3M2JA

Crystal structure of fluorescein-labeled class a -lactamase penp
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
256
structure length
256
Chain Sequence
DDFAKLEEQFDAKLGIFALDTGTNRTVAYRPDERFAFASTIKALTVGVLLQQKSIEDLNQRITYTRDDLVNYNPITEKHVDTGMTLKELADASLRYSDNAAQNLILKQIGGPESLKKELRKIGDEVTNPERFCPELNEVNPGETQDTSTARALVTSLRAFALEDKLPSEKRELLIDWMKRNTTGDALIRAGVPDGWEVADKTGAASYGTRNDIAIIWPPKGDPVVLAVLSSRDKKDAKYDDKLIAEATKVVMKALN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Beta-lactamase
publication title Crystal Structure of fluorescein-labeled Class A -lactamase PenP
rcsb
source organism Bacillus licheniformis
total genus 88
structure length 256
sequence length 256
chains with identical sequence B
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2010-03-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00144 Beta-lactamase Beta-lactamase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 3m2jA00
3ZG0A 3Q07A 1MWTA 1EI5A 3IXHA 3N8LA 3V3RA 3IQAA 3ZCZA 3B3XA 3S4XA 3W4OA 2UWXA 3IF6A 1BTLA 4GD6A 4LV3A 4U0XA 1K54C 2Y2PA 5CXWA 1GA0A 2X02A 4D2OA 2EXBA 2ZM8A 4QJGA 3MXSA 1Z6FA 2ZQ8A 4FD8A 2R9WA 3BFDA 2WYXA 1K55A 1ZC2A 3BFGA 1TEMA 2C5WB 4DE2A 1I5QA 1O07A 5CEBA 5CHUA 2Y2QA 1XP4A 4OP8A 5FQ9A 1ZG6A 2Y2MA 2Y2JA 4CJNA 4UA6A 2XGNA 3OPRA 1H8ZA 2Y2IA 2OV5A 2Y2NA 4CPKA 4YINA 2EX8A 3UE0A 2A49A 3VP2A 4DDSA 1EWZA 4IVKA 2Y4AA 1KDSA 4BJPA 2V20A 1YQSA 3NDGA 5EVID 2XEPA 5G18A 2X71A 5FQKA 5KZHA 1MBLA 1W8QA 3PBRA 3ZHHA 2WK0A 1YLZA 2HDSA 1H8YA 4KZ5A 4X69A 3HLBA 4S2NC 4E3NA 1O7EA 3G2YA 4Q8IA 1MXOA 2IWDA 2I72A 1NXYA 3N8SA 2P9VA 4R3BA 5DF7A 5FAOA 3RXWA 1HVBA 2C6WB 4A5RA 4BL3A 4S2MA 2EFXA 4DXBA 5E2FA 2Y2KA 3N7WA 2IWCA 2P9VB 2JBFA 1IELA 3IWQA 3MZDA 3PAEA 3Q1FA 5FASA 5HAQA 4KG5A 4KENB 4KQOA 1PYYA 3HLFA 4DE0A 3WRZA 1PI5A 1J9MA 3A3IA 5GLDA 5KMWA 3NDEA 4JXSA 4RVAA 2J8YA 4U3TA 2XR0A 4X6TA 5CHJA 2WUQA 4OVDA 1ZKJA 1JTDA 2WKHA 5FDHA 3VOYA 2EFUA 1KE0A 2XD1A 1SDNA 3IXDA 5JYOA 4S2KA 3HLEA 4XUXA 3VP1A 2ZQ9A 4RYEA 1ES3A 3MKEA 4EQIA 1KVLA 3A3JA 1PZOA 1HD8A 1ONGA 3O87A 2HP6A 2WGVA 3V5MA 4OPYA 1L0EA 1M40A 1W5DA 5FAPA 1U60A 3WS4A 1L0DA 3IXGA 4PMAA 4E3JA 3SOIA 1G6AA 1PW1A 4OPRA 3V39A 3IF5A 3HLWA 2PBYA 5E2GA 3N6IA 4OQ0A 3WS5A 1XGJA 3BM6A 1ES5A 3UDIA 2V1ZA 1K25A 3UO9A 3ZG5A 1E3UA 4BL2A 4E3LA 4XXRA 1BLSA 2WKIA 3HL9A 1ESUA 3UE3A 4Y7PA 3AGDA 4BENA 3AGFA 3UPNA 1RGYA 2XK1A 4E6XA 1DJAA 4WZ5A 1SHVA 4JF4A 4N9LA 4S2PA 2EXAA 3ZVWA 4UHUA 2IWBA 1JWZA 3SS3A 1ALQA 1PZPA 1H5XA 3S22A 4OP5A 4X68A 4OOMA 1L2SA 1TDLA 3ITAA 4ZDXA 5A93A 2H5SA 3CG5A 3N4IA 2XDMA 4RX3A 4E3OA 3G4PA 4N9KA 5CTNA 1PW8A 1ERMA 2WZXA 2H0TA 5BOHA 3IHAA 1W7FA 3HLDA 5EPHA 1XXMA 3OCLA 2E8IA 2WAEA 3FKVA 4KZ9A 4MEZA 5E2EA 4N1HA 3HUMA 3OPHA 1IYOA 2WGIA 4ID4A 1FCNA 5EVIB 5DVAA 4ZJ2A 1FQGA 2VGKA 5HX9A 3P09A 1K6RA 2Y91A 4KZ8A 2XF3A 1E3UD 5CTMA 4BD0A 1W79A 2J7VA 4O7DA 4Y0TA 1VQQA 3PBOA 3QHYA 3EQUA 4K0XA 2ZQDA 1MPLA 1XA1A 4OPQA 2HDUA 3HLCA 3IXBA 3W8KA 3BFEA 4OPZA 4DKIA 2Y2LA 3IF6B 5DTKA 2EX9A 4JKTA 3WS1A 3IT9A 3OZHA 3UE1A 4UA9A 1L0FA 3HREA 3Q7ZA 3G35A 4LCMA 5FI7A 3C5AA 4QY6A 2XLNA 4LCLA 1NY0A 1YMXA 3DWZA 1YLYA 1JVJA 3NCKA 3UPPA 3OPPA 1IKIA 3GR2A 3NC8A 1DJBA 2GDNA 4MBKA 5M1AA 3CZDA 3G31A 3PBQA 4EUZA 4WM9A 5EOOA 2XD5A 4DRTA 1YLWA 3ZG7B 2HP5A 2PU4A 5HAPA 3VSKA 3VSLA 2ZQCA 5HW3A 5J8XA 3PBTA 1WYBA 4NK3A 1KE4A 1K55C 4WELA 1ES2A 1K4EA 4JF5A 4B4XA 2Y2HA 2ZLYA 2CC1A 5HAIA 3N8RA 4P87A 1YLJA 2QMIA 3G2ZA 4M3KA 3W4PA 1CI9A 2WAFA 4MNRA 3ZGAB 1PWGA 1FR1A 3E2LA 4QY5A 1WYCA 1K57A 4X55A 2EX6A 4OQHA 3CMZA 4KG6A 4U0TA 1C3BA 1W8YA 1NRFA 3GVBA 5CHMA 1Q2PA 3BFCA 5KSCA 3BEBA 4JF6A 4KZ4A 5FATA 5FQQA 3ZNYA 4WEKA 4DE3A 5FQIA 2H0YA 3GQZA 1LI0A 1CEFA 2ZD8A 2J9PA 4MBFA 3SH8A 5E2HA 1LLBA 2JC7A 1I2SA 4N92A 1SDEA 1GCEA 2HDQA 4GKUA 4GNUA 5FSRA 4HBUA 3VP4A 2BG1A 2JCHA 4HBTA 2H10A 1K38A 1S6RA 4X53A 4B88A 3ZG9B 3IH8A 5AQ9A 4WZ4A 4E6WA 4WYYA 1XA7A 4KQRA 1GHPA 4OQGA 5GHYA 4K0WA 3FYZA 4R0QA 1FCMA 4JLFA 5CGSA 1FOFA 5A92A 2HPBA 3C7VA 3PBNA 2HP9A 4OH0A 3VP0A 3GV9A 2G2UA 4P85A 5AQBA 5CECA 1BSGA 4MBHA 4EWFA 1LL5A 1LHYA 3M6BA 1XKZA 3V50A 1CI8A 1ERQA 1GHMA 3CJMA 3O3VA 3OC2A 3O86A 3M6HA 3UN7A 1SCWA 3G30A 4EBNA 2Y2GA 1KVMA 5FQMA 5EVLA 4GN2A 2QPNA 4S2JA 4EV4A 1PWCA 4EBPA 4FCFA 1GHIA 1PI4A 4KZ7A 5EUAA 2XQZA 5U47A 4H8RA 1DY6A 2WADA 4LV0A 1G68A 3LCEA 1YLPA 5CEDA 1IYPA 3WS0A 2ZQAA 4JXVA 1NZUA 3NBLA 2XFTA 1AXBA 3Q82A 2Z2LB 3Q7VA 3SS4A 5CERA 2QZ6A 4DF6A 4ZJ1A 4JXGA 4XUZA 1FSWA 1Q2QA 2Y2OA 3D4FA 4E3MA 5GLBA 2JE5A 4N1XA 3SH9A 1FSYA 3C4OA 1BLHA 1MWSA 5FI6A 3VFHA 1TDGA 3HBRA 4GOGA 4IBXA 2VGJA 2WZZA 4DXCA 4GB7A 4KZ3A 5FAQA 2ZC4B 2ZMAA 4FH2A 4IBRA 3A3FA 4OKPA 3LO7A 1ESIA 4FSFA 2ZC3B 4GDBA 1FR6A 1Y54A 2ZC6B 1RP5A 1CEGA 3WS2A 4LENA 4GDNA 2ZQ7A 2J9OA 1BT5A 1TVFA 3RJUA 3UDXA 2OLVA 3NIAA 4UA7A 5GHZA 1K54A 3VMAA 1ZG4A 3UY6A 3IHBA 3PBSA 1N9BA 4IEDA 5EOEA 3QNBA 5CRFA 3VOZA 1K56D 4E3IA 5FI2A 5EVIC 5EE8A 4Y0OA 5DF8A 5CGXA 2XFSA 4KZ6A 1IYSA 3SS5A 4OOLA 3LY4A 3G34A 4KZBA 5F1FA 4BD1A 4JPMA 3WWXA 3MKFA 4PM8A 1BULA 4K91A 4YFMA 4PM5A 1XX2A 3UPOA 5GHXA 3IF6C 3QNCA 3ZFZA 3MBZA 5DF9A 4Z9QA 5F1GA 3RXXA 4RX2A 3G32A 4LV1A 4R4RA 4OLGA 4QHCA 2FFFB 3TOIA 4S2NA 3TG9A 4GD8A 4LV2A 5L2FA 5A90A 5M19A 1PWDA 3ZVTA 1SKFA 4RA7A 2HDRA 2A3UA 4B4ZA 3V3SA 4DE1A 3IWIA 1LI9A 4JXWA 4OONA 1N4OA 5TFQA 3UDFA 4DDYA 4ZJ3A 1KE3A 1WE4A 3BLSA 4MLLA 4WMCA 4BQMA 2Y55A 1S0WA 1ONHA 2WGWA 2XH9A 4KQQA 4WBGA 3WRTA 2Z2MB 5E43A 1JWVA 3C4PA 2ZC5B 3ZDJA 3VP3A 1IKGA 3FWLA 2WGWB 4OOYA 3IH9A 1L0GA 5F83A 1XPBA 2ZM2A 2OSUA 3NI9A 2X01A 3BLMA 3TSGA 3DW0A 4R3JA 5AQ7A 4R4SA 3BYDA 1NYYA 5TR7A 3MFDA 1BLCA 2G2WA 1QMEA 4X56A 1HTZA 5GL9A 1YM1A 1RCJA 4QB8A 1K57C 2Q9MA 2ZM0A 4KG2A 3E2KA 1XGIA 2B5RA 2R9XA 1FCOA 1CK3A 1KGEA 3Q81A 3ITBA 4Y0UA 3SH7A 3FZCA 3EQVA 4C75A 2DCFA 5HARA 3C7UA 4IVIA 3MXRA 3OPLA 5GLAA 4BLMA 3W4QA 1BUEA 1EROA 1IEMA 4NETA 3MZEA 4GZBA 5KSHA 4C3QA 4HEFA 3M2JA 4F94A 4S2LA 1I2WA 2DNSA 4JBFA 3GMWA 2RL3A 4R23A 1JWPA 3HLGA 3HVFA 5GLCA 3PTEA 1LL9A 4P6BA 4WMCD 5CGWA 4ZBEA 3MZFA 1PIOA 4PM6A 1MKIA 4S2IA 5AQAA 1K56A 3FV7A 5D3OA 5TGFA 3GSGA 2V2FF 3A3DA 2ZC7A 3S1YA 5HL1A 2Y59A 3PAGA 3LEZA 3FKWA 3NY4A 3I7JA 3GTCA 2EX2A 1NJ4A 3M2KA 3ZNTA 5F82A 2DRWA 5I94A 3VFFA 1KDWA 3P98A 4R1GA 3DWKA 1HZOA 3Q7VB 3GRJA 3ZG8B 1NYMA 2PU2A 1K4FA 2Q9NA 4OLDA 2P74A 4KZAA 4WZ5C 1E4DA 5FQJA 5IHVA 3AGEA 1MWUA 3O88A 1K6SA 2FFYA 4PPRA 4S2OA 5HFOA 3HUNA 3JYIA 1E25A 1KGGA 3ISGA 2ZJ9A 4QD4A 2BLSA 3BFFA 2OLUA 3OCNA 1BLPA 1YT4A 4ZAMA 3IWOA 5DTTA 5EECA 4PM9A 4UAAA 4WEJA 4E3KA 5FA7A 1KGFA 1JTGA 4ZTKA 2WKEA 1M6KA 3UNWA 5JYPA 4EBLA 1IYQA 1DJCA 1MWRA 2RCXA 5A91A 1YMSA 3BECA 4P0MA 1OMEA 1QMFA 1VM1A 4FH4A 5EVIA 1ES4A 1MY8A 4QU3A 4C6YA 1GA9A 1YLTA 3A3EA 4L0LA 3DTMA 5M18A 4HESA 1BZAA 4OQIA 1RGZA 1NZOA 3BRMA 4PM7A 3HUOA 5DTSA 3LY3A
chains in the Genus database with same CATH superfamily
3N8LA 1BTLA 4GD6A 2Y2PA 4IUKA 1GA0A 2X02A 2ZM8A 3SW1A 3MXSA 1Z6FA 2ZQ8A 2EA9A 3BFGA 1T19A 4DE2A 1I5QA 2NUTC 4EERA 5CHUA 5DJTA 2Y2QA 1OTIA 1T1CA 2K7SA 4CPKA 1JNUA 1PNEA 2A49A 1EWZA 2Y4AA 4BJPA 3KSFA 5KZHA 4UEYA 1ZHHB 2X71A 1MBLA 1PRQA 1S67L 1H8YA 2M1CA 3MS6A 2IWDA 2I72A 3B47A 5TBMB 3N8SA 4R3BA 4A5RA 1XFNA 4S2MA 4DXBA 3DTEA 2P9VB 2JBFA 3Q1FA 3PAEA 4KENB 1VETB 4KQOA 4EEUA 2PYRA 1J9MA 3NDEA 2QWSA 1H3QA 5FDHA 2EFUA 3IXDA 3HLEA 2XSSA 2ZQ9A 2NUPC 2EWWA 1L0EA 1M40A 1U60A 1L0DA 3IXGA 4E3JA 3SOIA 1PW1A 3WS5A 1N9OA 3BM6A 1TS0A 3T4KA 2V1ZA 3ZG5A 2KDKA 3TRCA 3HL9A 4Y7PA 1RGYA 4E6XA 3IX4A 4JF4A 2EXAA 3D3OA 4UHUA 2IWBA 1H5XA 3D9YA 5A93A 4WN5A 3CG5A 4E3OA 5CTNA 2J3TC 4NXBA 5HWVA 1W7FA 3T4TA 2E8IA 2JKRI 3FKVA 4KZ9A 3BY8A 5E2EA 3OPHA 1IYOA 5EVIB 2WKRA 1FQGA 2VGKA 2W3HA 2XF3A 4X1LA 1W79A 5EVEA 5J7EA 5FEFA 3UB6A 2HDUA 3W8KA 3IF6B 2VV8A 3OZHA 3BWLA 1T1BA 3Q7ZA 3G35A 5FI7A 3MF0A 3C5AA 4LCLA 3LIFA 3NCKA 5M1AA 3G31A 4EUZA 4EU0A 3F1OB 4DRTA 1VHMA 3PBTA 4NK3A 2J80A 1KE4A 4HJ4A 1K55C 2CC1A 5A8BA 5F69A 3G2ZA 3ICYA 3W4PA 1PWGA 1FR1A 2G7UA 4U0TA 4IJGA 5FEGA 3GVBA 5KSCA 5FQQA 1V9YA 3PYPA 2J9PA 3VE4A 4MBFA 4YOFA 3U2AA 3E4QA 1LLBA 2JC7A 4F3LA 2PR6A 2EWVA 4GNUA 4HBUA 3VP4A 3CITA 3LR4A 3LI8A 3ZG9B 3OBFA 4E6WA 4KQRA 3EGXC 1GHPA 3H7WA 5CGSA 4Y5FA 5AQBA 4MBHA 1F98A 2AVXA 3V50A 1ERQA 3O86A 3UN7A 1SCWA 3G30A 4EBNA 1KVMA 4Q0JA 4EETB 3QP8A 4EV4A 1MKMA 3T4SA 5EUAA 2XQZA 4HJ3A 3CAXA 2VX8A 3U4LP 1GSWA 3Q82A 2OAP1 3Q7VA 3SS4A 1NLZA 5CERA 1XJ6A 4ZJ1A 1Q2QA 3QP5A 5L8MA 4E3MA 2JE5A 2O9AA 1TDGA 1ZTUA 4GOGA 2VGJA 2WZZA 4GHIB 4IBRA 1ESIA 4FSFA 3LR5A 2ZC6B 1SKOA 1TVFA 4BMWA 2VJWA 2B95A 3UDXA 4XT2B 2OLVA 3LFVA 3VMAA 1ZG4A 4IEDA 5EOEA 5CRFA 1S1ZA 4QWOA 1OJGA 5FI2A 1XJ3A 5EVIC 5EE8A 1IYSA 3IS2B 3G34A 1VEUB 4JGPA 3VE3A 3MKFA 3P7NA 5IS1A 1L3LA 3IF6C 3QNCA 3ZFZA 1F9IA 4RX2A 4LV1A 4GCZA 5A90A 1PWDA 1TS8A 3V3SA 1LI9A 4OONA 4ZJ3A 3F1NB 4WMCA 4L9EA 2Y55A 3PHYA 5E43A 4FOFA 3C4PA 3VP3A 4UQIM 2XA7S 2OSUA 2X01A 3A0RA 5TR7A 1BLCA 4X56A 3DTIA 1RCJA 1CK3A 1KGEA 3Q81A 2ZOIA 4C75A 5L09A 3UB9A 3NOPC 3MXQA 1IEMA 4NETA 3M2JA 4F94A 5GLCA 3HVFA 3PTEA 4R70A 4MN7A 2PD7A 5TGFA 2V2FF 5AVFA 5HL1A 3NY4A 4MMNA 5EFWA 2EX2A 3M2KA 3ZNTA 1KDWA 3P98A 2A2LA 4R1GA 4AFIA 3H82A 2Q9NA 5FQJA 3AGEA 3PR6A 1MWUA 1K6SA 3FPVA 2FFYA 4PPRA 4HNBA 5HFOA 2O0YA 5IT5A 1KGGA 3OCNA 3T1QB 3IWOA 5EECA 4PM9A 4WEJA 1KGFA 3LEQA 3P01A 1P97A 2Z6DA 1NLYA 3BECA 4P0MA 1IFQA 1OMEA 1VM1A 5EVIA 1Y28A 2V8CA 2JKFA 5M18A 4HESA 1KOUA 4OQIA 4PM7A 3HUOA 5DTSA 3ZG0A 3Q07A 3IXHA 3V3RA 1IOUA 3IF6A 1K54C 5CXWA 2VZWA 4FUWA 1TF1A 4QJGA 4FD8A 2R9WA 3BFDA 1ZC2A 4I5SA 1TEMA 4OP8A 5FQ9A 2Y2JA 1DP9A 4LLOB 2ZMFA 2Y2IA 4LRXC 2HF6A 3LICA 4DDSA 4WLAA 2V20A 3NDGA 1YSQA 5FQKA 2WK0A 1YLZA 4KZ5A 4X69A 3ULFA 4Q8IA 1TD5A 5FAOA 2W3GA 4BL3A 3IWQA 1P0ZA 3MZDA 5FASA 4KG5A 3T4JA 1PYYA 3WRZA 3QP6A 4RVAA 1MZUA 4X6TA 2WUQA 4OVDA 1JTDA 5KIZA 1SDNA 4GS9B 4XUXA 4HY8A 3HJIA 2W3FA 4EQIA 3A3JA 1HD8A 3O87A 2LB5A 1W5DA 5FAPA 2Y8HA 3BQAA 1STZA 3HLWA 5E2GA 3N6IA 4OQ0A 1ES5A 1K25A 1E3UA 3G6OA 3AGFA 5AJGA 2XK1A 4S2PA 4I38A 3ZVWA 5HD5A 1H0MA 3SS3A 4PAUA 4OP5A 4X68A 1L2SA 5HZHA 2XDMA 4RX3A 1XJ4A 4N9KA 1LT0A 1PW8A 2WZXA 5BOHA 1PFLA 3EOIA 5EPHA 1XXMA 4GHIA 2WKPA 4O0PA 3T1RA 3LIEA 4HI4A 4X1MA 5DVAA 3T12B 3P09A 1K6RA 3F1PB 2VLGA 4XT2A 4O7DA 4ARZB 3K2NA 5MC7A 1S66L 1XA1A 4EXOA 3IXBA 4YNRA 1N9NA 1S4RA 2EX9A 3LI9A 4LRZE 3IS2A 3T4OA 1L0FA 3HREA 2JKTI 4LCMA 3NJAA 4QY6A 2GX5A 3DWZA 3IBRA 3JVVA 1JVJA 1TS6A 2K31A 3L7HA 4MBKA 5EOOA 1CJFA 2HP5A 2PU4A 4NEED 5HW3A 1WYBA 1D7EA 4D60A 2INWA 1K4EA 3RH8B 4YWZA 3MQQA 2IA2A 3N8RA 4P87A 1YLJA 3ZGAB 2WAFA 3S7QA 1WYCA 1K57A 4X55A 2EX6A 2VEAA 3HCYA 4KG6A 1W8YA 2VK3A 3BFCA 2HJ9C 3IX3A 4KZ4A 3DAVA 4ZRRA 3GQZA 1LI0A 2WKQA 5IU1A 1SDEA 1GSVA 3CI6A 2H10A 1S6RA 3BY9A 4WYYA 2PYPA 3FYZA 3K3CA 5A92A 3MFXA 2HP9A 3GV9A 3ZQ5A 1BSGA 1LL5A 4Q0HA 1CI8A 1GHMA 3CJMA 3CPTB 5EVLA 2QPNA 2QHKA 3S7NA 2QYBA 3JPUA 4IUHA 2WADA 4LV0A 1YLPA 5CEDA 1FILA 5DKLA 1F5MA 2DMWA 1D1JA 2E8JA 5LBRA 5I5LA 1OTEA 2I9VA 2L0WA 4IBXA 2QKPA 4KZ3A 4OKPA 4B93A 4GDBA 1P9RA 3H9WA 2FH5A 4UA7A 3NIAA 2FZ0A 4PHTA 4BBTA 1K56D 2HV1A 4OOLA 2D01A 4KZBA 4GJ4A 2J3TD 3WWXA 4L9FA 4YFMA 3UPOA 4UQIS 4R3AA 5F1GA 1OT6A 3G32A 4WUJA 4DMZA 3TOIA 5L2FA 4GD8A 2W0NA 4LV2A 1SKFA 4LFUA 2GNXA 2PAVP 5EM0A 2HZ5A 5TFQA 1G28A 4MLLA 4BQMA 1S0WA 3WRTA 2WGWA 5HDSA 1YKDA 3ZDJA 1IKGA 4OOYA 2ZM2A 2PRFA 2R78A 4GLQA 3TSGA 3DW0A 3FC7A 4R3JA 4II7A 3T4LA 2Q0OA 3BYDA 5HDDA 3FZCA 3EQVA 2DCFA 2YKHA 3OPLA 4H6JA 3OLOA 1EROA 2ZOHA 3MZEA 4C3QA 1T1AA 3GMWA 1JWPA 4EEPA 3TE8A 4WMCD 2CMNA 4BWIA 4ZBEA 3MZFA 1PIOA 4S2IA 5AQAA 1K56A 3GSGA 3A3DA 3PAGA 3FKWA 3I7JA 1NJ4A 2YKFA 2DRWA 2W3EA 2KLIA 2L4RA 4EW7A 5DKKA 1K4FA 4WZ5C 2ZMVA 1E4DA 5IHVA 3LUQA 3QP1A 4S2OA 3HUNA 1E25A 3ISGA 2BLSA 3BFFA 1BLPA 5DTTA 1JTGA 4ZTKA 3MJQA 1DJCA 1MWRA 1YSPA 1V9ZA 1NRJA 4QU3A 3DTMA 3E4OA 3BRMA 1VB6A 3EWKA 1EI5A 3IQAA 3B3XA 3S4XA 2UWXA 5HDCA 4Y2FA 1NWZA 1K55A 2C5WB 4DJ2A 1O07A 4ETXA 3E0YA 2Y2MA 1W63M 2XGNA 1H8ZA 2OV5A 4YINA 2EX8A 3UE0A 2O99A 4HP9A 4IVKA 4HOIA 5EVID 1YQSA 2PBDP 2XEPA 2HDSA 3HLBA 4S2NC 4E3NA 1O7EA 5TBMA 2P08A 2KOIA 2OAQ1 1NXYA 2P9VA 3RXWA 5FL3A 1HVBA 5TJJA 1VETA 2Y2KA 3N7WA 1IELA 3R7WB 5HAQA 3T1SA 4L9GA 3HLFA 1PI5A 3A3IA 1TS7A 5CHJA 2WKHA 3VOYA 1ACFA 5JYOA 4S2KA 1G6OA 3VP1A 3C30A 4RYEA 4MCWA 3MKEA 1YPRA 1PZOA 2HP6A 2WGVA 4OPYA 2B02A 3WS4A 3V39A 3IF5A 2PBYA 4Y15A 1BLSA 4EESA 1ESUA 3UE3A 1W63Q 1DJAA 4WZ5A 2VV6A 4Y17A 4N9LA 3V67A 1DP8A 1JWZA 1CQAA 1OJ5A 2V8FA 3ITAA 2J3WA 3G4PA 3NECA 1ERMA 2H0TA 3IHAA 1OPXA 3HLDA 3OCLA 2VGLM 4N1HA 1A0KA 1YAXA 3HUMA 3SZTA 2WGIA 4ZJ2A 1BYWA 5HX9A 4KZ8A 5CTMA 2Y91A 1E3UD 3K3DA 4Y0TA 3QHYA 2P04A 3EQUA 4K0XA 4OPQA 3BFEA 5DTKA 2M7VA 4JKTA 3WS1A 4UA9A 4CLCE 2B18A 5DJUA 1NY0A 3UPPA 3F1OA 3OPPA 3GR2A 1DJBA 2GDNA 5AVEA 2JKRM 3CZDA 3PBQA 4RQ9A 2V9AA 3VSLA 5J8XA 2Y79A 4WELA 3OOVA 2BASA 2Y2HA 4B4XA 5C5KA 5HAIA 4M3KA 1CI9A 4MNRA 3E2LA 3EEAA 3CMZA 1C3BA 1Q2PA 5FATA 4WEKA 4DE3A 5FQIA 2H0YA 2ZD8A 4HP4A 2W1TB 3UB5P 1I2SA 4N92A 4P6ZM 1GCEA 2HDQA 4GKUA 5FSRA 5DFYA 2BG1A 1K38A 4R6LA 5HWTA 4B88A 3IH8A 3UMDA 5AQ9A 1K0KA 1XA7A 4OQGA 3HJKA 4K0WA 4R0QA 2QJ5A 1FCMA 4JLFA 1FOFA 3PBNA 3H7WB 4P85A 5HPFA 1XKZA 3O3VA 3OC2A 4GW9A 3M6HA 2Y2GA 4GN2A 3EEHA 4S2JA 1OTAA 1PWCA 2VA0A 1GHIA 1PI4A 4KZ7A 3FPWA 4JGRA 1DY6A 3LCEA 3T1XA 3NBLA 3KX0X 3CHWP 2Z2LB 3A0SA 2QZ6A 3TJZC 4JXGA 2Y2OA 1DRMA 5GLBA 3W2ZA 4E04A 3C4OA 1BLHA 2P7JA 4GB7A 2ZC4B 2ZMAA 4FH2A 3LO7A 1H8MA 2ZC3B 1RP5A 2O9BA 4WL9A 2ZQ7A 2J9OA 1BT5A 3RJUA 3VOLA 5GHZA 3MSHA 1K54A 1UWNX 3IHBA 4LPZA 1N9BA 4ESPA 2OOLA 4Y0OA 5DF8A 2XRNA 1VEUA 3SS5A 1OTDA 5G4YA 1X0OA 4JPMA 4PM8A 5EV0A 4PM5A 1XX2A 2KX6A 5GHXA 2ZBBA 3MBZA 4Z9QA 1J3WA 3LYXA 4QHCA 2FFFB 1LL8A 5M19A 4RA7A 2HDRA 2A3UA 1AWIA 4B4ZA 3IWIA 3LY3A 3KSGA 1N4OA 3UDFA 3F1NA 1KE3A 1WE4A 4QPRA 5HD3A 2JKGA 2XH9A 4KQQA 4WBGA 2Z2MB 3KYQA 5F5YA 2V0WA 1P9WA 3IH9A 1L0GA 5F83A 1XPBA 5AQ7A 5EM1A 3EGDC 3R7WA 2MJ6A 3MFDA 2G2WA 1QMEA 2ACGA 1HTZA 2LB9A 1N9LA 4QB8A 2ZM0A 1XGIA 3D72A 3DTKA 3MMHA 4MDZA 4EQ1A 1LSVA 3ITBA 3SH7A 3C7UA 3MXRA 3R4KA 3W4QA 1BUEA 3NOTC 4IHQA 2RL3A 3HLGA 1LL9A 4P6BA 1MKIA 4DN0A 3DBAA 5D3OA 3C38A 3LR0A 4CLCB 4G3KA 4MN5A 3LEZA 3GTCA 5F82A 4ETZA 5I94A 1HZOA 3GRJA 3ZG8B 2OWJA 3MQOA 2PHYA 1NYMA 2PU2A 4KZAA 2UV0E 3H82B 3O88A 3RFBA 3JYIA 4I3AA 1S1YA 5DFXA 2V0UA 2WKEA 1M6KA 5JYPA 4EBLA 2RCXA 5A91A 5F6AA 1D06A 1ES4A 1MY8A 4C6YA 1GA9A 1YLTA 4L0LA 1BZAA 1RGZA 1NZOA 1UGUA 4OPZA 5GLAA 1MWTA 3ZCZA 2O9CA 3W4OA 3KYEA 3GECA 4LV3A 4U0XA 4NG2A 3KO6A 3PXPA 3UB8A 4D2OA 2EXBA 4CQHA 3MQ0A 2WYXA 3CUEC 5CEBA 4HH3A 1XP4A 4CJNA 1ZG6A 4UA6A 4Q0IA 3OPRA 2Y2NA 3A0VA 3VP2A 4HH2A 4PKYA 1KDSA 5G18A 3QP2A 1W8QA 3PBRA 3ZHHA 4I39A 4I3JA 3G2YA 3O5YA 4M4XA 1MXOA 4HIAA 5J3WA 3MR0A 3C2WA 2QJ7A 5DF7A 2C6WB 1Y4OA 2EFXA 5E2FA 2IWCA 3LR3A 3ZYTA 4DE0A 2PDRA 1MC0A 5GLDA 2W1TA 5KMWA 4JXSA 2J8YA 4U3TA 2XR0A 1DP6A 1ZKJA 3L9KA 4GS9A 2XD1A 1KE0A 4LRYC 1ES3A 1KVLA 1ONGA 4JGOA 3V5MA 2A24B 3C8CA 4PMAA 1F2KA 2L1MA 1S4SA 1G6AA 4OPRA 1XGJA 3BW6A 3UDIA 3UO9A 4E3LA 2ZL1B 4BL2A 1XJ2A 4XXRA 3BJNA 2WKIA 3UE6A 2VGLS 3AGDA 4BENA 3UPNA 3LIAA 1HLUP 1SHVA 2D02A 1ALQA 1PZPA 4CLCC 3S22A 4HQAA 1TDLA 4OOMA 4ZDXA 2H5SA 3N4IA 3B33A 2JN7A 3IX8A 5HPIA 1Z09A 2WAEA 4MEZA 1GSXA 4ID4A 3F1PA 3LIDA 1FCNA 4MN6A 4BD0A 4ARZA 2PT7A 2J7VA 1VQQA 3PBOA 2ZQDA 1MPLA 5FDSA 1UWPX 3HLCA 4DKIA 2Y2LA 4O01A 1OTBA 3IT9A 4CLCD 5CX7A 3NOUC 3UE1A 3CUEA 1FIKA 2XLNA 4BBVA 2GJ3A 2HJEA 1YMXA 2M7UA 1YLYA 4NKPA 1IKIA 3NC8A 2BTFP 4WM9A 2XD5A 1CF0A 1YLWA 3ZG7B 5HAPA 3VSKA 2PD8A 2ZQCA 4P6ZS 1ES2A 2H28A 4JF5A 2ZLYA 1EW0A 2XROA 2QMIA 4KUKA 3UB7A 4QY5A 4X25A 4OQHA 2JKTM 1NRFA 5CHMA 3BEBA 2W1RA 4JF6A 3ZNYA 3FG8A 1CEFA 3SH8A 5E2HA 4Y3IA 3T4QA 4KQDA 4NXFA 2JCHA 4HBTA 4X53A 4WZ4A 2VKSA 3BQ8A 3GDIA 5GHYA 4G3WA 4Z1WA 4O8GA 2HPBA 3C7VA 3CLOA 4OH0A 3VP0A 5K5BA 2G2UA 5CECA 4EWFA 3M6BA 1LHYA 3CPTA 4BBUA 5HSQA 4NXEA 5FQMA 4ME4A 4CLCA 4EBPA 3CWFA 4FCFA 3KSHA 3E98A 5U47A 3NHQA 4H8RA 1G68A 3JVUA 3QP4A 1IYPA 3WS0A 2ZQAA 5J4EA 4JXVA 1NZUA 2XFTA 1AXBA 3NULA 1T18A 4DF6A 2GZAA 4NXGA 4XUZA 1FSWA 3D4FA 4N1XA 3SH9A 1FSYA 1MWSA 5FI6A 3VFHA 3HBRA 3S7OA 4DXCA 5FAQA 3A3FA 4HHDA 1FR6A 1Y54A 1CEGA 4R38A 3LIBA 4LENA 4GDNA 3WS2A 3IBJA 3UY6A 3PBSA 5L07A 3QNBA 3VOZA 4E3IA 4HJ6A 5CGXA 2XFSA 4KZ6A 4JGQA 5HL6A 3LY4A 4I3IA 5F1FA 4BD1A 2W3DA 1BULA 2VV7A 4K91A 3VV4A 5DF9A 3T50A 3RXXA 3S7PA 4R4RA 1ODVA 4OLGA 4S2NA 5L10A 3TG9A 1G5UA 3ZVTA 4DE1A 3KYZA 3TW8A 1LSXA 2V1BA 4DDYA 3E4PA 4WF0A 3BLSA 5HWWA 1ONHA 2JHEA 1JWVA 2ZC5B 4Y13A 3FWLA 4FTXA 2WGWB 4KUOA 5G4ZA 3NI9A 3UMEA 3BLMA 4R4SA 1NYYA 4EUVA 5GL9A 4F3LB 1YM1A 1K57C 2Q9MA 4KG2A 3E2KA 1OT9A 2B5RA 2R9XA 1FCOA 2OWHA 2PR5A 4Y0UA 1LSWA 5HARA 4IVIA 4BLMA 2V1AA 2HGVA 4GZBA 4H6JB 5KSHA 2Z6CA 4HEFA 4S2LA 1I2WA 4JBFA 2DNSA 2XA7M 4R23A 2A24A 5CGWA 1SZVA 4PM6A 3LGOA 3FV7A 4B9OA 2ZL1A 4G3VA 2W27A 2ZC7A 3S1YA 2Y59A 3RTYA 3VFFA 4PKYG 3DWKA 3Q7VB 4OLDA 4K08A 2P74A 4LGWA 2ZJ9A 4QD4A 1XFQA 2OLUA 1YT4A 4ZAMA 4UAAA 4E3KA 5FA7A 3UNWA 1IYQA 1SKOB 1YMSA 3B42A 3KSIA 1QMFA 2K2NA 4FH4A 5F68A 4DJ3A 3A3EA 1WA9A 4JXWA
chains in the Genus database with same CATH topology
3ZG0A 3Q07A 1MWTA 1EI5A 3IXHA 3N8LA 3V3RA 3IQAA 3ZCZA 3B3XA 3S4XA 3W4OA 2UWXA 3IF6A 1BTLA 4GD6A 4LV3A 4U0XA 1K54C 2Y2PA 5CXWA 1GA0A 2X02A 4D2OA 2EXBA 2ZM8A 4QJGA 3MXSA 1Z6FA 2ZQ8A 4FD8A 2R9WA 3BFDA 2WYXA 1K55A 1ZC2A 3BFGA 1TEMA 2C5WB 4DE2A 1I5QA 1O07A 5CEBA 5CHUA 2Y2QA 1XP4A 4OP8A 5FQ9A 1ZG6A 2Y2MA 2Y2JA 4CJNA 4UA6A 2XGNA 3OPRA 1H8ZA 2Y2IA 2OV5A 2Y2NA 4CPKA 4YINA 2EX8A 3UE0A 2A49A 3VP2A 4DDSA 1EWZA 4IVKA 2Y4AA 1KDSA 4BJPA 2V20A 1YQSA 3NDGA 5EVID 2XEPA 5G18A 2X71A 5FQKA 5KZHA 1MBLA 1W8QA 3PBRA 3ZHHA 2WK0A 1YLZA 2HDSA 1H8YA 4KZ5A 4X69A 3HLBA 4S2NC 4E3NA 1O7EA 3G2YA 4Q8IA 1MXOA 2IWDA 2I72A 1NXYA 3N8SA 2P9VA 4R3BA 5DF7A 5FAOA 3RXWA 1HVBA 2C6WB 4A5RA 4BL3A 4S2MA 2EFXA 4DXBA 5E2FA 2Y2KA 3N7WA 2IWCA 2P9VB 2JBFA 1IELA 3IWQA 3MZDA 3PAEA 3Q1FA 5FASA 5HAQA 4KG5A 4KENB 4KQOA 1PYYA 3HLFA 4DE0A 3WRZA 1PI5A 1J9MA 3A3IA 5GLDA 5KMWA 3NDEA 4JXSA 4RVAA 2J8YA 4U3TA 2XR0A 4X6TA 5CHJA 2WUQA 4OVDA 1ZKJA 1JTDA 2WKHA 5FDHA 3VOYA 2EFUA 1KE0A 2XD1A 1SDNA 3IXDA 5JYOA 4S2KA 3HLEA 4XUXA 3VP1A 2ZQ9A 4RYEA 1ES3A 3MKEA 4EQIA 1KVLA 3A3JA 1PZOA 1HD8A 1ONGA 3O87A 2HP6A 2WGVA 3V5MA 4OPYA 1L0EA 1M40A 1W5DA 5FAPA 1U60A 3WS4A 1L0DA 3IXGA 4PMAA 4E3JA 3SOIA 1G6AA 1PW1A 4OPRA 3V39A 3IF5A 3HLWA 2PBYA 5E2GA 3N6IA 4OQ0A 3WS5A 1XGJA 3BM6A 1ES5A 3UDIA 2V1ZA 1K25A 3UO9A 3ZG5A 1E3UA 4BL2A 4E3LA 4XXRA 1BLSA 2WKIA 3HL9A 1ESUA 3UE3A 4Y7PA 3AGDA 4BENA 3AGFA 3UPNA 1RGYA 2XK1A 4E6XA 1DJAA 4WZ5A 1SHVA 4JF4A 4N9LA 4S2PA 2EXAA 3ZVWA 4UHUA 2IWBA 1JWZA 3SS3A 1ALQA 1PZPA 1H5XA 3S22A 4OP5A 4X68A 4OOMA 1L2SA 1TDLA 3ITAA 4ZDXA 5A93A 2H5SA 3CG5A 3N4IA 2XDMA 4RX3A 4E3OA 3G4PA 4N9KA 5CTNA 1PW8A 1ERMA 2WZXA 2H0TA 5BOHA 3IHAA 1W7FA 3HLDA 5EPHA 1XXMA 3OCLA 2E8IA 2WAEA 3FKVA 4KZ9A 4MEZA 5E2EA 4N1HA 3HUMA 3OPHA 1IYOA 2WGIA 4ID4A 1FCNA 5EVIB 5DVAA 4ZJ2A 1FQGA 2VGKA 5HX9A 3P09A 1K6RA 2Y91A 4KZ8A 2XF3A 1E3UD 5CTMA 4BD0A 1W79A 2J7VA 4O7DA 4Y0TA 1VQQA 3PBOA 3QHYA 3EQUA 4K0XA 2ZQDA 1MPLA 1XA1A 4OPQA 2HDUA 3HLCA 3IXBA 3W8KA 3BFEA 4OPZA 4DKIA 2Y2LA 3IF6B 5DTKA 2EX9A 4JKTA 3WS1A 3IT9A 3OZHA 3UE1A 4UA9A 1L0FA 3HREA 3Q7ZA 3G35A 4LCMA 5FI7A 3C5AA 4QY6A 2XLNA 4LCLA 1NY0A 1YMXA 3DWZA 1YLYA 1JVJA 3NCKA 3UPPA 3OPPA 1IKIA 3GR2A 3NC8A 1DJBA 2GDNA 4MBKA 5M1AA 3CZDA 3G31A 3PBQA 4EUZA 4WM9A 5EOOA 2XD5A 4DRTA 1YLWA 3ZG7B 2HP5A 2PU4A 5HAPA 3VSKA 3VSLA 2ZQCA 5HW3A 5J8XA 3PBTA 1WYBA 4NK3A 1KE4A 1K55C 4WELA 1ES2A 1K4EA 4JF5A 4B4XA 2Y2HA 2ZLYA 2CC1A 5HAIA 3N8RA 4P87A 1YLJA 2QMIA 3G2ZA 4M3KA 3W4PA 1CI9A 2WAFA 4MNRA 3ZGAB 1PWGA 1FR1A 3E2LA 4QY5A 1WYCA 1K57A 4X55A 2EX6A 4OQHA 3CMZA 4KG6A 4U0TA 1C3BA 1W8YA 1NRFA 3GVBA 5CHMA 1Q2PA 3BFCA 5KSCA 3BEBA 4JF6A 4KZ4A 5FATA 5FQQA 3ZNYA 4WEKA 4DE3A 5FQIA 2H0YA 3GQZA 1LI0A 1CEFA 2ZD8A 2J9PA 4MBFA 3SH8A 5E2HA 1LLBA 2JC7A 1I2SA 4N92A 1SDEA 1GCEA 2HDQA 4GKUA 4GNUA 5FSRA 4HBUA 3VP4A 2BG1A 2JCHA 4HBTA 2H10A 1K38A 1S6RA 4X53A 4B88A 3ZG9B 3IH8A 5AQ9A 4WZ4A 4E6WA 4WYYA 1XA7A 4KQRA 1GHPA 4OQGA 5GHYA 4K0WA 3FYZA 4R0QA 1FCMA 4JLFA 5CGSA 1FOFA 5A92A 2HPBA 3C7VA 3PBNA 2HP9A 4OH0A 3VP0A 3GV9A 2G2UA 4P85A 5AQBA 5CECA 1BSGA 4MBHA 4EWFA 1LL5A 1LHYA 3M6BA 1XKZA 3V50A 1CI8A 1ERQA 1GHMA 3CJMA 3O3VA 3OC2A 3O86A 3M6HA 3UN7A 1SCWA 3G30A 4EBNA 2Y2GA 1KVMA 5FQMA 5EVLA 4GN2A 2QPNA 4S2JA 4EV4A 1PWCA 4EBPA 4FCFA 1GHIA 1PI4A 4KZ7A 5EUAA 2XQZA 5U47A 4H8RA 1DY6A 2WADA 4LV0A 1G68A 3LCEA 1YLPA 5CEDA 1IYPA 3WS0A 2ZQAA 4JXVA 1NZUA 3NBLA 2XFTA 1AXBA 3Q82A 2Z2LB 3Q7VA 3SS4A 5CERA 2QZ6A 4DF6A 4ZJ1A 4JXGA 4XUZA 1FSWA 1Q2QA 2Y2OA 3D4FA 4E3MA 5GLBA 2JE5A 4N1XA 3SH9A 1FSYA 3C4OA 1BLHA 1MWSA 5FI6A 3VFHA 1TDGA 3HBRA 4GOGA 4IBXA 2VGJA 2WZZA 4DXCA 4GB7A 4KZ3A 5FAQA 2ZC4B 2ZMAA 4FH2A 4IBRA 3A3FA 4OKPA 3LO7A 1ESIA 4FSFA 2ZC3B 4GDBA 1FR6A 1Y54A 2ZC6B 1RP5A 1CEGA 3WS2A 4LENA 4GDNA 2ZQ7A 2J9OA 1BT5A 1TVFA 3RJUA 3UDXA 2OLVA 3NIAA 4UA7A 5GHZA 1K54A 3VMAA 1ZG4A 3UY6A 3IHBA 3PBSA 1N9BA 4IEDA 5EOEA 3QNBA 5CRFA 3VOZA 1K56D 4E3IA 5FI2A 5EVIC 5EE8A 4Y0OA 5DF8A 5CGXA 2XFSA 4KZ6A 1IYSA 3SS5A 4OOLA 3LY4A 3G34A 4KZBA 5F1FA 4BD1A 4JPMA 3WWXA 3MKFA 4PM8A 1BULA 4K91A 4YFMA 4PM5A 1XX2A 3UPOA 5GHXA 3IF6C 3QNCA 3ZFZA 3MBZA 5DF9A 4Z9QA 5F1GA 3RXXA 4RX2A 3G32A 4LV1A 4R4RA 4OLGA 4QHCA 2FFFB 3TOIA 4S2NA 3TG9A 4GD8A 4LV2A 5L2FA 5A90A 5M19A 1PWDA 3ZVTA 1SKFA 4RA7A 2HDRA 2A3UA 4B4ZA 3V3SA 4DE1A 3IWIA 1LI9A 4JXWA 4OONA 1N4OA 5TFQA 3UDFA 4DDYA 4ZJ3A 1KE3A 1WE4A 3BLSA 4MLLA 4WMCA 4BQMA 2Y55A 1S0WA 1ONHA 2WGWA 2XH9A 4KQQA 4WBGA 3WRTA 2Z2MB 5E43A 1JWVA 3C4PA 2ZC5B 3ZDJA 3VP3A 1IKGA 3FWLA 2WGWB 4OOYA 3IH9A 1L0GA 5F83A 1XPBA 2ZM2A 2OSUA 3NI9A 2X01A 3BLMA 3TSGA 3DW0A 4R3JA 5AQ7A 4R4SA 3BYDA 1NYYA 5TR7A 3MFDA 1BLCA 2G2WA 1QMEA 4X56A 1HTZA 5GL9A 1YM1A 1RCJA 4QB8A 1K57C 2Q9MA 2ZM0A 4KG2A 3E2KA 1XGIA 2B5RA 2R9XA 1FCOA 1CK3A 1KGEA 3Q81A 3ITBA 4Y0UA 3SH7A 3FZCA 3EQVA 4C75A 2DCFA 5HARA 3C7UA 4IVIA 3MXRA 3OPLA 5GLAA 4BLMA 3W4QA 1BUEA 1EROA 1IEMA 4NETA 3MZEA 4GZBA 5KSHA 4C3QA 4HEFA 3M2JA 4F94A 4S2LA 1I2WA 2DNSA 4JBFA 3GMWA 2RL3A 4R23A 1JWPA 3HLGA 3HVFA 5GLCA 3PTEA 1LL9A 4P6BA 4WMCD 5CGWA 4ZBEA 3MZFA 1PIOA 4PM6A 1MKIA 4S2IA 5AQAA 1K56A 3FV7A 5D3OA 5TGFA 3GSGA 2V2FF 3A3DA 2ZC7A 3S1YA 5HL1A 2Y59A 3PAGA 3LEZA 3FKWA 3NY4A 3I7JA 3GTCA 2EX2A 1NJ4A 3M2KA 3ZNTA 5F82A 2DRWA 5I94A 3VFFA 1KDWA 3P98A 4R1GA 3DWKA 1HZOA 3Q7VB 3GRJA 3ZG8B 1NYMA 2PU2A 1K4FA 2Q9NA 4OLDA 2P74A 4KZAA 4WZ5C 1E4DA 5FQJA 5IHVA 3AGEA 1MWUA 3O88A 1K6SA 2FFYA 4PPRA 4S2OA 5HFOA 3HUNA 3JYIA 1E25A 1KGGA 3ISGA 2ZJ9A 4QD4A 2BLSA 3BFFA 2OLUA 3OCNA 1BLPA 1YT4A 4ZAMA 3IWOA 5DTTA 5EECA 4PM9A 4UAAA 4WEJA 4E3KA 5FA7A 1KGFA 1JTGA 4ZTKA 2WKEA 1M6KA 3UNWA 5JYPA 4EBLA 1IYQA 1DJCA 1MWRA 2RCXA 5A91A 1YMSA 3BECA 4P0MA 1OMEA 1QMFA 1VM1A 4FH4A 5EVIA 1ES4A 1MY8A 4QU3A 4C6YA 1GA9A 1YLTA 3A3EA 4L0LA 3DTMA 5M18A 4HESA 1BZAA 4OQIA 1RGZA 1NZOA 3BRMA 4PM7A 3HUOA 5DTSA 3LY3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZG0 A;  3Q07 A;  1MWT A;  1EI5 A;  3IXH A;  3N8L A;  3V3R A;  3IQA A;  3ZCZ A;  3B3X A;  3S4X A;  3W4O A;  2UWX A;  3IF6 A;  1BTL A;  4GD6 A;  4LV3 A;  4U0X A;  1K54 C;  2Y2P A;  5CXW A;  1GA0 A;  2X02 A;  4D2O A;  2EXB A;  2ZM8 A;  4QJG A;  3MXS A;  1Z6F A;  2ZQ8 A;  4FD8 A;  2R9W A;  3BFD A;  2WYX A;  1K55 A;  1ZC2 A;  3BFG A;  1TEM A;  2C5W B;  4DE2 A;  1I5Q A;  1O07 A;  5CEB A;  5CHU A;  2Y2Q A;  1XP4 A;  4OP8 A;  5FQ9 A;  1ZG6 A;  2Y2M A;  2Y2J A;  4CJN A;  4UA6 A;  2XGN A;  3OPR A;  1H8Z A;  2Y2I A;  2OV5 A;  2Y2N A;  4CPK A;  4YIN A;  2EX8 A;  3UE0 A;  2A49 A;  3VP2 A;  4DDS A;  1EWZ A;  4IVK A;  2Y4A A;  1KDS A;  4BJP A;  2V20 A;  1YQS A;  3NDG A;  5EVI D;  2XEP A;  5G18 A;  2X71 A;  5FQK A;  5KZH A;  1MBL A;  1W8Q A;  3PBR A;  3ZHH A;  2WK0 A;  1YLZ A;  2HDS A;  1H8Y A;  4KZ5 A;  4X69 A;  3HLB A;  4S2N C;  4E3N A;  1O7E A;  3G2Y A;  4Q8I A;  1MXO A;  2IWD A;  2I72 A;  1NXY A;  3N8S A;  2P9V A;  4R3B A;  5DF7 A;  5FAO A;  3RXW A;  1HVB A;  2C6W B;  4A5R A;  4BL3 A;  4S2M A;  2EFX A;  4DXB A;  5E2F A;  2Y2K A;  3N7W A;  2IWC A;  2P9V B;  2JBF A;  1IEL A;  3IWQ A;  3MZD A;  3PAE A;  3Q1F A;  5FAS A;  5HAQ A;  4KG5 A;  4KEN B;  4KQO A;  1PYY A;  3HLF A;  4DE0 A;  3WRZ A;  1PI5 A;  1J9M A;  3A3I A;  5GLD A;  5KMW A;  3NDE A;  4JXS A;  4RVA A;  2J8Y A;  4U3T A;  2XR0 A;  4X6T A;  5CHJ A;  2WUQ A;  4OVD A;  1ZKJ A;  1JTD A;  2WKH A;  5FDH A;  3VOY A;  2EFU A;  1KE0 A;  2XD1 A;  1SDN A;  3IXD A;  5JYO A;  4S2K A;  3HLE A;  4XUX A;  3VP1 A;  2ZQ9 A;  4RYE A;  1ES3 A;  3MKE A;  4EQI A;  1KVL A;  3A3J A;  1PZO A;  1HD8 A;  1ONG A;  3O87 A;  2HP6 A;  2WGV A;  3V5M A;  4OPY A;  1L0E A;  1M40 A;  1W5D A;  5FAP A;  1U60 A;  3WS4 A;  1L0D A;  3IXG A;  4PMA A;  4E3J A;  3SOI A;  1G6A A;  1PW1 A;  4OPR A;  3V39 A;  3IF5 A;  3HLW A;  2PBY A;  5E2G A;  3N6I A;  4OQ0 A;  3WS5 A;  1XGJ A;  3BM6 A;  1ES5 A;  3UDI A;  2V1Z A;  1K25 A;  3UO9 A;  3ZG5 A;  1E3U A;  4BL2 A;  4E3L A;  4XXR A;  1BLS A;  2WKI A;  3HL9 A;  1ESU A;  3UE3 A;  4Y7P A;  3AGD A;  4BEN A;  3AGF A;  3UPN A;  1RGY A;  2XK1 A;  4E6X A;  1DJA A;  4WZ5 A;  1SHV A;  4JF4 A;  4N9L A;  4S2P A;  2EXA A;  3ZVW A;  4UHU A;  2IWB A;  1JWZ A;  3SS3 A;  1ALQ A;  1PZP A;  1H5X A;  3S22 A;  4OP5 A;  4X68 A;  4OOM A;  1L2S A;  1TDL A;  3ITA A;  4ZDX A;  5A93 A;  2H5S A;  3CG5 A;  3N4I A;  2XDM A;  4RX3 A;  4E3O A;  3G4P A;  4N9K A;  5CTN A;  1PW8 A;  1ERM A;  2WZX A;  2H0T A;  5BOH A;  3IHA A;  1W7F A;  3HLD A;  5EPH A;  1XXM A;  3OCL A;  2E8I A;  2WAE A;  3FKV A;  4KZ9 A;  4MEZ A;  5E2E A;  4N1H A;  3HUM A;  3OPH A;  1IYO A;  2WGI A;  4ID4 A;  1FCN A;  5EVI B;  5DVA A;  4ZJ2 A;  1FQG A;  2VGK A;  5HX9 A;  3P09 A;  1K6R A;  2Y91 A;  4KZ8 A;  2XF3 A;  1E3U D;  5CTM A;  4BD0 A;  1W79 A;  2J7V A;  4O7D A;  4Y0T A;  1VQQ A;  3PBO A;  3QHY A;  3EQU A;  4K0X A;  2ZQD A;  1MPL A;  1XA1 A;  4OPQ A;  2HDU A;  3HLC A;  3IXB A;  3W8K A;  3BFE A;  4OPZ A;  4DKI A;  2Y2L A;  3IF6 B;  5DTK A;  2EX9 A;  4JKT A;  3WS1 A;  3IT9 A;  3OZH A;  3UE1 A;  4UA9 A;  1L0F A;  3HRE A;  3Q7Z A;  3G35 A;  4LCM A;  5FI7 A;  3C5A A;  4QY6 A;  2XLN A;  4LCL A;  1NY0 A;  1YMX A;  3DWZ A;  1YLY A;  1JVJ A;  3NCK A;  3UPP A;  3OPP A;  1IKI A;  3GR2 A;  3NC8 A;  1DJB A;  2GDN A;  4MBK A;  5M1A A;  3CZD A;  3G31 A;  3PBQ A;  4EUZ A;  4WM9 A;  5EOO A;  2XD5 A;  4DRT A;  1YLW A;  3ZG7 B;  2HP5 A;  2PU4 A;  5HAP A;  3VSK A;  3VSL A;  2ZQC A;  5HW3 A;  5J8X A;  3PBT A;  1WYB A;  4NK3 A;  1KE4 A;  1K55 C;  4WEL A;  1ES2 A;  1K4E A;  4JF5 A;  4B4X A;  2Y2H A;  2ZLY A;  2CC1 A;  5HAI A;  3N8R A;  4P87 A;  1YLJ A;  2QMI A;  3G2Z A;  4M3K A;  3W4P A;  1CI9 A;  2WAF A;  4MNR A;  3ZGA B;  1PWG A;  1FR1 A;  3E2L A;  4QY5 A;  1WYC A;  1K57 A;  4X55 A;  2EX6 A;  4OQH A;  3CMZ A;  4KG6 A;  4U0T A;  1C3B A;  1W8Y A;  1NRF A;  3GVB A;  5CHM A;  1Q2P A;  3BFC A;  5KSC A;  3BEB A;  4JF6 A;  4KZ4 A;  5FAT A;  5FQQ A;  3ZNY A;  4WEK A;  4DE3 A;  5FQI A;  2H0Y A;  3GQZ A;  1LI0 A;  1CEF A;  2ZD8 A;  2J9P A;  4MBF A;  3SH8 A;  5E2H A;  1LLB A;  2JC7 A;  1I2S A;  4N92 A;  1SDE A;  1GCE A;  2HDQ A;  4GKU A;  4GNU A;  5FSR A;  4HBU A;  3VP4 A;  2BG1 A;  2JCH A;  4HBT A;  2H10 A;  1K38 A;  1S6R A;  4X53 A;  4B88 A;  3ZG9 B;  3IH8 A;  5AQ9 A;  4WZ4 A;  4E6W A;  4WYY A;  1XA7 A;  4KQR A;  1GHP A;  4OQG A;  5GHY A;  4K0W A;  3FYZ A;  4R0Q A;  1FCM A;  4JLF A;  5CGS A;  1FOF A;  5A92 A;  2HPB A;  3C7V A;  3PBN A;  2HP9 A;  4OH0 A;  3VP0 A;  3GV9 A;  2G2U A;  4P85 A;  5AQB A;  5CEC A;  1BSG A;  4MBH A;  4EWF A;  1LL5 A;  1LHY A;  3M6B A;  1XKZ A;  3V50 A;  1CI8 A;  1ERQ A;  1GHM A;  3CJM A;  3O3V A;  3OC2 A;  3O86 A;  3M6H A;  3UN7 A;  1SCW A;  3G30 A;  4EBN A;  2Y2G A;  1KVM A;  5FQM A;  5EVL A;  4GN2 A;  2QPN A;  4S2J A;  4EV4 A;  1PWC A;  4EBP A;  4FCF A;  1GHI A;  1PI4 A;  4KZ7 A;  5EUA A;  2XQZ A;  5U47 A;  4H8R A;  1DY6 A;  2WAD A;  4LV0 A;  1G68 A;  3LCE A;  1YLP A;  5CED A;  1IYP A;  3WS0 A;  2ZQA A;  4JXV A;  1NZU A;  3NBL A;  2XFT A;  1AXB A;  3Q82 A;  2Z2L B;  3Q7V A;  3SS4 A;  5CER A;  2QZ6 A;  4DF6 A;  4ZJ1 A;  4JXG A;  4XUZ A;  1FSW A;  1Q2Q A;  2Y2O A;  3D4F A;  4E3M A;  5GLB A;  2JE5 A;  4N1X A;  3SH9 A;  1FSY A;  3C4O A;  1BLH A;  1MWS A;  5FI6 A;  3VFH A;  1TDG A;  3HBR A;  4GOG A;  4IBX A;  2VGJ A;  2WZZ A;  4DXC A;  4GB7 A;  4KZ3 A;  5FAQ A;  2ZC4 B;  2ZMA A;  4FH2 A;  4IBR A;  3A3F A;  4OKP A;  3LO7 A;  1ESI A;  4FSF A;  2ZC3 B;  4GDB A;  1FR6 A;  1Y54 A;  2ZC6 B;  1RP5 A;  1CEG A;  3WS2 A;  4LEN A;  4GDN A;  2ZQ7 A;  2J9O A;  1BT5 A;  1TVF A;  3RJU A;  3UDX A;  2OLV A;  3NIA A;  4UA7 A;  5GHZ A;  1K54 A;  3VMA A;  1ZG4 A;  3UY6 A;  3IHB A;  3PBS A;  1N9B A;  4IED A;  5EOE A;  3QNB A;  5CRF A;  3VOZ A;  1K56 D;  4E3I A;  5FI2 A;  5EVI C;  5EE8 A;  4Y0O A;  5DF8 A;  5CGX A;  2XFS A;  4KZ6 A;  1IYS A;  3SS5 A;  4OOL A;  3LY4 A;  3G34 A;  4KZB A;  5F1F A;  4BD1 A;  4JPM A;  3WWX A;  3MKF A;  4PM8 A;  1BUL A;  4K91 A;  4YFM A;  4PM5 A;  1XX2 A;  3UPO A;  5GHX A;  3IF6 C;  3QNC A;  3ZFZ A;  3MBZ A;  5DF9 A;  4Z9Q A;  5F1G A;  3RXX A;  4RX2 A;  3G32 A;  4LV1 A;  4R4R A;  4OLG A;  4QHC A;  2FFF B;  3TOI A;  4S2N A;  3TG9 A;  4GD8 A;  4LV2 A;  5L2F A;  5A90 A;  5M19 A;  1PWD A;  3ZVT A;  1SKF A;  4RA7 A;  2HDR A;  2A3U A;  4B4Z A;  3V3S A;  4DE1 A;  3IWI A;  1LI9 A;  4JXW A;  4OON A;  1N4O A;  5TFQ A;  3UDF A;  4DDY A;  4ZJ3 A;  1KE3 A;  1WE4 A;  3BLS A;  4MLL A;  4WMC A;  4BQM A;  2Y55 A;  1S0W A;  1ONH A;  2WGW A;  2XH9 A;  4KQQ A;  4WBG A;  3WRT A;  2Z2M B;  5E43 A;  1JWV A;  3C4P A;  2ZC5 B;  3ZDJ A;  3VP3 A;  1IKG A;  3FWL A;  2WGW B;  4OOY A;  3IH9 A;  1L0G A;  5F83 A;  1XPB A;  2ZM2 A;  2OSU A;  3NI9 A;  2X01 A;  3BLM A;  3TSG A;  3DW0 A;  4R3J A;  5AQ7 A;  4R4S A;  3BYD A;  1NYY A;  5TR7 A;  3MFD A;  1BLC A;  2G2W A;  1QME A;  4X56 A;  1HTZ A;  5GL9 A;  1YM1 A;  1RCJ A;  4QB8 A;  1K57 C;  2Q9M A;  2ZM0 A;  4KG2 A;  3E2K A;  1XGI A;  2B5R A;  2R9X A;  1FCO A;  1CK3 A;  1KGE A;  3Q81 A;  3ITB A;  4Y0U A;  3SH7 A;  3FZC A;  3EQV A;  4C75 A;  2DCF A;  5HAR A;  3C7U A;  4IVI A;  3MXR A;  3OPL A;  5GLA A;  4BLM A;  3W4Q A;  1BUE A;  1ERO A;  1IEM A;  4NET A;  3MZE A;  4GZB A;  5KSH A;  4C3Q A;  4HEF A;  3M2J A;  4F94 A;  4S2L A;  1I2W A;  2DNS A;  4JBF A;  3GMW A;  2RL3 A;  4R23 A;  1JWP A;  3HLG A;  3HVF A;  5GLC A;  3PTE A;  1LL9 A;  4P6B A;  4WMC D;  5CGW A;  4ZBE A;  3MZF A;  1PIO A;  4PM6 A;  1MKI A;  4S2I A;  5AQA A;  1K56 A;  3FV7 A;  5D3O A;  5TGF A;  3GSG A;  2V2F F;  3A3D A;  2ZC7 A;  3S1Y A;  5HL1 A;  2Y59 A;  3PAG A;  3LEZ A;  3FKW A;  3NY4 A;  3I7J A;  3GTC A;  2EX2 A;  1NJ4 A;  3M2K A;  3ZNT A;  5F82 A;  2DRW A;  5I94 A;  3VFF A;  1KDW A;  3P98 A;  4R1G A;  3DWK A;  1HZO A;  3Q7V B;  3GRJ A;  3ZG8 B;  1NYM A;  2PU2 A;  1K4F A;  2Q9N A;  4OLD A;  2P74 A;  4KZA A;  4WZ5 C;  1E4D A;  5FQJ A;  5IHV A;  3AGE A;  1MWU A;  3O88 A;  1K6S A;  2FFY A;  4PPR A;  4S2O A;  5HFO A;  3HUN A;  3JYI A;  1E25 A;  1KGG A;  3ISG A;  2ZJ9 A;  4QD4 A;  2BLS A;  3BFF A;  2OLU A;  3OCN A;  1BLP A;  1YT4 A;  4ZAM A;  3IWO A;  5DTT A;  5EEC A;  4PM9 A;  4UAA A;  4WEJ A;  4E3K A;  5FA7 A;  1KGF A;  1JTG A;  4ZTK A;  2WKE A;  1M6K A;  3UNW A;  5JYP A;  4EBL A;  1IYQ A;  1DJC A;  1MWR A;  2RCX A;  5A91 A;  1YMS A;  3BEC A;  4P0M A;  1OME A;  1QMF A;  1VM1 A;  4FH4 A;  5EVI A;  1ES4 A;  1MY8 A;  4QU3 A;  4C6Y A;  1GA9 A;  1YLT A;  3A3E A;  4L0L A;  3DTM A;  5M18 A;  4HES A;  1BZA A;  4OQI A;  1RGZ A;  1NZO A;  3BRM A;  4PM7 A;  3HUO A;  5DTS A;  3LY3 A; 
#chains in the Genus database with same CATH topology
 3N8L A;  1BTL A;  4GD6 A;  2Y2P A;  4IUK A;  1GA0 A;  2X02 A;  2ZM8 A;  3SW1 A;  3MXS A;  1Z6F A;  2ZQ8 A;  2EA9 A;  3BFG A;  1T19 A;  4DE2 A;  1I5Q A;  2NUT C;  4EER A;  5CHU A;  5DJT A;  2Y2Q A;  1OTI A;  1T1C A;  2K7S A;  4CPK A;  1JNU A;  1PNE A;  2A49 A;  1EWZ A;  2Y4A A;  4BJP A;  3KSF A;  5KZH A;  4UEY A;  1ZHH B;  2X71 A;  1MBL A;  1PRQ A;  1S67 L;  1H8Y A;  2M1C A;  3MS6 A;  2IWD A;  2I72 A;  3B47 A;  5TBM B;  3N8S A;  4R3B A;  4A5R A;  1XFN A;  4S2M A;  4DXB A;  3DTE A;  2P9V B;  2JBF A;  3Q1F A;  3PAE A;  4KEN B;  1VET B;  4KQO A;  4EEU A;  2PYR A;  1J9M A;  3NDE A;  2QWS A;  1H3Q A;  5FDH A;  2EFU A;  3IXD A;  3HLE A;  2XSS A;  2ZQ9 A;  2NUP C;  2EWW A;  1L0E A;  1M40 A;  1U60 A;  1L0D A;  3IXG A;  4E3J A;  3SOI A;  1PW1 A;  3WS5 A;  1N9O A;  3BM6 A;  1TS0 A;  3T4K A;  2V1Z A;  3ZG5 A;  2KDK A;  3TRC A;  3HL9 A;  4Y7P A;  1RGY A;  4E6X A;  3IX4 A;  4JF4 A;  2EXA A;  3D3O A;  4UHU A;  2IWB A;  1H5X A;  3D9Y A;  5A93 A;  4WN5 A;  3CG5 A;  4E3O A;  5CTN A;  2J3T C;  4NXB A;  5HWV A;  1W7F A;  3T4T A;  2E8I A;  2JKR I;  3FKV A;  4KZ9 A;  3BY8 A;  5E2E A;  3OPH A;  1IYO A;  5EVI B;  2WKR A;  1FQG A;  2VGK A;  2W3H A;  2XF3 A;  4X1L A;  1W79 A;  5EVE A;  5J7E A;  5FEF A;  3UB6 A;  2HDU A;  3W8K A;  3IF6 B;  2VV8 A;  3OZH A;  3BWL A;  1T1B A;  3Q7Z A;  3G35 A;  5FI7 A;  3MF0 A;  3C5A A;  4LCL A;  3LIF A;  3NCK A;  5M1A A;  3G31 A;  4EUZ A;  4EU0 A;  3F1O B;  4DRT A;  1VHM A;  3PBT A;  4NK3 A;  2J80 A;  1KE4 A;  4HJ4 A;  1K55 C;  2CC1 A;  5A8B A;  5F69 A;  3G2Z A;  3ICY A;  3W4P A;  1PWG A;  1FR1 A;  2G7U A;  4U0T A;  4IJG A;  5FEG A;  3GVB A;  5KSC A;  5FQQ A;  1V9Y A;  3PYP A;  2J9P A;  3VE4 A;  4MBF A;  4YOF A;  3U2A A;  3E4Q A;  1LLB A;  2JC7 A;  4F3L A;  2PR6 A;  2EWV A;  4GNU A;  4HBU A;  3VP4 A;  3CIT A;  3LR4 A;  3LI8 A;  3ZG9 B;  3OBF A;  4E6W A;  4KQR A;  3EGX C;  1GHP A;  3H7W A;  5CGS A;  4Y5F A;  5AQB A;  4MBH A;  1F98 A;  2AVX A;  3V50 A;  1ERQ A;  3O86 A;  3UN7 A;  1SCW A;  3G30 A;  4EBN A;  1KVM A;  4Q0J A;  4EET B;  3QP8 A;  4EV4 A;  1MKM A;  3T4S A;  5EUA A;  2XQZ A;  4HJ3 A;  3CAX A;  2VX8 A;  3U4L P;  1GSW A;  3Q82 A;  2OAP 1;  3Q7V A;  3SS4 A;  1NLZ A;  5CER A;  1XJ6 A;  4ZJ1 A;  1Q2Q A;  3QP5 A;  5L8M A;  4E3M A;  2JE5 A;  2O9A A;  1TDG A;  1ZTU A;  4GOG A;  2VGJ A;  2WZZ A;  4GHI B;  4IBR A;  1ESI A;  4FSF A;  3LR5 A;  2ZC6 B;  1SKO A;  1TVF A;  4BMW A;  2VJW A;  2B95 A;  3UDX A;  4XT2 B;  2OLV A;  3LFV A;  3VMA A;  1ZG4 A;  4IED A;  5EOE A;  5CRF A;  1S1Z A;  4QWO A;  1OJG A;  5FI2 A;  1XJ3 A;  5EVI C;  5EE8 A;  1IYS A;  3IS2 B;  3G34 A;  1VEU B;  4JGP A;  3VE3 A;  3MKF A;  3P7N A;  5IS1 A;  1L3L A;  3IF6 C;  3QNC A;  3ZFZ A;  1F9I A;  4RX2 A;  4LV1 A;  4GCZ A;  5A90 A;  1PWD A;  1TS8 A;  3V3S A;  1LI9 A;  4OON A;  4ZJ3 A;  3F1N B;  4WMC A;  4L9E A;  2Y55 A;  3PHY A;  5E43 A;  4FOF A;  3C4P A;  3VP3 A;  4UQI M;  2XA7 S;  2OSU A;  2X01 A;  3A0R A;  5TR7 A;  1BLC A;  4X56 A;  3DTI A;  1RCJ A;  1CK3 A;  1KGE A;  3Q81 A;  2ZOI A;  4C75 A;  5L09 A;  3UB9 A;  3NOP C;  3MXQ A;  1IEM A;  4NET A;  3M2J A;  4F94 A;  5GLC A;  3HVF A;  3PTE A;  4R70 A;  4MN7 A;  2PD7 A;  5TGF A;  2V2F F;  5AVF A;  5HL1 A;  3NY4 A;  4MMN A;  5EFW A;  2EX2 A;  3M2K A;  3ZNT A;  1KDW A;  3P98 A;  2A2L A;  4R1G A;  4AFI A;  3H82 A;  2Q9N A;  5FQJ A;  3AGE A;  3PR6 A;  1MWU A;  1K6S A;  3FPV A;  2FFY A;  4PPR A;  4HNB A;  5HFO A;  2O0Y A;  5IT5 A;  1KGG A;  3OCN A;  3T1Q B;  3IWO A;  5EEC A;  4PM9 A;  4WEJ A;  1KGF A;  3LEQ A;  3P01 A;  1P97 A;  2Z6D A;  1NLY A;  3BEC A;  4P0M A;  1IFQ A;  1OME A;  1VM1 A;  5EVI A;  1Y28 A;  2V8C A;  2JKF A;  5M18 A;  4HES A;  1KOU A;  4OQI A;  4PM7 A;  3HUO A;  5DTS A;  3ZG0 A;  3Q07 A;  3IXH A;  3V3R A;  1IOU A;  3IF6 A;  1K54 C;  5CXW A;  2VZW A;  4FUW A;  1TF1 A;  4QJG A;  4FD8 A;  2R9W A;  3BFD A;  1ZC2 A;  4I5S A;  1TEM A;  4OP8 A;  5FQ9 A;  2Y2J A;  1DP9 A;  4LLO B;  2ZMF A;  2Y2I A;  4LRX C;  2HF6 A;  3LIC A;  4DDS A;  4WLA A;  2V20 A;  3NDG A;  1YSQ A;  5FQK A;  2WK0 A;  1YLZ A;  4KZ5 A;  4X69 A;  3ULF A;  4Q8I A;  1TD5 A;  5FAO A;  2W3G A;  4BL3 A;  3IWQ A;  1P0Z A;  3MZD A;  5FAS A;  4KG5 A;  3T4J A;  1PYY A;  3WRZ A;  3QP6 A;  4RVA A;  1MZU A;  4X6T A;  2WUQ A;  4OVD A;  1JTD A;  5KIZ A;  1SDN A;  4GS9 B;  4XUX A;  4HY8 A;  3HJI A;  2W3F A;  4EQI A;  3A3J A;  1HD8 A;  3O87 A;  2LB5 A;  1W5D A;  5FAP A;  2Y8H A;  3BQA A;  1STZ A;  3HLW A;  5E2G A;  3N6I A;  4OQ0 A;  1ES5 A;  1K25 A;  1E3U A;  3G6O A;  3AGF A;  5AJG A;  2XK1 A;  4S2P A;  4I38 A;  3ZVW A;  5HD5 A;  1H0M A;  3SS3 A;  4PAU A;  4OP5 A;  4X68 A;  1L2S A;  5HZH A;  2XDM A;  4RX3 A;  1XJ4 A;  4N9K A;  1LT0 A;  1PW8 A;  2WZX A;  5BOH A;  1PFL A;  3EOI A;  5EPH A;  1XXM A;  4GHI A;  2WKP A;  4O0P A;  3T1R A;  3LIE A;  4HI4 A;  4X1M A;  5DVA A;  3T12 B;  3P09 A;  1K6R A;  3F1P B;  2VLG A;  4XT2 A;  4O7D A;  4ARZ B;  3K2N A;  5MC7 A;  1S66 L;  1XA1 A;  4EXO A;  3IXB A;  4YNR A;  1N9N A;  1S4R A;  2EX9 A;  3LI9 A;  4LRZ E;  3IS2 A;  3T4O A;  1L0F A;  3HRE A;  2JKT I;  4LCM A;  3NJA A;  4QY6 A;  2GX5 A;  3DWZ A;  3IBR A;  3JVV A;  1JVJ A;  1TS6 A;  2K31 A;  3L7H A;  4MBK A;  5EOO A;  1CJF A;  2HP5 A;  2PU4 A;  4NEE D;  5HW3 A;  1WYB A;  1D7E A;  4D60 A;  2INW A;  1K4E A;  3RH8 B;  4YWZ A;  3MQQ A;  2IA2 A;  3N8R A;  4P87 A;  1YLJ A;  3ZGA B;  2WAF A;  3S7Q A;  1WYC A;  1K57 A;  4X55 A;  2EX6 A;  2VEA A;  3HCY A;  4KG6 A;  1W8Y A;  2VK3 A;  3BFC A;  2HJ9 C;  3IX3 A;  4KZ4 A;  3DAV A;  4ZRR A;  3GQZ A;  1LI0 A;  2WKQ A;  5IU1 A;  1SDE A;  1GSV A;  3CI6 A;  2H10 A;  1S6R A;  3BY9 A;  4WYY A;  2PYP A;  3FYZ A;  3K3C A;  5A92 A;  3MFX A;  2HP9 A;  3GV9 A;  3ZQ5 A;  1BSG A;  1LL5 A;  4Q0H A;  1CI8 A;  1GHM A;  3CJM A;  3CPT B;  5EVL A;  2QPN A;  2QHK A;  3S7N A;  2QYB A;  3JPU A;  4IUH A;  2WAD A;  4LV0 A;  1YLP A;  5CED A;  1FIL A;  5DKL A;  1F5M A;  2DMW A;  1D1J A;  2E8J A;  5LBR A;  5I5L A;  1OTE A;  2I9V A;  2L0W A;  4IBX A;  2QKP A;  4KZ3 A;  4OKP A;  4B93 A;  4GDB A;  1P9R A;  3H9W A;  2FH5 A;  4UA7 A;  3NIA A;  2FZ0 A;  4PHT A;  4BBT A;  1K56 D;  2HV1 A;  4OOL A;  2D01 A;  4KZB A;  4GJ4 A;  2J3T D;  3WWX A;  4L9F A;  4YFM A;  3UPO A;  4UQI S;  4R3A A;  5F1G A;  1OT6 A;  3G32 A;  4WUJ A;  4DMZ A;  3TOI A;  5L2F A;  4GD8 A;  2W0N A;  4LV2 A;  1SKF A;  4LFU A;  2GNX A;  2PAV P;  5EM0 A;  2HZ5 A;  5TFQ A;  1G28 A;  4MLL A;  4BQM A;  1S0W A;  3WRT A;  2WGW A;  5HDS A;  1YKD A;  3ZDJ A;  1IKG A;  4OOY A;  2ZM2 A;  2PRF A;  2R78 A;  4GLQ A;  3TSG A;  3DW0 A;  3FC7 A;  4R3J A;  4II7 A;  3T4L A;  2Q0O A;  3BYD A;  5HDD A;  3FZC A;  3EQV A;  2DCF A;  2YKH A;  3OPL A;  4H6J A;  3OLO A;  1ERO A;  2ZOH A;  3MZE A;  4C3Q A;  1T1A A;  3GMW A;  1JWP A;  4EEP A;  3TE8 A;  4WMC D;  2CMN A;  4BWI A;  4ZBE A;  3MZF A;  1PIO A;  4S2I A;  5AQA A;  1K56 A;  3GSG A;  3A3D A;  3PAG A;  3FKW A;  3I7J A;  1NJ4 A;  2YKF A;  2DRW A;  2W3E A;  2KLI A;  2L4R A;  4EW7 A;  5DKK A;  1K4F A;  4WZ5 C;  2ZMV A;  1E4D A;  5IHV A;  3LUQ A;  3QP1 A;  4S2O A;  3HUN A;  1E25 A;  3ISG A;  2BLS A;  3BFF A;  1BLP A;  5DTT A;  1JTG A;  4ZTK A;  3MJQ A;  1DJC A;  1MWR A;  1YSP A;  1V9Z A;  1NRJ A;  4QU3 A;  3DTM A;  3E4O A;  3BRM A;  1VB6 A;  3EWK A;  1EI5 A;  3IQA A;  3B3X A;  3S4X A;  2UWX A;  5HDC A;  4Y2F A;  1NWZ A;  1K55 A;  2C5W B;  4DJ2 A;  1O07 A;  4ETX A;  3E0Y A;  2Y2M A;  1W63 M;  2XGN A;  1H8Z A;  2OV5 A;  4YIN A;  2EX8 A;  3UE0 A;  2O99 A;  4HP9 A;  4IVK A;  4HOI A;  5EVI D;  1YQS A;  2PBD P;  2XEP A;  2HDS A;  3HLB A;  4S2N C;  4E3N A;  1O7E A;  5TBM A;  2P08 A;  2KOI A;  2OAQ 1;  1NXY A;  2P9V A;  3RXW A;  5FL3 A;  1HVB A;  5TJJ A;  1VET A;  2Y2K A;  3N7W A;  1IEL A;  3R7W B;  5HAQ A;  3T1S A;  4L9G A;  3HLF A;  1PI5 A;  3A3I A;  1TS7 A;  5CHJ A;  2WKH A;  3VOY A;  1ACF A;  5JYO A;  4S2K A;  1G6O A;  3VP1 A;  3C30 A;  4RYE A;  4MCW A;  3MKE A;  1YPR A;  1PZO A;  2HP6 A;  2WGV A;  4OPY A;  2B02 A;  3WS4 A;  3V39 A;  3IF5 A;  2PBY A;  4Y15 A;  1BLS A;  4EES A;  1ESU A;  3UE3 A;  1W63 Q;  1DJA A;  4WZ5 A;  2VV6 A;  4Y17 A;  4N9L A;  3V67 A;  1DP8 A;  1JWZ A;  1CQA A;  1OJ5 A;  2V8F A;  3ITA A;  2J3W A;  3G4P A;  3NEC A;  1ERM A;  2H0T A;  3IHA A;  1OPX A;  3HLD A;  3OCL A;  2VGL M;  4N1H A;  1A0K A;  1YAX A;  3HUM A;  3SZT A;  2WGI A;  4ZJ2 A;  1BYW A;  5HX9 A;  4KZ8 A;  5CTM A;  2Y91 A;  1E3U D;  3K3D A;  4Y0T A;  3QHY A;  2P04 A;  3EQU A;  4K0X A;  4OPQ A;  3BFE A;  5DTK A;  2M7V A;  4JKT A;  3WS1 A;  4UA9 A;  4CLC E;  2B18 A;  5DJU A;  1NY0 A;  3UPP A;  3F1O A;  3OPP A;  3GR2 A;  1DJB A;  2GDN A;  5AVE A;  2JKR M;  3CZD A;  3PBQ A;  4RQ9 A;  2V9A A;  3VSL A;  5J8X A;  2Y79 A;  4WEL A;  3OOV A;  2BAS A;  2Y2H A;  4B4X A;  5C5K A;  5HAI A;  4M3K A;  1CI9 A;  4MNR A;  3E2L A;  3EEA A;  3CMZ A;  1C3B A;  1Q2P A;  5FAT A;  4WEK A;  4DE3 A;  5FQI A;  2H0Y A;  2ZD8 A;  4HP4 A;  2W1T B;  3UB5 P;  1I2S A;  4N92 A;  4P6Z M;  1GCE A;  2HDQ A;  4GKU A;  5FSR A;  5DFY A;  2BG1 A;  1K38 A;  4R6L A;  5HWT A;  4B88 A;  3IH8 A;  3UMD A;  5AQ9 A;  1K0K A;  1XA7 A;  4OQG A;  3HJK A;  4K0W A;  4R0Q A;  2QJ5 A;  1FCM A;  4JLF A;  1FOF A;  3PBN A;  3H7W B;  4P85 A;  5HPF A;  1XKZ A;  3O3V A;  3OC2 A;  4GW9 A;  3M6H A;  2Y2G A;  4GN2 A;  3EEH A;  4S2J A;  1OTA A;  1PWC A;  2VA0 A;  1GHI A;  1PI4 A;  4KZ7 A;  3FPW A;  4JGR A;  1DY6 A;  3LCE A;  3T1X A;  3NBL A;  3KX0 X;  3CHW P;  2Z2L B;  3A0S A;  2QZ6 A;  3TJZ C;  4JXG A;  2Y2O A;  1DRM A;  5GLB A;  3W2Z A;  4E04 A;  3C4O A;  1BLH A;  2P7J A;  4GB7 A;  2ZC4 B;  2ZMA A;  4FH2 A;  3LO7 A;  1H8M A;  2ZC3 B;  1RP5 A;  2O9B A;  4WL9 A;  2ZQ7 A;  2J9O A;  1BT5 A;  3RJU A;  3VOL A;  5GHZ A;  3MSH A;  1K54 A;  1UWN X;  3IHB A;  4LPZ A;  1N9B A;  4ESP A;  2OOL A;  4Y0O A;  5DF8 A;  2XRN A;  1VEU A;  3SS5 A;  1OTD A;  5G4Y A;  1X0O A;  4JPM A;  4PM8 A;  5EV0 A;  4PM5 A;  1XX2 A;  2KX6 A;  5GHX A;  2ZBB A;  3MBZ A;  4Z9Q A;  1J3W A;  3LYX A;  4QHC A;  2FFF B;  1LL8 A;  5M19 A;  4RA7 A;  2HDR A;  2A3U A;  1AWI A;  4B4Z A;  3IWI A;  3LY3 A;  3KSG A;  1N4O A;  3UDF A;  3F1N A;  1KE3 A;  1WE4 A;  4QPR A;  5HD3 A;  2JKG A;  2XH9 A;  4KQQ A;  4WBG A;  2Z2M B;  3KYQ A;  5F5Y A;  2V0W A;  1P9W A;  3IH9 A;  1L0G A;  5F83 A;  1XPB A;  5AQ7 A;  5EM1 A;  3EGD C;  3R7W A;  2MJ6 A;  3MFD A;  2G2W A;  1QME A;  2ACG A;  1HTZ A;  2LB9 A;  1N9L A;  4QB8 A;  2ZM0 A;  1XGI A;  3D72 A;  3DTK A;  3MMH A;  4MDZ A;  4EQ1 A;  1LSV A;  3ITB A;  3SH7 A;  3C7U A;  3MXR A;  3R4K A;  3W4Q A;  1BUE A;  3NOT C;  4IHQ A;  2RL3 A;  3HLG A;  1LL9 A;  4P6B A;  1MKI A;  4DN0 A;  3DBA A;  5D3O A;  3C38 A;  3LR0 A;  4CLC B;  4G3K A;  4MN5 A;  3LEZ A;  3GTC A;  5F82 A;  4ETZ A;  5I94 A;  1HZO A;  3GRJ A;  3ZG8 B;  2OWJ A;  3MQO A;  2PHY A;  1NYM A;  2PU2 A;  4KZA A;  2UV0 E;  3H82 B;  3O88 A;  3RFB A;  3JYI A;  4I3A A;  1S1Y A;  5DFX A;  2V0U A;  2WKE A;  1M6K A;  5JYP A;  4EBL A;  2RCX A;  5A91 A;  5F6A A;  1D06 A;  1ES4 A;  1MY8 A;  4C6Y A;  1GA9 A;  1YLT A;  4L0L A;  1BZA A;  1RGZ A;  1NZO A;  1UGU A;  4OPZ A;  5GLA A;  1MWT A;  3ZCZ A;  2O9C A;  3W4O A;  3KYE A;  3GEC A;  4LV3 A;  4U0X A;  4NG2 A;  3KO6 A;  3PXP A;  3UB8 A;  4D2O A;  2EXB A;  4CQH A;  3MQ0 A;  2WYX A;  3CUE C;  5CEB A;  4HH3 A;  1XP4 A;  4CJN A;  1ZG6 A;  4UA6 A;  4Q0I A;  3OPR A;  2Y2N A;  3A0V A;  3VP2 A;  4HH2 A;  4PKY A;  1KDS A;  5G18 A;  3QP2 A;  1W8Q A;  3PBR A;  3ZHH A;  4I39 A;  4I3J A;  3G2Y A;  3O5Y A;  4M4X A;  1MXO A;  4HIA A;  5J3W A;  3MR0 A;  3C2W A;  2QJ7 A;  5DF7 A;  2C6W B;  1Y4O A;  2EFX A;  5E2F A;  2IWC A;  3LR3 A;  3ZYT A;  4DE0 A;  2PDR A;  1MC0 A;  5GLD A;  2W1T A;  5KMW A;  4JXS A;  2J8Y A;  4U3T A;  2XR0 A;  1DP6 A;  1ZKJ A;  3L9K A;  4GS9 A;  2XD1 A;  1KE0 A;  4LRY C;  1ES3 A;  1KVL A;  1ONG A;  4JGO A;  3V5M A;  2A24 B;  3C8C A;  4PMA A;  1F2K A;  2L1M A;  1S4S A;  1G6A A;  4OPR A;  1XGJ A;  3BW6 A;  3UDI A;  3UO9 A;  4E3L A;  2ZL1 B;  4BL2 A;  1XJ2 A;  4XXR A;  3BJN A;  2WKI A;  3UE6 A;  2VGL S;  3AGD A;  4BEN A;  3UPN A;  3LIA A;  1HLU P;  1SHV A;  2D02 A;  1ALQ A;  1PZP A;  4CLC C;  3S22 A;  4HQA A;  1TDL A;  4OOM A;  4ZDX A;  2H5S A;  3N4I A;  3B33 A;  2JN7 A;  3IX8 A;  5HPI A;  1Z09 A;  2WAE A;  4MEZ A;  1GSX A;  4ID4 A;  3F1P A;  3LID A;  1FCN A;  4MN6 A;  4BD0 A;  4ARZ A;  2PT7 A;  2J7V A;  1VQQ A;  3PBO A;  2ZQD A;  1MPL A;  5FDS A;  1UWP X;  3HLC A;  4DKI A;  2Y2L A;  4O01 A;  1OTB A;  3IT9 A;  4CLC D;  5CX7 A;  3NOU C;  3UE1 A;  3CUE A;  1FIK A;  2XLN A;  4BBV A;  2GJ3 A;  2HJE A;  1YMX A;  2M7U A;  1YLY A;  4NKP A;  1IKI A;  3NC8 A;  2BTF P;  4WM9 A;  2XD5 A;  1CF0 A;  1YLW A;  3ZG7 B;  5HAP A;  3VSK A;  2PD8 A;  2ZQC A;  4P6Z S;  1ES2 A;  2H28 A;  4JF5 A;  2ZLY A;  1EW0 A;  2XRO A;  2QMI A;  4KUK A;  3UB7 A;  4QY5 A;  4X25 A;  4OQH A;  2JKT M;  1NRF A;  5CHM A;  3BEB A;  2W1R A;  4JF6 A;  3ZNY A;  3FG8 A;  1CEF A;  3SH8 A;  5E2H A;  4Y3I A;  3T4Q A;  4KQD A;  4NXF A;  2JCH A;  4HBT A;  4X53 A;  4WZ4 A;  2VKS A;  3BQ8 A;  3GDI A;  5GHY A;  4G3W A;  4Z1W A;  4O8G A;  2HPB A;  3C7V A;  3CLO A;  4OH0 A;  3VP0 A;  5K5B A;  2G2U A;  5CEC A;  4EWF A;  3M6B A;  1LHY A;  3CPT A;  4BBU A;  5HSQ A;  4NXE A;  5FQM A;  4ME4 A;  4CLC A;  4EBP A;  3CWF A;  4FCF A;  3KSH A;  3E98 A;  5U47 A;  3NHQ A;  4H8R A;  1G68 A;  3JVU A;  3QP4 A;  1IYP A;  3WS0 A;  2ZQA A;  5J4E A;  4JXV A;  1NZU A;  2XFT A;  1AXB A;  3NUL A;  1T18 A;  4DF6 A;  2GZA A;  4NXG A;  4XUZ A;  1FSW A;  3D4F A;  4N1X A;  3SH9 A;  1FSY A;  1MWS A;  5FI6 A;  3VFH A;  3HBR A;  3S7O A;  4DXC A;  5FAQ A;  3A3F A;  4HHD A;  1FR6 A;  1Y54 A;  1CEG A;  4R38 A;  3LIB A;  4LEN A;  4GDN A;  3WS2 A;  3IBJ A;  3UY6 A;  3PBS A;  5L07 A;  3QNB A;  3VOZ A;  4E3I A;  4HJ6 A;  5CGX A;  2XFS A;  4KZ6 A;  4JGQ A;  5HL6 A;  3LY4 A;  4I3I A;  5F1F A;  4BD1 A;  2W3D A;  1BUL A;  2VV7 A;  4K91 A;  3VV4 A;  5DF9 A;  3T50 A;  3RXX A;  3S7P A;  4R4R A;  1ODV A;  4OLG A;  4S2N A;  5L10 A;  3TG9 A;  1G5U A;  3ZVT A;  4DE1 A;  3KYZ A;  3TW8 A;  1LSX A;  2V1B A;  4DDY A;  3E4P A;  4WF0 A;  3BLS A;  5HWW A;  1ONH A;  2JHE A;  1JWV A;  2ZC5 B;  4Y13 A;  3FWL A;  4FTX A;  2WGW B;  4KUO A;  5G4Z A;  3NI9 A;  3UME A;  3BLM A;  4R4S A;  1NYY A;  4EUV A;  5GL9 A;  4F3L B;  1YM1 A;  1K57 C;  2Q9M A;  4KG2 A;  3E2K A;  1OT9 A;  2B5R A;  2R9X A;  1FCO A;  2OWH A;  2PR5 A;  4Y0U A;  1LSW A;  5HAR A;  4IVI A;  4BLM A;  2V1A A;  2HGV A;  4GZB A;  4H6J B;  5KSH A;  2Z6C A;  4HEF A;  4S2L A;  1I2W A;  4JBF A;  2DNS A;  2XA7 M;  4R23 A;  2A24 A;  5CGW A;  1SZV A;  4PM6 A;  3LGO A;  3FV7 A;  4B9O A;  2ZL1 A;  4G3V A;  2W27 A;  2ZC7 A;  3S1Y A;  2Y59 A;  3RTY A;  3VFF A;  4PKY G;  3DWK A;  3Q7V B;  4OLD A;  4K08 A;  2P74 A;  4LGW A;  2ZJ9 A;  4QD4 A;  1XFQ A;  2OLU A;  1YT4 A;  4ZAM A;  4UAA A;  4E3K A;  5FA7 A;  3UNW A;  1IYQ A;  1SKO B;  1YMS A;  3B42 A;  3KSI A;  1QMF A;  2K2N A;  4FH4 A;  5F68 A;  4DJ3 A;  3A3E A;  1WA9 A;  4JXW A; 
#chains in the Genus database with same CATH homology
 3ZG0 A;  3Q07 A;  1MWT A;  1EI5 A;  3IXH A;  3N8L A;  3V3R A;  3IQA A;  3ZCZ A;  3B3X A;  3S4X A;  3W4O A;  2UWX A;  3IF6 A;  1BTL A;  4GD6 A;  4LV3 A;  4U0X A;  1K54 C;  2Y2P A;  5CXW A;  1GA0 A;  2X02 A;  4D2O A;  2EXB A;  2ZM8 A;  4QJG A;  3MXS A;  1Z6F A;  2ZQ8 A;  4FD8 A;  2R9W A;  3BFD A;  2WYX A;  1K55 A;  1ZC2 A;  3BFG A;  1TEM A;  2C5W B;  4DE2 A;  1I5Q A;  1O07 A;  5CEB A;  5CHU A;  2Y2Q A;  1XP4 A;  4OP8 A;  5FQ9 A;  1ZG6 A;  2Y2M A;  2Y2J A;  4CJN A;  4UA6 A;  2XGN A;  3OPR A;  1H8Z A;  2Y2I A;  2OV5 A;  2Y2N A;  4CPK A;  4YIN A;  2EX8 A;  3UE0 A;  2A49 A;  3VP2 A;  4DDS A;  1EWZ A;  4IVK A;  2Y4A A;  1KDS A;  4BJP A;  2V20 A;  1YQS A;  3NDG A;  5EVI D;  2XEP A;  5G18 A;  2X71 A;  5FQK A;  5KZH A;  1MBL A;  1W8Q A;  3PBR A;  3ZHH A;  2WK0 A;  1YLZ A;  2HDS A;  1H8Y A;  4KZ5 A;  4X69 A;  3HLB A;  4S2N C;  4E3N A;  1O7E A;  3G2Y A;  4Q8I A;  1MXO A;  2IWD A;  2I72 A;  1NXY A;  3N8S A;  2P9V A;  4R3B A;  5DF7 A;  5FAO A;  3RXW A;  1HVB A;  2C6W B;  4A5R A;  4BL3 A;  4S2M A;  2EFX A;  4DXB A;  5E2F A;  2Y2K A;  3N7W A;  2IWC A;  2P9V B;  2JBF A;  1IEL A;  3IWQ A;  3MZD A;  3PAE A;  3Q1F A;  5FAS A;  5HAQ A;  4KG5 A;  4KEN B;  4KQO A;  1PYY A;  3HLF A;  4DE0 A;  3WRZ A;  1PI5 A;  1J9M A;  3A3I A;  5GLD A;  5KMW A;  3NDE A;  4JXS A;  4RVA A;  2J8Y A;  4U3T A;  2XR0 A;  4X6T A;  5CHJ A;  2WUQ A;  4OVD A;  1ZKJ A;  1JTD A;  2WKH A;  5FDH A;  3VOY A;  2EFU A;  1KE0 A;  2XD1 A;  1SDN A;  3IXD A;  5JYO A;  4S2K A;  3HLE A;  4XUX A;  3VP1 A;  2ZQ9 A;  4RYE A;  1ES3 A;  3MKE A;  4EQI A;  1KVL A;  3A3J A;  1PZO A;  1HD8 A;  1ONG A;  3O87 A;  2HP6 A;  2WGV A;  3V5M A;  4OPY A;  1L0E A;  1M40 A;  1W5D A;  5FAP A;  1U60 A;  3WS4 A;  1L0D A;  3IXG A;  4PMA A;  4E3J A;  3SOI A;  1G6A A;  1PW1 A;  4OPR A;  3V39 A;  3IF5 A;  3HLW A;  2PBY A;  5E2G A;  3N6I A;  4OQ0 A;  3WS5 A;  1XGJ A;  3BM6 A;  1ES5 A;  3UDI A;  2V1Z A;  1K25 A;  3UO9 A;  3ZG5 A;  1E3U A;  4BL2 A;  4E3L A;  4XXR A;  1BLS A;  2WKI A;  3HL9 A;  1ESU A;  3UE3 A;  4Y7P A;  3AGD A;  4BEN A;  3AGF A;  3UPN A;  1RGY A;  2XK1 A;  4E6X A;  1DJA A;  4WZ5 A;  1SHV A;  4JF4 A;  4N9L A;  4S2P A;  2EXA A;  3ZVW A;  4UHU A;  2IWB A;  1JWZ A;  3SS3 A;  1ALQ A;  1PZP A;  1H5X A;  3S22 A;  4OP5 A;  4X68 A;  4OOM A;  1L2S A;  1TDL A;  3ITA A;  4ZDX A;  5A93 A;  2H5S A;  3CG5 A;  3N4I A;  2XDM A;  4RX3 A;  4E3O A;  3G4P A;  4N9K A;  5CTN A;  1PW8 A;  1ERM A;  2WZX A;  2H0T A;  5BOH A;  3IHA A;  1W7F A;  3HLD A;  5EPH A;  1XXM A;  3OCL A;  2E8I A;  2WAE A;  3FKV A;  4KZ9 A;  4MEZ A;  5E2E A;  4N1H A;  3HUM A;  3OPH A;  1IYO A;  2WGI A;  4ID4 A;  1FCN A;  5EVI B;  5DVA A;  4ZJ2 A;  1FQG A;  2VGK A;  5HX9 A;  3P09 A;  1K6R A;  2Y91 A;  4KZ8 A;  2XF3 A;  1E3U D;  5CTM A;  4BD0 A;  1W79 A;  2J7V A;  4O7D A;  4Y0T A;  1VQQ A;  3PBO A;  3QHY A;  3EQU A;  4K0X A;  2ZQD A;  1MPL A;  1XA1 A;  4OPQ A;  2HDU A;  3HLC A;  3IXB A;  3W8K A;  3BFE A;  4OPZ A;  4DKI A;  2Y2L A;  3IF6 B;  5DTK A;  2EX9 A;  4JKT A;  3WS1 A;  3IT9 A;  3OZH A;  3UE1 A;  4UA9 A;  1L0F A;  3HRE A;  3Q7Z A;  3G35 A;  4LCM A;  5FI7 A;  3C5A A;  4QY6 A;  2XLN A;  4LCL A;  1NY0 A;  1YMX A;  3DWZ A;  1YLY A;  1JVJ A;  3NCK A;  3UPP A;  3OPP A;  1IKI A;  3GR2 A;  3NC8 A;  1DJB A;  2GDN A;  4MBK A;  5M1A A;  3CZD A;  3G31 A;  3PBQ A;  4EUZ A;  4WM9 A;  5EOO A;  2XD5 A;  4DRT A;  1YLW A;  3ZG7 B;  2HP5 A;  2PU4 A;  5HAP A;  3VSK A;  3VSL A;  2ZQC A;  5HW3 A;  5J8X A;  3PBT A;  1WYB A;  4NK3 A;  1KE4 A;  1K55 C;  4WEL A;  1ES2 A;  1K4E A;  4JF5 A;  4B4X A;  2Y2H A;  2ZLY A;  2CC1 A;  5HAI A;  3N8R A;  4P87 A;  1YLJ A;  2QMI A;  3G2Z A;  4M3K A;  3W4P A;  1CI9 A;  2WAF A;  4MNR A;  3ZGA B;  1PWG A;  1FR1 A;  3E2L A;  4QY5 A;  1WYC A;  1K57 A;  4X55 A;  2EX6 A;  4OQH A;  3CMZ A;  4KG6 A;  4U0T A;  1C3B A;  1W8Y A;  1NRF A;  3GVB A;  5CHM A;  1Q2P A;  3BFC A;  5KSC A;  3BEB A;  4JF6 A;  4KZ4 A;  5FAT A;  5FQQ A;  3ZNY A;  4WEK A;  4DE3 A;  5FQI A;  2H0Y A;  3GQZ A;  1LI0 A;  1CEF A;  2ZD8 A;  2J9P A;  4MBF A;  3SH8 A;  5E2H A;  1LLB A;  2JC7 A;  1I2S A;  4N92 A;  1SDE A;  1GCE A;  2HDQ A;  4GKU A;  4GNU A;  5FSR A;  4HBU A;  3VP4 A;  2BG1 A;  2JCH A;  4HBT A;  2H10 A;  1K38 A;  1S6R A;  4X53 A;  4B88 A;  3ZG9 B;  3IH8 A;  5AQ9 A;  4WZ4 A;  4E6W A;  4WYY A;  1XA7 A;  4KQR A;  1GHP A;  4OQG A;  5GHY A;  4K0W A;  3FYZ A;  4R0Q A;  1FCM A;  4JLF A;  5CGS A;  1FOF A;  5A92 A;  2HPB A;  3C7V A;  3PBN A;  2HP9 A;  4OH0 A;  3VP0 A;  3GV9 A;  2G2U A;  4P85 A;  5AQB A;  5CEC A;  1BSG A;  4MBH A;  4EWF A;  1LL5 A;  1LHY A;  3M6B A;  1XKZ A;  3V50 A;  1CI8 A;  1ERQ A;  1GHM A;  3CJM A;  3O3V A;  3OC2 A;  3O86 A;  3M6H A;  3UN7 A;  1SCW A;  3G30 A;  4EBN A;  2Y2G A;  1KVM A;  5FQM A;  5EVL A;  4GN2 A;  2QPN A;  4S2J A;  4EV4 A;  1PWC A;  4EBP A;  4FCF A;  1GHI A;  1PI4 A;  4KZ7 A;  5EUA A;  2XQZ A;  5U47 A;  4H8R A;  1DY6 A;  2WAD A;  4LV0 A;  1G68 A;  3LCE A;  1YLP A;  5CED A;  1IYP A;  3WS0 A;  2ZQA A;  4JXV A;  1NZU A;  3NBL A;  2XFT A;  1AXB A;  3Q82 A;  2Z2L B;  3Q7V A;  3SS4 A;  5CER A;  2QZ6 A;  4DF6 A;  4ZJ1 A;  4JXG A;  4XUZ A;  1FSW A;  1Q2Q A;  2Y2O A;  3D4F A;  4E3M A;  5GLB A;  2JE5 A;  4N1X A;  3SH9 A;  1FSY A;  3C4O A;  1BLH A;  1MWS A;  5FI6 A;  3VFH A;  1TDG A;  3HBR A;  4GOG A;  4IBX A;  2VGJ A;  2WZZ A;  4DXC A;  4GB7 A;  4KZ3 A;  5FAQ A;  2ZC4 B;  2ZMA A;  4FH2 A;  4IBR A;  3A3F A;  4OKP A;  3LO7 A;  1ESI A;  4FSF A;  2ZC3 B;  4GDB A;  1FR6 A;  1Y54 A;  2ZC6 B;  1RP5 A;  1CEG A;  3WS2 A;  4LEN A;  4GDN A;  2ZQ7 A;  2J9O A;  1BT5 A;  1TVF A;  3RJU A;  3UDX A;  2OLV A;  3NIA A;  4UA7 A;  5GHZ A;  1K54 A;  3VMA A;  1ZG4 A;  3UY6 A;  3IHB A;  3PBS A;  1N9B A;  4IED A;  5EOE A;  3QNB A;  5CRF A;  3VOZ A;  1K56 D;  4E3I A;  5FI2 A;  5EVI C;  5EE8 A;  4Y0O A;  5DF8 A;  5CGX A;  2XFS A;  4KZ6 A;  1IYS A;  3SS5 A;  4OOL A;  3LY4 A;  3G34 A;  4KZB A;  5F1F A;  4BD1 A;  4JPM A;  3WWX A;  3MKF A;  4PM8 A;  1BUL A;  4K91 A;  4YFM A;  4PM5 A;  1XX2 A;  3UPO A;  5GHX A;  3IF6 C;  3QNC A;  3ZFZ A;  3MBZ A;  5DF9 A;  4Z9Q A;  5F1G A;  3RXX A;  4RX2 A;  3G32 A;  4LV1 A;  4R4R A;  4OLG A;  4QHC A;  2FFF B;  3TOI A;  4S2N A;  3TG9 A;  4GD8 A;  4LV2 A;  5L2F A;  5A90 A;  5M19 A;  1PWD A;  3ZVT A;  1SKF A;  4RA7 A;  2HDR A;  2A3U A;  4B4Z A;  3V3S A;  4DE1 A;  3IWI A;  1LI9 A;  4JXW A;  4OON A;  1N4O A;  5TFQ A;  3UDF A;  4DDY A;  4ZJ3 A;  1KE3 A;  1WE4 A;  3BLS A;  4MLL A;  4WMC A;  4BQM A;  2Y55 A;  1S0W A;  1ONH A;  2WGW A;  2XH9 A;  4KQQ A;  4WBG A;  3WRT A;  2Z2M B;  5E43 A;  1JWV A;  3C4P A;  2ZC5 B;  3ZDJ A;  3VP3 A;  1IKG A;  3FWL A;  2WGW B;  4OOY A;  3IH9 A;  1L0G A;  5F83 A;  1XPB A;  2ZM2 A;  2OSU A;  3NI9 A;  2X01 A;  3BLM A;  3TSG A;  3DW0 A;  4R3J A;  5AQ7 A;  4R4S A;  3BYD A;  1NYY A;  5TR7 A;  3MFD A;  1BLC A;  2G2W A;  1QME A;  4X56 A;  1HTZ A;  5GL9 A;  1YM1 A;  1RCJ A;  4QB8 A;  1K57 C;  2Q9M A;  2ZM0 A;  4KG2 A;  3E2K A;  1XGI A;  2B5R A;  2R9X A;  1FCO A;  1CK3 A;  1KGE A;  3Q81 A;  3ITB A;  4Y0U A;  3SH7 A;  3FZC A;  3EQV A;  4C75 A;  2DCF A;  5HAR A;  3C7U A;  4IVI A;  3MXR A;  3OPL A;  5GLA A;  4BLM A;  3W4Q A;  1BUE A;  1ERO A;  1IEM A;  4NET A;  3MZE A;  4GZB A;  5KSH A;  4C3Q A;  4HEF A;  3M2J A;  4F94 A;  4S2L A;  1I2W A;  2DNS A;  4JBF A;  3GMW A;  2RL3 A;  4R23 A;  1JWP A;  3HLG A;  3HVF A;  5GLC A;  3PTE A;  1LL9 A;  4P6B A;  4WMC D;  5CGW A;  4ZBE A;  3MZF A;  1PIO A;  4PM6 A;  1MKI A;  4S2I A;  5AQA A;  1K56 A;  3FV7 A;  5D3O A;  5TGF A;  3GSG A;  2V2F F;  3A3D A;  2ZC7 A;  3S1Y A;  5HL1 A;  2Y59 A;  3PAG A;  3LEZ A;  3FKW A;  3NY4 A;  3I7J A;  3GTC A;  2EX2 A;  1NJ4 A;  3M2K A;  3ZNT A;  5F82 A;  2DRW A;  5I94 A;  3VFF A;  1KDW A;  3P98 A;  4R1G A;  3DWK A;  1HZO A;  3Q7V B;  3GRJ A;  3ZG8 B;  1NYM A;  2PU2 A;  1K4F A;  2Q9N A;  4OLD A;  2P74 A;  4KZA A;  4WZ5 C;  1E4D A;  5FQJ A;  5IHV A;  3AGE A;  1MWU A;  3O88 A;  1K6S A;  2FFY A;  4PPR A;  4S2O A;  5HFO A;  3HUN A;  3JYI A;  1E25 A;  1KGG A;  3ISG A;  2ZJ9 A;  4QD4 A;  2BLS A;  3BFF A;  2OLU A;  3OCN A;  1BLP A;  1YT4 A;  4ZAM A;  3IWO A;  5DTT A;  5EEC A;  4PM9 A;  4UAA A;  4WEJ A;  4E3K A;  5FA7 A;  1KGF A;  1JTG A;  4ZTK A;  2WKE A;  1M6K A;  3UNW A;  5JYP A;  4EBL A;  1IYQ A;  1DJC A;  1MWR A;  2RCX A;  5A91 A;  1YMS A;  3BEC A;  4P0M A;  1OME A;  1QMF A;  1VM1 A;  4FH4 A;  5EVI A;  1ES4 A;  1MY8 A;  4QU3 A;  4C6Y A;  1GA9 A;  1YLT A;  3A3E A;  4L0L A;  3DTM A;  5M18 A;  4HES A;  1BZA A;  4OQI A;  1RGZ A;  1NZO A;  3BRM A;  4PM7 A;  3HUO A;  5DTS A;  3LY3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...