1BYWA

Structure of the n-terminal domain of the human-erg potassium channel
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
110
structure length
110
Chain Sequence
b'SRKFIIANARVENCAVIYCNDGFCELCGYSRAEVMQRPCTCDFLHGPCTQRRAAAQIAQALLGAEERKVEIAFYRKDGSCFLCLVDVVPVKNEDGAVIMFILNFEVVMEK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (HUMAN ERG POTASSIUM CHANNEL)
molecule tags Membrane protein
source organism Homo sapiens
publication title Crystal Structure and Functional Analysis of the Herg Potassium Channel N-Terminus: A Eukaryotic Pas Domain
pubmed doi rcsb
total genus 27
structure length 110
sequence length 110
ec nomenclature
pdb deposition date 1998-10-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13426 PAS_9 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 1bywA00
4JGQA 1OT9A 2JN7A 2JHEA 2A24B 2V0UA 1DP6A 3BY8A 4HJ4A 4HH2A 4NXEA 3MJQA 1KOUA 3EWKA 3PHYA 3UB8A 2V0WA 2R78A 3CWFA 3OLOA 4H6JB 3E4PA 3C8CA 3KX0X 2PHYA 2GJ3A 3NHQA 4MN6A 5F68A 4I39A 5IU1A 2WKPA 2Z6CA 1DP9A 1OTEA 2D01A 4L9EA 5HDSA 4F3LA 5J3WA 1DRMA 5G4YA 4LRXC 3MR0A 1P0ZA 3IBRA 4GS9B 4XT2B 3UMDA 4PKYA 5G4ZA 1S1ZA 2QJ7A 4K08A 1EW0A 1T19A 5DJUA 3UB9A 2P7JA 3A0RA 3HJIA 4BBTA 4GHIA 5HDCA 4E04A 2PYRA 1XJ2A 2H28A 1MZUA 3FG8A 3G6OA 3H7WA 4WLAA 4H6JA 3MFXA 2QJ5A 3NOTC 4NXFA 5F5YA 3ULFA 4PKYG 4HJ3A 2VLGA 2W27A 4HP9A 3UE6A 4LRZE 1N9NA 1BYWA 2M1CA 2PR6A 1WA9A 3K3CA 3LI8A 3E4OA 1Y28A 3B33A 4HQAA 4I3JA 4LLOB 5J7EA 2V1AA 3C2WA 1T18A 2ZOIA 4WF0A 1V9YA 2A24A 2OWJA 2I9VA 3F1PB 5TBMA 1D06A 3E4QA 3T50A 2KDKA 3K3DA 4NXBA 3HJKA 3A0VA 1XJ3A 2VV7A 2OWHA 1NWZA 1LSWA 1OT6A 2PYPA 3NOPC 4R38A 1S66L 4EETB 4EXOA 5AVEA 4EEPA 4R3AA 4KQDA 4EERA 1JNUA 4B9OA 3RH8B 4WUJA 3NJAA 3ICYA 1TS0A 5HSQA 1UWPX 2VV6A 5IS1A 4BBUA 3LIAA 4XT2A 3P7NA 1OTBA 5HD5A 2WKQA 4EW7A 4I3AA 2B02A 5DKLA 1D7EA 4JGOA 2EA9A 1F98A 3LICA 3CLOA 2CMNA 1TS6A 3F1NA 3LIEA 2D02A 3EEHA 4HHDA 1T1BA 2W0NA 5F69A 4KUOA 1S4RA 1OTAA 3BWLA 3H82B 3F1OA 4HIAA 5F6AA 4F3LB 3A0SA 2VEAA 2L1MA 1XJ4A 1F9IA 4DJ3A 1V9ZA 2PD8A 2V1BA 1S67L 4EEUA 3NOUC 3LI9A 5HDDA 1LSVA 2L4RA 2QKPA 4HY8A 4HNBA 3MXQA 4M4XA 1N9LA 1T1AA 1OJGA 3F1OB 2HV1A 2BASA 3LIDA 5HWWA 5A8BA 1P97A 1GSVA 1LSXA 3GECA 4WN5A 2PDRA 3GDIA 4I38A 4RQ9A 3RTYA 1ODVA 2K7SA 3MQQA 4DJ2A 5AVFA 3CAXA 1X0OA 3BY9A 1XJ6A 5HZHA 4GW9A 4BBVA 3IS2A 1XFNA 3D72A 1GSXA 3H9WA 4GCZA 4I5SA 4LPZA 5J4EA 1OJ5A 3H7WB 5EFWA 2QHKA 4R70A 5TBMB 3UMEA 4EESA 3PYPA 2WKRA 4KUKA 3ZQ5A 2J80A 2VV8A 1GSWA 3F1NB 4NXGA 3UB6A 1OTDA 1XFQA 3VE4A 2KX6A 3LIBA 5KIZA 1N9OA 2V9AA 2Z6DA 4GS9A 1UWNX 1LL8A 3IS2B 4HH3A 1VB6A 4HJ6A 1T1CA 3FC7A 4EQ1A 4HP4A 3MQOA 3LUQA 2OOLA 4GHIB 3F1PA 5HD3A 5DKKA 4JGRA 5HWVA 3H82A 1DP8A 4HI4A 4L9FA 3LIFA 5DJTA 1LT0A 1UGUA 4YWZA 1TS8A 1OTIA 4I3IA 3UB7A 2ZBBA 4MN5A 2INWA 3LYXA 2L0WA 3VE3A 2ZOHA 5I5LA 4R6LA 3SW1A 2YKFA 1S1YA 3VOLA 5HWTA 4JGPA 1S4SA 2PD7A 1G28A 4HOIA 4L9GA 4LRYC 2QWSA 1TS7A 2YKHA 2PR5A 4WL9A
chains in the Genus database with same CATH superfamily
1BUEA 4E3IA 4RX2A 1HTZA 5EOOA 4N1XA 4RX3A 3UB5P 5IU1A 3SOIA 3WS0A 3FWLA 5J3WA 1XX2A 2PRFA 4L0LA 4MBKA 5CECA 3ZDJA 2XD1A 3PBSA 1IFQA 4H6JA 3MFXA 2OLVA 2HGVA 5HPIA 1D1JA 1W8YA 1QMFA 1N9NA 1BYWA 3G31A 1HVBA 1T18A 1V9YA 4PM8A 2PBDP 3RFBA 2H0YA 2XQZA 3BFFA 4KQDA 2ZD8A 1CEFA 3UDXA 2RCXA 2WZZA 2XD5A 5GLBA 4S2MA 1GA0A 3MF0A 4PPRA 1FCNA 3LIAA 4MNRA 1H8ZA 1VETB 5TGFA 1ERMA 3S7NA 1F98A 5CTNA 2ZL1A 3IXGA 4YINA 1H3QA 4Y17A 4C3QA 3A3DA 2HPBA 1T1AA 3T4SA 2BASA 5HWWA 3RJUA 4A5RA 3A3EA 2Y55A 5EE8A 1ODVA 1DY6A 3BLSA 3UMEA 3PYPA 2WKIA 3ZGAB 4HP4A 5GL9A 4OQHA 4L9FA 4P0MA 1H8MA 4HESA 4MN5A 4S2KA 4QD4A 4UAAA 5EOEA 2O99A 4JGPA 2JN7A 3LY4A 4HJ4A 3G35A 3EWKA 1I5QA 4WEJA 3LR0A 3RXXA 3CWFA 3JPUA 2PHYA 1YAXA 5AQBA 3QHYA 4GD8A 4PMAA 1STZA 1BT5A 3HREA 4P87A 3SH7A 1TEMA 4FUWA 4PKYG 2H10A 4U0TA 5KZHA 2HDQA 3LFVA 3G30A 3O88A 1NJ4A 3OCNA 2J3TC 2HDSA 5AVEA 5AQAA 3T4JA 1PZPA 4O01A 4BENA 1E4DA 4FSFA 5FQIA 2ZQCA 2EA9A 4P85A 3CLOA 2P74A 4LFUA 1N9BA 4PAUA 2OAP1 4YOFA 3PBRA 1LSVA 3QNBA 1I2SA 3IXDA 3UO9A 5FAOA 1XA7A 4F94A 3LEQA 3FPVA 2Y79A 3D4FA 3D72A 5IT5A 3SZTA 3WS4A 4AFIA 4FTXA 3C30A 3W2ZA 2Y2QA 2WK0A 2ZBBA 3ZFZA 3MKFA 1SHVA 2ZL1B 1ES2A 3V50A 4FCFA 3HLGA 1O7EA 3KX0X 4OOLA 4I39A 2WKPA 2VZWA 3P98A 1P0ZA 1K0KA 4PKYA 3IXHA 3S7PA 3A0RA 5EV0A 3D3OA 2OV5A 1K6RA 3ZNYA 3UNWA 4MN7A 2Y2MA 4X1MA 5EM0A 4LRZE 1KVMA 5AJGA 5F82A 3SS5A 2OWJA 2I9VA 3T50A 3DWZA 4Y2FA 3A0VA 1NWZA 3PTEA 3EGDC 4CLCB 1JTDA 1ES5A 3RH8B 3NJAA 1UWPX 3KYZA 3N7WA 1SKFA 4GDNA 1FR6A 4JGOA 3BQAA 4XUZA 3PXPA 5DF7A 4MEZA 5FQQA 2ZMVA 1M40A 2PD8A 3GMWA 2X71A 5FATA 4UEYA 5D3OA 2UV0E 2V1ZA 4OQ0A 1NXYA 3BY9A 3CPTB 1XFNA 3V3SA 4B93A 4GOGA 4KENB 3BECA 5M1AA 1XFQA 3VFHA 2IA2A 2XA7M 4UHUA 3ZYTA 5DJTA 1NRJA 3VSLA 2INWA 4LENA 1BULA 3A3FA 3PBNA 3AGFA 2PD7A 3A0SA 1FR1A 3LCEA 3UY6A 3Q7VA 1W8QA 3Q7ZA 3OC2A 1BTLA 3C8CA 3DBAA 2GJ3A 4U0XA 2FFYA 5GHZA 1F2KA 4S2NA 4GS9B 4QY6A 5GLAA 4Y3IA 4E04A 5HDCA 1XJ2A 1ESIA 3T4QA 3T1XA 2IWBA 4QB8A 2R9WA 2Y2OA 3LI8A 3E4OA 4LLOB 3B33A 3IBJA 3ZVWA 2ZM2A 2Y2JA 4WMCA 3WS5A 2H0TA 2GNXA 1TS0A 4XXRA 1Q2PA 2C6WB 3G2ZA 3KYEA 4IEDA 5DF8A 2NUPC 4X68A 1XJ4A 3IH8A 4DJ3A 1V9ZA 2P08A 2G7UA 3LI9A 4NEED 5CRFA 4M4XA 2J3TD 3V39A 1H0MA 3F1OB 3VV4A 1JVJA 3GECA 4OLGA 1W63Q 5HZHA 1KGEA 5M18A 4GW9A 4I5SA 5GLCA 4X56A 3VP0A 1TDGA 2O9CA 2Y91A 1G6AA 3G2YA 1AXBA 1VB6A 4WZ5C 3S1YA 2J7VA 3OZHA 3LUQA 2VGKA 5FI6A 5HWVA 2WGWB 1TS8A 4R4SA 5F1GA 1TD5A 4IHQA 2MJ6A 4L9GA 4DF6A 3TE8A 3CUEA 1DP6A 3BY8A 3BFCA 3UE3A 2JKTI 3E0YA 4ARZB 2VX8A 3CI6A 2UWXA 5DTSA 5HX9A 4CPKA 1CF0A 1K4EA 5A92A 2EX6A 4WLAA 5F5YA 1KDWA 4OOYA 4N9KA 4IVIA 4S2PA 5CGWA 4B4XA 5I94A 4NXGA 4E3JA 1LI9A 4WEKA 2K2NA 4B9OA 4R23A 3SS4A 3PAGA 1KE0A 1MC0A 3WRZA 2GZAA 3QP4A 1IYOA 2CMNA 3LIEA 3F1OA 3FZCA 1PYYA 3V3RA 2WGIA 4EQIA 2HJ9C 4E3KA 1TDLA 3VP3A 1OJGA 2XA7S 5FDHA 2FH5A 2EX8A 4O8GA 4LV2A 3C7VA 2K7SA 4OPQA 1ACFA 1GHMA 2Y2PA 1YQSA 1AWIA 4KUKA 4CQHA 5A90A 2V9AA 1W7FA 5EVIC 4Y0UA 5EPHA 4S2OA 1K57C 4BD0A 4EBPA 2W3GA 3M6BA 1S1YA 3N8LA 4HOIA 1E3UA 1IKGA 2HF6A 5MC7A 1KOUA 2B18A 2Z2MB 4GB7A 3Q81A 3ITAA 5EECA 2JKTM 3UMDA 3V5MA 5CXWA 3T4OA 3UB9A 1K55C 3G6OA 3S7OA 1L3LA 3QP8A 1K25A 4MLLA 4I3JA 1Y28A 4BLMA 3NY4A 1YSQA 1G6OA 2P9VA 1ZG4A 1C3BA 3UDIA 3O3VA 2WGWA 1NYYA 2AVXA 4KQOA 5DKLA 1PNEA 4OQIA 2OLUA 3DW0A 3CMZA 5M19A 4MMNA 1S4RA 5DTTA 2VGJA 1ZG6A 2L1MA 2VEAA 1M6KA 3JVVA 2WKHA 4N9LA 5HDDA 4ARZA 4KZAA 3ISGA 1ERQA 1YMSA 4Y15A 1FCMA 4OPYA 3QP1A 3HUNA 2XDMA 1TF1A 2M7UA 1ZTUA 5J4EA 4BL3A 2DCFA 2EWVA 1H8YA 2WKRA 4R3BA 4Q0HA 1N9OA 3C4OA 3BLMA 5E2EA 1XGJA 1T1CA 1GCEA 3MQOA 1VEUA 4GHIB 3F1PA 5FASA 1KGFA 3LO7A 4JBFA 4R6LA 4PM7A 3MXSA 1BLCA 1JWVA 3LY3A 1SDEA 1PZOA 4Y13A 4KQRA 5EVIA 4ZJ3A 4HBUA 5JYPA 1K55A 3IWIA 2D01A 3WRTA 3FYZA 4X1LA 5EVIB 5CTMA 1Z6FA 3BYDA 1MZUA 1MPLA 4DXBA 2M1CA 4R1GA 1HLUP 3IF6A 2XLNA 1XJ3A 2OWHA 1XPBA 4X69A 4EU0A 3KO6A 2A3UA 5IS1A 3T4TA 3OPPA 3P7NA 3IF6B 3CG5A 5CEDA 1Q2QA 3CUEC 1DJCA 1CJFA 2D02A 3BW6A 4Y5FA 3DTIA 2XSSA 1VEUB 2V1BA 4ZJ1A 2HP6A 2WYXA 4ZDXA 4R4RA 4HY8A 3DAVA 2WADA 4EUVA 2WAFA 1FQGA 1KGGA 1LL9A 5BOHA 2Z2LB 4WN5A 2ZC7A 3ZCZA 2HP5A 4DJ2A 3LR5A 3HLEA 5U47A 1GSXA 1CI9A 4PM9A 3T4LA 5L09A 4EESA 4JF5A 1OMEA 4DE1A 4P6ZM 1QMEA 1NZOA 1VQQA 3V67A 3W4OA 3LYXA 3MFDA 2LB9A 2KLIA 1NZUA 4X55A 5FAQA 2JE5A 5LBRA 2VKSA 5FEFA 4GNUA 1G68A 2PU2A 3MSHA 2W3FA 5A8BA 1RGYA 4KZ7A 2V0WA 2QYBA 2ZM8A 4MN6A 2JBFA 3C5AA 3W4QA 3CZDA 4XT2B 1EWZA 4DXCA 5FA7A 3O86A 4JXWA 2VLGA 1RCJA 5IHVA 3KSHA 3F1PB 5TBMA 1XA1A 1LSWA 1OT6A 4R0QA 3IT9A 3Q82A 3OPLA 1RP5A 2ZLYA 1FSWA 1GHPA 3KSGA 4DDYA 4HHDA 3HUMA 5HL6A 2EFUA 3ZG0A 4DKIA 3KYQA 1S67L 3NOUC 1EI5A 4UA9A 4EBNA 1ESUA 1W63M 4GKUA 1E3UD 2EX2A 5E43A 1NY0A 4P6ZS 2G2WA 4D2OA 3CAXA 3FV7A 2VGLM 3IS2A 3VSKA 3WWXA 3NULA 4R70A 2VV8A 3UB6A 5CERA 3P09A 3UE1A 2O9BA 4KG2A 4S2JA 2Q0OA 3VE3A 2J9PA 2I72A 2EXBA 4WBGA 1CK3A 4KZ5A 3B47A 2YKHA 2JHEA 2A24B 1IOUA 3VFFA 1PI5A 4ZBEA 3DWKA 1E25A 3BJNA 2Y2NA 1DP9A 2GDNA 5EVID 4DN0A 1DRMA 5G4YA 4LV3A 3SH8A 4ID4A 5FI7A 4P6BA 4II7A 5FQ9A 1YLTA 2XR0A 2PR6A 5K5BA 3B42A 3MXRA 5HAIA 1BLSA 3VOZA 3LEZA 1KVLA 2XEPA 2VV6A 4KZBA 2VA0A 3HVFA 1OPXA 3IWOA 3EEHA 4JXSA 2C5WB 4OP5A 4DE0A 3HLFA 5KMWA 4JF6A 3CPTA 1YT4A 1F5MA 3MXQA 1NYMA 1LSXA 3JYIA 1WYCA 3M6HA 1P9RA 1XJ6A 1GA9A 4BL2A 3IX8A 5HAQA 1OJ5A 1W79A 2R9XA 1K4FA 1MKIA 1S0WA 5KIZA 3VE4A 2XK1A 3TW8A 1LL8A 2XFSA 4Q8IA 4EUZA 3EGXC 2ZC3B 2DRWA 5FAPA 3G32A 2OOLA 3EQUA 1Y4OA 2V2FF 4EBLA 3UB7A 3ZG8B 4OVDA 3BQ8A 4OPZA 2Q9NA 5I5LA 3GR2A 3SW1A 2YKFA 1CEGA 3JVUA 3GSGA 4QU3A 4S2NC 4MDZA 1TS7A 1A0KA 3MKEA 4HH2A 2W3DA 2P9VB 3NHQA 5HDSA 4GJ4A 3MR0A 4GZBA 5FDSA 2QJ7A 3P01A 4JXVA 2H5SA 2WZXA 4MBFA 2A2LA 2QJ5A 3IXBA 1ONHA 4DRTA 4E3NA 3UE6A 1J9MA 5L10A 5E2GA 3C2WA 4CLCA 4DDSA 2VK3A 4NXBA 3HJKA 2VV7A 2PYPA 3NOPC 2IWDA 4LCLA 1JNUA 5EVLA 1HD8A 3HLDA 1IELA 4CLCD 2Y2IA 4GD6A 4XT2A 5HPFA 3T1QB 2ZMAA 1D7EA 3L7HA 2PU4A 1DJBA 2PT7A 4X25A 4IJGA 5L07A 5TFQA 3BWLA 3T12B 5FSRA 3GTCA 2ZMFA 4MCWA 3HL9A 1XKZA 4H8RA 2WKEA 1PW1A 5DFXA 1LLBA 4UA6A 4WZ5A 4KZ3A 2PDRA 2Y2LA 4ETZA 4RQ9A 3RTYA 3W4PA 5AVFA 2ZJ9A 1YKDA 3PBTA 3C7UA 4OH0A 3H7WB 2E8JA 3IH9A 3ZQ5A 3LIBA 4R38A 3Q1FA 1SCWA 1YLWA 2JKRM 5CGXA 5KSHA 5CGSA 5DKKA 1DP8A 1L0EA 1UGUA 2ZOHA 3PR6A 3OPRA 1JWZA 1G28A 4WMCD 4WL9A 4NXEA 4ESPA 3T1RA 3U4LP 1PI4A 4YNRA 2Z6CA 2GX5A 1OTEA 4L9EA 4K08A 1T19A 1IYQA 2P7JA 2PYRA 3BFDA 2M7VA 4DE2A 3NDEA 1JWPA 4JLFA 3O87A 3QP5A 3PBOA 2ZOIA 2W1TB 1LI0A 4IUHA 3ZVTA 1LL5A 3E2KA 3E4QA 1SKOB 1ALQA 4EETB 5E2HA 3NDGA 4BMWA 5FEGA 3S22A 1YLPA 3D9YA 3HBRA 2JKRI 1OTBA 2ZM0A 4IVKA 4IBRA 5J8XA 1PWGA 4QPRA 2Y2KA 1G5UA 3O5YA 3M2JA 2B5RA 2X01A 5DTKA 1KDSA 1MWUA 1YLZA 3PBQA 4IUKA 4UA7A 2OSUA 4PM6A 2J9OA 2ZC6B 4E3OA 1FCOA 2O9AA 2XF3A 3MZFA 4BBVA 5DFYA 4Z9QA 5EFWA 3NBLA 1GSWA 2E8IA 3UDFA 1BZAA 3MZDA 4HH3A 4I3IA 1UWNX 4EQ1A 1CQAA 3TJZC 3ZHHA 5HD3A 3LIFA 4OOMA 5HWTA 1W5DA 2PR5A 4JGQA 1OT9A 4ZTKA 2W1TA 1ES4A 4LGWA 2WGVA 2A49A 5GHXA 4G3KA 4UQIS 1L0DA 5FQMA 3MMHA 4JXGA 3QP6A 4KZ9A 2FZ0A 4ZAMA 1ZKJA 4C75A 3FG8A 3H7WA 3ULFA 4NXFA 4S2IA 2IWCA 3NI9A 5FI2A 3E2LA 4GN2A 3SS3A 1D06A 2KDKA 4EXOA 4Y0OA 4O0PA 3NECA 5TJJA 2ZQ7A 1J3WA 2ZQ8A 1N4OA 1PRQA 3CJMA 1PFLA 4QJGA 4KZ6A 2B02A 3ZG5A 4B4ZA 1IKIA 3TRCA 4WM9A 3MZEA 3IF5A 3MS6A 2EXAA 2V8FA 5CHUA 5AQ7A 2DNSA 4B88A 5F6AA 4Y7PA 4KZ4A 1O07A 2CC1A 2QKPA 2HDUA 5DVAA 2HDRA 1BLPA 3WS2A 3OPHA 4MBHA 4I38A 3G34A 3E98A 4PM5A 4RVAA 3SH9A 1OTDA 4D60A 3IHAA 1YLJA 4HJ6A 5FQJA 4HI4A 1LT0A 4WELA 2NUTC 4K91A 4M3KA 2KOIA 4KZ8A 2PAVP 5L2FA 3VOLA 1GHIA 4HBTA 3QP2A 1WE4A 5FL3A 4N1HA 5HARA 1BLHA 3ZNTA 3ZG7B 3A3JA 1YSPA 5AQ9A 3FKVA 4K0WA 5DF9A 4E3LA 4KQQA 4O7DA 3PAEA 4Y0TA 1BSGA 4HP9A 2WAEA 1WA9A 1XP4A 4E3MA 4WF0A 1NLZA 2V20A 2J3WA 1S66L 1L0GA 4EERA 1CI8A 5CX7A 4QHCA 3IQAA 3HCYA 1XGIA 2WKQA 4I3AA 2W1RA 4ZJ2A 3BRMA 3F1NA 3VP4A 1ES3A 2W0NA 2JKGA 4ETXA 3GVBA 3U2AA 3IF6C 4G3VA 4HIAA 4EV4A 3KSFA 4NKPA 5EVEA 1L2SA 3TSGA 3NCKA 4UQIM 1N9LA 4X6TA 1PWCA 4G3WA 1SDNA 2QZ6A 2DMWA 1JTGA 3BM6A 3DTKA 3N4IA 4FH4A 1MBLA 1LHYA 3T1SA 1YMXA 1OTIA 4Q0JA 2L0WA 3LR4A 4BJPA 4LV1A 3UPNA 3N6IA 4ZRRA 3UN7A 1IEMA 3I7JA 4YWZA 3PHYA 1ZC2A 1H5XA 3HLBA 3E4PA 4NK3A 1K6SA 4F3LA 5HFOA 4BWIA 3IBRA 2ZQ9A 5DJUA 1EW0A 3HJIA 4BBTA 1K54C 3WS1A 4HJ3A 1PWDA 4EWFA 5EUAA 5HW3A 4HQAA 5J7EA 2EWWA 4QWOA 2V1AA 3IHBA 3CHWP 2A24A 3K3DA 3S7QA 2XGNA 3OLOA 4H6JB 4EEPA 5KSCA 2OAQ1 1KE4A 4GLQA 3G4PA 5TR7A 4XUXA 3VMAA 4E6WA 2FFFB 4JPMA 4BBUA 5HD5A 3VP2A 4RA7A 3IX3A 4ME4A 3LICA 5CHJA 2O0YA 1TS6A 3Q7VB 4KUOA 1S6RA 3NC8A 1FIKA 4C6YA 3MQ0A 5A93A 1F9IA 2G2UA 4EEUA 3W8KA 1PIOA 2Y4AA 4HNBA 4OONA 1MXOA 2ZQDA 5E2FA 4CLCE 1DJAA 1PW8A 3GDIA 2ACGA 4NETA 1ZHHB 3MQQA 4PHTA 1K56A 2Q9MA 4IBXA 2XRNA 4GCZA 1Z09A 3C4PA 4BQMA 1YLYA 4OPRA 2HZ5A 4R3JA 2J80A 4GS9A 3NIAA 3IS2B 5CHMA 1SZVA 3FC7A 2Y2GA 1MWSA 3AGEA 5GHYA 1MWRA 3H82A 3ITBA 4KG6A 2W3HA 2HP9A 3R7WA 1Y54A 3TG9A 2QPNA 2QWSA 2V0UA 3MJQA 3UB8A 4FD8A 2Y8HA 2R78A 3ZG9B 3R7WB 3T4KA 3EQVA 4LCMA 2XROA 1XXMA 1NRFA 5G4ZA 1S1ZA 3FKWA 4GHIA 4CLCC 2H28A 3B3XA 3EEAA 5EM1A 1FOFA 3DTMA 1SKOA 5FQKA 5L8MA 5JYOA 3BFGA 3K3CA 3IWQA 1L0FA 2BLSA 2HJEA 2EX9A 3L9KA 1NLYA 4N92A 1VM1A 3CITA 2PBYA 1K57A 5A91A 4YFMA 2WUQA 4WUJA 1P9WA 4WYYA 3HLCA 1FSYA 3VP1A 5HSQA 2P04A 3OCLA 4Q0IA 3RXWA 1FILA 3TOIA 5F69A 3H82B 1I2WA 4F3LB 2L4RA 2BG1A 4DMZA 1KE3A 2X02A 5F83A 4Z1WA 1YPRA 1IYPA 3KSIA 4DE3A 3GV9A 5TBMB 3F1NB 2KX6A 4JKTA 2EFXA 3HLWA 4K0XA 4JGRA 3S4XA 3LGOA 3AGDA 3BFEA 3EOIA 1U60A 4RYEA 5HL1A 3A3IA 3M2KA 1S4SA 3C38A 4CJNA 2K31A 5HAPA 3N8RA 5CEBA 2ZC4B 2RL3A 5F68A 2W3EA 1EROA 4LRXC 4GDBA 3BEBA 2BTFP 4BD1A 4KG5A 3LR3A 3NOTC 3K2NA 3OBFA 3OOVA 2W27A 3UE0A 5F1FA 3N8SA 2LB5A 1RGZA 2XH9A 1K54A 4EW7A 5C5KA 1K38A 2XFTA 2J8YA 4S2LA 1HZOA 4FOFA 1MY8A 4OP8A 4R3AA 4OKPA 1MKMA 3ICYA 4E6XA 3VOYA 1YM1A 5G18A 3GQZA 1TVFA 4JF4A 1ONGA 3UPOA 1T1BA 4X53A 2JC7A 2ZQAA 4U3TA 4OLDA 1OTAA 3R4KA 4HEFA 1MWTA 1VETA 3GRJA 3UPPA 3HUOA 4LV0A 3FPWA 2B95A 1WYBA 3LIDA 2HV1A 2JKFA 5GLDA 1P97A 1GSVA 2ZC5B 1X0OA 3IX4A 3H9WA 4LPZA 2V8CA 4WZ4A 3MBZA 3Q07A 4NG2A 3DTEA 4QY5A 2QHKA 2QMIA 1K56D 2Y59A 2Z6DA 2JCHA 1IYSA 3QNCA 2Y2HA 1VHMA 4FH2A 2VJWA 2VGLS 4OQGA 4LRYC
chains in the Genus database with same CATH topology
3CUEA 2JHEA 2A24B 1IOUA 1DP6A 3BY8A 3UE3A 2JKTI 5FL3A 3E0YA 4ARZB 2VX8A 3CI6A 5IU1A 3BJNA 1YSPA 1DP9A 4DN0A 5J3WA 1DRMA 5G4YA 4L0LA 5DF9A 3PBSA 1IFQA 4WLAA 4H6JA 3MFXA 5F5YA 2HGVA 4II7A 5HPIA 4HP9A 1N9NA 1BYWA 2PR6A 1WA9A 5K5BA 1T18A 4WF0A 1V9YA 3B42A 3RFBA 1NLZA 4NXGA 2J3WA 1S66L 4WEKA 4KQDA 4EERA 5CX7A 2K2NA 4B9OA 3MF0A 2VV6A 3HCYA 3LIAA 2VA0A 2WKQA 1MC0A 4I3AA 1OPXA 2GZAA 2W1RA 3S7NA 1F98A 2CMNA 3F1NA 3LIEA 3EEHA 2W0NA 4ETXA 3U2AA 4G3VA 3F1OA 4HIAA 1H3QA 3KSFA 4NKPA 2HJ9C 1F5MA 3MXQA 4UQIM 1N9LA 1T1AA 1OJGA 2XA7S 3T4SA 2BASA 2FH5A 4G3WA 5HWWA 4O8GA 1LSXA 1ODVA 2K7SA 1P9RA 1XJ6A 2DMWA 1OJ5A 3UMEA 3PYPA 4KUKA 4CQHA 5KIZA 3VE4A 3TW8A 2V9AA 1LL8A 3EGXC 4HP4A 2OOLA 3EQUA 4L9FA 3UB7A 1OTIA 1H8MA 3BQ8A 4MN5A 4Q0JA 2L0WA 2W3GA 3LR4A 4BJPA 5I5LA 3SW1A 2YKFA 2O99A 1S1YA 3JVUA 4ZRRA 4HOIA 4MDZA 4JGPA 1TS7A 4YWZA 2HF6A 2JN7A 4HJ4A 4HH2A 5MC7A 1KOUA 2W3DA 3EWKA 3PHYA 2B18A 3LR0A 4WEJA 3CWFA 3E4PA 3NHQA 2PHYA 1YAXA 4F3LA 5HDSA 4GJ4A 2JKTM 4BWIA 3MR0A 3IBRA 3UMDA 1STZA 5DJUA 2QJ7A 1EW0A 3P01A 3T4OA 3UB9A 3HJIA 4BBTA 3G6OA 2A2LA 2QJ5A 3S7OA 4PKYG 4HJ3A 3UE6A 4I3JA 1Y28A 3LFVA 4HQAA 5J7EA 2EWWA 2V1AA 3C2WA 4CLCA 2A24A 3OCNA 2J3TC 1YSQA 3K3DA 4NXBA 3S7QA 3OLOA 3HJKA 2VV7A 4H6JB 2PYPA 1G6OA 3NOPC 5AVEA 4EEPA 2OAQ1 4GLQA 1JNUA 3T4JA 4CLCD 4O01A 4BBUA 4XT2A 5HPFA 5HD5A 4FSFA 4KQOA 5DKLA 4ME4A 1D7EA 2EA9A 3LICA 3CLOA 2O0YA 1TS6A 2PT7A 4IJGA 4MMNA 4KUOA 1S4RA 3BWLA 4PAUA 2OAP1 2VEAA 2L1MA 3MQ0A 4YOFA 1F9IA 2ZMFA 3JVVA 3PBRA 4MCWA 4EEUA 5HDDA 1LSVA 4HNBA 4ARZA 4CLCE 5DFXA 2PDRA 3GDIA 4ETZA 4RQ9A 3RTYA 1ZHHB 3MQQA 4PHTA 5AVFA 3PBTA 1YKDA 3FPVA 2Y79A 2XRNA 3D72A 1TF1A 4GCZA 1ZTUA 2M7UA 5IT5A 5J4EA 3H7WB 2EWVA 2WKRA 3ZQ5A 2J80A 4Q0HA 3LIBA 1N9OA 4GS9A 4R38A 4AFIA 3IS2B 2JKRM 1T1CA 3C30A 3FC7A 5KSHA 3MQOA 3W2ZA 4GHIB 3F1PA 5DKKA 3H82A 1DP8A 1UGUA 2ZBBA 2W3HA 2ZOHA 4R6LA 3PR6A 3R7WA 1G28A 2QWSA 4WL9A 2V0UA 4NXEA 3MJQA 3UB8A 2Y8HA 2R78A 3R7WB 3KX0X 4OOLA 4YNRA 4I39A 2WKPA 2GX5A 1OTEA 2VZWA 2D01A 2Z6CA 4L9EA 3T4KA 3EQVA 1P0ZA 2XROA 4PKYA 5G4ZA 1S1ZA 4K08A 1T19A 2P7JA 3S7PA 3A0RA 4GHIA 4CLCC 2PYRA 2H28A 3D3OA 1MZUA 4MN7A 3EEAA 2M7VA 5L8MA 4LRZE 5AJGA 2M1CA 3K3CA 3PBOA 2ZOIA 2HJEA 2W1TB 2OWJA 4IUHA 2I9VA 3T50A 3E4QA 1NLYA 4Y2FA 3A0VA 1XJ3A 2OWHA 1NWZA 4EETB 3CITA 3EGDC 4CLCB 3RH8B 4EU0A 4WUJA 1P9WA 3KO6A 3NJAA 4BMWA 5HSQA 2P04A 1UWPX 5IS1A 3KYZA 3T4TA 3OCLA 4Q0IA 2JKRI 3P7NA 1OTBA 4JGOA 3CUEC 4QPRA 3BQAA 2D02A 3BW6A 3PXPA 5F69A 3H82B 3O5YA 2ZMVA 4Y5FA 2XSSA 4F3LB 2PD8A 2V1BA 3PBQA 2L4RA 4HY8A 4UEYA 4EUVA 4IUKA 4DMZA 4WN5A 2O9AA 4Z1WA 4DJ2A 3LR5A 3BY9A 4BBVA 1XFNA 4B93A 1GSXA 3KSIA 5DFYA 5EFWA 3T4LA 5TBMB 4EESA 1GSWA 3F1NB 4P6ZM 1XFQA 2KX6A 4HH3A 4I3IA 1UWNX 2IA2A 2XA7M 4EQ1A 3ZYTA 3TJZC 5HD3A 4JGRA 5DJTA 3V67A 3LIFA 1NRJA 2INWA 3LYXA 2LB9A 2KLIA 4OOMA 3EOIA 3PBNA 5LBRA 2VKSA 5HWTA 1S4SA 2PD7A 3C38A 2W3FA 2K31A 5A8BA 3A0SA 2PR5A 4JGQA 1OT9A 2W1TA 2V0WA 3OC2A 2QYBA 4G3KA 4UQIS 3C8CA 3DBAA 2GJ3A 4MN6A 5F68A 2W3EA 3MMHA 4LRXC 4GS9B 4XT2B 2FZ0A 4Y3IA 4E04A 5HDCA 1XJ2A 3FG8A 3H7WA 3LR3A 3ULFA 4NXFA 3T4QA 3NOTC 3K2NA 2VLGA 3OBFA 3OOVA 2W27A 2LB5A 3KSHA 3LI8A 3E4OA 4LLOB 3B33A 3IBJA 4EW7A 5C5KA 3F1PB 5TBMA 1D06A 2KDKA 4FOFA 1LSWA 1OT6A 4EXOA 4R3AA 4O0PA 2GNXA 1MKMA 3ICYA 1TS0A 5TJJA 2B02A 3KSGA 4HHDA 3TRCA 5HL6A 1T1BA 1OTAA 3R4KA 2NUPC 5F6AA 1XJ4A 3KYQA 1V9ZA 4DJ3A 2P08A 1S67L 3NOUC 2G7UA 3FPWA 3LI9A 4NEED 2QKPA 4M4XA 1W63M 2J3TD 3F1OB 2HV1A 3LIDA 3VV4A 1P97A 1GSVA 3GECA 4I38A 4P6ZS 3E98A 1W63Q 5HZHA 3CAXA 1X0OA 2VGLM 4GW9A 3IS2A 3H9WA 4I5SA 4LPZA 2QHKA 4R70A 2O9CA 2VV8A 3UB6A 1OTDA 2Z6DA 1VB6A 4HJ6A 2O9BA 3LUQA 1VHMA 5HWVA 4HI4A 1LT0A 1TS8A 4WELA 2NUTC 3VE3A 2KOIA 2VJWA 1TD5A 4IHQA 2VGLS 3VOLA 2MJ6A 3B47A 4L9GA 4LRYC 2YKHA 3TE8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JGQ A;  1OT9 A;  2JN7 A;  2JHE A;  2A24 B;  2V0U A;  1DP6 A;  3BY8 A;  4HJ4 A;  4HH2 A;  4NXE A;  3MJQ A;  1KOU A;  3EWK A;  3PHY A;  3UB8 A;  2V0W A;  2R78 A;  3CWF A;  3OLO A;  4H6J B;  3E4P A;  3C8C A;  3KX0 X;  2PHY A;  2GJ3 A;  3NHQ A;  4MN6 A;  5F68 A;  4I39 A;  5IU1 A;  2WKP A;  2Z6C A;  1DP9 A;  1OTE A;  2D01 A;  4L9E A;  5HDS A;  4F3L A;  5J3W A;  1DRM A;  5G4Y A;  4LRX C;  3MR0 A;  1P0Z A;  3IBR A;  4GS9 B;  4XT2 B;  3UMD A;  4PKY A;  5G4Z A;  1S1Z A;  2QJ7 A;  4K08 A;  1EW0 A;  1T19 A;  5DJU A;  3UB9 A;  2P7J A;  3A0R A;  3HJI A;  4BBT A;  4GHI A;  5HDC A;  4E04 A;  2PYR A;  1XJ2 A;  2H28 A;  1MZU A;  3FG8 A;  3G6O A;  3H7W A;  4WLA A;  4H6J A;  3MFX A;  2QJ5 A;  3NOT C;  4NXF A;  5F5Y A;  3ULF A;  4PKY G;  4HJ3 A;  2VLG A;  2W27 A;  4HP9 A;  3UE6 A;  4LRZ E;  1N9N A;  1BYW A;  2M1C A;  2PR6 A;  1WA9 A;  3K3C A;  3LI8 A;  3E4O A;  1Y28 A;  3B33 A;  4HQA A;  4I3J A;  4LLO B;  5J7E A;  2V1A A;  3C2W A;  1T18 A;  2ZOI A;  4WF0 A;  1V9Y A;  2A24 A;  2OWJ A;  2I9V A;  3F1P B;  5TBM A;  1D06 A;  3E4Q A;  3T50 A;  2KDK A;  3K3D A;  4NXB A;  3HJK A;  3A0V A;  1XJ3 A;  2VV7 A;  2OWH A;  1NWZ A;  1LSW A;  1OT6 A;  2PYP A;  3NOP C;  4R38 A;  1S66 L;  4EET B;  4EXO A;  5AVE A;  4EEP A;  4R3A A;  4KQD A;  4EER A;  1JNU A;  4B9O A;  3RH8 B;  4WUJ A;  3NJA A;  3ICY A;  1TS0 A;  5HSQ A;  1UWP X;  2VV6 A;  5IS1 A;  4BBU A;  3LIA A;  4XT2 A;  3P7N A;  1OTB A;  5HD5 A;  2WKQ A;  4EW7 A;  4I3A A;  2B02 A;  5DKL A;  1D7E A;  4JGO A;  2EA9 A;  1F98 A;  3LIC A;  3CLO A;  2CMN A;  1TS6 A;  3F1N A;  3LIE A;  2D02 A;  3EEH A;  4HHD A;  1T1B A;  2W0N A;  5F69 A;  4KUO A;  1S4R A;  1OTA A;  3BWL A;  3H82 B;  3F1O A;  4HIA A;  5F6A A;  4F3L B;  3A0S A;  2VEA A;  2L1M A;  1XJ4 A;  1F9I A;  4DJ3 A;  1V9Z A;  2PD8 A;  2V1B A;  1S67 L;  4EEU A;  3NOU C;  3LI9 A;  5HDD A;  1LSV A;  2L4R A;  2QKP A;  4HY8 A;  4HNB A;  3MXQ A;  4M4X A;  1N9L A;  1T1A A;  1OJG A;  3F1O B;  2HV1 A;  2BAS A;  3LID A;  5HWW A;  5A8B A;  1P97 A;  1GSV A;  1LSX A;  3GEC A;  4WN5 A;  2PDR A;  3GDI A;  4I38 A;  4RQ9 A;  3RTY A;  1ODV A;  2K7S A;  3MQQ A;  4DJ2 A;  5AVF A;  3CAX A;  1X0O A;  3BY9 A;  1XJ6 A;  5HZH A;  4GW9 A;  4BBV A;  3IS2 A;  1XFN A;  3D72 A;  1GSX A;  3H9W A;  4GCZ A;  4I5S A;  4LPZ A;  5J4E A;  1OJ5 A;  3H7W B;  5EFW A;  2QHK A;  4R70 A;  5TBM B;  3UME A;  4EES A;  3PYP A;  2WKR A;  4KUK A;  3ZQ5 A;  2J80 A;  2VV8 A;  1GSW A;  3F1N B;  4NXG A;  3UB6 A;  1OTD A;  1XFQ A;  3VE4 A;  2KX6 A;  3LIB A;  5KIZ A;  1N9O A;  2V9A A;  2Z6D A;  4GS9 A;  1UWN X;  1LL8 A;  3IS2 B;  4HH3 A;  1VB6 A;  4HJ6 A;  1T1C A;  3FC7 A;  4EQ1 A;  4HP4 A;  3MQO A;  3LUQ A;  2OOL A;  4GHI B;  3F1P A;  5HD3 A;  5DKK A;  4JGR A;  5HWV A;  3H82 A;  1DP8 A;  4HI4 A;  4L9F A;  3LIF A;  5DJT A;  1LT0 A;  1UGU A;  4YWZ A;  1TS8 A;  1OTI A;  4I3I A;  3UB7 A;  2ZBB A;  4MN5 A;  2INW A;  3LYX A;  2L0W A;  3VE3 A;  2ZOH A;  5I5L A;  4R6L A;  3SW1 A;  2YKF A;  1S1Y A;  3VOL A;  5HWT A;  4JGP A;  1S4S A;  2PD7 A;  1G28 A;  4HOI A;  4L9G A;  4LRY C;  2QWS A;  1TS7 A;  2YKH A;  2PR5 A;  4WL9 A; 
#chains in the Genus database with same CATH topology
 1BUE A;  4E3I A;  4RX2 A;  1HTZ A;  5EOO A;  4N1X A;  4RX3 A;  3UB5 P;  5IU1 A;  3SOI A;  3WS0 A;  3FWL A;  5J3W A;  1XX2 A;  2PRF A;  4L0L A;  4MBK A;  5CEC A;  3ZDJ A;  2XD1 A;  3PBS A;  1IFQ A;  4H6J A;  3MFX A;  2OLV A;  2HGV A;  5HPI A;  1D1J A;  1W8Y A;  1QMF A;  1N9N A;  1BYW A;  3G31 A;  1HVB A;  1T18 A;  1V9Y A;  4PM8 A;  2PBD P;  3RFB A;  2H0Y A;  2XQZ A;  3BFF A;  4KQD A;  2ZD8 A;  1CEF A;  3UDX A;  2RCX A;  2WZZ A;  2XD5 A;  5GLB A;  4S2M A;  1GA0 A;  3MF0 A;  4PPR A;  1FCN A;  3LIA A;  4MNR A;  1H8Z A;  1VET B;  5TGF A;  1ERM A;  3S7N A;  1F98 A;  5CTN A;  2ZL1 A;  3IXG A;  4YIN A;  1H3Q A;  4Y17 A;  4C3Q A;  3A3D A;  2HPB A;  1T1A A;  3T4S A;  2BAS A;  5HWW A;  3RJU A;  4A5R A;  3A3E A;  2Y55 A;  5EE8 A;  1ODV A;  1DY6 A;  3BLS A;  3UME A;  3PYP A;  2WKI A;  3ZGA B;  4HP4 A;  5GL9 A;  4OQH A;  4L9F A;  4P0M A;  1H8M A;  4HES A;  4MN5 A;  4S2K A;  4QD4 A;  4UAA A;  5EOE A;  2O99 A;  4JGP A;  2JN7 A;  3LY4 A;  4HJ4 A;  3G35 A;  3EWK A;  1I5Q A;  4WEJ A;  3LR0 A;  3RXX A;  3CWF A;  3JPU A;  2PHY A;  1YAX A;  5AQB A;  3QHY A;  4GD8 A;  4PMA A;  1STZ A;  1BT5 A;  3HRE A;  4P87 A;  3SH7 A;  1TEM A;  4FUW A;  4PKY G;  2H10 A;  4U0T A;  5KZH A;  2HDQ A;  3LFV A;  3G30 A;  3O88 A;  1NJ4 A;  3OCN A;  2J3T C;  2HDS A;  5AVE A;  5AQA A;  3T4J A;  1PZP A;  4O01 A;  4BEN A;  1E4D A;  4FSF A;  5FQI A;  2ZQC A;  2EA9 A;  4P85 A;  3CLO A;  2P74 A;  4LFU A;  1N9B A;  4PAU A;  2OAP 1;  4YOF A;  3PBR A;  1LSV A;  3QNB A;  1I2S A;  3IXD A;  3UO9 A;  5FAO A;  1XA7 A;  4F94 A;  3LEQ A;  3FPV A;  2Y79 A;  3D4F A;  3D72 A;  5IT5 A;  3SZT A;  3WS4 A;  4AFI A;  4FTX A;  3C30 A;  3W2Z A;  2Y2Q A;  2WK0 A;  2ZBB A;  3ZFZ A;  3MKF A;  1SHV A;  2ZL1 B;  1ES2 A;  3V50 A;  4FCF A;  3HLG A;  1O7E A;  3KX0 X;  4OOL A;  4I39 A;  2WKP A;  2VZW A;  3P98 A;  1P0Z A;  1K0K A;  4PKY A;  3IXH A;  3S7P A;  3A0R A;  5EV0 A;  3D3O A;  2OV5 A;  1K6R A;  3ZNY A;  3UNW A;  4MN7 A;  2Y2M A;  4X1M A;  5EM0 A;  4LRZ E;  1KVM A;  5AJG A;  5F82 A;  3SS5 A;  2OWJ A;  2I9V A;  3T50 A;  3DWZ A;  4Y2F A;  3A0V A;  1NWZ A;  3PTE A;  3EGD C;  4CLC B;  1JTD A;  1ES5 A;  3RH8 B;  3NJA A;  1UWP X;  3KYZ A;  3N7W A;  1SKF A;  4GDN A;  1FR6 A;  4JGO A;  3BQA A;  4XUZ A;  3PXP A;  5DF7 A;  4MEZ A;  5FQQ A;  2ZMV A;  1M40 A;  2PD8 A;  3GMW A;  2X71 A;  5FAT A;  4UEY A;  5D3O A;  2UV0 E;  2V1Z A;  4OQ0 A;  1NXY A;  3BY9 A;  3CPT B;  1XFN A;  3V3S A;  4B93 A;  4GOG A;  4KEN B;  3BEC A;  5M1A A;  1XFQ A;  3VFH A;  2IA2 A;  2XA7 M;  4UHU A;  3ZYT A;  5DJT A;  1NRJ A;  3VSL A;  2INW A;  4LEN A;  1BUL A;  3A3F A;  3PBN A;  3AGF A;  2PD7 A;  3A0S A;  1FR1 A;  3LCE A;  3UY6 A;  3Q7V A;  1W8Q A;  3Q7Z A;  3OC2 A;  1BTL A;  3C8C A;  3DBA A;  2GJ3 A;  4U0X A;  2FFY A;  5GHZ A;  1F2K A;  4S2N A;  4GS9 B;  4QY6 A;  5GLA A;  4Y3I A;  4E04 A;  5HDC A;  1XJ2 A;  1ESI A;  3T4Q A;  3T1X A;  2IWB A;  4QB8 A;  2R9W A;  2Y2O A;  3LI8 A;  3E4O A;  4LLO B;  3B33 A;  3IBJ A;  3ZVW A;  2ZM2 A;  2Y2J A;  4WMC A;  3WS5 A;  2H0T A;  2GNX A;  1TS0 A;  4XXR A;  1Q2P A;  2C6W B;  3G2Z A;  3KYE A;  4IED A;  5DF8 A;  2NUP C;  4X68 A;  1XJ4 A;  3IH8 A;  4DJ3 A;  1V9Z A;  2P08 A;  2G7U A;  3LI9 A;  4NEE D;  5CRF A;  4M4X A;  2J3T D;  3V39 A;  1H0M A;  3F1O B;  3VV4 A;  1JVJ A;  3GEC A;  4OLG A;  1W63 Q;  5HZH A;  1KGE A;  5M18 A;  4GW9 A;  4I5S A;  5GLC A;  4X56 A;  3VP0 A;  1TDG A;  2O9C A;  2Y91 A;  1G6A A;  3G2Y A;  1AXB A;  1VB6 A;  4WZ5 C;  3S1Y A;  2J7V A;  3OZH A;  3LUQ A;  2VGK A;  5FI6 A;  5HWV A;  2WGW B;  1TS8 A;  4R4S A;  5F1G A;  1TD5 A;  4IHQ A;  2MJ6 A;  4L9G A;  4DF6 A;  3TE8 A;  3CUE A;  1DP6 A;  3BY8 A;  3BFC A;  3UE3 A;  2JKT I;  3E0Y A;  4ARZ B;  2VX8 A;  3CI6 A;  2UWX A;  5DTS A;  5HX9 A;  4CPK A;  1CF0 A;  1K4E A;  5A92 A;  2EX6 A;  4WLA A;  5F5Y A;  1KDW A;  4OOY A;  4N9K A;  4IVI A;  4S2P A;  5CGW A;  4B4X A;  5I94 A;  4NXG A;  4E3J A;  1LI9 A;  4WEK A;  2K2N A;  4B9O A;  4R23 A;  3SS4 A;  3PAG A;  1KE0 A;  1MC0 A;  3WRZ A;  2GZA A;  3QP4 A;  1IYO A;  2CMN A;  3LIE A;  3F1O A;  3FZC A;  1PYY A;  3V3R A;  2WGI A;  4EQI A;  2HJ9 C;  4E3K A;  1TDL A;  3VP3 A;  1OJG A;  2XA7 S;  5FDH A;  2FH5 A;  2EX8 A;  4O8G A;  4LV2 A;  3C7V A;  2K7S A;  4OPQ A;  1ACF A;  1GHM A;  2Y2P A;  1YQS A;  1AWI A;  4KUK A;  4CQH A;  5A90 A;  2V9A A;  1W7F A;  5EVI C;  4Y0U A;  5EPH A;  4S2O A;  1K57 C;  4BD0 A;  4EBP A;  2W3G A;  3M6B A;  1S1Y A;  3N8L A;  4HOI A;  1E3U A;  1IKG A;  2HF6 A;  5MC7 A;  1KOU A;  2B18 A;  2Z2M B;  4GB7 A;  3Q81 A;  3ITA A;  5EEC A;  2JKT M;  3UMD A;  3V5M A;  5CXW A;  3T4O A;  3UB9 A;  1K55 C;  3G6O A;  3S7O A;  1L3L A;  3QP8 A;  1K25 A;  4MLL A;  4I3J A;  1Y28 A;  4BLM A;  3NY4 A;  1YSQ A;  1G6O A;  2P9V A;  1ZG4 A;  1C3B A;  3UDI A;  3O3V A;  2WGW A;  1NYY A;  2AVX A;  4KQO A;  5DKL A;  1PNE A;  4OQI A;  2OLU A;  3DW0 A;  3CMZ A;  5M19 A;  4MMN A;  1S4R A;  5DTT A;  2VGJ A;  1ZG6 A;  2L1M A;  2VEA A;  1M6K A;  3JVV A;  2WKH A;  4N9L A;  5HDD A;  4ARZ A;  4KZA A;  3ISG A;  1ERQ A;  1YMS A;  4Y15 A;  1FCM A;  4OPY A;  3QP1 A;  3HUN A;  2XDM A;  1TF1 A;  2M7U A;  1ZTU A;  5J4E A;  4BL3 A;  2DCF A;  2EWV A;  1H8Y A;  2WKR A;  4R3B A;  4Q0H A;  1N9O A;  3C4O A;  3BLM A;  5E2E A;  1XGJ A;  1T1C A;  1GCE A;  3MQO A;  1VEU A;  4GHI B;  3F1P A;  5FAS A;  1KGF A;  3LO7 A;  4JBF A;  4R6L A;  4PM7 A;  3MXS A;  1BLC A;  1JWV A;  3LY3 A;  1SDE A;  1PZO A;  4Y13 A;  4KQR A;  5EVI A;  4ZJ3 A;  4HBU A;  5JYP A;  1K55 A;  3IWI A;  2D01 A;  3WRT A;  3FYZ A;  4X1L A;  5EVI B;  5CTM A;  1Z6F A;  3BYD A;  1MZU A;  1MPL A;  4DXB A;  2M1C A;  4R1G A;  1HLU P;  3IF6 A;  2XLN A;  1XJ3 A;  2OWH A;  1XPB A;  4X69 A;  4EU0 A;  3KO6 A;  2A3U A;  5IS1 A;  3T4T A;  3OPP A;  3P7N A;  3IF6 B;  3CG5 A;  5CED A;  1Q2Q A;  3CUE C;  1DJC A;  1CJF A;  2D02 A;  3BW6 A;  4Y5F A;  3DTI A;  2XSS A;  1VEU B;  2V1B A;  4ZJ1 A;  2HP6 A;  2WYX A;  4ZDX A;  4R4R A;  4HY8 A;  3DAV A;  2WAD A;  4EUV A;  2WAF A;  1FQG A;  1KGG A;  1LL9 A;  5BOH A;  2Z2L B;  4WN5 A;  2ZC7 A;  3ZCZ A;  2HP5 A;  4DJ2 A;  3LR5 A;  3HLE A;  5U47 A;  1GSX A;  1CI9 A;  4PM9 A;  3T4L A;  5L09 A;  4EES A;  4JF5 A;  1OME A;  4DE1 A;  4P6Z M;  1QME A;  1NZO A;  1VQQ A;  3V67 A;  3W4O A;  3LYX A;  3MFD A;  2LB9 A;  2KLI A;  1NZU A;  4X55 A;  5FAQ A;  2JE5 A;  5LBR A;  2VKS A;  5FEF A;  4GNU A;  1G68 A;  2PU2 A;  3MSH A;  2W3F A;  5A8B A;  1RGY A;  4KZ7 A;  2V0W A;  2QYB A;  2ZM8 A;  4MN6 A;  2JBF A;  3C5A A;  3W4Q A;  3CZD A;  4XT2 B;  1EWZ A;  4DXC A;  5FA7 A;  3O86 A;  4JXW A;  2VLG A;  1RCJ A;  5IHV A;  3KSH A;  3F1P B;  5TBM A;  1XA1 A;  1LSW A;  1OT6 A;  4R0Q A;  3IT9 A;  3Q82 A;  3OPL A;  1RP5 A;  2ZLY A;  1FSW A;  1GHP A;  3KSG A;  4DDY A;  4HHD A;  3HUM A;  5HL6 A;  2EFU A;  3ZG0 A;  4DKI A;  3KYQ A;  1S67 L;  3NOU C;  1EI5 A;  4UA9 A;  4EBN A;  1ESU A;  1W63 M;  4GKU A;  1E3U D;  2EX2 A;  5E43 A;  1NY0 A;  4P6Z S;  2G2W A;  4D2O A;  3CAX A;  3FV7 A;  2VGL M;  3IS2 A;  3VSK A;  3WWX A;  3NUL A;  4R70 A;  2VV8 A;  3UB6 A;  5CER A;  3P09 A;  3UE1 A;  2O9B A;  4KG2 A;  4S2J A;  2Q0O A;  3VE3 A;  2J9P A;  2I72 A;  2EXB A;  4WBG A;  1CK3 A;  4KZ5 A;  3B47 A;  2YKH A;  2JHE A;  2A24 B;  1IOU A;  3VFF A;  1PI5 A;  4ZBE A;  3DWK A;  1E25 A;  3BJN A;  2Y2N A;  1DP9 A;  2GDN A;  5EVI D;  4DN0 A;  1DRM A;  5G4Y A;  4LV3 A;  3SH8 A;  4ID4 A;  5FI7 A;  4P6B A;  4II7 A;  5FQ9 A;  1YLT A;  2XR0 A;  2PR6 A;  5K5B A;  3B42 A;  3MXR A;  5HAI A;  1BLS A;  3VOZ A;  3LEZ A;  1KVL A;  2XEP A;  2VV6 A;  4KZB A;  2VA0 A;  3HVF A;  1OPX A;  3IWO A;  3EEH A;  4JXS A;  2C5W B;  4OP5 A;  4DE0 A;  3HLF A;  5KMW A;  4JF6 A;  3CPT A;  1YT4 A;  1F5M A;  3MXQ A;  1NYM A;  1LSX A;  3JYI A;  1WYC A;  3M6H A;  1P9R A;  1XJ6 A;  1GA9 A;  4BL2 A;  3IX8 A;  5HAQ A;  1OJ5 A;  1W79 A;  2R9X A;  1K4F A;  1MKI A;  1S0W A;  5KIZ A;  3VE4 A;  2XK1 A;  3TW8 A;  1LL8 A;  2XFS A;  4Q8I A;  4EUZ A;  3EGX C;  2ZC3 B;  2DRW A;  5FAP A;  3G32 A;  2OOL A;  3EQU A;  1Y4O A;  2V2F F;  4EBL A;  3UB7 A;  3ZG8 B;  4OVD A;  3BQ8 A;  4OPZ A;  2Q9N A;  5I5L A;  3GR2 A;  3SW1 A;  2YKF A;  1CEG A;  3JVU A;  3GSG A;  4QU3 A;  4S2N C;  4MDZ A;  1TS7 A;  1A0K A;  3MKE A;  4HH2 A;  2W3D A;  2P9V B;  3NHQ A;  5HDS A;  4GJ4 A;  3MR0 A;  4GZB A;  5FDS A;  2QJ7 A;  3P01 A;  4JXV A;  2H5S A;  2WZX A;  4MBF A;  2A2L A;  2QJ5 A;  3IXB A;  1ONH A;  4DRT A;  4E3N A;  3UE6 A;  1J9M A;  5L10 A;  5E2G A;  3C2W A;  4CLC A;  4DDS A;  2VK3 A;  4NXB A;  3HJK A;  2VV7 A;  2PYP A;  3NOP C;  2IWD A;  4LCL A;  1JNU A;  5EVL A;  1HD8 A;  3HLD A;  1IEL A;  4CLC D;  2Y2I A;  4GD6 A;  4XT2 A;  5HPF A;  3T1Q B;  2ZMA A;  1D7E A;  3L7H A;  2PU4 A;  1DJB A;  2PT7 A;  4X25 A;  4IJG A;  5L07 A;  5TFQ A;  3BWL A;  3T12 B;  5FSR A;  3GTC A;  2ZMF A;  4MCW A;  3HL9 A;  1XKZ A;  4H8R A;  2WKE A;  1PW1 A;  5DFX A;  1LLB A;  4UA6 A;  4WZ5 A;  4KZ3 A;  2PDR A;  2Y2L A;  4ETZ A;  4RQ9 A;  3RTY A;  3W4P A;  5AVF A;  2ZJ9 A;  1YKD A;  3PBT A;  3C7U A;  4OH0 A;  3H7W B;  2E8J A;  3IH9 A;  3ZQ5 A;  3LIB A;  4R38 A;  3Q1F A;  1SCW A;  1YLW A;  2JKR M;  5CGX A;  5KSH A;  5CGS A;  5DKK A;  1DP8 A;  1L0E A;  1UGU A;  2ZOH A;  3PR6 A;  3OPR A;  1JWZ A;  1G28 A;  4WMC D;  4WL9 A;  4NXE A;  4ESP A;  3T1R A;  3U4L P;  1PI4 A;  4YNR A;  2Z6C A;  2GX5 A;  1OTE A;  4L9E A;  4K08 A;  1T19 A;  1IYQ A;  2P7J A;  2PYR A;  3BFD A;  2M7V A;  4DE2 A;  3NDE A;  1JWP A;  4JLF A;  3O87 A;  3QP5 A;  3PBO A;  2ZOI A;  2W1T B;  1LI0 A;  4IUH A;  3ZVT A;  1LL5 A;  3E2K A;  3E4Q A;  1SKO B;  1ALQ A;  4EET B;  5E2H A;  3NDG A;  4BMW A;  5FEG A;  3S22 A;  1YLP A;  3D9Y A;  3HBR A;  2JKR I;  1OTB A;  2ZM0 A;  4IVK A;  4IBR A;  5J8X A;  1PWG A;  4QPR A;  2Y2K A;  1G5U A;  3O5Y A;  3M2J A;  2B5R A;  2X01 A;  5DTK A;  1KDS A;  1MWU A;  1YLZ A;  3PBQ A;  4IUK A;  4UA7 A;  2OSU A;  4PM6 A;  2J9O A;  2ZC6 B;  4E3O A;  1FCO A;  2O9A A;  2XF3 A;  3MZF A;  4BBV A;  5DFY A;  4Z9Q A;  5EFW A;  3NBL A;  1GSW A;  2E8I A;  3UDF A;  1BZA A;  3MZD A;  4HH3 A;  4I3I A;  1UWN X;  4EQ1 A;  1CQA A;  3TJZ C;  3ZHH A;  5HD3 A;  3LIF A;  4OOM A;  5HWT A;  1W5D A;  2PR5 A;  4JGQ A;  1OT9 A;  4ZTK A;  2W1T A;  1ES4 A;  4LGW A;  2WGV A;  2A49 A;  5GHX A;  4G3K A;  4UQI S;  1L0D A;  5FQM A;  3MMH A;  4JXG A;  3QP6 A;  4KZ9 A;  2FZ0 A;  4ZAM A;  1ZKJ A;  4C75 A;  3FG8 A;  3H7W A;  3ULF A;  4NXF A;  4S2I A;  2IWC A;  3NI9 A;  5FI2 A;  3E2L A;  4GN2 A;  3SS3 A;  1D06 A;  2KDK A;  4EXO A;  4Y0O A;  4O0P A;  3NEC A;  5TJJ A;  2ZQ7 A;  1J3W A;  2ZQ8 A;  1N4O A;  1PRQ A;  3CJM A;  1PFL A;  4QJG A;  4KZ6 A;  2B02 A;  3ZG5 A;  4B4Z A;  1IKI A;  3TRC A;  4WM9 A;  3MZE A;  3IF5 A;  3MS6 A;  2EXA A;  2V8F A;  5CHU A;  5AQ7 A;  2DNS A;  4B88 A;  5F6A A;  4Y7P A;  4KZ4 A;  1O07 A;  2CC1 A;  2QKP A;  2HDU A;  5DVA A;  2HDR A;  1BLP A;  3WS2 A;  3OPH A;  4MBH A;  4I38 A;  3G34 A;  3E98 A;  4PM5 A;  4RVA A;  3SH9 A;  1OTD A;  4D60 A;  3IHA A;  1YLJ A;  4HJ6 A;  5FQJ A;  4HI4 A;  1LT0 A;  4WEL A;  2NUT C;  4K91 A;  4M3K A;  2KOI A;  4KZ8 A;  2PAV P;  5L2F A;  3VOL A;  1GHI A;  4HBT A;  3QP2 A;  1WE4 A;  5FL3 A;  4N1H A;  5HAR A;  1BLH A;  3ZNT A;  3ZG7 B;  3A3J A;  1YSP A;  5AQ9 A;  3FKV A;  4K0W A;  5DF9 A;  4E3L A;  4KQQ A;  4O7D A;  3PAE A;  4Y0T A;  1BSG A;  4HP9 A;  2WAE A;  1WA9 A;  1XP4 A;  4E3M A;  4WF0 A;  1NLZ A;  2V20 A;  2J3W A;  1S66 L;  1L0G A;  4EER A;  1CI8 A;  5CX7 A;  4QHC A;  3IQA A;  3HCY A;  1XGI A;  2WKQ A;  4I3A A;  2W1R A;  4ZJ2 A;  3BRM A;  3F1N A;  3VP4 A;  1ES3 A;  2W0N A;  2JKG A;  4ETX A;  3GVB A;  3U2A A;  3IF6 C;  4G3V A;  4HIA A;  4EV4 A;  3KSF A;  4NKP A;  5EVE A;  1L2S A;  3TSG A;  3NCK A;  4UQI M;  1N9L A;  4X6T A;  1PWC A;  4G3W A;  1SDN A;  2QZ6 A;  2DMW A;  1JTG A;  3BM6 A;  3DTK A;  3N4I A;  4FH4 A;  1MBL A;  1LHY A;  3T1S A;  1YMX A;  1OTI A;  4Q0J A;  2L0W A;  3LR4 A;  4BJP A;  4LV1 A;  3UPN A;  3N6I A;  4ZRR A;  3UN7 A;  1IEM A;  3I7J A;  4YWZ A;  3PHY A;  1ZC2 A;  1H5X A;  3HLB A;  3E4P A;  4NK3 A;  1K6S A;  4F3L A;  5HFO A;  4BWI A;  3IBR A;  2ZQ9 A;  5DJU A;  1EW0 A;  3HJI A;  4BBT A;  1K54 C;  3WS1 A;  4HJ3 A;  1PWD A;  4EWF A;  5EUA A;  5HW3 A;  4HQA A;  5J7E A;  2EWW A;  4QWO A;  2V1A A;  3IHB A;  3CHW P;  2A24 A;  3K3D A;  3S7Q A;  2XGN A;  3OLO A;  4H6J B;  4EEP A;  5KSC A;  2OAQ 1;  1KE4 A;  4GLQ A;  3G4P A;  5TR7 A;  4XUX A;  3VMA A;  4E6W A;  2FFF B;  4JPM A;  4BBU A;  5HD5 A;  3VP2 A;  4RA7 A;  3IX3 A;  4ME4 A;  3LIC A;  5CHJ A;  2O0Y A;  1TS6 A;  3Q7V B;  4KUO A;  1S6R A;  3NC8 A;  1FIK A;  4C6Y A;  3MQ0 A;  5A93 A;  1F9I A;  2G2U A;  4EEU A;  3W8K A;  1PIO A;  2Y4A A;  4HNB A;  4OON A;  1MXO A;  2ZQD A;  5E2F A;  4CLC E;  1DJA A;  1PW8 A;  3GDI A;  2ACG A;  4NET A;  1ZHH B;  3MQQ A;  4PHT A;  1K56 A;  2Q9M A;  4IBX A;  2XRN A;  4GCZ A;  1Z09 A;  3C4P A;  4BQM A;  1YLY A;  4OPR A;  2HZ5 A;  4R3J A;  2J80 A;  4GS9 A;  3NIA A;  3IS2 B;  5CHM A;  1SZV A;  3FC7 A;  2Y2G A;  1MWS A;  3AGE A;  5GHY A;  1MWR A;  3H82 A;  3ITB A;  4KG6 A;  2W3H A;  2HP9 A;  3R7W A;  1Y54 A;  3TG9 A;  2QPN A;  2QWS A;  2V0U A;  3MJQ A;  3UB8 A;  4FD8 A;  2Y8H A;  2R78 A;  3ZG9 B;  3R7W B;  3T4K A;  3EQV A;  4LCM A;  2XRO A;  1XXM A;  1NRF A;  5G4Z A;  1S1Z A;  3FKW A;  4GHI A;  4CLC C;  2H28 A;  3B3X A;  3EEA A;  5EM1 A;  1FOF A;  3DTM A;  1SKO A;  5FQK A;  5L8M A;  5JYO A;  3BFG A;  3K3C A;  3IWQ A;  1L0F A;  2BLS A;  2HJE A;  2EX9 A;  3L9K A;  1NLY A;  4N92 A;  1VM1 A;  3CIT A;  2PBY A;  1K57 A;  5A91 A;  4YFM A;  2WUQ A;  4WUJ A;  1P9W A;  4WYY A;  3HLC A;  1FSY A;  3VP1 A;  5HSQ A;  2P04 A;  3OCL A;  4Q0I A;  3RXW A;  1FIL A;  3TOI A;  5F69 A;  3H82 B;  1I2W A;  4F3L B;  2L4R A;  2BG1 A;  4DMZ A;  1KE3 A;  2X02 A;  5F83 A;  4Z1W A;  1YPR A;  1IYP A;  3KSI A;  4DE3 A;  3GV9 A;  5TBM B;  3F1N B;  2KX6 A;  4JKT A;  2EFX A;  3HLW A;  4K0X A;  4JGR A;  3S4X A;  3LGO A;  3AGD A;  3BFE A;  3EOI A;  1U60 A;  4RYE A;  5HL1 A;  3A3I A;  3M2K A;  1S4S A;  3C38 A;  4CJN A;  2K31 A;  5HAP A;  3N8R A;  5CEB A;  2ZC4 B;  2RL3 A;  5F68 A;  2W3E A;  1ERO A;  4LRX C;  4GDB A;  3BEB A;  2BTF P;  4BD1 A;  4KG5 A;  3LR3 A;  3NOT C;  3K2N A;  3OBF A;  3OOV A;  2W27 A;  3UE0 A;  5F1F A;  3N8S A;  2LB5 A;  1RGZ A;  2XH9 A;  1K54 A;  4EW7 A;  5C5K A;  1K38 A;  2XFT A;  2J8Y A;  4S2L A;  1HZO A;  4FOF A;  1MY8 A;  4OP8 A;  4R3A A;  4OKP A;  1MKM A;  3ICY A;  4E6X A;  3VOY A;  1YM1 A;  5G18 A;  3GQZ A;  1TVF A;  4JF4 A;  1ONG A;  3UPO A;  1T1B A;  4X53 A;  2JC7 A;  2ZQA A;  4U3T A;  4OLD A;  1OTA A;  3R4K A;  4HEF A;  1MWT A;  1VET A;  3GRJ A;  3UPP A;  3HUO A;  4LV0 A;  3FPW A;  2B95 A;  1WYB A;  3LID A;  2HV1 A;  2JKF A;  5GLD A;  1P97 A;  1GSV A;  2ZC5 B;  1X0O A;  3IX4 A;  3H9W A;  4LPZ A;  2V8C A;  4WZ4 A;  3MBZ A;  3Q07 A;  4NG2 A;  3DTE A;  4QY5 A;  2QHK A;  2QMI A;  1K56 D;  2Y59 A;  2Z6D A;  2JCH A;  1IYS A;  3QNC A;  2Y2H A;  1VHM A;  4FH2 A;  2VJW A;  2VGL S;  4OQG A;  4LRY C; 
#chains in the Genus database with same CATH homology
 3CUE A;  2JHE A;  2A24 B;  1IOU A;  1DP6 A;  3BY8 A;  3UE3 A;  2JKT I;  5FL3 A;  3E0Y A;  4ARZ B;  2VX8 A;  3CI6 A;  5IU1 A;  3BJN A;  1YSP A;  1DP9 A;  4DN0 A;  5J3W A;  1DRM A;  5G4Y A;  4L0L A;  5DF9 A;  3PBS A;  1IFQ A;  4WLA A;  4H6J A;  3MFX A;  5F5Y A;  2HGV A;  4II7 A;  5HPI A;  4HP9 A;  1N9N A;  1BYW A;  2PR6 A;  1WA9 A;  5K5B A;  1T18 A;  4WF0 A;  1V9Y A;  3B42 A;  3RFB A;  1NLZ A;  4NXG A;  2J3W A;  1S66 L;  4WEK A;  4KQD A;  4EER A;  5CX7 A;  2K2N A;  4B9O A;  3MF0 A;  2VV6 A;  3HCY A;  3LIA A;  2VA0 A;  2WKQ A;  1MC0 A;  4I3A A;  1OPX A;  2GZA A;  2W1R A;  3S7N A;  1F98 A;  2CMN A;  3F1N A;  3LIE A;  3EEH A;  2W0N A;  4ETX A;  3U2A A;  4G3V A;  3F1O A;  4HIA A;  1H3Q A;  3KSF A;  4NKP A;  2HJ9 C;  1F5M A;  3MXQ A;  4UQI M;  1N9L A;  1T1A A;  1OJG A;  2XA7 S;  3T4S A;  2BAS A;  2FH5 A;  4G3W A;  5HWW A;  4O8G A;  1LSX A;  1ODV A;  2K7S A;  1P9R A;  1XJ6 A;  2DMW A;  1OJ5 A;  3UME A;  3PYP A;  4KUK A;  4CQH A;  5KIZ A;  3VE4 A;  3TW8 A;  2V9A A;  1LL8 A;  3EGX C;  4HP4 A;  2OOL A;  3EQU A;  4L9F A;  3UB7 A;  1OTI A;  1H8M A;  3BQ8 A;  4MN5 A;  4Q0J A;  2L0W A;  2W3G A;  3LR4 A;  4BJP A;  5I5L A;  3SW1 A;  2YKF A;  2O99 A;  1S1Y A;  3JVU A;  4ZRR A;  4HOI A;  4MDZ A;  4JGP A;  1TS7 A;  4YWZ A;  2HF6 A;  2JN7 A;  4HJ4 A;  4HH2 A;  5MC7 A;  1KOU A;  2W3D A;  3EWK A;  3PHY A;  2B18 A;  3LR0 A;  4WEJ A;  3CWF A;  3E4P A;  3NHQ A;  2PHY A;  1YAX A;  4F3L A;  5HDS A;  4GJ4 A;  2JKT M;  4BWI A;  3MR0 A;  3IBR A;  3UMD A;  1STZ A;  5DJU A;  2QJ7 A;  1EW0 A;  3P01 A;  3T4O A;  3UB9 A;  3HJI A;  4BBT A;  3G6O A;  2A2L A;  2QJ5 A;  3S7O A;  4PKY G;  4HJ3 A;  3UE6 A;  4I3J A;  1Y28 A;  3LFV A;  4HQA A;  5J7E A;  2EWW A;  2V1A A;  3C2W A;  4CLC A;  2A24 A;  3OCN A;  2J3T C;  1YSQ A;  3K3D A;  4NXB A;  3S7Q A;  3OLO A;  3HJK A;  2VV7 A;  4H6J B;  2PYP A;  1G6O A;  3NOP C;  5AVE A;  4EEP A;  2OAQ 1;  4GLQ A;  1JNU A;  3T4J A;  4CLC D;  4O01 A;  4BBU A;  4XT2 A;  5HPF A;  5HD5 A;  4FSF A;  4KQO A;  5DKL A;  4ME4 A;  1D7E A;  2EA9 A;  3LIC A;  3CLO A;  2O0Y A;  1TS6 A;  2PT7 A;  4IJG A;  4MMN A;  4KUO A;  1S4R A;  3BWL A;  4PAU A;  2OAP 1;  2VEA A;  2L1M A;  3MQ0 A;  4YOF A;  1F9I A;  2ZMF A;  3JVV A;  3PBR A;  4MCW A;  4EEU A;  5HDD A;  1LSV A;  4HNB A;  4ARZ A;  4CLC E;  5DFX A;  2PDR A;  3GDI A;  4ETZ A;  4RQ9 A;  3RTY A;  1ZHH B;  3MQQ A;  4PHT A;  5AVF A;  3PBT A;  1YKD A;  3FPV A;  2Y79 A;  2XRN A;  3D72 A;  1TF1 A;  4GCZ A;  1ZTU A;  2M7U A;  5IT5 A;  5J4E A;  3H7W B;  2EWV A;  2WKR A;  3ZQ5 A;  2J80 A;  4Q0H A;  3LIB A;  1N9O A;  4GS9 A;  4R38 A;  4AFI A;  3IS2 B;  2JKR M;  1T1C A;  3C30 A;  3FC7 A;  5KSH A;  3MQO A;  3W2Z A;  4GHI B;  3F1P A;  5DKK A;  3H82 A;  1DP8 A;  1UGU A;  2ZBB A;  2W3H A;  2ZOH A;  4R6L A;  3PR6 A;  3R7W A;  1G28 A;  2QWS A;  4WL9 A;  2V0U A;  4NXE A;  3MJQ A;  3UB8 A;  2Y8H A;  2R78 A;  3R7W B;  3KX0 X;  4OOL A;  4YNR A;  4I39 A;  2WKP A;  2GX5 A;  1OTE A;  2VZW A;  2D01 A;  2Z6C A;  4L9E A;  3T4K A;  3EQV A;  1P0Z A;  2XRO A;  4PKY A;  5G4Z A;  1S1Z A;  4K08 A;  1T19 A;  2P7J A;  3S7P A;  3A0R A;  4GHI A;  4CLC C;  2PYR A;  2H28 A;  3D3O A;  1MZU A;  4MN7 A;  3EEA A;  2M7V A;  5L8M A;  4LRZ E;  5AJG A;  2M1C A;  3K3C A;  3PBO A;  2ZOI A;  2HJE A;  2W1T B;  2OWJ A;  4IUH A;  2I9V A;  3T50 A;  3E4Q A;  1NLY A;  4Y2F A;  3A0V A;  1XJ3 A;  2OWH A;  1NWZ A;  4EET B;  3CIT A;  3EGD C;  4CLC B;  3RH8 B;  4EU0 A;  4WUJ A;  1P9W A;  3KO6 A;  3NJA A;  4BMW A;  5HSQ A;  2P04 A;  1UWP X;  5IS1 A;  3KYZ A;  3T4T A;  3OCL A;  4Q0I A;  2JKR I;  3P7N A;  1OTB A;  4JGO A;  3CUE C;  4QPR A;  3BQA A;  2D02 A;  3BW6 A;  3PXP A;  5F69 A;  3H82 B;  3O5Y A;  2ZMV A;  4Y5F A;  2XSS A;  4F3L B;  2PD8 A;  2V1B A;  3PBQ A;  2L4R A;  4HY8 A;  4UEY A;  4EUV A;  4IUK A;  4DMZ A;  4WN5 A;  2O9A A;  4Z1W A;  4DJ2 A;  3LR5 A;  3BY9 A;  4BBV A;  1XFN A;  4B93 A;  1GSX A;  3KSI A;  5DFY A;  5EFW A;  3T4L A;  5TBM B;  4EES A;  1GSW A;  3F1N B;  4P6Z M;  1XFQ A;  2KX6 A;  4HH3 A;  4I3I A;  1UWN X;  2IA2 A;  2XA7 M;  4EQ1 A;  3ZYT A;  3TJZ C;  5HD3 A;  4JGR A;  5DJT A;  3V67 A;  3LIF A;  1NRJ A;  2INW A;  3LYX A;  2LB9 A;  2KLI A;  4OOM A;  3EOI A;  3PBN A;  5LBR A;  2VKS A;  5HWT A;  1S4S A;  2PD7 A;  3C38 A;  2W3F A;  2K31 A;  5A8B A;  3A0S A;  2PR5 A;  4JGQ A;  1OT9 A;  2W1T A;  2V0W A;  3OC2 A;  2QYB A;  4G3K A;  4UQI S;  3C8C A;  3DBA A;  2GJ3 A;  4MN6 A;  5F68 A;  2W3E A;  3MMH A;  4LRX C;  4GS9 B;  4XT2 B;  2FZ0 A;  4Y3I A;  4E04 A;  5HDC A;  1XJ2 A;  3FG8 A;  3H7W A;  3LR3 A;  3ULF A;  4NXF A;  3T4Q A;  3NOT C;  3K2N A;  2VLG A;  3OBF A;  3OOV A;  2W27 A;  2LB5 A;  3KSH A;  3LI8 A;  3E4O A;  4LLO B;  3B33 A;  3IBJ A;  4EW7 A;  5C5K A;  3F1P B;  5TBM A;  1D06 A;  2KDK A;  4FOF A;  1LSW A;  1OT6 A;  4EXO A;  4R3A A;  4O0P A;  2GNX A;  1MKM A;  3ICY A;  1TS0 A;  5TJJ A;  2B02 A;  3KSG A;  4HHD A;  3TRC A;  5HL6 A;  1T1B A;  1OTA A;  3R4K A;  2NUP C;  5F6A A;  1XJ4 A;  3KYQ A;  1V9Z A;  4DJ3 A;  2P08 A;  1S67 L;  3NOU C;  2G7U A;  3FPW A;  3LI9 A;  4NEE D;  2QKP A;  4M4X A;  1W63 M;  2J3T D;  3F1O B;  2HV1 A;  3LID A;  3VV4 A;  1P97 A;  1GSV A;  3GEC A;  4I38 A;  4P6Z S;  3E98 A;  1W63 Q;  5HZH A;  3CAX A;  1X0O A;  2VGL M;  4GW9 A;  3IS2 A;  3H9W A;  4I5S A;  4LPZ A;  2QHK A;  4R70 A;  2O9C A;  2VV8 A;  3UB6 A;  1OTD A;  2Z6D A;  1VB6 A;  4HJ6 A;  2O9B A;  3LUQ A;  1VHM A;  5HWV A;  4HI4 A;  1LT0 A;  1TS8 A;  4WEL A;  2NUT C;  3VE3 A;  2KOI A;  2VJW A;  1TD5 A;  4IHQ A;  2VGL S;  3VOL A;  2MJ6 A;  3B47 A;  4L9G A;  4LRY C;  2YKH A;  3TE8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...