1BYWA

Structure of the n-terminal domain of the human-erg potassium channel
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
110
structure length
110
Chain Sequence
SRKFIIANARVENCAVIYCNDGFCELCGYSRAEVMQRPCTCDFLHGPCTQRRAAAQIAQALLGAEERKVEIAFYRKDGSCFLCLVDVVPVKNEDGAVIMFILNFEVVMEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (HUMAN ERG POTASSIUM CHANNEL)
publication title Crystal Structure and Functional Analysis of the Herg Potassium Channel N-Terminus: A Eukaryotic Pas Domain
pubmed doi rcsb
source organism Homo sapiens
molecule tags Membrane protein
total genus 27
structure length 110
sequence length 110
ec nomenclature
pdb deposition date 1998-10-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13426 PAS_9 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 1bywA00
2QJ5A 4I3JA 5HDSA 1UGUA 3FC7A 4LPZA 1D7EA 1KOUA 3LI9A 3A0SA 1S66L 2GJ3A 3RTYA 4EEPA 5F68A 4GS9A 1OTDA 2WKRA 3PHYA 4PKYG 2Z6CA 3B33A 3RH8B 1T19A 4LRZE 3ZQ5A 3E4QA 4BBUA 5AVEA 2V0UA 1XFQA 3KX0X 3MQOA 2I9VA 2ZOIA 4NXFA 4KUKA 5F6AA 4NXGA 4R6LA 4I5SA 3BY9A 1T1AA 2PD7A 3IS2B 4EQ1A 3CAXA 4HNBA 3HJKA 3IS2A 1XJ4A 1LSXA 2Z6DA 1Y28A 2VV7A 2B02A 2PR6A 1S1YA 1TS0A 3NOPC 3PYPA 4NXEA 3BWLA 3VOLA 2VV6A 5HWTA 1TS6A 3VE3A 4H6JB 1BYWA 3UB8A 4H6JA 3A0RA 2L4RA 1N9LA 4YWZA 4K08A 1TS8A 5G4YA 2W27A 4GCZA 2EA9A 3ULFA 1XJ6A 2PHYA 4EETB 4HJ4A 1N9OA 2D01A 4R38A 1UWPX 5F69A 5IS1A 5HD5A 2VV8A 3MQQA 2KX6A 3UB7A 5EFWA 3UB9A 3FG8A 5IU1A 1XFNA 3LIAA 3GDIA 4GS9B 4LRXC 2BASA 3D72A 3HJIA 4HQAA 3UMDA 1OTIA 1VB6A 3LUQA 4JGQA 3CLOA 3LIDA 3CWFA 1DP9A 1UWNX 2YKHA 3LIFA 1OT6A 1MZUA 2J80A 3EEHA 3OLOA 3NJAA 5DJUA 1DP8A 2CMNA 2ZBBA 3NHQA 1DP6A 1T18A 4HOIA 2A24B 1GSXA 2OWJA 4XT2B 4I39A 2A24A 5I5LA 4XT2A 2V0WA 5DKLA 4JGOA 1LL8A 3EWKA 1S1ZA 2M1CA 2PYRA 3H9WA 3P7NA 3K3CA 4HH3A 3UB6A 3E4PA 2INWA 2KDKA 1OTBA 1T1BA 4LLOB 4HIAA 3K3DA 4PKYA 4I38A 2VLGA 2PR5A 1XJ3A 4I3IA 1OJ5A 4HP4A 2WKQA 3LIEA 2L0WA 4F3LA 3MXQA 1P0ZA 2D02A 3MJQA 2VEAA 4DJ2A 1EW0A 3G6OA 4MN5A 2WKPA 1G28A 2OWHA 2P7JA 2HV1A 1OJGA 1S4SA 2QJ7A 2H28A 4HJ6A 1ODVA 2V1AA 3LYXA 4EESA 4L9FA 4EW7A 1NWZA 5HDCA 1S4RA 2YKFA 4JGRA 1LSVA 1OT9A 4RQ9A 4HJ3A 4HH2A 3MFXA 2R78A 4DJ3A 2V9AA 5J7EA 1T1CA 3UE6A 1WA9A 2QWSA 4HI4A 1F9IA 3E4OA 1OTAA 3LICA 4GHIB 4I3AA 5TBMB 1V9ZA 2JN7A 4GHIA 3T50A 5TBMA 4WLAA 3A0VA 2JHEA 2L1MA 1F98A 1GSVA 3BY8A 4HY8A 1XJ2A 2W0NA 4BBTA 4WL9A 2OOLA 5J4EA 4EEUA 3VE4A 4EXOA 3UMEA 2V1BA 4HHDA 1OTEA 1S67L 1GSWA 4KUOA 2QKPA 4M4XA 5HZHA 2PD8A 4R3AA 4BBVA 2K7SA 5DKKA 4L9EA 5DJTA 4WUJA 3LIBA 5HSQA 2ZOHA 5F5YA 4MN6A 5HDDA 2PYPA 4F3LB 1P97A 1X0OA 2PDRA 5HD3A 3ICYA 4WN5A 2QHKA 5HWVA 1LT0A 5A8BA 1LSWA 4LRYC 3NOTC 5HWWA 1N9NA 3C2WA 3F1PB 3SW1A 4L9GA 3F1PA 4GW9A 3F1NB 4WF0A 5J3WA 3F1NA 3F1OB 4JGPA 5AVFA 3MR0A 3GECA 5KIZA 4NXBA 3LI8A 1DRMA 3F1OA 3NOUC 3IBRA 3H82B 3C8CA 3H7WB 4KQDA 5G4ZA 3H82A 1JNUA 4E04A 3H7WA 4B9OA 1TS7A 4EERA 1D06A 4R70A 1V9YA 4HP9A
chains in the Genus database with same CATH superfamily
5HDSA 4GDNA 1UGUA 2Q9NA 4EWFA 2JKTM 2P08A 3V3SA 3QP2A 3W2ZA 3IT9A 2VKSA 1G6OA 1TDLA 3A0SA 3UNWA 3NECA 1S66L 2GJ3A 1MC0A 3VP3A 1JWZA 5AQ7A 3RTYA 4EEPA 5F68A 1PRQA 4BENA 3JVUA 2WZXA 4Q0IA 4IUHA 5L09A 1AWIA 1IELA 3PHYA 2Z6CA 3EGXC 3ZNTA 1GA9A 4WEJA 1K0KA 3JPUA 5L8MA 3ZG7B 1XFQA 5CGWA 1LL9A 3GMWA 4OQIA 1DY6A 2I9VA 3M2KA 1NRJA 2Y2KA 3S7NA 2RL3A 5F82A 3IS2A 1XJ4A 4JXWA 2B5RA 1JWVA 2P9VB 3B3XA 4QPRA 5EOEA 1MWTA 2VV7A 4OP5A 2B02A 2PR6A 3KYEA 1TS0A 1PWCA 3G4PA 1K55C 5CRFA 2R9XA 3VOLA 4E3OA 1TS6A 1JTDA 3DAVA 4H6JB 4R4SA 2DRWA 3UB8A 2P04A 1M40A 2J3TC 3HL9A 4F94A 3W4PA 3ZGAB 1E3UA 5KMWA 2A3UA 2FFYA 4KENB 4IUKA 4GCZA 2ZQ8A 2PU2A 3IXDA 4EETB 1J3WA 3NDGA 3LY3A 5DTSA 2D01A 4EV4A 4JXVA 4RYEA 4R38A 1UWPX 3MF0A 1KDSA 5F69A 3U4LP 4EU0A 3KSHA 3NULA 3T1QB 4MBKA 4ETXA 4R3BA 5EVLA 3DWKA 4JXGA 2Y2JA 3FG8A 3S22A 3BECA 4S2MA 3GDIA 5E2HA 1L0EA 3HJIA 3VV4A 1K54C 4EBPA 2Z2MB 3SOIA 5JYPA 5HPIA 5L07A 3CLOA 2C5WB 4DXCA 2YKHA 1UWNX 3LIFA 1OT6A 1M6KA 3S1YA 2W3EA 3LO7A 2W1TA 5C5KA 3BQ8A 3NJAA 4BWIA 4S2PA 3VP0A 3UE1A 2WYXA 2OAQ1 3AGFA 1KDWA 1DP6A 2A24B 1GSXA 1K25A 4OPYA 2OWJA 5AQBA 3CPTA 4OP8A 1FSYA 1WYBA 5EECA 3ZCZA 4B4XA 1MWUA 3N4IA 3IHAA 2O99A 5CHMA 3CHWP 3LCEA 3VFFA 3K3CA 4P6ZM 3UB6A 2Y2MA 2KDKA 1ERMA 3FV7A 4LLOB 2M7UA 5LBRA 3MFDA 4PKYA 3ZNYA 1BLHA 2XK1A 2VLGA 2PR5A 1ESUA 2J7VA 2P74A 1HVBA 1BZAA 5CHUA 5I94A 3CMZA 3G2YA 3V39A 1H0MA 4F3LA 1P0ZA 1SDEA 3MJQA 2QYBA 4CLCE 4R1GA 3ZVTA 1EW0A 4JXSA 4NK3A 2VGKA 5FATA 2XFSA 3IX8A 2Y2QA 2W3HA 1S4SA 2IA2A 1L3LA 1MY8A 3MBZA 3O86A 3LYXA 1FILA 3SH7A 3ZFZA 3S7QA 3ISGA 4GB7A 2Y4AA 4IBRA 4EW7A 3LR5A 4N1XA 2K2NA 5GL9A 2LB9A 4N9KA 3V5MA 4XUXA 5GHYA 2ZL1A 1HLUP 2YKFA 4JGRA 3D3OA 1LSVA 3CJMA 1ES5A 4U0XA 3P98A 1ES4A 2Y79A 1NLYA 3OPHA 5FASA 2WADA 2OSUA 4P87A 4N9LA 1FIKA 2R78A 1U60A 2Y8HA 3MZFA 2QWSA 3AGEA 5FAQA 2HDRA 3PBRA 1H8MA 4G3KA 5CECA 3WS5A 2JKFA 3MQ0A 4GHIA 3T50A 5TBMA 5G18A 4WLAA 2XROA 3D9YA 2JHEA 3O5YA 3IF6C 4GD6A 2V20A 5FQ9A 1VM1A 2B95A 3BY8A 4R3JA 4N92A 3FPVA 2W0NA 4WZ5C 4WL9A 4NEED 3PBQA 4FH4A 5E2EA 1BUEA 3GQZA 4O01A 3UO9A 1S67L 4MDZA 2V2FF 2WKHA 3QP8A 2WGIA 4OVDA 2WKEA 5DJTA 3RJUA 1YM1A 1ONHA 3SH8A 2ZOHA 5F5YA 1LI0A 1G68A 2ZMFA 4MN6A 1BLSA 2PYPA 4DDSA 5TJJA 4KZ6A 1P97A 2PDRA 1KVMA 4X6TA 4X56A 1PW8A 2EFXA 5A93A 5HWVA 1LT0A 1TVFA 1BSGA 3C2WA 2HJEA 3BFFA 1STZA 3C38A 3CG5A 2HGVA 4UA7A 3KYQA 3SW1A 4N1HA 1IKIA 1DJAA 3F1OB 3MR0A 2G7UA 3T4KA 1KGEA 1IYOA 4E3LA 4LV3A 4Q8IA 3H82B 3C8CA 5FDSA 4KQDA 3IWOA 5FI7A 1JNUA 1PWDA 3H7WA 3DTIA 5AQAA 1TS7A 4EERA 3UN7A 2ZQ9A 1V9YA 5FAOA 4HP9A 3ZYTA 3A3JA 4FUWA 3OPPA 4LGWA 4M3KA 4EQIA 5A91A 4LPZA 1D7EA 1KOUA 1PI5A 1LLBA 3EOIA 3LI9A 5HAPA 1Z09A 2CC1A 1XP4A 2BLSA 3E2LA 5EE8A 4MBHA 1FSWA 1ALQA 4BMWA 1PFLA 2GDNA 1DJCA 3UDIA 4D2OA 5DF9A 3IBJA 3R4KA 4FTXA 1IEMA 4X68A 1RGYA 1SKOB 4LRZE 4A5RA 5L2FA 1YLWA 2WK0A 4WYYA 2V0UA 4GDBA 2DNSA 2XA7M 4ZTKA 5DF7A 2DMWA 3Q7ZA 3BFCA 3HLBA 3C30A 4I5SA 3EEAA 1T1AA 4MBFA 2Y2GA 1MWRA 3LR3A 2WUQA 3CAXA 3MS6A 3EQVA 4HNBA 5HAIA 2WGWB 1K55A 1RP5A 4RX2A 3NI9A 3U2AA 2A49A 1PIOA 3IXGA 2HPBA 4K0WA 3CZDA 1MBLA 5HWTA 3FZCA 4KZ9A 3VE3A 4GLQA 1BYWA 4ZJ3A 3WWXA 1TD5A 4OH0A 4K08A 3Q81A 3BQAA 4IHQA 5FQJA 1NZOA 4BJPA 3C7VA 4PMAA 1ZTUA 5G4YA 1MKMA 1H8YA 2W27A 1L2SA 3MMHA 2EA9A 3ULFA 2H5SA 2PHYA 1VHMA 1PNEA 3UPNA 1ZC2A 3JYIA 4OQ0A 4DE3A 2Y2PA 2DCFA 4FSFA 3RXWA 5CXWA 4Y0TA 5HD5A 1BLPA 2VV8A 2ZM8A 1J9MA 4LV0A 5K5BA 4E3KA 4GOGA 1K54A 4E6XA 4UA9A 1CEGA 3LIAA 4AFIA 3OCLA 2JKRI 3D72A 1K56D 4HQAA 2VK3A 3UMDA 5MC7A 2HDQA 3LUQA 2PT7A 3LIDA 3CWFA 1DP9A 1W8YA 1VEUB 5GHZA 1MZUA 2RCXA 4S2JA 1DP8A 4ZAMA 5CTMA 3WS0A 1T18A 5TGFA 2J8YA 4XT2A 3HLGA 2V0WA 2XD1A 5CHJA 4KZ8A 4EBLA 4ARZB 1SZVA 3ITBA 3CITA 4BD0A 4JGOA 3EWKA 2MJ6A 3SH9A 1WYCA 4GJ4A 1BT5A 4HH3A 1Q2PA 5EM0A 3MZDA 4KZBA 2UV0E 1NY0A 2INWA 4B4ZA 3B42A 1YMSA 4HIAA 3B47A 2LB5A 2XRNA 3WS1A 3A3IA 5TFQA 2PBDP 1PZPA 3WS4A 3ZHHA 4OPRA 1XJ3A 3G2ZA 3KYZA 3P09A 3QP6A 3V50A 1OJ5A 5FQIA 5AJGA 5FI6A 3LIEA 4JF6A 4E3IA 3HLWA 2JE5A 3MXQA 2XEPA 5GLAA 3WS2A 3NC8A 4DJ2A 2VX8A 3G6OA 1JTGA 2M7VA 2WKPA 4KG6A 2OWHA 1RCJA 1OJGA 2QJ7A 2G2WA 1ODVA 2V1AA 1Q2QA 3NBLA 1O07A 2ZC6B 4EESA 2B18A 3C7UA 2BG1A 2J9PA 3N8LA 1F2KA 2EFUA 4CLCB 2QPNA 3IX4A 3PTEA 3TW8A 5DFXA 4IVIA 4QY6A 4DKIA 1ES3A 1YKDA 3MKEA 4H8RA 5FEGA 4RQ9A 5EVIB 2XH9A 4HJ3A 5EOOA 2O9AA 4KZ4A 4HH2A 1GHPA 1QMFA 3M6BA 2K31A 2HP5A 3DW0A 5J7EA 5CERA 5BOHA 4IEDA 2J9OA 1F9IA 2XD5A 3E4OA 1FQGA 3NIAA 4OOLA 3IF6A 4I3AA 1L0FA 2Q9MA 4KQRA 1V9ZA 5DTKA 1D1JA 3A0VA 3QNCA 4WZ5A 1JWPA 2QZ6A 3PAEA 2Y2OA 2L1MA 4P6ZS 4EUVA 2WZZA 1ESIA 4GN2A 1WE4A 3OCNA 1ONGA 2GX5A 2VGJA 4HY8A 2VZWA 5FSRA 1XJ2A 1CQAA 1K56A 2OOLA 4X1LA 1W63Q 5J4EA 4EEUA 3C4OA 5AQ9A 1K4EA 5HL6A 1L0DA 2BTFP 1OPXA 4LV1A 1YAXA 3Q82A 3Q7VA 4II7A 3L9KA 5EPHA 2ZJ9A 4NETA 1GSWA 3ZG5A 3KSIA 4KUOA 3R7WB 4DRTA 4WUJA 3HUMA 3OBFA 5HSQA 2WGVA 4S2LA 4R0QA 5HD3A 4WN5A 4DF6A 1E4DA 5A8BA 4LRYC 1CK3A 5E43A 5EUAA 5FDHA 3T1SA 3F1PB 4GZBA 4MCWA 4BLMA 3GTCA 4WF0A 4L0LA 5J3WA 3F1NA 2XR0A 5AVFA 1ZG4A 2VGLM 4NXBA 2ZMVA 5EVID 3QP4A 4G3WA 2I72A 1IYQA 4B9OA 1D06A 4O7DA 4R70A 4S2IA 4X1MA 1C3BA 2HDUA 4I3JA 4S2NC 3FC7A 1G5UA 1PW1A 3LY4A 2ZC5B 5HW3A 2FH5A 4LV2A 3IF5A 4WZ4A 3VOZA 2WKRA 3ITAA 2Y2IA 4PKYG 4DN0A 4KZAA 2OLVA 2ZM2A 1T19A 3O3VA 3ZQ5A 1LI9A 4KZ7A 5AVEA 5FEFA 3ZG9B 3KX0X 4KZ5A 5KZHA 2EWWA 4PM7A 2ZOIA 4NXFA 4KUKA 5F6AA 4NXGA 4OQHA 3GRJA 5GHXA 4UA6A 3BY9A 2PD7A 3IS2B 1ZG6A 4EQ1A 2Y2NA 3HJKA 5M1AA 2Z6DA 5FQQA 2P9VA 4PM6A 4E3NA 5M18A 4B93A 3OOVA 3NY4A 2VA0A 4NXEA 3BRMA 2W3FA 2V8FA 2VV6A 4E3JA 4JF4A 2WAEA 1MKIA 3BFDA 4H6JA 2HP9A 4XXRA 4KZ3A 1FCNA 2ZLYA 2L4RA 4UQIM 4QJGA 3LEZA 1TS8A 3T4LA 3ZDJA 2QMIA 5HX9A 3G32A 3SS4A 2HP6A 4QB8A 4U0TA 3ZVWA 3WRZA 1K57A 4UHUA 4E6WA 1IYSA 1N9OA 5D3OA 4UAAA 2KLIA 4K0XA 3S4XA 1CF0A 3KSFA 1CEFA 4UEYA 4G3VA 2NUTC 3PBNA 2ZQCA 4KQOA 1Y4OA 5EFWA 3UB9A 4YINA 5IT5A 4JBFA 3G31A 4QU3A 3KO6A 4GS9B 1YLJA 2BASA 3T4JA 3TRCA 2JKTI 2EXAA 4DE2A 5DFYA 1OTIA 1VB6A 2XA7S 3HLEA 4JGQA 3HUNA 3MSHA 2J80A 3UB5P 1ZHHB 2PU4A 2CMNA 1CJFA 2ZBBA 3NHQA 4DDYA 4E3MA 4ZRRA 1W5DA 3VP2A 1NJ4A 2A24A 5FQMA 4ZDXA 2JKGA 4RVAA 4X55A 3RFBA 3LR4A 2O0YA 2NUPC 3HLFA 5DKLA 1OMEA 5KSHA 3GVBA 3I7JA 1LL8A 4HBUA 2M1CA 5EV0A 2PYRA 2AVXA 3P7NA 4QWOA 3E4PA 3HBRA 1OTBA 2HDSA 3VP1A 1E3UD 1S0WA 5A92A 3IXBA 3CUEC 3M6HA 3K3DA 3OPLA 1HZOA 4FCFA 1FOFA 5CX7A 1YQSA 3UY6A 4I3IA 5FI2A 3IH8A 2X01A 2V1ZA 1KGFA 2L0WA 4O0PA 2D02A 1G6AA 2VEAA 4Q0HA 4WEKA 5CTNA 4BL2A 4QY5A 1G28A 3LGOA 2HV1A 3JVVA 1YLZA 2H28A 4HJ6A 1NYYA 4JPMA 4ZJ1A 3TE8A 3EQUA 5L10A 3TG9A 4Z9QA 5KSCA 2XQZA 4L9FA 4R4RA 3VSLA 1K57C 2X02A 5CEDA 5FL3A 1XXMA 1NWZA 2ZL1B 4Q0JA 4P0MA 1S4RA 3T4OA 3GR2A 2H0TA 1IOUA 4KG5A 1Y54A 2ZD8A 1OT9A 3HVFA 2EX6A 3W4QA 4BL3A 4CLCC 4LCMA 4PM8A 1K38A 3G35A 3NDEA 5U47A 3RXXA 4MLLA 3MFXA 3LEQA 4DE1A 5CGXA 1T1CA 3TJZC 4ID4A 3V67A 2Y2HA 1FR6A 1H3QA 1KGGA 5EVIC 1OTAA 1I2SA 4GHIB 1YPRA 5TBMB 1EROA 2PBYA 4LFUA 2JN7A 2E8JA 1QMEA 4PM9A 1YLTA 1AXBA 3BLMA 4HEFA 3VSKA 2G2UA 1DJBA 2PAVP 4X53A 3VE4A 4GNUA 3E2KA 2Y55A 1A0KA 1GHIA 2ZC4B 3T4QA 3C4PA 4Y0UA 4P85A 4Y13A 4ZJ2A 4HHDA 1OTEA 4P6BA 3MZEA 3ZG8B 4RX3A 3QP5A 5HZHA 4R3AA 4BBVA 1E25A 1K4FA 5JYOA 5DKKA 3VMAA 3LIBA 3S7PA 2Z2LB 3FKVA 3UE0A 5HDDA 5GLDA 3PBOA 3SS3A 3BW6A 5F1FA 2EXBA 5FAPA 4PHTA 1VETB 2W1RA 1LSWA 3OPRA 4S2KA 1PWGA 4NKPA 2Y59A 4LENA 2FZ0A 4L9GA 2ZQ7A 4GW9A 4ESPA 1NLZA 5IHVA 4Y0OA 2O9CA 3T1RA 2OV5A 1ES2A 4JGPA 5GLCA 3GECA 3G34A 1DRMA 3F1OA 5HARA 3NOUC 3UPPA 3SS5A 3Q07A 1HTZA 1TF1A 4CJNA 2HZ5A 3TOIA 3H7WB 5G4ZA 3H82A 3QP1A 4S2NA 3DBAA 4Y5FA 4EUZA 1IFQA 4HBTA 2QJ5A 3HLCA 4K91A 4MN7A 3T4TA 2JKRM 4CPKA 1LL5A 3AGDA 4IJGA 4LCLA 4WELA 2H10A 3IX3A 4C6YA 3W8KA 4GS9A 1OTDA 4KG2A 4JKTA 4WMCD 3B33A 1H5XA 2WAFA 3W4OA 4OLDA 3RH8B 2EX8A 5J8XA 3E4QA 4BBUA 3M2JA 4NG2A 1SKOA 3HUOA 3IWQA 1ACFA 3IXHA 3MQOA 3V3RA 1F5MA 5HPFA 4R6LA 1CI9A 1RGZA 1TEMA 3CI6A 2IWDA 2O9BA 3PBTA 3P01A 1LSXA 3OZHA 1K6RA 1Y28A 3BJNA 2WGWA 4WM9A 1XA7A 4Z1WA 4U3TA 1S1YA 3D4FA 3NCKA 3NOPC 1L0GA 3PYPA 5EVEA 1BLCA 1O7EA 3BWLA 3L7HA 4YOFA 3MXRA 3HLDA 1SCWA 2E8IA 4DMZA 1XKZA 2VGLS 4CQHA 3LR0A 2OLUA 3IWIA 3T4SA 4JF5A 4OLGA 5HL1A 4CLCD 3A0RA 3BYDA 1N9LA 1NZUA 4QD4A 3O87A 2GNXA 4YWZA 4RA7A 1XGJA 1KE0A 4MNRA 4MEZA 1YSPA 1P9WA 1H8ZA 3K2NA 4Y17A 5DTTA 5E2GA 3SZTA 3BLSA 5E2FA 1XJ6A 4JLFA 3IHBA 1Z6FA 4O8GA 1YSQA 2WKIA 3E0YA 3N8RA 4HJ4A 5CEBA 2XDMA 5F1GA 3VFHA 4ME4A 4Y3IA 3UDFA 5IS1A 1NRFA 3T1XA 1S6RA 3MQQA 1ERQA 2KX6A 3UB7A 2A2LA 3UE3A 5FQKA 5IU1A 1K6SA 1KE4A 1XFNA 2Q0OA 4Y7PA 4LRXC 4IBXA 3FPWA 4ZBEA 4B88A 3WRTA 3VOYA 4S2OA 3ZG0A 2ZC7A 1YT4A 1I2WA 1P9RA 3PR6A 3EEHA 1VEUA 3OLOA 5DJUA 2EX2A 3Q1FA 1HD8A 2HF6A 3DTKA 3MXSA 2XSSA 3MKFA 3GV9A 3N8SA 1KE3A 2ZQAA 4HOIA 4XT2B 4I39A 4YNRA 5I5LA 4BD1A 4WBGA 4PPRA 2J3TD 2XLNA 3DTEA 4DXBA 1BTLA 4OKPA 4KQQA 1BULA 3BEBA 4ARZA 4ETZA 5DF8A 1S1ZA 3TSGA 3S7OA 3G30A 2UWXA 3CUEA 1SKFA 3H9WA 4R23A 4WMCA 4PAUA 1GA0A 1SDNA 5DVAA 1I5QA 2JC7A 5CGSA 1T1BA 4UQIS 2X71A 4I38A 5HAQA 2JCHA 5FA7A 4HP4A 1XPBA 4YFMA 2WKQA 3BFGA 3FYZA 4GKUA 1FCOA 4QHCA 3A3EA 4MN5A 2GZAA 1CI8A 1VETA 2P7JA 3PXPA 1YMXA 2H0YA 2EX9A 3GSGA 3HREA 4PM5A 1N4OA 1XA1A 3EGDC 4BQMA 2IWBA 1ZKJA 2XFTA 4X25A 4EBNA 1PZOA 1IKGA 4FH2A 3FWLA 4IVKA 5HDCA 1MXOA 2R9WA 4CLCA 3T12B 5F83A 4FD8A 2Y2LA 4X69A 1PI4A 4OQGA 3DTMA 4XUZA 1W8QA 3QNBA 4DE0A 1PYYA 1W79A 5EVIA 3IH9A 3BFEA 3VP4A 4DJ3A 3N6IA 2V9AA 2W1TB 1GCEA 3PAGA 3UE6A 1SHVA 1WA9A 5GLBA 3BM6A 4HI4A 3IF6B 5TR7A 3LICA 1KVLA 3DWZA 3A3FA 3UDXA 3CPTB 4D60A 4OPZA 1NXYA 3KSGA 2PRFA 2C6WB 4OOYA 2ACGA 1F98A 1GSVA 2EWVA 2J3WA 1NYMA 2IWCA 2JBFA 1W7FA 4BBTA 5M19A 3FKWA 2XGNA 1N9BA 4EXOA 2ZC3B 3UMEA 3HCYA 3PBSA 3Q7VB 2V1BA 1YLYA 4OOMA 1FR1A 4FOFA 2QKPA 4M4XA 3QHYA 2PD8A 2ZM0A 4Y2FA 2KOIA 2K7SA 4L9EA 1IYPA 1TDGA 2VJWA 2ZQDA 4GD8A 3R7WA 1MPLA 2Y91A 4Y15A 5EM1A 3O88A 1XX2A 2HJ9C 4F3LB 1X0OA 1EI5A 3ICYA 2V8CA 1W63M 2QHKA 2OAP1 3UPOA 1GHMA 2ZMAA 3E98A 3NOTC 2XF3A 5HWWA 1N9NA 4MMNA 4OONA 3C5AA 3N7WA 1YLPA 3F1PA 3F1NB 1VQQA 2FFFB 3IQAA 5KIZA 3LI8A 4C75A 3LFVA 5A90A 1MWSA 3IBRA 1JVJA 4C3QA 3A3DA 4HESA 1EWZA 3OC2A 5HFOA 1XGIA 2W3GA 1LHYA 2W3DA 4E04A 4OPQA 1FCMA
chains in the Genus database with same CATH topology
2QJ5A 4I3JA 4MN7A 5HDSA 3T4TA 2JKRM 1UGUA 3FC7A 4LPZA 1D7EA 2JKTM 2P08A 4IJGA 1KOUA 3W2ZA 3EOIA 3LI9A 2VKSA 1G6OA 4WELA 3A0SA 1S66L 2GJ3A 1MC0A 4BMWA 2FH5A 3RTYA 4EEPA 5F68A 4GS9A 3JVUA 4Q0IA 1OTDA 2WKRA 4IUHA 5DF9A 3IBJA 3PHYA 2Z6CA 4PKYG 4DN0A 3EGXC 3R4KA 3B33A 4WEJA 3RH8B 1T19A 4LRZE 3ZQ5A 3E4QA 4BBUA 5L8MA 5AVEA 2V0UA 1XFQA 3KX0X 3MQOA 1F5MA 2XA7M 2EWWA 5HPFA 2I9VA 2ZOIA 1NRJA 4NXFA 4KUKA 5F6AA 4NXGA 2DMWA 4R6LA 3C30A 3S7NA 4I5SA 3CI6A 3EEAA 2O9BA 3PBTA 3BY9A 1T1AA 2PD7A 3IS2B 4EQ1A 3LR3A 3CAXA 3P01A 3EQVA 4HNBA 3HJKA 3IS2A 1XJ4A 1LSXA 4QPRA 2Z6DA 1Y28A 3BJNA 2VV7A 4Z1WA 3U2AA 2B02A 2PR6A 1S1YA 3OOVA 4B93A 1TS0A 3NOPC 3PYPA 2VA0A 4NXEA 3BWLA 3VOLA 4YOFA 2W3FA 2VV6A 5HWTA 1TS6A 4DMZA 3VE3A 4GLQA 4H6JB 1BYWA 2VGLS 4CQHA 3LR0A 3UB8A 2P04A 4H6JA 2J3TC 3T4SA 4CLCD 3A0RA 2L4RA 1N9LA 1TD5A 4YWZA 2GNXA 4K08A 4UQIM 3BQAA 1TS8A 3T4LA 4IHQA 1YSPA 1P9WA 4BJPA 1ZTUA 3K2NA 5G4YA 1MKMA 2W27A 4IUKA 4GCZA 3MMHA 2EA9A 3ULFA 1XJ6A 2PHYA 1VHMA 4O8GA 1YSQA 3E0YA 4EETB 4HJ4A 1N9OA 2D01A 4R38A 1UWPX 4ME4A 3MF0A 2KLIA 5F69A 4Y3IA 4EU0A 5IS1A 3KSFA 3KSHA 4FSFA 5HD5A 4UEYA 2VV8A 4G3VA 2NUTC 3MQQA 3PBNA 4KQOA 4ETXA 2KX6A 3UB7A 5K5BA 5EFWA 2A2LA 3UB9A 3UE3A 3FG8A 5IU1A 5IT5A 1XFNA 3LIAA 3GDIA 3KO6A 4GS9B 4LRXC 4AFIA 3OCLA 2JKRI 2BASA 3D72A 3HJIA 3T4JA 4HQAA 3VV4A 3FPWA 3TRCA 3UMDA 2JKTI 5DFYA 5HPIA 5MC7A 1OTIA 1VB6A 3LUQA 2XA7S 4JGQA 2PT7A 3CLOA 3LIDA 3CWFA 1DP9A 1UWNX 2YKHA 3LIFA 1OT6A 1MZUA 2J80A 2W3EA 1P9RA 2W1TA 3BQ8A 3PR6A 5C5KA 3EEHA 3OLOA 3NJAA 5DJUA 1DP8A 4BWIA 1ZHHB 2HF6A 2CMNA 2ZBBA 2XSSA 3NHQA 2OAQ1 4ZRRA 1DP6A 1T18A 4HOIA 2A24B 1GSXA 2OWJA 4XT2B 4I39A 4YNRA 2A24A 5I5LA 4XT2A 2V0WA 2J3TD 3RFBA 3LR4A 2O0YA 2NUPC 4ARZB 5DKLA 3CITA 5KSHA 4JGOA 1LL8A 4ARZA 4ETZA 3EWKA 2MJ6A 1S1ZA 2O99A 2M1CA 3S7OA 2PYRA 3CUEA 4GJ4A 3H9WA 3P7NA 3K3CA 4HH3A 4P6ZM 3UB6A 4PAUA 3E4PA 2INWA 2KDKA 1OTBA 1T1BA 3B42A 4UQIS 4LLOB 2M7UA 4HIAA 3B47A 2LB5A 5LBRA 2XRNA 3CUEC 3K3DA 4PKYA 4I38A 2VLGA 5CX7A 2PR5A 1XJ3A 3KYZA 4I3IA 1OJ5A 4HP4A 5AJGA 2WKQA 3LIEA 2L0WA 4O0PA 4F3LA 3MXQA 1P0ZA 2D02A 3MJQA 2VEAA 2QYBA 4Q0HA 4CLCE 4WEKA 4DJ2A 2VX8A 1EW0A 3G6OA 2M7VA 4MN5A 2WKPA 2GZAA 1G28A 2OWHA 2P7JA 3PXPA 2HV1A 3JVVA 1OJGA 2W3HA 1S4SA 2QJ7A 2H28A 2IA2A 4HJ6A 3EGDC 1ODVA 2V1AA 3TE8A 3LYXA 3EQUA 3S7QA 4EESA 4L9FA 2B18A 4EW7A 3LR5A 2K2NA 5FL3A 1NWZA 2LB9A 4Q0JA 5HDCA 4CLCB 1S4RA 3T4OA 3TW8A 2YKFA 4JGRA 5DFXA 3D3OA 4CLCA 1IOUA 1LSVA 1OT9A 1YKDA 2Y79A 1NLYA 4RQ9A 4CLCC 4HJ3A 2O9AA 4HH2A 3MFXA 2R78A 2K31A 4DJ3A 2Y8HA 2V9AA 2W1TB 1T1CA 3UE6A 5J7EA 3TJZC 3V67A 1WA9A 2QWSA 1H3QA 4HI4A 1F9IA 3E4OA 1OTAA 3PBRA 1H8MA 3LICA 4G3KA 4OOLA 4GHIB 4I3AA 5TBMB 1V9ZA 2JN7A 3MQ0A 4GHIA 3T50A 5TBMA 4WLAA 2XROA 3A0VA 2JHEA 3O5YA 2L1MA 4P6ZS 3KSGA 4EUVA 3OCNA 1F98A 1GSVA 3BY8A 2GX5A 4HY8A 2VZWA 3FPVA 1XJ2A 2EWVA 2J3WA 2W0NA 4BBTA 4WL9A 2OOLA 1W63Q 5J4EA 4EEUA 3VE4A 4EXOA 5HL6A 3UMEA 3HCYA 4NEED 3T4QA 1OPXA 3PBSA 3PBQA 1YAXA 2V1BA 4II7A 4HHDA 4O01A 4OOMA 1OTEA 1S67L 1GSWA 4MDZA 3KSIA 4FOFA 4KUOA 2QKPA 4M4XA 5HZHA 2PD8A 4R3AA 4Y2FA 4BBVA 2KOIA 2K7SA 5DKKA 4L9EA 3R7WB 5DJTA 2VJWA 4WUJA 3R7WA 3LIBA 3OBFA 3S7PA 5HSQA 2ZOHA 5F5YA 2ZMFA 4MN6A 5HDDA 2PYPA 3PBOA 2HJ9C 5TJJA 4F3LB 1P97A 1X0OA 3BW6A 2PDRA 5HD3A 3ICYA 4WN5A 1W63M 2QHKA 2OAP1 5HWVA 4PHTA 1LT0A 5A8BA 2W1RA 1LSWA 4LRYC 3E98A 3NOTC 5HWWA 1N9NA 4MMNA 3C2WA 4NKPA 2HJEA 3F1PB 1STZA 2FZ0A 3C38A 2HGVA 4MCWA 3KYQA 3SW1A 4L9GA 3F1PA 4GW9A 1NLZA 3F1NB 4WF0A 4L0LA 2O9CA 5J3WA 3F1NA 3F1OB 4JGPA 5AVFA 3MR0A 2G7UA 2VGLM 3GECA 5KIZA 4NXBA 3LI8A 1DRMA 3T4KA 3F1OA 3NOUC 2ZMVA 4G3WA 3LFVA 3IBRA 1TF1A 3H82B 3C8CA 3H7WB 4KQDA 5G4ZA 3OC2A 3H82A 2W3GA 2W3DA 1JNUA 4E04A 3H7WA 3DBAA 4Y5FA 1TS7A 4B9OA 4EERA 1D06A 4R70A 1IFQA 1V9YA 4HP9A 3ZYTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QJ5 A;  4I3J A;  5HDS A;  1UGU A;  3FC7 A;  4LPZ A;  1D7E A;  1KOU A;  3LI9 A;  3A0S A;  1S66 L;  2GJ3 A;  3RTY A;  4EEP A;  5F68 A;  4GS9 A;  1OTD A;  2WKR A;  3PHY A;  4PKY G;  2Z6C A;  3B33 A;  3RH8 B;  1T19 A;  4LRZ E;  3ZQ5 A;  3E4Q A;  4BBU A;  5AVE A;  2V0U A;  1XFQ A;  3KX0 X;  3MQO A;  2I9V A;  2ZOI A;  4NXF A;  4KUK A;  5F6A A;  4NXG A;  4R6L A;  4I5S A;  3BY9 A;  1T1A A;  2PD7 A;  3IS2 B;  4EQ1 A;  3CAX A;  4HNB A;  3HJK A;  3IS2 A;  1XJ4 A;  1LSX A;  2Z6D A;  1Y28 A;  2VV7 A;  2B02 A;  2PR6 A;  1S1Y A;  1TS0 A;  3NOP C;  3PYP A;  4NXE A;  3BWL A;  3VOL A;  2VV6 A;  5HWT A;  1TS6 A;  3VE3 A;  4H6J B;  1BYW A;  3UB8 A;  4H6J A;  3A0R A;  2L4R A;  1N9L A;  4YWZ A;  4K08 A;  1TS8 A;  5G4Y A;  2W27 A;  4GCZ A;  2EA9 A;  3ULF A;  1XJ6 A;  2PHY A;  4EET B;  4HJ4 A;  1N9O A;  2D01 A;  4R38 A;  1UWP X;  5F69 A;  5IS1 A;  5HD5 A;  2VV8 A;  3MQQ A;  2KX6 A;  3UB7 A;  5EFW A;  3UB9 A;  3FG8 A;  5IU1 A;  1XFN A;  3LIA A;  3GDI A;  4GS9 B;  4LRX C;  2BAS A;  3D72 A;  3HJI A;  4HQA A;  3UMD A;  1OTI A;  1VB6 A;  3LUQ A;  4JGQ A;  3CLO A;  3LID A;  3CWF A;  1DP9 A;  1UWN X;  2YKH A;  3LIF A;  1OT6 A;  1MZU A;  2J80 A;  3EEH A;  3OLO A;  3NJA A;  5DJU A;  1DP8 A;  2CMN A;  2ZBB A;  3NHQ A;  1DP6 A;  1T18 A;  4HOI A;  2A24 B;  1GSX A;  2OWJ A;  4XT2 B;  4I39 A;  2A24 A;  5I5L A;  4XT2 A;  2V0W A;  5DKL A;  4JGO A;  1LL8 A;  3EWK A;  1S1Z A;  2M1C A;  2PYR A;  3H9W A;  3P7N A;  3K3C A;  4HH3 A;  3UB6 A;  3E4P A;  2INW A;  2KDK A;  1OTB A;  1T1B A;  4LLO B;  4HIA A;  3K3D A;  4PKY A;  4I38 A;  2VLG A;  2PR5 A;  1XJ3 A;  4I3I A;  1OJ5 A;  4HP4 A;  2WKQ A;  3LIE A;  2L0W A;  4F3L A;  3MXQ A;  1P0Z A;  2D02 A;  3MJQ A;  2VEA A;  4DJ2 A;  1EW0 A;  3G6O A;  4MN5 A;  2WKP A;  1G28 A;  2OWH A;  2P7J A;  2HV1 A;  1OJG A;  1S4S A;  2QJ7 A;  2H28 A;  4HJ6 A;  1ODV A;  2V1A A;  3LYX A;  4EES A;  4L9F A;  4EW7 A;  1NWZ A;  5HDC A;  1S4R A;  2YKF A;  4JGR A;  1LSV A;  1OT9 A;  4RQ9 A;  4HJ3 A;  4HH2 A;  3MFX A;  2R78 A;  4DJ3 A;  2V9A A;  5J7E A;  1T1C A;  3UE6 A;  1WA9 A;  2QWS A;  4HI4 A;  1F9I A;  3E4O A;  1OTA A;  3LIC A;  4GHI B;  4I3A A;  5TBM B;  1V9Z A;  2JN7 A;  4GHI A;  3T50 A;  5TBM A;  4WLA A;  3A0V A;  2JHE A;  2L1M A;  1F98 A;  1GSV A;  3BY8 A;  4HY8 A;  1XJ2 A;  2W0N A;  4BBT A;  4WL9 A;  2OOL A;  5J4E A;  4EEU A;  3VE4 A;  4EXO A;  3UME A;  2V1B A;  4HHD A;  1OTE A;  1S67 L;  1GSW A;  4KUO A;  2QKP A;  4M4X A;  5HZH A;  2PD8 A;  4R3A A;  4BBV A;  2K7S A;  5DKK A;  4L9E A;  5DJT A;  4WUJ A;  3LIB A;  5HSQ A;  2ZOH A;  5F5Y A;  4MN6 A;  5HDD A;  2PYP A;  4F3L B;  1P97 A;  1X0O A;  2PDR A;  5HD3 A;  3ICY A;  4WN5 A;  2QHK A;  5HWV A;  1LT0 A;  5A8B A;  1LSW A;  4LRY C;  3NOT C;  5HWW A;  1N9N A;  3C2W A;  3F1P B;  3SW1 A;  4L9G A;  3F1P A;  4GW9 A;  3F1N B;  4WF0 A;  5J3W A;  3F1N A;  3F1O B;  4JGP A;  5AVF A;  3MR0 A;  3GEC A;  5KIZ A;  4NXB A;  3LI8 A;  1DRM A;  3F1O A;  3NOU C;  3IBR A;  3H82 B;  3C8C A;  3H7W B;  4KQD A;  5G4Z A;  3H82 A;  1JNU A;  4E04 A;  3H7W A;  4B9O A;  1TS7 A;  4EER A;  1D06 A;  4R70 A;  1V9Y A;  4HP9 A; 
#chains in the Genus database with same CATH topology
 5HDS A;  4GDN A;  1UGU A;  2Q9N A;  4EWF A;  2JKT M;  2P08 A;  3V3S A;  3QP2 A;  3W2Z A;  3IT9 A;  2VKS A;  1G6O A;  1TDL A;  3A0S A;  3UNW A;  3NEC A;  1S66 L;  2GJ3 A;  1MC0 A;  3VP3 A;  1JWZ A;  5AQ7 A;  3RTY A;  4EEP A;  5F68 A;  1PRQ A;  4BEN A;  3JVU A;  2WZX A;  4Q0I A;  4IUH A;  5L09 A;  1AWI A;  1IEL A;  3PHY A;  2Z6C A;  3EGX C;  3ZNT A;  1GA9 A;  4WEJ A;  1K0K A;  3JPU A;  5L8M A;  3ZG7 B;  1XFQ A;  5CGW A;  1LL9 A;  3GMW A;  4OQI A;  1DY6 A;  2I9V A;  3M2K A;  1NRJ A;  2Y2K A;  3S7N A;  2RL3 A;  5F82 A;  3IS2 A;  1XJ4 A;  4JXW A;  2B5R A;  1JWV A;  2P9V B;  3B3X A;  4QPR A;  5EOE A;  1MWT A;  2VV7 A;  4OP5 A;  2B02 A;  2PR6 A;  3KYE A;  1TS0 A;  1PWC A;  3G4P A;  1K55 C;  5CRF A;  2R9X A;  3VOL A;  4E3O A;  1TS6 A;  1JTD A;  3DAV A;  4H6J B;  4R4S A;  2DRW A;  3UB8 A;  2P04 A;  1M40 A;  2J3T C;  3HL9 A;  4F94 A;  3W4P A;  3ZGA B;  1E3U A;  5KMW A;  2A3U A;  2FFY A;  4KEN B;  4IUK A;  4GCZ A;  2ZQ8 A;  2PU2 A;  3IXD A;  4EET B;  1J3W A;  3NDG A;  3LY3 A;  5DTS A;  2D01 A;  4EV4 A;  4JXV A;  4RYE A;  4R38 A;  1UWP X;  3MF0 A;  1KDS A;  5F69 A;  3U4L P;  4EU0 A;  3KSH A;  3NUL A;  3T1Q B;  4MBK A;  4ETX A;  4R3B A;  5EVL A;  3DWK A;  4JXG A;  2Y2J A;  3FG8 A;  3S22 A;  3BEC A;  4S2M A;  3GDI A;  5E2H A;  1L0E A;  3HJI A;  3VV4 A;  1K54 C;  4EBP A;  2Z2M B;  3SOI A;  5JYP A;  5HPI A;  5L07 A;  3CLO A;  2C5W B;  4DXC A;  2YKH A;  1UWN X;  3LIF A;  1OT6 A;  1M6K A;  3S1Y A;  2W3E A;  3LO7 A;  2W1T A;  5C5K A;  3BQ8 A;  3NJA A;  4BWI A;  4S2P A;  3VP0 A;  3UE1 A;  2WYX A;  2OAQ 1;  3AGF A;  1KDW A;  1DP6 A;  2A24 B;  1GSX A;  1K25 A;  4OPY A;  2OWJ A;  5AQB A;  3CPT A;  4OP8 A;  1FSY A;  1WYB A;  5EEC A;  3ZCZ A;  4B4X A;  1MWU A;  3N4I A;  3IHA A;  2O99 A;  5CHM A;  3CHW P;  3LCE A;  3VFF A;  3K3C A;  4P6Z M;  3UB6 A;  2Y2M A;  2KDK A;  1ERM A;  3FV7 A;  4LLO B;  2M7U A;  5LBR A;  3MFD A;  4PKY A;  3ZNY A;  1BLH A;  2XK1 A;  2VLG A;  2PR5 A;  1ESU A;  2J7V A;  2P74 A;  1HVB A;  1BZA A;  5CHU A;  5I94 A;  3CMZ A;  3G2Y A;  3V39 A;  1H0M A;  4F3L A;  1P0Z A;  1SDE A;  3MJQ A;  2QYB A;  4CLC E;  4R1G A;  3ZVT A;  1EW0 A;  4JXS A;  4NK3 A;  2VGK A;  5FAT A;  2XFS A;  3IX8 A;  2Y2Q A;  2W3H A;  1S4S A;  2IA2 A;  1L3L A;  1MY8 A;  3MBZ A;  3O86 A;  3LYX A;  1FIL A;  3SH7 A;  3ZFZ A;  3S7Q A;  3ISG A;  4GB7 A;  2Y4A A;  4IBR A;  4EW7 A;  3LR5 A;  4N1X A;  2K2N A;  5GL9 A;  2LB9 A;  4N9K A;  3V5M A;  4XUX A;  5GHY A;  2ZL1 A;  1HLU P;  2YKF A;  4JGR A;  3D3O A;  1LSV A;  3CJM A;  1ES5 A;  4U0X A;  3P98 A;  1ES4 A;  2Y79 A;  1NLY A;  3OPH A;  5FAS A;  2WAD A;  2OSU A;  4P87 A;  4N9L A;  1FIK A;  2R78 A;  1U60 A;  2Y8H A;  3MZF A;  2QWS A;  3AGE A;  5FAQ A;  2HDR A;  3PBR A;  1H8M A;  4G3K A;  5CEC A;  3WS5 A;  2JKF A;  3MQ0 A;  4GHI A;  3T50 A;  5TBM A;  5G18 A;  4WLA A;  2XRO A;  3D9Y A;  2JHE A;  3O5Y A;  3IF6 C;  4GD6 A;  2V20 A;  5FQ9 A;  1VM1 A;  2B95 A;  3BY8 A;  4R3J A;  4N92 A;  3FPV A;  2W0N A;  4WZ5 C;  4WL9 A;  4NEE D;  3PBQ A;  4FH4 A;  5E2E A;  1BUE A;  3GQZ A;  4O01 A;  3UO9 A;  1S67 L;  4MDZ A;  2V2F F;  2WKH A;  3QP8 A;  2WGI A;  4OVD A;  2WKE A;  5DJT A;  3RJU A;  1YM1 A;  1ONH A;  3SH8 A;  2ZOH A;  5F5Y A;  1LI0 A;  1G68 A;  2ZMF A;  4MN6 A;  1BLS A;  2PYP A;  4DDS A;  5TJJ A;  4KZ6 A;  1P97 A;  2PDR A;  1KVM A;  4X6T A;  4X56 A;  1PW8 A;  2EFX A;  5A93 A;  5HWV A;  1LT0 A;  1TVF A;  1BSG A;  3C2W A;  2HJE A;  3BFF A;  1STZ A;  3C38 A;  3CG5 A;  2HGV A;  4UA7 A;  3KYQ A;  3SW1 A;  4N1H A;  1IKI A;  1DJA A;  3F1O B;  3MR0 A;  2G7U A;  3T4K A;  1KGE A;  1IYO A;  4E3L A;  4LV3 A;  4Q8I A;  3H82 B;  3C8C A;  5FDS A;  4KQD A;  3IWO A;  5FI7 A;  1JNU A;  1PWD A;  3H7W A;  3DTI A;  5AQA A;  1TS7 A;  4EER A;  3UN7 A;  2ZQ9 A;  1V9Y A;  5FAO A;  4HP9 A;  3ZYT A;  3A3J A;  4FUW A;  3OPP A;  4LGW A;  4M3K A;  4EQI A;  5A91 A;  4LPZ A;  1D7E A;  1KOU A;  1PI5 A;  1LLB A;  3EOI A;  3LI9 A;  5HAP A;  1Z09 A;  2CC1 A;  1XP4 A;  2BLS A;  3E2L A;  5EE8 A;  4MBH A;  1FSW A;  1ALQ A;  4BMW A;  1PFL A;  2GDN A;  1DJC A;  3UDI A;  4D2O A;  5DF9 A;  3IBJ A;  3R4K A;  4FTX A;  1IEM A;  4X68 A;  1RGY A;  1SKO B;  4LRZ E;  4A5R A;  5L2F A;  1YLW A;  2WK0 A;  4WYY A;  2V0U A;  4GDB A;  2DNS A;  2XA7 M;  4ZTK A;  5DF7 A;  2DMW A;  3Q7Z A;  3BFC A;  3HLB A;  3C30 A;  4I5S A;  3EEA A;  1T1A A;  4MBF A;  2Y2G A;  1MWR A;  3LR3 A;  2WUQ A;  3CAX A;  3MS6 A;  3EQV A;  4HNB A;  5HAI A;  2WGW B;  1K55 A;  1RP5 A;  4RX2 A;  3NI9 A;  3U2A A;  2A49 A;  1PIO A;  3IXG A;  2HPB A;  4K0W A;  3CZD A;  1MBL A;  5HWT A;  3FZC A;  4KZ9 A;  3VE3 A;  4GLQ A;  1BYW A;  4ZJ3 A;  3WWX A;  1TD5 A;  4OH0 A;  4K08 A;  3Q81 A;  3BQA A;  4IHQ A;  5FQJ A;  1NZO A;  4BJP A;  3C7V A;  4PMA A;  1ZTU A;  5G4Y A;  1MKM A;  1H8Y A;  2W27 A;  1L2S A;  3MMH A;  2EA9 A;  3ULF A;  2H5S A;  2PHY A;  1VHM A;  1PNE A;  3UPN A;  1ZC2 A;  3JYI A;  4OQ0 A;  4DE3 A;  2Y2P A;  2DCF A;  4FSF A;  3RXW A;  5CXW A;  4Y0T A;  5HD5 A;  1BLP A;  2VV8 A;  2ZM8 A;  1J9M A;  4LV0 A;  5K5B A;  4E3K A;  4GOG A;  1K54 A;  4E6X A;  4UA9 A;  1CEG A;  3LIA A;  4AFI A;  3OCL A;  2JKR I;  3D72 A;  1K56 D;  4HQA A;  2VK3 A;  3UMD A;  5MC7 A;  2HDQ A;  3LUQ A;  2PT7 A;  3LID A;  3CWF A;  1DP9 A;  1W8Y A;  1VEU B;  5GHZ A;  1MZU A;  2RCX A;  4S2J A;  1DP8 A;  4ZAM A;  5CTM A;  3WS0 A;  1T18 A;  5TGF A;  2J8Y A;  4XT2 A;  3HLG A;  2V0W A;  2XD1 A;  5CHJ A;  4KZ8 A;  4EBL A;  4ARZ B;  1SZV A;  3ITB A;  3CIT A;  4BD0 A;  4JGO A;  3EWK A;  2MJ6 A;  3SH9 A;  1WYC A;  4GJ4 A;  1BT5 A;  4HH3 A;  1Q2P A;  5EM0 A;  3MZD A;  4KZB A;  2UV0 E;  1NY0 A;  2INW A;  4B4Z A;  3B42 A;  1YMS A;  4HIA A;  3B47 A;  2LB5 A;  2XRN A;  3WS1 A;  3A3I A;  5TFQ A;  2PBD P;  1PZP A;  3WS4 A;  3ZHH A;  4OPR A;  1XJ3 A;  3G2Z A;  3KYZ A;  3P09 A;  3QP6 A;  3V50 A;  1OJ5 A;  5FQI A;  5AJG A;  5FI6 A;  3LIE A;  4JF6 A;  4E3I A;  3HLW A;  2JE5 A;  3MXQ A;  2XEP A;  5GLA A;  3WS2 A;  3NC8 A;  4DJ2 A;  2VX8 A;  3G6O A;  1JTG A;  2M7V A;  2WKP A;  4KG6 A;  2OWH A;  1RCJ A;  1OJG A;  2QJ7 A;  2G2W A;  1ODV A;  2V1A A;  1Q2Q A;  3NBL A;  1O07 A;  2ZC6 B;  4EES A;  2B18 A;  3C7U A;  2BG1 A;  2J9P A;  3N8L A;  1F2K A;  2EFU A;  4CLC B;  2QPN A;  3IX4 A;  3PTE A;  3TW8 A;  5DFX A;  4IVI A;  4QY6 A;  4DKI A;  1ES3 A;  1YKD A;  3MKE A;  4H8R A;  5FEG A;  4RQ9 A;  5EVI B;  2XH9 A;  4HJ3 A;  5EOO A;  2O9A A;  4KZ4 A;  4HH2 A;  1GHP A;  1QMF A;  3M6B A;  2K31 A;  2HP5 A;  3DW0 A;  5J7E A;  5CER A;  5BOH A;  4IED A;  2J9O A;  1F9I A;  2XD5 A;  3E4O A;  1FQG A;  3NIA A;  4OOL A;  3IF6 A;  4I3A A;  1L0F A;  2Q9M A;  4KQR A;  1V9Z A;  5DTK A;  1D1J A;  3A0V A;  3QNC A;  4WZ5 A;  1JWP A;  2QZ6 A;  3PAE A;  2Y2O A;  2L1M A;  4P6Z S;  4EUV A;  2WZZ A;  1ESI A;  4GN2 A;  1WE4 A;  3OCN A;  1ONG A;  2GX5 A;  2VGJ A;  4HY8 A;  2VZW A;  5FSR A;  1XJ2 A;  1CQA A;  1K56 A;  2OOL A;  4X1L A;  1W63 Q;  5J4E A;  4EEU A;  3C4O A;  5AQ9 A;  1K4E A;  5HL6 A;  1L0D A;  2BTF P;  1OPX A;  4LV1 A;  1YAX A;  3Q82 A;  3Q7V A;  4II7 A;  3L9K A;  5EPH A;  2ZJ9 A;  4NET A;  1GSW A;  3ZG5 A;  3KSI A;  4KUO A;  3R7W B;  4DRT A;  4WUJ A;  3HUM A;  3OBF A;  5HSQ A;  2WGV A;  4S2L A;  4R0Q A;  5HD3 A;  4WN5 A;  4DF6 A;  1E4D A;  5A8B A;  4LRY C;  1CK3 A;  5E43 A;  5EUA A;  5FDH A;  3T1S A;  3F1P B;  4GZB A;  4MCW A;  4BLM A;  3GTC A;  4WF0 A;  4L0L A;  5J3W A;  3F1N A;  2XR0 A;  5AVF A;  1ZG4 A;  2VGL M;  4NXB A;  2ZMV A;  5EVI D;  3QP4 A;  4G3W A;  2I72 A;  1IYQ A;  4B9O A;  1D06 A;  4O7D A;  4R70 A;  4S2I A;  4X1M A;  1C3B A;  2HDU A;  4I3J A;  4S2N C;  3FC7 A;  1G5U A;  1PW1 A;  3LY4 A;  2ZC5 B;  5HW3 A;  2FH5 A;  4LV2 A;  3IF5 A;  4WZ4 A;  3VOZ A;  2WKR A;  3ITA A;  2Y2I A;  4PKY G;  4DN0 A;  4KZA A;  2OLV A;  2ZM2 A;  1T19 A;  3O3V A;  3ZQ5 A;  1LI9 A;  4KZ7 A;  5AVE A;  5FEF A;  3ZG9 B;  3KX0 X;  4KZ5 A;  5KZH A;  2EWW A;  4PM7 A;  2ZOI A;  4NXF A;  4KUK A;  5F6A A;  4NXG A;  4OQH A;  3GRJ A;  5GHX A;  4UA6 A;  3BY9 A;  2PD7 A;  3IS2 B;  1ZG6 A;  4EQ1 A;  2Y2N A;  3HJK A;  5M1A A;  2Z6D A;  5FQQ A;  2P9V A;  4PM6 A;  4E3N A;  5M18 A;  4B93 A;  3OOV A;  3NY4 A;  2VA0 A;  4NXE A;  3BRM A;  2W3F A;  2V8F A;  2VV6 A;  4E3J A;  4JF4 A;  2WAE A;  1MKI A;  3BFD A;  4H6J A;  2HP9 A;  4XXR A;  4KZ3 A;  1FCN A;  2ZLY A;  2L4R A;  4UQI M;  4QJG A;  3LEZ A;  1TS8 A;  3T4L A;  3ZDJ A;  2QMI A;  5HX9 A;  3G32 A;  3SS4 A;  2HP6 A;  4QB8 A;  4U0T A;  3ZVW A;  3WRZ A;  1K57 A;  4UHU A;  4E6W A;  1IYS A;  1N9O A;  5D3O A;  4UAA A;  2KLI A;  4K0X A;  3S4X A;  1CF0 A;  3KSF A;  1CEF A;  4UEY A;  4G3V A;  2NUT C;  3PBN A;  2ZQC A;  4KQO A;  1Y4O A;  5EFW A;  3UB9 A;  4YIN A;  5IT5 A;  4JBF A;  3G31 A;  4QU3 A;  3KO6 A;  4GS9 B;  1YLJ A;  2BAS A;  3T4J A;  3TRC A;  2JKT I;  2EXA A;  4DE2 A;  5DFY A;  1OTI A;  1VB6 A;  2XA7 S;  3HLE A;  4JGQ A;  3HUN A;  3MSH A;  2J80 A;  3UB5 P;  1ZHH B;  2PU4 A;  2CMN A;  1CJF A;  2ZBB A;  3NHQ A;  4DDY A;  4E3M A;  4ZRR A;  1W5D A;  3VP2 A;  1NJ4 A;  2A24 A;  5FQM A;  4ZDX A;  2JKG A;  4RVA A;  4X55 A;  3RFB A;  3LR4 A;  2O0Y A;  2NUP C;  3HLF A;  5DKL A;  1OME A;  5KSH A;  3GVB A;  3I7J A;  1LL8 A;  4HBU A;  2M1C A;  5EV0 A;  2PYR A;  2AVX A;  3P7N A;  4QWO A;  3E4P A;  3HBR A;  1OTB A;  2HDS A;  3VP1 A;  1E3U D;  1S0W A;  5A92 A;  3IXB A;  3CUE C;  3M6H A;  3K3D A;  3OPL A;  1HZO A;  4FCF A;  1FOF A;  5CX7 A;  1YQS A;  3UY6 A;  4I3I A;  5FI2 A;  3IH8 A;  2X01 A;  2V1Z A;  1KGF A;  2L0W A;  4O0P A;  2D02 A;  1G6A A;  2VEA A;  4Q0H A;  4WEK A;  5CTN A;  4BL2 A;  4QY5 A;  1G28 A;  3LGO A;  2HV1 A;  3JVV A;  1YLZ A;  2H28 A;  4HJ6 A;  1NYY A;  4JPM A;  4ZJ1 A;  3TE8 A;  3EQU A;  5L10 A;  3TG9 A;  4Z9Q A;  5KSC A;  2XQZ A;  4L9F A;  4R4R A;  3VSL A;  1K57 C;  2X02 A;  5CED A;  5FL3 A;  1XXM A;  1NWZ A;  2ZL1 B;  4Q0J A;  4P0M A;  1S4R A;  3T4O A;  3GR2 A;  2H0T A;  1IOU A;  4KG5 A;  1Y54 A;  2ZD8 A;  1OT9 A;  3HVF A;  2EX6 A;  3W4Q A;  4BL3 A;  4CLC C;  4LCM A;  4PM8 A;  1K38 A;  3G35 A;  3NDE A;  5U47 A;  3RXX A;  4MLL A;  3MFX A;  3LEQ A;  4DE1 A;  5CGX A;  1T1C A;  3TJZ C;  4ID4 A;  3V67 A;  2Y2H A;  1FR6 A;  1H3Q A;  1KGG A;  5EVI C;  1OTA A;  1I2S A;  4GHI B;  1YPR A;  5TBM B;  1ERO A;  2PBY A;  4LFU A;  2JN7 A;  2E8J A;  1QME A;  4PM9 A;  1YLT A;  1AXB A;  3BLM A;  4HEF A;  3VSK A;  2G2U A;  1DJB A;  2PAV P;  4X53 A;  3VE4 A;  4GNU A;  3E2K A;  2Y55 A;  1A0K A;  1GHI A;  2ZC4 B;  3T4Q A;  3C4P A;  4Y0U A;  4P85 A;  4Y13 A;  4ZJ2 A;  4HHD A;  1OTE A;  4P6B A;  3MZE A;  3ZG8 B;  4RX3 A;  3QP5 A;  5HZH A;  4R3A A;  4BBV A;  1E25 A;  1K4F A;  5JYO A;  5DKK A;  3VMA A;  3LIB A;  3S7P A;  2Z2L B;  3FKV A;  3UE0 A;  5HDD A;  5GLD A;  3PBO A;  3SS3 A;  3BW6 A;  5F1F A;  2EXB A;  5FAP A;  4PHT A;  1VET B;  2W1R A;  1LSW A;  3OPR A;  4S2K A;  1PWG A;  4NKP A;  2Y59 A;  4LEN A;  2FZ0 A;  4L9G A;  2ZQ7 A;  4GW9 A;  4ESP A;  1NLZ A;  5IHV A;  4Y0O A;  2O9C A;  3T1R A;  2OV5 A;  1ES2 A;  4JGP A;  5GLC A;  3GEC A;  3G34 A;  1DRM A;  3F1O A;  5HAR A;  3NOU C;  3UPP A;  3SS5 A;  3Q07 A;  1HTZ A;  1TF1 A;  4CJN A;  2HZ5 A;  3TOI A;  3H7W B;  5G4Z A;  3H82 A;  3QP1 A;  4S2N A;  3DBA A;  4Y5F A;  4EUZ A;  1IFQ A;  4HBT A;  2QJ5 A;  3HLC A;  4K91 A;  4MN7 A;  3T4T A;  2JKR M;  4CPK A;  1LL5 A;  3AGD A;  4IJG A;  4LCL A;  4WEL A;  2H10 A;  3IX3 A;  4C6Y A;  3W8K A;  4GS9 A;  1OTD A;  4KG2 A;  4JKT A;  4WMC D;  3B33 A;  1H5X A;  2WAF A;  3W4O A;  4OLD A;  3RH8 B;  2EX8 A;  5J8X A;  3E4Q A;  4BBU A;  3M2J A;  4NG2 A;  1SKO A;  3HUO A;  3IWQ A;  1ACF A;  3IXH A;  3MQO A;  3V3R A;  1F5M A;  5HPF A;  4R6L A;  1CI9 A;  1RGZ A;  1TEM A;  3CI6 A;  2IWD A;  2O9B A;  3PBT A;  3P01 A;  1LSX A;  3OZH A;  1K6R A;  1Y28 A;  3BJN A;  2WGW A;  4WM9 A;  1XA7 A;  4Z1W A;  4U3T A;  1S1Y A;  3D4F A;  3NCK A;  3NOP C;  1L0G A;  3PYP A;  5EVE A;  1BLC A;  1O7E A;  3BWL A;  3L7H A;  4YOF A;  3MXR A;  3HLD A;  1SCW A;  2E8I A;  4DMZ A;  1XKZ A;  2VGL S;  4CQH A;  3LR0 A;  2OLU A;  3IWI A;  3T4S A;  4JF5 A;  4OLG A;  5HL1 A;  4CLC D;  3A0R A;  3BYD A;  1N9L A;  1NZU A;  4QD4 A;  3O87 A;  2GNX A;  4YWZ A;  4RA7 A;  1XGJ A;  1KE0 A;  4MNR A;  4MEZ A;  1YSP A;  1P9W A;  1H8Z A;  3K2N A;  4Y17 A;  5DTT A;  5E2G A;  3SZT A;  3BLS A;  5E2F A;  1XJ6 A;  4JLF A;  3IHB A;  1Z6F A;  4O8G A;  1YSQ A;  2WKI A;  3E0Y A;  3N8R A;  4HJ4 A;  5CEB A;  2XDM A;  5F1G A;  3VFH A;  4ME4 A;  4Y3I A;  3UDF A;  5IS1 A;  1NRF A;  3T1X A;  1S6R A;  3MQQ A;  1ERQ A;  2KX6 A;  3UB7 A;  2A2L A;  3UE3 A;  5FQK A;  5IU1 A;  1K6S A;  1KE4 A;  1XFN A;  2Q0O A;  4Y7P A;  4LRX C;  4IBX A;  3FPW A;  4ZBE A;  4B88 A;  3WRT A;  3VOY A;  4S2O A;  3ZG0 A;  2ZC7 A;  1YT4 A;  1I2W A;  1P9R A;  3PR6 A;  3EEH A;  1VEU A;  3OLO A;  5DJU A;  2EX2 A;  3Q1F A;  1HD8 A;  2HF6 A;  3DTK A;  3MXS A;  2XSS A;  3MKF A;  3GV9 A;  3N8S A;  1KE3 A;  2ZQA A;  4HOI A;  4XT2 B;  4I39 A;  4YNR A;  5I5L A;  4BD1 A;  4WBG A;  4PPR A;  2J3T D;  2XLN A;  3DTE A;  4DXB A;  1BTL A;  4OKP A;  4KQQ A;  1BUL A;  3BEB A;  4ARZ A;  4ETZ A;  5DF8 A;  1S1Z A;  3TSG A;  3S7O A;  3G30 A;  2UWX A;  3CUE A;  1SKF A;  3H9W A;  4R23 A;  4WMC A;  4PAU A;  1GA0 A;  1SDN A;  5DVA A;  1I5Q A;  2JC7 A;  5CGS A;  1T1B A;  4UQI S;  2X71 A;  4I38 A;  5HAQ A;  2JCH A;  5FA7 A;  4HP4 A;  1XPB A;  4YFM A;  2WKQ A;  3BFG A;  3FYZ A;  4GKU A;  1FCO A;  4QHC A;  3A3E A;  4MN5 A;  2GZA A;  1CI8 A;  1VET A;  2P7J A;  3PXP A;  1YMX A;  2H0Y A;  2EX9 A;  3GSG A;  3HRE A;  4PM5 A;  1N4O A;  1XA1 A;  3EGD C;  4BQM A;  2IWB A;  1ZKJ A;  2XFT A;  4X25 A;  4EBN A;  1PZO A;  1IKG A;  4FH2 A;  3FWL A;  4IVK A;  5HDC A;  1MXO A;  2R9W A;  4CLC A;  3T12 B;  5F83 A;  4FD8 A;  2Y2L A;  4X69 A;  1PI4 A;  4OQG A;  3DTM A;  4XUZ A;  1W8Q A;  3QNB A;  4DE0 A;  1PYY A;  1W79 A;  5EVI A;  3IH9 A;  3BFE A;  3VP4 A;  4DJ3 A;  3N6I A;  2V9A A;  2W1T B;  1GCE A;  3PAG A;  3UE6 A;  1SHV A;  1WA9 A;  5GLB A;  3BM6 A;  4HI4 A;  3IF6 B;  5TR7 A;  3LIC A;  1KVL A;  3DWZ A;  3A3F A;  3UDX A;  3CPT B;  4D60 A;  4OPZ A;  1NXY A;  3KSG A;  2PRF A;  2C6W B;  4OOY A;  2ACG A;  1F98 A;  1GSV A;  2EWV A;  2J3W A;  1NYM A;  2IWC A;  2JBF A;  1W7F A;  4BBT A;  5M19 A;  3FKW A;  2XGN A;  1N9B A;  4EXO A;  2ZC3 B;  3UME A;  3HCY A;  3PBS A;  3Q7V B;  2V1B A;  1YLY A;  4OOM A;  1FR1 A;  4FOF A;  2QKP A;  4M4X A;  3QHY A;  2PD8 A;  2ZM0 A;  4Y2F A;  2KOI A;  2K7S A;  4L9E A;  1IYP A;  1TDG A;  2VJW A;  2ZQD A;  4GD8 A;  3R7W A;  1MPL A;  2Y91 A;  4Y15 A;  5EM1 A;  3O88 A;  1XX2 A;  2HJ9 C;  4F3L B;  1X0O A;  1EI5 A;  3ICY A;  2V8C A;  1W63 M;  2QHK A;  2OAP 1;  3UPO A;  1GHM A;  2ZMA A;  3E98 A;  3NOT C;  2XF3 A;  5HWW A;  1N9N A;  4MMN A;  4OON A;  3C5A A;  3N7W A;  1YLP A;  3F1P A;  3F1N B;  1VQQ A;  2FFF B;  3IQA A;  5KIZ A;  3LI8 A;  4C75 A;  3LFV A;  5A90 A;  1MWS A;  3IBR A;  1JVJ A;  4C3Q A;  3A3D A;  4HES A;  1EWZ A;  3OC2 A;  5HFO A;  1XGI A;  2W3G A;  1LHY A;  2W3D A;  4E04 A;  4OPQ A;  1FCM A; 
#chains in the Genus database with same CATH homology
 2QJ5 A;  4I3J A;  4MN7 A;  5HDS A;  3T4T A;  2JKR M;  1UGU A;  3FC7 A;  4LPZ A;  1D7E A;  2JKT M;  2P08 A;  4IJG A;  1KOU A;  3W2Z A;  3EOI A;  3LI9 A;  2VKS A;  1G6O A;  4WEL A;  3A0S A;  1S66 L;  2GJ3 A;  1MC0 A;  4BMW A;  2FH5 A;  3RTY A;  4EEP A;  5F68 A;  4GS9 A;  3JVU A;  4Q0I A;  1OTD A;  2WKR A;  4IUH A;  5DF9 A;  3IBJ A;  3PHY A;  2Z6C A;  4PKY G;  4DN0 A;  3EGX C;  3R4K A;  3B33 A;  4WEJ A;  3RH8 B;  1T19 A;  4LRZ E;  3ZQ5 A;  3E4Q A;  4BBU A;  5L8M A;  5AVE A;  2V0U A;  1XFQ A;  3KX0 X;  3MQO A;  1F5M A;  2XA7 M;  2EWW A;  5HPF A;  2I9V A;  2ZOI A;  1NRJ A;  4NXF A;  4KUK A;  5F6A A;  4NXG A;  2DMW A;  4R6L A;  3C30 A;  3S7N A;  4I5S A;  3CI6 A;  3EEA A;  2O9B A;  3PBT A;  3BY9 A;  1T1A A;  2PD7 A;  3IS2 B;  4EQ1 A;  3LR3 A;  3CAX A;  3P01 A;  3EQV A;  4HNB A;  3HJK A;  3IS2 A;  1XJ4 A;  1LSX A;  4QPR A;  2Z6D A;  1Y28 A;  3BJN A;  2VV7 A;  4Z1W A;  3U2A A;  2B02 A;  2PR6 A;  1S1Y A;  3OOV A;  4B93 A;  1TS0 A;  3NOP C;  3PYP A;  2VA0 A;  4NXE A;  3BWL A;  3VOL A;  4YOF A;  2W3F A;  2VV6 A;  5HWT A;  1TS6 A;  4DMZ A;  3VE3 A;  4GLQ A;  4H6J B;  1BYW A;  2VGL S;  4CQH A;  3LR0 A;  3UB8 A;  2P04 A;  4H6J A;  2J3T C;  3T4S A;  4CLC D;  3A0R A;  2L4R A;  1N9L A;  1TD5 A;  4YWZ A;  2GNX A;  4K08 A;  4UQI M;  3BQA A;  1TS8 A;  3T4L A;  4IHQ A;  1YSP A;  1P9W A;  4BJP A;  1ZTU A;  3K2N A;  5G4Y A;  1MKM A;  2W27 A;  4IUK A;  4GCZ A;  3MMH A;  2EA9 A;  3ULF A;  1XJ6 A;  2PHY A;  1VHM A;  4O8G A;  1YSQ A;  3E0Y A;  4EET B;  4HJ4 A;  1N9O A;  2D01 A;  4R38 A;  1UWP X;  4ME4 A;  3MF0 A;  2KLI A;  5F69 A;  4Y3I A;  4EU0 A;  5IS1 A;  3KSF A;  3KSH A;  4FSF A;  5HD5 A;  4UEY A;  2VV8 A;  4G3V A;  2NUT C;  3MQQ A;  3PBN A;  4KQO A;  4ETX A;  2KX6 A;  3UB7 A;  5K5B A;  5EFW A;  2A2L A;  3UB9 A;  3UE3 A;  3FG8 A;  5IU1 A;  5IT5 A;  1XFN A;  3LIA A;  3GDI A;  3KO6 A;  4GS9 B;  4LRX C;  4AFI A;  3OCL A;  2JKR I;  2BAS A;  3D72 A;  3HJI A;  3T4J A;  4HQA A;  3VV4 A;  3FPW A;  3TRC A;  3UMD A;  2JKT I;  5DFY A;  5HPI A;  5MC7 A;  1OTI A;  1VB6 A;  3LUQ A;  2XA7 S;  4JGQ A;  2PT7 A;  3CLO A;  3LID A;  3CWF A;  1DP9 A;  1UWN X;  2YKH A;  3LIF A;  1OT6 A;  1MZU A;  2J80 A;  2W3E A;  1P9R A;  2W1T A;  3BQ8 A;  3PR6 A;  5C5K A;  3EEH A;  3OLO A;  3NJA A;  5DJU A;  1DP8 A;  4BWI A;  1ZHH B;  2HF6 A;  2CMN A;  2ZBB A;  2XSS A;  3NHQ A;  2OAQ 1;  4ZRR A;  1DP6 A;  1T18 A;  4HOI A;  2A24 B;  1GSX A;  2OWJ A;  4XT2 B;  4I39 A;  4YNR A;  2A24 A;  5I5L A;  4XT2 A;  2V0W A;  2J3T D;  3RFB A;  3LR4 A;  2O0Y A;  2NUP C;  4ARZ B;  5DKL A;  3CIT A;  5KSH A;  4JGO A;  1LL8 A;  4ARZ A;  4ETZ A;  3EWK A;  2MJ6 A;  1S1Z A;  2O99 A;  2M1C A;  3S7O A;  2PYR A;  3CUE A;  4GJ4 A;  3H9W A;  3P7N A;  3K3C A;  4HH3 A;  4P6Z M;  3UB6 A;  4PAU A;  3E4P A;  2INW A;  2KDK A;  1OTB A;  1T1B A;  3B42 A;  4UQI S;  4LLO B;  2M7U A;  4HIA A;  3B47 A;  2LB5 A;  5LBR A;  2XRN A;  3CUE C;  3K3D A;  4PKY A;  4I38 A;  2VLG A;  5CX7 A;  2PR5 A;  1XJ3 A;  3KYZ A;  4I3I A;  1OJ5 A;  4HP4 A;  5AJG A;  2WKQ A;  3LIE A;  2L0W A;  4O0P A;  4F3L A;  3MXQ A;  1P0Z A;  2D02 A;  3MJQ A;  2VEA A;  2QYB A;  4Q0H A;  4CLC E;  4WEK A;  4DJ2 A;  2VX8 A;  1EW0 A;  3G6O A;  2M7V A;  4MN5 A;  2WKP A;  2GZA A;  1G28 A;  2OWH A;  2P7J A;  3PXP A;  2HV1 A;  3JVV A;  1OJG A;  2W3H A;  1S4S A;  2QJ7 A;  2H28 A;  2IA2 A;  4HJ6 A;  3EGD C;  1ODV A;  2V1A A;  3TE8 A;  3LYX A;  3EQU A;  3S7Q A;  4EES A;  4L9F A;  2B18 A;  4EW7 A;  3LR5 A;  2K2N A;  5FL3 A;  1NWZ A;  2LB9 A;  4Q0J A;  5HDC A;  4CLC B;  1S4R A;  3T4O A;  3TW8 A;  2YKF A;  4JGR A;  5DFX A;  3D3O A;  4CLC A;  1IOU A;  1LSV A;  1OT9 A;  1YKD A;  2Y79 A;  1NLY A;  4RQ9 A;  4CLC C;  4HJ3 A;  2O9A A;  4HH2 A;  3MFX A;  2R78 A;  2K31 A;  4DJ3 A;  2Y8H A;  2V9A A;  2W1T B;  1T1C A;  3UE6 A;  5J7E A;  3TJZ C;  3V67 A;  1WA9 A;  2QWS A;  1H3Q A;  4HI4 A;  1F9I A;  3E4O A;  1OTA A;  3PBR A;  1H8M A;  3LIC A;  4G3K A;  4OOL A;  4GHI B;  4I3A A;  5TBM B;  1V9Z A;  2JN7 A;  3MQ0 A;  4GHI A;  3T50 A;  5TBM A;  4WLA A;  2XRO A;  3A0V A;  2JHE A;  3O5Y A;  2L1M A;  4P6Z S;  3KSG A;  4EUV A;  3OCN A;  1F98 A;  1GSV A;  3BY8 A;  2GX5 A;  4HY8 A;  2VZW A;  3FPV A;  1XJ2 A;  2EWV A;  2J3W A;  2W0N A;  4BBT A;  4WL9 A;  2OOL A;  1W63 Q;  5J4E A;  4EEU A;  3VE4 A;  4EXO A;  5HL6 A;  3UME A;  3HCY A;  4NEE D;  3T4Q A;  1OPX A;  3PBS A;  3PBQ A;  1YAX A;  2V1B A;  4II7 A;  4HHD A;  4O01 A;  4OOM A;  1OTE A;  1S67 L;  1GSW A;  4MDZ A;  3KSI A;  4FOF A;  4KUO A;  2QKP A;  4M4X A;  5HZH A;  2PD8 A;  4R3A A;  4Y2F A;  4BBV A;  2KOI A;  2K7S A;  5DKK A;  4L9E A;  3R7W B;  5DJT A;  2VJW A;  4WUJ A;  3R7W A;  3LIB A;  3OBF A;  3S7P A;  5HSQ A;  2ZOH A;  5F5Y A;  2ZMF A;  4MN6 A;  5HDD A;  2PYP A;  3PBO A;  2HJ9 C;  5TJJ A;  4F3L B;  1P97 A;  1X0O A;  3BW6 A;  2PDR A;  5HD3 A;  3ICY A;  4WN5 A;  1W63 M;  2QHK A;  2OAP 1;  5HWV A;  4PHT A;  1LT0 A;  5A8B A;  2W1R A;  1LSW A;  4LRY C;  3E98 A;  3NOT C;  5HWW A;  1N9N A;  4MMN A;  3C2W A;  4NKP A;  2HJE A;  3F1P B;  1STZ A;  2FZ0 A;  3C38 A;  2HGV A;  4MCW A;  3KYQ A;  3SW1 A;  4L9G A;  3F1P A;  4GW9 A;  1NLZ A;  3F1N B;  4WF0 A;  4L0L A;  2O9C A;  5J3W A;  3F1N A;  3F1O B;  4JGP A;  5AVF A;  3MR0 A;  2G7U A;  2VGL M;  3GEC A;  5KIZ A;  4NXB A;  3LI8 A;  1DRM A;  3T4K A;  3F1O A;  3NOU C;  2ZMV A;  4G3W A;  3LFV A;  3IBR A;  1TF1 A;  3H82 B;  3C8C A;  3H7W B;  4KQD A;  5G4Z A;  3OC2 A;  3H82 A;  2W3G A;  2W3D A;  1JNU A;  4E04 A;  3H7W A;  3DBA A;  4Y5F A;  1TS7 A;  4B9O A;  4EER A;  1D06 A;  4R70 A;  1IFQ A;  1V9Y A;  4HP9 A;  3ZYT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...