1BYWA

Structure of the n-terminal domain of the human-erg potassium channel
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
110
structure length
110
Chain Sequence
SRKFIIANARVENCAVIYCNDGFCELCGYSRAEVMQRPCTCDFLHGPCTQRRAAAQIAQALLGAEERKVEIAFYRKDGSCFLCLVDVVPVKNEDGAVIMFILNFEVVMEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (HUMAN ERG POTASSIUM CHANNEL)
publication title Crystal Structure and Functional Analysis of the Herg Potassium Channel N-Terminus: A Eukaryotic Pas Domain
pubmed doi rcsb
source organism Homo sapiens
molecule tags Membrane protein
total genus 27
structure length 110
sequence length 110
ec nomenclature
pdb deposition date 1998-10-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13426 PAS_9 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 1bywA00
4HHDA 5HWWA 4I5SA 2QKPA 1V9YA 1OJ5A 4H6JA 4EESA 4L9EA 2V0UA 5HDSA 2OWHA 3A0SA 4EXOA 4I3IA 2PYRA 4XT2B 1ODVA 3E4QA 3IS2A 5HWTA 5I5LA 5HSQA 4WUJA 1S67L 1T1AA 2PHYA 4WLAA 3LUQA 4F3LA 1T18A 2OOLA 3F1OB 5HD5A 3LYXA 4HQAA 2EA9A 3PHYA 2PDRA 4R38A 4GS9A 3LIFA 5DJUA 1OTEA 2JHEA 2PD8A 4BBVA 1D7EA 4MN5A 1LSXA 2D01A 2Z6CA 4EQ1A 4LPZA 2PD7A 4BBTA 1T19A 5J4EA 2ZOHA 4JGOA 3F1NA 3MQOA 2KX6A 1LSVA 3H82B 5F5YA 3PYPA 1UGUA 2A24B 3SW1A 1OT6A 5G4ZA 5DKLA 3T50A 5KIZA 1KOUA 1X0OA 2WKRA 3ZQ5A 1VB6A 3A0RA 2BASA 4GHIB 3LIDA 1OT9A 3MQQA 3NOTC 2CMNA 4KUKA 1N9OA 3UB6A 2J80A 1S4SA 1OJGA 2L0WA 1G28A 5J3WA 4HJ3A 4B9OA 4XT2A 1XJ6A 1TS6A 3VE3A 2HV1A 5DKKA 2L1MA 4WF0A 1GSXA 2H28A 3F1OA 4HH3A 2OWJA 2R78A 2P7JA 4PKYG 4K08A 3UMDA 1S66L 2WKQA 5IU1A 3FC7A 2YKHA 3MXQA 1XJ4A 3A0VA 1XJ3A 3UB9A 4JGQA 3F1PB 4DJ3A 1S1ZA 1GSWA 4LRYC 4NXEA 2K7SA 1MZUA 3RH8B 2JN7A 4HP4A 1T1CA 4R6LA 2QJ5A 3VOLA 3MFXA 4NXGA 4HNBA 1EW0A 3CAXA 2D02A 5TBMA 2M1CA 3NJAA 1GSVA 2QJ7A 2QHKA 4LRZE 3OLOA 3VE4A 2A24A 1P97A 1BYWA 2V1BA 1OTAA 2PR5A 1S1YA 4KUOA 5EFWA 4HH2A 3C8CA 3LI8A 2L4RA 1XJ2A 5F69A 3P7NA 4I38A 3E4PA 4LRXC 1DP8A 2ZBBA 3RTYA 3NHQA 2QWSA 2V9AA 4GHIA 3MR0A 4HIAA 3ICYA 2PR6A 4HJ6A 4HI4A 3BWLA 1JNUA 3HJKA 1OTBA 4JGPA 5G4YA 5F68A 3LIEA 4MN6A 4HY8A 2ZOIA 1LSWA 2VEAA 3LIBA 1N9LA 5HD3A 1WA9A 2B02A 1S4RA 4EETB 2VV7A 1Y28A 3LICA 4NXFA 1TS7A 3B33A 4L9GA 3CWFA 5HDDA 3KX0X 3H7WB 1TS0A 4YWZA 3HJIA 2VV8A 1DP9A 5HDCA 3FG8A 5AVEA 1TS8A 3F1PA 1LL8A 4M4XA 4I39A 4RQ9A 3K3DA 1V9ZA 2YKFA 4HJ4A 4H6JB 3UE6A 5HZHA 1DP6A 2KDKA 4LLOB 4GW9A 5HWVA 4EERA 1UWNX 3EWKA 3UMEA 3IS2B 3CLOA 5DJTA 3GECA 4GCZA 2V0WA 4F3LB 3LI9A 1F98A 3C2WA 3D72A 4HP9A 1P0ZA 1XFNA 4EEPA 3NOUC 5F6AA 5IS1A 2VLGA 3K3CA 2V1AA 3IBRA 3H82A 1NWZA 4BBUA 3G6OA 4GS9B 3H9WA 3BY9A 1UWPX 3EEHA 4L9FA 3UB7A 4JGRA 2INWA 5TBMB 4E04A 1N9NA 2VV6A 3MJQA 4KQDA 4HOIA 3F1NB 5A8BA 2W0NA 2Z6DA 4DJ2A 3BY8A 1D06A 2GJ3A 3NOPC 1LT0A 1XFQA 4WN5A 5AVFA 2W27A 1DRMA 1OTIA 2WKPA 2PYPA 4EEUA 1T1BA 3LIAA 1F9IA 4NXBA 1OTDA 3GDIA 3UB8A 4I3AA 3H7WA 2I9VA 3E4OA 4EW7A 4WL9A 4R70A 4R3AA 4PKYA 5J7EA 4I3JA 3ULFA
chains in the Genus database with same CATH superfamily
4BQMA 4I5SA 1KGEA 1MWTA 3BRMA 2HDSA 4BLMA 5FDSA 2OLVA 3ZVWA 3PR6A 3UB5P 3Q7ZA 1O7EA 2W3HA 1NLZA 3CPTB 2OWHA 3A0SA 4I3IA 1C3BA 1HLUP 4ID4A 1BTLA 3DTIA 4KZ9A 3Q1FA 1T1AA 2VGLM 5AQ7A 2QYBA 4Q8IA 3VP2A 5HAPA 4Z9QA 4DN0A 2HZ5A 1RP5A 2Y2LA 3M6BA 2QZ6A 2G2UA 3C4PA 2OOLA 5HD5A 3VV4A 3LYXA 4DE3A 4FOFA 5EOEA 3KSIA 2P9VB 4EBNA 3KYQA 3UPOA 4JXWA 1K56A 3GRJA 4QWOA 4E3LA 1XGJA 3UE0A 3LIFA 4UEYA 5DJUA 4OOMA 1OTEA 2JE5A 1K6RA 2PD8A 4Y5FA 5GLDA 2D01A 2Z6CA 4GN2A 4JXSA 4S2MA 5CTMA 2GZAA 5L09A 3RFBA 3W8KA 3MQOA 1ZTUA 1MY8A 2P74A 1JTGA 3MXRA 4A5RA 2A24B 1EROA 3CITA 3DTEA 3V5MA 1OT6A 5G4ZA 1X0OA 3O86A 2ZQ8A 3Q81A 3UPPA 3QP8A 4OLGA 2BASA 3S7OA 5F83A 1OT9A 3MQQA 4WMCA 5GHXA 4X6TA 5EM1A 4JKTA 3ISGA 4C6YA 2E8JA 3VOZA 3UDXA 1OJGA 3MFDA 1HTZA 1TDGA 3CPTA 3GTCA 2Q0OA 4HEFA 1DJAA 1YLJA 4IHQA 3T1RA 1VETB 2WK0A 4EUVA 2PU2A 4KQQA 3NY4A 4S2PA 5L2FA 5DKKA 3PBOA 3EEAA 1PWDA 1GSXA 4PKYG 1YQSA 2IWDA 4NETA 2WKQA 5GLBA 5FI7A 2YKHA 1PWGA 2EWVA 2P9VA 1XJ4A 2W1TB 2XA7S 3CG5A 3OC2A 4MBKA 5K5BA 3S7NA 4DJ3A 1GSWA 4S2JA 2ZC5B 2K7SA 1MZUA 3IQAA 1KGFA 4OPYA 4UA7A 1YLPA 2Y2GA 4NXGA 4GZBA 1J3WA 3SH7A 3FWLA 4LV2A 5FAOA 5TBMA 3WS5A 1S6RA 5CHMA 2Q9MA 1CEGA 3NCKA 2QHKA 4LRZE 2ZQAA 2A24A 5HPIA 1P97A 4U3TA 2V1BA 5KMWA 4EUZA 1ESUA 4R4RA 1S1YA 5EFWA 4X1MA 4HH2A 2XFSA 1BLPA 1XJ2A 5E2EA 3P7NA 3E4PA 4R3JA 3TE8A 3UO9A 2V9AA 2Z2LB 2J3TC 3MR0A 5E2FA 4OPRA 1W7FA 3PAGA 4QD4A 1E4DA 3IXHA 4MDZA 3HJKA 1OTBA 1YSPA 1NRFA 4JGPA 3C7VA 4R23A 2EX8A 3MZEA 3ZNYA 3LIEA 4KENB 2WZZA 4S2NA 1LSWA 3GSGA 2W3FA 4RA7A 3HUNA 5JYOA 4WZ5A 1N9LA 1W63M 3HVFA 1S4RA 5EM0A 4Z1WA 3S1YA 4JXVA 3CWFA 4CJNA 3EGXC 4KQRA 4LV3A 3T4TA 3KX0X 2O99A 3GMWA 3IX8A 4L0LA 1SCWA 2VV8A 3BYDA 4NG2A 2W1TA 3A3IA 1CI8A 1DP9A 3AGFA 5AQ9A 1EWZA 4R0QA 2EWWA 1LL8A 4M4XA 1K6SA 4ZDXA 4MNRA 1PWCA 2YKFA 1SZVA 3E2LA 4H6JB 2J3WA 1BLCA 2IA2A 2B5RA 4LLOB 1YT4A 3HUMA 3QP6A 3ZNTA 1K57A 2XH9A 3EWKA 2BTFP 1VM1A 3IS2B 2Y2NA 3A3DA 3CLOA 3ITBA 4GCZA 3LI9A 4DDSA 5CEDA 1GA0A 5FI2A 1GHMA 3VP3A 3V39A 1P0ZA 1XFNA 1JWVA 2UV0E 4EEPA 1PIOA 5IS1A 3IXBA 3MS6A 3O5YA 3K3CA 4CLCC 2XK1A 3H82A 1ERQA 2EFXA 4GS9B 4PMAA 3S7QA 3SOIA 2WKIA 5LBRA 4IVKA 4MMNA 2I72A 3D9YA 2J3TD 4GJ4A 1N9NA 4EWFA 1ONGA 1W8QA 3T12B 5FQJA 5A8BA 2Z6DA 1E3UA 3JVVA 4KZ3A 3TG9A 4DJ2A 4N92A 2HGVA 2ZQ9A 1K4FA 4MEZA 1LT0A 4KZ7A 1OPXA 3ZG7B 4WN5A 4OP8A 2AVXA 2WKPA 2PYPA 4XXRA 2OAP1 3LIAA 4ZJ2A 5DTSA 1P9WA 1F9IA 2V20A 4ETXA 3GDIA 3UB8A 2I9VA 2WGVA 1XA1A 4FSFA 3WS2A 3IWQA 2O9BA 4PKYA 4FD8A 5DVAA 3ZDJA 2QKPA 3P98A 5CX7A 1L0EA 3DAVA 4N1XA 3OPHA 4X53A 4H6JA 2HJ9C 4EESA 4H8RA 1L0FA 3PBNA 4FH2A 3ZCZA 5HWTA 3IS2A 5I5LA 3D4FA 1S67L 5FQIA 2PHYA 5HFOA 4Y13A 2ZLYA 3HUOA 4IBXA 2LB5A 1G68A 3HLWA 3LY3A 2RCXA 1K56D 1ZG4A 1T18A 3AGEA 3F1OB 1PI5A 4YOFA 4OVDA 3B3XA 3UE3A 3KSGA 1Z09A 1PFLA 3RJUA 3PHYA 1L2SA 2O0YA 2PDRA 4JLFA 3NECA 3A3FA 1BUEA 4GS9A 4CLCD 3HLDA 4CLCE 4E3MA 4C75A 3KO6A 2JHEA 3VP0A 1EI5A 4BBVA 1LSXA 3O88A 2XR0A 1P9RA 1ZC2A 2IWCA 4BBTA 2WADA 4GB7A 2ZOHA 4JGOA 3MQ0A 3D3OA 4UQIS 2JKTM 3KSHA 5A91A 4IVIA 4MLLA 3G2ZA 4B4XA 4LCMA 2H5SA 3WS1A 4Q0JA 4ARZB 4QPRA 3T50A 3SH9A 2OSUA 3IH9A 4WMCD 4BL3A 1GHPA 5TFQA 3ZQ5A 2WAEA 2VZWA 3T4OA 1LL9A 4UA6A 5AJGA 4Q0HA 3C7UA 2XDMA 4GHIB 3UE1A 4U0XA 3VFFA 3IT9A 4DXCA 3QP2A 4S2NC 5DTTA 2ZMVA 4WZ5C 1YAXA 2NUPC 2FFYA 2QPNA 1FSYA 1G28A 4WEJA 1HVBA 4Q0IA 4B9OA 3BM6A 3G35A 1K55A 4PM7A 1PI4A 1IKGA 1GA9A 4HBTA 3VE3A 3EQUA 4AFIA 2ZC4B 4R1GA 3OPPA 1D1JA 4OONA 4F94A 3UNWA 3NC8A 2XEPA 3TJZC 3F1OA 3OZHA 3CUEA 2R78A 4PHTA 3UY6A 5EVIA 1ES2A 5EECA 3LCEA 3UB9A 1YKDA 4UAAA 2BG1A 5JYPA 1FQGA 4BD0A 2Y8HA 1FCOA 3RH8B 2JN7A 3WRTA 4OOLA 3OOVA 1SDNA 3SS3A 4E6XA 3VOLA 3MFXA 5I94A 3DBAA 4BL2A 1EW0A 3OCLA 4N9KA 1N4OA 2ZM8A 1ES4A 3NJAA 1GSVA 4XUXA 3HCYA 1XKZA 5KZHA 4ARZA 2GX5A 2PR5A 1IYSA 4KG2A 3CHWP 1H8YA 2L4RA 3WRZA 3CI6A 2Y4AA 4MBFA 1DP8A 3C38A 3N7WA 3NHQA 4GHIA 4PM5A 3M6HA 3ICYA 4DRTA 3MMHA 3CZDA 4QU3A 1WE4A 4PPRA 5EPHA 1JNUA 2ZMAA 1SDEA 4OOYA 2FFFB 5DFYA 2H0YA 2J9OA 1QMEA 5AQAA 4ESPA 1W63Q 4MN6A 4JF5A 3LIBA 1VEUB 3SH8A 2O9AA 2IWBA 3T4KA 1WA9A 2R9WA 4EETB 4DMZA 1J9MA 3WS0A 4IJGA 3LGOA 4YNRA 1K38A 3Q7VB 5EOOA 1N9BA 1YLZA 3B33A 4L9GA 5CGXA 3VOYA 5L07A 5HDDA 4CPKA 5GL9A 3KSFA 3S22A 2WKHA 3RXWA 3HJIA 4S2KA 5HL6A 4GKUA 3BFDA 5AVEA 1H3QA 1YLYA 1TS8A 3W2ZA 4I39A 1U60A 4HJ4A 4WM9A 2E8IA 5HZHA 3KYZA 1DP6A 4PAUA 2KDKA 4GW9A 5HWVA 1K54A 4E3KA 2ZQ7A 2XQZA 3UMEA 3HLGA 4BD1A 2PBDP 2UWXA 4R4SA 2J8YA 4II7A 2V0WA 4F3LB 5CGSA 1NXYA 1F98A 5TGFA 3C2WA 4HP9A 3U2AA 3SZTA 3KYEA 5F6AA 2Y2IA 2VGKA 1L0GA 2V1AA 5GHZA 2JKRI 4FTXA 5EV0A 5FQMA 2BLSA 4BBUA 2JBFA 3IXGA 3LEQA 3MSHA 4E3OA 3G6OA 3BY9A 2PRFA 4DXBA 3EEHA 4PM9A 3K2NA 4JGRA 4MN7A 2DNSA 1MKMA 3GVBA 4Y15A 2K2NA 3IWOA 4LGWA 3EQVA 4DE2A 1E3UD 4E04A 2H0TA 2Y55A 4LV1A 4B4ZA 1PNEA 1K25A 5FAPA 1DJCA 4HOIA 3C4OA 3U4LP 4KZBA 4UQIM 3T4QA 5M18A 1D06A 1NY0A 4BWIA 1MKIA 3VSKA 1XFQA 2W3DA 5AVFA 3Q82A 2Y2JA 1DRMA 3ZG5A 3HBRA 1CQAA 3HLCA 1LHYA 3BQAA 3Q7VA 5HAQA 1VETA 2P04A 5FDHA 3W4QA 4UA9A 3HREA 1WYBA 4U0TA 4I3AA 1Y4OA 3TOIA 3E4OA 1XGIA 4JBFA 3BQ8A 4S2IA 4WL9A 5FAQA 1BULA 5FQKA 1FOFA 4IUHA 4E3NA 4HHDA 5HWWA 3VP4A 2JKFA 1LI9A 1K55C 3JVUA 1V9YA 1JWZA 1OJ5A 1W5DA 4L9EA 1O07A 2V0UA 5HDSA 3CUEC 3FKVA 2PYRA 4OPZA 4XT2B 1ODVA 3E4QA 5HSQA 2OAQ1 4WUJA 5EVIC 4X25A 4WLAA 3LUQA 2WYXA 4F3LA 2C5WB 5FEFA 1PRQA 5E43A 3JPUA 4ME4A 4K0XA 4HQAA 3N6IA 3DWZA 4EBPA 2EXBA 1MC0A 2HDUA 3T1XA 1NZOA 1IELA 3L9KA 3O3VA 3IF6B 3IX4A 1ESIA 1JWPA 2V8CA 5IHVA 4PM6A 1TD5A 3CJMA 2ZM0A 2GNXA 3QP1A 2Y2OA 1SHVA 4Y7PA 3IH8A 4EQ1A 3S4XA 2VGJA 3NDGA 4MCWA 1MWUA 4E6WA 4UHUA 2X01A 3QNBA 4GD8A 1MPLA 3N4IA 1KE0A 1FR6A 3ZVTA 3HLFA 1KOUA 1PZPA 1ZG6A 2WAFA 5EE8A 2WKRA 5FL3A 2B95A 3LR5A 3PBSA 4G3VA 3VFHA 5HL1A 3A0RA 3NOTC 2CMNA 4KUKA 2CC1A 3UB6A 2V8FA 2J80A 1YMXA 4QY5A 4KZ6A 3BEBA 2VKSA 4OQ0A 1H8ZA 2HF6A 1Q2PA 5J3WA 2P08A 3VP1A 1RGZA 4XT2A 4P0MA 3ZG8B 1XJ6A 3G32A 1TS6A 3OPRA 5CHJA 5EVID 2A49A 3E98A 2HPBA 3SS4A 3P01A 2L1MA 5DTKA 2H28A 4HH3A 4X69A 1W8YA 2X71A 3V50A 1ALQA 5FEGA 3FC7A 3C30A 3MXQA 3QHYA 3LR4A 1YLTA 2Y2QA 3BFFA 3TSGA 3A0VA 4QY6A 4YINA 2XRNA 3IF6A 4JGQA 4S2OA 1IFQA 3F1PB 1YPRA 4X55A 1H8MA 1ERMA 1FR1A 4LRYC 2XA7M 1TF1A 2XF3A 1NLYA 4EV4A 1RCJA 1I2WA 4HP4A 3A3EA 2HJEA 2QJ5A 3N8SA 4HNBA 1XA7A 3NI9A 3PBTA 3Q07A 3O87A 2ZQDA 4N9LA 2M1CA 4P6BA 3LFVA 4DKIA 3SS5A 2Y2MA 5C5KA 3UN7A 3NULA 1F2KA 3CMZA 3OLOA 3VE4A 5U47A 1BYWA 4C3QA 3MKFA 5TR7A 1OTAA 2MJ6A 2J9PA 3C8CA 4X68A 4EBLA 4OQHA 4CLCB 4LRXC 1S0WA 3C5AA 2QWSA 3N8LA 1XXMA 2PR6A 4HJ6A 4HI4A 2QMIA 3UDFA 1DJBA 5G4YA 1F5MA 3BECA 4HY8A 2ZOIA 4Y0UA 3FPWA 4RVAA 1AXBA 2V2FF 4ZAMA 3DW0A 1SKFA 2FZ0A 1E25A 2B02A 2VV7A 2WGIA 1Y28A 1LLBA 2G2WA 1STZA 5J8XA 2ZD8A 3LICA 4NXFA 5DF9A 3LR3A 3ZFZA 1GCEA 1TS0A 3H7WB 4ZTKA 4O01A 4P6ZS 2EX2A 4E3IA 1KDSA 1BT5A 3F1PA 1M6KA 1PYYA 2Y2KA 3PBQA 3K3DA 5CECA 5HAIA 4WBGA 1V9ZA 4IUKA 1K57C 4GDBA 5G18A 5L8MA 1ES3A 2XSSA 5DJTA 2R9XA 4JPMA 2HP9A 4X56A 3R4KA 1MWSA 3OPLA 5FI6A 3M2KA 4QJGA 1IYOA 1FIKA 3D72A 3T1SA 5CERA 3NOUC 3G4PA 2VLGA 3P09A 4WYYA 5DF8A 1FCMA 3ZGAB 1NWZA 1CEFA 4GD6A 2ZC3B 5GLAA 1PW1A 3NDEA 4CLCA 1UWPX 4L9FA 3UB7A 1TDLA 3TRCA 3V3RA 5HPFA 1MBLA 4E3JA 1QMFA 4KG6A 5TBMB 4JXGA 3A3JA 3ZHHA 2VV6A 5KSHA 2ZC7A 1OMEA 4B93A 4JF6A 3F1NB 4DF6A 4D60A 1K4EA 1RGYA 1WYCA 3BJNA 3BLMA 2PBYA 3IF5A 3DTMA 3NOPC 1FSWA 2W3EA 2W27A 1OTIA 4EEUA 1T1BA 3AGDA 3N8RA 2WKEA 4NXBA 1OTDA 4M3KA 3T4JA 1MXOA 3H7WA 4WELA 2ZJ9A 4R70A 3PBRA 4R3AA 5TJJA 3IWIA 4D2OA 5J7EA 1NYYA 1LL5A 3M2JA 5E2GA 4O0PA 2ZC6B 3GR2A 4FCFA 1BLSA 2WGWB 2VK3A 2A2LA 5A90A 3LR0A 4HBUA 4EXOA 4WZ4A 4P85A 1HD8A 2HDRA 2C6WB 1CF0A 4GLQA 3LY4A 1G5UA 4QHCA 3IF6C 3T4SA 2WUQA 4OQIA 5FQQA 4R3BA 1GHIA 2Y91A 1L3LA 5CRFA 5DF7A 3FZCA 2GDNA 3QP5A 3EGDC 3PXPA 5FSRA 2G7UA 2ZMFA 3G31A 4ETZA 2EA9A 2OLUA 4HESA 1IYQA 4R38A 4OP5A 4Y17A 3DWKA 1YMSA 5CXWA 1KVLA 5CEBA 3LO7A 3E2KA 1D7EA 3G30A 2XD5A 4MN5A 4OH0A 4LPZA 2PD7A 5DFXA 5AQBA 4EQIA 1KE3A 4YFMA 1T19A 1IKIA 5J4EA 3I7JA 5FASA 3F1NA 5KSCA 1NRJA 1YSQA 3QP4A 5FATA 1LI0A 2KX6A 1LSVA 3H82B 2FH5A 3MZDA 3PYPA 5F5YA 3ITAA 5EUAA 4KZ8A 1UGUA 2M7VA 4QB8A 3SW1A 2EX9A 1YLWA 2PT7A 1VEUA 4N1HA 5DKLA 4MBHA 5KIZA 4PM8A 3S7PA 2RL3A 4NK3A 2K31A 1VB6A 1VHMA 3LIDA 1L0DA 5CHUA 2VX8A 4ZRRA 4FUWA 1N9OA 1ZKJA 2W1RA 5F82A 5FQ9A 3VSLA 2J7VA 2WGWA 1S4SA 3NBLA 2L0WA 3WWXA 5GLCA 2DCFA 1DY6A 3T1QB 2A3UA 4HJ3A 1JTDA 2JC7A 1NYMA 3WS4A 5HW3A 5EVLA 2VGLS 2Y79A 4LCLA 1AWIA 3IHAA 2HV1A 4BENA 4CQHA 1CJFA 4WF0A 2OWJA 4B88A 3GV9A 2P7JA 2XLNA 4K08A 3UMDA 2HP6A 1S66L 5IU1A 4OQGA 4RX2A 3MXSA 2JKTI 3HLBA 3G2YA 4P6ZM 5E2HA 1PW8A 1XJ3A 5CGWA 1Q2QA 3FKWA 5IT5A 1PZOA 2EXAA 1S1ZA 2ZL1B 3HL9A 3T4LA 3VMAA 2H10A 2EFUA 4NXEA 1I5QA 4LENA 3E0YA 2M7UA 1T1CA 4R6LA 4JF4A 4Y0OA 1KVMA 3CAXA 5M1AA 2D02A 2DRWA 1CK3A 1ZHHB 4DDYA 5EVEA 3B42A 4K0WA 4KZAA 2QJ7A 1A0KA 1XP4A 1KGGA 4Y0TA 1IOUA 4OKPA 2LB9A 4DE1A 1TEMA 4KUOA 3BLSA 3LI8A 4BMWA 2Q9NA 2XGNA 5F69A 2NUTC 4ZBEA 2Y2HA 4I38A 2JCHA 2KOIA 2ZBBA 3W4PA 4IEDA 3RTYA 4FH4A 3BFEA 1G6AA 4HIAA 3QNCA 4S2LA 1ES5A 2KLIA 3BWLA 1K0KA 4Y2FA 4KQOA 3ZG0A 2O9CA 3MZFA 4G3WA 3UPNA 3G34A 4GNUA 2W3GA 5HARA 4ZJ3A 2JKRM 5F68A 4O8GA 1W79A 3JYIA 4BJPA 3B47A 2VEAA 5HX9A 1HZOA 3BFCA 2ACGA 3IHBA 3MF0A 5HD3A 2ZM2A 3OBFA 5L10A 1TS7A 1SKOB 4G3KA 2B18A 4KG5A 1ACFA 3R7WB 4LFUA 1TVFA 2XD1A 4YWZA 1KDWA 3NIAA 3BFGA 5HDCA 4ZJ1A 3FG8A 2Y59A 1MWRA 4GOGA 3DTKA 2HDQA 1CI9A 1VQQA 5GHYA 2ZL1A 5BOHA 4RQ9A 1K54C 1Y54A 3RXXA 2JKGA 1BZAA 3UE6A 4NKPA 4GDNA 4EERA 5M19A 3V67A 1G6OA 1UWNX 2PAVP 3FYZA 1JVJA 2OV5A 2ZQCA 2XFTA 3GECA 4OPQA 3UDIA 2HP5A 2VJWA 4P87A 1XPBA 5CTNA 5EVIB 1IYPA 1FCNA 4K91A 5FA7A 3OCNA 1H5XA 3IBRA 3L7HA 1Z6FA 4X1LA 4IBRA 3W4OA 1IEMA 3MKEA 1NJ4A 1ONHA 3H9WA 1BSGA 2V1ZA 3IBJA 1I2SA 1H0MA 2PU4A 2X02A 4EU0A 4Y3IA 2INWA 1YM1A 3ZYTA 4RX3A 2Y2PA 3ZG9B 3FV7A 2Z2MB 3MJQA 4XUZA 1M40A 4KQDA 5A92A 5A93A 4RYEA 2W0NA 3PAEA 3BY8A 3LEZA 1NZUA 1XX2A 2GJ3A 3FPVA 1FILA 3HLEA 3IX3A 1BLHA 2VA0A 3TW8A 2DMWA 3MBZA 4KZ4A 3V3SA 1SKOA 2EX6A 5F1GA 4NEED 3EOIA 2WZXA 2XROA 4WEKA 3PTEA 4KZ5A 3R7WA 5MC7A 5F1FA 4O7DA 4EW7A 5D3OA 3BW6A 4OLDA 4LV0A 1KE4A 4I3JA 4DE0A 3GQZA 3ULFA 3IXDA
chains in the Genus database with same CATH topology
4HHDA 5HWWA 4I5SA 4O0PA 2QKPA 5CX7A 3JVUA 1V9YA 1OJ5A 3PR6A 2HJ9C 4H6JA 4EESA 4L9EA 2A2LA 2W3HA 1NLZA 2V0UA 3LR0A 5HDSA 2OWHA 3PBNA 3A0SA 4EXOA 3CUEC 4I3IA 2PYRA 4XT2B 1ODVA 3E4QA 3IS2A 5HWTA 5I5LA 5HSQA 2OAQ1 4WUJA 1S67L 1T1AA 2PHYA 4WLAA 2VGLM 2QYBA 4GLQA 3LUQA 4F3LA 4DN0A 3T4SA 2LB5A 1T18A 2OOLA 3F1OB 5HD5A 4ME4A 3VV4A 3LYXA 4YOFA 4HQAA 3EGDC 4FOFA 3UE3A 3KSIA 3PXPA 3KSGA 2G7UA 2ZMFA 4ETZA 1MC0A 3KYQA 2EA9A 3PHYA 2O0YA 2PDRA 4R38A 4GS9A 3LIFA 4CLCD 4UEYA 5DJUA 4OOMA 1OTEA 1TD5A 4CLCE 2GNXA 3KO6A 2JHEA 2PD8A 4Y5FA 4BBVA 1D7EA 4MN5A 1LSXA 2D01A 2Z6CA 4EQ1A 4LPZA 2PD7A 5DFXA 1P9RA 2GZAA 4BBTA 3RFBA 1T19A 5J4EA 4MCWA 2ZOHA 4JGOA 3MQ0A 3D3OA 3F1NA 4UQIS 3MQOA 2JKTM 1NRJA 1YSQA 3KSHA 1ZTUA 2KX6A 1LSVA 3H82B 2FH5A 3PYPA 5F5YA 1UGUA 2M7VA 2A24B 3CITA 4Q0JA 3SW1A 4ARZB 2PT7A 1OT6A 4QPRA 5DKLA 5G4ZA 3T50A 5KIZA 1KOUA 1X0OA 2WKRA 5FL3A 3S7PA 3LR5A 3ZQ5A 2VZWA 3PBSA 2K31A 4G3VA 3T4OA 1VB6A 5AJGA 3A0RA 1VHMA 4Q0HA 2BASA 3S7OA 4GHIB 3LIDA 1OT9A 3MQQA 3NOTC 2CMNA 2VX8A 4KUKA 4ZRRA 2ZMVA 1N9OA 3UB6A 2W1RA 2J80A 1YAXA 2NUPC 1S4SA 1OJGA 2VKSA 2L0WA 1G28A 4WEJA 2HF6A 5J3WA 2P08A 4HJ3A 4Q0IA 4B9OA 4XT2A 2VGLS 4IHQA 1XJ6A 2Y79A 1TS6A 3VE3A 3EQUA 4AFIA 2HV1A 4CQHA 3E98A 3P01A 5DKKA 2L1MA 3PBOA 3EEAA 4WF0A 3TJZC 1GSXA 2H28A 3F1OA 4HH3A 3CUEA 2OWJA 2R78A 2P7JA 4PKYG 4PHTA 4K08A 3UMDA 1S66L 2WKQA 5IU1A 3FC7A 2YKHA 3C30A 2EWVA 3MXQA 1XJ4A 3LR4A 2W1TB 2JKTI 2XA7S 3OC2A 3A0VA 4P6ZM 2XRNA 1XJ3A 3UB9A 4JGQA 1IFQA 5IT5A 5K5BA 1YKDA 3F1PB 3S7NA 4DJ3A 1H8MA 1S1ZA 2Y8HA 3T4LA 1GSWA 4LRYC 2XA7M 1TF1A 1NLYA 4NXEA 2K7SA 1MZUA 3RH8B 2JN7A 3E0YA 4OOLA 4HP4A 3OOVA 2M7UA 2HJEA 1T1CA 4R6LA 2QJ5A 3VOLA 3MFXA 4NXGA 4HNBA 3DBAA 1EW0A 3CAXA 3PBTA 3OCLA 2D02A 5TBMA 1ZHHB 2M1CA 3NJAA 3B42A 3LFVA 1GSVA 5C5KA 2QJ7A 3HCYA 2QHKA 4LRZE 3OLOA 3VE4A 1IOUA 2A24A 5HPIA 1P97A 1BYWA 2V1BA 4ARZA 2GX5A 2LB9A 1OTAA 2PR5A 1S1YA 2MJ6A 4KUOA 5EFWA 4HH2A 3C8CA 3LI8A 2L4RA 1XJ2A 4BMWA 5F69A 2NUTC 3CI6A 3P7NA 4CLCB 4I38A 3E4PA 4LRXC 1DP8A 2KOIA 3TE8A 2ZBBA 3C38A 3RTYA 3NHQA 2QWSA 2V9AA 4GHIA 2J3TC 3MR0A 4HIAA 3ICYA 2PR6A 3MMHA 2KLIA 4HJ6A 4HI4A 3BWLA 4Y2FA 4KQOA 4MDZA 2O9CA 1JNUA 3HJKA 1OTBA 1YSPA 4G3WA 4JGPA 2W3GA 5G4YA 1F5MA 2JKRM 5F68A 5DFYA 4O8GA 3LIEA 1W63Q 4MN6A 4HY8A 2ZOIA 4BJPA 3FPWA 1LSWA 3B47A 2VEAA 3LIBA 2O9AA 2W3FA 2FZ0A 3MF0A 1N9LA 3T4KA 5HD3A 1WA9A 1W63M 2B02A 1S4RA 4DMZA 2VV7A 4EETB 4IJGA 1Y28A 1STZA 3OBFA 4YNRA 4Z1WA 3LICA 4NXFA 1TS7A 3B33A 4L9GA 3CWFA 2B18A 4G3KA 5HDDA 3EGXC 5DF9A 3KSFA 3LR3A 3R7WB 3KX0X 2O99A 3T4TA 3H7WB 1TS0A 4L0LA 4YWZA 3HJIA 2VV8A 4O01A 4P6ZS 5HL6A 2W1TA 1DP9A 5HDCA 3FG8A 5AVEA 1H3QA 2EWWA 1TS8A 3W2ZA 3F1PA 1LL8A 4M4XA 4I39A 3PBQA 3K3DA 4RQ9A 1V9ZA 2YKFA 4HJ4A 4IUKA 4H6JB 3UE6A 5HZHA 3KYZA 1DP6A 2J3WA 4PAUA 4NKPA 2KDKA 2IA2A 4LLOB 4GW9A 5HWVA 4EERA 3V67A 1G6OA 1UWNX 5L8MA 3EWKA 3UMEA 3IS2B 2XSSA 3CLOA 5DJTA 3GECA 4GCZA 4II7A 2V0WA 4F3LB 3R4KA 3LI9A 2VJWA 1F98A 3C2WA 3D72A 4HP9A 1P0ZA 1XFNA 3U2AA 4EEPA 3NOUC 5F6AA 5IS1A 2VLGA 3O5YA 3K3CA 3OCNA 2V1AA 2JKRI 3IBRA 4CLCC 3H82A 1NWZA 4BBUA 3G6OA 4GS9B 3H9WA 3BY9A 4CLCA 1UWPX 3EEHA 4L9FA 3S7QA 3IBJA 3UB7A 3K2NA 3TRCA 4JGRA 5LBRA 4MN7A 5HPFA 4MMNA 1MKMA 4EU0A 4Y3IA 2K2NA 2INWA 5TBMB 3EQVA 2J3TD 3ZYTA 4E04A 4GJ4A 1N9NA 2VV6A 5KSHA 3MJQA 4B93A 4KQDA 4HOIA 3F1NB 5A8BA 2W0NA 2Z6DA 3JVVA 4UQIM 3T4QA 3BJNA 4DJ2A 3BY8A 1D06A 2HGVA 4BWIA 2GJ3A 3FPVA 3NOPC 1LT0A 1XFQA 1OPXA 2W3DA 4WN5A 2W3EA 5AVFA 2W27A 1DRMA 1OTIA 2WKPA 2PYPA 2VA0A 4EEUA 3TW8A 1T1BA 2OAP1 3LIAA 3BQAA 2DMWA 1P9WA 1F9IA 2P04A 4ETXA 4NEED 3EOIA 4NXBA 1OTDA 3GDIA 2XROA 4WEKA 3R7WA 3T4JA 4I3AA 3UB8A 5MC7A 3H7WA 2I9VA 3E4OA 4WELA 4FSFA 4EW7A 3BW6A 3BQ8A 4WL9A 4R70A 3PBRA 4R3AA 5TJJA 2O9BA 4PKYA 5J7EA 4I3JA 4IUHA 3ULFA 4EUVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HHD A;  5HWW A;  4I5S A;  2QKP A;  1V9Y A;  1OJ5 A;  4H6J A;  4EES A;  4L9E A;  2V0U A;  5HDS A;  2OWH A;  3A0S A;  4EXO A;  4I3I A;  2PYR A;  4XT2 B;  1ODV A;  3E4Q A;  3IS2 A;  5HWT A;  5I5L A;  5HSQ A;  4WUJ A;  1S67 L;  1T1A A;  2PHY A;  4WLA A;  3LUQ A;  4F3L A;  1T18 A;  2OOL A;  3F1O B;  5HD5 A;  3LYX A;  4HQA A;  2EA9 A;  3PHY A;  2PDR A;  4R38 A;  4GS9 A;  3LIF A;  5DJU A;  1OTE A;  2JHE A;  2PD8 A;  4BBV A;  1D7E A;  4MN5 A;  1LSX A;  2D01 A;  2Z6C A;  4EQ1 A;  4LPZ A;  2PD7 A;  4BBT A;  1T19 A;  5J4E A;  2ZOH A;  4JGO A;  3F1N A;  3MQO A;  2KX6 A;  1LSV A;  3H82 B;  5F5Y A;  3PYP A;  1UGU A;  2A24 B;  3SW1 A;  1OT6 A;  5G4Z A;  5DKL A;  3T50 A;  5KIZ A;  1KOU A;  1X0O A;  2WKR A;  3ZQ5 A;  1VB6 A;  3A0R A;  2BAS A;  4GHI B;  3LID A;  1OT9 A;  3MQQ A;  3NOT C;  2CMN A;  4KUK A;  1N9O A;  3UB6 A;  2J80 A;  1S4S A;  1OJG A;  2L0W A;  1G28 A;  5J3W A;  4HJ3 A;  4B9O A;  4XT2 A;  1XJ6 A;  1TS6 A;  3VE3 A;  2HV1 A;  5DKK A;  2L1M A;  4WF0 A;  1GSX A;  2H28 A;  3F1O A;  4HH3 A;  2OWJ A;  2R78 A;  2P7J A;  4PKY G;  4K08 A;  3UMD A;  1S66 L;  2WKQ A;  5IU1 A;  3FC7 A;  2YKH A;  3MXQ A;  1XJ4 A;  3A0V A;  1XJ3 A;  3UB9 A;  4JGQ A;  3F1P B;  4DJ3 A;  1S1Z A;  1GSW A;  4LRY C;  4NXE A;  2K7S A;  1MZU A;  3RH8 B;  2JN7 A;  4HP4 A;  1T1C A;  4R6L A;  2QJ5 A;  3VOL A;  3MFX A;  4NXG A;  4HNB A;  1EW0 A;  3CAX A;  2D02 A;  5TBM A;  2M1C A;  3NJA A;  1GSV A;  2QJ7 A;  2QHK A;  4LRZ E;  3OLO A;  3VE4 A;  2A24 A;  1P97 A;  1BYW A;  2V1B A;  1OTA A;  2PR5 A;  1S1Y A;  4KUO A;  5EFW A;  4HH2 A;  3C8C A;  3LI8 A;  2L4R A;  1XJ2 A;  5F69 A;  3P7N A;  4I38 A;  3E4P A;  4LRX C;  1DP8 A;  2ZBB A;  3RTY A;  3NHQ A;  2QWS A;  2V9A A;  4GHI A;  3MR0 A;  4HIA A;  3ICY A;  2PR6 A;  4HJ6 A;  4HI4 A;  3BWL A;  1JNU A;  3HJK A;  1OTB A;  4JGP A;  5G4Y A;  5F68 A;  3LIE A;  4MN6 A;  4HY8 A;  2ZOI A;  1LSW A;  2VEA A;  3LIB A;  1N9L A;  5HD3 A;  1WA9 A;  2B02 A;  1S4R A;  4EET B;  2VV7 A;  1Y28 A;  3LIC A;  4NXF A;  1TS7 A;  3B33 A;  4L9G A;  3CWF A;  5HDD A;  3KX0 X;  3H7W B;  1TS0 A;  4YWZ A;  3HJI A;  2VV8 A;  1DP9 A;  5HDC A;  3FG8 A;  5AVE A;  1TS8 A;  3F1P A;  1LL8 A;  4M4X A;  4I39 A;  4RQ9 A;  3K3D A;  1V9Z A;  2YKF A;  4HJ4 A;  4H6J B;  3UE6 A;  5HZH A;  1DP6 A;  2KDK A;  4LLO B;  4GW9 A;  5HWV A;  4EER A;  1UWN X;  3EWK A;  3UME A;  3IS2 B;  3CLO A;  5DJT A;  3GEC A;  4GCZ A;  2V0W A;  4F3L B;  3LI9 A;  1F98 A;  3C2W A;  3D72 A;  4HP9 A;  1P0Z A;  1XFN A;  4EEP A;  3NOU C;  5F6A A;  5IS1 A;  2VLG A;  3K3C A;  2V1A A;  3IBR A;  3H82 A;  1NWZ A;  4BBU A;  3G6O A;  4GS9 B;  3H9W A;  3BY9 A;  1UWP X;  3EEH A;  4L9F A;  3UB7 A;  4JGR A;  2INW A;  5TBM B;  4E04 A;  1N9N A;  2VV6 A;  3MJQ A;  4KQD A;  4HOI A;  3F1N B;  5A8B A;  2W0N A;  2Z6D A;  4DJ2 A;  3BY8 A;  1D06 A;  2GJ3 A;  3NOP C;  1LT0 A;  1XFQ A;  4WN5 A;  5AVF A;  2W27 A;  1DRM A;  1OTI A;  2WKP A;  2PYP A;  4EEU A;  1T1B A;  3LIA A;  1F9I A;  4NXB A;  1OTD A;  3GDI A;  3UB8 A;  4I3A A;  3H7W A;  2I9V A;  3E4O A;  4EW7 A;  4WL9 A;  4R70 A;  4R3A A;  4PKY A;  5J7E A;  4I3J A;  3ULF A; 
#chains in the Genus database with same CATH topology
 4BQM A;  4I5S A;  1KGE A;  1MWT A;  3BRM A;  2HDS A;  4BLM A;  5FDS A;  2OLV A;  3ZVW A;  3PR6 A;  3UB5 P;  3Q7Z A;  1O7E A;  2W3H A;  1NLZ A;  3CPT B;  2OWH A;  3A0S A;  4I3I A;  1C3B A;  1HLU P;  4ID4 A;  1BTL A;  3DTI A;  4KZ9 A;  3Q1F A;  1T1A A;  2VGL M;  5AQ7 A;  2QYB A;  4Q8I A;  3VP2 A;  5HAP A;  4Z9Q A;  4DN0 A;  2HZ5 A;  1RP5 A;  2Y2L A;  3M6B A;  2QZ6 A;  2G2U A;  3C4P A;  2OOL A;  5HD5 A;  3VV4 A;  3LYX A;  4DE3 A;  4FOF A;  5EOE A;  3KSI A;  2P9V B;  4EBN A;  3KYQ A;  3UPO A;  4JXW A;  1K56 A;  3GRJ A;  4QWO A;  4E3L A;  1XGJ A;  3UE0 A;  3LIF A;  4UEY A;  5DJU A;  4OOM A;  1OTE A;  2JE5 A;  1K6R A;  2PD8 A;  4Y5F A;  5GLD A;  2D01 A;  2Z6C A;  4GN2 A;  4JXS A;  4S2M A;  5CTM A;  2GZA A;  5L09 A;  3RFB A;  3W8K A;  3MQO A;  1ZTU A;  1MY8 A;  2P74 A;  1JTG A;  3MXR A;  4A5R A;  2A24 B;  1ERO A;  3CIT A;  3DTE A;  3V5M A;  1OT6 A;  5G4Z A;  1X0O A;  3O86 A;  2ZQ8 A;  3Q81 A;  3UPP A;  3QP8 A;  4OLG A;  2BAS A;  3S7O A;  5F83 A;  1OT9 A;  3MQQ A;  4WMC A;  5GHX A;  4X6T A;  5EM1 A;  4JKT A;  3ISG A;  4C6Y A;  2E8J A;  3VOZ A;  3UDX A;  1OJG A;  3MFD A;  1HTZ A;  1TDG A;  3CPT A;  3GTC A;  2Q0O A;  4HEF A;  1DJA A;  1YLJ A;  4IHQ A;  3T1R A;  1VET B;  2WK0 A;  4EUV A;  2PU2 A;  4KQQ A;  3NY4 A;  4S2P A;  5L2F A;  5DKK A;  3PBO A;  3EEA A;  1PWD A;  1GSX A;  4PKY G;  1YQS A;  2IWD A;  4NET A;  2WKQ A;  5GLB A;  5FI7 A;  2YKH A;  1PWG A;  2EWV A;  2P9V A;  1XJ4 A;  2W1T B;  2XA7 S;  3CG5 A;  3OC2 A;  4MBK A;  5K5B A;  3S7N A;  4DJ3 A;  1GSW A;  4S2J A;  2ZC5 B;  2K7S A;  1MZU A;  3IQA A;  1KGF A;  4OPY A;  4UA7 A;  1YLP A;  2Y2G A;  4NXG A;  4GZB A;  1J3W A;  3SH7 A;  3FWL A;  4LV2 A;  5FAO A;  5TBM A;  3WS5 A;  1S6R A;  5CHM A;  2Q9M A;  1CEG A;  3NCK A;  2QHK A;  4LRZ E;  2ZQA A;  2A24 A;  5HPI A;  1P97 A;  4U3T A;  2V1B A;  5KMW A;  4EUZ A;  1ESU A;  4R4R A;  1S1Y A;  5EFW A;  4X1M A;  4HH2 A;  2XFS A;  1BLP A;  1XJ2 A;  5E2E A;  3P7N A;  3E4P A;  4R3J A;  3TE8 A;  3UO9 A;  2V9A A;  2Z2L B;  2J3T C;  3MR0 A;  5E2F A;  4OPR A;  1W7F A;  3PAG A;  4QD4 A;  1E4D A;  3IXH A;  4MDZ A;  3HJK A;  1OTB A;  1YSP A;  1NRF A;  4JGP A;  3C7V A;  4R23 A;  2EX8 A;  3MZE A;  3ZNY A;  3LIE A;  4KEN B;  2WZZ A;  4S2N A;  1LSW A;  3GSG A;  2W3F A;  4RA7 A;  3HUN A;  5JYO A;  4WZ5 A;  1N9L A;  1W63 M;  3HVF A;  1S4R A;  5EM0 A;  4Z1W A;  3S1Y A;  4JXV A;  3CWF A;  4CJN A;  3EGX C;  4KQR A;  4LV3 A;  3T4T A;  3KX0 X;  2O99 A;  3GMW A;  3IX8 A;  4L0L A;  1SCW A;  2VV8 A;  3BYD A;  4NG2 A;  2W1T A;  3A3I A;  1CI8 A;  1DP9 A;  3AGF A;  5AQ9 A;  1EWZ A;  4R0Q A;  2EWW A;  1LL8 A;  4M4X A;  1K6S A;  4ZDX A;  4MNR A;  1PWC A;  2YKF A;  1SZV A;  3E2L A;  4H6J B;  2J3W A;  1BLC A;  2IA2 A;  2B5R A;  4LLO B;  1YT4 A;  3HUM A;  3QP6 A;  3ZNT A;  1K57 A;  2XH9 A;  3EWK A;  2BTF P;  1VM1 A;  3IS2 B;  2Y2N A;  3A3D A;  3CLO A;  3ITB A;  4GCZ A;  3LI9 A;  4DDS A;  5CED A;  1GA0 A;  5FI2 A;  1GHM A;  3VP3 A;  3V39 A;  1P0Z A;  1XFN A;  1JWV A;  2UV0 E;  4EEP A;  1PIO A;  5IS1 A;  3IXB A;  3MS6 A;  3O5Y A;  3K3C A;  4CLC C;  2XK1 A;  3H82 A;  1ERQ A;  2EFX A;  4GS9 B;  4PMA A;  3S7Q A;  3SOI A;  2WKI A;  5LBR A;  4IVK A;  4MMN A;  2I72 A;  3D9Y A;  2J3T D;  4GJ4 A;  1N9N A;  4EWF A;  1ONG A;  1W8Q A;  3T12 B;  5FQJ A;  5A8B A;  2Z6D A;  1E3U A;  3JVV A;  4KZ3 A;  3TG9 A;  4DJ2 A;  4N92 A;  2HGV A;  2ZQ9 A;  1K4F A;  4MEZ A;  1LT0 A;  4KZ7 A;  1OPX A;  3ZG7 B;  4WN5 A;  4OP8 A;  2AVX A;  2WKP A;  2PYP A;  4XXR A;  2OAP 1;  3LIA A;  4ZJ2 A;  5DTS A;  1P9W A;  1F9I A;  2V20 A;  4ETX A;  3GDI A;  3UB8 A;  2I9V A;  2WGV A;  1XA1 A;  4FSF A;  3WS2 A;  3IWQ A;  2O9B A;  4PKY A;  4FD8 A;  5DVA A;  3ZDJ A;  2QKP A;  3P98 A;  5CX7 A;  1L0E A;  3DAV A;  4N1X A;  3OPH A;  4X53 A;  4H6J A;  2HJ9 C;  4EES A;  4H8R A;  1L0F A;  3PBN A;  4FH2 A;  3ZCZ A;  5HWT A;  3IS2 A;  5I5L A;  3D4F A;  1S67 L;  5FQI A;  2PHY A;  5HFO A;  4Y13 A;  2ZLY A;  3HUO A;  4IBX A;  2LB5 A;  1G68 A;  3HLW A;  3LY3 A;  2RCX A;  1K56 D;  1ZG4 A;  1T18 A;  3AGE A;  3F1O B;  1PI5 A;  4YOF A;  4OVD A;  3B3X A;  3UE3 A;  3KSG A;  1Z09 A;  1PFL A;  3RJU A;  3PHY A;  1L2S A;  2O0Y A;  2PDR A;  4JLF A;  3NEC A;  3A3F A;  1BUE A;  4GS9 A;  4CLC D;  3HLD A;  4CLC E;  4E3M A;  4C75 A;  3KO6 A;  2JHE A;  3VP0 A;  1EI5 A;  4BBV A;  1LSX A;  3O88 A;  2XR0 A;  1P9R A;  1ZC2 A;  2IWC A;  4BBT A;  2WAD A;  4GB7 A;  2ZOH A;  4JGO A;  3MQ0 A;  3D3O A;  4UQI S;  2JKT M;  3KSH A;  5A91 A;  4IVI A;  4MLL A;  3G2Z A;  4B4X A;  4LCM A;  2H5S A;  3WS1 A;  4Q0J A;  4ARZ B;  4QPR A;  3T50 A;  3SH9 A;  2OSU A;  3IH9 A;  4WMC D;  4BL3 A;  1GHP A;  5TFQ A;  3ZQ5 A;  2WAE A;  2VZW A;  3T4O A;  1LL9 A;  4UA6 A;  5AJG A;  4Q0H A;  3C7U A;  2XDM A;  4GHI B;  3UE1 A;  4U0X A;  3VFF A;  3IT9 A;  4DXC A;  3QP2 A;  4S2N C;  5DTT A;  2ZMV A;  4WZ5 C;  1YAX A;  2NUP C;  2FFY A;  2QPN A;  1FSY A;  1G28 A;  4WEJ A;  1HVB A;  4Q0I A;  4B9O A;  3BM6 A;  3G35 A;  1K55 A;  4PM7 A;  1PI4 A;  1IKG A;  1GA9 A;  4HBT A;  3VE3 A;  3EQU A;  4AFI A;  2ZC4 B;  4R1G A;  3OPP A;  1D1J A;  4OON A;  4F94 A;  3UNW A;  3NC8 A;  2XEP A;  3TJZ C;  3F1O A;  3OZH A;  3CUE A;  2R78 A;  4PHT A;  3UY6 A;  5EVI A;  1ES2 A;  5EEC A;  3LCE A;  3UB9 A;  1YKD A;  4UAA A;  2BG1 A;  5JYP A;  1FQG A;  4BD0 A;  2Y8H A;  1FCO A;  3RH8 B;  2JN7 A;  3WRT A;  4OOL A;  3OOV A;  1SDN A;  3SS3 A;  4E6X A;  3VOL A;  3MFX A;  5I94 A;  3DBA A;  4BL2 A;  1EW0 A;  3OCL A;  4N9K A;  1N4O A;  2ZM8 A;  1ES4 A;  3NJA A;  1GSV A;  4XUX A;  3HCY A;  1XKZ A;  5KZH A;  4ARZ A;  2GX5 A;  2PR5 A;  1IYS A;  4KG2 A;  3CHW P;  1H8Y A;  2L4R A;  3WRZ A;  3CI6 A;  2Y4A A;  4MBF A;  1DP8 A;  3C38 A;  3N7W A;  3NHQ A;  4GHI A;  4PM5 A;  3M6H A;  3ICY A;  4DRT A;  3MMH A;  3CZD A;  4QU3 A;  1WE4 A;  4PPR A;  5EPH A;  1JNU A;  2ZMA A;  1SDE A;  4OOY A;  2FFF B;  5DFY A;  2H0Y A;  2J9O A;  1QME A;  5AQA A;  4ESP A;  1W63 Q;  4MN6 A;  4JF5 A;  3LIB A;  1VEU B;  3SH8 A;  2O9A A;  2IWB A;  3T4K A;  1WA9 A;  2R9W A;  4EET B;  4DMZ A;  1J9M A;  3WS0 A;  4IJG A;  3LGO A;  4YNR A;  1K38 A;  3Q7V B;  5EOO A;  1N9B A;  1YLZ A;  3B33 A;  4L9G A;  5CGX A;  3VOY A;  5L07 A;  5HDD A;  4CPK A;  5GL9 A;  3KSF A;  3S22 A;  2WKH A;  3RXW A;  3HJI A;  4S2K A;  5HL6 A;  4GKU A;  3BFD A;  5AVE A;  1H3Q A;  1YLY A;  1TS8 A;  3W2Z A;  4I39 A;  1U60 A;  4HJ4 A;  4WM9 A;  2E8I A;  5HZH A;  3KYZ A;  1DP6 A;  4PAU A;  2KDK A;  4GW9 A;  5HWV A;  1K54 A;  4E3K A;  2ZQ7 A;  2XQZ A;  3UME A;  3HLG A;  4BD1 A;  2PBD P;  2UWX A;  4R4S A;  2J8Y A;  4II7 A;  2V0W A;  4F3L B;  5CGS A;  1NXY A;  1F98 A;  5TGF A;  3C2W A;  4HP9 A;  3U2A A;  3SZT A;  3KYE A;  5F6A A;  2Y2I A;  2VGK A;  1L0G A;  2V1A A;  5GHZ A;  2JKR I;  4FTX A;  5EV0 A;  5FQM A;  2BLS A;  4BBU A;  2JBF A;  3IXG A;  3LEQ A;  3MSH A;  4E3O A;  3G6O A;  3BY9 A;  2PRF A;  4DXB A;  3EEH A;  4PM9 A;  3K2N A;  4JGR A;  4MN7 A;  2DNS A;  1MKM A;  3GVB A;  4Y15 A;  2K2N A;  3IWO A;  4LGW A;  3EQV A;  4DE2 A;  1E3U D;  4E04 A;  2H0T A;  2Y55 A;  4LV1 A;  4B4Z A;  1PNE A;  1K25 A;  5FAP A;  1DJC A;  4HOI A;  3C4O A;  3U4L P;  4KZB A;  4UQI M;  3T4Q A;  5M18 A;  1D06 A;  1NY0 A;  4BWI A;  1MKI A;  3VSK A;  1XFQ A;  2W3D A;  5AVF A;  3Q82 A;  2Y2J A;  1DRM A;  3ZG5 A;  3HBR A;  1CQA A;  3HLC A;  1LHY A;  3BQA A;  3Q7V A;  5HAQ A;  1VET A;  2P04 A;  5FDH A;  3W4Q A;  4UA9 A;  3HRE A;  1WYB A;  4U0T A;  4I3A A;  1Y4O A;  3TOI A;  3E4O A;  1XGI A;  4JBF A;  3BQ8 A;  4S2I A;  4WL9 A;  5FAQ A;  1BUL A;  5FQK A;  1FOF A;  4IUH A;  4E3N A;  4HHD A;  5HWW A;  3VP4 A;  2JKF A;  1LI9 A;  1K55 C;  3JVU A;  1V9Y A;  1JWZ A;  1OJ5 A;  1W5D A;  4L9E A;  1O07 A;  2V0U A;  5HDS A;  3CUE C;  3FKV A;  2PYR A;  4OPZ A;  4XT2 B;  1ODV A;  3E4Q A;  5HSQ A;  2OAQ 1;  4WUJ A;  5EVI C;  4X25 A;  4WLA A;  3LUQ A;  2WYX A;  4F3L A;  2C5W B;  5FEF A;  1PRQ A;  5E43 A;  3JPU A;  4ME4 A;  4K0X A;  4HQA A;  3N6I A;  3DWZ A;  4EBP A;  2EXB A;  1MC0 A;  2HDU A;  3T1X A;  1NZO A;  1IEL A;  3L9K A;  3O3V A;  3IF6 B;  3IX4 A;  1ESI A;  1JWP A;  2V8C A;  5IHV A;  4PM6 A;  1TD5 A;  3CJM A;  2ZM0 A;  2GNX A;  3QP1 A;  2Y2O A;  1SHV A;  4Y7P A;  3IH8 A;  4EQ1 A;  3S4X A;  2VGJ A;  3NDG A;  4MCW A;  1MWU A;  4E6W A;  4UHU A;  2X01 A;  3QNB A;  4GD8 A;  1MPL A;  3N4I A;  1KE0 A;  1FR6 A;  3ZVT A;  3HLF A;  1KOU A;  1PZP A;  1ZG6 A;  2WAF A;  5EE8 A;  2WKR A;  5FL3 A;  2B95 A;  3LR5 A;  3PBS A;  4G3V A;  3VFH A;  5HL1 A;  3A0R A;  3NOT C;  2CMN A;  4KUK A;  2CC1 A;  3UB6 A;  2V8F A;  2J80 A;  1YMX A;  4QY5 A;  4KZ6 A;  3BEB A;  2VKS A;  4OQ0 A;  1H8Z A;  2HF6 A;  1Q2P A;  5J3W A;  2P08 A;  3VP1 A;  1RGZ A;  4XT2 A;  4P0M A;  3ZG8 B;  1XJ6 A;  3G32 A;  1TS6 A;  3OPR A;  5CHJ A;  5EVI D;  2A49 A;  3E98 A;  2HPB A;  3SS4 A;  3P01 A;  2L1M A;  5DTK A;  2H28 A;  4HH3 A;  4X69 A;  1W8Y A;  2X71 A;  3V50 A;  1ALQ A;  5FEG A;  3FC7 A;  3C30 A;  3MXQ A;  3QHY A;  3LR4 A;  1YLT A;  2Y2Q A;  3BFF A;  3TSG A;  3A0V A;  4QY6 A;  4YIN A;  2XRN A;  3IF6 A;  4JGQ A;  4S2O A;  1IFQ A;  3F1P B;  1YPR A;  4X55 A;  1H8M A;  1ERM A;  1FR1 A;  4LRY C;  2XA7 M;  1TF1 A;  2XF3 A;  1NLY A;  4EV4 A;  1RCJ A;  1I2W A;  4HP4 A;  3A3E A;  2HJE A;  2QJ5 A;  3N8S A;  4HNB A;  1XA7 A;  3NI9 A;  3PBT A;  3Q07 A;  3O87 A;  2ZQD A;  4N9L A;  2M1C A;  4P6B A;  3LFV A;  4DKI A;  3SS5 A;  2Y2M A;  5C5K A;  3UN7 A;  3NUL A;  1F2K A;  3CMZ A;  3OLO A;  3VE4 A;  5U47 A;  1BYW A;  4C3Q A;  3MKF A;  5TR7 A;  1OTA A;  2MJ6 A;  2J9P A;  3C8C A;  4X68 A;  4EBL A;  4OQH A;  4CLC B;  4LRX C;  1S0W A;  3C5A A;  2QWS A;  3N8L A;  1XXM A;  2PR6 A;  4HJ6 A;  4HI4 A;  2QMI A;  3UDF A;  1DJB A;  5G4Y A;  1F5M A;  3BEC A;  4HY8 A;  2ZOI A;  4Y0U A;  3FPW A;  4RVA A;  1AXB A;  2V2F F;  4ZAM A;  3DW0 A;  1SKF A;  2FZ0 A;  1E25 A;  2B02 A;  2VV7 A;  2WGI A;  1Y28 A;  1LLB A;  2G2W A;  1STZ A;  5J8X A;  2ZD8 A;  3LIC A;  4NXF A;  5DF9 A;  3LR3 A;  3ZFZ A;  1GCE A;  1TS0 A;  3H7W B;  4ZTK A;  4O01 A;  4P6Z S;  2EX2 A;  4E3I A;  1KDS A;  1BT5 A;  3F1P A;  1M6K A;  1PYY A;  2Y2K A;  3PBQ A;  3K3D A;  5CEC A;  5HAI A;  4WBG A;  1V9Z A;  4IUK A;  1K57 C;  4GDB A;  5G18 A;  5L8M A;  1ES3 A;  2XSS A;  5DJT A;  2R9X A;  4JPM A;  2HP9 A;  4X56 A;  3R4K A;  1MWS A;  3OPL A;  5FI6 A;  3M2K A;  4QJG A;  1IYO A;  1FIK A;  3D72 A;  3T1S A;  5CER A;  3NOU C;  3G4P A;  2VLG A;  3P09 A;  4WYY A;  5DF8 A;  1FCM A;  3ZGA B;  1NWZ A;  1CEF A;  4GD6 A;  2ZC3 B;  5GLA A;  1PW1 A;  3NDE A;  4CLC A;  1UWP X;  4L9F A;  3UB7 A;  1TDL A;  3TRC A;  3V3R A;  5HPF A;  1MBL A;  4E3J A;  1QMF A;  4KG6 A;  5TBM B;  4JXG A;  3A3J A;  3ZHH A;  2VV6 A;  5KSH A;  2ZC7 A;  1OME A;  4B93 A;  4JF6 A;  3F1N B;  4DF6 A;  4D60 A;  1K4E A;  1RGY A;  1WYC A;  3BJN A;  3BLM A;  2PBY A;  3IF5 A;  3DTM A;  3NOP C;  1FSW A;  2W3E A;  2W27 A;  1OTI A;  4EEU A;  1T1B A;  3AGD A;  3N8R A;  2WKE A;  4NXB A;  1OTD A;  4M3K A;  3T4J A;  1MXO A;  3H7W A;  4WEL A;  2ZJ9 A;  4R70 A;  3PBR A;  4R3A A;  5TJJ A;  3IWI A;  4D2O A;  5J7E A;  1NYY A;  1LL5 A;  3M2J A;  5E2G A;  4O0P A;  2ZC6 B;  3GR2 A;  4FCF A;  1BLS A;  2WGW B;  2VK3 A;  2A2L A;  5A90 A;  3LR0 A;  4HBU A;  4EXO A;  4WZ4 A;  4P85 A;  1HD8 A;  2HDR A;  2C6W B;  1CF0 A;  4GLQ A;  3LY4 A;  1G5U A;  4QHC A;  3IF6 C;  3T4S A;  2WUQ A;  4OQI A;  5FQQ A;  4R3B A;  1GHI A;  2Y91 A;  1L3L A;  5CRF A;  5DF7 A;  3FZC A;  2GDN A;  3QP5 A;  3EGD C;  3PXP A;  5FSR A;  2G7U A;  2ZMF A;  3G31 A;  4ETZ A;  2EA9 A;  2OLU A;  4HES A;  1IYQ A;  4R38 A;  4OP5 A;  4Y17 A;  3DWK A;  1YMS A;  5CXW A;  1KVL A;  5CEB A;  3LO7 A;  3E2K A;  1D7E A;  3G30 A;  2XD5 A;  4MN5 A;  4OH0 A;  4LPZ A;  2PD7 A;  5DFX A;  5AQB A;  4EQI A;  1KE3 A;  4YFM A;  1T19 A;  1IKI A;  5J4E A;  3I7J A;  5FAS A;  3F1N A;  5KSC A;  1NRJ A;  1YSQ A;  3QP4 A;  5FAT A;  1LI0 A;  2KX6 A;  1LSV A;  3H82 B;  2FH5 A;  3MZD A;  3PYP A;  5F5Y A;  3ITA A;  5EUA A;  4KZ8 A;  1UGU A;  2M7V A;  4QB8 A;  3SW1 A;  2EX9 A;  1YLW A;  2PT7 A;  1VEU A;  4N1H A;  5DKL A;  4MBH A;  5KIZ A;  4PM8 A;  3S7P A;  2RL3 A;  4NK3 A;  2K31 A;  1VB6 A;  1VHM A;  3LID A;  1L0D A;  5CHU A;  2VX8 A;  4ZRR A;  4FUW A;  1N9O A;  1ZKJ A;  2W1R A;  5F82 A;  5FQ9 A;  3VSL A;  2J7V A;  2WGW A;  1S4S A;  3NBL A;  2L0W A;  3WWX A;  5GLC A;  2DCF A;  1DY6 A;  3T1Q B;  2A3U A;  4HJ3 A;  1JTD A;  2JC7 A;  1NYM A;  3WS4 A;  5HW3 A;  5EVL A;  2VGL S;  2Y79 A;  4LCL A;  1AWI A;  3IHA A;  2HV1 A;  4BEN A;  4CQH A;  1CJF A;  4WF0 A;  2OWJ A;  4B88 A;  3GV9 A;  2P7J A;  2XLN A;  4K08 A;  3UMD A;  2HP6 A;  1S66 L;  5IU1 A;  4OQG A;  4RX2 A;  3MXS A;  2JKT I;  3HLB A;  3G2Y A;  4P6Z M;  5E2H A;  1PW8 A;  1XJ3 A;  5CGW A;  1Q2Q A;  3FKW A;  5IT5 A;  1PZO A;  2EXA A;  1S1Z A;  2ZL1 B;  3HL9 A;  3T4L A;  3VMA A;  2H10 A;  2EFU A;  4NXE A;  1I5Q A;  4LEN A;  3E0Y A;  2M7U A;  1T1C A;  4R6L A;  4JF4 A;  4Y0O A;  1KVM A;  3CAX A;  5M1A A;  2D02 A;  2DRW A;  1CK3 A;  1ZHH B;  4DDY A;  5EVE A;  3B42 A;  4K0W A;  4KZA A;  2QJ7 A;  1A0K A;  1XP4 A;  1KGG A;  4Y0T A;  1IOU A;  4OKP A;  2LB9 A;  4DE1 A;  1TEM A;  4KUO A;  3BLS A;  3LI8 A;  4BMW A;  2Q9N A;  2XGN A;  5F69 A;  2NUT C;  4ZBE A;  2Y2H A;  4I38 A;  2JCH A;  2KOI A;  2ZBB A;  3W4P A;  4IED A;  3RTY A;  4FH4 A;  3BFE A;  1G6A A;  4HIA A;  3QNC A;  4S2L A;  1ES5 A;  2KLI A;  3BWL A;  1K0K A;  4Y2F A;  4KQO A;  3ZG0 A;  2O9C A;  3MZF A;  4G3W A;  3UPN A;  3G34 A;  4GNU A;  2W3G A;  5HAR A;  4ZJ3 A;  2JKR M;  5F68 A;  4O8G A;  1W79 A;  3JYI A;  4BJP A;  3B47 A;  2VEA A;  5HX9 A;  1HZO A;  3BFC A;  2ACG A;  3IHB A;  3MF0 A;  5HD3 A;  2ZM2 A;  3OBF A;  5L10 A;  1TS7 A;  1SKO B;  4G3K A;  2B18 A;  4KG5 A;  1ACF A;  3R7W B;  4LFU A;  1TVF A;  2XD1 A;  4YWZ A;  1KDW A;  3NIA A;  3BFG A;  5HDC A;  4ZJ1 A;  3FG8 A;  2Y59 A;  1MWR A;  4GOG A;  3DTK A;  2HDQ A;  1CI9 A;  1VQQ A;  5GHY A;  2ZL1 A;  5BOH A;  4RQ9 A;  1K54 C;  1Y54 A;  3RXX A;  2JKG A;  1BZA A;  3UE6 A;  4NKP A;  4GDN A;  4EER A;  5M19 A;  3V67 A;  1G6O A;  1UWN X;  2PAV P;  3FYZ A;  1JVJ A;  2OV5 A;  2ZQC A;  2XFT A;  3GEC A;  4OPQ A;  3UDI A;  2HP5 A;  2VJW A;  4P87 A;  1XPB A;  5CTN A;  5EVI B;  1IYP A;  1FCN A;  4K91 A;  5FA7 A;  3OCN A;  1H5X A;  3IBR A;  3L7H A;  1Z6F A;  4X1L A;  4IBR A;  3W4O A;  1IEM A;  3MKE A;  1NJ4 A;  1ONH A;  3H9W A;  1BSG A;  2V1Z A;  3IBJ A;  1I2S A;  1H0M A;  2PU4 A;  2X02 A;  4EU0 A;  4Y3I A;  2INW A;  1YM1 A;  3ZYT A;  4RX3 A;  2Y2P A;  3ZG9 B;  3FV7 A;  2Z2M B;  3MJQ A;  4XUZ A;  1M40 A;  4KQD A;  5A92 A;  5A93 A;  4RYE A;  2W0N A;  3PAE A;  3BY8 A;  3LEZ A;  1NZU A;  1XX2 A;  2GJ3 A;  3FPV A;  1FIL A;  3HLE A;  3IX3 A;  1BLH A;  2VA0 A;  3TW8 A;  2DMW A;  3MBZ A;  4KZ4 A;  3V3S A;  1SKO A;  2EX6 A;  5F1G A;  4NEE D;  3EOI A;  2WZX A;  2XRO A;  4WEK A;  3PTE A;  4KZ5 A;  3R7W A;  5MC7 A;  5F1F A;  4O7D A;  4EW7 A;  5D3O A;  3BW6 A;  4OLD A;  4LV0 A;  1KE4 A;  4I3J A;  4DE0 A;  3GQZ A;  3ULF A;  3IXD A; 
#chains in the Genus database with same CATH homology
 4HHD A;  5HWW A;  4I5S A;  4O0P A;  2QKP A;  5CX7 A;  3JVU A;  1V9Y A;  1OJ5 A;  3PR6 A;  2HJ9 C;  4H6J A;  4EES A;  4L9E A;  2A2L A;  2W3H A;  1NLZ A;  2V0U A;  3LR0 A;  5HDS A;  2OWH A;  3PBN A;  3A0S A;  4EXO A;  3CUE C;  4I3I A;  2PYR A;  4XT2 B;  1ODV A;  3E4Q A;  3IS2 A;  5HWT A;  5I5L A;  5HSQ A;  2OAQ 1;  4WUJ A;  1S67 L;  1T1A A;  2PHY A;  4WLA A;  2VGL M;  2QYB A;  4GLQ A;  3LUQ A;  4F3L A;  4DN0 A;  3T4S A;  2LB5 A;  1T18 A;  2OOL A;  3F1O B;  5HD5 A;  4ME4 A;  3VV4 A;  3LYX A;  4YOF A;  4HQA A;  3EGD C;  4FOF A;  3UE3 A;  3KSI A;  3PXP A;  3KSG A;  2G7U A;  2ZMF A;  4ETZ A;  1MC0 A;  3KYQ A;  2EA9 A;  3PHY A;  2O0Y A;  2PDR A;  4R38 A;  4GS9 A;  3LIF A;  4CLC D;  4UEY A;  5DJU A;  4OOM A;  1OTE A;  1TD5 A;  4CLC E;  2GNX A;  3KO6 A;  2JHE A;  2PD8 A;  4Y5F A;  4BBV A;  1D7E A;  4MN5 A;  1LSX A;  2D01 A;  2Z6C A;  4EQ1 A;  4LPZ A;  2PD7 A;  5DFX A;  1P9R A;  2GZA A;  4BBT A;  3RFB A;  1T19 A;  5J4E A;  4MCW A;  2ZOH A;  4JGO A;  3MQ0 A;  3D3O A;  3F1N A;  4UQI S;  3MQO A;  2JKT M;  1NRJ A;  1YSQ A;  3KSH A;  1ZTU A;  2KX6 A;  1LSV A;  3H82 B;  2FH5 A;  3PYP A;  5F5Y A;  1UGU A;  2M7V A;  2A24 B;  3CIT A;  4Q0J A;  3SW1 A;  4ARZ B;  2PT7 A;  1OT6 A;  4QPR A;  5DKL A;  5G4Z A;  3T50 A;  5KIZ A;  1KOU A;  1X0O A;  2WKR A;  5FL3 A;  3S7P A;  3LR5 A;  3ZQ5 A;  2VZW A;  3PBS A;  2K31 A;  4G3V A;  3T4O A;  1VB6 A;  5AJG A;  3A0R A;  1VHM A;  4Q0H A;  2BAS A;  3S7O A;  4GHI B;  3LID A;  1OT9 A;  3MQQ A;  3NOT C;  2CMN A;  2VX8 A;  4KUK A;  4ZRR A;  2ZMV A;  1N9O A;  3UB6 A;  2W1R A;  2J80 A;  1YAX A;  2NUP C;  1S4S A;  1OJG A;  2VKS A;  2L0W A;  1G28 A;  4WEJ A;  2HF6 A;  5J3W A;  2P08 A;  4HJ3 A;  4Q0I A;  4B9O A;  4XT2 A;  2VGL S;  4IHQ A;  1XJ6 A;  2Y79 A;  1TS6 A;  3VE3 A;  3EQU A;  4AFI A;  2HV1 A;  4CQH A;  3E98 A;  3P01 A;  5DKK A;  2L1M A;  3PBO A;  3EEA A;  4WF0 A;  3TJZ C;  1GSX A;  2H28 A;  3F1O A;  4HH3 A;  3CUE A;  2OWJ A;  2R78 A;  2P7J A;  4PKY G;  4PHT A;  4K08 A;  3UMD A;  1S66 L;  2WKQ A;  5IU1 A;  3FC7 A;  2YKH A;  3C30 A;  2EWV A;  3MXQ A;  1XJ4 A;  3LR4 A;  2W1T B;  2JKT I;  2XA7 S;  3OC2 A;  3A0V A;  4P6Z M;  2XRN A;  1XJ3 A;  3UB9 A;  4JGQ A;  1IFQ A;  5IT5 A;  5K5B A;  1YKD A;  3F1P B;  3S7N A;  4DJ3 A;  1H8M A;  1S1Z A;  2Y8H A;  3T4L A;  1GSW A;  4LRY C;  2XA7 M;  1TF1 A;  1NLY A;  4NXE A;  2K7S A;  1MZU A;  3RH8 B;  2JN7 A;  3E0Y A;  4OOL A;  4HP4 A;  3OOV A;  2M7U A;  2HJE A;  1T1C A;  4R6L A;  2QJ5 A;  3VOL A;  3MFX A;  4NXG A;  4HNB A;  3DBA A;  1EW0 A;  3CAX A;  3PBT A;  3OCL A;  2D02 A;  5TBM A;  1ZHH B;  2M1C A;  3NJA A;  3B42 A;  3LFV A;  1GSV A;  5C5K A;  2QJ7 A;  3HCY A;  2QHK A;  4LRZ E;  3OLO A;  3VE4 A;  1IOU A;  2A24 A;  5HPI A;  1P97 A;  1BYW A;  2V1B A;  4ARZ A;  2GX5 A;  2LB9 A;  1OTA A;  2PR5 A;  1S1Y A;  2MJ6 A;  4KUO A;  5EFW A;  4HH2 A;  3C8C A;  3LI8 A;  2L4R A;  1XJ2 A;  4BMW A;  5F69 A;  2NUT C;  3CI6 A;  3P7N A;  4CLC B;  4I38 A;  3E4P A;  4LRX C;  1DP8 A;  2KOI A;  3TE8 A;  2ZBB A;  3C38 A;  3RTY A;  3NHQ A;  2QWS A;  2V9A A;  4GHI A;  2J3T C;  3MR0 A;  4HIA A;  3ICY A;  2PR6 A;  3MMH A;  2KLI A;  4HJ6 A;  4HI4 A;  3BWL A;  4Y2F A;  4KQO A;  4MDZ A;  2O9C A;  1JNU A;  3HJK A;  1OTB A;  1YSP A;  4G3W A;  4JGP A;  2W3G A;  5G4Y A;  1F5M A;  2JKR M;  5F68 A;  5DFY A;  4O8G A;  3LIE A;  1W63 Q;  4MN6 A;  4HY8 A;  2ZOI A;  4BJP A;  3FPW A;  1LSW A;  3B47 A;  2VEA A;  3LIB A;  2O9A A;  2W3F A;  2FZ0 A;  3MF0 A;  1N9L A;  3T4K A;  5HD3 A;  1WA9 A;  1W63 M;  2B02 A;  1S4R A;  4DMZ A;  2VV7 A;  4EET B;  4IJG A;  1Y28 A;  1STZ A;  3OBF A;  4YNR A;  4Z1W A;  3LIC A;  4NXF A;  1TS7 A;  3B33 A;  4L9G A;  3CWF A;  2B18 A;  4G3K A;  5HDD A;  3EGX C;  5DF9 A;  3KSF A;  3LR3 A;  3R7W B;  3KX0 X;  2O99 A;  3T4T A;  3H7W B;  1TS0 A;  4L0L A;  4YWZ A;  3HJI A;  2VV8 A;  4O01 A;  4P6Z S;  5HL6 A;  2W1T A;  1DP9 A;  5HDC A;  3FG8 A;  5AVE A;  1H3Q A;  2EWW A;  1TS8 A;  3W2Z A;  3F1P A;  1LL8 A;  4M4X A;  4I39 A;  3PBQ A;  3K3D A;  4RQ9 A;  1V9Z A;  2YKF A;  4HJ4 A;  4IUK A;  4H6J B;  3UE6 A;  5HZH A;  3KYZ A;  1DP6 A;  2J3W A;  4PAU A;  4NKP A;  2KDK A;  2IA2 A;  4LLO B;  4GW9 A;  5HWV A;  4EER A;  3V67 A;  1G6O A;  1UWN X;  5L8M A;  3EWK A;  3UME A;  3IS2 B;  2XSS A;  3CLO A;  5DJT A;  3GEC A;  4GCZ A;  4II7 A;  2V0W A;  4F3L B;  3R4K A;  3LI9 A;  2VJW A;  1F98 A;  3C2W A;  3D72 A;  4HP9 A;  1P0Z A;  1XFN A;  3U2A A;  4EEP A;  3NOU C;  5F6A A;  5IS1 A;  2VLG A;  3O5Y A;  3K3C A;  3OCN A;  2V1A A;  2JKR I;  3IBR A;  4CLC C;  3H82 A;  1NWZ A;  4BBU A;  3G6O A;  4GS9 B;  3H9W A;  3BY9 A;  4CLC A;  1UWP X;  3EEH A;  4L9F A;  3S7Q A;  3IBJ A;  3UB7 A;  3K2N A;  3TRC A;  4JGR A;  5LBR A;  4MN7 A;  5HPF A;  4MMN A;  1MKM A;  4EU0 A;  4Y3I A;  2K2N A;  2INW A;  5TBM B;  3EQV A;  2J3T D;  3ZYT A;  4E04 A;  4GJ4 A;  1N9N A;  2VV6 A;  5KSH A;  3MJQ A;  4B93 A;  4KQD A;  4HOI A;  3F1N B;  5A8B A;  2W0N A;  2Z6D A;  3JVV A;  4UQI M;  3T4Q A;  3BJN A;  4DJ2 A;  3BY8 A;  1D06 A;  2HGV A;  4BWI A;  2GJ3 A;  3FPV A;  3NOP C;  1LT0 A;  1XFQ A;  1OPX A;  2W3D A;  4WN5 A;  2W3E A;  5AVF A;  2W27 A;  1DRM A;  1OTI A;  2WKP A;  2PYP A;  2VA0 A;  4EEU A;  3TW8 A;  1T1B A;  2OAP 1;  3LIA A;  3BQA A;  2DMW A;  1P9W A;  1F9I A;  2P04 A;  4ETX A;  4NEE D;  3EOI A;  4NXB A;  1OTD A;  3GDI A;  2XRO A;  4WEK A;  3R7W A;  3T4J A;  4I3A A;  3UB8 A;  5MC7 A;  3H7W A;  2I9V A;  3E4O A;  4WEL A;  4FSF A;  4EW7 A;  3BW6 A;  3BQ8 A;  4WL9 A;  4R70 A;  3PBR A;  4R3A A;  5TJJ A;  2O9B A;  4PKY A;  5J7E A;  4I3J A;  4IUH A;  3ULF A;  4EUV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...