A;  3ZG5 A;  3UN7 A;  4OLD A;  4CJN A;  5AQ7 A;  4LCM A;  1K57 A;  4D2O A;  4FSF A;  3C4O A;  3WWX A;  2HP5 A;  4ZTK A;  1IYO A;  3BFD A;  3FKW A;  5IHV A;  5GLA A;  3C7U A;  3IXD A;  1YMS A;  4GDB A;  3LCE A;  4GOG A;  4UA7 A;  1ZG6 A;  4MLL A;  1FCO A;  5HFO A;  2X71 A;  1K57 C;  3EQU A;  1W8Q A;  4JXW A;  4GKU A;  3BFE A;  2J9P A;  4RYE A;  4H8R A;  5CGX A;  2IWC A;  5FQM A;  1PWG A;  3GV9 A;  2Y2Q A;  4K91 A;  3HUM A;  5TGF A;  4PMA A;  1KE0 A;  3PBT A;  2WGV A;  2Y2M A;  5DVA A;  3ZHH A;  2WZX A;  4CPK A;  1SHV A;  3A3E A;  1ONH A;  3AGD A;  1HZO A;  1IEM A;  1ERQ A;  4BL2 A;  4IVK A;  4S2K A;  4S2N C;  4OLG A;  3FV7 A;  1CI8 A;  1K55 C;  5CGW A;  3QNB A;  4KZ3 A;  3V3R A;  4OKP A;  4F94 A;  4KQO A;  3VSK A;  4BEN A;  2WKI A;  4JXG A;  1LHY A;  5F82 A;  3IT9 A;  2X01 A;  3VOZ A;  3MZD A;  4X69 A;  2ZD8 A;  3JYI A;  1IYS A;  4LV2 A;  2JCH A;  3G2Z A;  4WYY A;  5HAQ A;  3Q7V A;  1GCE A;  3SH8 A;  3VFH A;  3C4P A;  5GLB A;  3TOI A;  4E6W A;  2ZQ7 A;  2WAE A;  3S22 A;  4JF6 A;  3ITA A;  4JXS A;  1YLZ A;  1NZO A;  2VGK A;  2Z2M B;  4X68 A;  5F83 A;  1SCW A;  1BLC A;  2EX6 A;  3ZG8 B;  1O7E A;  4JBF A;  3UNW A;  1JTD A;  2WYX A;  5DF7 A;  2XFS A;  3UE3 A;  1GHI A;  3NIA A;  4OQG A;  1G6A A;  4KG2 A;  4Y0T A;  3TG9 A;  3OCN A;  3CJM A;  5J8X A;  3BFF A;  4N1X A;  2WAD A;  5M1A A;  3WRZ A;  4IBR A;  4EQI A;  1YQS A;  4PM9 A;  5AQB A;  1LLB A;  3HVF A;  3Q82 A;  3DWZ A;  1MPL A;  3HLF A;  5A93 A;  2JE5 A;  5FAT A;  4ZJ1 A;  1PW8 A;  3ZGA B;  4S2L A;  3E2L A;  3G31 A;  1NYY A;  4WEL A;  3M2J A;  1J9M A;  3VP1 A;  5KZH A;  2JC7 A;  2ZQ9 A;  3N6I A;  4QU3 A;  5CTN A;  3HLE A;  3WRT A;  3W4Q A;  1ES5 A;  1EWZ A;  1ZC2 A;  4EBL A;  1K56 D;  2J9O A;  1SKF A;  3ZFZ A;  3ZG0 A;  1BLS A;  3SS3 A;  2XEP A;  3G34 A;  2V2F F;  3MZE A;  3LY3 A;  4S2J A;  1BZA A;  2P9V B;  2VGJ A;  1FR1 A;  5EVI A;  3BFC A;  4S2P A;  1H8Z A;  3ZG7 B;  3DTM A;  3SOI A;  2Y2N A;  2HDU A;  5JYP A;  1IYQ A;  1K4F A;  4DE1 A;  3PBS A;  3ZVW A;  3RJU A;  3SH9 A;  2ZMA A;  4U0X A;  3VP2 A;  2UWX A;  3O3V A;  5EVI C;  4JKT A;  1CEF A;  3OPP A;  1MWR A;  4GDN A;  2G2W A;  1XA7 A;  1EI5 A;  2QMI A;  3AGE A;  2QPN A;  1ESI A;  1IEL A;  4R3B A;  1YLP A;  3MBZ A;  1KVL A;  2ZQ8 A;  3FYZ A;  4E3O A;  1E3U A;  1ZG4 A;  3V3S A;  5FAO A;  3HLG A;  4X56 A;  3NI9 A;  4DE0 A;  4MNR A;  4EV4 A;  5FAS A;  1XKZ A;  3UE0 A;  3WS0 A;  3PBR A;  4GB7 A;  1YMX A;  1PYY A;  1BSG A;  3BRM A;  4N9L A;  1W5D A;  3UPP A;  1O07 A;  4FD8 A;  3N4I A;  4JXV A;  1ONG A;  3HLW A;  2XK1 A;  4WMC A;  2ZM0 A;  3IHA A;  2IWD A;  5DTT A;  5M18 A;  1ES2 A;  4S2O A;  5DTS A;  4BD0 A;  1PZO A;  4P87 A;  4PPR A;  5KSC A;  4UAA A;  4EBN A;  2XLN A;  4P6B A;  3Q07 A;  2XD5 A;  1W7F A;  4OQ0 A;  4RVA A;  4OVD A;  2XF3 A;  5TR7 A;  3HBR A;  3IF5 A;  4UHU A;  4BJP A;  4PM8 A;  4E3I A;  1E25 A;  1K6R A;  5GLC A;  3FWL A;  3RXX A;  2Y59 A;  2ZC6 B;  4Y0U A;  5AQA A;  4HEF A;  2PBY A;  1KVM A;  2HDS A;  1KE3 A;  2C6W B;  1JWZ A;  4U0T A;  4EBP A;  1PWD A;  4DRT A;  5JYO A;  5FSR A;  1I2S A;  4ZBE A;  5HL1 A;  2Y2H A;  1DJB A;  1MWT A;  3WS1 A;  2Q9N A;  2WK0 A;  3V5M A;  3IQA A;  1DJA A;  4N1H A;  3HLD A;  4MEZ A;  4X55 A;  4XUZ A;  2EXB A;  5D3O A;  3VP4 A;  4B4X A;  3E2K A;  3UO9 A;  1MXO A;  4Q8I A;  4OP5 A;  3WS2 A;  1RGZ A;  2XDM A;  2H5S A;  2XR0 A;  5EE8 A;  1RGY A;  3ZCZ A;  1JWP A;  4L0L A;  4RA7 A;  1TDL A;  5GHX A;  2IWB A;  3OPH A;  3PBN A;  5CHU A;  4FH2 A;  4KG6 A;  1CI9 A;  3IH9 A;  1YM1 A;  1BLH A;  4KG5 A;  5E2G A;  2DNS A;  3W4O A;  2ZC7 A;  4QD4 A;  3A3F A;  4BQM A;  3P98 A;  1Y54 A;  4C75 A;  5CEB A;  2XGN A;  2V20 A;  4OQI A;  4KZB A;  4E6X A;  1MY8 A;  1KGF A;  2OLV A;  2ZM8 A;  3VP0 A;  3IF6 B;  5EPH A;  2WKE A;  2PU4 A;  4OOM A;  4A5R A;  1XP4 A;  1JWV A;  3G2Y A;  5CXW A;  4KQR A;  2OLU A;  2RL3 A;  4LV3 A;  3ZG9 B;  2Y91 A;  3ISG A;  3OC2 A; 
#chains in the Genus database with same CATH topology
 3B3X A;  3V39 A;  2Y2G A;  3Q81 A;  4OOY A;  3UDF A;  1MWU A;  4Y0O A;  5CHJ A;  4D60 A;  1U60 A;  5HAP A;  2FFY A;  1NZU A;  2HV1 A;  1Z6F A;  4DN0 A;  2W27 A;  4U3T A;  1PIO A;  2A24 B;  4JF4 A;  1OT9 A;  3LIA A;  4LRX C;  4IUH A;  3VV4 A;  4X53 A;  5FI7 A;  3RXW A;  3MXS A;  1L0G A;  2FFF B;  5FQQ A;  1BT5 A;  3F1O B;  3IHB A;  1GA0 A;  3N7W A;  1ES3 A;  1Q2Q A;  2R78 A;  5HWW A;  2GZA A;  1AXB A;  3HUN A;  4DDS A;  1KGE A;  5F1F A;  3A3J A;  2L0W A;  2EFX A;  3OOV A;  4QHC A;  4Z9Q A;  2ZQA A;  3HL9 A;  1L0D A;  4OPQ A;  2B95 A;  3W2Z A;  1L0E A;  2A49 A;  2ZC3 B;  3IXH A;  4WLA A;  1NLY A;  2PYR A;  1YKD A;  4E3K A;  4I38 A;  3NDG A;  3CAX A;  4HJ6 A;  2CC1 A;  3RTY A;  4KEN B;  1KGG A;  3Q1F A;  2H10 A;  1F98 A;  2E8I A;  1DP6 A;  1NXY A;  3QP2 A;  3IXG A;  3N8R A;  3CUE C;  4I3J A;  1WYC A;  1L3L A;  3VP3 A;  1N9O A;  3FZC A;  4KZ8 A;  4DE2 A;  2P9V A;  1NLZ A;  1XFN A;  1ODV A;  1H8M A;  5EVI B;  3HLB A;  1OPX A;  3G30 A;  4MBK A;  3LY4 A;  3IH8 A;  2WAF A;  1H8Y A;  1BTL A;  3MKF A;  2BLS A;  4E3N A;  3LR0 A;  4I3A A;  3OPR A;  3PBQ A;  5EVI D;  2LB9 A;  4XXR A;  1QME A;  4OH0 A;  2PDR A;  3BQA A;  2ACG A;  1SZV A;  1N9B A;  2V0W A;  4F3L A;  4AFI A;  4NXB A;  5G18 A;  3G35 A;  5E2H A;  3WS4 A;  3ZHH A;  3E4Q A;  4UA9 A;  1XXM A;  5TBM A;  1TS8 A;  2KOI A;  3RFB A;  4CLC C;  1HD8 A;  2RCX A;  3IBR A;  4ID4 A;  5U47 A;  3E4O A;  3RH8 B;  3EQV A;  5CER A;  3DTE A;  4PKY A;  3CPT B;  4NK3 A;  3EEH A;  1N9N A;  1Q2P A;  2JKR I;  3O87 A;  3D4F A;  5CTM A;  4LCL A;  3CWF A;  3SS4 A;  3B42 A;  3TE8 A;  3UB6 A;  1SDE A;  5HW3 A;  3W4P A;  4R23 A;  3GQZ A;  3UMD A;  5CHM A;  4Y7P A;  3NJA A;  3KSH A;  1FCN A;  4WZ5 C;  1KDW A;  4I39 A;  3IF6 C;  2V1A A;  3A3D A;  4GN2 A;  5DTK A;  1XPB A;  3DW0 A;  3UY6 A;  4R3A A;  3JPU A;  1XGJ A;  4HBU A;  4EES A;  2ZQC A;  4BMW A;  3A0S A;  5A90 A;  4YOF A;  5EM0 A;  2JKG A;  4WN5 A;  1K57 A;  4FSF A;  2HP5 A;  5IHV A;  4MN6 A;  4FOF A;  3LCE A;  4UA7 A;  2X71 A;  1K57 C;  5CGX A;  4RYE A;  3GV9 A;  5TGF A;  4HH2 A;  2VX8 A;  2WZX A;  1HZO A;  1ERQ A;  3LFV A;  2INW A;  4OLG A;  1OJ5 A;  3NOT C;  1K55 C;  4P6Z M;  4F94 A;  1D1J A;  2X01 A;  5HAQ A;  1IYS A;  3QP6 A;  3Q7V A;  3VFH A;  5GLB A;  3ITA A;  4EEU A;  1YLZ A;  3VE3 A;  4X68 A;  1YSP A;  1BLC A;  1O7E A;  1JTD A;  4XT2 B;  4UQI S;  3GDI A;  5J8X A;  4QWO A;  2O9B A;  3H7W A;  1CJF A;  1YQS A;  5AVF A;  3F1P B;  1MPL A;  2JE5 A;  4Y17 A;  3ZGA B;  3E2L A;  3G31 A;  4WEL A;  3M2J A;  3VP1 A;  4QU3 A;  3N6I A;  5AVE A;  3W4Q A;  1ES5 A;  4EET B;  3ZFZ A;  1OTA A;  2XEP A;  2V2F F;  1G6O A;  3TW8 A;  2P9V B;  2VGJ A;  4NXF A;  1TS7 A;  3SOI A;  4DJ2 A;  5EV0 A;  4U0X A;  4JKT A;  3OPP A;  3QP5 A;  4LPZ A;  2QMI A;  1EI5 A;  3AGE A;  1IEL A;  4R3B A;  1GSV A;  4NKP A;  3F1N A;  1IFQ A;  5FAO A;  4EV4 A;  5FAS A;  1XKZ A;  1HLU P;  1G5U A;  4GB7 A;  3BRM A;  1W63 Q;  2NUP C;  3N4I A;  3H82 A;  2FZ0 A;  2G7U A;  4S2O A;  4P87 A;  2J80 A;  3FG8 A;  4F3L B;  4P6B A;  3S7P A;  1W7F A;  4OVD A;  2XF3 A;  5TR7 A;  3IF5 A;  3MSH A;  5GLC A;  2ZC6 B;  4HEF A;  2ZL1 A;  1KE3 A;  3T4K A;  5TBM B;  3R4K A;  1PWD A;  4DRT A;  1VEU A;  5FSR A;  5JYO A;  2Y2H A;  2WK0 A;  4MEZ A;  3TRC A;  4Q0I A;  1JWP A;  3IX4 A;  5GHX A;  1OJG A;  4FH2 A;  1SKO A;  4KG5 A;  2DNS A;  3A3F A;  3P98 A;  1Y54 A;  4C75 A;  3T4L A;  5EM1 A;  4KZB A;  2E8J A;  1TD5 A;  4E6X A;  5FEF A;  1KGF A;  1S1Y A;  3IF6 B;  5EPH A;  1OTI A;  1F9I A;  1FIK A;  5CXW A;  4KQR A;  3ISG A;  5EFW A;  2R9W A;  3UPO A;  4YFM A;  4DMZ A;  2Q9M A;  2H0Y A;  5FAP A;  4GD8 A;  3VOY A;  3LID A;  2GDN A;  2BAS A;  3S4X A;  4KZ6 A;  3IBJ A;  5CGS A;  2VJW A;  1LL9 A;  3IS2 A;  1K54 A;  2JKT I;  4LEN A;  4N9K A;  5FQJ A;  4EWF A;  3PAG A;  4WF0 A;  1K54 C;  3CI6 A;  3LR4 A;  4QPR A;  1C3B A;  3ZDJ A;  1VM1 A;  2OOL A;  4BLM A;  3LYX A;  2J8Y A;  4K0W A;  5HAI A;  3NY4 A;  5HAR A;  5G4Z A;  1N9L A;  4DE3 A;  1MWS A;  1ZTU A;  2X02 A;  4R3J A;  2FH5 A;  2XRO A;  2HF6 A;  1NY0 A;  5HX9 A;  1ERM A;  3Q7V B;  1A0K A;  5EOE A;  2O9C A;  3GMW A;  3GTC A;  2W1R A;  1YLT A;  2P04 A;  1P9W A;  4GW9 A;  5FI2 A;  2ZOI A;  3FPW A;  2DCF A;  3VSL A;  5CEC A;  1H3Q A;  3BLM A;  4C6Y A;  2PRF A;  4DF6 A;  3H7W B;  3UB5 P;  3EEA A;  1BLP A;  1TS0 A;  3GR2 A;  5AQ9 A;  1PWC A;  3R7W B;  1S66 L;  1XA1 A;  1RCJ A;  4MN5 A;  3JVU A;  1M6K A;  4JGO A;  1Z09 A;  3V67 A;  4HH3 A;  4X6T A;  3BM6 A;  4R4S A;  3VOL A;  1G68 A;  4KZ4 A;  2VK3 A;  3ZNY A;  3HJI A;  4IVI A;  3ZYT A;  3S7O A;  2ZC5 B;  4S2M A;  3IWO A;  3IWQ A;  1FQG A;  3F1N B;  1TVF A;  2CMN A;  3MR0 A;  1S6R A;  1JVJ A;  1FIL A;  3BJN A;  1XFQ A;  2KX6 A;  1FSW A;  4WEJ A;  3WS5 A;  2EWV A;  3G6O A;  3G32 A;  1RP5 A;  1CEG A;  2DRW A;  4HOI A;  2XD1 A;  4BD1 A;  4KZA A;  4JPM A;  2BG1 A;  1DP8 A;  1PW1 A;  1K38 A;  4YWZ A;  4EXO A;  4O01 A;  3B33 A;  1M40 A;  4MBF A;  1ERO A;  3CIT A;  4P85 A;  2ZL1 B;  4KZ9 A;  4JGR A;  2WZZ A;  4KZ7 A;  1VEU B;  4QY5 A;  5FQK A;  4IED A;  2L1M A;  4QY6 A;  5FL3 A;  4S2I A;  1WA9 A;  3PYP A;  2ZJ9 A;  1LI9 A;  1K4E A;  4P0M A;  4ETX A;  4HJ3 A;  1T1C A;  2WKH A;  1SKO B;  3UE1 A;  4M4X A;  2PR6 A;  1WE4 A;  3ZVT A;  1E4D A;  4DKI A;  1ES4 A;  3LUQ A;  5FDH A;  4ZJ3 A;  1GSW A;  2P08 A;  5LBR A;  2V1B A;  1ZKJ A;  3T4Q A;  2WGW A;  3ZG5 A;  4CJN A;  5F6A A;  3WWX A;  1IYO A;  3O5Y A;  3T50 A;  3FKW A;  2K2N A;  4GDB A;  4GOG A;  1FCO A;  5HFO A;  3EQU A;  3BY8 A;  3P01 A;  4GKU A;  2QJ5 A;  1YAX A;  3IS2 B;  3KO6 A;  2B18 A;  2Z6D A;  2Q0O A;  4GS9 A;  3MMH A;  3QP8 A;  4R70 A;  3KYQ A;  3E0Y A;  2V0U A;  3FV7 A;  5CGW A;  4G3K A;  3VSK A;  4BEN A;  1LSW A;  1LHY A;  3MZD A;  4H6J A;  3G2Z A;  1GCE A;  5HDC A;  2M7V A;  4JF6 A;  3S22 A;  3MQ0 A;  5K5B A;  4PHT A;  1T1A A;  5CX7 A;  2EX6 A;  3D9Y A;  3UNW A;  2XFS A;  3UE3 A;  1G6A A;  4KG2 A;  1W63 M;  1J3W A;  3BFF A;  1Y4O A;  1D7E A;  1VET A;  4PM9 A;  1LLB A;  3LEQ A;  4Q0J A;  4LFU A;  2V8C A;  3KSG A;  1V9Z A;  5KZH A;  2XA7 S;  2JC7 A;  2ZQ9 A;  3HLE A;  3HCY A;  3U4L P;  1EWZ A;  4EBL A;  3DTK A;  3T4J A;  3LR5 A;  1BLS A;  3SS3 A;  3G34 A;  2VV7 A;  5IS1 A;  4PAU A;  3BFC A;  4S2P A;  1H8Z A;  4DE1 A;  3SH9 A;  2ZMA A;  4UQI M;  3L7H A;  3O3V A;  3A0R A;  1MWR A;  4GDN A;  2G2W A;  1NWZ A;  3FYZ A;  4E3O A;  2GNX A;  4MMN A;  1BYW A;  4DE0 A;  3UE0 A;  5EVE A;  4L9F A;  4N9L A;  1PYY A;  1BSG A;  3UPP A;  3MQO A;  2OWH A;  3HLW A;  4WMC A;  5M18 A;  3H9W A;  4HP4 A;  1PZO A;  4HJ4 A;  5MC7 A;  4FUW A;  2W0N A;  3K3D A;  4RVA A;  4UHU A;  2QYB A;  2HGV A;  3RXX A;  3PR6 A;  4BBU A;  1JWZ A;  4K08 A;  5HL1 A;  3T4T A;  3V5M A;  2PYP A;  4N1H A;  4X55 A;  5D3O A;  3VP4 A;  4B4X A;  4Q8I A;  1OT6 A;  3E4P A;  2B02 A;  2XDM A;  2XR0 A;  5EE8 A;  2HZ5 A;  3ZCZ A;  1T1B A;  4L0L A;  5F69 A;  4GHI A;  3PBN A;  5CHU A;  3PXP A;  1YM1 A;  5J3W A;  2VV8 A;  5CEB A;  2XGN A;  2V20 A;  4OQI A;  2OLV A;  5L07 A;  4OOM A;  4Y5F A;  2OLU A;  5TJJ A;  1P97 A;  1VB6 A;  1S4R A;  2Y4A A;  4L9G A;  3KX0 X;  3ZNT A;  3I7J A;  1KE4 A;  1K25 A;  1N4O A;  4WZ4 A;  4HBT A;  1IKG A;  4RQ9 A;  2ZM2 A;  2HJ9 C;  1I2W A;  2WGW B;  3LIB A;  4WEK A;  4L9E A;  3A0V A;  5EVL A;  5I5L A;  3C7V A;  2KDK A;  2Y55 A;  3TSG A;  2K31 A;  5I94 A;  5EEC A;  4FTX A;  4GLQ A;  5AJG A;  5FQ9 A;  1NRJ A;  3GRJ A;  4PM6 A;  2LB5 A;  4KQQ A;  3VMA A;  4E3M A;  5HD5 A;  1KDS A;  4EUZ A;  2OV5 A;  4GS9 B;  4HES A;  5F68 A;  4R0Q A;  2JHE A;  4M3K A;  1EW0 A;  1JTG A;  3D72 A;  4OQH A;  3MXR A;  1PI4 A;  4WBG A;  1GA9 A;  4Y15 A;  2WKP A;  3P7N A;  1SDN A;  4H6J B;  3OPL A;  2Y2K A;  1IYP A;  5FI6 A;  5GHZ A;  2J7V A;  1NJ4 A;  4ZDX A;  4OON A;  5DF8 A;  1XJ4 A;  5J7E A;  3FKV A;  3S7N A;  3M6B A;  2K7S A;  2I9V A;  4O8G A;  4WL9 A;  4OP8 A;  2WUQ A;  2G2U A;  4PM7 A;  3LI9 A;  1YLW A;  2HP6 A;  4B4Z A;  2M7U A;  1FOF A;  5A91 A;  2Y2J A;  4K0X A;  4EUV A;  3C5A A;  4DJ3 A;  4CQH A;  3NCK A;  4S2N A;  3UDI A;  5FA7 A;  3GVB A;  3ULF A;  4EW7 A;  3VFF A;  4WM9 A;  2WGI A;  2P74 A;  1T18 A;  2VA0 A;  1LL8 A;  5EOO A;  2PAV P;  1MC0 A;  4R4R A;  1PZP A;  3MJQ A;  3IXB A;  1G28 A;  4QB8 A;  3C30 A;  3C38 A;  4X1M A;  5IT5 A;  1D06 A;  3Q7Z A;  1S4S A;  2H28 A;  3T12 B;  2ZLY A;  4KZ5 A;  1L2S A;  4JGQ A;  3GSG A;  2J3W A;  3HUO A;  3N8L A;  2Z2L B;  1DJC A;  1PI5 A;  2P7J A;  3BEB A;  3ZQ5 A;  4UEY A;  2HP9 A;  3IX8 A;  4OPR A;  4OPY A;  3MS6 A;  5HDS A;  1OTD A;  3SS5 A;  2HJE A;  3DTI A;  4FCF A;  4MBH A;  5HWT A;  1ACF A;  3EWK A;  1FSY A;  3BFG A;  1DY6 A;  3OZH A;  3PBO A;  4GZB A;  5E43 A;  4LV0 A;  4WMC D;  1MBL A;  2HPB A;  1TEM A;  5L2F A;  2B5R A;  3QP4 A;  3KSI A;  4BL3 A;  4DXC A;  1W8Y A;  4E04 A;  1FCM A;  5DJT A;  5F5Y A;  5M19 A;  4HNB A;  2EXA A;  2VEA A;  3BWL A;  5DKK A;  1PFL A;  1BUE A;  3V50 A;  2BTF P;  2EFU A;  1LT0 A;  3C2W A;  2OSU A;  2V1Z A;  3OBF A;  5HL6 A;  2JKF A;  1CK3 A;  3BLS A;  4GHI B;  2YKF A;  5A8B A;  3T1X A;  1YLJ A;  2ZOH A;  2J3T C;  1TF1 A;  2JBF A;  1ESU A;  3SZT A;  4RX2 A;  1S0W A;  4O7D A;  3U2A A;  4NEE D;  1MKI A;  4JLF A;  5L8M A;  3G4P A;  5FAQ A;  4KQD A;  2Y2O A;  3S1Y A;  4ME4 A;  2EX9 A;  2A3U A;  3UN7 A;  4HP9 A;  4LCM A;  1YSQ A;  3C4O A;  3FC7 A;  3C7U A;  3NOP C;  2Z6C A;  4KUO A;  1ZG6 A;  4MCW A;  4HQA A;  3BFE A;  2J9P A;  5FQM A;  1PWG A;  2Y2Q A;  4K91 A;  3T1Q B;  5HPI A;  2WGV A;  2Y2M A;  2W3D A;  4CPK A;  1V9Y A;  2XSS A;  3A3E A;  2Y79 A;  3EGX C;  1IEM A;  4BL2 A;  5DFY A;  1CI8 A;  4IHQ A;  3QNB A;  3V3R A;  4KQO A;  2WKI A;  3TJZ C;  5F82 A;  1UGU A;  3VOZ A;  1XJ3 A;  3T4S A;  4X69 A;  2ZD8 A;  4LV2 A;  2JCH A;  3D3O A;  3C4P A;  4ESP A;  4HY8 A;  2WAE A;  1NZO A;  2VLG A;  2Z2M B;  5F83 A;  1SCW A;  3H82 B;  4JBF A;  2VGL M;  2QJ7 A;  5DF7 A;  4ARZ A;  2O9A A;  3NIA A;  4OQG A;  4Y0T A;  1IOU A;  3NOU C;  4N1X A;  5HSQ A;  3LIE A;  5M1A A;  3WRZ A;  3BW6 A;  1CF0 A;  5AQB A;  4II7 A;  4ZJ1 A;  2WKQ A;  4B9O A;  4S2L A;  1CQA A;  4YNR A;  1J9M A;  2ZBB A;  4LRZ E;  5CTN A;  3LR3 A;  1VHM A;  1F2K A;  4MDZ A;  1ZC2 A;  3B47 A;  1LSX A;  3ZG0 A;  1PNE A;  3MZE A;  3SW1 A;  3ZG7 B;  3DTM A;  2Y2N A;  2HDU A;  3KYZ A;  3RJU A;  3VP2 A;  2UWX A;  2UV0 E;  2QPN A;  1ESI A;  1YLP A;  3MBZ A;  2ZQ8 A;  1E3U A;  1ZG4 A;  3V3S A;  3HLG A;  1STZ A;  2OAQ 1;  5L10 A;  4Y3I A;  3WS0 A;  4Y2F A;  2W3F A;  3VE4 A;  2XA7 M;  1O07 A;  3L9K A;  2W3G A;  1ONG A;  1MZU A;  2ZM0 A;  4LLO B;  3IHA A;  2IWD A;  5DTT A;  4XT2 A;  4BD0 A;  5KSC A;  4UAA A;  2XLN A;  3Q07 A;  4OQ0 A;  3LI8 A;  4LGW A;  3EGD C;  4BJP A;  3F1P A;  4PM8 A;  3GEC A;  2Y59 A;  3LIC A;  4Y0U A;  5AQA A;  2VGL S;  1T19 A;  3CUE A;  2O0Y A;  4ZBE A;  3C8C A;  4R38 A;  3WS1 A;  2Q9N A;  5HPF A;  3HLD A;  1Y28 A;  3UO9 A;  2L4R A;  2PR5 A;  4OP5 A;  3WS2 A;  1RGZ A;  2H5S A;  3LIF A;  4CLC E;  1TDL A;  2IWB A;  4KG6 A;  1CI9 A;  2W3H A;  5C5K A;  2VV6 A;  1GSX A;  1BLH A;  5E2G A;  2D01 A;  3W4O A;  2O99 A;  3BQ8 A;  2PD8 A;  2ZM8 A;  3VP0 A;  2OAP 1;  2PU4 A;  4A5R A;  5HWV A;  1XP4 A;  1JWV A;  3G2Y A;  5DJU A;  1DP9 A;  2W1T A;  3K3C A;  2W3E A;  3KYE A;  1GHP A;  4C3Q A;  5KMW A;  2J3T D;  3QHY A;  4E3J A;  4EER A;  2V8F A;  3DWK A;  3PAE A;  1YPR A;  1S67 L;  3OLO A;  4OOL A;  4GCZ A;  2XQZ A;  3QNC A;  4NXE A;  3BY9 A;  3T1S A;  1XJ2 A;  3K2N A;  3O86 A;  4CLC A;  2M1C A;  1LI0 A;  1K0K A;  2QZ6 A;  3MQQ A;  1KOU A;  2Y2L A;  5F1G A;  4JGP A;  2XRN A;  1OME A;  3JVV A;  1WYB A;  4ETZ A;  3OCL A;  4LV1 A;  1I5Q A;  3NHQ A;  4FH4 A;  5L09 A;  2A2L A;  3UB9 A;  3AGF A;  3PHY A;  1OTE A;  3O88 A;  4IJG A;  4EQ1 A;  3CMZ A;  1NRF A;  4G3V A;  3SH7 A;  4NXG A;  4WZ5 A;  2HDQ A;  3IF6 A;  3UDX A;  4QJG A;  2ZC4 B;  2GX5 A;  5BOH A;  5HZH A;  4N92 A;  1ALQ A;  3UPN A;  4GNU A;  5GL9 A;  1XGI A;  4I5S A;  1HVB A;  3CZD A;  1MKM A;  2I72 A;  2JN7 A;  2WKR A;  1K56 A;  2Y2P A;  4ARZ B;  3NBL A;  4RX3 A;  5J4E A;  5A92 A;  2HDR A;  2XH9 A;  1H5X A;  4EEP A;  3UB8 A;  5HD3 A;  1YT4 A;  3MZF A;  5CRF A;  5KSH A;  3NEC A;  4R6L A;  2ZMF A;  5E2E A;  4IBX A;  3BYD A;  4OPZ A;  4R1G A;  1YLY A;  4HHD A;  1QMF A;  3PTE A;  2PU2 A;  3UB7 A;  2PT7 A;  2EX8 A;  5EUA A;  4UA6 A;  1X0O A;  4HIA A;  2ZQD A;  4X25 A;  4YIN A;  1K55 A;  4ZJ2 A;  5GHY A;  4JF5 A;  5E2F A;  3LGO A;  5CED A;  1UWN X;  1PRQ A;  4ZAM A;  3T4O A;  3ICY A;  1HTZ A;  1XX2 A;  1NYM A;  2ZMV A;  3UE6 A;  3DBA A;  3A3I A;  1GHM A;  1S1Z A;  2EX2 A;  2VZW A;  2C5W B;  4BWI A;  1W79 A;  3P09 A;  5FQI A;  4GD6 A;  2JKT M;  3CG5 A;  4BBT A;  1BUL A;  3HLC A;  3IWI A;  3HJK A;  3EOI A;  5DF9 A;  4E3L A;  4WUJ A;  2QKP A;  1IKI A;  1E3U D;  1K6S A;  4DXB A;  3MFD A;  3W8K A;  3BEC A;  1FR6 A;  3ITB A;  3MF0 A;  4PM5 A;  2IA2 A;  2Y2I A;  1AWI A;  4PKY G;  2QWS A;  2Y8H A;  4DDY A;  3E98 A;  3R7W A;  1LSV A;  3MKE A;  2OWJ A;  4IUK A;  2XFT A;  3N8S A;  1TS6 A;  3HRE A;  4GJ4 A;  1UWP X;  2R9X A;  5G4Y A;  3NDE A;  3M6H A;  3NC8 A;  1LL5 A;  2QHK A;  4B88 A;  2H0T A;  4XUX A;  2NUT C;  3LO7 A;  3LEZ A;  2W1T B;  1VQQ A;  4NET A;  1L0F A;  5TFQ A;  5GLD A;  4P6Z S;  2EA9 A;  1TDG A;  4HI4 A;  1VET B;  3M2K A;  4I3I A;  4OLD A;  5AQ7 A;  1H0M A;  5DFX A;  4D2O A;  1JNU A;  4ZTK A;  3BFD A;  5GLA A;  3IXD A;  2A24 A;  1YMS A;  2YKH A;  4MLL A;  4CLC B;  1W8Q A;  4JXW A;  4Q0H A;  1XJ6 A;  4KUK A;  4MN7 A;  4H8R A;  2IWC A;  3HUM A;  4PMA A;  1KE0 A;  3PBT A;  3F1O A;  5DVA A;  2MJ6 A;  1SHV A;  1ONH A;  3AGD A;  4CLC D;  4IVK A;  4S2K A;  4S2N C;  4KZ3 A;  4OKP A;  2KLI A;  4JXG A;  3IT9 A;  3JYI A;  4WYY A;  3SH8 A;  3T1R A;  4E6W A;  4NG2 A;  3TOI A;  2ZQ7 A;  4JXS A;  2VGK A;  3ZG8 B;  2WYX A;  1GHI A;  3CHW P;  3TG9 A;  4B93 A;  2V9A A;  3OCN A;  3CJM A;  2PHY A;  2WAD A;  4Y13 A;  4IBR A;  4EQI A;  3HVF A;  3FPV A;  3DWZ A;  3Q82 A;  5FEG A;  3HLF A;  4LRY C;  5A93 A;  5FAT A;  1PW8 A;  4BBV A;  1NYY A;  1OTB A;  3DAV A;  3WRT A;  2GJ3 A;  1K56 D;  2J9O A;  1SKF A;  3S7Q A;  3LY3 A;  4S2J A;  1BZA A;  4X1L A;  1FR1 A;  4Z1W A;  5EVI A;  3MXQ A;  5FDS A;  5JYP A;  1IYQ A;  1K4F A;  3PBS A;  3ZVW A;  3KSF A;  5EVI C;  4G3W A;  1CEF A;  4EU0 A;  1XA7 A;  1DRM A;  5IU1 A;  1KVL A;  4X56 A;  3NI9 A;  4MNR A;  1P9R A;  3PBR A;  3IX3 A;  1YMX A;  2PD7 A;  1W5D A;  4FD8 A;  4JXV A;  1F5M A;  2VKS A;  2XK1 A;  1ES2 A;  5DTS A;  4PPR A;  2PBD P;  4EBN A;  2XD5 A;  5DKL A;  3HBR A;  2D02 A;  5HDD A;  4E3I A;  1E25 A;  1K6R A;  3FWL A;  2PBY A;  2AVX A;  3CLO A;  1KVM A;  2HDS A;  2C6W B;  3NUL A;  3CPT A;  4U0T A;  4EBP A;  1I2S A;  2DMW A;  1DJB A;  1MWT A;  3MFX A;  2EWW A;  3IQA A;  1DJA A;  4XUZ A;  2EXB A;  3E2K A;  1MXO A;  1ZHH B;  1RGY A;  3UME A;  4RA7 A;  3OPH A;  5KIZ A;  3IH9 A;  1P0Z A;  2ZC7 A;  4QD4 A;  4BQM A;  4O0P A;  1MY8 A;  2WKE A;  4ZRR A;  2JKR M;  3QP1 A;  2RL3 A;  4LV3 A;  3ZG9 B;  2Y91 A;  3OC2 A; 
#chains in the Genus database with same CATH homology
 3B3X A;  3V39 A;  2Y2G A;  2Y4A A;  1GHP A;  4C3Q A;  5KMW A;  3Q81 A;  3QHY A;  3I7J A;  3ZNT A;  1KE4 A;  2R9W A;  3UPO A;  1K25 A;  1N4O A;  4WZ4 A;  4HBT A;  4YFM A;  4E3J A;  1IKG A;  4OOY A;  3UDF A;  3DWK A;  1MWU A;  4Y0O A;  5CHJ A;  3PAE A;  2Q9M A;  2ZM2 A;  2H0Y A;  1I2W A;  5FAP A;  1U60 A;  4OOL A;  5HAP A;  4GD8 A;  3VOY A;  2XQZ A;  2FFY A;  2WGW B;  1NZU A;  3QNC A;  2GDN A;  3O86 A;  1Z6F A;  3S4X A;  1LI0 A;  4WEK A;  2QZ6 A;  5EVL A;  3C7V A;  4KZ6 A;  4U3T A;  5CGS A;  2Y55 A;  3TSG A;  5I94 A;  1PIO A;  5EEC A;  4JF4 A;  1LL9 A;  2Y2L A;  5F1G A;  1K54 A;  4X53 A;  5FQ9 A;  5FI7 A;  3GRJ A;  1OME A;  3RXW A;  4LEN A;  4PM6 A;  1WYB A;  3MXS A;  4N9K A;  5FQJ A;  1L0G A;  2FFF B;  4KQQ A;  3OCL A;  4LV1 A;  1I5Q A;  3PAG A;  3VMA A;  4EWF A;  5FQQ A;  1BT5 A;  1K54 C;  4FH4 A;  4E3M A;  1C3B A;  3ZDJ A;  1KDS A;  4EUZ A;  3AGF A;  1VM1 A;  3IHB A;  2OV5 A;  1GA0 A;  3N7W A;  3O88 A;  4HES A;  1ES3 A;  1Q2Q A;  4R0Q A;  3HUN A;  1AXB A;  4M3K A;  4BLM A;  1KGE A;  4DDS A;  2J8Y A;  3A3J A;  5F1F A;  4K0W A;  3CMZ A;  2EFX A;  5HAI A;  3NY4 A;  1JTG A;  5HAR A;  4OQH A;  1NRF A;  3MXR A;  1PI4 A;  4QHC A;  4WBG A;  4DE3 A;  3SH7 A;  1GA9 A;  1MWS A;  4Z9Q A;  2X02 A;  4R3J A;  2ZQA A;  3HL9 A;  1SDN A;  4WZ5 A;  1L0D A;  2HDQ A;  3IF6 A;  3UDX A;  4QJG A;  4OPQ A;  3OPL A;  1NY0 A;  5HX9 A;  1ERM A;  3Q7V B;  2Y2K A;  2ZC4 B;  5EOE A;  1IYP A;  5FI6 A;  1L0E A;  2A49 A;  2ZC3 B;  3IXH A;  5BOH A;  5GHZ A;  2J7V A;  4N92 A;  1NJ4 A;  4ZDX A;  1ALQ A;  3GMW A;  3GTC A;  3UPN A;  4GNU A;  5GL9 A;  1YLT A;  4OON A;  1XGI A;  1HVB A;  5FI2 A;  4E3K A;  5DF8 A;  3CZD A;  2I72 A;  1K56 A;  2Y2P A;  3NBL A;  3NDG A;  4RX3 A;  2DCF A;  5A92 A;  3FKV A;  3VSL A;  2HDR A;  2XH9 A;  3M6B A;  2CC1 A;  3BLM A;  4C6Y A;  5CEC A;  1H5X A;  4KEN B;  1KGG A;  3Q1F A;  4DF6 A;  4OP8 A;  1BLP A;  1YT4 A;  2H10 A;  3MZF A;  5CRF A;  5KSH A;  2E8I A;  2WUQ A;  2G2U A;  4PM7 A;  3GR2 A;  1YLW A;  2HP6 A;  5AQ9 A;  1PWC A;  4B4Z A;  1NXY A;  3IXG A;  3N8R A;  5E2E A;  1FOF A;  1WYC A;  3BYD A;  4IBX A;  4OPZ A;  1XA1 A;  1RCJ A;  4R1G A;  3VP3 A;  1M6K A;  1YLY A;  5A91 A;  3FZC A;  4KZ8 A;  4DE2 A;  2P9V A;  1QMF A;  3PTE A;  2Y2J A;  4X6T A;  4K0X A;  3BM6 A;  2PU2 A;  3C5A A;  2EX8 A;  5EUA A;  4UA6 A;  3NCK A;  4S2N A;  3UDI A;  2ZQD A;  4R4S A;  5FA7 A;  3GVB A;  4YIN A;  5EVI B;  3HLB A;  1K55 A;  1G68 A;  3G30 A;  4KZ4 A;  4ZJ2 A;  4MBK A;  3VFF A;  5GHY A;  4JF5 A;  3ZNY A;  3LY4 A;  5E2F A;  3IH8 A;  5CED A;  4WM9 A;  2WAF A;  1H8Y A;  2WGI A;  4ZAM A;  2P74 A;  4IVI A;  5EOO A;  1BTL A;  3MKF A;  2BLS A;  2ZC5 B;  4S2M A;  4R4R A;  1PZP A;  3IWO A;  4E3N A;  3IWQ A;  1FQG A;  1HTZ A;  1XX2 A;  3IXB A;  1NYM A;  3OPR A;  3PBQ A;  5EVI D;  1TVF A;  4QB8 A;  4XXR A;  3A3I A;  1GHM A;  2EX2 A;  3Q7Z A;  2C5W B;  1W79 A;  3P09 A;  1S6R A;  1JVJ A;  5FQI A;  1QME A;  4OH0 A;  4GD6 A;  2ZLY A;  4KZ5 A;  1L2S A;  1FSW A;  3GSG A;  3CG5 A;  4WEJ A;  3WS5 A;  1N9B A;  3G32 A;  1RP5 A;  1CEG A;  3HUO A;  2DRW A;  3N8L A;  1BUL A;  3HLC A;  3IWI A;  2Z2L B;  5DF9 A;  4E3L A;  5G18 A;  1DJC A;  3G35 A;  2XD1 A;  5E2H A;  1PI5 A;  1IKI A;  1E3U D;  1K6S A;  3BEB A;  4BD1 A;  4DXB A;  3MFD A;  3WS4 A;  4KZA A;  4JPM A;  4UA9 A;  2HP9 A;  2BG1 A;  4OPR A;  1XXM A;  4OPY A;  3W8K A;  3BEC A;  1PW1 A;  1FR6 A;  1K38 A;  3ITB A;  3SS5 A;  4FCF A;  4MBH A;  4PM5 A;  2Y2I A;  1HD8 A;  1FSY A;  1M40 A;  2RCX A;  3BFG A;  1DY6 A;  3OZH A;  3PBO A;  4GZB A;  4ID4 A;  4MBF A;  5E43 A;  1ERO A;  4LV0 A;  4WMC D;  1MBL A;  5U47 A;  3EQV A;  2HPB A;  4P85 A;  4DDY A;  5CER A;  4KZ9 A;  1TEM A;  5L2F A;  2B5R A;  3MKE A;  4NK3 A;  2WZZ A;  4KZ7 A;  4BL3 A;  4DXC A;  4QY5 A;  1W8Y A;  5FQK A;  3O87 A;  1Q2P A;  2XFT A;  4IED A;  1FCM A;  3N8S A;  3D4F A;  5CTM A;  5M19 A;  4QY6 A;  2EXA A;  4LCL A;  4S2I A;  1BUE A;  3V50 A;  2EFU A;  2ZJ9 A;  1LI9 A;  3SS4 A;  3HRE A;  1SDE A;  2OSU A;  2V1Z A;  5HW3 A;  1CK3 A;  3BLS A;  1K4E A;  4P0M A;  3W4P A;  4R23 A;  2WKH A;  3GQZ A;  1YLJ A;  3UE1 A;  5CHM A;  4Y7P A;  1WE4 A;  2R9X A;  3NDE A;  2JBF A;  1ESU A;  3ZVT A;  1FCN A;  4RX2 A;  3M6H A;  3NC8 A;  1KDW A;  1LL5 A;  4WZ5 C;  1E4D A;  3IF6 C;  4GN2 A;  1S0W A;  3A3D A;  4O7D A;  4DKI A;  1ES4 A;  5DTK A;  4B88 A;  5FDH A;  1XPB A;  3DW0 A;  2H0T A;  4ZJ3 A;  1MKI A;  3UY6 A;  4JLF A;  3G4P A;  4XUX A;  5FAQ A;  1XGJ A;  3LO7 A;  2Y2O A;  3LEZ A;  4HBU A;  3S1Y A;  1VQQ A;  2ZQC A;  4NET A;  1L0F A;  5TFQ A;  5GLD A;  2EX9 A;  1TDG A;  1ZKJ A;  5A90 A;  2A3U A;  2WGW A;  3M2K A;  3ZG5 A;  3UN7 A;  4OLD A;  4CJN A;  5AQ7 A;  4LCM A;  1K57 A;  4D2O A;  4FSF A;  3C4O A;  3WWX A;  2HP5 A;  4ZTK A;  1IYO A;  3BFD A;  3FKW A;  5IHV A;  5GLA A;  3C7U A;  3IXD A;  1YMS A;  4GDB A;  3LCE A;  4GOG A;  4UA7 A;  1ZG6 A;  4MLL A;  1FCO A;  5HFO A;  2X71 A;  1K57 C;  3EQU A;  1W8Q A;  4JXW A;  4GKU A;  3BFE A;  2J9P A;  4RYE A;  4H8R A;  5CGX A;  2IWC A;  5FQM A;  1PWG A;  3GV9 A;  2Y2Q A;  4K91 A;  3HUM A;  5TGF A;  4PMA A;  1KE0 A;  3PBT A;  2WGV A;  2Y2M A;  5DVA A;  3ZHH A;  2WZX A;  4CPK A;  1SHV A;  3A3E A;  1ONH A;  3AGD A;  1HZO A;  1IEM A;  1ERQ A;  4BL2 A;  4IVK A;  4S2K A;  4S2N C;  4OLG A;  3FV7 A;  1CI8 A;  1K55 C;  5CGW A;  3QNB A;  4KZ3 A;  3V3R A;  4OKP A;  4F94 A;  4KQO A;  3VSK A;  4BEN A;  2WKI A;  4JXG A;  1LHY A;  5F82 A;  3IT9 A;  2X01 A;  3VOZ A;  3MZD A;  4X69 A;  2ZD8 A;  3JYI A;  1IYS A;  4LV2 A;  2JCH A;  3G2Z A;  4WYY A;  5HAQ A;  3Q7V A;  1GCE A;  3SH8 A;  3VFH A;  3C4P A;  5GLB A;  3TOI A;  4E6W A;  2ZQ7 A;  2WAE A;  3S22 A;  4JF6 A;  3ITA A;  4JXS A;  1YLZ A;  1NZO A;  2VGK A;  2Z2M B;  4X68 A;  5F83 A;  1SCW A;  1BLC A;  2EX6 A;  3ZG8 B;  1O7E A;  4JBF A;  3UNW A;  1JTD A;  2WYX A;  5DF7 A;  2XFS A;  3UE3 A;  1GHI A;  3NIA A;  4OQG A;  1G6A A;  4KG2 A;  4Y0T A;  3TG9 A;  3OCN A;  3CJM A;  5J8X A;  3BFF A;  4N1X A;  2WAD A;  5M1A A;  3WRZ A;  4IBR A;  4EQI A;  1YQS A;  4PM9 A;  5AQB A;  1LLB A;  3HVF A;  3Q82 A;  3DWZ A;  1MPL A;  3HLF A;  5A93 A;  2JE5 A;  5FAT A;  4ZJ1 A;  1PW8 A;  3ZGA B;  4S2L A;  3E2L A;  3G31 A;  1NYY A;  4WEL A;  3M2J A;  1J9M A;  3VP1 A;  5KZH A;  2JC7 A;  2ZQ9 A;  3N6I A;  4QU3 A;  5CTN A;  3HLE A;  3WRT A;  3W4Q A;  1ES5 A;  1EWZ A;  1ZC2 A;  4EBL A;  1K56 D;  2J9O A;  1SKF A;  3ZFZ A;  3ZG0 A;  1BLS A;  3SS3 A;  2XEP A;  3G34 A;  2V2F F;  3MZE A;  3LY3 A;  4S2J A;  1BZA A;  2P9V B;  2VGJ A;  1FR1 A;  5EVI A;  3BFC A;  4S2P A;  1H8Z A;  3ZG7 B;  3DTM A;  3SOI A;  2Y2N A;  2HDU A;  5JYP A;  1IYQ A;  1K4F A;  4DE1 A;  3PBS A;  3ZVW A;  3RJU A;  3SH9 A;  2ZMA A;  4U0X A;  3VP2 A;  2UWX A;  3O3V A;  5EVI C;  4JKT A;  1CEF A;  3OPP A;  1MWR A;  4GDN A;  2G2W A;  1XA7 A;  1EI5 A;  2QMI A;  3AGE A;  2QPN A;  1ESI A;  1IEL A;  4R3B A;  1YLP A;  3MBZ A;  1KVL A;  2ZQ8 A;  3FYZ A;  4E3O A;  1E3U A;  1ZG4 A;  3V3S A;  5FAO A;  3HLG A;  4X56 A;  3NI9 A;  4DE0 A;  4MNR A;  4EV4 A;  5FAS A;  1XKZ A;  3UE0 A;  3WS0 A;  3PBR A;  4GB7 A;  1YMX A;  1PYY A;  1BSG A;  3BRM A;  4N9L A;  1W5D A;  3UPP A;  1O07 A;  4FD8 A;  3N4I A;  4JXV A;  1ONG A;  3HLW A;  2XK1 A;  4WMC A;  2ZM0 A;  3IHA A;  2IWD A;  5DTT A;  5M18 A;  1ES2 A;  4S2O A;  5DTS A;  4BD0 A;  1PZO A;  4P87 A;  4PPR A;  5KSC A;  4UAA A;  4EBN A;  2XLN A;  4P6B A;  3Q07 A;  2XD5 A;  1W7F A;  4OQ0 A;  4RVA A;  4OVD A;  2XF3 A;  5TR7 A;  3HBR A;  3IF5 A;  4UHU A;  4BJP A;  4PM8 A;  4E3I A;  1E25 A;  1K6R A;  5GLC A;  3FWL A;  3RXX A;  2Y59 A;  2ZC6 B;  4Y0U A;  5AQA A;  4HEF A;  2PBY A;  1KVM A;  2HDS A;  1KE3 A;  2C6W B;  1JWZ A;  4U0T A;  4EBP A;  1PWD A;  4DRT A;  5JYO A;  5FSR A;  1I2S A;  4ZBE A;  5HL1 A;  2Y2H A;  1DJB A;  1MWT A;  3WS1 A;  2Q9N A;  2WK0 A;  3V5M A;  3IQA A;  1DJA A;  4N1H A;  3HLD A;  4MEZ A;  4X55 A;  4XUZ A;  2EXB A;  5D3O A;  3VP4 A;  4B4X A;  3E2K A;  3UO9 A;  1MXO A;  4Q8I A;  4OP5 A;  3WS2 A;  1RGZ A;  2XDM A;  2H5S A;  2XR0 A;  5EE8 A;  1RGY A;  3ZCZ A;  1JWP A;  4L0L A;  4RA7 A;  1TDL A;  5GHX A;  2IWB A;  3OPH A;  3PBN A;  5CHU A;  4FH2 A;  4KG6 A;  1CI9 A;  3IH9 A;  1YM1 A;  1BLH A;  4KG5 A;  5E2G A;  2DNS A;  3W4O A;  2ZC7 A;  4QD4 A;  3A3F A;  4BQM A;  3P98 A;  1Y54 A;  4C75 A;  5CEB A;  2XGN A;  2V20 A;  4OQI A;  4KZB A;  4E6X A;  1MY8 A;  1KGF A;  2OLV A;  2ZM8 A;  3VP0 A;  3IF6 B;  5EPH A;  2WKE A;  2PU4 A;  4OOM A;  4A5R A;  1XP4 A;  1JWV A;  3G2Y A;  5CXW A;  4KQR A;  2OLU A;  2RL3 A;  4LV3 A;  3ZG9 B;  2Y91 A;  3ISG A;  3OC2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...