1BYWA

Structure of the n-terminal domain of the human-erg potassium channel
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
110
structure length
110
Chain Sequence
SRKFIIANARVENCAVIYCNDGFCELCGYSRAEVMQRPCTCDFLHGPCTQRRAAAQIAQALLGAEERKVEIAFYRKDGSCFLCLVDVVPVKNEDGAVIMFILNFEVVMEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein
molecule keywords PROTEIN (HUMAN ERG POTASSIUM CHANNEL)
publication title Crystal Structure and Functional Analysis of the Herg Potassium Channel N-Terminus: A Eukaryotic Pas Domain
pubmed doi rcsb
source organism Homo sapiens
total genus 27
structure length 110
sequence length 110
ec nomenclature
pdb deposition date 1998-10-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13426 PAS_9 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 1bywA00
3CWFA 3FC7A 4M4XA 2A24B 4I3JA 3VE4A 5HSQA 2PDRA 1TS0A 4LLOB 4R38A 4EEUA 1EW0A 5HD3A 2B02A 3LIFA 5EFWA 3BWLA 4DJ3A 3E4PA 4WLAA 4H6JB 1N9LA 5AVFA 1XJ6A 4XT2B 3LIDA 2PR5A 4HIAA 4BBUA 2JHEA 3NOUC 3MQOA 2PYPA 5DKLA 4HQAA 4EXOA 5F5YA 2WKPA 3FG8A 3SW1A 2QJ7A 4HNBA 1NWZA 1T1AA 5TBMA 4HOIA 5I5LA 4E04A 4WL9A 2L4RA 2A24A 5F69A 4DJ2A 1UWNX 5DJUA 3CAXA 5HWTA 5HWVA 4WN5A 1LL8A 1T19A 5F6AA 4H6JA 2I9VA 4KQDA 1TS7A 3E4QA 3RH8B 1GSVA 2QKPA 3HJKA 3KX0X 3EWKA 3LYXA 1ODVA 5TBMB 4LRZE 4RQ9A 1V9YA 1S66L 2L1MA 5HDSA 1S4RA 5HDCA 4KUKA 3RTYA 3NOPC 4EERA 1GSXA 2K7SA 4EQ1A 4K08A 4LPZA 1N9OA 1V9ZA 1OT9A 3NHQA 3UB9A 2BASA 2PD7A 3C2WA 3LICA 4EEPA 4NXGA 1S1YA 4WF0A 3MJQA 2CMNA 1UGUA 2WKQA 3E4OA 2WKRA 4PKYA 4I39A 4HJ4A 3UB6A 4MN5A 1XJ3A 3H9WA 2OWJA 3F1OA 4BBVA 2M1CA 5J7EA 1XJ2A 1KOUA 1DRMA 3MFXA 1XFQA 3F1NB 3T50A 1LSVA 5F68A 3UMDA 3UMEA 2YKHA 3IBRA 4I38A 2OOLA 3GECA 2R78A 4HP4A 1OTIA 4HY8A 1TS8A 5DKKA 2VEAA 2JN7A 3LIBA 3K3CA 4I5SA 4GS9A 5G4YA 2Z6CA 4HJ6A 4NXBA 3B33A 2HV1A 2PYRA 1LSWA 4JGPA 2PR6A 4PKYG 1LT0A 2D02A 3F1OB 1G28A 5J3WA 2GJ3A 1OT6A 4HH3A 4GW9A 3UE6A 3H7WB 1DP8A 2VV8A 3NJAA 4EW7A 5J4EA 5IU1A 1GSWA 3LI9A 1UWPX 5AVEA 3D72A 5HD5A 2W0NA 1TS6A 3IS2B 2OWHA 4LRYC 3GDIA 3F1NA 1D7EA 2QWSA 1T1BA 2Z6DA 4F3LA 5A8BA 1XJ4A 1WA9A 3A0RA 4HJ3A 2VV7A 4GS9B 1N9NA 3ULFA 1DP9A 1OTAA 1OTDA 2ZBBA 5KIZA 1JNUA 2V9AA 1X0OA 2INWA 5G4ZA 1S4SA 4B9OA 3UB8A 4L9EA 4HP9A 4I3AA 4YWZA 3G6OA 5HZHA 3K3DA 1BYWA 4LRXC 3HJIA 1LSXA 1OTBA 2ZOHA 2V1AA 3H82A 3MXQA 2VLGA 1P97A 2D01A 3H7WA 4NXFA 3OLOA 4KUOA 5DJTA 3P7NA 2ZOIA 4I3IA 4F3LB 3PHYA 5HDDA 3LIAA 3VE3A 4EESA 3ICYA 1S67L 2QHKA 3IS2A 4L9GA 4BBTA 3MR0A 4GHIB 4JGRA 1T1CA 3F1PB 2J80A 1OJGA 4HI4A 3MQQA 5HWWA 3C8CA 3LI8A 2EA9A 1F9IA 4HH2A 3A0VA 1P0ZA 3A0SA 4NXEA 4HHDA 2VV6A 3EEHA 1Y28A 1DP6A 2V0UA 3VOLA 4GCZA 1VB6A 3CLOA 2KDKA 1D06A 3H82B 3BY9A 3LUQA 4EETB 4L9FA 3UB7A 2W27A 4JGQA 1F98A 4R70A 2V0WA 3PYPA 1XFNA 2QJ5A 5IS1A 2PHYA 3ZQ5A 2YKFA 2V1BA 2PD8A 2L0WA 4XT2A 2H28A 2KX6A 4MN6A 1S1ZA 4JGOA 3NOTC 4R3AA 2P7JA 1OTEA 4WUJA 4GHIA 1MZUA 3LIEA 1T18A 1OJ5A 3F1PA 4R6LA 3BY8A
chains in the Genus database with same CATH superfamily
1DJBA 2A24B 4I3JA 3VE4A 5HSQA 1TS0A 5TJJA 3R4KA 3OCNA 4R38A 4LV3A 2H0YA 2W3EA 5EPHA 2BTFP 2J3TC 5GHXA 2B02A 3LIFA 4G3WA 1K54A 3ZCZA 4KZ6A 5HAPA 2H10A 2JCHA 1MWRA 4P6BA 4Y15A 1FOFA 3V3SA 5K5BA 3LGOA 2PBDP 4UQIS 2JHEA 5GLDA 5FI6A 2K31A 3V67A 3IT9A 4EXOA 1KGEA 3N8RA 4KZ3A 2XRNA 3UPNA 2Y91A 1J9MA 2JKTI 4EQIA 4YNRA 2O9AA 3N7WA 4B4XA 2VKSA 5DTSA 3R7WA 5I5LA 4WL9A 3ZG9B 2XD5A 1PI4A 4WMCA 1PWCA 4DJ2A 4JF5A 1PNEA 5CTNA 3WS1A 2ZC5B 2Y2OA 3IQAA 4YFMA 3VOZA 2A49A 1TDLA 3MXSA 3LCEA 3HL9A 5FI7A 4WN5A 4E3KA 3FWLA 5EUAA 5F6AA 4RYEA 4H6JA 2OLVA 2Y2IA 5FQKA 1VM1A 1GSVA 3U2AA 3IH8A 1D1JA 4ZJ3A 5FQ9A 3UY6A 3C4PA 4NETA 1BTLA 3CITA 1LL5A 4O7DA 3UPOA 4A5RA 5DTKA 1K4EA 4RQ9A 3B42A 1S66L 2L1MA 4WZ5C 3R7WB 5GLBA 5HDCA 3EOIA 4IBRA 3K2NA 1MXOA 1SDEA 2Y2LA 3BYDA 1V9ZA 4IBXA 3QP1A 1NYMA 2W3HA 2XGNA 4YINA 2XFTA 5L07A 3NBLA 3W8KA 4X56A 1ONHA 3HLGA 4OPRA 3CG5A 2CMNA 3O3VA 1NY0A 2O9BA 1XPBA 1FQGA 4MN5A 3SS5A 2DRWA 3GRJA 3ZHHA 3HBRA 1CI9A 1YLZA 2M1CA 4N92A 1IOUA 5J7EA 4DXBA 1GA9A 1YAXA 2Q9MA 2ZMVA 1KDSA 3BFGA 4E3JA 3T50A 1W79A 4GLQA 3FYZA 2YKHA 3D4FA 5CEBA 4P87A 4WYYA 3MMHA 4Y0TA 3MKFA 4QY5A 3IX3A 5EVIB 3LIBA 1IYOA 3K3CA 3CPTA 3IWIA 5G4YA 4S2LA 3HVFA 4FD8A 4X1LA 2JKGA 2PYRA 4JXVA 1ONGA 5GHZA 4Y7PA 2JKRI 3IXGA 2UWXA 1U60A 1TF1A 1ERQA 4MDZA 4XXRA 5GLAA 4OPQA 1ESUA 3A3DA 4IUHA 3UE3A 1BLSA 2GJ3A 3UE6A 1YQSA 1W7FA 4PHTA 4EW7A 1M6KA 5IU1A 1LI9A 5EVIC 3KSHA 1HVBA 3LI9A 5HPFA 1UWPX 3JVUA 3DW0A 3WS0A 4R4RA 4K91A 4G3KA 3IS2B 4OOMA 3GDIA 3NCKA 4E3NA 1D7EA 4WEJA 1T1BA 2W1RA 1GHIA 3CPTB 2Y2PA 3S7QA 2V8FA 3ULFA 3ZNYA 2Y59A 2V9AA 1NZOA 5KSHA 5M19A 1KGGA 4ESPA 2INWA 1Z6FA 3QP4A 3UB8A 3VP4A 4GDBA 5CXWA 1BYWA 2WZZA 2WGIA 1NRJA 3HJIA 1NXYA 3SS4A 3EGXC 1TVFA 1LSXA 3G4PA 2HDSA 2V1AA 4AFIA 3DWZA 2NUTC 3V3RA 2D01A 4NXFA 5A91A 1H5XA 5AQ9A 5HDDA 3S7NA 4EBNA 3W2ZA 2WKEA 3DTEA 2QHKA 1E25A 4L9GA 2P9VB 4KZBA 4Z9QA 5DF9A 1SZVA 4GHIB 2ZL1A 1KE0A 4QB8A 3ZG7B 2HP6A 4O8GA 1FR6A 2C5WB 5KZHA 3T1RA 5TFQA 3CUEA 1OJGA 2R9WA 1K55C 3MF0A 4QU3A 1BLCA 3UN7A 3RXWA 2PT7A 1CEFA 1MWUA 4IJGA 1EWZA 3EGDC 5GLCA 1YLYA 4HHDA 2VV6A 4JXGA 5HARA 1DP6A 2V0UA 1K6SA 2B18A 3FPVA 3IXHA 3Q07A 4CPKA 3DTMA 1NLYA 2OLUA 2XA7M 4U0TA 3BFFA 4KENB 1D06A 3Q7VA 2QZ6A 3HREA 3BY9A 2ZC7A 4R70A 4PMAA 2P04A 1XP4A 2VGLS 1YLTA 1XFNA 5CERA 1FR1A 2H5SA 5IS1A 3TE8A 5L09A 2PHYA 5FDHA 1VEUA 2ZL1B 1IELA 2L0WA 2XF3A 1RCJA 3GMWA 3G2YA 2FH5A 4JGOA 1J3WA 4R3AA 3MSHA 2XR0A 3LIEA 5CECA 1I5QA 3F1PA 1XA1A 3BY8A 1DJCA 1JVJA 4Y3IA 4ZJ1A 3Q7VB 3OBFA 4EEUA 3C7VA 4KG5A 4DE2A 1HD8A 1OMEA 3PAEA 1Q2QA 2OV5A 1MC0A 3BLMA 4R3JA 2J9PA 3L7HA 3LFVA 3BQAA 4E6XA 2ZQ8A 2Y2QA 3DTKA 1F5MA 5GL9A 1RP5A 4GNUA 5DF7A 4HIAA 4ZAMA 1GHPA 1YM1A 3NI9A 2PYPA 2FZ0A 1PWDA 5DKLA 5EOOA 1ES4A 3PBQA 4HQAA 5AQAA 5HAQA 3FG8A 2J7VA 3W4OA 1PYYA 1YLPA 3BFDA 1QMFA 2XDMA 4E04A 1K6RA 2A24A 5F69A 1L3LA 5TR7A 4NEED 5L8MA 3WS4A 1YPRA 1NLZA 3E98A 1Z09A 1LLBA 1L0EA 3S4XA 1BLPA 4DF6A 3SH7A 5IHVA 1K56D 4DE1A 4UQIM 2I9VA 4GD8A 1MKIA 3MZEA 2DNSA 1TS7A 3RH8B 1IYQA 3M2JA 3FV7A 3C30A 3KSFA 1TDGA 2ZD8A 1O7EA 1H0MA 3E0YA 5FSRA 4LV0A 4R23A 3UDFA 5EM0A 3LYXA 5FA7A 2WKIA 2I72A 1FCMA 4KZ7A 4KUKA 3RTYA 3ZDJA 1ZHHB 1K25A 5HW3A 3G35A 2G2WA 4KZAA 4JLFA 1N9OA 1F2KA 1OT9A 4QWOA 4PM6A 4MEZA 2HDQA 2PD7A 3OZHA 3LICA 4EEPA 3MKEA 4UA7A 4NXGA 3HLFA 3BECA 2O9CA 4WF0A 3MJQA 4X25A 2LB9A 4WZ5A 3E4OA 1E3UD 4EV4A 3DTIA 1MPLA 4KQQA 3E2KA 2OWJA 5A90A 1IFQA 4IEDA 5G18A 1PZPA 3T4OA 1XJ2A 2LB5A 4KZ4A 1XFQA 4KQRA 1IEMA 2EFUA 3O86A 1DY6A 5I94A 2J3WA 3NY4A 4ZRRA 2OOLA 3MZDA 2R78A 1KGFA 4S2NC 5HL1A 4X69A 4S2PA 2XEPA 2VK3A 3L9KA 5F1FA 2JN7A 4E3MA 4ARZA 1KDWA 3GV9A 4BLMA 2QPNA 3S7OA 4ZTKA 4C3QA 3HUOA 4UEYA 3E2LA 4PM8A 4NXBA 2VZWA 4OKPA 2JE5A 1G68A 4CLCD 5A93A 2PR6A 2JKTM 2D02A 1STZA 5FATA 4RA7A 1G28A 2GDNA 2R9XA 4OLDA 2VGKA 2WAEA 3H7WB 1JTGA 1NJ4A 2VV8A 4N1HA 3A3IA 3VP2A 4R4SA 3ITAA 4OLGA 3D72A 3P01A 1MY8A 2EX9A 3LR4A 4LRYC 4HBUA 3V50A 2QWSA 1PWGA 5A8BA 1XJ4A 3G30A 3NDEA 2Y79A 4ARZB 2WGVA 4N9KA 4UA9A 2BLSA 5KIZA 5EVIA 1X0OA 4QPRA 4MLLA 5CTMA 3HLDA 4EWFA 4N9LA 2WYXA 4DRTA 1IKGA 1S4SA 1G6OA 4GN2A 1KVMA 2Y2JA 2XK1A 4YWZA 3AGFA 1JWZA 5HZHA 3K3DA 5LBRA 3S7PA 2PU4A 1Y54A 1E4DA 3QNBA 2WUQA 4KZ8A 3KYZA 3T1SA 2ZOHA 3PBTA 3H82A 3MXQA 4S2OA 1YLWA 3IXBA 3FKWA 4BMWA 1L0FA 4KG6A 1K56A 4GJ4A 3P7NA 3C4OA 2E8JA 3PHYA 5FAOA 5CEDA 3LIAA 1S67L 3IS2A 4BBTA 2HJ9C 1Q2PA 3UPPA 3ZYTA 4QD4A 1EROA 1PW8A 5CGWA 1K38A 2ZM8A 3CZDA 3OPRA 2EA9A 4JPMA 4YOFA 4EBLA 4D2OA 1YKDA 3LY4A 4ID4A 2HDRA 3C7UA 2C6WB 3FPWA 4HH2A 1FCOA 4PPRA 3NC8A 4EUVA 3JPUA 1SKOA 4GCZA 4P6ZS 3KSIA 2HJEA 3OCLA 3PBOA 3T4LA 4OQIA 1ZG4A 3H82B 3LR0A 4NKPA 3N4IA 3LUQA 4EETB 5CGSA 4L9FA 3PAGA 3UB7A 4JGQA 4OQHA 1F98A 2PBYA 1K55A 2EX6A 5D3OA 4UHUA 2G7UA 1NYYA 1E3UA 3PYPA 5FQMA 3BFEA 2QJ5A 4GOGA 3RXXA 4LCLA 3ZQ5A 2J8YA 4XT2A 5L10A 4FOFA 3HLCA 5F1GA 4EBPA 2MJ6A 3VP3A 2EX2A 4DXCA 4MBHA 5JYOA 1H3QA 2P9VA 1NRFA 4JF4A 2JKRM 5L2FA 3V5MA 4WZ4A 1GA0A 1MZUA 1P9RA 4GHIA 4H8RA 1T18A 4OONA 4L0LA 3P09A 3IX4A 4X6TA 2ZQDA 2ZMFA 1TD5A 1SKOB 3IBJA 5KMWA 3FC7A 4M4XA 3N8SA 3T4SA 1YLJA 1YT4A 4S2KA 4IVKA 4LLOB 1IYSA 3ZGAB 5EFWA 3BWLA 1H8YA 2ZMAA 4BL2A 1P9WA 5AJGA 2VGLM 3E4PA 4OVDA 5AQ7A 4S2IA 1N9LA 1XJ6A 4X1MA 4XT2B 3LIDA 1ES2A 2RL3A 1XXMA 4Y0UA 4BBUA 1ZG6A 4ETXA 3NOUC 2W3DA 2X02A 3V39A 3HLBA 2ZLYA 4QHCA 3C5AA 1W5DA 3I7JA 3SW1A 3QHYA 3G2ZA 3ZVTA 2ZM0A 4MBFA 4Q0HA 1T1AA 4G3VA 3SZTA 4OPYA 4HOIA 1C3BA 3DAVA 3DBAA 4P0MA 1H8MA 2G2UA 4OH0A 3EQVA 2Y2HA 3CI6A 4WBGA 3TRCA 1OPXA 4Y2FA 4PM7A 3CAXA 4UAAA 4HBTA 1ES5A 4Q0JA 4D60A 5M1AA 3IHBA 5FQQA 1I2SA 4PAUA 4MBKA 2HGVA 1KVLA 3NULA 3E4QA 1JTDA 2XROA 1XGJA 2XFSA 3HJKA 4FTXA 4CLCC 1G6AA 5FI2A 3TOIA 4LRZE 2PAVP 5CX7A 5DTTA 5F82A 2HZ5A 4WELA 2WK0A 1ZKJA 2H0TA 1GSXA 3LEZA 2VGJA 2UV0E 3IH9A 4EQ1A 4Z1WA 2M7UA 2E8IA 2XQZA 2Q9NA 4LPZA 3CJMA 2A2LA 2WGWB 3PTEA 3NHQA 4DMZA 3UB9A 1SDNA 4MNRA 3O87A 2PRFA 2OSUA 3D9YA 3G31A 1UGUA 4DDSA 4FSFA 3MFDA 4OQGA 4PKYA 5M18A 2EFXA 3BQ8A 1K4FA 3UB6A 4CLCE 3UNWA 2V8CA 1YMSA 2FFFB 2JKFA 3H9WA 1VQQA 4BBVA 1W63M 1KOUA 1DRMA 5E2GA 2J9OA 3IXDA 3F1NB 2B5RA 2Q0OA 3UMDA 3UMEA 3IBRA 3JVVA 2ZM2A 4I38A 3GECA 1XKZA 2HDUA 2IA2A 1CEGA 1OTIA 4BL3A 1TS8A 5FEGA 2VEAA 3UDIA 2Y4AA 2FFYA 2HF6A 5E2HA 4I5SA 4GS9A 5J8XA 2OAQ1 3Q7ZA 3N6IA 2Z6CA 2BG1A 5EVLA 1H8ZA 3B33A 4DKIA 4JKTA 2HV1A 2W1TA 4JGPA 1LT0A 1CQAA 3T12B 4S2NA 3HLWA 5J3WA 1OT6A 4HH3A 1ES3A 5EECA 3IX8A 3M6HA 4K0XA 3VSLA 5AVEA 5HD5A 2W0NA 2O0YA 3AGDA 1FSWA 4OOLA 1PRQA 2ZQ7A 3ZG8B 4S2JA 4MCWA 4F3LA 4N1XA 1CI8A 4OP5A 3WRTA 4GS9B 4WM9A 3OPPA 3BRMA 4ZBEA 3KO6A 1VETA 3OPHA 1OTAA 2ZBBA 5HL6A 1JNUA 3LEQA 2W1TB 2ZQCA 5EV0A 4O01A 1K57A 5G4ZA 3W4QA 2Y2MA 4GKUA 4B9OA 4L9EA 2P08A 4I3AA 2JBFA 3C38A 1ZC2A 1EI5A 1L0DA 4LRXC 3EEAA 1WE4A 1M40A 5FAQA 1LI0A 2VLGA 1P97A 3MZFA 1NZUA 3H7WA 3A3EA 3OLOA 4KUOA 2P74A 5DJTA 1FIKA 3N8LA 2ZOIA 3KSGA 4F3LB 3SH8A 1IYPA 1AWIA 3SOIA 3ZFZA 2GX5A 3ICYA 2A3UA 2EX8A 2HPBA 3IF6A 2GNXA 4DE3A 4E3OA 2QYBA 3MR0A 4JGRA 1VETB 2GZAA 1T1CA 3QP6A 4HI4A 5HWWA 3LI8A 1F9IA 5CRFA 2Y2NA 2CC1A 1SCWA 2VA0A 2IWBA 3A0SA 4NXEA 3W4PA 4E3IA 1VHMA 3GTCA 4IUKA 4ZDXA 3KYQA 4UA6A 2XH9A 2ZQAA 1IKIA 1AXBA 3QP2A 4IVIA 3VOLA 1VB6A 3PXPA 5C5KA 3BW6A 3FKVA 1ZTUA 4KG2A 4HEFA 4ETZA 4QJGA 2Z2MB 2X01A 4X68A 4QY6A 1KE3A 1K57C 4C6YA 3IF6B 3P98A 2YKFA 2V1BA 2EXBA 5MC7A 2H28A 2KX6A 1S1ZA 3NOTC 4XUZA 3VP0A 4U0XA 1BSGA 2P7JA 3LO7A 4O0PA 1OTEA 4S2MA 4WUJA 3BM6A 1PIOA 3VOYA 1G5UA 1W8YA 2XSSA 3Q82A 1K54C 3ZNTA 5AQBA 4GZBA 3JYIA 4E3LA 4R6LA 2ZC6B 5EE8A 3M2KA 3Q81A 1JWVA 3ZG0A 3HUMA 4BWIA 3CWFA 4P6ZM 2OAP1 3OC2A 3IF6C 2PDRA 3MS6A 1EW0A 4GB7A 4RX3A 5HD3A 4OPZA 4LGWA 1W8QA 3PBSA 3S22A 3GVBA 4R1GA 1PZOA 5F83A 4DJ3A 5DFYA 2ACGA 2WAFA 4WLAA 4LENA 4H6JB 5AVFA 3ITBA 4DDYA 3TSGA 5FDSA 2PR5A 3UO9A 2QMIA 4II7A 3QP5A 5EVEA 2V1ZA 1HZOA 2DMWA 5DFXA 3MQOA 4Y17A 3MQ0A 1HLUP 5FQJA 5F5YA 3HCYA 4LV1A 5FQIA 3PBRA 4X55A 2WKPA 3T4KA 5BOHA 4MMNA 5CHJA 3TG9A 2QJ7A 3KYEA 1XA7A 4HNBA 1NWZA 1TEMA 2WKHA 4MN7A 3NECA 3GQZA 5TBMA 3CMZA 3VV4A 4U3TA 2L4RA 1N9BA 1A0KA 1ACFA 1MWSA 3O5YA 5E2EA 3WRZA 1UWNX 1ALQA 5DJUA 1W63Q 1FCNA 5HWTA 4FH2A 4JF6A 5HWVA 1LL8A 1T19A 4CQHA 4ZJ2A 1MKMA 1KE4A 2WADA 1BLHA 2HP9A 4R3BA 4KQDA 3HLEA 3LR5A 4OP8A 1WYCA 3T1QB 1RGYA 1BUEA 2QKPA 3MBZA 5FEFA 3IWQA 3KX0X 1S0WA 1BULA 3AGEA 4EUZA 2J3TD 3EWKA 1ODVA 3T4TA 5TBMB 4FCFA 2XD1A 1V9YA 2DCFA 2IWCA 5HDSA 1S4RA 3SH9A 3RFBA 3NOPC 3IF5A 3GSGA 4EERA 2K7SA 5E2FA 1DJAA 1S6RA 4K0WA 3O88A 4K08A 1RGZA 4BENA 4JXWA 4JXSA 3ZVWA 4RX2A 3ZG5A 2BASA 3WS2A 3NIAA 3C2WA 3TW8A 3BLSA 5HPIA 1XGIA 1S1YA 3VFHA 4CLCA 4XUXA 3CHWP 4Y5FA 4FUWA 1MWTA 2WKQA 3EQUA 3T4JA 4RVAA 1PI5A 1CF0A 1XX2A 2WKRA 4Q8IA 2ZJ9A 4I39A 4HJ4A 3WS5A 3M6BA 1ERMA 1L0GA 3ISGA 1XJ3A 2Z2LB 4LCMA 3F1OA 2V2FF 2EWVA 3WWXA 3MFXA 3B47A 4WEKA 4OQ0A 1LSVA 5F68A 5FASA 1SHVA 4HESA 4M3KA 1CK3A 4CJNA 3G32A 1LHYA 1SKFA 5FAPA 4HP4A 3VP1A 2B95A 4HY8A 5DKKA 4Q0IA 1MBLA 4GD6A 2ZC4B 5EOEA 4DN0A 4CLCB 5GHYA 2WGWA 4HJ6A 4LV2A 1FILA 5A92A 2NUPC 1LSWA 3IHAA 3OPLA 4PKYG 2PU2A 5E43A 3Q1FA 5TGFA 2W3GA 2X71A 3MXRA 3F1OB 4LFUA 5CGXA 3QNCA 4GW9A 1K0KA 1DP8A 3NJAA 5J4EA 1GSWA 4E6WA 1L2SA 1TS6A 4IHQA 3U4LP 2OWHA 5JYPA 3F1NA 1YMXA 1HTZA 2Z6DA 4B88A 5HX9A 1WA9A 3A0RA 2Y2GA 4KQOA 5EM1A 2Y8HA 4HJ3A 2VV7A 4BQMA 1GHMA 1N9NA 4B4ZA 3DWKA 1O07A 1DP9A 1OTDA 5DF8A 4WMCD 3VSKA 2XLNA 2VJWA 3G34A 5DVAA 1CJFA 4C75A 3UB5P 3VFFA 4HP9A 3G6OA 3VMAA 2V20A 4EU0A 3UE1A 3HUNA 4KZ9A 4OOYA 2ZC3B 2XA7S 3CUEC 3T4QA 5HFOA 3LR3A 2ZQ9A 3D3OA 3BEBA 1OTBA 2EXAA 3LY3A 1VEUB 5CHUA 1BZAA 1ESIA 1BT5A 4JBFA 4I3IA 4F94A 1Y4OA 3VE3A 4EESA 3PR6A 4P85A 4BJPA 1PFLA 2EWWA 1JWPA 1FSYA 3A3JA 5U47A 4BD0A 2VX8A 3F1PB 2J80A 3MQQA 1I2WA 3C8CA 4GDNA 4FH4A 2RCXA 1QMEA 3BFCA 4Y0OA 3IWOA 3TJZC 5EVID 2KOIA 2M7VA 2W3FA 3A0VA 1P0ZA 4PM5A 3EEHA 1Y28A 2Y2KA 2Y55A 4ME4A 2KLIA 3FZCA 4R0QA 3CLOA 3UDXA 3T1XA 2KDKA 2WZXA 1WYBA 1PW1A 5KSCA 2W27A 1YSQA 5FL3A 1GCEA 3NDGA 2V0WA 4Y13A 4DE0A 2HP5A 4KZ5A 2PD8A 5IT5A 3SS3A 3A3FA 4MN6A 2K2NA 1LL9A 2IWDA 1YSPA 5CHMA 3S1YA 3B3XA 2AVXA 3PBNA 2JC7A 4NG2A 4B93A 1N4OA 3BJNA 3RJUA 1OJ5A 4BD1A 3QP8A 3GR2A 3OOVA 5HAIA 3UE0A 4X53A 4NK3A 2O99A 4PM9A
chains in the Genus database with same CATH topology
3CWFA 3FC7A 4M4XA 2A24B 4Y3IA 4P6ZM 3T4SA 2OAP1 4I3JA 3OC2A 3VE4A 5HSQA 2PDRA 1TS0A 5TJJA 3R4KA 4LLOB 3OCNA 3OBFA 4R38A 4EEUA 1EW0A 5HD3A 1MC0A 2W3EA 2J3TC 3PBSA 2B02A 3LIFA 4G3WA 5EFWA 3BWLA 1P9WA 4DJ3A 5AJGA 2VGLM 3E4PA 5DFYA 3LFVA 4WLAA 3BQAA 4H6JB 1N9LA 5AVFA 1XJ6A 4XT2B 3LIDA 2PR5A 4II7A 1F5MA 4HIAA 4BBUA 5K5BA 2DMWA 5DFXA 4UQIS 4ETXA 2JHEA 3NOUC 2W3DA 3MQOA 3MQ0A 2PYPA 2FZ0A 5DKLA 3PBQA 2K31A 4HQAA 3V67A 5F5YA 4EXOA 3HCYA 3PBRA 2WKPA 2XRNA 3T4KA 3FG8A 3SW1A 2JKTI 4MMNA 2QJ7A 4YNRA 2O9AA 4Q0HA 4HNBA 1NWZA 2VKSA 4MN7A 1T1AA 5TBMA 4G3VA 3VV4A 4HOIA 3R7WA 5I5LA 4E04A 4WL9A 2L4RA 3DBAA 1H8MA 2A24A 5F69A 3EQVA 4DJ2A 3O5YA 3CI6A 3TRCA 1UWNX 1OPXA 5DJUA 4NEED 5L8MA 4Y2FA 1W63Q 1NLZA 3CAXA 5HWTA 3E98A 4Q0JA 5HWVA 4WN5A 1LL8A 4PAUA 1T19A 2HGVA 4CQHA 5F6AA 1MKMA 4H6JA 4UQIM 2I9VA 4KQDA 3LR5A 1TS7A 3E4QA 3RH8B 1GSVA 3U2AA 2XROA 2QKPA 3C30A 3KSFA 3HJKA 3CITA 3KX0X 3E0YA 2J3TD 3EWKA 4CLCC 3LYXA 1ODVA 3T4TA 5TBMB 4LRZE 4RQ9A 1V9YA 3B42A 1S66L 2L1MA 3R7WB 5HDSA 1S4RA 5CX7A 5HDCA 3RFBA 4KUKA 3RTYA 3NOPC 3EOIA 1ZHHB 4WELA 4EERA 1GSXA 2K7SA 4EQ1A 4Z1WA 2M7UA 3K2NA 4K08A 4LPZA 1N9OA 2A2LA 1V9ZA 1OT9A 2W3HA 4DMZA 3NHQA 3UB9A 2BASA 2PD7A 3C2WA 3LICA 4EEPA 3TW8A 4NXGA 5HPIA 2O9CA 1S1YA 4CLCA 4WF0A 3MJQA 2LB9A 4Y5FA 2CMNA 1UGUA 2WKQA 3E4OA 3EQUA 3T4JA 2O9BA 2WKRA 4FSFA 4PKYA 4I39A 3BQ8A 4HJ4A 3UB6A 4CLCE 4MN5A 1XJ3A 3H9WA 2OWJA 3F1OA 1IFQA 4BBVA 2M1CA 2EWVA 5J7EA 1IOUA 1W63M 3T4OA 1XJ2A 1KOUA 1DRMA 3MFXA 2LB5A 3B47A 4WEKA 1XFQA 1YAXA 2ZMVA 3F1NB 3T50A 1LSVA 5F68A 2J3WA 4GLQA 3UMDA 3UMEA 2YKHA 4ZRRA 3IBRA 3JVVA 4I38A 2OOLA 3GECA 2R78A 4HP4A 3MMHA 2IA2A 1OTIA 4HY8A 1TS8A 5DKKA 2VEAA 4Q0IA 2JN7A 3LIBA 4ARZA 2HF6A 3K3CA 4I5SA 4GS9A 3S7OA 2OAQ1 4DN0A 4CLCB 5G4YA 4UEYA 2Z6CA 4HJ6A 4NXBA 3B33A 2HV1A 2PYRA 2VZWA 2W1TA 2NUPC 4CLCD 1LSWA 4JGPA 2JKRI 2PR6A 4PKYG 1LT0A 2JKTM 2D02A 1STZA 2W3GA 1TF1A 3F1OB 1G28A 4MDZA 5J3WA 4IUHA 3UE3A 2GJ3A 1OT6A 4HH3A 4GW9A 3UE6A 4PHTA 3H7WB 1DP8A 2VV8A 3NJAA 4EW7A 5J4EA 5IU1A 1GSWA 3KSHA 3LI9A 5HPFA 1UWPX 3JVUA 3D72A 5AVEA 2W0NA 2O0YA 5HD5A 1TS6A 4OOLA 4G3KA 3IS2B 3P01A 4IHQA 3LR4A 2OWHA 4LRYC 4OOMA 3GDIA 3F1NA 4MCWA 1D7EA 4WEJA 2QWSA 1T1BA 2Z6DA 2W1RA 4F3LA 5A8BA 1XJ4A 1WA9A 2Y79A 3A0RA 4KQOA 2Y8HA 4ARZB 4HJ3A 2VV7A 4GS9B 3S7QA 1N9NA 3KO6A 3ULFA 1DP9A 1OTAA 1OTDA 2ZBBA 5HL6A 5KIZA 1JNUA 2V9AA 2VJWA 1X0OA 5KSHA 4QPRA 2W1TB 2INWA 4O01A 5G4ZA 1S4SA 4B9OA 1G6OA 3UB8A 4L9EA 2P08A 4HP9A 4I3AA 4YWZA 3G6OA 3C38A 5HZHA 3K3DA 5LBRA 1BYWA 4EU0A 3S7PA 4LRXC 1NRJA 3EEAA 3HJIA 2XA7S 3EGXC 1LSXA 3CUEC 3T4QA 3LR3A 3D3OA 3KYZA 1OTBA 2ZOHA 3PBTA 2V1AA 3H82A 4AFIA 3MXQA 2VLGA 2NUTC 1P97A 2D01A 3H7WA 4NXFA 3OLOA 4BMWA 4KUOA 5DJTA 4GJ4A 3P7NA 2ZOIA 3KSGA 4I3IA 4F3LB 3PHYA 5HDDA 3LIAA 3S7NA 3W2ZA 2GX5A 3VE3A 4EESA 3PR6A 3ICYA 4BJPA 1S67L 2QHKA 3IS2A 4L9GA 2GNXA 4BBTA 2EWWA 5DF9A 2QYBA 3MR0A 4GHIB 2HJ9C 4JGRA 4O8GA 3ZYTA 2GZAA 1T1CA 2VX8A 3CUEA 3F1PB 2J80A 1OJGA 4HI4A 3MQQA 5HWWA 3C8CA 3MF0A 3LI8A 2EA9A 1F9IA 4YOFA 2PT7A 3TJZC 1YKDA 2KOIA 3FPWA 2VA0A 4HH2A 4IJGA 3EGDC 2W3FA 3A0VA 2M7VA 1P0ZA 3A0SA 4NXEA 1VHMA 4EUVA 4HHDA 2VV6A 3EEHA 4IUKA 3KYQA 1Y28A 1DP6A 2V0UA 2B18A 3FPVA 4ME4A 3VOLA 4GCZA 2KLIA 4P6ZS 1VB6A 3KSIA 2HJEA 1NLYA 3CLOA 3PXPA 3OCLA 5C5KA 3PBOA 3T4LA 2XA7M 3BW6A 2KDKA 1D06A 3H82B 1ZTUA 3BY9A 3LR0A 4NKPA 3LUQA 4EETB 4ETZA 4L9FA 3UB7A 2W27A 4JGQA 1YSQA 1F98A 5FL3A 4R70A 2G7UA 2P04A 2V0WA 2VGLS 3PYPA 1XFNA 2QJ5A 5IS1A 3TE8A 2PHYA 3ZQ5A 2YKFA 2V1BA 2PD8A 5IT5A 2L0WA 4XT2A 5MC7A 2H28A 4FOFA 2KX6A 2FH5A 1S1ZA 2K2NA 4MN6A 4JGOA 3NOTC 4R3AA 2MJ6A 1YSPA 2P7JA 4O0PA 1OTEA 4WUJA 1H3QA 2JKRM 2XSSA 4GHIA 1MZUA 1P9RA 3PBNA 3LIEA 4B93A 1T18A 3BJNA 4L0LA 1OJ5A 3F1PA 4R6LA 2ZMFA 3OOVA 3BY8A 1TD5A 3IBJA 2O99A 4BWIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CWF A;  3FC7 A;  4M4X A;  2A24 B;  4I3J A;  3VE4 A;  5HSQ A;  2PDR A;  1TS0 A;  4LLO B;  4R38 A;  4EEU A;  1EW0 A;  5HD3 A;  2B02 A;  3LIF A;  5EFW A;  3BWL A;  4DJ3 A;  3E4P A;  4WLA A;  4H6J B;  1N9L A;  5AVF A;  1XJ6 A;  4XT2 B;  3LID A;  2PR5 A;  4HIA A;  4BBU A;  2JHE A;  3NOU C;  3MQO A;  2PYP A;  5DKL A;  4HQA A;  4EXO A;  5F5Y A;  2WKP A;  3FG8 A;  3SW1 A;  2QJ7 A;  4HNB A;  1NWZ A;  1T1A A;  5TBM A;  4HOI A;  5I5L A;  4E04 A;  4WL9 A;  2L4R A;  2A24 A;  5F69 A;  4DJ2 A;  1UWN X;  5DJU A;  3CAX A;  5HWT A;  5HWV A;  4WN5 A;  1LL8 A;  1T19 A;  5F6A A;  4H6J A;  2I9V A;  4KQD A;  1TS7 A;  3E4Q A;  3RH8 B;  1GSV A;  2QKP A;  3HJK A;  3KX0 X;  3EWK A;  3LYX A;  1ODV A;  5TBM B;  4LRZ E;  4RQ9 A;  1V9Y A;  1S66 L;  2L1M A;  5HDS A;  1S4R A;  5HDC A;  4KUK A;  3RTY A;  3NOP C;  4EER A;  1GSX A;  2K7S A;  4EQ1 A;  4K08 A;  4LPZ A;  1N9O A;  1V9Z A;  1OT9 A;  3NHQ A;  3UB9 A;  2BAS A;  2PD7 A;  3C2W A;  3LIC A;  4EEP A;  4NXG A;  1S1Y A;  4WF0 A;  3MJQ A;  2CMN A;  1UGU A;  2WKQ A;  3E4O A;  2WKR A;  4PKY A;  4I39 A;  4HJ4 A;  3UB6 A;  4MN5 A;  1XJ3 A;  3H9W A;  2OWJ A;  3F1O A;  4BBV A;  2M1C A;  5J7E A;  1XJ2 A;  1KOU A;  1DRM A;  3MFX A;  1XFQ A;  3F1N B;  3T50 A;  1LSV A;  5F68 A;  3UMD A;  3UME A;  2YKH A;  3IBR A;  4I38 A;  2OOL A;  3GEC A;  2R78 A;  4HP4 A;  1OTI A;  4HY8 A;  1TS8 A;  5DKK A;  2VEA A;  2JN7 A;  3LIB A;  3K3C A;  4I5S A;  4GS9 A;  5G4Y A;  2Z6C A;  4HJ6 A;  4NXB A;  3B33 A;  2HV1 A;  2PYR A;  1LSW A;  4JGP A;  2PR6 A;  4PKY G;  1LT0 A;  2D02 A;  3F1O B;  1G28 A;  5J3W A;  2GJ3 A;  1OT6 A;  4HH3 A;  4GW9 A;  3UE6 A;  3H7W B;  1DP8 A;  2VV8 A;  3NJA A;  4EW7 A;  5J4E A;  5IU1 A;  1GSW A;  3LI9 A;  1UWP X;  5AVE A;  3D72 A;  5HD5 A;  2W0N A;  1TS6 A;  3IS2 B;  2OWH A;  4LRY C;  3GDI A;  3F1N A;  1D7E A;  2QWS A;  1T1B A;  2Z6D A;  4F3L A;  5A8B A;  1XJ4 A;  1WA9 A;  3A0R A;  4HJ3 A;  2VV7 A;  4GS9 B;  1N9N A;  3ULF A;  1DP9 A;  1OTA A;  1OTD A;  2ZBB A;  5KIZ A;  1JNU A;  2V9A A;  1X0O A;  2INW A;  5G4Z A;  1S4S A;  4B9O A;  3UB8 A;  4L9E A;  4HP9 A;  4I3A A;  4YWZ A;  3G6O A;  5HZH A;  3K3D A;  1BYW A;  4LRX C;  3HJI A;  1LSX A;  1OTB A;  2ZOH A;  2V1A A;  3H82 A;  3MXQ A;  2VLG A;  1P97 A;  2D01 A;  3H7W A;  4NXF A;  3OLO A;  4KUO A;  5DJT A;  3P7N A;  2ZOI A;  4I3I A;  4F3L B;  3PHY A;  5HDD A;  3LIA A;  3VE3 A;  4EES A;  3ICY A;  1S67 L;  2QHK A;  3IS2 A;  4L9G A;  4BBT A;  3MR0 A;  4GHI B;  4JGR A;  1T1C A;  3F1P B;  2J80 A;  1OJG A;  4HI4 A;  3MQQ A;  5HWW A;  3C8C A;  3LI8 A;  2EA9 A;  1F9I A;  4HH2 A;  3A0V A;  1P0Z A;  3A0S A;  4NXE A;  4HHD A;  2VV6 A;  3EEH A;  1Y28 A;  1DP6 A;  2V0U A;  3VOL A;  4GCZ A;  1VB6 A;  3CLO A;  2KDK A;  1D06 A;  3H82 B;  3BY9 A;  3LUQ A;  4EET B;  4L9F A;  3UB7 A;  2W27 A;  4JGQ A;  1F98 A;  4R70 A;  2V0W A;  3PYP A;  1XFN A;  2QJ5 A;  5IS1 A;  2PHY A;  3ZQ5 A;  2YKF A;  2V1B A;  2PD8 A;  2L0W A;  4XT2 A;  2H28 A;  2KX6 A;  4MN6 A;  1S1Z A;  4JGO A;  3NOT C;  4R3A A;  2P7J A;  1OTE A;  4WUJ A;  4GHI A;  1MZU A;  3LIE A;  1T18 A;  1OJ5 A;  3F1P A;  4R6L A;  3BY8 A; 
#chains in the Genus database with same CATH topology
 1DJB A;  2A24 B;  4I3J A;  3VE4 A;  5HSQ A;  1TS0 A;  5TJJ A;  3R4K A;  3OCN A;  4R38 A;  4LV3 A;  2H0Y A;  2W3E A;  5EPH A;  2BTF P;  2J3T C;  5GHX A;  2B02 A;  3LIF A;  4G3W A;  1K54 A;  3ZCZ A;  4KZ6 A;  5HAP A;  2H10 A;  2JCH A;  1MWR A;  4P6B A;  4Y15 A;  1FOF A;  3V3S A;  5K5B A;  3LGO A;  2PBD P;  4UQI S;  2JHE A;  5GLD A;  5FI6 A;  2K31 A;  3V67 A;  3IT9 A;  4EXO A;  1KGE A;  3N8R A;  4KZ3 A;  2XRN A;  3UPN A;  2Y91 A;  1J9M A;  2JKT I;  4EQI A;  4YNR A;  2O9A A;  3N7W A;  4B4X A;  2VKS A;  5DTS A;  3R7W A;  5I5L A;  4WL9 A;  3ZG9 B;  2XD5 A;  1PI4 A;  4WMC A;  1PWC A;  4DJ2 A;  4JF5 A;  1PNE A;  5CTN A;  3WS1 A;  2ZC5 B;  2Y2O A;  3IQA A;  4YFM A;  3VOZ A;  2A49 A;  1TDL A;  3MXS A;  3LCE A;  3HL9 A;  5FI7 A;  4WN5 A;  4E3K A;  3FWL A;  5EUA A;  5F6A A;  4RYE A;  4H6J A;  2OLV A;  2Y2I A;  5FQK A;  1VM1 A;  1GSV A;  3U2A A;  3IH8 A;  1D1J A;  4ZJ3 A;  5FQ9 A;  3UY6 A;  3C4P A;  4NET A;  1BTL A;  3CIT A;  1LL5 A;  4O7D A;  3UPO A;  4A5R A;  5DTK A;  1K4E A;  4RQ9 A;  3B42 A;  1S66 L;  2L1M A;  4WZ5 C;  3R7W B;  5GLB A;  5HDC A;  3EOI A;  4IBR A;  3K2N A;  1MXO A;  1SDE A;  2Y2L A;  3BYD A;  1V9Z A;  4IBX A;  3QP1 A;  1NYM A;  2W3H A;  2XGN A;  4YIN A;  2XFT A;  5L07 A;  3NBL A;  3W8K A;  4X56 A;  1ONH A;  3HLG A;  4OPR A;  3CG5 A;  2CMN A;  3O3V A;  1NY0 A;  2O9B A;  1XPB A;  1FQG A;  4MN5 A;  3SS5 A;  2DRW A;  3GRJ A;  3ZHH A;  3HBR A;  1CI9 A;  1YLZ A;  2M1C A;  4N92 A;  1IOU A;  5J7E A;  4DXB A;  1GA9 A;  1YAX A;  2Q9M A;  2ZMV A;  1KDS A;  3BFG A;  4E3J A;  3T50 A;  1W79 A;  4GLQ A;  3FYZ A;  2YKH A;  3D4F A;  5CEB A;  4P87 A;  4WYY A;  3MMH A;  4Y0T A;  3MKF A;  4QY5 A;  3IX3 A;  5EVI B;  3LIB A;  1IYO A;  3K3C A;  3CPT A;  3IWI A;  5G4Y A;  4S2L A;  3HVF A;  4FD8 A;  4X1L A;  2JKG A;  2PYR A;  4JXV A;  1ONG A;  5GHZ A;  4Y7P A;  2JKR I;  3IXG A;  2UWX A;  1U60 A;  1TF1 A;  1ERQ A;  4MDZ A;  4XXR A;  5GLA A;  4OPQ A;  1ESU A;  3A3D A;  4IUH A;  3UE3 A;  1BLS A;  2GJ3 A;  3UE6 A;  1YQS A;  1W7F A;  4PHT A;  4EW7 A;  1M6K A;  5IU1 A;  1LI9 A;  5EVI C;  3KSH A;  1HVB A;  3LI9 A;  5HPF A;  1UWP X;  3JVU A;  3DW0 A;  3WS0 A;  4R4R A;  4K91 A;  4G3K A;  3IS2 B;  4OOM A;  3GDI A;  3NCK A;  4E3N A;  1D7E A;  4WEJ A;  1T1B A;  2W1R A;  1GHI A;  3CPT B;  2Y2P A;  3S7Q A;  2V8F A;  3ULF A;  3ZNY A;  2Y59 A;  2V9A A;  1NZO A;  5KSH A;  5M19 A;  1KGG A;  4ESP A;  2INW A;  1Z6F A;  3QP4 A;  3UB8 A;  3VP4 A;  4GDB A;  5CXW A;  1BYW A;  2WZZ A;  2WGI A;  1NRJ A;  3HJI A;  1NXY A;  3SS4 A;  3EGX C;  1TVF A;  1LSX A;  3G4P A;  2HDS A;  2V1A A;  4AFI A;  3DWZ A;  2NUT C;  3V3R A;  2D01 A;  4NXF A;  5A91 A;  1H5X A;  5AQ9 A;  5HDD A;  3S7N A;  4EBN A;  3W2Z A;  2WKE A;  3DTE A;  2QHK A;  1E25 A;  4L9G A;  2P9V B;  4KZB A;  4Z9Q A;  5DF9 A;  1SZV A;  4GHI B;  2ZL1 A;  1KE0 A;  4QB8 A;  3ZG7 B;  2HP6 A;  4O8G A;  1FR6 A;  2C5W B;  5KZH A;  3T1R A;  5TFQ A;  3CUE A;  1OJG A;  2R9W A;  1K55 C;  3MF0 A;  4QU3 A;  1BLC A;  3UN7 A;  3RXW A;  2PT7 A;  1CEF A;  1MWU A;  4IJG A;  1EWZ A;  3EGD C;  5GLC A;  1YLY A;  4HHD A;  2VV6 A;  4JXG A;  5HAR A;  1DP6 A;  2V0U A;  1K6S A;  2B18 A;  3FPV A;  3IXH A;  3Q07 A;  4CPK A;  3DTM A;  1NLY A;  2OLU A;  2XA7 M;  4U0T A;  3BFF A;  4KEN B;  1D06 A;  3Q7V A;  2QZ6 A;  3HRE A;  3BY9 A;  2ZC7 A;  4R70 A;  4PMA A;  2P04 A;  1XP4 A;  2VGL S;  1YLT A;  1XFN A;  5CER A;  1FR1 A;  2H5S A;  5IS1 A;  3TE8 A;  5L09 A;  2PHY A;  5FDH A;  1VEU A;  2ZL1 B;  1IEL A;  2L0W A;  2XF3 A;  1RCJ A;  3GMW A;  3G2Y A;  2FH5 A;  4JGO A;  1J3W A;  4R3A A;  3MSH A;  2XR0 A;  3LIE A;  5CEC A;  1I5Q A;  3F1P A;  1XA1 A;  3BY8 A;  1DJC A;  1JVJ A;  4Y3I A;  4ZJ1 A;  3Q7V B;  3OBF A;  4EEU A;  3C7V A;  4KG5 A;  4DE2 A;  1HD8 A;  1OME A;  3PAE A;  1Q2Q A;  2OV5 A;  1MC0 A;  3BLM A;  4R3J A;  2J9P A;  3L7H A;  3LFV A;  3BQA A;  4E6X A;  2ZQ8 A;  2Y2Q A;  3DTK A;  1F5M A;  5GL9 A;  1RP5 A;  4GNU A;  5DF7 A;  4HIA A;  4ZAM A;  1GHP A;  1YM1 A;  3NI9 A;  2PYP A;  2FZ0 A;  1PWD A;  5DKL A;  5EOO A;  1ES4 A;  3PBQ A;  4HQA A;  5AQA A;  5HAQ A;  3FG8 A;  2J7V A;  3W4O A;  1PYY A;  1YLP A;  3BFD A;  1QMF A;  2XDM A;  4E04 A;  1K6R A;  2A24 A;  5F69 A;  1L3L A;  5TR7 A;  4NEE D;  5L8M A;  3WS4 A;  1YPR A;  1NLZ A;  3E98 A;  1Z09 A;  1LLB A;  1L0E A;  3S4X A;  1BLP A;  4DF6 A;  3SH7 A;  5IHV A;  1K56 D;  4DE1 A;  4UQI M;  2I9V A;  4GD8 A;  1MKI A;  3MZE A;  2DNS A;  1TS7 A;  3RH8 B;  1IYQ A;  3M2J A;  3FV7 A;  3C30 A;  3KSF A;  1TDG A;  2ZD8 A;  1O7E A;  1H0M A;  3E0Y A;  5FSR A;  4LV0 A;  4R23 A;  3UDF A;  5EM0 A;  3LYX A;  5FA7 A;  2WKI A;  2I72 A;  1FCM A;  4KZ7 A;  4KUK A;  3RTY A;  3ZDJ A;  1ZHH B;  1K25 A;  5HW3 A;  3G35 A;  2G2W A;  4KZA A;  4JLF A;  1N9O A;  1F2K A;  1OT9 A;  4QWO A;  4PM6 A;  4MEZ A;  2HDQ A;  2PD7 A;  3OZH A;  3LIC A;  4EEP A;  3MKE A;  4UA7 A;  4NXG A;  3HLF A;  3BEC A;  2O9C A;  4WF0 A;  3MJQ A;  4X25 A;  2LB9 A;  4WZ5 A;  3E4O A;  1E3U D;  4EV4 A;  3DTI A;  1MPL A;  4KQQ A;  3E2K A;  2OWJ A;  5A90 A;  1IFQ A;  4IED A;  5G18 A;  1PZP A;  3T4O A;  1XJ2 A;  2LB5 A;  4KZ4 A;  1XFQ A;  4KQR A;  1IEM A;  2EFU A;  3O86 A;  1DY6 A;  5I94 A;  2J3W A;  3NY4 A;  4ZRR A;  2OOL A;  3MZD A;  2R78 A;  1KGF A;  4S2N C;  5HL1 A;  4X69 A;  4S2P A;  2XEP A;  2VK3 A;  3L9K A;  5F1F A;  2JN7 A;  4E3M A;  4ARZ A;  1KDW A;  3GV9 A;  4BLM A;  2QPN A;  3S7O A;  4ZTK A;  4C3Q A;  3HUO A;  4UEY A;  3E2L A;  4PM8 A;  4NXB A;  2VZW A;  4OKP A;  2JE5 A;  1G68 A;  4CLC D;  5A93 A;  2PR6 A;  2JKT M;  2D02 A;  1STZ A;  5FAT A;  4RA7 A;  1G28 A;  2GDN A;  2R9X A;  4OLD A;  2VGK A;  2WAE A;  3H7W B;  1JTG A;  1NJ4 A;  2VV8 A;  4N1H A;  3A3I A;  3VP2 A;  4R4S A;  3ITA A;  4OLG A;  3D72 A;  3P01 A;  1MY8 A;  2EX9 A;  3LR4 A;  4LRY C;  4HBU A;  3V50 A;  2QWS A;  1PWG A;  5A8B A;  1XJ4 A;  3G30 A;  3NDE A;  2Y79 A;  4ARZ B;  2WGV A;  4N9K A;  4UA9 A;  2BLS A;  5KIZ A;  5EVI A;  1X0O A;  4QPR A;  4MLL A;  5CTM A;  3HLD A;  4EWF A;  4N9L A;  2WYX A;  4DRT A;  1IKG A;  1S4S A;  1G6O A;  4GN2 A;  1KVM A;  2Y2J A;  2XK1 A;  4YWZ A;  3AGF A;  1JWZ A;  5HZH A;  3K3D A;  5LBR A;  3S7P A;  2PU4 A;  1Y54 A;  1E4D A;  3QNB A;  2WUQ A;  4KZ8 A;  3KYZ A;  3T1S A;  2ZOH A;  3PBT A;  3H82 A;  3MXQ A;  4S2O A;  1YLW A;  3IXB A;  3FKW A;  4BMW A;  1L0F A;  4KG6 A;  1K56 A;  4GJ4 A;  3P7N A;  3C4O A;  2E8J A;  3PHY A;  5FAO A;  5CED A;  3LIA A;  1S67 L;  3IS2 A;  4BBT A;  2HJ9 C;  1Q2P A;  3UPP A;  3ZYT A;  4QD4 A;  1ERO A;  1PW8 A;  5CGW A;  1K38 A;  2ZM8 A;  3CZD A;  3OPR A;  2EA9 A;  4JPM A;  4YOF A;  4EBL A;  4D2O A;  1YKD A;  3LY4 A;  4ID4 A;  2HDR A;  3C7U A;  2C6W B;  3FPW A;  4HH2 A;  1FCO A;  4PPR A;  3NC8 A;  4EUV A;  3JPU A;  1SKO A;  4GCZ A;  4P6Z S;  3KSI A;  2HJE A;  3OCL A;  3PBO A;  3T4L A;  4OQI A;  1ZG4 A;  3H82 B;  3LR0 A;  4NKP A;  3N4I A;  3LUQ A;  4EET B;  5CGS A;  4L9F A;  3PAG A;  3UB7 A;  4JGQ A;  4OQH A;  1F98 A;  2PBY A;  1K55 A;  2EX6 A;  5D3O A;  4UHU A;  2G7U A;  1NYY A;  1E3U A;  3PYP A;  5FQM A;  3BFE A;  2QJ5 A;  4GOG A;  3RXX A;  4LCL A;  3ZQ5 A;  2J8Y A;  4XT2 A;  5L10 A;  4FOF A;  3HLC A;  5F1G A;  4EBP A;  2MJ6 A;  3VP3 A;  2EX2 A;  4DXC A;  4MBH A;  5JYO A;  1H3Q A;  2P9V A;  1NRF A;  4JF4 A;  2JKR M;  5L2F A;  3V5M A;  4WZ4 A;  1GA0 A;  1MZU A;  1P9R A;  4GHI A;  4H8R A;  1T18 A;  4OON A;  4L0L A;  3P09 A;  3IX4 A;  4X6T A;  2ZQD A;  2ZMF A;  1TD5 A;  1SKO B;  3IBJ A;  5KMW A;  3FC7 A;  4M4X A;  3N8S A;  3T4S A;  1YLJ A;  1YT4 A;  4S2K A;  4IVK A;  4LLO B;  1IYS A;  3ZGA B;  5EFW A;  3BWL A;  1H8Y A;  2ZMA A;  4BL2 A;  1P9W A;  5AJG A;  2VGL M;  3E4P A;  4OVD A;  5AQ7 A;  4S2I A;  1N9L A;  1XJ6 A;  4X1M A;  4XT2 B;  3LID A;  1ES2 A;  2RL3 A;  1XXM A;  4Y0U A;  4BBU A;  1ZG6 A;  4ETX A;  3NOU C;  2W3D A;  2X02 A;  3V39 A;  3HLB A;  2ZLY A;  4QHC A;  3C5A A;  1W5D A;  3I7J A;  3SW1 A;  3QHY A;  3G2Z A;  3ZVT A;  2ZM0 A;  4MBF A;  4Q0H A;  1T1A A;  4G3V A;  3SZT A;  4OPY A;  4HOI A;  1C3B A;  3DAV A;  3DBA A;  4P0M A;  1H8M A;  2G2U A;  4OH0 A;  3EQV A;  2Y2H A;  3CI6 A;  4WBG A;  3TRC A;  1OPX A;  4Y2F A;  4PM7 A;  3CAX A;  4UAA A;  4HBT A;  1ES5 A;  4Q0J A;  4D60 A;  5M1A A;  3IHB A;  5FQQ A;  1I2S A;  4PAU A;  4MBK A;  2HGV A;  1KVL A;  3NUL A;  3E4Q A;  1JTD A;  2XRO A;  1XGJ A;  2XFS A;  3HJK A;  4FTX A;  4CLC C;  1G6A A;  5FI2 A;  3TOI A;  4LRZ E;  2PAV P;  5CX7 A;  5DTT A;  5F82 A;  2HZ5 A;  4WEL A;  2WK0 A;  1ZKJ A;  2H0T A;  1GSX A;  3LEZ A;  2VGJ A;  2UV0 E;  3IH9 A;  4EQ1 A;  4Z1W A;  2M7U A;  2E8I A;  2XQZ A;  2Q9N A;  4LPZ A;  3CJM A;  2A2L A;  2WGW B;  3PTE A;  3NHQ A;  4DMZ A;  3UB9 A;  1SDN A;  4MNR A;  3O87 A;  2PRF A;  2OSU A;  3D9Y A;  3G31 A;  1UGU A;  4DDS A;  4FSF A;  3MFD A;  4OQG A;  4PKY A;  5M18 A;  2EFX A;  3BQ8 A;  1K4F A;  3UB6 A;  4CLC E;  3UNW A;  2V8C A;  1YMS A;  2FFF B;  2JKF A;  3H9W A;  1VQQ A;  4BBV A;  1W63 M;  1KOU A;  1DRM A;  5E2G A;  2J9O A;  3IXD A;  3F1N B;  2B5R A;  2Q0O A;  3UMD A;  3UME A;  3IBR A;  3JVV A;  2ZM2 A;  4I38 A;  3GEC A;  1XKZ A;  2HDU A;  2IA2 A;  1CEG A;  1OTI A;  4BL3 A;  1TS8 A;  5FEG A;  2VEA A;  3UDI A;  2Y4A A;  2FFY A;  2HF6 A;  5E2H A;  4I5S A;  4GS9 A;  5J8X A;  2OAQ 1;  3Q7Z A;  3N6I A;  2Z6C A;  2BG1 A;  5EVL A;  1H8Z A;  3B33 A;  4DKI A;  4JKT A;  2HV1 A;  2W1T A;  4JGP A;  1LT0 A;  1CQA A;  3T12 B;  4S2N A;  3HLW A;  5J3W A;  1OT6 A;  4HH3 A;  1ES3 A;  5EEC A;  3IX8 A;  3M6H A;  4K0X A;  3VSL A;  5AVE A;  5HD5 A;  2W0N A;  2O0Y A;  3AGD A;  1FSW A;  4OOL A;  1PRQ A;  2ZQ7 A;  3ZG8 B;  4S2J A;  4MCW A;  4F3L A;  4N1X A;  1CI8 A;  4OP5 A;  3WRT A;  4GS9 B;  4WM9 A;  3OPP A;  3BRM A;  4ZBE A;  3KO6 A;  1VET A;  3OPH A;  1OTA A;  2ZBB A;  5HL6 A;  1JNU A;  3LEQ A;  2W1T B;  2ZQC A;  5EV0 A;  4O01 A;  1K57 A;  5G4Z A;  3W4Q A;  2Y2M A;  4GKU A;  4B9O A;  4L9E A;  2P08 A;  4I3A A;  2JBF A;  3C38 A;  1ZC2 A;  1EI5 A;  1L0D A;  4LRX C;  3EEA A;  1WE4 A;  1M40 A;  5FAQ A;  1LI0 A;  2VLG A;  1P97 A;  3MZF A;  1NZU A;  3H7W A;  3A3E A;  3OLO A;  4KUO A;  2P74 A;  5DJT A;  1FIK A;  3N8L A;  2ZOI A;  3KSG A;  4F3L B;  3SH8 A;  1IYP A;  1AWI A;  3SOI A;  3ZFZ A;  2GX5 A;  3ICY A;  2A3U A;  2EX8 A;  2HPB A;  3IF6 A;  2GNX A;  4DE3 A;  4E3O A;  2QYB A;  3MR0 A;  4JGR A;  1VET B;  2GZA A;  1T1C A;  3QP6 A;  4HI4 A;  5HWW A;  3LI8 A;  1F9I A;  5CRF A;  2Y2N A;  2CC1 A;  1SCW A;  2VA0 A;  2IWB A;  3A0S A;  4NXE A;  3W4P A;  4E3I A;  1VHM A;  3GTC A;  4IUK A;  4ZDX A;  3KYQ A;  4UA6 A;  2XH9 A;  2ZQA A;  1IKI A;  1AXB A;  3QP2 A;  4IVI A;  3VOL A;  1VB6 A;  3PXP A;  5C5K A;  3BW6 A;  3FKV A;  1ZTU A;  4KG2 A;  4HEF A;  4ETZ A;  4QJG A;  2Z2M B;  2X01 A;  4X68 A;  4QY6 A;  1KE3 A;  1K57 C;  4C6Y A;  3IF6 B;  3P98 A;  2YKF A;  2V1B A;  2EXB A;  5MC7 A;  2H28 A;  2KX6 A;  1S1Z A;  3NOT C;  4XUZ A;  3VP0 A;  4U0X A;  1BSG A;  2P7J A;  3LO7 A;  4O0P A;  1OTE A;  4S2M A;  4WUJ A;  3BM6 A;  1PIO A;  3VOY A;  1G5U A;  1W8Y A;  2XSS A;  3Q82 A;  1K54 C;  3ZNT A;  5AQB A;  4GZB A;  3JYI A;  4E3L A;  4R6L A;  2ZC6 B;  5EE8 A;  3M2K A;  3Q81 A;  1JWV A;  3ZG0 A;  3HUM A;  4BWI A;  3CWF A;  4P6Z M;  2OAP 1;  3OC2 A;  3IF6 C;  2PDR A;  3MS6 A;  1EW0 A;  4GB7 A;  4RX3 A;  5HD3 A;  4OPZ A;  4LGW A;  1W8Q A;  3PBS A;  3S22 A;  3GVB A;  4R1G A;  1PZO A;  5F83 A;  4DJ3 A;  5DFY A;  2ACG A;  2WAF A;  4WLA A;  4LEN A;  4H6J B;  5AVF A;  3ITB A;  4DDY A;  3TSG A;  5FDS A;  2PR5 A;  3UO9 A;  2QMI A;  4II7 A;  3QP5 A;  5EVE A;  2V1Z A;  1HZO A;  2DMW A;  5DFX A;  3MQO A;  4Y17 A;  3MQ0 A;  1HLU P;  5FQJ A;  5F5Y A;  3HCY A;  4LV1 A;  5FQI A;  3PBR A;  4X55 A;  2WKP A;  3T4K A;  5BOH A;  4MMN A;  5CHJ A;  3TG9 A;  2QJ7 A;  3KYE A;  1XA7 A;  4HNB A;  1NWZ A;  1TEM A;  2WKH A;  4MN7 A;  3NEC A;  3GQZ A;  5TBM A;  3CMZ A;  3VV4 A;  4U3T A;  2L4R A;  1N9B A;  1A0K A;  1ACF A;  1MWS A;  3O5Y A;  5E2E A;  3WRZ A;  1UWN X;  1ALQ A;  5DJU A;  1W63 Q;  1FCN A;  5HWT A;  4FH2 A;  4JF6 A;  5HWV A;  1LL8 A;  1T19 A;  4CQH A;  4ZJ2 A;  1MKM A;  1KE4 A;  2WAD A;  1BLH A;  2HP9 A;  4R3B A;  4KQD A;  3HLE A;  3LR5 A;  4OP8 A;  1WYC A;  3T1Q B;  1RGY A;  1BUE A;  2QKP A;  3MBZ A;  5FEF A;  3IWQ A;  3KX0 X;  1S0W A;  1BUL A;  3AGE A;  4EUZ A;  2J3T D;  3EWK A;  1ODV A;  3T4T A;  5TBM B;  4FCF A;  2XD1 A;  1V9Y A;  2DCF A;  2IWC A;  5HDS A;  1S4R A;  3SH9 A;  3RFB A;  3NOP C;  3IF5 A;  3GSG A;  4EER A;  2K7S A;  5E2F A;  1DJA A;  1S6R A;  4K0W A;  3O88 A;  4K08 A;  1RGZ A;  4BEN A;  4JXW A;  4JXS A;  3ZVW A;  4RX2 A;  3ZG5 A;  2BAS A;  3WS2 A;  3NIA A;  3C2W A;  3TW8 A;  3BLS A;  5HPI A;  1XGI A;  1S1Y A;  3VFH A;  4CLC A;  4XUX A;  3CHW P;  4Y5F A;  4FUW A;  1MWT A;  2WKQ A;  3EQU A;  3T4J A;  4RVA A;  1PI5 A;  1CF0 A;  1XX2 A;  2WKR A;  4Q8I A;  2ZJ9 A;  4I39 A;  4HJ4 A;  3WS5 A;  3M6B A;  1ERM A;  1L0G A;  3ISG A;  1XJ3 A;  2Z2L B;  4LCM A;  3F1O A;  2V2F F;  2EWV A;  3WWX A;  3MFX A;  3B47 A;  4WEK A;  4OQ0 A;  1LSV A;  5F68 A;  5FAS A;  1SHV A;  4HES A;  4M3K A;  1CK3 A;  4CJN A;  3G32 A;  1LHY A;  1SKF A;  5FAP A;  4HP4 A;  3VP1 A;  2B95 A;  4HY8 A;  5DKK A;  4Q0I A;  1MBL A;  4GD6 A;  2ZC4 B;  5EOE A;  4DN0 A;  4CLC B;  5GHY A;  2WGW A;  4HJ6 A;  4LV2 A;  1FIL A;  5A92 A;  2NUP C;  1LSW A;  3IHA A;  3OPL A;  4PKY G;  2PU2 A;  5E43 A;  3Q1F A;  5TGF A;  2W3G A;  2X71 A;  3MXR A;  3F1O B;  4LFU A;  5CGX A;  3QNC A;  4GW9 A;  1K0K A;  1DP8 A;  3NJA A;  5J4E A;  1GSW A;  4E6W A;  1L2S A;  1TS6 A;  4IHQ A;  3U4L P;  2OWH A;  5JYP A;  3F1N A;  1YMX A;  1HTZ A;  2Z6D A;  4B88 A;  5HX9 A;  1WA9 A;  3A0R A;  2Y2G A;  4KQO A;  5EM1 A;  2Y8H A;  4HJ3 A;  2VV7 A;  4BQM A;  1GHM A;  1N9N A;  4B4Z A;  3DWK A;  1O07 A;  1DP9 A;  1OTD A;  5DF8 A;  4WMC D;  3VSK A;  2XLN A;  2VJW A;  3G34 A;  5DVA A;  1CJF A;  4C75 A;  3UB5 P;  3VFF A;  4HP9 A;  3G6O A;  3VMA A;  2V20 A;  4EU0 A;  3UE1 A;  3HUN A;  4KZ9 A;  4OOY A;  2ZC3 B;  2XA7 S;  3CUE C;  3T4Q A;  5HFO A;  3LR3 A;  2ZQ9 A;  3D3O A;  3BEB A;  1OTB A;  2EXA A;  3LY3 A;  1VEU B;  5CHU A;  1BZA A;  1ESI A;  1BT5 A;  4JBF A;  4I3I A;  4F94 A;  1Y4O A;  3VE3 A;  4EES A;  3PR6 A;  4P85 A;  4BJP A;  1PFL A;  2EWW A;  1JWP A;  1FSY A;  3A3J A;  5U47 A;  4BD0 A;  2VX8 A;  3F1P B;  2J80 A;  3MQQ A;  1I2W A;  3C8C A;  4GDN A;  4FH4 A;  2RCX A;  1QME A;  3BFC A;  4Y0O A;  3IWO A;  3TJZ C;  5EVI D;  2KOI A;  2M7V A;  2W3F A;  3A0V A;  1P0Z A;  4PM5 A;  3EEH A;  1Y28 A;  2Y2K A;  2Y55 A;  4ME4 A;  2KLI A;  3FZC A;  4R0Q A;  3CLO A;  3UDX A;  3T1X A;  2KDK A;  2WZX A;  1WYB A;  1PW1 A;  5KSC A;  2W27 A;  1YSQ A;  5FL3 A;  1GCE A;  3NDG A;  2V0W A;  4Y13 A;  4DE0 A;  2HP5 A;  4KZ5 A;  2PD8 A;  5IT5 A;  3SS3 A;  3A3F A;  4MN6 A;  2K2N A;  1LL9 A;  2IWD A;  1YSP A;  5CHM A;  3S1Y A;  3B3X A;  2AVX A;  3PBN A;  2JC7 A;  4NG2 A;  4B93 A;  1N4O A;  3BJN A;  3RJU A;  1OJ5 A;  4BD1 A;  3QP8 A;  3GR2 A;  3OOV A;  5HAI A;  3UE0 A;  4X53 A;  4NK3 A;  2O99 A;  4PM9 A; 
#chains in the Genus database with same CATH homology
 3CWF A;  3FC7 A;  4M4X A;  2A24 B;  4Y3I A;  4P6Z M;  3T4S A;  2OAP 1;  4I3J A;  3OC2 A;  3VE4 A;  5HSQ A;  2PDR A;  1TS0 A;  5TJJ A;  3R4K A;  4LLO B;  3OCN A;  3OBF A;  4R38 A;  4EEU A;  1EW0 A;  5HD3 A;  1MC0 A;  2W3E A;  2J3T C;  3PBS A;  2B02 A;  3LIF A;  4G3W A;  5EFW A;  3BWL A;  1P9W A;  4DJ3 A;  5AJG A;  2VGL M;  3E4P A;  5DFY A;  3LFV A;  4WLA A;  3BQA A;  4H6J B;  1N9L A;  5AVF A;  1XJ6 A;  4XT2 B;  3LID A;  2PR5 A;  4II7 A;  1F5M A;  4HIA A;  4BBU A;  5K5B A;  2DMW A;  5DFX A;  4UQI S;  4ETX A;  2JHE A;  3NOU C;  2W3D A;  3MQO A;  3MQ0 A;  2PYP A;  2FZ0 A;  5DKL A;  3PBQ A;  2K31 A;  4HQA A;  3V67 A;  5F5Y A;  4EXO A;  3HCY A;  3PBR A;  2WKP A;  2XRN A;  3T4K A;  3FG8 A;  3SW1 A;  2JKT I;  4MMN A;  2QJ7 A;  4YNR A;  2O9A A;  4Q0H A;  4HNB A;  1NWZ A;  2VKS A;  4MN7 A;  1T1A A;  5TBM A;  4G3V A;  3VV4 A;  4HOI A;  3R7W A;  5I5L A;  4E04 A;  4WL9 A;  2L4R A;  3DBA A;  1H8M A;  2A24 A;  5F69 A;  3EQV A;  4DJ2 A;  3O5Y A;  3CI6 A;  3TRC A;  1UWN X;  1OPX A;  5DJU A;  4NEE D;  5L8M A;  4Y2F A;  1W63 Q;  1NLZ A;  3CAX A;  5HWT A;  3E98 A;  4Q0J A;  5HWV A;  4WN5 A;  1LL8 A;  4PAU A;  1T19 A;  2HGV A;  4CQH A;  5F6A A;  1MKM A;  4H6J A;  4UQI M;  2I9V A;  4KQD A;  3LR5 A;  1TS7 A;  3E4Q A;  3RH8 B;  1GSV A;  3U2A A;  2XRO A;  2QKP A;  3C30 A;  3KSF A;  3HJK A;  3CIT A;  3KX0 X;  3E0Y A;  2J3T D;  3EWK A;  4CLC C;  3LYX A;  1ODV A;  3T4T A;  5TBM B;  4LRZ E;  4RQ9 A;  1V9Y A;  3B42 A;  1S66 L;  2L1M A;  3R7W B;  5HDS A;  1S4R A;  5CX7 A;  5HDC A;  3RFB A;  4KUK A;  3RTY A;  3NOP C;  3EOI A;  1ZHH B;  4WEL A;  4EER A;  1GSX A;  2K7S A;  4EQ1 A;  4Z1W A;  2M7U A;  3K2N A;  4K08 A;  4LPZ A;  1N9O A;  2A2L A;  1V9Z A;  1OT9 A;  2W3H A;  4DMZ A;  3NHQ A;  3UB9 A;  2BAS A;  2PD7 A;  3C2W A;  3LIC A;  4EEP A;  3TW8 A;  4NXG A;  5HPI A;  2O9C A;  1S1Y A;  4CLC A;  4WF0 A;  3MJQ A;  2LB9 A;  4Y5F A;  2CMN A;  1UGU A;  2WKQ A;  3E4O A;  3EQU A;  3T4J A;  2O9B A;  2WKR A;  4FSF A;  4PKY A;  4I39 A;  3BQ8 A;  4HJ4 A;  3UB6 A;  4CLC E;  4MN5 A;  1XJ3 A;  3H9W A;  2OWJ A;  3F1O A;  1IFQ A;  4BBV A;  2M1C A;  2EWV A;  5J7E A;  1IOU A;  1W63 M;  3T4O A;  1XJ2 A;  1KOU A;  1DRM A;  3MFX A;  2LB5 A;  3B47 A;  4WEK A;  1XFQ A;  1YAX A;  2ZMV A;  3F1N B;  3T50 A;  1LSV A;  5F68 A;  2J3W A;  4GLQ A;  3UMD A;  3UME A;  2YKH A;  4ZRR A;  3IBR A;  3JVV A;  4I38 A;  2OOL A;  3GEC A;  2R78 A;  4HP4 A;  3MMH A;  2IA2 A;  1OTI A;  4HY8 A;  1TS8 A;  5DKK A;  2VEA A;  4Q0I A;  2JN7 A;  3LIB A;  4ARZ A;  2HF6 A;  3K3C A;  4I5S A;  4GS9 A;  3S7O A;  2OAQ 1;  4DN0 A;  4CLC B;  5G4Y A;  4UEY A;  2Z6C A;  4HJ6 A;  4NXB A;  3B33 A;  2HV1 A;  2PYR A;  2VZW A;  2W1T A;  2NUP C;  4CLC D;  1LSW A;  4JGP A;  2JKR I;  2PR6 A;  4PKY G;  1LT0 A;  2JKT M;  2D02 A;  1STZ A;  2W3G A;  1TF1 A;  3F1O B;  1G28 A;  4MDZ A;  5J3W A;  4IUH A;  3UE3 A;  2GJ3 A;  1OT6 A;  4HH3 A;  4GW9 A;  3UE6 A;  4PHT A;  3H7W B;  1DP8 A;  2VV8 A;  3NJA A;  4EW7 A;  5J4E A;  5IU1 A;  1GSW A;  3KSH A;  3LI9 A;  5HPF A;  1UWP X;  3JVU A;  3D72 A;  5AVE A;  2W0N A;  2O0Y A;  5HD5 A;  1TS6 A;  4OOL A;  4G3K A;  3IS2 B;  3P01 A;  4IHQ A;  3LR4 A;  2OWH A;  4LRY C;  4OOM A;  3GDI A;  3F1N A;  4MCW A;  1D7E A;  4WEJ A;  2QWS A;  1T1B A;  2Z6D A;  2W1R A;  4F3L A;  5A8B A;  1XJ4 A;  1WA9 A;  2Y79 A;  3A0R A;  4KQO A;  2Y8H A;  4ARZ B;  4HJ3 A;  2VV7 A;  4GS9 B;  3S7Q A;  1N9N A;  3KO6 A;  3ULF A;  1DP9 A;  1OTA A;  1OTD A;  2ZBB A;  5HL6 A;  5KIZ A;  1JNU A;  2V9A A;  2VJW A;  1X0O A;  5KSH A;  4QPR A;  2W1T B;  2INW A;  4O01 A;  5G4Z A;  1S4S A;  4B9O A;  1G6O A;  3UB8 A;  4L9E A;  2P08 A;  4HP9 A;  4I3A A;  4YWZ A;  3G6O A;  3C38 A;  5HZH A;  3K3D A;  5LBR A;  1BYW A;  4EU0 A;  3S7P A;  4LRX C;  1NRJ A;  3EEA A;  3HJI A;  2XA7 S;  3EGX C;  1LSX A;  3CUE C;  3T4Q A;  3LR3 A;  3D3O A;  3KYZ A;  1OTB A;  2ZOH A;  3PBT A;  2V1A A;  3H82 A;  4AFI A;  3MXQ A;  2VLG A;  2NUT C;  1P97 A;  2D01 A;  3H7W A;  4NXF A;  3OLO A;  4BMW A;  4KUO A;  5DJT A;  4GJ4 A;  3P7N A;  2ZOI A;  3KSG A;  4I3I A;  4F3L B;  3PHY A;  5HDD A;  3LIA A;  3S7N A;  3W2Z A;  2GX5 A;  3VE3 A;  4EES A;  3PR6 A;  3ICY A;  4BJP A;  1S67 L;  2QHK A;  3IS2 A;  4L9G A;  2GNX A;  4BBT A;  2EWW A;  5DF9 A;  2QYB A;  3MR0 A;  4GHI B;  2HJ9 C;  4JGR A;  4O8G A;  3ZYT A;  2GZA A;  1T1C A;  2VX8 A;  3CUE A;  3F1P B;  2J80 A;  1OJG A;  4HI4 A;  3MQQ A;  5HWW A;  3C8C A;  3MF0 A;  3LI8 A;  2EA9 A;  1F9I A;  4YOF A;  2PT7 A;  3TJZ C;  1YKD A;  2KOI A;  3FPW A;  2VA0 A;  4HH2 A;  4IJG A;  3EGD C;  2W3F A;  3A0V A;  2M7V A;  1P0Z A;  3A0S A;  4NXE A;  1VHM A;  4EUV A;  4HHD A;  2VV6 A;  3EEH A;  4IUK A;  3KYQ A;  1Y28 A;  1DP6 A;  2V0U A;  2B18 A;  3FPV A;  4ME4 A;  3VOL A;  4GCZ A;  2KLI A;  4P6Z S;  1VB6 A;  3KSI A;  2HJE A;  1NLY A;  3CLO A;  3PXP A;  3OCL A;  5C5K A;  3PBO A;  3T4L A;  2XA7 M;  3BW6 A;  2KDK A;  1D06 A;  3H82 B;  1ZTU A;  3BY9 A;  3LR0 A;  4NKP A;  3LUQ A;  4EET B;  4ETZ A;  4L9F A;  3UB7 A;  2W27 A;  4JGQ A;  1YSQ A;  1F98 A;  5FL3 A;  4R70 A;  2G7U A;  2P04 A;  2V0W A;  2VGL S;  3PYP A;  1XFN A;  2QJ5 A;  5IS1 A;  3TE8 A;  2PHY A;  3ZQ5 A;  2YKF A;  2V1B A;  2PD8 A;  5IT5 A;  2L0W A;  4XT2 A;  5MC7 A;  2H28 A;  4FOF A;  2KX6 A;  2FH5 A;  1S1Z A;  2K2N A;  4MN6 A;  4JGO A;  3NOT C;  4R3A A;  2MJ6 A;  1YSP A;  2P7J A;  4O0P A;  1OTE A;  4WUJ A;  1H3Q A;  2JKR M;  2XSS A;  4GHI A;  1MZU A;  1P9R A;  3PBN A;  3LIE A;  4B93 A;  1T18 A;  3BJN A;  4L0L A;  1OJ5 A;  3F1P A;  4R6L A;  2ZMF A;  3OOV A;  3BY8 A;  1TD5 A;  3IBJ A;  2O99 A;  4BWI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...