1BYWA

Structure of the n-terminal domain of the human-erg potassium channel
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
110
structure length
110
Chain Sequence
SRKFIIANARVENCAVIYCNDGFCELCGYSRAEVMQRPCTCDFLHGPCTQRRAAAQIAQALLGAEERKVEIAFYRKDGSCFLCLVDVVPVKNEDGAVIMFILNFEVVMEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure and Functional Analysis of the Herg Potassium Channel N-Terminus: A Eukaryotic Pas Domain
pubmed doi rcsb
source organism Homo sapiens
molecule tags Membrane protein
molecule keywords PROTEIN (HUMAN ERG POTASSIUM CHANNEL)
total genus 27
structure length 110
sequence length 110
ec nomenclature
pdb deposition date 1998-10-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13426 PAS_9 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 1bywA00
1DP6A 3F1NB 3OLOA 2WKRA 1F98A 5HDDA 1DP9A 4GCZA 4PKYG 4F3LB 4I3IA 4HI4A 2WKPA 2QHKA 2V1BA 3UB6A 4EETB 2ZBBA 4EQ1A 3NOUC 1BYWA 4R3AA 3UB8A 1Y28A 1OTEA 1N9OA 4JGQA 3UMDA 1EW0A 5A8BA 4NXGA 4NXEA 1S1YA 2EA9A 3ICYA 5F69A 4GHIA 5HZHA 1N9LA 4XT2B 4GW9A 5G4ZA 5TBMA 3NHQA 4I39A 2I9VA 3F1NA 2V9AA 4BBTA 3LUQA 2OOLA 2W27A 3MQQA 1V9YA 2M1CA 1ODVA 4I3JA 3HJKA 5J3WA 3UB7A 4YWZA 3CLOA 5AVEA 1TS8A 4KQDA 1JNUA 3C2WA 4L9EA 5F5YA 4EW7A 3K3CA 1UWPX 1GSVA 1LSVA 4WLAA 2H28A 3LIFA 3H7WA 4PKYA 4MN5A 3IS2A 2KX6A 2JHEA 2Z6DA 4GHIB 4R70A 5HDSA 3G6OA 2GJ3A 3LYXA 4H6JB 1T18A 3LIEA 4LPZA 4WUJA 5HWTA 2VEAA 5HSQA 1DRMA 3GECA 4K08A 4M4XA 3MR0A 1V9ZA 3VOLA 1OTBA 4EXOA 2PDRA 5F6AA 3D72A 5HWVA 4BBVA 1T1CA 3VE3A 4EERA 2V0WA 4LRXC 2PD8A 3H82B 2L4RA 1OTDA 3UB9A 3H7WB 3LIDA 4HY8A 3IS2B 3EEHA 4MN6A 3VE4A 1OJ5A 5IS1A 3BWLA 1T1AA 4KUKA 2J80A 2BASA 4E04A 4NXFA 3H9WA 2A24A 3A0VA 2YKHA 4GS9B 3PHYA 1S4RA 3PYPA 4I38A 5DJTA 3NJAA 5DKKA 4DJ2A 1D7EA 3LICA 3B33A 4HJ3A 3UMEA 2L0WA 2PR5A 3GDIA 4JGPA 5TBMB 1S4SA 3CAXA 2PYRA 4WL9A 4DJ3A 3C8CA 1LT0A 2QJ7A 1GSWA 2PHYA 5I5LA 4LRZE 3FG8A 5EFWA 1XFNA 4EEUA 2V0UA 2OWHA 5J7EA 4HQAA 4HP9A 4HOIA 3UE6A 5IU1A 1F9IA 3E4QA 2A24B 3F1OB 3MJQA 5J4EA 1LSXA 1KOUA 4GS9A 2R78A 1DP8A 4BBUA 2P7JA 2VV6A 2D01A 4WF0A 5AVFA 4EESA 1OJGA 2JN7A 3MQOA 1S67L 4HH2A 5DKLA 2INWA 2YKFA 4H6JA 4R38A 3CWFA 2KDKA 2K7SA 3LIBA 1OTAA 1OT6A 1VB6A 2WKQA 5DJUA 4I5SA 5HWWA 5G4YA 2PYPA 1T1BA 2W0NA 4JGRA 2L1MA 3F1PB 3LIAA 3F1OA 3A0SA 4WN5A 4HP4A 1TS0A 5F68A 3NOTC 3P7NA 1G28A 3MXQA 2D02A 2OWJA 4EEPA 3H82A 1WA9A 1UWNX 3ULFA 3E4OA 4LRYC 3BY8A 2VV8A 1P97A 1TS6A 1XJ4A 5HD3A 2QWSA 4L9FA 1NWZA 2PD7A 1XJ2A 4LLOB 5KIZA 3SW1A 2QJ5A 4HH3A 1X0OA 4JGOA 1OTIA 3F1PA 2VV7A 1S66L 2Z6CA 1XFQA 3FC7A 4HJ4A 4HNBA 4L9GA 1P0ZA 3E4PA 3RTYA 2QKPA 2B02A 3EWKA 3HJIA 4KUOA 2ZOIA 3T50A 2V1AA 4F3LA 1GSXA 4RQ9A 1XJ3A 4I3AA 2VLGA 3A0RA 3IBRA 4R6LA 1N9NA 3LI9A 3BY9A 1OT9A 1D06A 1S1ZA 3KX0X 3MFXA 1T19A 1XJ6A 4HHDA 4HIAA 4NXBA 1LSWA 2ZOHA 4B9OA 2CMNA 5HD5A 1LL8A 2HV1A 1MZUA 4HJ6A 5HDCA 3RH8B 1TS7A 3ZQ5A 3NOPC 3LI8A 3K3DA 4XT2A 2PR6A 1UGUA
chains in the Genus database with same CATH superfamily
3F1NB 3E2KA 2WKRA 1ESUA 4PKYG 4ZJ3A 3OOVA 3T1RA 4S2KA 1FIKA 1JTDA 1FQGA 3IT9A 5DTTA 2B95A 1H8MA 2W3GA 2BG1A 1KVLA 2P9VB 3CLOA 5EVLA 3G30A 4IBRA 1BSGA 3E98A 5K5BA 1YAXA 2V20A 1YMSA 2LB5A 3FWLA 1C3BA 1PI4A 4LRXC 4S2MA 3VFHA 1CEGA 4O7DA 1MWSA 4KUKA 5FI6A 4OH0A 4B88A 4GDBA 4EWFA 2ZMVA 1M40A 4Y0OA 3IH8A 4EV4A 1CF0A 1K4EA 3T12B 2QJ7A 3U2AA 2PHYA 1PZPA 4HP9A 2EX2A 2P7JA 2KOIA 1S67L 1XP4A 3B47A 2WKQA 1CK3A 4CLCB 1PW1A 1KE3A 4FOFA 5F68A 4IBXA 1SDNA 3C4PA 1TS6A 3UE1A 3WS2A 5HD3A 3C30A 2P9VA 2IA2A 1OPXA 3F1PA 3LFVA 4PM7A 4ZAMA 3HJIA 3QP4A 4E3IA 3UE0A 2DMWA 4R6LA 1J9MA 2Q9MA 3GRJA 4GOGA 3RH8B 3FPVA 3O3VA 5CHJA 5HDCA 3LI8A 1UGUA 1XA7A 4K0WA 1F98A 4BD0A 1KGEA 4S2JA 4DE0A 4EETB 2UWXA 4PM9A 4GN2A 1JVJA 4GHIA 1FR6A 3R7WA 4GW9A 3V39A 4X56A 4JXVA 4E3NA 4UA6A 4CPKA 2E8JA 4WUJA 3KSGA 2WGWB 4KG6A 2DRWA 3IX4A 4CLCA 3W8KA 2PT7A 5EVIC 1PWGA 3M2KA 1T1CA 4DF6A 1MWTA 4EUZA 4CJNA 3V5MA 3UDFA 3H7WB 3IS2B 5M1AA 2G7UA 4X6TA 1VETB 2X01A 1DY6A 1GHIA 2GDNA 2I72A 1E4DA 3GDIA 1L0GA 3LEZA 1S4SA 3LR5A 3V50A 5J4EA 2ZQ7A 4KG5A 2H0YA 5HW3A 3MQOA 5DKLA 2Y2GA 4JXSA 4N1XA 1NXYA 5FQQA 4E3LA 1RP5A 5C5KA 2PYPA 2W0NA 4X68A 3BEBA 1Z6FA 3P7NA 3MXQA 2D02A 4QJGA 1VHMA 2ZJ9A 1TEMA 1XJ2A 4FH4A 3N6IA 1K54A 1E25A 3AGFA 4U0TA 4F3LA 4FTXA 1VQQA 3BQAA 2VK3A 4G3VA 2Y2JA 4HIAA 1ES3A 5HD5A 3NOPC 5BOHA 5EV0A 2AVXA 5HDDA 5HARA 4GCZA 4N1HA 2OLUA 4GD8A 4R3AA 3ICYA 4RX3A 5G4ZA 4WZ5C 1JWVA 3LGOA 5CEBA 3MQQA 2ACGA 4YWZA 2Y2NA 1LSVA 1LL5A 3LYXA 3LIEA 1F5MA 2WGIA 3LO7A 2ZQ8A 1XXMA 4OP5A 1E3UD 5FAPA 3VSLA 4EERA 2K2NA 3HUNA 5U47A 3UPOA 2L4RA 2R9WA 1W7FA 1BZAA 3OPLA 4Y15A 3IXBA 3A0VA 2WAFA 5AQAA 4DRTA 4GZBA 3N7WA 2JC7A 1VM1A 2XA7S 5FQKA 3A3EA 1YLYA 3CI6A 3SS4A 5CECA 3BLMA 3A3IA 4NKPA 2P74A 1BT5A 2ZC4B 1KGGA 4DXBA 1LLBA 1KE0A 5FI2A 4EEPA 3H82A 1K25A 1WA9A 1GCEA 4LRYC 5A93A 3L7HA 2ZC7A 5MC7A 3MBZA 5FL3A 5E2FA 4YNRA 2GNXA 4UA9A 2HJEA 3W4QA 2V1AA 1EROA 1S1ZA 1D06A 1L0FA 1ZG6A 4S2NA 4XT2A 4RYEA 2ZC3B 2ZL1A 2P04A 1PZOA 3TJZC 2ZBBA 3CJMA 1Y28A 1H8ZA 1MKIA 4NXGA 1MPLA 5TBMA 1K54C 1RCJA 1V9YA 5E43A 1A0KA 3AGEA 3JVVA 4PM8A 5LBRA 1O7EA 3IF6B 5A91A 2VEAA 3C7VA 1V9ZA 3KYQA 3Q82A 3VP1A 3S7NA 2Y2PA 2BASA 3T4LA 1S6RA 3OPHA 1S4RA 2Y91A 3IHAA 3UN7A 4JGPA 2XSSA 3DBAA 1RGZA 5I5LA 2V0UA 2ZD8A 4II7A 4FH2A 1O07A 4B93A 3WRTA 2D01A 2IWCA 3CWFA 5EVIB 5GLBA 3VP4A 3T4OA 4R1GA 4N9KA 1JWZA 1P97A 2J3WA 4MBFA 3E0YA 5F1FA 4UQIS 4QY6A 2EWWA 4LLOB 1SHVA 4QB8A 2ZOIA 3O88A 2XRNA 1MWRA 2ZQAA 4JF4A 4Y0UA 1N9NA 3MFXA 1IEMA 2ZQCA 4EQIA 2PBYA 4F3LB 3SOIA 3G34A 5CXWA 4WBGA 3ZFZA 5IHVA 2XD1A 1PRQA 1ZKJA 4MNRA 1K4FA 4PMAA 4C6YA 2M1CA 2ZM2A 3CPTB 5J7EA 3G2ZA 1DJBA 4KQDA 4L9EA 4BWIA 4R4SA 4MN5A 2W3HA 3G6OA 2HJ9C 3PBRA 3MFDA 1IYQA 5TJJA 3P09A 4AFIA 5F6AA 4ZRRA 5F1GA 3UB5P 3HLBA 2J7VA 1ES4A 2B18A 2J80A 3V67A 2FZ0A 1AWIA 5CX7A 3H9WA 2XDMA 1IYOA 2DNSA 2BTFP 5KMWA 4E3JA 3UDXA 1LT0A 4UQIM 1N4OA 4DDSA 5AQ7A 1K56A 3LCEA 3OCNA 4GS9A 1KOUA 3NULA 2V2FF 5AVFA 4WMCD 1DJAA 2O9BA 5D3OA 1YLPA 3CMZA 4H8RA 2V1ZA 4WN5A 2Y59A 3PR6A 4LCLA 5L10A 1HZOA 4NETA 3MKEA 4L9FA 2HP6A 2XFTA 1IYSA 3L9KA 3CPTA 3S7PA 2XLNA 1XFQA 3UE3A 3O86A 1MC0A 1XJ3A 3FV7A 2WYXA 3CITA 2MJ6A 4HJ6A 1MZUA 3EEAA 4OONA 2WKPA 1E3UA 1HTZA 3VOZA 3V3SA 1FILA 1FOFA 1N9BA 4C3QA 2ZL1B 4LFUA 4K0XA 2EFUA 3TE8A 5FI7A 4P6BA 1PWDA 5HDSA 2VJWA 3RXXA 4R70A 3RXWA 3ZNTA 3IXDA 3ZGAB 3M6HA 3GECA 3ZDJA 4LGWA 1CI8A 5DF7A 2HDSA 4EXOA 4QY5A 2W3DA 4IUHA 4X55A 2J3TC 2PD8A 1OMEA 5DKKA 1XGJA 1RGYA 1ZC2A 4JF5A 2W3EA 3FG8A 1SKFA 3GQZA 5EECA 5IU1A 4BD1A 4XUZA 1ONHA 2JN7A 3VOYA 3BFCA 1BULA 1K57C 4EUVA 3NOTC 4PM5A 5DVAA 1UWNX 4D2OA 1MBLA 1PI5A 3R7WB 4QWOA 2E8IA 4O01A 1BLCA 2VGJA 1NWZA 5EE8A 5JYOA 3B42A 1X0OA 3KYZA 4L9GA 1SKOB 1PWCA 1H3QA 3PAEA 1TDLA 3UPPA 2J3TD 3T1SA 3BFEA 1K0KA 3IF5A 5HAQA 3UB6A 3WS0A 4EQ1A 3EQVA 1LI0A 4XXRA 4L0LA 1OTEA 3MMHA 3E2LA 5FQ9A 3DTMA 5F69A 3NDGA 1SDEA 1L3LA 3F1NA 2V9AA 4BBTA 1ES2A 2HF6A 2OSUA 3IBJA 5AVEA 1TS8A 4BJPA 1GSVA 3LIFA 3ZQ5A 4HESA 2GJ3A 1NZUA 3MF0A 4OOYA 4IVIA 3LIDA 1YPRA 3BWLA 4JPMA 4OPRA 1YLJA 2HP5A 2JE5A 4YINA 3SS5A 3PHYA 5DJTA 4FUWA 4MLLA 3UMEA 2PR5A 3CAXA 2PYRA 5DF8A 2B5RA 2EWVA 4MBKA 2LB9A 2ZQDA 1VEUB 5F82A 3S7OA 2R78A 1DP8A 5GL9A 5TR7A 1OJGA 4D60A 2K7SA 1OTAA 5EM1A 5GHYA 5EVEA 1ES5A 3N4IA 3K2NA 3BFDA 2HDQA 2H5SA 1NLYA 4R0QA 1W8QA 3NECA 4DMZA 3KSHA 4RQ9A 3IBRA 5DFXA 4OQHA 4NXBA 1LSWA 5DFYA 3ZNYA 3MKFA 2PR6A 4ARZB 1PW8A 1ERMA 4KZ3A 3V3RA 3FYZA 2QHKA 4A5RA 3EOIA 3M6BA 3Q07A 4EBLA 2I9VA 3W4PA 3IWIA 3LUQA 4I3JA 3BFGA 1XA1A 3S1YA 1UWPX 5AQ9A 5CTMA 4GHIB 2ZC5B 3OZHA 1IFQA 2EXAA 4OKPA 1KE4A 3TW8A 5FQMA 1H5XA 3H82B 2ZQ9A 3PAGA 1D1JA 2RL3A 5IS1A 2W1RA 3CUEA 5FASA 1NYYA 4WYYA 3BECA 2O99A 4HJ3A 2Q9NA 5G18A 1YLZA 5FEGA 3QNCA 4Y5FA 1F9IA 3F1OB 1LSXA 5GHXA 1G68A 3T4KA 3LEQA 3ISGA 2JKFA 4RVAA 4JGRA 2QZ6A 3MZDA 2NUTC 4LENA 3E4OA 3ZG5A 3Q7VA 3C7UA 2QWSA 3UY6A 5FAOA 4MCWA 2Z6CA 1S66L 2RCXA 1KDSA 2QKPA 4S2LA 4I3AA 3IF6C 2R9XA 3QP8A 3KX0X 5AJGA 4JXWA 1SKOA 1JWPA 3BYDA 3M2JA 5HAPA 3BW6A 2WGVA 4OQIA 4I3IA 2HDUA 3SS3A 1BLPA 1ZG4A 3P01A 3R4KA 2IWDA 4YFMA 4MMNA 4LV2A 3CG5A 3QP5A 4U0XA 4XUXA 3UPNA 4DN0A 3W2ZA 2V8CA 3MXRA 2Y4AA 3MQ0A 4G3KA 1CI9A 5EOOA 1P9RA 4UEYA 2H28A 3HUMA 1NYMA 2KX6A 4GB7A 5HAIA 3VP0A 3IH9A 3OPPA 5AQBA 2Y2HA 5TFQA 3MZFA 2IWBA 4FD8A 4E6WA 2WAEA 2QYBA 3Q7VB 4MEZA 1EWZA 4IUKA 4NXFA 2YKHA 3PYPA 3NJAA 3JYIA 3B33A 1K55C 3IX8A 4Y3IA 1LI9A 4Y17A 3IWOA 3HL9A 1H0MA 4HQAA 1IKIA 3KO6A 4ZBEA 3IX3A 3E4QA 5DF9A 4GLQA 3A3DA 2JBFA 2OLVA 3CZDA 4H6JA 3QP1A 5M19A 4JXGA 1I5QA 3ITAA 4QD4A 5G4YA 1J3WA 3C5AA 4P6ZM 4OLGA 2L1MA 3WWXA 4RX2A 1ZTUA 3NY4A 4RA7A 3G2YA 4WEKA 4KZ4A 4KZ7A 4HJ4A 4R4RA 3T50A 2GZAA 4IVKA 3RJUA 4HBTA 2HV1A 2XROA 5GHZA 5HL6A 2O9CA 4OVDA 2V1BA 2PBDP 5EPHA 4Z9QA 3UMDA 1EW0A 2Y55A 1Y4OA 5HZHA 4XT2B 5GLDA 4ARZA 4CLCD 3I7JA 4GKUA 4X1MA 2OV5A 5F5YA 5JYPA 1TF1A 2WK0A 3FKVA 1FCNA 2JHEA 2Z6DA 4DE2A 3UO9A 5CEDA 3VOLA 3LY3A 2PDRA 2XD5A 1FCOA 5HWVA 1FSYA 3S4XA 3VE4A 4DKIA 4R3BA 3G32A 3BQ8A 1NRJA 3GVBA 2A24A 5J8XA 3DTKA 2EX8A 3HUOA 4DJ3A 4C75A 3IQAA 5FSRA 5EFWA 4EBPA 1W79A 3OBFA 3B3XA 4BBUA 4ZTKA 1ESIA 2C5WB 2KDKA 4NK3A 4O0PA 5HWWA 1G5UA 4HP4A 4DE1A 1IOUA 1KDWA 3EGDC 4OOLA 5FEFA 3VSKA 1Z09A 2J8YA 3ZVTA 4JF6A 3EWKA 1STZA 2HDRA 3A0RA 3S7QA 2XR0A 3T1XA 1XJ6A 4ESPA 3JVUA 3NI9A 4P0MA 4MDZA 1DP9A 3LR0A 4GD6A 2Y79A 3ZG8B 5HX9A 3T4SA 4JGQA 3KSIA 4NXEA 4LV1A 3Q1FA 4I39A 3D4FA 1DJCA 3LY4A 1EI5A 3O87A 5J3WA 3QP2A 3MS6A 3C4OA 1HLUP 4PKYA 4QPRA 5A92A 5HWTA 3GTCA 4JKTA 2Y8HA 5FQIA 5E2HA 4N92A 4ETZA 3LR3A 1OJ5A 2K31A 2VGLM 2X71A 4FCFA 3DTEA 3PBNA 4KQQA 4NG2A 1YKDA 2L0WA 5E2GA 4WL9A 2ZM8A 2UV0E 4EEUA 1XFNA 4P6ZS 3OPRA 3IXHA 4G3WA 2WKEA 4HH2A 3DAVA 3Q7ZA 1K6SA 1OT6A 5DJUA 4I5SA 5HL1A 4PM6A 3A0SA 4LCMA 1TS0A 1G28A 4EBNA 4UA7A 2EX6A 4OPYA 1XJ4A 5CGSA 5CTNA 3IWQA 3VMAA 5F83A 4N9LA 3TG9A 3CHWP 4WELA 2JKTI 5M18A 2OAQ1 3HCYA 4KUOA 1TDGA 1Q2QA 4S2IA 1Q2PA 3S22A 2QMIA 1OT9A 3NDEA 1GA0A 2ZOHA 1FR1A 1L0EA 3A3FA 2A2LA 1AXBA 4P85A 5GLAA 3BM6A 4IHQA 2JKRI 3NHQA 1MWUA 4X53A 1PFLA 1U60A 2WGWA 3HJKA 2CC1A 1JNUA 5E2EA 1TVFA 1VEUA 2JCHA 4U3TA 2FFFB 2ZM0A 3IS2A 4HEFA 3Q81A 1DRMA 4DXCA 4S2PA 2JKRM 2ZLYA 2XEPA 3HREA 1XKZA 1CEFA 2VGKA 1NRFA 1YSQA 5FDHA 5L8MA 2WADA 3LICA 3C8CA 2NUPC 3DWKA 4LRZE 3ITBA 2ZMAA 2OWHA 3T1QB 3UE6A 1GHPA 4O8GA 2INWA 4BENA 4ME4A 4ZDXA 1VB6A 4K91A 2BLSA 5EVID 3TOIA 1MKMA 1NZOA 2PD7A 1WYCA 4KENB 1IKGA 3E4PA 2B02A 1NY0A 1GSXA 2JKGA 1GHMA 3UDIA 3WS4A 4Q0HA 2W1TB 3LI9A 3ZHHA 3BY9A 1W63M 3AGDA 2XFSA 4BL2A 1FCMA 3HLGA 2H10A 1YM1A 1LHYA 2G2UA 1PIOA 4ZJ1A 4HI4A 1CJFA 2HGVA 4GDNA 1BYWA 2WZZA 1ERQA 5EM0A 3T4JA 3HVFA 3T4QA 3P98A 5KSCA 4EU0A 5KSHA 3PXPA 3O5YA 4OP8A 2OOLA 2W27A 1WYBA 4P87A 1ODVA 4OPQA 1CQAA 3SH8A 2WKHA 4WLAA 4KZAA 5A8BA 2HZ5A 4X1LA 1ONGA 4LPZA 2HPBA 1WE4A 3U4LP 5EOEA 4YOFA 4ID4A 3FZCA 2FH5A 1I2WA 2V0WA 2J9PA 3D3OA 1OTDA 2P08A 4HY8A 4MN6A 4Q8IA 4WEJA 4MBHA 4Y13A 3NCKA 4I38A 3N8LA 3RFBA 1G6AA 1D7EA 5HPFA 1MY8A 3VV4A 5FDSA 5A90A 2W1TA 5CRFA 3SZTA 2A3UA 5L09A 2Z2MB 1Y54A 2H0TA 4EESA 1W63Q 2XH9A 4WZ5A 4IEDA 1K56D 4E3MA 3ZYTA 2OWJA 2O0YA 2PAVP 3ULFA 4F94A 4JBFA 3SW1A 2QJ5A 4KG2A 4QU3A 4Z1WA 1W8YA 4JGOA 3DW0A 2VV7A 1QMEA 1YT4A 3GSGA 1BLHA 1G6OA 4KZBA 4X69A 3MZEA 3HLEA 4HHDA 2KLIA 1K6RA 2OAP1 2CMNA 2Y2OA 4DE3A 1DP6A 4Y2FA 4WM9A 3UNWA 4KQOA 1S0WA 3MSHA 5CGWA 1W5DA 3UB8A 3D9YA 2Y2QA 4KZ6A 2VZWA 3EQUA 3DWZA 2M7UA 4LV3A 3UB7A 4CQHA 3WS5A 3KYEA 4PPRA 2ZC6B 5DTSA 4BQMA 3IXGA 3T4TA 4EW7A 4OQ0A 4H6JB 3N8RA 1KGFA 2WZXA 2JKTM 3GMWA 3D72A 4BBVA 3C38A 4S2NC 2VA0A 1NJ4A 3UB9A 4NEED 4OQGA 1T1AA 5FATA 4E04A 5L2FA 1SZVA 3HBRA 3VP3A 1ALQA 4Q0IA 2XQZA 4Q0JA 5EVIA 3A3JA 3BLSA 3QHYA 3PBSA 4CLCC 2M7VA 1YLTA 4PAUA 1YSPA 1I2SA 2PU2A 4E3OA 3PTEA 4R38A 1F2KA 4BLMA 2WKIA 3ZG7B 3F1OA 1XPBA 2C6WB 2EX9A 2Y2LA 4JLFA 4R3JA 4LV0A 2O9AA 4HH3A 2EFXA 3BFFA 4HNBA 1HD8A 3MXSA 3PBTA 2XF3A 3TRCA 5CHMA 2FFYA 2XGNA 1TS7A 5CGXA 1M6KA 1BUEA 4OPZA 3OLOA 3G35A 2DCFA 5HFOA 1K55A 1FSWA 4Y0TA 3NOUC 1S1YA 3N8SA 4R23A 1N9LA 2Q0OA 2XA7M 4UAAA 1ZHHB 3LR4A 4DDYA 3BRMA 3K3CA 2W3FA 1T18A 3EGXC 4WMCA 4K08A 4M4XA 2J9OA 2GX5A 1PYYA 4OOMA 2PU4A 3EEHA 4GJ4A 4MN7A 1KVMA 4GS9B 4DJ2A 2XK1A 3G4PA 4M3KA 5TBMB 1ACFA 1GSWA 1XX2A 4HOIA 3WRZA 2VV6A 3IF6A 5KZHA 3G31A 5IT5A 1T1BA 3F1PB 3LIAA 3HLWA 2VX8A 4GNUA 1K38A 1YLWA 2VGLS 4KZ5A 5FAQA 1LL9A 1L2SA 1H8YA 3WS1A 3ZVWA 3JPUA 1P0ZA 3RTYA 3OC2A 4PHTA 1XGIA 3QNBA 4B9OA 1HVBA 1LL8A 1JTGA 5DTKA 3GR2A 3ZCZA 2EXBA 4E3KA 3QP6A 5EUAA 2Y2KA 5CERA 1PNEA 2PRFA 1N9OA 3FKWA 3CUEC 2EA9A 1BLSA 2Y2IA 1L0DA 3TSGA 3OCLA 5CHUA 1BTLA 4FSFA 2X02A 5FA7A 4B4ZA 5I94A 3C2WA 3PBOA 4UHUA 4ETXA 1YQSA 3H7WA 5L07A 5HSQA 1IYPA 1P9WA 2WUQA 1VETA 3MR0A 3KSFA 1OTBA 3NIAA 3BJNA 4Y7PA 1K57A 1SCWA 3VE3A 4BL3A 3HLFA 1QMFA 1IELA 2G2WA 1TD5A 4ZJ2A 2V8FA 1YMXA 3PBQA 2Z2LB 3DTIA 1MXOA 4KZ8A 3IHBA 4X25A 4KZ9A 4HBUA 3MJQA 2A24B 3GV9A 2ZMFA 4WF0A 2HP9A 1NLZA 2YKFA 3HLDA 3W4OA 3ZG9B 2QPNA 2VKSA 3LIBA 3NC8A 5HPIA 3SH7A 5FQJA 4BMWA 2Y2MA 5GLCA 4QHCA 4B4XA 3BY8A 2VV8A 4OLDA 2A49A 3VFFA 4IJGA 4KQRA 4WZ4A 5KIZA 3VP2A 3ZG0A 1OTIA 3SH9A 3HLCA 3FC7A 5TGFA 3NBLA 1GA9A 3FPWA 4S2OA 2VLGA 1T19A 3K3DA 4E6XA 4CLCE
chains in the Genus database with same CATH topology
3F1NB 2WKRA 4PKYG 4F3LB 4I3IA 4HI4A 2HGVA 1BYWA 3OOVA 3P01A 3R4KA 3T4JA 3T4QA 4MMNA 4EU0A 5KSHA 3PXPA 3O5YA 1H8MA 2OOLA 2W27A 4DN0A 2W3GA 2M1CA 1ODVA 5J7EA 3W2ZA 3CLOA 4KQDA 4L9EA 4BWIA 3MQ0A 3E98A 4G3KA 5K5BA 1YAXA 1P9RA 4UEYA 2H28A 4WLAA 5A8BA 4MN5A 2KX6A 2W3HA 3G6OA 2HJ9C 4LPZA 3PBRA 5TJJA 2LB5A 4AFIA 5F6AA 4ZRRA 4YOFA 2FH5A 2V0WA 4LRXC 3D3OA 1OTDA 2P08A 4HY8A 4MN6A 4WEJA 2B18A 4KUKA 2J80A 2QYBA 3V67A 2FZ0A 4IUKA 5CX7A 4NXFA 3H9WA 2YKHA 4I38A 3PYPA 3RFBA 3NJAA 1D7EA 2ZMVA 3B33A 5HPFA 4Y3IA 3VV4A 1LT0A 2QJ7A 2PHYA 4UQIM 3U2AA 3OCNA 2W1TA 4HQAA 4HP9A 3KO6A 5DF9A 3E4QA 4GS9A 1KOUA 4GLQA 2P7JA 2KOIA 5AVFA 4EESA 1W63Q 1S67L 4H6JA 2O9BA 3B47A 2WKQA 4CLCB 5G4YA 4P6ZM 2L1MA 4WN5A 4FOFA 5F68A 3ZYTA 2OWJA 3PR6A 2O0YA 3ULFA 1ZTUA 1TS6A 5HD3A 4L9FA 3C30A 3SW1A 2QJ5A 4Z1WA 4JGOA 3S7PA 2IA2A 4WEKA 1OPXA 2VV7A 3F1PA 1XFQA 4HJ4A 3LFVA 3UE3A 3HJIA 3T50A 2GZAA 1G6OA 1MC0A 2DMWA 1XJ3A 4R6LA 3CITA 4HHDA 2KLIA 2OAP1 2CMNA 2MJ6A 2HV1A 4HJ6A 1MZUA 3RH8B 2XROA 3FPVA 3EEAA 5HDCA 3LI8A 1UGUA 1DP6A 4Y2FA 5HL6A 1F98A 4KQOA 2O9CA 2WKPA 2V1BA 4EETB 3UB8A 3UMDA 1EW0A 4GHIA 5HZHA 2VZWA 3EQUA 4XT2B 4GW9A 3R7WA 4ARZA 4CLCD 2M7UA 3UB7A 3TE8A 4CQHA 5F5YA 1TF1A 5HDSA 2VJWA 2JHEA 2Z6DA 4R70A 3T4TA 4WUJA 4EW7A 4H6JB 3GECA 3KSGA 2JKTM 3VOLA 4CLCA 4EXOA 2PDRA 3D72A 2PT7A 5HWVA 4BBVA 1T1CA 2W3DA 3C38A 4IUHA 2J3TC 2VA0A 2PD8A 3UB9A 4NEED 3H7WB 3VE4A 3IS2B 2G7UA 3BQ8A 1T1AA 1NRJA 4E04A 2A24A 5DKKA 4Q0IA 4Q0JA 3GDIA 1S4SA 3LR5A 4DJ3A 2W3EA 3PBSA 4CLCC 3FG8A 5EFWA 2M7VA 5IU1A 5J4EA 3OBFA 4PAUA 1YSPA 4BBUA 2JN7A 3MQOA 5DKLA 4R38A 2KDKA 4O0PA 5HWWA 5C5KA 2PYPA 2W0NA 3F1OA 4EUVA 4HP4A 3NOTC 3P7NA 3MXQA 2D02A 1IOUA 1UWNX 3EGDC 3R7WB 1VHMA 4O01A 1NWZA 1XJ2A 4OOLA 2O9AA 4HH3A 3B42A 1X0OA 3KYZA 4L9GA 4HNBA 1H3QA 3EWKA 1STZA 3PBTA 4F3LA 3TRCA 3BQAA 3A0RA 4G3VA 3S7QA 2J3TD 1XJ6A 4HIAA 5HD5A 3JVUA 1TS7A 3NOPC 4MDZA 3OLOA 5HDDA 1DP9A 3LR0A 4GCZA 2Y79A 3UB6A 4EQ1A 3NOUC 4R3AA 3EQVA 4L0LA 1OTEA 3MMHA 4JGQA 3T4SA 3KSIA 4NXEA 1S1YA 3ICYA 5F69A 1N9LA 5G4ZA 4I39A 3F1NA 2V9AA 4BBTA 3MQQA 2HF6A 5J3WA 3IBJA 2XA7M 4YWZA 1ZHHB 5AVEA 1TS8A 3LR4A 4BJPA 3K3CA 2W3FA 1GSVA 1LSVA 3LIFA 4PKYA 4QPRA 3ZQ5A 2GJ3A 3LYXA 1T18A 3EGXC 3LIEA 1F5MA 5HWTA 4K08A 3MF0A 4M4XA 2Y8HA 2GX5A 4EERA 4ETZA 2K2NA 4OOMA 3LR3A 2L4RA 3LIDA 3EEHA 4GJ4A 1OJ5A 3BWLA 2K31A 2VGLM 4MN7A 3A0VA 3PBNA 4GS9B 3PHYA 5DJTA 4DJ2A 3UMEA 1YKDA 2L0WA 2PR5A 5TBMB 3CAXA 2PYRA 4WL9A 2EWVA 1GSWA 2XA7S 4EEUA 1XFNA 2LB9A 4HOIA 3CI6A 4P6ZS 3S7OA 2R78A 1DP8A 2VV6A 4G3WA 4NKPA 1OJGA 4HH2A 2K7SA 1OTAA 1OT6A 5DJUA 4I5SA 5IT5A 1T1BA 3F1PB 3K2NA 3LIAA 3A0SA 1TS0A 2VX8A 1G28A 4EEPA 3H82A 1WA9A 2VGLS 4LRYC 1XJ4A 5MC7A 1NLYA 4WELA 5FL3A 2JKTI 4YNRA 1P0ZA 3OC2A 2GNXA 3KSHA 4PHTA 3RTYA 2OAQ1 3HCYA 4KUOA 2HJEA 4DMZA 2V1AA 4RQ9A 3IBRA 1OT9A 1D06A 1S1ZA 5DFXA 4NXBA 1LSWA 2ZOHA 5DFYA 4B9OA 1LL8A 4XT2A 2A2LA 2PR6A 4ARZB 2P04A 2QHKA 3TJZC 2ZBBA 1Y28A 4IHQA 1N9OA 4NXGA 3CUEC 3EOIA 2EA9A 2JKRI 5TBMA 3NHQA 2I9VA 3LUQA 3OCLA 1V9YA 4I3JA 4FSFA 3HJKA 1JNUA 3C2WA 3JVVA 3PBOA 1UWPX 5LBRA 4ETXA 3H7WA 3IS2A 4GHIB 5HSQA 2VEAA 1DRMA 1P9WA 3MR0A 3KSFA 1V9ZA 1OTBA 3KYQA 1IFQA 2JKRM 3BJNA 3TW8A 3VE3A 3H82B 1YSQA 3S7NA 5IS1A 2W1RA 2BASA 3T4LA 3CUEA 1TD5A 1S4RA 3PBQA 5L8MA 3LICA 2O99A 4HJ3A 4JGPA 2XSSA 3DBAA 3C8CA 2NUPC 5I5LA 4LRZE 2V0UA 2OWHA 4Y5FA 3UE6A 1F9IA 3F1OB 2A24B 3MJQA 4II7A 1LSXA 4O8GA 4B93A 2ZMFA 3T4KA 2D01A 4WF0A 1NLZA 2INWA 2YKFA 3CWFA 4ME4A 2VKSA 3LIBA 1VB6A 5HPIA 4JGRA 3T4OA 4BMWA 2NUTC 3E4OA 1MKMA 2VV8A 1P97A 3BY8A 2J3WA 4IJGA 2QWSA 2PD7A 5KIZA 3E0YA 4UQIS 4MCWA 1OTIA 2EWWA 4LLOB 2Z6CA 1S66L 3FC7A 3E4PA 2QKPA 2B02A 2ZOIA 1GSXA 3FPWA 2XRNA 4I3AA 2VLGA 4Q0HA 2W1TB 1N9NA 3LI9A 3BY9A 1W63M 3MFXA 3KX0X 5AJGA 1T19A 3K3DA 3BW6A 4CLCE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DP6 A;  3F1N B;  3OLO A;  2WKR A;  1F98 A;  5HDD A;  1DP9 A;  4GCZ A;  4PKY G;  4F3L B;  4I3I A;  4HI4 A;  2WKP A;  2QHK A;  2V1B A;  3UB6 A;  4EET B;  2ZBB A;  4EQ1 A;  3NOU C;  1BYW A;  4R3A A;  3UB8 A;  1Y28 A;  1OTE A;  1N9O A;  4JGQ A;  3UMD A;  1EW0 A;  5A8B A;  4NXG A;  4NXE A;  1S1Y A;  2EA9 A;  3ICY A;  5F69 A;  4GHI A;  5HZH A;  1N9L A;  4XT2 B;  4GW9 A;  5G4Z A;  5TBM A;  3NHQ A;  4I39 A;  2I9V A;  3F1N A;  2V9A A;  4BBT A;  3LUQ A;  2OOL A;  2W27 A;  3MQQ A;  1V9Y A;  2M1C A;  1ODV A;  4I3J A;  3HJK A;  5J3W A;  3UB7 A;  4YWZ A;  3CLO A;  5AVE A;  1TS8 A;  4KQD A;  1JNU A;  3C2W A;  4L9E A;  5F5Y A;  4EW7 A;  3K3C A;  1UWP X;  1GSV A;  1LSV A;  4WLA A;  2H28 A;  3LIF A;  3H7W A;  4PKY A;  4MN5 A;  3IS2 A;  2KX6 A;  2JHE A;  2Z6D A;  4GHI B;  4R70 A;  5HDS A;  3G6O A;  2GJ3 A;  3LYX A;  4H6J B;  1T18 A;  3LIE A;  4LPZ A;  4WUJ A;  5HWT A;  2VEA A;  5HSQ A;  1DRM A;  3GEC A;  4K08 A;  4M4X A;  3MR0 A;  1V9Z A;  3VOL A;  1OTB A;  4EXO A;  2PDR A;  5F6A A;  3D72 A;  5HWV A;  4BBV A;  1T1C A;  3VE3 A;  4EER A;  2V0W A;  4LRX C;  2PD8 A;  3H82 B;  2L4R A;  1OTD A;  3UB9 A;  3H7W B;  3LID A;  4HY8 A;  3IS2 B;  3EEH A;  4MN6 A;  3VE4 A;  1OJ5 A;  5IS1 A;  3BWL A;  1T1A A;  4KUK A;  2J80 A;  2BAS A;  4E04 A;  4NXF A;  3H9W A;  2A24 A;  3A0V A;  2YKH A;  4GS9 B;  3PHY A;  1S4R A;  3PYP A;  4I38 A;  5DJT A;  3NJA A;  5DKK A;  4DJ2 A;  1D7E A;  3LIC A;  3B33 A;  4HJ3 A;  3UME A;  2L0W A;  2PR5 A;  3GDI A;  4JGP A;  5TBM B;  1S4S A;  3CAX A;  2PYR A;  4WL9 A;  4DJ3 A;  3C8C A;  1LT0 A;  2QJ7 A;  1GSW A;  2PHY A;  5I5L A;  4LRZ E;  3FG8 A;  5EFW A;  1XFN A;  4EEU A;  2V0U A;  2OWH A;  5J7E A;  4HQA A;  4HP9 A;  4HOI A;  3UE6 A;  5IU1 A;  1F9I A;  3E4Q A;  2A24 B;  3F1O B;  3MJQ A;  5J4E A;  1LSX A;  1KOU A;  4GS9 A;  2R78 A;  1DP8 A;  4BBU A;  2P7J A;  2VV6 A;  2D01 A;  4WF0 A;  5AVF A;  4EES A;  1OJG A;  2JN7 A;  3MQO A;  1S67 L;  4HH2 A;  5DKL A;  2INW A;  2YKF A;  4H6J A;  4R38 A;  3CWF A;  2KDK A;  2K7S A;  3LIB A;  1OTA A;  1OT6 A;  1VB6 A;  2WKQ A;  5DJU A;  4I5S A;  5HWW A;  5G4Y A;  2PYP A;  1T1B A;  2W0N A;  4JGR A;  2L1M A;  3F1P B;  3LIA A;  3F1O A;  3A0S A;  4WN5 A;  4HP4 A;  1TS0 A;  5F68 A;  3NOT C;  3P7N A;  1G28 A;  3MXQ A;  2D02 A;  2OWJ A;  4EEP A;  3H82 A;  1WA9 A;  1UWN X;  3ULF A;  3E4O A;  4LRY C;  3BY8 A;  2VV8 A;  1P97 A;  1TS6 A;  1XJ4 A;  5HD3 A;  2QWS A;  4L9F A;  1NWZ A;  2PD7 A;  1XJ2 A;  4LLO B;  5KIZ A;  3SW1 A;  2QJ5 A;  4HH3 A;  1X0O A;  4JGO A;  1OTI A;  3F1P A;  2VV7 A;  1S66 L;  2Z6C A;  1XFQ A;  3FC7 A;  4HJ4 A;  4HNB A;  4L9G A;  1P0Z A;  3E4P A;  3RTY A;  2QKP A;  2B02 A;  3EWK A;  3HJI A;  4KUO A;  2ZOI A;  3T50 A;  2V1A A;  4F3L A;  1GSX A;  4RQ9 A;  1XJ3 A;  4I3A A;  2VLG A;  3A0R A;  3IBR A;  4R6L A;  1N9N A;  3LI9 A;  3BY9 A;  1OT9 A;  1D06 A;  1S1Z A;  3KX0 X;  3MFX A;  1T19 A;  1XJ6 A;  4HHD A;  4HIA A;  4NXB A;  1LSW A;  2ZOH A;  4B9O A;  2CMN A;  5HD5 A;  1LL8 A;  2HV1 A;  1MZU A;  4HJ6 A;  5HDC A;  3RH8 B;  1TS7 A;  3ZQ5 A;  3NOP C;  3LI8 A;  3K3D A;  4XT2 A;  2PR6 A;  1UGU A; 
#chains in the Genus database with same CATH topology
 3F1N B;  3E2K A;  2WKR A;  1ESU A;  4PKY G;  4ZJ3 A;  3OOV A;  3T1R A;  4S2K A;  1FIK A;  1JTD A;  1FQG A;  3IT9 A;  5DTT A;  2B95 A;  1H8M A;  2W3G A;  2BG1 A;  1KVL A;  2P9V B;  3CLO A;  5EVL A;  3G30 A;  4IBR A;  1BSG A;  3E98 A;  5K5B A;  1YAX A;  2V20 A;  1YMS A;  2LB5 A;  3FWL A;  1C3B A;  1PI4 A;  4LRX C;  4S2M A;  3VFH A;  1CEG A;  4O7D A;  1MWS A;  4KUK A;  5FI6 A;  4OH0 A;  4B88 A;  4GDB A;  4EWF A;  2ZMV A;  1M40 A;  4Y0O A;  3IH8 A;  4EV4 A;  1CF0 A;  1K4E A;  3T12 B;  2QJ7 A;  3U2A A;  2PHY A;  1PZP A;  4HP9 A;  2EX2 A;  2P7J A;  2KOI A;  1S67 L;  1XP4 A;  3B47 A;  2WKQ A;  1CK3 A;  4CLC B;  1PW1 A;  1KE3 A;  4FOF A;  5F68 A;  4IBX A;  1SDN A;  3C4P A;  1TS6 A;  3UE1 A;  3WS2 A;  5HD3 A;  3C30 A;  2P9V A;  2IA2 A;  1OPX A;  3F1P A;  3LFV A;  4PM7 A;  4ZAM A;  3HJI A;  3QP4 A;  4E3I A;  3UE0 A;  2DMW A;  4R6L A;  1J9M A;  2Q9M A;  3GRJ A;  4GOG A;  3RH8 B;  3FPV A;  3O3V A;  5CHJ A;  5HDC A;  3LI8 A;  1UGU A;  1XA7 A;  4K0W A;  1F98 A;  4BD0 A;  1KGE A;  4S2J A;  4DE0 A;  4EET B;  2UWX A;  4PM9 A;  4GN2 A;  1JVJ A;  4GHI A;  1FR6 A;  3R7W A;  4GW9 A;  3V39 A;  4X56 A;  4JXV A;  4E3N A;  4UA6 A;  4CPK A;  2E8J A;  4WUJ A;  3KSG A;  2WGW B;  4KG6 A;  2DRW A;  3IX4 A;  4CLC A;  3W8K A;  2PT7 A;  5EVI C;  1PWG A;  3M2K A;  1T1C A;  4DF6 A;  1MWT A;  4EUZ A;  4CJN A;  3V5M A;  3UDF A;  3H7W B;  3IS2 B;  5M1A A;  2G7U A;  4X6T A;  1VET B;  2X01 A;  1DY6 A;  1GHI A;  2GDN A;  2I72 A;  1E4D A;  3GDI A;  1L0G A;  3LEZ A;  1S4S A;  3LR5 A;  3V50 A;  5J4E A;  2ZQ7 A;  4KG5 A;  2H0Y A;  5HW3 A;  3MQO A;  5DKL A;  2Y2G A;  4JXS A;  4N1X A;  1NXY A;  5FQQ A;  4E3L A;  1RP5 A;  5C5K A;  2PYP A;  2W0N A;  4X68 A;  3BEB A;  1Z6F A;  3P7N A;  3MXQ A;  2D02 A;  4QJG A;  1VHM A;  2ZJ9 A;  1TEM A;  1XJ2 A;  4FH4 A;  3N6I A;  1K54 A;  1E25 A;  3AGF A;  4U0T A;  4F3L A;  4FTX A;  1VQQ A;  3BQA A;  2VK3 A;  4G3V A;  2Y2J A;  4HIA A;  1ES3 A;  5HD5 A;  3NOP C;  5BOH A;  5EV0 A;  2AVX A;  5HDD A;  5HAR A;  4GCZ A;  4N1H A;  2OLU A;  4GD8 A;  4R3A A;  3ICY A;  4RX3 A;  5G4Z A;  4WZ5 C;  1JWV A;  3LGO A;  5CEB A;  3MQQ A;  2ACG A;  4YWZ A;  2Y2N A;  1LSV A;  1LL5 A;  3LYX A;  3LIE A;  1F5M A;  2WGI A;  3LO7 A;  2ZQ8 A;  1XXM A;  4OP5 A;  1E3U D;  5FAP A;  3VSL A;  4EER A;  2K2N A;  3HUN A;  5U47 A;  3UPO A;  2L4R A;  2R9W A;  1W7F A;  1BZA A;  3OPL A;  4Y15 A;  3IXB A;  3A0V A;  2WAF A;  5AQA A;  4DRT A;  4GZB A;  3N7W A;  2JC7 A;  1VM1 A;  2XA7 S;  5FQK A;  3A3E A;  1YLY A;  3CI6 A;  3SS4 A;  5CEC A;  3BLM A;  3A3I A;  4NKP A;  2P74 A;  1BT5 A;  2ZC4 B;  1KGG A;  4DXB A;  1LLB A;  1KE0 A;  5FI2 A;  4EEP A;  3H82 A;  1K25 A;  1WA9 A;  1GCE A;  4LRY C;  5A93 A;  3L7H A;  2ZC7 A;  5MC7 A;  3MBZ A;  5FL3 A;  5E2F A;  4YNR A;  2GNX A;  4UA9 A;  2HJE A;  3W4Q A;  2V1A A;  1ERO A;  1S1Z A;  1D06 A;  1L0F A;  1ZG6 A;  4S2N A;  4XT2 A;  4RYE A;  2ZC3 B;  2ZL1 A;  2P04 A;  1PZO A;  3TJZ C;  2ZBB A;  3CJM A;  1Y28 A;  1H8Z A;  1MKI A;  4NXG A;  1MPL A;  5TBM A;  1K54 C;  1RCJ A;  1V9Y A;  5E43 A;  1A0K A;  3AGE A;  3JVV A;  4PM8 A;  5LBR A;  1O7E A;  3IF6 B;  5A91 A;  2VEA A;  3C7V A;  1V9Z A;  3KYQ A;  3Q82 A;  3VP1 A;  3S7N A;  2Y2P A;  2BAS A;  3T4L A;  1S6R A;  3OPH A;  1S4R A;  2Y91 A;  3IHA A;  3UN7 A;  4JGP A;  2XSS A;  3DBA A;  1RGZ A;  5I5L A;  2V0U A;  2ZD8 A;  4II7 A;  4FH2 A;  1O07 A;  4B93 A;  3WRT A;  2D01 A;  2IWC A;  3CWF A;  5EVI B;  5GLB A;  3VP4 A;  3T4O A;  4R1G A;  4N9K A;  1JWZ A;  1P97 A;  2J3W A;  4MBF A;  3E0Y A;  5F1F A;  4UQI S;  4QY6 A;  2EWW A;  4LLO B;  1SHV A;  4QB8 A;  2ZOI A;  3O88 A;  2XRN A;  1MWR A;  2ZQA A;  4JF4 A;  4Y0U A;  1N9N A;  3MFX A;  1IEM A;  2ZQC A;  4EQI A;  2PBY A;  4F3L B;  3SOI A;  3G34 A;  5CXW A;  4WBG A;  3ZFZ A;  5IHV A;  2XD1 A;  1PRQ A;  1ZKJ A;  4MNR A;  1K4F A;  4PMA A;  4C6Y A;  2M1C A;  2ZM2 A;  3CPT B;  5J7E A;  3G2Z A;  1DJB A;  4KQD A;  4L9E A;  4BWI A;  4R4S A;  4MN5 A;  2W3H A;  3G6O A;  2HJ9 C;  3PBR A;  3MFD A;  1IYQ A;  5TJJ A;  3P09 A;  4AFI A;  5F6A A;  4ZRR A;  5F1G A;  3UB5 P;  3HLB A;  2J7V A;  1ES4 A;  2B18 A;  2J80 A;  3V67 A;  2FZ0 A;  1AWI A;  5CX7 A;  3H9W A;  2XDM A;  1IYO A;  2DNS A;  2BTF P;  5KMW A;  4E3J A;  3UDX A;  1LT0 A;  4UQI M;  1N4O A;  4DDS A;  5AQ7 A;  1K56 A;  3LCE A;  3OCN A;  4GS9 A;  1KOU A;  3NUL A;  2V2F F;  5AVF A;  4WMC D;  1DJA A;  2O9B A;  5D3O A;  1YLP A;  3CMZ A;  4H8R A;  2V1Z A;  4WN5 A;  2Y59 A;  3PR6 A;  4LCL A;  5L10 A;  1HZO A;  4NET A;  3MKE A;  4L9F A;  2HP6 A;  2XFT A;  1IYS A;  3L9K A;  3CPT A;  3S7P A;  2XLN A;  1XFQ A;  3UE3 A;  3O86 A;  1MC0 A;  1XJ3 A;  3FV7 A;  2WYX A;  3CIT A;  2MJ6 A;  4HJ6 A;  1MZU A;  3EEA A;  4OON A;  2WKP A;  1E3U A;  1HTZ A;  3VOZ A;  3V3S A;  1FIL A;  1FOF A;  1N9B A;  4C3Q A;  2ZL1 B;  4LFU A;  4K0X A;  2EFU A;  3TE8 A;  5FI7 A;  4P6B A;  1PWD A;  5HDS A;  2VJW A;  3RXX A;  4R70 A;  3RXW A;  3ZNT A;  3IXD A;  3ZGA B;  3M6H A;  3GEC A;  3ZDJ A;  4LGW A;  1CI8 A;  5DF7 A;  2HDS A;  4EXO A;  4QY5 A;  2W3D A;  4IUH A;  4X55 A;  2J3T C;  2PD8 A;  1OME A;  5DKK A;  1XGJ A;  1RGY A;  1ZC2 A;  4JF5 A;  2W3E A;  3FG8 A;  1SKF A;  3GQZ A;  5EEC A;  5IU1 A;  4BD1 A;  4XUZ A;  1ONH A;  2JN7 A;  3VOY A;  3BFC A;  1BUL A;  1K57 C;  4EUV A;  3NOT C;  4PM5 A;  5DVA A;  1UWN X;  4D2O A;  1MBL A;  1PI5 A;  3R7W B;  4QWO A;  2E8I A;  4O01 A;  1BLC A;  2VGJ A;  1NWZ A;  5EE8 A;  5JYO A;  3B42 A;  1X0O A;  3KYZ A;  4L9G A;  1SKO B;  1PWC A;  1H3Q A;  3PAE A;  1TDL A;  3UPP A;  2J3T D;  3T1S A;  3BFE A;  1K0K A;  3IF5 A;  5HAQ A;  3UB6 A;  3WS0 A;  4EQ1 A;  3EQV A;  1LI0 A;  4XXR A;  4L0L A;  1OTE A;  3MMH A;  3E2L A;  5FQ9 A;  3DTM A;  5F69 A;  3NDG A;  1SDE A;  1L3L A;  3F1N A;  2V9A A;  4BBT A;  1ES2 A;  2HF6 A;  2OSU A;  3IBJ A;  5AVE A;  1TS8 A;  4BJP A;  1GSV A;  3LIF A;  3ZQ5 A;  4HES A;  2GJ3 A;  1NZU A;  3MF0 A;  4OOY A;  4IVI A;  3LID A;  1YPR A;  3BWL A;  4JPM A;  4OPR A;  1YLJ A;  2HP5 A;  2JE5 A;  4YIN A;  3SS5 A;  3PHY A;  5DJT A;  4FUW A;  4MLL A;  3UME A;  2PR5 A;  3CAX A;  2PYR A;  5DF8 A;  2B5R A;  2EWV A;  4MBK A;  2LB9 A;  2ZQD A;  1VEU B;  5F82 A;  3S7O A;  2R78 A;  1DP8 A;  5GL9 A;  5TR7 A;  1OJG A;  4D60 A;  2K7S A;  1OTA A;  5EM1 A;  5GHY A;  5EVE A;  1ES5 A;  3N4I A;  3K2N A;  3BFD A;  2HDQ A;  2H5S A;  1NLY A;  4R0Q A;  1W8Q A;  3NEC A;  4DMZ A;  3KSH A;  4RQ9 A;  3IBR A;  5DFX A;  4OQH A;  4NXB A;  1LSW A;  5DFY A;  3ZNY A;  3MKF A;  2PR6 A;  4ARZ B;  1PW8 A;  1ERM A;  4KZ3 A;  3V3R A;  3FYZ A;  2QHK A;  4A5R A;  3EOI A;  3M6B A;  3Q07 A;  4EBL A;  2I9V A;  3W4P A;  3IWI A;  3LUQ A;  4I3J A;  3BFG A;  1XA1 A;  3S1Y A;  1UWP X;  5AQ9 A;  5CTM A;  4GHI B;  2ZC5 B;  3OZH A;  1IFQ A;  2EXA A;  4OKP A;  1KE4 A;  3TW8 A;  5FQM A;  1H5X A;  3H82 B;  2ZQ9 A;  3PAG A;  1D1J A;  2RL3 A;  5IS1 A;  2W1R A;  3CUE A;  5FAS A;  1NYY A;  4WYY A;  3BEC A;  2O99 A;  4HJ3 A;  2Q9N A;  5G18 A;  1YLZ A;  5FEG A;  3QNC A;  4Y5F A;  1F9I A;  3F1O B;  1LSX A;  5GHX A;  1G68 A;  3T4K A;  3LEQ A;  3ISG A;  2JKF A;  4RVA A;  4JGR A;  2QZ6 A;  3MZD A;  2NUT C;  4LEN A;  3E4O A;  3ZG5 A;  3Q7V A;  3C7U A;  2QWS A;  3UY6 A;  5FAO A;  4MCW A;  2Z6C A;  1S66 L;  2RCX A;  1KDS A;  2QKP A;  4S2L A;  4I3A A;  3IF6 C;  2R9X A;  3QP8 A;  3KX0 X;  5AJG A;  4JXW A;  1SKO A;  1JWP A;  3BYD A;  3M2J A;  5HAP A;  3BW6 A;  2WGV A;  4OQI A;  4I3I A;  2HDU A;  3SS3 A;  1BLP A;  1ZG4 A;  3P01 A;  3R4K A;  2IWD A;  4YFM A;  4MMN A;  4LV2 A;  3CG5 A;  3QP5 A;  4U0X A;  4XUX A;  3UPN A;  4DN0 A;  3W2Z A;  2V8C A;  3MXR A;  2Y4A A;  3MQ0 A;  4G3K A;  1CI9 A;  5EOO A;  1P9R A;  4UEY A;  2H28 A;  3HUM A;  1NYM A;  2KX6 A;  4GB7 A;  5HAI A;  3VP0 A;  3IH9 A;  3OPP A;  5AQB A;  2Y2H A;  5TFQ A;  3MZF A;  2IWB A;  4FD8 A;  4E6W A;  2WAE A;  2QYB A;  3Q7V B;  4MEZ A;  1EWZ A;  4IUK A;  4NXF A;  2YKH A;  3PYP A;  3NJA A;  3JYI A;  3B33 A;  1K55 C;  3IX8 A;  4Y3I A;  1LI9 A;  4Y17 A;  3IWO A;  3HL9 A;  1H0M A;  4HQA A;  1IKI A;  3KO6 A;  4ZBE A;  3IX3 A;  3E4Q A;  5DF9 A;  4GLQ A;  3A3D A;  2JBF A;  2OLV A;  3CZD A;  4H6J A;  3QP1 A;  5M19 A;  4JXG A;  1I5Q A;  3ITA A;  4QD4 A;  5G4Y A;  1J3W A;  3C5A A;  4P6Z M;  4OLG A;  2L1M A;  3WWX A;  4RX2 A;  1ZTU A;  3NY4 A;  4RA7 A;  3G2Y A;  4WEK A;  4KZ4 A;  4KZ7 A;  4HJ4 A;  4R4R A;  3T50 A;  2GZA A;  4IVK A;  3RJU A;  4HBT A;  2HV1 A;  2XRO A;  5GHZ A;  5HL6 A;  2O9C A;  4OVD A;  2V1B A;  2PBD P;  5EPH A;  4Z9Q A;  3UMD A;  1EW0 A;  2Y55 A;  1Y4O A;  5HZH A;  4XT2 B;  5GLD A;  4ARZ A;  4CLC D;  3I7J A;  4GKU A;  4X1M A;  2OV5 A;  5F5Y A;  5JYP A;  1TF1 A;  2WK0 A;  3FKV A;  1FCN A;  2JHE A;  2Z6D A;  4DE2 A;  3UO9 A;  5CED A;  3VOL A;  3LY3 A;  2PDR A;  2XD5 A;  1FCO A;  5HWV A;  1FSY A;  3S4X A;  3VE4 A;  4DKI A;  4R3B A;  3G32 A;  3BQ8 A;  1NRJ A;  3GVB A;  2A24 A;  5J8X A;  3DTK A;  2EX8 A;  3HUO A;  4DJ3 A;  4C75 A;  3IQA A;  5FSR A;  5EFW A;  4EBP A;  1W79 A;  3OBF A;  3B3X A;  4BBU A;  4ZTK A;  1ESI A;  2C5W B;  2KDK A;  4NK3 A;  4O0P A;  5HWW A;  1G5U A;  4HP4 A;  4DE1 A;  1IOU A;  1KDW A;  3EGD C;  4OOL A;  5FEF A;  3VSK A;  1Z09 A;  2J8Y A;  3ZVT A;  4JF6 A;  3EWK A;  1STZ A;  2HDR A;  3A0R A;  3S7Q A;  2XR0 A;  3T1X A;  1XJ6 A;  4ESP A;  3JVU A;  3NI9 A;  4P0M A;  4MDZ A;  1DP9 A;  3LR0 A;  4GD6 A;  2Y79 A;  3ZG8 B;  5HX9 A;  3T4S A;  4JGQ A;  3KSI A;  4NXE A;  4LV1 A;  3Q1F A;  4I39 A;  3D4F A;  1DJC A;  3LY4 A;  1EI5 A;  3O87 A;  5J3W A;  3QP2 A;  3MS6 A;  3C4O A;  1HLU P;  4PKY A;  4QPR A;  5A92 A;  5HWT A;  3GTC A;  4JKT A;  2Y8H A;  5FQI A;  5E2H A;  4N92 A;  4ETZ A;  3LR3 A;  1OJ5 A;  2K31 A;  2VGL M;  2X71 A;  4FCF A;  3DTE A;  3PBN A;  4KQQ A;  4NG2 A;  1YKD A;  2L0W A;  5E2G A;  4WL9 A;  2ZM8 A;  2UV0 E;  4EEU A;  1XFN A;  4P6Z S;  3OPR A;  3IXH A;  4G3W A;  2WKE A;  4HH2 A;  3DAV A;  3Q7Z A;  1K6S A;  1OT6 A;  5DJU A;  4I5S A;  5HL1 A;  4PM6 A;  3A0S A;  4LCM A;  1TS0 A;  1G28 A;  4EBN A;  4UA7 A;  2EX6 A;  4OPY A;  1XJ4 A;  5CGS A;  5CTN A;  3IWQ A;  3VMA A;  5F83 A;  4N9L A;  3TG9 A;  3CHW P;  4WEL A;  2JKT I;  5M18 A;  2OAQ 1;  3HCY A;  4KUO A;  1TDG A;  1Q2Q A;  4S2I A;  1Q2P A;  3S22 A;  2QMI A;  1OT9 A;  3NDE A;  1GA0 A;  2ZOH A;  1FR1 A;  1L0E A;  3A3F A;  2A2L A;  1AXB A;  4P85 A;  5GLA A;  3BM6 A;  4IHQ A;  2JKR I;  3NHQ A;  1MWU A;  4X53 A;  1PFL A;  1U60 A;  2WGW A;  3HJK A;  2CC1 A;  1JNU A;  5E2E A;  1TVF A;  1VEU A;  2JCH A;  4U3T A;  2FFF B;  2ZM0 A;  3IS2 A;  4HEF A;  3Q81 A;  1DRM A;  4DXC A;  4S2P A;  2JKR M;  2ZLY A;  2XEP A;  3HRE A;  1XKZ A;  1CEF A;  2VGK A;  1NRF A;  1YSQ A;  5FDH A;  5L8M A;  2WAD A;  3LIC A;  3C8C A;  2NUP C;  3DWK A;  4LRZ E;  3ITB A;  2ZMA A;  2OWH A;  3T1Q B;  3UE6 A;  1GHP A;  4O8G A;  2INW A;  4BEN A;  4ME4 A;  4ZDX A;  1VB6 A;  4K91 A;  2BLS A;  5EVI D;  3TOI A;  1MKM A;  1NZO A;  2PD7 A;  1WYC A;  4KEN B;  1IKG A;  3E4P A;  2B02 A;  1NY0 A;  1GSX A;  2JKG A;  1GHM A;  3UDI A;  3WS4 A;  4Q0H A;  2W1T B;  3LI9 A;  3ZHH A;  3BY9 A;  1W63 M;  3AGD A;  2XFS A;  4BL2 A;  1FCM A;  3HLG A;  2H10 A;  1YM1 A;  1LHY A;  2G2U A;  1PIO A;  4ZJ1 A;  4HI4 A;  1CJF A;  2HGV A;  4GDN A;  1BYW A;  2WZZ A;  1ERQ A;  5EM0 A;  3T4J A;  3HVF A;  3T4Q A;  3P98 A;  5KSC A;  4EU0 A;  5KSH A;  3PXP A;  3O5Y A;  4OP8 A;  2OOL A;  2W27 A;  1WYB A;  4P87 A;  1ODV A;  4OPQ A;  1CQA A;  3SH8 A;  2WKH A;  4WLA A;  4KZA A;  5A8B A;  2HZ5 A;  4X1L A;  1ONG A;  4LPZ A;  2HPB A;  1WE4 A;  3U4L P;  5EOE A;  4YOF A;  4ID4 A;  3FZC A;  2FH5 A;  1I2W A;  2V0W A;  2J9P A;  3D3O A;  1OTD A;  2P08 A;  4HY8 A;  4MN6 A;  4Q8I A;  4WEJ A;  4MBH A;  4Y13 A;  3NCK A;  4I38 A;  3N8L A;  3RFB A;  1G6A A;  1D7E A;  5HPF A;  1MY8 A;  3VV4 A;  5FDS A;  5A90 A;  2W1T A;  5CRF A;  3SZT A;  2A3U A;  5L09 A;  2Z2M B;  1Y54 A;  2H0T A;  4EES A;  1W63 Q;  2XH9 A;  4WZ5 A;  4IED A;  1K56 D;  4E3M A;  3ZYT A;  2OWJ A;  2O0Y A;  2PAV P;  3ULF A;  4F94 A;  4JBF A;  3SW1 A;  2QJ5 A;  4KG2 A;  4QU3 A;  4Z1W A;  1W8Y A;  4JGO A;  3DW0 A;  2VV7 A;  1QME A;  1YT4 A;  3GSG A;  1BLH A;  1G6O A;  4KZB A;  4X69 A;  3MZE A;  3HLE A;  4HHD A;  2KLI A;  1K6R A;  2OAP 1;  2CMN A;  2Y2O A;  4DE3 A;  1DP6 A;  4Y2F A;  4WM9 A;  3UNW A;  4KQO A;  1S0W A;  3MSH A;  5CGW A;  1W5D A;  3UB8 A;  3D9Y A;  2Y2Q A;  4KZ6 A;  2VZW A;  3EQU A;  3DWZ A;  2M7U A;  4LV3 A;  3UB7 A;  4CQH A;  3WS5 A;  3KYE A;  4PPR A;  2ZC6 B;  5DTS A;  4BQM A;  3IXG A;  3T4T A;  4EW7 A;  4OQ0 A;  4H6J B;  3N8R A;  1KGF A;  2WZX A;  2JKT M;  3GMW A;  3D72 A;  4BBV A;  3C38 A;  4S2N C;  2VA0 A;  1NJ4 A;  3UB9 A;  4NEE D;  4OQG A;  1T1A A;  5FAT A;  4E04 A;  5L2F A;  1SZV A;  3HBR A;  3VP3 A;  1ALQ A;  4Q0I A;  2XQZ A;  4Q0J A;  5EVI A;  3A3J A;  3BLS A;  3QHY A;  3PBS A;  4CLC C;  2M7V A;  1YLT A;  4PAU A;  1YSP A;  1I2S A;  2PU2 A;  4E3O A;  3PTE A;  4R38 A;  1F2K A;  4BLM A;  2WKI A;  3ZG7 B;  3F1O A;  1XPB A;  2C6W B;  2EX9 A;  2Y2L A;  4JLF A;  4R3J A;  4LV0 A;  2O9A A;  4HH3 A;  2EFX A;  3BFF A;  4HNB A;  1HD8 A;  3MXS A;  3PBT A;  2XF3 A;  3TRC A;  5CHM A;  2FFY A;  2XGN A;  1TS7 A;  5CGX A;  1M6K A;  1BUE A;  4OPZ A;  3OLO A;  3G35 A;  2DCF A;  5HFO A;  1K55 A;  1FSW A;  4Y0T A;  3NOU C;  1S1Y A;  3N8S A;  4R23 A;  1N9L A;  2Q0O A;  2XA7 M;  4UAA A;  1ZHH B;  3LR4 A;  4DDY A;  3BRM A;  3K3C A;  2W3F A;  1T18 A;  3EGX C;  4WMC A;  4K08 A;  4M4X A;  2J9O A;  2GX5 A;  1PYY A;  4OOM A;  2PU4 A;  3EEH A;  4GJ4 A;  4MN7 A;  1KVM A;  4GS9 B;  4DJ2 A;  2XK1 A;  3G4P A;  4M3K A;  5TBM B;  1ACF A;  1GSW A;  1XX2 A;  4HOI A;  3WRZ A;  2VV6 A;  3IF6 A;  5KZH A;  3G31 A;  5IT5 A;  1T1B A;  3F1P B;  3LIA A;  3HLW A;  2VX8 A;  4GNU A;  1K38 A;  1YLW A;  2VGL S;  4KZ5 A;  5FAQ A;  1LL9 A;  1L2S A;  1H8Y A;  3WS1 A;  3ZVW A;  3JPU A;  1P0Z A;  3RTY A;  3OC2 A;  4PHT A;  1XGI A;  3QNB A;  4B9O A;  1HVB A;  1LL8 A;  1JTG A;  5DTK A;  3GR2 A;  3ZCZ A;  2EXB A;  4E3K A;  3QP6 A;  5EUA A;  2Y2K A;  5CER A;  1PNE A;  2PRF A;  1N9O A;  3FKW A;  3CUE C;  2EA9 A;  1BLS A;  2Y2I A;  1L0D A;  3TSG A;  3OCL A;  5CHU A;  1BTL A;  4FSF A;  2X02 A;  5FA7 A;  4B4Z A;  5I94 A;  3C2W A;  3PBO A;  4UHU A;  4ETX A;  1YQS A;  3H7W A;  5L07 A;  5HSQ A;  1IYP A;  1P9W A;  2WUQ A;  1VET A;  3MR0 A;  3KSF A;  1OTB A;  3NIA A;  3BJN A;  4Y7P A;  1K57 A;  1SCW A;  3VE3 A;  4BL3 A;  3HLF A;  1QMF A;  1IEL A;  2G2W A;  1TD5 A;  4ZJ2 A;  2V8F A;  1YMX A;  3PBQ A;  2Z2L B;  3DTI A;  1MXO A;  4KZ8 A;  3IHB A;  4X25 A;  4KZ9 A;  4HBU A;  3MJQ A;  2A24 B;  3GV9 A;  2ZMF A;  4WF0 A;  2HP9 A;  1NLZ A;  2YKF A;  3HLD A;  3W4O A;  3ZG9 B;  2QPN A;  2VKS A;  3LIB A;  3NC8 A;  5HPI A;  3SH7 A;  5FQJ A;  4BMW A;  2Y2M A;  5GLC A;  4QHC A;  4B4X A;  3BY8 A;  2VV8 A;  4OLD A;  2A49 A;  3VFF A;  4IJG A;  4KQR A;  4WZ4 A;  5KIZ A;  3VP2 A;  3ZG0 A;  1OTI A;  3SH9 A;  3HLC A;  3FC7 A;  5TGF A;  3NBL A;  1GA9 A;  3FPW A;  4S2O A;  2VLG A;  1T19 A;  3K3D A;  4E6X A;  4CLC E; 
#chains in the Genus database with same CATH homology
 3F1N B;  2WKR A;  4PKY G;  4F3L B;  4I3I A;  4HI4 A;  2HGV A;  1BYW A;  3OOV A;  3P01 A;  3R4K A;  3T4J A;  3T4Q A;  4MMN A;  4EU0 A;  5KSH A;  3PXP A;  3O5Y A;  1H8M A;  2OOL A;  2W27 A;  4DN0 A;  2W3G A;  2M1C A;  1ODV A;  5J7E A;  3W2Z A;  3CLO A;  4KQD A;  4L9E A;  4BWI A;  3MQ0 A;  3E98 A;  4G3K A;  5K5B A;  1YAX A;  1P9R A;  4UEY A;  2H28 A;  4WLA A;  5A8B A;  4MN5 A;  2KX6 A;  2W3H A;  3G6O A;  2HJ9 C;  4LPZ A;  3PBR A;  5TJJ A;  2LB5 A;  4AFI A;  5F6A A;  4ZRR A;  4YOF A;  2FH5 A;  2V0W A;  4LRX C;  3D3O A;  1OTD A;  2P08 A;  4HY8 A;  4MN6 A;  4WEJ A;  2B18 A;  4KUK A;  2J80 A;  2QYB A;  3V67 A;  2FZ0 A;  4IUK A;  5CX7 A;  4NXF A;  3H9W A;  2YKH A;  4I38 A;  3PYP A;  3RFB A;  3NJA A;  1D7E A;  2ZMV A;  3B33 A;  5HPF A;  4Y3I A;  3VV4 A;  1LT0 A;  2QJ7 A;  2PHY A;  4UQI M;  3U2A A;  3OCN A;  2W1T A;  4HQA A;  4HP9 A;  3KO6 A;  5DF9 A;  3E4Q A;  4GS9 A;  1KOU A;  4GLQ A;  2P7J A;  2KOI A;  5AVF A;  4EES A;  1W63 Q;  1S67 L;  4H6J A;  2O9B A;  3B47 A;  2WKQ A;  4CLC B;  5G4Y A;  4P6Z M;  2L1M A;  4WN5 A;  4FOF A;  5F68 A;  3ZYT A;  2OWJ A;  3PR6 A;  2O0Y A;  3ULF A;  1ZTU A;  1TS6 A;  5HD3 A;  4L9F A;  3C30 A;  3SW1 A;  2QJ5 A;  4Z1W A;  4JGO A;  3S7P A;  2IA2 A;  4WEK A;  1OPX A;  2VV7 A;  3F1P A;  1XFQ A;  4HJ4 A;  3LFV A;  3UE3 A;  3HJI A;  3T50 A;  2GZA A;  1G6O A;  1MC0 A;  2DMW A;  1XJ3 A;  4R6L A;  3CIT A;  4HHD A;  2KLI A;  2OAP 1;  2CMN A;  2MJ6 A;  2HV1 A;  4HJ6 A;  1MZU A;  3RH8 B;  2XRO A;  3FPV A;  3EEA A;  5HDC A;  3LI8 A;  1UGU A;  1DP6 A;  4Y2F A;  5HL6 A;  1F98 A;  4KQO A;  2O9C A;  2WKP A;  2V1B A;  4EET B;  3UB8 A;  3UMD A;  1EW0 A;  4GHI A;  5HZH A;  2VZW A;  3EQU A;  4XT2 B;  4GW9 A;  3R7W A;  4ARZ A;  4CLC D;  2M7U A;  3UB7 A;  3TE8 A;  4CQH A;  5F5Y A;  1TF1 A;  5HDS A;  2VJW A;  2JHE A;  2Z6D A;  4R70 A;  3T4T A;  4WUJ A;  4EW7 A;  4H6J B;  3GEC A;  3KSG A;  2JKT M;  3VOL A;  4CLC A;  4EXO A;  2PDR A;  3D72 A;  2PT7 A;  5HWV A;  4BBV A;  1T1C A;  2W3D A;  3C38 A;  4IUH A;  2J3T C;  2VA0 A;  2PD8 A;  3UB9 A;  4NEE D;  3H7W B;  3VE4 A;  3IS2 B;  2G7U A;  3BQ8 A;  1T1A A;  1NRJ A;  4E04 A;  2A24 A;  5DKK A;  4Q0I A;  4Q0J A;  3GDI A;  1S4S A;  3LR5 A;  4DJ3 A;  2W3E A;  3PBS A;  4CLC C;  3FG8 A;  5EFW A;  2M7V A;  5IU1 A;  5J4E A;  3OBF A;  4PAU A;  1YSP A;  4BBU A;  2JN7 A;  3MQO A;  5DKL A;  4R38 A;  2KDK A;  4O0P A;  5HWW A;  5C5K A;  2PYP A;  2W0N A;  3F1O A;  4EUV A;  4HP4 A;  3NOT C;  3P7N A;  3MXQ A;  2D02 A;  1IOU A;  1UWN X;  3EGD C;  3R7W B;  1VHM A;  4O01 A;  1NWZ A;  1XJ2 A;  4OOL A;  2O9A A;  4HH3 A;  3B42 A;  1X0O A;  3KYZ A;  4L9G A;  4HNB A;  1H3Q A;  3EWK A;  1STZ A;  3PBT A;  4F3L A;  3TRC A;  3BQA A;  3A0R A;  4G3V A;  3S7Q A;  2J3T D;  1XJ6 A;  4HIA A;  5HD5 A;  3JVU A;  1TS7 A;  3NOP C;  4MDZ A;  3OLO A;  5HDD A;  1DP9 A;  3LR0 A;  4GCZ A;  2Y79 A;  3UB6 A;  4EQ1 A;  3NOU C;  4R3A A;  3EQV A;  4L0L A;  1OTE A;  3MMH A;  4JGQ A;  3T4S A;  3KSI A;  4NXE A;  1S1Y A;  3ICY A;  5F69 A;  1N9L A;  5G4Z A;  4I39 A;  3F1N A;  2V9A A;  4BBT A;  3MQQ A;  2HF6 A;  5J3W A;  3IBJ A;  2XA7 M;  4YWZ A;  1ZHH B;  5AVE A;  1TS8 A;  3LR4 A;  4BJP A;  3K3C A;  2W3F A;  1GSV A;  1LSV A;  3LIF A;  4PKY A;  4QPR A;  3ZQ5 A;  2GJ3 A;  3LYX A;  1T18 A;  3EGX C;  3LIE A;  1F5M A;  5HWT A;  4K08 A;  3MF0 A;  4M4X A;  2Y8H A;  2GX5 A;  4EER A;  4ETZ A;  2K2N A;  4OOM A;  3LR3 A;  2L4R A;  3LID A;  3EEH A;  4GJ4 A;  1OJ5 A;  3BWL A;  2K31 A;  2VGL M;  4MN7 A;  3A0V A;  3PBN A;  4GS9 B;  3PHY A;  5DJT A;  4DJ2 A;  3UME A;  1YKD A;  2L0W A;  2PR5 A;  5TBM B;  3CAX A;  2PYR A;  4WL9 A;  2EWV A;  1GSW A;  2XA7 S;  4EEU A;  1XFN A;  2LB9 A;  4HOI A;  3CI6 A;  4P6Z S;  3S7O A;  2R78 A;  1DP8 A;  2VV6 A;  4G3W A;  4NKP A;  1OJG A;  4HH2 A;  2K7S A;  1OTA A;  1OT6 A;  5DJU A;  4I5S A;  5IT5 A;  1T1B A;  3F1P B;  3K2N A;  3LIA A;  3A0S A;  1TS0 A;  2VX8 A;  1G28 A;  4EEP A;  3H82 A;  1WA9 A;  2VGL S;  4LRY C;  1XJ4 A;  5MC7 A;  1NLY A;  4WEL A;  5FL3 A;  2JKT I;  4YNR A;  1P0Z A;  3OC2 A;  2GNX A;  3KSH A;  4PHT A;  3RTY A;  2OAQ 1;  3HCY A;  4KUO A;  2HJE A;  4DMZ A;  2V1A A;  4RQ9 A;  3IBR A;  1OT9 A;  1D06 A;  1S1Z A;  5DFX A;  4NXB A;  1LSW A;  2ZOH A;  5DFY A;  4B9O A;  1LL8 A;  4XT2 A;  2A2L A;  2PR6 A;  4ARZ B;  2P04 A;  2QHK A;  3TJZ C;  2ZBB A;  1Y28 A;  4IHQ A;  1N9O A;  4NXG A;  3CUE C;  3EOI A;  2EA9 A;  2JKR I;  5TBM A;  3NHQ A;  2I9V A;  3LUQ A;  3OCL A;  1V9Y A;  4I3J A;  4FSF A;  3HJK A;  1JNU A;  3C2W A;  3JVV A;  3PBO A;  1UWP X;  5LBR A;  4ETX A;  3H7W A;  3IS2 A;  4GHI B;  5HSQ A;  2VEA A;  1DRM A;  1P9W A;  3MR0 A;  3KSF A;  1V9Z A;  1OTB A;  3KYQ A;  1IFQ A;  2JKR M;  3BJN A;  3TW8 A;  3VE3 A;  3H82 B;  1YSQ A;  3S7N A;  5IS1 A;  2W1R A;  2BAS A;  3T4L A;  3CUE A;  1TD5 A;  1S4R A;  3PBQ A;  5L8M A;  3LIC A;  2O99 A;  4HJ3 A;  4JGP A;  2XSS A;  3DBA A;  3C8C A;  2NUP C;  5I5L A;  4LRZ E;  2V0U A;  2OWH A;  4Y5F A;  3UE6 A;  1F9I A;  3F1O B;  2A24 B;  3MJQ A;  4II7 A;  1LSX A;  4O8G A;  4B93 A;  2ZMF A;  3T4K A;  2D01 A;  4WF0 A;  1NLZ A;  2INW A;  2YKF A;  3CWF A;  4ME4 A;  2VKS A;  3LIB A;  1VB6 A;  5HPI A;  4JGR A;  3T4O A;  4BMW A;  2NUT C;  3E4O A;  1MKM A;  2VV8 A;  1P97 A;  3BY8 A;  2J3W A;  4IJG A;  2QWS A;  2PD7 A;  5KIZ A;  3E0Y A;  4UQI S;  4MCW A;  1OTI A;  2EWW A;  4LLO B;  2Z6C A;  1S66 L;  3FC7 A;  3E4P A;  2QKP A;  2B02 A;  2ZOI A;  1GSX A;  3FPW A;  2XRN A;  4I3A A;  2VLG A;  4Q0H A;  2W1T B;  1N9N A;  3LI9 A;  3BY9 A;  1W63 M;  3MFX A;  3KX0 X;  5AJG A;  1T19 A;  3K3D A;  3BW6 A;  4CLC E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...