3M2JA

Crystal structure of fluorescein-labeled class a -lactamase penp
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
256
structure length
256
Chain Sequence
DDFAKLEEQFDAKLGIFALDTGTNRTVAYRPDERFAFASTIKALTVGVLLQQKSIEDLNQRITYTRDDLVNYNPITEKHVDTGMTLKELADASLRYSDNAAQNLILKQIGGPESLKKELRKIGDEVTNPERFCPELNEVNPGETQDTSTARALVTSLRAFALEDKLPSEKRELLIDWMKRNTTGDALIRAGVPDGWEVADKTGAASYGTRNDIAIIWPPKGDPVVLAVLSSRDKKDAKYDDKLIAEATKVVMKALN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of fluorescein-labeled Class A -lactamase PenP
rcsb
source organism Bacillus licheniformis
molecule tags Hydrolase
molecule keywords Beta-lactamase
total genus 88
structure length 256
sequence length 256
chains with identical sequence B
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2010-03-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00144 Beta-lactamase Beta-lactamase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 3m2jA00
3PBOA 4RYEA 2XLNA 4WYYA 3N8LA 4OPYA 5FQQA 1W8QA 2OSUA 4KZ4A 2WUQA 4CPKA 3HLCA 2WGWA 4OLGA 1PI4A 2Y2HA 4JF4A 4R0QA 5FQKA 2HP5A 2HP9A 4K91A 2EXBA 1DJAA 4QD4A 1DJCA 2EX6A 3UE3A 1K6SA 3ZNYA 3UDIA 3Q82A 2EX8A 1MWSA 5FI6A 3VP1A 3BEBA 1K55A 1KDWA 4DE2A 3N8RA 2Y91A 5KSCA 5M18A 3G35A 1LL9A 2DRWA 4MBHA 4GKUA 4WMCD 1IKIA 4R3BA 5AQAA 4DE0A 1NYYA 3IH9A 1PYYA 4KZ3A 2PU4A 5HARA 1VQQA 3ZG5A 3MBZA 3NDEA 2HDUA 4S2OA 1HZOA 5GL9A 5CEDA 2ZM0A 5DTSA 1ZG4A 3ZNTA 4MEZA 3IF6A 1RGYA 2Y2QA 4PM6A 4UA9A 3SH8A 5HAIA 4WZ5C 1PZPA 1GHIA 2ZQ9A 1XP4A 5F83A 1PWGA 4FD8A 4PPRA 4JXSA 4NK3A 3PBQA 5GHXA 3W4QA 3OCNA 2R9XA 4Y7PA 4HEFA 1FCMA 2EX9A 3E2LA 2I72A 2Z2LB 4ZTKA 3SH9A 3UDFA 4E3IA 3OZHA 1XA1A 4WZ5A 2H5SA 1ALQA 1MBLA 5AQBA 2HDQA 3OPRA 2HP6A 1ESUA 3BFEA 4GB7A 4N9LA 3WS5A 3O88A 2FFFB 4WELA 4Y0UA 5HX9A 1YM1A 4M3KA 4U3TA 3ZG8B 1E4DA 2P9VA 4X56A 1K4EA 2HPBA 4EBPA 2WAEA 3V39A 1U60A 3VFHA 1K55C 1ERMA 4R4RA 4S2JA 1L0FA 3GRJA 4JXVA 4QU3A 4KZAA 1KGEA 1RCJA 2XD5A 1PW8A 1IYQA 4MBKA 4WBGA 1SHVA 3ZVWA 5EVIB 1GHPA 4MBFA 4X68A 4ZJ2A 2WGVA 1L0EA 3GTCA 3TSGA 1ERQA 4GD6A 5CGWA 4IVIA 3V3RA 3FKWA 3W8KA 2XFSA 2IWBA 2IWCA 2H10A 3GV9A 3PBSA 2XFTA 4JKTA 3ITBA 3IH8A 1MKIA 4R3JA 3Q81A 3QNBA 3BFDA 1W8YA 3W4OA 5L2FA 3LY3A 2JBFA 3C5AA 4OH0A 4GDNA 4X6TA 3HLDA 3ZVTA 4DKIA 4E3OA 1G68A 2XK1A 3HLGA 4EBLA 2Y2GA 1TEMA 3RJUA 4GN2A 2WGWB 3ZG9B 2A3UA 5HW3A 3HUMA 3GSGA 4OKPA 4IBXA 1NZUA 4NETA 3A3EA 4U0TA 5HAQA 2QPNA 3MXSA 4PMAA 1LHYA 4FSFA 4KZ9A 5GLAA 3C7VA 3VSKA 1HVBA 4OPZA 1SDEA 2Y55A 2VGKA 1G6AA 3HBRA 1KE0A 4E3MA 3V3SA 3B3XA 4RX3A 2HDSA 3IQAA 3UPPA 3IWOA 2RL3A 5HL1A 2J8YA 1H8YA 4LCMA 3HVFA 3A3DA 1FR6A 3BFCA 2HDRA 4B4XA 2WZZA 3C4OA 5CHMA 2XF3A 4JPMA 2XD1A 3ISGA 3G4PA 3IF6B 5CHJA 3FWLA 5E43A 2Q9MA 1IYPA 4ID4A 3VMAA 2V20A 3M2JA 1QMFA 2B5RA 4BLMA 4FH4A 4WEKA 1K56A 4XXRA 5FQ9A 1MWTA 1JWVA 1YMSA 5CGSA 4OQIA 1ZKJA 3S22A 3SH7A 4KZ7A 1LLBA 1ES3A 1FR1A 3BLSA 5F1GA 2A49A 5FQJA 3C7UA 4HESA 1IELA 1KVMA 4E3JA 3WRTA 1W7FA 3OPLA 2ZM2A 3UPNA 5D3OA 2WKEA 5E2HA 4OOYA 1W5DA 3G30A 1XA7A 4KG5A 5E2GA 1KVLA 3M6HA 1K4FA 1K6RA 3NBLA 4DXCA 2UWXA 4KG6A 3UO9A 1FCOA 5A91A 1MY8A 1GA0A 3ITAA 3NC8A 5EOEA 5GLDA 2JC7A 2XGNA 4Z9QA 5KZHA 3P98A 4E3KA 3IXGA 5EOOA 1KGGA 3UPOA 1ZC2A 3RXWA 1FSYA 4B88A 4X69A 3ZHHA 3WS0A 3WS2A 4OQ0A 5A93A 4K0WA 5FSRA 5TR7A 1PIOA 2WZXA 5KSHA 1JTDA 2DNSA 4N1XA 5KMWA 2P9VB 4OVDA 1LL5A 2ZC7A 2Y2JA 5E2FA 1Q2QA 4R23A 1MWRA 4DXBA 2XDMA 3IXBA 4JXGA 1SKFA 2V1ZA 3D4FA 1CK3A 3GMWA 1ONGA 4OPQA 3MKFA 1QMEA 1H5XA 2EX2A 3HLBA 3RXXA 4QHCA 3O3VA 1PI5A 4KG2A 4N9KA 4KQOA 3DTMA 1N9BA 1I2SA 1MWUA 1YLYA 1AXBA 4PM7A 5A92A 3BLMA 3UE0A 3G2ZA 5BOHA 1FCNA 4OP5A 4C75A 4BQMA 2Y4AA 3A3FA 3CMZA 3GVBA 4XUZA 4EBNA 2ZD8A 3PAEA 3MFDA 3IWIA 4IVKA 4FH2A 5AQ9A 1PWDA 3ZG0A 4BD1A 2XR0A 3PBNA 5CRFA 3PBTA 1XX2A 1XGJA 5EVIA 4A5RA 3OCLA 4GOGA 5I94A 4MNRA 2OV5A 2P74A 3SOIA 1ES2A 5DTTA 5FAQA 3WS1A 3O86A 3VFFA 4R4SA 2C6WB 5EVIC 1BLCA 4X55A 4U0XA 4JXWA 4WMCA 4JF5A 1K57A 1YT4A 4N1HA 4KZ5A 3G2YA 3V50A 4KQQA 2Y2PA 5JYPA 1SCWA 2G2UA 1FQGA 4JF6A 5DVAA 2ZC3B 2X01A 1E3UA 3QNCA 3NDGA 3VP2A 4LCLA 4DRTA 2ZQCA 3QHYA 5HFOA 4BD0A 3UNWA 1RGZA 5TGFA 1YLJA 1BTLA 4ZBEA 3HLEA 4QY5A 3DWZA 1GCEA 3WWXA 1TVFA 3G34A 3MZEA 3FZCA 1K25A 3DW0A 1M6KA 3N8SA 1EROA 3NY4A 3IXHA 5CGXA 4DE1A 4LENA 2Y2KA 3OPPA 3AGFA 3VOZA 1XPBA 3UE1A 3OC2A 1YLWA 2X71A 3OPHA 3UN7A 2GDNA 1L2SA 3HUOA 4OOMA 4WZ4A 1WYCA 3VP3A 1BULA 5M1AA 2WK0A 1KE3A 1OMEA 4EQIA 1MPLA 1H8ZA 4YINA 3IHAA 3BECA 1FSWA 3VP0A 4P6BA 1IYOA 1K38A 1KGFA 4B4ZA 2ZQ8A 2ZMAA 3GR2A 1ONHA 3N4IA 3S4XA 2V2FF 3HUNA 5FASA 4OP8A 1DY6A 4XUXA 2PU2A 4JLFA 4K0XA 4KENB 4JBFA 2RCXA 3FV7A 3PAGA 1K54A 5CTNA 2JCHA 1LI0A 1O7EA 3N7WA 3VP4A 4GZBA 4DF6A 4HBTA 3FYZA 5AQ7A 2H0YA 5FDHA 2Z2MB 5CEBA 2ZC6B 4S2NC 1K54C 1NJ4A 2ZQAA 1CEGA 3FKVA 1NZOA 1KDSA 2Y59A 4DDYA 3E2KA 5FATA 1IKGA 3BFGA 1BT5A 5IHVA 4KZBA 5J8XA 4KZ6A 2ZC4B 2JE5A 1PW1A 1W79A 2ZC5B 4LV0A 2BLSA 2ZJ9A 3CJMA 3N6IA 5TFQA 4Q8IA 4E6XA 2Y2LA 5A90A 3Q7VB 4YFMA 4GD8A 3SS5A 2J9OA 1IYSA 3TG9A 1ZG6A 3DWKA 3ZGAB 4PM5A 2DCFA 1DJBA 1XXMA 1E3UD 3IXDA 1S6RA 4UA7A 3MKEA 1JTGA 2OLUA 4KZ8A 5DF9A 3WS4A 4X53A 3HLWA 3TOIA 1K57C 3G32A 1JWPA 1CI8A 5HAPA 2Y2OA 4E3LA 1WYBA 3Q07A 3MXRA 2Y2NA 4S2MA 5GHYA 4S2LA 1GA9A 5G18A 4F94A 1YQSA 1N4OA 3MZDA 5FAOA 5F82A 4BL3A 3Q7ZA 2XEPA 3ZCZA 5CXWA 4N92A 3EQVA 1YMXA 4OLDA 1M40A 3Q1FA 5EECA 2EFUA 5EPHA 3PBRA 4DDSA 4ZJ3A 3CG5A 2Y2IA 3UY6A 2EFXA 3W4PA 3HREA 2WAFA 1FOFA 1VM1A 5U47A 4C3QA 4Y0TA 3A3JA 5M19A 1BLPA 2ZQ7A 1L0DA 2CC1A 4GNUA 4OONA 1LI9A 2QMIA 1XGIA 2R9WA 1PWCA 3P09A 3O87A 4IBRA 3ZG7B 2QZ6A 2ZQDA 4UAAA 4UA6A 2Q9NA 3HLFA 4OOLA 2VGJA 3MZFA 1J9MA 1I2WA 2E8IA 3SS3A 4H8RA 4BENA 4CJNA 4S2IA 3CZDA 5GHZA 1MXOA 2ZLYA 1IEMA 4EWFA 3JYIA 4E6WA 5EVLA 2XH9A 1C3BA 5GLBA 1TDGA 4DE3A 4EV4A 3AGDA 4RA7A 2H0TA 1BLSA 3AGEA 3LEZA 4OPRA 4P87A 1E25A 5CHUA 2EXAA 2G2WA 3LCEA 5FI2A 4GDBA 1HTZA 3V5MA 1L0GA 4LV1A 3C4PA 4BJPA 1Y54A 4E3NA 1HD8A 3LY4A 3PTEA 4R1GA 5DTKA 2WGIA 2Y2MA 5CECA 1Z6FA 1YLTA 4PM8A 1CI9A 5FQIA 2XQZA 1BZAA 3A3IA 3BYDA 1SDNA 4LV3A 5GLCA 5DF7A 2OLVA 4LV2A 3NCKA 1BUEA 4ZJ1A 4QJGA 3HL9A 3ZDJA 3VOYA 4PM9A 1NY0A 2J9PA 3IWQA 2PBYA 3M2KA 3Q7VA 1NRFA 1YLPA 3IHBA 3IF5A 4L0LA 4RX2A 5EUAA 3BFFA 3IF6C 4D2OA 3EQUA 4S2PA 3ZFZA 1NXYA 4S2KA 1ES5A 3NI9A 1K56D 2WADA 3VSLA 2ZM8A 4MLLA 5DF8A 3BRMA 3BM6A 4KQRA 1WE4A 4P85A 3LO7A 1O07A 2WKIA 1XKZA 5CTMA 2X02A 2C5WB 1GHMA 4ZDXA 1JWZA 3WRZA 1Q2PA 1BSGA 3NIAA 3G31A 4C6YA 1PZOA 1EWZA 4O7DA 5JYOA 1TDLA 3IT9A 1EI5A 4S2NA 5CERA 4OQHA 4BL2A 4FCFA 5E2EA 2WYXA 1YLZA 3UDXA 5EVID 5FQMA 2IWDA 2J7VA 1BLHA 3SS4A 2BG1A 4P0MA 4RVAA 4UHUA 5F1FA 1ES4A 2FFYA 1RP5A 3S1YA 4ZAMA 4EUZA 5EE8A 5FAPA 4Y0OA 5FI7A 2WKHA 3GQZA 4HBUA 4IEDA 3M6BA 1JVJA 1I5QA 4WM9A 1NYMA 4QY6A 4OQGA 5FA7A 3I7JA 4QB8A 1KE4A 1CEFA 1ESIA 4WEJA 1S0WA
chains in the Genus database with same CATH superfamily
1YSPA 4RYEA 2VK3A 5FQQA 2OSUA 5HPFA 5J7EA 4OLGA 4JGQA 5FQKA 1DJAA 4QD4A 3L9KA 2EX8A 1MWSA 5FI6A 5KSCA 5M18A 4DE0A 4Y3IA 5J4EA 4KZ3A 4L9GA 2VLGA 4GJ4A 2VGLS 3MBZA 3NDEA 1HZOA 3MQ0A 5CEDA 1ZG4A 1RGYA 2OAP1 5HAIA 2JHEA 2ZQ9A 3W4QA 3OCNA 2R9XA 4Y7PA 1FCMA 4ZTKA 3SH9A 1L3LA 2PRFA 4E3IA 4HJ6A 1XA1A 5L09A 3CWFA 4GB7A 3VE3A 2FFFB 1J3WA 4Y0UA 1ODVA 5CX7A 1E4DA 3ULFA 1U60A 4X1MA 3CITA 1ERMA 4S2JA 1L0FA 1OTDA 3GRJA 1KGEA 3DTIA 1IYQA 4MBKA 3ZVWA 1SHVA 1GHPA 4MBFA 4YWZA 3W8KA 3GV9A 4R3JA 3Q81A 3QNBA 2VGLM 3MR0A 3IS2B 2PR6A 3LY3A 2JBFA 3C5AA 5EVEA 3ZVTA 1G68A 2XK1A 1GSVA 4EBLA 3RJUA 4GN2A 3GSGA 4IBXA 4U0TA 2W3HA 1TF1A 3VSKA 4MN6A 5IU1A 3S7QA 1SDEA 2BASA 4E3MA 3B3XA 4RX3A 3IQAA 3UPPA 2RL3A 5HL1A 4LCMA 4LRXC 2HDRA 4B4XA 3C4OA 3D9YA 2XF3A 3G4PA 3VMAA 3M2JA 1QMFA 1UGUA 1ACFA 1G6OA 1YPRA 4MMNA 1ZKJA 5FQJA 2ZMFA 4E04A 1KVMA 4E3JA 1W7FA 2ZL1B 4BBVA 2WKEA 4GS9A 2V8FA 1OPXA 4DXCA 5HDDA 3D3OA 3ITAA 3UB8A 4Z9QA 2B18A 5K5BA 5EOOA 4CLCD 1SZVA 5HWVA 1FSYA 3F1PA 3WS0A 3WS2A 4OQ0A 5FSRA 2BTFP 4HIAA 2OAQ1 4HJ4A 1Q2QA 1MWRA 4DXBA 3IXBA 3GMWA 1DP9A 4IJGA 5G4YA 4QHCA 2K7SA 4KG2A 1MKMA 1N9BA 2HJ9C 1YLYA 2INWA 4NG2A 3G2ZA 4OP5A 4Y13A 3MFDA 3IWIA 3H82B 3ZG0A 1DP8A 2XR0A 3MSHA 1OTAA 4EU0A 2VKSA 3SOIA 4UEYA 5FAQA 3O86A 3TW8A 3A0VA 5EVIC 4U0XA 1CF0A 3DAVA 4B93A 1VETB 1K57A 4N1HA 4F3LA 5HWTA 1CQAA 1SCWA 4JF6A 5DVAA 3KYZA 4NXBA 4LCLA 3HJKA 5HFOA 4BD0A 3UNWA 5TGFA 1BTLA 4BBUA 3WWXA 1TVFA 3FZCA 1TS6A 3N8SA 2P04A 4DE1A 2Y2KA 3VOZA 2A24A 4OOMA 4NKPA 2WK0A 4GHIB 4WN5A 4B9OA 1MC0A 4P6BA 1KGFA 2ZQ8A 2ZMAA 3GR2A 3C8CA 3S4XA 2QKPA 4JBFA 3PAGA 1K54A 1D7EA 3S7OA 3N7WA 3VP4A 3UB9A 2ZL1A 3FYZA 4LLOB 5AQ7A 2H0YA 5FDHA 4EEPA 2KLIA 2PHYA 3FKVA 2KX6A 4DDYA 5IHVA 1BT5A 4KZBA 2M1CA 5FEFA 5J8XA 5EFWA 5DKKA 2ZC4B 2W3GA 4LV0A 2ZC5B 2BLSA 3CJMA 3N6IA 4Q8IA 2LB9A 3Q7VB 3SS5A 3TG9A 3DWKA 4PM5A 1XXMA 1E3UD 1S6RA 3MKEA 1JTGA 3K3DA 3G32A 3KO6A 3LFVA 1CI8A 2Y2NA 3BQAA 3MXQA 3EGXC 1YQSA 5FAOA 3Q7ZA 2DMWA 2V0UA 3LR0A 5J3WA 4DJ2A 2EFUA 5EPHA 4ZJ3A 3KX0X 5U47A 4Y0TA 5M19A 2L1MA 3VOYA 2QMIA 2OOLA 3CUEA 4UA6A 3MZFA 1J9MA 1VEUA 4BWIA 2Z6DA 4E6WA 5GLBA 3AGDA 2KOIA 2H0TA 4OPRA 2EXAA 2G2WA 3LCEA 1EW0A 1HTZA 4BJPA 4HH2A 4R1GA 5F69A 4PKYG 2Y2MA 2W3EA 4Y5FA 5FQIA 3OOVA 3A3IA 4LV3A 1SDNA 4KQDA 4LV2A 4NXEA 1TS8A 4QWOA 3IHBA 5HDCA 1PNEA 2VV7A 3EQUA 3KSGA 4S2PA 5DJUA 4YOFA 3BRMA 4EERA 3LEQA 4MCWA 2WKIA 1GHMA 5DFYA 4ZDXA 3NIAA 3F1OA 5JYOA 1TDLA 3S7PA 4OQHA 2YKHA 3L7HA 4FCFA 3CPTB 2JKFA 2IWDA 3T50A 3SS4A 2BG1A 4P0MA 4UHUA 1RP5A 2HF6A 4ZAMA 5TBMA 2WKHA 3GQZA 4GCZA 3F1NA 3M6BA 1I5QA 4WM9A 1NYMA 5FA7A 4QB8A 2XLNA 4WYYA 1XFNA 4ETXA 3VOLA 4KZ4A 4LPZA 4CPKA 1PI4A 2Y2HA 2HP9A 3UE3A 1ZHHB 3Q82A 3VP1A 3BEBA 1KDWA 3N8RA 1LSVA 1N9OA 3P7NA 1LL9A 2DRWA 4R3BA 3IH9A 4FTXA 2HDUA 4S2OA 5A8BA 5GL9A 3ZNTA 4MEZA 3QP6A 3IF6A 2R78A 4UA9A 4Q0IA 4WZ5C 1GHIA 1PWGA 4NK3A 3PBQA 2XRNA 2W27A 4HEFA 3A0SA 2I72A 3ZYTA 3O5YA 1N9LA 2H5SA 5TJJA 5AQBA 2HDQA 3KSFA 4WELA 5AVEA 1YM1A 2QJ7A 4U3TA 2P9VA 4X56A 2WAEA 3V39A 1K55C 4QU3A 4WBGA 3K2NA 3UB6A 4ZJ2A 1XJ4A 2Y8HA 2PT7A 3LR4A 4IVIA 3LR3A 5KIZA 2XFSA 3ITBA 2E8JA 5FEGA 5L2FA 4I3AA 3UE6A 1XJ3A 4GDNA 3HLDA 5C5KA 4DKIA 2O0YA 1UWNX 4EQ1A 4CLCC 4HNBA 2WGWB 3ZG9B 2A3UA 4GW9A 3CUEC 4OKPA 2WKRA 1DP6A 3KSIA 4PMAA 5GLAA 3C7VA 2VGKA 1A0KA 4HHDA 3BJNA 3T1QB 2HDSA 1G28A 3IWOA 1H8YA 5F5YA 4UQIM 1FR6A 3F1OB 3BFCA 3MFXA 2WZZA 4JPMA 3ISGA 3FWLA 1IYPA 4DN0A 2B5RA 3CPTA 4BLMA 1K56A 5CGSA 4KZ7A 1LLBA 1FR1A 3C7UA 4HESA 4M4XA 3KYQA 3OPLA 1H0MA 5D3OA 1W5DA 1F9IA 1XA7A 4KG5A 1LL8A 1KVLA 1K4FA 5DKLA 3PR6A 3UO9A 3NJAA 3R7WB 1XJ2A 2JC7A 2XGNA 5KZHA 2K31A 3P98A 4E3KA 2WKQA 1ZC2A 4B88A 4H6JA 2VJWA 5TR7A 1PIOA 4R6LA 4GHIA 2WZXA 5KSHA 1JTDA 4R3AA 5KMWA 5HSQA 2W3FA 2Y2JA 4XT2B 3CHWP 2VEAA 1SKFA 4PAUA 1CJFA 3D4FA 2A24B 2EX2A 4Y2FA 3RXXA 2ZOHA 4N9KA 3QP5A 3RH8B 5A92A 3BLMA 1KOUA 2O9CA 3CMZA 3B42A 4XUZA 2J80A 2ZD8A 2K2NA 3PBNA 5G4ZA 5CRFA 1NLZA 3PBTA 4EEUA 1XGJA 4A5RA 4GOGA 1XJ6A 2V9AA 1IOUA 5DTTA 3WS1A 1BLCA 4X55A 2JKRI 5HL6A 2XA7M 4JF5A 1YT4A 2QYBA 1S4SA 3G2YA 4KQQA 1NRJA 5JYPA 3FG8A 4NXGA 2ZC3B 2X01A 1TS7A 2ZQCA 1YLJA 2W1TA 5HDSA 2PAVP 4ZBEA 3HLEA 3MF0A 3DWZA 3G34A 3T1SA 5IS1A 2A2LA 1K25A 2O9AA 3PXPA 1LSWA 4HJ3A 3IXHA 3OPPA 3AGFA 1XPBA 4Y15A 3OC2A 1L2SA 2CMNA 1BULA 1KE3A 1OMEA 2W1RA 4EQIA 3EEAA 1MPLA 1H8ZA 2H28A 4GS9B 1AWIA 3C2WA 4B4ZA 3HUNA 1DY6A 4XUXA 3FV7A 4O8GA 2JCHA 5I5LA 1O7EA 4UQIS 4HBTA 2Z2MB 2ZC6B 3F1PB 2ZQAA 1STZA 1KDSA 5FATA 1IKGA 3BFGA 1BYWA 1T1CA 5EV0A 2JE5A 1PW1A 2Y2LA 5A90A 4G3WA 4GD8A 1ZG6A 3IXDA 4UA7A 4KZ8A 3TOIA 3IX4A 2Y2OA 4E3LA 4F3LB 2LB5A 3MXRA 4S2MA 3TE8A 1UWPX 1YAXA 2KDKA 1NWZA 5F82A 4XT2A 1YMXA 3EGDC 3PBRA 4DDSA 3UY6A 2JKTI 1S66L 2VZWA 1OJ5A 2ZQ7A 4X68A 4DE2A 3P09A 1K0KA 3NOTC 3O87A 2QZ6A 2ZQDA 2Q9NA 3HLFA 4OOLA 1JNUA 4Q0HA 3QP4A 2VGJA 3P01A 3SS3A 4X25A 4BENA 4CJNA 3CZDA 4EWFA 3JYIA 4EV4A 4RA7A 1BLSA 3LEZA 4P87A 1E25A 5CHUA 2V1BA 1W63M 4GDBA 3RFBA 3V5MA 3C4PA 3PTEA 3LUQA 4KUKA 1YLTA 2J3WA 3BYDA 5GLCA 3LIEA 4BBTA 5DF7A 5F6AA 2Q0OA 2M7VA 1BUEA 4ZJ1A 4QJGA 4PM9A 3Q7VA 2J9PA 3IWQA 3IX3A 1YLPA 3IF5A 4L0LA 3KSHA 3ZFZA 4S2KA 3NI9A 2WADA 2ZM8A 1YKDA 3BM6A 3LO7A 2PDRA 4HOIA 2X02A 3WRZA 1BSGA 4O7DA 3IT9A 3JVVA 5DJTA 1EI5A 2GZAA 4S2NA 2HV1A 1TS0A 5EVID 2J7VA 4O0PA 5EE8A 4Y0OA 3KYEA 4HBUA 1JVJA 4EETB 4OQGA 3I7JA 1CEFA 3QP8A 1ESIA 4GKUA 1S0WA 3PBOA 1W8QA 2O99A 4HP9A 1NLYA 1S1YA 3HLCA 2WGWA 2NUTC 2G7UA 3PYPA 4JF4A 3MJQA 2HP5A 4K91A 2EXBA 1K6SA 3UDIA 1K55A 1P9RA 2Y91A 3G35A 4MBHA 5AQAA 4WMCD 1IKIA 2IA2A 2PU4A 5HARA 3ZG5A 3T4SA 2ZM0A 5DTSA 1W63Q 3H9WA 2Y2QA 4PM6A 3SH8A 5F83A 4FD8A 2Z2LB 3T12B 3UDFA 3OZHA 4G3KA 1ALQA 1MBLA 2HP6A 4N9LA 3BFEA 3WS5A 5HX9A 4FOFA 4M3KA 4EUVA 1K4EA 2HPBA 2W3DA 4EBPA 4Z1WA 3VFHA 4KZAA 1T1AA 3SW1A 5EVIB 3S7NA 2WGVA 1L0EA 2QJ5A 3LIFA 2JKTM 3V3RA 2IWBA 2IWCA 2H10A 3PBSA 2XFTA 4JKTA 3T4OA 3BFDA 1OTBA 1W8YA 4HP4A 5MC7A 1VETA 3HLGA 2VV6A 4ETZA 5HW3A 3HUMA 1NZUA 3A3EA 3UMDA 3MS6A 3LIAA 2QPNA 4FSFA 1HVBA 4OPZA 1Z09A 2V1AA 3HBRA 2QWSA 3ICYA 4WUJA 2AVXA 5TBMB 2J8YA 3A3DA 3EWKA 2XD1A 3IF6B 5CHJA 4MN5A 2PD7A 1SKOB 4ID4A 2V20A 3HCYA 4FH4A 4WEKA 4XXRA 5FQ9A 1JWVA 4OQIA 3S22A 1ES3A 2A49A 1IELA 1N9NA 4JGRA 5LBRA 1P9WA 2V0WA 5E2HA 5E2GA 2VA0A 1K6RA 3UB7A 2UWXA 4KG6A 1FCOA 1GA0A 3BY9A 3MMHA 3BWLA 2P08A 4EXOA 3BW6A 2B95A 5AJGA 3IXGA 1KGGA 3UPOA 3RXWA 3LR5A 2PR5A 3EOIA 4K0WA 2XSSA 4LGWA 2DNSA 3NOUC 2P9VB 1LL5A 1G5UA 2XDMA 2JKGA 4JXGA 2Y79A 1FIKA 2V1ZA 1CK3A 1ONGA 2PYRA 1PI5A 5HPIA 1XFQA 1H3QA 1T18A 5BOHA 1FCNA 3T4TA 4C75A 4BQMA 3PAEA 4FH2A 5AQ9A 5EM0A 3JVUA 4BD1A 3IX8A 3LI9A 5EVIA 3OCLA 5I94A 1ES2A 4MDZA 1F2KA 3VFFA 4R4SA 3C30A 4JXWA 1FILA 4WMCA 1OJGA 2YKFA 1FQGA 2HGVA 4CLCB 4NXFA 1E3UA 3QNCA 2I9VA 3NDGA 5AVFA 3VP2A 4DRTA 1X0OA 4QY5A 1GCEA 3MZEA 1OTEA 3NY4A 3D72A 5CGXA 4LENA 4R70A 3DTKA 1YLWA 3OPHA 2GDNA 5DFXA 4WZ4A 1WYCA 5M1AA 2M7UA 3NECA 1SKOA 1OTIA 4YINA 3BECA 3VP0A 1K38A 4KUOA 4LRZE 1ONHA 5FASA 2PU2A 1V9YA 1Y28A 5CTNA 1LI0A 4GZBA 4DF6A 2ZMVA 4JGOA 1K54C 1CEGA 3QP1A 1NZOA 2Y59A 2HZ5A 4CQHA 2ACGA 2V8CA 3CAXA 4K08A 4KZ6A 3LI8A 1W79A 5TFQA 2ZJ9A 4PHTA 3E4QA 4YFMA 3ZGAB 5L07A 3LIDA 1P0ZA 1DJBA 2W1TB 4LFUA 5DF9A 3LIBA 2FH5A 1T19A 1JWPA 3PHYA 1GSXA 1WYBA 3Q07A 4F94A 3W2ZA 3MZDA 4BL3A 2B02A 3U2AA 2XEPA 3NULA 4N92A 1M40A 5EECA 3TJZC 2NUPC 2EFXA 3T4KA 3HREA 2WAFA 3A3JA 1BLPA 4GNUA 1PWCA 4UAAA 1VB6A 3UMEA 3VV4A 2MJ6A 1I2WA 3SZTA 4S2IA 5GHZA 4ARZA 2ZLYA 1IEMA 1Y4OA 2XH9A 1TDGA 4LV1A 3FPWA 4E3NA 4L9FA 2WGIA 4YNRA 5CECA 1LSXA 1MZUA 4HH3A 3DTEA 2XQZA 1BZAA 5HD3A 2OLVA 3NCKA 4EW7A 2QHKA 3HL9A 1LT0A 1NY0A 2PBYA 2OWJA 1NRFA 5EUAA 3H7WA 3BFFA 4D2OA 4ZRRA 1WA9A 1ES5A 5DF8A 4KQRA 4P85A 1WE4A 3T1RA 1XKZA 5CTMA 1T1BA 1D06A 2C5WB 3G31A 1PZOA 2J3TC 1EWZA 5CERA 1YLZA 3UDXA 5FQMA 5FDSA 4RVAA 5F1FA 1ES4A 2XA7S 3S1YA 2PBDP 4EUZA 5FAPA 5FI7A 4MN7A 4QY6A 1KE4A 4WEJA 2EWWA 3N8LA 4OPYA 2WUQA 2VV8A 4I3IA 4WL9A 1D1JA 4R0QA 1DJCA 2EX6A 3ZNYA 1NYYA 1PYYA 1DRMA 1VQQA 1P97A 1OT6A 1PZPA 2EWVA 1XP4A 4PPRA 4JXSA 5GHXA 3E2LA 2EX9A 4WZ5A 2XROA 3B33A 3OPRA 1ESUA 3U4LP 3O88A 4FUWA 3ZG8B 3CI6A 3CLOA 4X1LA 4PKYA 4ESPA 4R4RA 4JXVA 4HY8A 2XD5A 1RCJA 1PW8A 2GJ3A 4GLQA 2ZBBA 3GTCA 3TSGA 1ERQA 4GD6A 5CGWA 5L8MA 3FC7A 4DJ3A 3FKWA 3RTYA 3IH8A 3OLOA 2OWHA 1MKIA 3W4OA 3H82A 4X6TA 4OH0A 4E3OA 2Y2GA 1TEMA 3LICA 1F5MA 4NETA 5HAQA 3B47A 3MXSA 1LHYA 4KZ9A 3T4JA 2Y55A 1G6AA 1KE0A 3V3SA 2HJEA 3HVFA 2FZ0A 5HZHA 5CHMA 1TD5A 4D60A 5E43A 2Q9MA 2D01A 3TRCA 1ZTUA 1MWTA 1YMSA 4L9EA 2ZOIA 3SH7A 3BLSA 5F1GA 3T4LA 2O9BA 3C38A 3WRTA 3JPUA 2ZM2A 2UV0E 3UPNA 4OOYA 3G30A 3M6HA 3NBLA 5FL3A 3IS2A 5A91A 1MY8A 3NC8A 5EOEA 5GLDA 5L10A 2W0NA 3HJIA 4IUKA 4X69A 3ZHHA 3LYXA 5A93A 4N1XA 4OVDA 2ZC7A 3NOPC 5E2FA 4R23A 1GSWA 4JGPA 4OPQA 3MKFA 1QMEA 1H5XA 1VHMA 3HLBA 3QP2A 3O3VA 3LGOA 4KQOA 3DTMA 1I2SA 1MWUA 1AXBA 4PM7A 4AFIA 3UE0A 2Y4AA 3A3FA 3GVBA 4EBNA 4IVKA 1PWDA 2GNXA 3DBAA 4LRYC 1XX2A 4MNRA 2OV5A 2P74A 4ME4A 1V9ZA 3T4QA 3ZQ5A 2C6WB 1S67L 4Q0JA 4KZ5A 3V50A 2Y2PA 2G2UA 2J3TD 3NHQA 3G6OA 3IBJA 3QHYA 3V67A 1RGZA 4R38A 4I39A 4P6ZM 1PFLA 3K3CA 3T1XA 2P7JA 3DW0A 4DMZA 1M6KA 2GX5A 4HQAA 1EROA 1VEUB 3OBFA 3UE1A 2X71A 3UN7A 3HUOA 3VP3A 3GECA 3IHAA 1FSWA 1IYOA 3N4IA 2V2FF 4OP8A 4JLFA 4K0XA 4KENB 4QPRA 2RCXA 4ARZB 5EM1A 4IUHA 3E4OA 1F98A 3R4KA 1S4RA 3BQ8A 5CEBA 4S2NC 3H7WB 1NJ4A 3F1NB 3E2KA 4HI4A 3BY8A 2Z6CA 1HLUP 3R7WA 4P6ZS 3FPVA 4CLCA 4E6XA 3UB5P 4I38A 2J9OA 1IYSA 1OT9A 2DCFA 2PYPA 5IT5A 4H6JB 2OLUA 4WLAA 3WS4A 4X53A 3HLWA 4I3JA 1K57C 3IBRA 5HAPA 5GHYA 4S2LA 1GA9A 5G18A 2VX8A 1N4OA 3ZCZA 5CXWA 3EQVA 4OLDA 2JKRM 2L0WA 3Q1FA 3CG5A 2Y2IA 3W4PA 2L4RA 1FOFA 1VM1A 4C3QA 5HD5A 4OONA 1L0DA 2CC1A 4Y17A 1LI9A 2JN7A 1XGIA 2R9WA 4IHQA 2PD8A 2WKPA 3ZG7B 4IBRA 1S1ZA 2E8IA 1YSQA 4H8RA 2D02A 1MXOA 5EVLA 4CLCE 1C3BA 4DE3A 5FI2A 3AGEA 1IFQA 4WF0A 1L0GA 3EEHA 1H8MA 1Y54A 3A0RA 1HD8A 3LY4A 3VE4A 5DTKA 1Z6FA 3MQQA 4PM8A 1CI9A 5F68A 3ZDJA 3M2KA 4RX2A 3IF6C 1NXYA 4I5SA 1K56D 3VSLA 4MLLA 4EESA 4II7A 3E4PA 1O07A 3E98A 1JWZA 1Q2PA 4C6YA 4O01A 3GDIA 4RQ9A 4BL2A 1PRQA 3E0YA 5E2EA 4BMWA 5HWWA 2WYXA 4NEED 2EA9A 1BLHA 2FFYA 4IEDA 4G3VA 3MQOA
chains in the Genus database with same CATH topology
3PBOA 4RYEA 2XLNA 4WYYA 3N8LA 4OPYA 5FQQA 1W8QA 2OSUA 4KZ4A 2WUQA 4CPKA 3HLCA 2WGWA 4OLGA 1PI4A 2Y2HA 4JF4A 4R0QA 5FQKA 2HP5A 2HP9A 4K91A 2EXBA 1DJAA 4QD4A 1DJCA 2EX6A 3UE3A 1K6SA 3ZNYA 3UDIA 3Q82A 2EX8A 1MWSA 5FI6A 3VP1A 3BEBA 1K55A 1KDWA 4DE2A 3N8RA 2Y91A 5KSCA 5M18A 3G35A 1LL9A 2DRWA 4MBHA 4GKUA 4WMCD 1IKIA 4R3BA 5AQAA 4DE0A 1NYYA 3IH9A 1PYYA 4KZ3A 2PU4A 5HARA 1VQQA 3ZG5A 3MBZA 3NDEA 2HDUA 4S2OA 1HZOA 5GL9A 5CEDA 2ZM0A 5DTSA 1ZG4A 3ZNTA 4MEZA 3IF6A 1RGYA 2Y2QA 4PM6A 4UA9A 3SH8A 5HAIA 4WZ5C 1PZPA 1GHIA 2ZQ9A 1XP4A 5F83A 1PWGA 4FD8A 4PPRA 4JXSA 4NK3A 3PBQA 5GHXA 3W4QA 3OCNA 2R9XA 4Y7PA 4HEFA 1FCMA 2EX9A 3E2LA 2I72A 2Z2LB 4ZTKA 3SH9A 3UDFA 4E3IA 3OZHA 1XA1A 4WZ5A 2H5SA 1ALQA 1MBLA 5AQBA 2HDQA 3OPRA 2HP6A 1ESUA 3BFEA 4GB7A 4N9LA 3WS5A 3O88A 2FFFB 4WELA 4Y0UA 5HX9A 1YM1A 4M3KA 4U3TA 3ZG8B 1E4DA 2P9VA 4X56A 1K4EA 2HPBA 4EBPA 2WAEA 3V39A 1U60A 3VFHA 1K55C 1ERMA 4R4RA 4S2JA 1L0FA 3GRJA 4JXVA 4QU3A 4KZAA 1KGEA 1RCJA 2XD5A 1PW8A 1IYQA 4MBKA 4WBGA 1SHVA 3ZVWA 5EVIB 1GHPA 4MBFA 4X68A 4ZJ2A 2WGVA 1L0EA 3GTCA 3TSGA 1ERQA 4GD6A 5CGWA 4IVIA 3V3RA 3FKWA 3W8KA 2XFSA 2IWBA 2IWCA 2H10A 3GV9A 3PBSA 2XFTA 4JKTA 3ITBA 3IH8A 1MKIA 4R3JA 3Q81A 3QNBA 3BFDA 1W8YA 3W4OA 5L2FA 3LY3A 2JBFA 3C5AA 4OH0A 4GDNA 4X6TA 3HLDA 3ZVTA 4DKIA 4E3OA 1G68A 2XK1A 3HLGA 4EBLA 2Y2GA 1TEMA 3RJUA 4GN2A 2WGWB 3ZG9B 2A3UA 5HW3A 3HUMA 3GSGA 4OKPA 4IBXA 1NZUA 4NETA 3A3EA 4U0TA 5HAQA 2QPNA 3MXSA 4PMAA 1LHYA 4FSFA 4KZ9A 5GLAA 3C7VA 3VSKA 1HVBA 4OPZA 1SDEA 2Y55A 2VGKA 1G6AA 3HBRA 1KE0A 4E3MA 3V3SA 3B3XA 4RX3A 2HDSA 3IQAA 3UPPA 3IWOA 2RL3A 5HL1A 2J8YA 1H8YA 4LCMA 3HVFA 3A3DA 1FR6A 3BFCA 2HDRA 4B4XA 2WZZA 3C4OA 5CHMA 2XF3A 4JPMA 2XD1A 3ISGA 3G4PA 3IF6B 5CHJA 3FWLA 5E43A 2Q9MA 1IYPA 4ID4A 3VMAA 2V20A 3M2JA 1QMFA 2B5RA 4BLMA 4FH4A 4WEKA 1K56A 4XXRA 5FQ9A 1MWTA 1JWVA 1YMSA 5CGSA 4OQIA 1ZKJA 3S22A 3SH7A 4KZ7A 1LLBA 1ES3A 1FR1A 3BLSA 5F1GA 2A49A 5FQJA 3C7UA 4HESA 1IELA 1KVMA 4E3JA 3WRTA 1W7FA 3OPLA 2ZM2A 3UPNA 5D3OA 2WKEA 5E2HA 4OOYA 1W5DA 3G30A 1XA7A 4KG5A 5E2GA 1KVLA 3M6HA 1K4FA 1K6RA 3NBLA 4DXCA 2UWXA 4KG6A 3UO9A 1FCOA 5A91A 1MY8A 1GA0A 3ITAA 3NC8A 5EOEA 5GLDA 2JC7A 2XGNA 4Z9QA 5KZHA 3P98A 4E3KA 3IXGA 5EOOA 1KGGA 3UPOA 1ZC2A 3RXWA 1FSYA 4B88A 4X69A 3ZHHA 3WS0A 3WS2A 4OQ0A 5A93A 4K0WA 5FSRA 5TR7A 1PIOA 2WZXA 5KSHA 1JTDA 2DNSA 4N1XA 5KMWA 2P9VB 4OVDA 1LL5A 2ZC7A 2Y2JA 5E2FA 1Q2QA 4R23A 1MWRA 4DXBA 2XDMA 3IXBA 4JXGA 1SKFA 2V1ZA 3D4FA 1CK3A 3GMWA 1ONGA 4OPQA 3MKFA 1QMEA 1H5XA 2EX2A 3HLBA 3RXXA 4QHCA 3O3VA 1PI5A 4KG2A 4N9KA 4KQOA 3DTMA 1N9BA 1I2SA 1MWUA 1YLYA 1AXBA 4PM7A 5A92A 3BLMA 3UE0A 3G2ZA 5BOHA 1FCNA 4OP5A 4C75A 4BQMA 2Y4AA 3A3FA 3CMZA 3GVBA 4XUZA 4EBNA 2ZD8A 3PAEA 3MFDA 3IWIA 4IVKA 4FH2A 5AQ9A 1PWDA 3ZG0A 4BD1A 2XR0A 3PBNA 5CRFA 3PBTA 1XX2A 1XGJA 5EVIA 4A5RA 3OCLA 4GOGA 5I94A 4MNRA 2OV5A 2P74A 3SOIA 1ES2A 5DTTA 5FAQA 3WS1A 3O86A 3VFFA 4R4SA 2C6WB 5EVIC 1BLCA 4X55A 4U0XA 4JXWA 4WMCA 4JF5A 1K57A 1YT4A 4N1HA 4KZ5A 3G2YA 3V50A 4KQQA 2Y2PA 5JYPA 1SCWA 2G2UA 1FQGA 4JF6A 5DVAA 2ZC3B 2X01A 1E3UA 3QNCA 3NDGA 3VP2A 4LCLA 4DRTA 2ZQCA 3QHYA 5HFOA 4BD0A 3UNWA 1RGZA 5TGFA 1YLJA 1BTLA 4ZBEA 3HLEA 4QY5A 3DWZA 1GCEA 3WWXA 1TVFA 3G34A 3MZEA 3FZCA 1K25A 3DW0A 1M6KA 3N8SA 1EROA 3NY4A 3IXHA 5CGXA 4DE1A 4LENA 2Y2KA 3OPPA 3AGFA 3VOZA 1XPBA 3UE1A 3OC2A 1YLWA 2X71A 3OPHA 3UN7A 2GDNA 1L2SA 3HUOA 4OOMA 4WZ4A 1WYCA 3VP3A 1BULA 5M1AA 2WK0A 1KE3A 1OMEA 4EQIA 1MPLA 1H8ZA 4YINA 3IHAA 3BECA 1FSWA 3VP0A 4P6BA 1IYOA 1K38A 1KGFA 4B4ZA 2ZQ8A 2ZMAA 3GR2A 1ONHA 3N4IA 3S4XA 2V2FF 3HUNA 5FASA 4OP8A 1DY6A 4XUXA 2PU2A 4JLFA 4K0XA 4KENB 4JBFA 2RCXA 3FV7A 3PAGA 1K54A 5CTNA 2JCHA 1LI0A 1O7EA 3N7WA 3VP4A 4GZBA 4DF6A 4HBTA 3FYZA 5AQ7A 2H0YA 5FDHA 2Z2MB 5CEBA 2ZC6B 4S2NC 1K54C 1NJ4A 2ZQAA 1CEGA 3FKVA 1NZOA 1KDSA 2Y59A 4DDYA 3E2KA 5FATA 1IKGA 3BFGA 1BT5A 5IHVA 4KZBA 5J8XA 4KZ6A 2ZC4B 2JE5A 1PW1A 1W79A 2ZC5B 4LV0A 2BLSA 2ZJ9A 3CJMA 3N6IA 5TFQA 4Q8IA 4E6XA 2Y2LA 5A90A 3Q7VB 4YFMA 4GD8A 3SS5A 2J9OA 1IYSA 3TG9A 1ZG6A 3DWKA 3ZGAB 4PM5A 2DCFA 1DJBA 1XXMA 1E3UD 3IXDA 1S6RA 4UA7A 3MKEA 1JTGA 2OLUA 4KZ8A 5DF9A 3WS4A 4X53A 3HLWA 3TOIA 1K57C 3G32A 1JWPA 1CI8A 5HAPA 2Y2OA 4E3LA 1WYBA 3Q07A 3MXRA 2Y2NA 4S2MA 5GHYA 4S2LA 1GA9A 5G18A 4F94A 1YQSA 1N4OA 3MZDA 5FAOA 5F82A 4BL3A 3Q7ZA 2XEPA 3ZCZA 5CXWA 4N92A 3EQVA 1YMXA 4OLDA 1M40A 3Q1FA 5EECA 2EFUA 5EPHA 3PBRA 4DDSA 4ZJ3A 3CG5A 2Y2IA 3UY6A 2EFXA 3W4PA 3HREA 2WAFA 1FOFA 1VM1A 5U47A 4C3QA 4Y0TA 3A3JA 5M19A 1BLPA 2ZQ7A 1L0DA 2CC1A 4GNUA 4OONA 1LI9A 2QMIA 1XGIA 2R9WA 1PWCA 3P09A 3O87A 4IBRA 3ZG7B 2QZ6A 2ZQDA 4UAAA 4UA6A 2Q9NA 3HLFA 4OOLA 2VGJA 3MZFA 1J9MA 1I2WA 2E8IA 3SS3A 4H8RA 4BENA 4CJNA 4S2IA 3CZDA 5GHZA 1MXOA 2ZLYA 1IEMA 4EWFA 3JYIA 4E6WA 5EVLA 2XH9A 1C3BA 5GLBA 1TDGA 4DE3A 4EV4A 3AGDA 4RA7A 2H0TA 1BLSA 3AGEA 3LEZA 4OPRA 4P87A 1E25A 5CHUA 2EXAA 2G2WA 3LCEA 5FI2A 4GDBA 1HTZA 3V5MA 1L0GA 4LV1A 3C4PA 4BJPA 1Y54A 4E3NA 1HD8A 3LY4A 3PTEA 4R1GA 5DTKA 2WGIA 2Y2MA 5CECA 1Z6FA 1YLTA 4PM8A 1CI9A 5FQIA 2XQZA 1BZAA 3A3IA 3BYDA 1SDNA 4LV3A 5GLCA 5DF7A 2OLVA 4LV2A 3NCKA 1BUEA 4ZJ1A 4QJGA 3HL9A 3ZDJA 3VOYA 4PM9A 1NY0A 2J9PA 3IWQA 2PBYA 3M2KA 3Q7VA 1NRFA 1YLPA 3IHBA 3IF5A 4L0LA 4RX2A 5EUAA 3BFFA 3IF6C 4D2OA 3EQUA 4S2PA 3ZFZA 1NXYA 4S2KA 1ES5A 3NI9A 1K56D 2WADA 3VSLA 2ZM8A 4MLLA 5DF8A 3BRMA 3BM6A 4KQRA 1WE4A 4P85A 3LO7A 1O07A 2WKIA 1XKZA 5CTMA 2X02A 2C5WB 1GHMA 4ZDXA 1JWZA 3WRZA 1Q2PA 1BSGA 3NIAA 3G31A 4C6YA 1PZOA 1EWZA 4O7DA 5JYOA 1TDLA 3IT9A 1EI5A 4S2NA 5CERA 4OQHA 4BL2A 4FCFA 5E2EA 2WYXA 1YLZA 3UDXA 5EVID 5FQMA 2IWDA 2J7VA 1BLHA 3SS4A 2BG1A 4P0MA 4RVAA 4UHUA 5F1FA 1ES4A 2FFYA 1RP5A 3S1YA 4ZAMA 4EUZA 5EE8A 5FAPA 4Y0OA 5FI7A 2WKHA 3GQZA 4HBUA 4IEDA 3M6BA 1JVJA 1I5QA 4WM9A 1NYMA 4QY6A 4OQGA 5FA7A 3I7JA 4QB8A 1KE4A 1CEFA 1ESIA 4WEJA 1S0WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PBO A;  4RYE A;  2XLN A;  4WYY A;  3N8L A;  4OPY A;  5FQQ A;  1W8Q A;  2OSU A;  4KZ4 A;  2WUQ A;  4CPK A;  3HLC A;  2WGW A;  4OLG A;  1PI4 A;  2Y2H A;  4JF4 A;  4R0Q A;  5FQK A;  2HP5 A;  2HP9 A;  4K91 A;  2EXB A;  1DJA A;  4QD4 A;  1DJC A;  2EX6 A;  3UE3 A;  1K6S A;  3ZNY A;  3UDI A;  3Q82 A;  2EX8 A;  1MWS A;  5FI6 A;  3VP1 A;  3BEB A;  1K55 A;  1KDW A;  4DE2 A;  3N8R A;  2Y91 A;  5KSC A;  5M18 A;  3G35 A;  1LL9 A;  2DRW A;  4MBH A;  4GKU A;  4WMC D;  1IKI A;  4R3B A;  5AQA A;  4DE0 A;  1NYY A;  3IH9 A;  1PYY A;  4KZ3 A;  2PU4 A;  5HAR A;  1VQQ A;  3ZG5 A;  3MBZ A;  3NDE A;  2HDU A;  4S2O A;  1HZO A;  5GL9 A;  5CED A;  2ZM0 A;  5DTS A;  1ZG4 A;  3ZNT A;  4MEZ A;  3IF6 A;  1RGY A;  2Y2Q A;  4PM6 A;  4UA9 A;  3SH8 A;  5HAI A;  4WZ5 C;  1PZP A;  1GHI A;  2ZQ9 A;  1XP4 A;  5F83 A;  1PWG A;  4FD8 A;  4PPR A;  4JXS A;  4NK3 A;  3PBQ A;  5GHX A;  3W4Q A;  3OCN A;  2R9X A;  4Y7P A;  4HEF A;  1FCM A;  2EX9 A;  3E2L A;  2I72 A;  2Z2L B;  4ZTK A;  3SH9 A;  3UDF A;  4E3I A;  3OZH A;  1XA1 A;  4WZ5 A;  2H5S A;  1ALQ A;  1MBL A;  5AQB A;  2HDQ A;  3OPR A;  2HP6 A;  1ESU A;  3BFE A;  4GB7 A;  4N9L A;  3WS5 A;  3O88 A;  2FFF B;  4WEL A;  4Y0U A;  5HX9 A;  1YM1 A;  4M3K A;  4U3T A;  3ZG8 B;  1E4D A;  2P9V A;  4X56 A;  1K4E A;  2HPB A;  4EBP A;  2WAE A;  3V39 A;  1U60 A;  3VFH A;  1K55 C;  1ERM A;  4R4R A;  4S2J A;  1L0F A;  3GRJ A;  4JXV A;  4QU3 A;  4KZA A;  1KGE A;  1RCJ A;  2XD5 A;  1PW8 A;  1IYQ A;  4MBK A;  4WBG A;  1SHV A;  3ZVW A;  5EVI B;  1GHP A;  4MBF A;  4X68 A;  4ZJ2 A;  2WGV A;  1L0E A;  3GTC A;  3TSG A;  1ERQ A;  4GD6 A;  5CGW A;  4IVI A;  3V3R A;  3FKW A;  3W8K A;  2XFS A;  2IWB A;  2IWC A;  2H10 A;  3GV9 A;  3PBS A;  2XFT A;  4JKT A;  3ITB A;  3IH8 A;  1MKI A;  4R3J A;  3Q81 A;  3QNB A;  3BFD A;  1W8Y A;  3W4O A;  5L2F A;  3LY3 A;  2JBF A;  3C5A A;  4OH0 A;  4GDN A;  4X6T A;  3HLD A;  3ZVT A;  4DKI A;  4E3O A;  1G68 A;  2XK1 A;  3HLG A;  4EBL A;  2Y2G A;  1TEM A;  3RJU A;  4GN2 A;  2WGW B;  3ZG9 B;  2A3U A;  5HW3 A;  3HUM A;  3GSG A;  4OKP A;  4IBX A;  1NZU A;  4NET A;  3A3E A;  4U0T A;  5HAQ A;  2QPN A;  3MXS A;  4PMA A;  1LHY A;  4FSF A;  4KZ9 A;  5GLA A;  3C7V A;  3VSK A;  1HVB A;  4OPZ A;  1SDE A;  2Y55 A;  2VGK A;  1G6A A;  3HBR A;  1KE0 A;  4E3M A;  3V3S A;  3B3X A;  4RX3 A;  2HDS A;  3IQA A;  3UPP A;  3IWO A;  2RL3 A;  5HL1 A;  2J8Y A;  1H8Y A;  4LCM A;  3HVF A;  3A3D A;  1FR6 A;  3BFC A;  2HDR A;  4B4X A;  2WZZ A;  3C4O A;  5CHM A;  2XF3 A;  4JPM A;  2XD1 A;  3ISG A;  3G4P A;  3IF6 B;  5CHJ A;  3FWL A;  5E43 A;  2Q9M A;  1IYP A;  4ID4 A;  3VMA A;  2V20 A;  3M2J A;  1QMF A;  2B5R A;  4BLM A;  4FH4 A;  4WEK A;  1K56 A;  4XXR A;  5FQ9 A;  1MWT A;  1JWV A;  1YMS A;  5CGS A;  4OQI A;  1ZKJ A;  3S22 A;  3SH7 A;  4KZ7 A;  1LLB A;  1ES3 A;  1FR1 A;  3BLS A;  5F1G A;  2A49 A;  5FQJ A;  3C7U A;  4HES A;  1IEL A;  1KVM A;  4E3J A;  3WRT A;  1W7F A;  3OPL A;  2ZM2 A;  3UPN A;  5D3O A;  2WKE A;  5E2H A;  4OOY A;  1W5D A;  3G30 A;  1XA7 A;  4KG5 A;  5E2G A;  1KVL A;  3M6H A;  1K4F A;  1K6R A;  3NBL A;  4DXC A;  2UWX A;  4KG6 A;  3UO9 A;  1FCO A;  5A91 A;  1MY8 A;  1GA0 A;  3ITA A;  3NC8 A;  5EOE A;  5GLD A;  2JC7 A;  2XGN A;  4Z9Q A;  5KZH A;  3P98 A;  4E3K A;  3IXG A;  5EOO A;  1KGG A;  3UPO A;  1ZC2 A;  3RXW A;  1FSY A;  4B88 A;  4X69 A;  3ZHH A;  3WS0 A;  3WS2 A;  4OQ0 A;  5A93 A;  4K0W A;  5FSR A;  5TR7 A;  1PIO A;  2WZX A;  5KSH A;  1JTD A;  2DNS A;  4N1X A;  5KMW A;  2P9V B;  4OVD A;  1LL5 A;  2ZC7 A;  2Y2J A;  5E2F A;  1Q2Q A;  4R23 A;  1MWR A;  4DXB A;  2XDM A;  3IXB A;  4JXG A;  1SKF A;  2V1Z A;  3D4F A;  1CK3 A;  3GMW A;  1ONG A;  4OPQ A;  3MKF A;  1QME A;  1H5X A;  2EX2 A;  3HLB A;  3RXX A;  4QHC A;  3O3V A;  1PI5 A;  4KG2 A;  4N9K A;  4KQO A;  3DTM A;  1N9B A;  1I2S A;  1MWU A;  1YLY A;  1AXB A;  4PM7 A;  5A92 A;  3BLM A;  3UE0 A;  3G2Z A;  5BOH A;  1FCN A;  4OP5 A;  4C75 A;  4BQM A;  2Y4A A;  3A3F A;  3CMZ A;  3GVB A;  4XUZ A;  4EBN A;  2ZD8 A;  3PAE A;  3MFD A;  3IWI A;  4IVK A;  4FH2 A;  5AQ9 A;  1PWD A;  3ZG0 A;  4BD1 A;  2XR0 A;  3PBN A;  5CRF A;  3PBT A;  1XX2 A;  1XGJ A;  5EVI A;  4A5R A;  3OCL A;  4GOG A;  5I94 A;  4MNR A;  2OV5 A;  2P74 A;  3SOI A;  1ES2 A;  5DTT A;  5FAQ A;  3WS1 A;  3O86 A;  3VFF A;  4R4S A;  2C6W B;  5EVI C;  1BLC A;  4X55 A;  4U0X A;  4JXW A;  4WMC A;  4JF5 A;  1K57 A;  1YT4 A;  4N1H A;  4KZ5 A;  3G2Y A;  3V50 A;  4KQQ A;  2Y2P A;  5JYP A;  1SCW A;  2G2U A;  1FQG A;  4JF6 A;  5DVA A;  2ZC3 B;  2X01 A;  1E3U A;  3QNC A;  3NDG A;  3VP2 A;  4LCL A;  4DRT A;  2ZQC A;  3QHY A;  5HFO A;  4BD0 A;  3UNW A;  1RGZ A;  5TGF A;  1YLJ A;  1BTL A;  4ZBE A;  3HLE A;  4QY5 A;  3DWZ A;  1GCE A;  3WWX A;  1TVF A;  3G34 A;  3MZE A;  3FZC A;  1K25 A;  3DW0 A;  1M6K A;  3N8S A;  1ERO A;  3NY4 A;  3IXH A;  5CGX A;  4DE1 A;  4LEN A;  2Y2K A;  3OPP A;  3AGF A;  3VOZ A;  1XPB A;  3UE1 A;  3OC2 A;  1YLW A;  2X71 A;  3OPH A;  3UN7 A;  2GDN A;  1L2S A;  3HUO A;  4OOM A;  4WZ4 A;  1WYC A;  3VP3 A;  1BUL A;  5M1A A;  2WK0 A;  1KE3 A;  1OME A;  4EQI A;  1MPL A;  1H8Z A;  4YIN A;  3IHA A;  3BEC A;  1FSW A;  3VP0 A;  4P6B A;  1IYO A;  1K38 A;  1KGF A;  4B4Z A;  2ZQ8 A;  2ZMA A;  3GR2 A;  1ONH A;  3N4I A;  3S4X A;  2V2F F;  3HUN A;  5FAS A;  4OP8 A;  1DY6 A;  4XUX A;  2PU2 A;  4JLF A;  4K0X A;  4KEN B;  4JBF A;  2RCX A;  3FV7 A;  3PAG A;  1K54 A;  5CTN A;  2JCH A;  1LI0 A;  1O7E A;  3N7W A;  3VP4 A;  4GZB A;  4DF6 A;  4HBT A;  3FYZ A;  5AQ7 A;  2H0Y A;  5FDH A;  2Z2M B;  5CEB A;  2ZC6 B;  4S2N C;  1K54 C;  1NJ4 A;  2ZQA A;  1CEG A;  3FKV A;  1NZO A;  1KDS A;  2Y59 A;  4DDY A;  3E2K A;  5FAT A;  1IKG A;  3BFG A;  1BT5 A;  5IHV A;  4KZB A;  5J8X A;  4KZ6 A;  2ZC4 B;  2JE5 A;  1PW1 A;  1W79 A;  2ZC5 B;  4LV0 A;  2BLS A;  2ZJ9 A;  3CJM A;  3N6I A;  5TFQ A;  4Q8I A;  4E6X A;  2Y2L A;  5A90 A;  3Q7V B;  4YFM A;  4GD8 A;  3SS5 A;  2J9O A;  1IYS A;  3TG9 A;  1ZG6 A;  3DWK A;  3ZGA B;  4PM5 A;  2DCF A;  1DJB A;  1XXM A;  1E3U D;  3IXD A;  1S6R A;  4UA7 A;  3MKE A;  1JTG A;  2OLU A;  4KZ8 A;  5DF9 A;  3WS4 A;  4X53 A;  3HLW A;  3TOI A;  1K57 C;  3G32 A;  1JWP A;  1CI8 A;  5HAP A;  2Y2O A;  4E3L A;  1WYB A;  3Q07 A;  3MXR A;  2Y2N A;  4S2M A;  5GHY A;  4S2L A;  1GA9 A;  5G18 A;  4F94 A;  1YQS A;  1N4O A;  3MZD A;  5FAO A;  5F82 A;  4BL3 A;  3Q7Z A;  2XEP A;  3ZCZ A;  5CXW A;  4N92 A;  3EQV A;  1YMX A;  4OLD A;  1M40 A;  3Q1F A;  5EEC A;  2EFU A;  5EPH A;  3PBR A;  4DDS A;  4ZJ3 A;  3CG5 A;  2Y2I A;  3UY6 A;  2EFX A;  3W4P A;  3HRE A;  2WAF A;  1FOF A;  1VM1 A;  5U47 A;  4C3Q A;  4Y0T A;  3A3J A;  5M19 A;  1BLP A;  2ZQ7 A;  1L0D A;  2CC1 A;  4GNU A;  4OON A;  1LI9 A;  2QMI A;  1XGI A;  2R9W A;  1PWC A;  3P09 A;  3O87 A;  4IBR A;  3ZG7 B;  2QZ6 A;  2ZQD A;  4UAA A;  4UA6 A;  2Q9N A;  3HLF A;  4OOL A;  2VGJ A;  3MZF A;  1J9M A;  1I2W A;  2E8I A;  3SS3 A;  4H8R A;  4BEN A;  4CJN A;  4S2I A;  3CZD A;  5GHZ A;  1MXO A;  2ZLY A;  1IEM A;  4EWF A;  3JYI A;  4E6W A;  5EVL A;  2XH9 A;  1C3B A;  5GLB A;  1TDG A;  4DE3 A;  4EV4 A;  3AGD A;  4RA7 A;  2H0T A;  1BLS A;  3AGE A;  3LEZ A;  4OPR A;  4P87 A;  1E25 A;  5CHU A;  2EXA A;  2G2W A;  3LCE A;  5FI2 A;  4GDB A;  1HTZ A;  3V5M A;  1L0G A;  4LV1 A;  3C4P A;  4BJP A;  1Y54 A;  4E3N A;  1HD8 A;  3LY4 A;  3PTE A;  4R1G A;  5DTK A;  2WGI A;  2Y2M A;  5CEC A;  1Z6F A;  1YLT A;  4PM8 A;  1CI9 A;  5FQI A;  2XQZ A;  1BZA A;  3A3I A;  3BYD A;  1SDN A;  4LV3 A;  5GLC A;  5DF7 A;  2OLV A;  4LV2 A;  3NCK A;  1BUE A;  4ZJ1 A;  4QJG A;  3HL9 A;  3ZDJ A;  3VOY A;  4PM9 A;  1NY0 A;  2J9P A;  3IWQ A;  2PBY A;  3M2K A;  3Q7V A;  1NRF A;  1YLP A;  3IHB A;  3IF5 A;  4L0L A;  4RX2 A;  5EUA A;  3BFF A;  3IF6 C;  4D2O A;  3EQU A;  4S2P A;  3ZFZ A;  1NXY A;  4S2K A;  1ES5 A;  3NI9 A;  1K56 D;  2WAD A;  3VSL A;  2ZM8 A;  4MLL A;  5DF8 A;  3BRM A;  3BM6 A;  4KQR A;  1WE4 A;  4P85 A;  3LO7 A;  1O07 A;  2WKI A;  1XKZ A;  5CTM A;  2X02 A;  2C5W B;  1GHM A;  4ZDX A;  1JWZ A;  3WRZ A;  1Q2P A;  1BSG A;  3NIA A;  3G31 A;  4C6Y A;  1PZO A;  1EWZ A;  4O7D A;  5JYO A;  1TDL A;  3IT9 A;  1EI5 A;  4S2N A;  5CER A;  4OQH A;  4BL2 A;  4FCF A;  5E2E A;  2WYX A;  1YLZ A;  3UDX A;  5EVI D;  5FQM A;  2IWD A;  2J7V A;  1BLH A;  3SS4 A;  2BG1 A;  4P0M A;  4RVA A;  4UHU A;  5F1F A;  1ES4 A;  2FFY A;  1RP5 A;  3S1Y A;  4ZAM A;  4EUZ A;  5EE8 A;  5FAP A;  4Y0O A;  5FI7 A;  2WKH A;  3GQZ A;  4HBU A;  4IED A;  3M6B A;  1JVJ A;  1I5Q A;  4WM9 A;  1NYM A;  4QY6 A;  4OQG A;  5FA7 A;  3I7J A;  4QB8 A;  1KE4 A;  1CEF A;  1ESI A;  4WEJ A;  1S0W A; 
#chains in the Genus database with same CATH topology
 1YSP A;  4RYE A;  2VK3 A;  5FQQ A;  2OSU A;  5HPF A;  5J7E A;  4OLG A;  4JGQ A;  5FQK A;  1DJA A;  4QD4 A;  3L9K A;  2EX8 A;  1MWS A;  5FI6 A;  5KSC A;  5M18 A;  4DE0 A;  4Y3I A;  5J4E A;  4KZ3 A;  4L9G A;  2VLG A;  4GJ4 A;  2VGL S;  3MBZ A;  3NDE A;  1HZO A;  3MQ0 A;  5CED A;  1ZG4 A;  1RGY A;  2OAP 1;  5HAI A;  2JHE A;  2ZQ9 A;  3W4Q A;  3OCN A;  2R9X A;  4Y7P A;  1FCM A;  4ZTK A;  3SH9 A;  1L3L A;  2PRF A;  4E3I A;  4HJ6 A;  1XA1 A;  5L09 A;  3CWF A;  4GB7 A;  3VE3 A;  2FFF B;  1J3W A;  4Y0U A;  1ODV A;  5CX7 A;  1E4D A;  3ULF A;  1U60 A;  4X1M A;  3CIT A;  1ERM A;  4S2J A;  1L0F A;  1OTD A;  3GRJ A;  1KGE A;  3DTI A;  1IYQ A;  4MBK A;  3ZVW A;  1SHV A;  1GHP A;  4MBF A;  4YWZ A;  3W8K A;  3GV9 A;  4R3J A;  3Q81 A;  3QNB A;  2VGL M;  3MR0 A;  3IS2 B;  2PR6 A;  3LY3 A;  2JBF A;  3C5A A;  5EVE A;  3ZVT A;  1G68 A;  2XK1 A;  1GSV A;  4EBL A;  3RJU A;  4GN2 A;  3GSG A;  4IBX A;  4U0T A;  2W3H A;  1TF1 A;  3VSK A;  4MN6 A;  5IU1 A;  3S7Q A;  1SDE A;  2BAS A;  4E3M A;  3B3X A;  4RX3 A;  3IQA A;  3UPP A;  2RL3 A;  5HL1 A;  4LCM A;  4LRX C;  2HDR A;  4B4X A;  3C4O A;  3D9Y A;  2XF3 A;  3G4P A;  3VMA A;  3M2J A;  1QMF A;  1UGU A;  1ACF A;  1G6O A;  1YPR A;  4MMN A;  1ZKJ A;  5FQJ A;  2ZMF A;  4E04 A;  1KVM A;  4E3J A;  1W7F A;  2ZL1 B;  4BBV A;  2WKE A;  4GS9 A;  2V8F A;  1OPX A;  4DXC A;  5HDD A;  3D3O A;  3ITA A;  3UB8 A;  4Z9Q A;  2B18 A;  5K5B A;  5EOO A;  4CLC D;  1SZV A;  5HWV A;  1FSY A;  3F1P A;  3WS0 A;  3WS2 A;  4OQ0 A;  5FSR A;  2BTF P;  4HIA A;  2OAQ 1;  4HJ4 A;  1Q2Q A;  1MWR A;  4DXB A;  3IXB A;  3GMW A;  1DP9 A;  4IJG A;  5G4Y A;  4QHC A;  2K7S A;  4KG2 A;  1MKM A;  1N9B A;  2HJ9 C;  1YLY A;  2INW A;  4NG2 A;  3G2Z A;  4OP5 A;  4Y13 A;  3MFD A;  3IWI A;  3H82 B;  3ZG0 A;  1DP8 A;  2XR0 A;  3MSH A;  1OTA A;  4EU0 A;  2VKS A;  3SOI A;  4UEY A;  5FAQ A;  3O86 A;  3TW8 A;  3A0V A;  5EVI C;  4U0X A;  1CF0 A;  3DAV A;  4B93 A;  1VET B;  1K57 A;  4N1H A;  4F3L A;  5HWT A;  1CQA A;  1SCW A;  4JF6 A;  5DVA A;  3KYZ A;  4NXB A;  4LCL A;  3HJK A;  5HFO A;  4BD0 A;  3UNW A;  5TGF A;  1BTL A;  4BBU A;  3WWX A;  1TVF A;  3FZC A;  1TS6 A;  3N8S A;  2P04 A;  4DE1 A;  2Y2K A;  3VOZ A;  2A24 A;  4OOM A;  4NKP A;  2WK0 A;  4GHI B;  4WN5 A;  4B9O A;  1MC0 A;  4P6B A;  1KGF A;  2ZQ8 A;  2ZMA A;  3GR2 A;  3C8C A;  3S4X A;  2QKP A;  4JBF A;  3PAG A;  1K54 A;  1D7E A;  3S7O A;  3N7W A;  3VP4 A;  3UB9 A;  2ZL1 A;  3FYZ A;  4LLO B;  5AQ7 A;  2H0Y A;  5FDH A;  4EEP A;  2KLI A;  2PHY A;  3FKV A;  2KX6 A;  4DDY A;  5IHV A;  1BT5 A;  4KZB A;  2M1C A;  5FEF A;  5J8X A;  5EFW A;  5DKK A;  2ZC4 B;  2W3G A;  4LV0 A;  2ZC5 B;  2BLS A;  3CJM A;  3N6I A;  4Q8I A;  2LB9 A;  3Q7V B;  3SS5 A;  3TG9 A;  3DWK A;  4PM5 A;  1XXM A;  1E3U D;  1S6R A;  3MKE A;  1JTG A;  3K3D A;  3G32 A;  3KO6 A;  3LFV A;  1CI8 A;  2Y2N A;  3BQA A;  3MXQ A;  3EGX C;  1YQS A;  5FAO A;  3Q7Z A;  2DMW A;  2V0U A;  3LR0 A;  5J3W A;  4DJ2 A;  2EFU A;  5EPH A;  4ZJ3 A;  3KX0 X;  5U47 A;  4Y0T A;  5M19 A;  2L1M A;  3VOY A;  2QMI A;  2OOL A;  3CUE A;  4UA6 A;  3MZF A;  1J9M A;  1VEU A;  4BWI A;  2Z6D A;  4E6W A;  5GLB A;  3AGD A;  2KOI A;  2H0T A;  4OPR A;  2EXA A;  2G2W A;  3LCE A;  1EW0 A;  1HTZ A;  4BJP A;  4HH2 A;  4R1G A;  5F69 A;  4PKY G;  2Y2M A;  2W3E A;  4Y5F A;  5FQI A;  3OOV A;  3A3I A;  4LV3 A;  1SDN A;  4KQD A;  4LV2 A;  4NXE A;  1TS8 A;  4QWO A;  3IHB A;  5HDC A;  1PNE A;  2VV7 A;  3EQU A;  3KSG A;  4S2P A;  5DJU A;  4YOF A;  3BRM A;  4EER A;  3LEQ A;  4MCW A;  2WKI A;  1GHM A;  5DFY A;  4ZDX A;  3NIA A;  3F1O A;  5JYO A;  1TDL A;  3S7P A;  4OQH A;  2YKH A;  3L7H A;  4FCF A;  3CPT B;  2JKF A;  2IWD A;  3T50 A;  3SS4 A;  2BG1 A;  4P0M A;  4UHU A;  1RP5 A;  2HF6 A;  4ZAM A;  5TBM A;  2WKH A;  3GQZ A;  4GCZ A;  3F1N A;  3M6B A;  1I5Q A;  4WM9 A;  1NYM A;  5FA7 A;  4QB8 A;  2XLN A;  4WYY A;  1XFN A;  4ETX A;  3VOL A;  4KZ4 A;  4LPZ A;  4CPK A;  1PI4 A;  2Y2H A;  2HP9 A;  3UE3 A;  1ZHH B;  3Q82 A;  3VP1 A;  3BEB A;  1KDW A;  3N8R A;  1LSV A;  1N9O A;  3P7N A;  1LL9 A;  2DRW A;  4R3B A;  3IH9 A;  4FTX A;  2HDU A;  4S2O A;  5A8B A;  5GL9 A;  3ZNT A;  4MEZ A;  3QP6 A;  3IF6 A;  2R78 A;  4UA9 A;  4Q0I A;  4WZ5 C;  1GHI A;  1PWG A;  4NK3 A;  3PBQ A;  2XRN A;  2W27 A;  4HEF A;  3A0S A;  2I72 A;  3ZYT A;  3O5Y A;  1N9L A;  2H5S A;  5TJJ A;  5AQB A;  2HDQ A;  3KSF A;  4WEL A;  5AVE A;  1YM1 A;  2QJ7 A;  4U3T A;  2P9V A;  4X56 A;  2WAE A;  3V39 A;  1K55 C;  4QU3 A;  4WBG A;  3K2N A;  3UB6 A;  4ZJ2 A;  1XJ4 A;  2Y8H A;  2PT7 A;  3LR4 A;  4IVI A;  3LR3 A;  5KIZ A;  2XFS A;  3ITB A;  2E8J A;  5FEG A;  5L2F A;  4I3A A;  3UE6 A;  1XJ3 A;  4GDN A;  3HLD A;  5C5K A;  4DKI A;  2O0Y A;  1UWN X;  4EQ1 A;  4CLC C;  4HNB A;  2WGW B;  3ZG9 B;  2A3U A;  4GW9 A;  3CUE C;  4OKP A;  2WKR A;  1DP6 A;  3KSI A;  4PMA A;  5GLA A;  3C7V A;  2VGK A;  1A0K A;  4HHD A;  3BJN A;  3T1Q B;  2HDS A;  1G28 A;  3IWO A;  1H8Y A;  5F5Y A;  4UQI M;  1FR6 A;  3F1O B;  3BFC A;  3MFX A;  2WZZ A;  4JPM A;  3ISG A;  3FWL A;  1IYP A;  4DN0 A;  2B5R A;  3CPT A;  4BLM A;  1K56 A;  5CGS A;  4KZ7 A;  1LLB A;  1FR1 A;  3C7U A;  4HES A;  4M4X A;  3KYQ A;  3OPL A;  1H0M A;  5D3O A;  1W5D A;  1F9I A;  1XA7 A;  4KG5 A;  1LL8 A;  1KVL A;  1K4F A;  5DKL A;  3PR6 A;  3UO9 A;  3NJA A;  3R7W B;  1XJ2 A;  2JC7 A;  2XGN A;  5KZH A;  2K31 A;  3P98 A;  4E3K A;  2WKQ A;  1ZC2 A;  4B88 A;  4H6J A;  2VJW A;  5TR7 A;  1PIO A;  4R6L A;  4GHI A;  2WZX A;  5KSH A;  1JTD A;  4R3A A;  5KMW A;  5HSQ A;  2W3F A;  2Y2J A;  4XT2 B;  3CHW P;  2VEA A;  1SKF A;  4PAU A;  1CJF A;  3D4F A;  2A24 B;  2EX2 A;  4Y2F A;  3RXX A;  2ZOH A;  4N9K A;  3QP5 A;  3RH8 B;  5A92 A;  3BLM A;  1KOU A;  2O9C A;  3CMZ A;  3B42 A;  4XUZ A;  2J80 A;  2ZD8 A;  2K2N A;  3PBN A;  5G4Z A;  5CRF A;  1NLZ A;  3PBT A;  4EEU A;  1XGJ A;  4A5R A;  4GOG A;  1XJ6 A;  2V9A A;  1IOU A;  5DTT A;  3WS1 A;  1BLC A;  4X55 A;  2JKR I;  5HL6 A;  2XA7 M;  4JF5 A;  1YT4 A;  2QYB A;  1S4S A;  3G2Y A;  4KQQ A;  1NRJ A;  5JYP A;  3FG8 A;  4NXG A;  2ZC3 B;  2X01 A;  1TS7 A;  2ZQC A;  1YLJ A;  2W1T A;  5HDS A;  2PAV P;  4ZBE A;  3HLE A;  3MF0 A;  3DWZ A;  3G34 A;  3T1S A;  5IS1 A;  2A2L A;  1K25 A;  2O9A A;  3PXP A;  1LSW A;  4HJ3 A;  3IXH A;  3OPP A;  3AGF A;  1XPB A;  4Y15 A;  3OC2 A;  1L2S A;  2CMN A;  1BUL A;  1KE3 A;  1OME A;  2W1R A;  4EQI A;  3EEA A;  1MPL A;  1H8Z A;  2H28 A;  4GS9 B;  1AWI A;  3C2W A;  4B4Z A;  3HUN A;  1DY6 A;  4XUX A;  3FV7 A;  4O8G A;  2JCH A;  5I5L A;  1O7E A;  4UQI S;  4HBT A;  2Z2M B;  2ZC6 B;  3F1P B;  2ZQA A;  1STZ A;  1KDS A;  5FAT A;  1IKG A;  3BFG A;  1BYW A;  1T1C A;  5EV0 A;  2JE5 A;  1PW1 A;  2Y2L A;  5A90 A;  4G3W A;  4GD8 A;  1ZG6 A;  3IXD A;  4UA7 A;  4KZ8 A;  3TOI A;  3IX4 A;  2Y2O A;  4E3L A;  4F3L B;  2LB5 A;  3MXR A;  4S2M A;  3TE8 A;  1UWP X;  1YAX A;  2KDK A;  1NWZ A;  5F82 A;  4XT2 A;  1YMX A;  3EGD C;  3PBR A;  4DDS A;  3UY6 A;  2JKT I;  1S66 L;  2VZW A;  1OJ5 A;  2ZQ7 A;  4X68 A;  4DE2 A;  3P09 A;  1K0K A;  3NOT C;  3O87 A;  2QZ6 A;  2ZQD A;  2Q9N A;  3HLF A;  4OOL A;  1JNU A;  4Q0H A;  3QP4 A;  2VGJ A;  3P01 A;  3SS3 A;  4X25 A;  4BEN A;  4CJN A;  3CZD A;  4EWF A;  3JYI A;  4EV4 A;  4RA7 A;  1BLS A;  3LEZ A;  4P87 A;  1E25 A;  5CHU A;  2V1B A;  1W63 M;  4GDB A;  3RFB A;  3V5M A;  3C4P A;  3PTE A;  3LUQ A;  4KUK A;  1YLT A;  2J3W A;  3BYD A;  5GLC A;  3LIE A;  4BBT A;  5DF7 A;  5F6A A;  2Q0O A;  2M7V A;  1BUE A;  4ZJ1 A;  4QJG A;  4PM9 A;  3Q7V A;  2J9P A;  3IWQ A;  3IX3 A;  1YLP A;  3IF5 A;  4L0L A;  3KSH A;  3ZFZ A;  4S2K A;  3NI9 A;  2WAD A;  2ZM8 A;  1YKD A;  3BM6 A;  3LO7 A;  2PDR A;  4HOI A;  2X02 A;  3WRZ A;  1BSG A;  4O7D A;  3IT9 A;  3JVV A;  5DJT A;  1EI5 A;  2GZA A;  4S2N A;  2HV1 A;  1TS0 A;  5EVI D;  2J7V A;  4O0P A;  5EE8 A;  4Y0O A;  3KYE A;  4HBU A;  1JVJ A;  4EET B;  4OQG A;  3I7J A;  1CEF A;  3QP8 A;  1ESI A;  4GKU A;  1S0W A;  3PBO A;  1W8Q A;  2O99 A;  4HP9 A;  1NLY A;  1S1Y A;  3HLC A;  2WGW A;  2NUT C;  2G7U A;  3PYP A;  4JF4 A;  3MJQ A;  2HP5 A;  4K91 A;  2EXB A;  1K6S A;  3UDI A;  1K55 A;  1P9R A;  2Y91 A;  3G35 A;  4MBH A;  5AQA A;  4WMC D;  1IKI A;  2IA2 A;  2PU4 A;  5HAR A;  3ZG5 A;  3T4S A;  2ZM0 A;  5DTS A;  1W63 Q;  3H9W A;  2Y2Q A;  4PM6 A;  3SH8 A;  5F83 A;  4FD8 A;  2Z2L B;  3T12 B;  3UDF A;  3OZH A;  4G3K A;  1ALQ A;  1MBL A;  2HP6 A;  4N9L A;  3BFE A;  3WS5 A;  5HX9 A;  4FOF A;  4M3K A;  4EUV A;  1K4E A;  2HPB A;  2W3D A;  4EBP A;  4Z1W A;  3VFH A;  4KZA A;  1T1A A;  3SW1 A;  5EVI B;  3S7N A;  2WGV A;  1L0E A;  2QJ5 A;  3LIF A;  2JKT M;  3V3R A;  2IWB A;  2IWC A;  2H10 A;  3PBS A;  2XFT A;  4JKT A;  3T4O A;  3BFD A;  1OTB A;  1W8Y A;  4HP4 A;  5MC7 A;  1VET A;  3HLG A;  2VV6 A;  4ETZ A;  5HW3 A;  3HUM A;  1NZU A;  3A3E A;  3UMD A;  3MS6 A;  3LIA A;  2QPN A;  4FSF A;  1HVB A;  4OPZ A;  1Z09 A;  2V1A A;  3HBR A;  2QWS A;  3ICY A;  4WUJ A;  2AVX A;  5TBM B;  2J8Y A;  3A3D A;  3EWK A;  2XD1 A;  3IF6 B;  5CHJ A;  4MN5 A;  2PD7 A;  1SKO B;  4ID4 A;  2V20 A;  3HCY A;  4FH4 A;  4WEK A;  4XXR A;  5FQ9 A;  1JWV A;  4OQI A;  3S22 A;  1ES3 A;  2A49 A;  1IEL A;  1N9N A;  4JGR A;  5LBR A;  1P9W A;  2V0W A;  5E2H A;  5E2G A;  2VA0 A;  1K6R A;  3UB7 A;  2UWX A;  4KG6 A;  1FCO A;  1GA0 A;  3BY9 A;  3MMH A;  3BWL A;  2P08 A;  4EXO A;  3BW6 A;  2B95 A;  5AJG A;  3IXG A;  1KGG A;  3UPO A;  3RXW A;  3LR5 A;  2PR5 A;  3EOI A;  4K0W A;  2XSS A;  4LGW A;  2DNS A;  3NOU C;  2P9V B;  1LL5 A;  1G5U A;  2XDM A;  2JKG A;  4JXG A;  2Y79 A;  1FIK A;  2V1Z A;  1CK3 A;  1ONG A;  2PYR A;  1PI5 A;  5HPI A;  1XFQ A;  1H3Q A;  1T18 A;  5BOH A;  1FCN A;  3T4T A;  4C75 A;  4BQM A;  3PAE A;  4FH2 A;  5AQ9 A;  5EM0 A;  3JVU A;  4BD1 A;  3IX8 A;  3LI9 A;  5EVI A;  3OCL A;  5I94 A;  1ES2 A;  4MDZ A;  1F2K A;  3VFF A;  4R4S A;  3C30 A;  4JXW A;  1FIL A;  4WMC A;  1OJG A;  2YKF A;  1FQG A;  2HGV A;  4CLC B;  4NXF A;  1E3U A;  3QNC A;  2I9V A;  3NDG A;  5AVF A;  3VP2 A;  4DRT A;  1X0O A;  4QY5 A;  1GCE A;  3MZE A;  1OTE A;  3NY4 A;  3D72 A;  5CGX A;  4LEN A;  4R70 A;  3DTK A;  1YLW A;  3OPH A;  2GDN A;  5DFX A;  4WZ4 A;  1WYC A;  5M1A A;  2M7U A;  3NEC A;  1SKO A;  1OTI A;  4YIN A;  3BEC A;  3VP0 A;  1K38 A;  4KUO A;  4LRZ E;  1ONH A;  5FAS A;  2PU2 A;  1V9Y A;  1Y28 A;  5CTN A;  1LI0 A;  4GZB A;  4DF6 A;  2ZMV A;  4JGO A;  1K54 C;  1CEG A;  3QP1 A;  1NZO A;  2Y59 A;  2HZ5 A;  4CQH A;  2ACG A;  2V8C A;  3CAX A;  4K08 A;  4KZ6 A;  3LI8 A;  1W79 A;  5TFQ A;  2ZJ9 A;  4PHT A;  3E4Q A;  4YFM A;  3ZGA B;  5L07 A;  3LID A;  1P0Z A;  1DJB A;  2W1T B;  4LFU A;  5DF9 A;  3LIB A;  2FH5 A;  1T19 A;  1JWP A;  3PHY A;  1GSX A;  1WYB A;  3Q07 A;  4F94 A;  3W2Z A;  3MZD A;  4BL3 A;  2B02 A;  3U2A A;  2XEP A;  3NUL A;  4N92 A;  1M40 A;  5EEC A;  3TJZ C;  2NUP C;  2EFX A;  3T4K A;  3HRE A;  2WAF A;  3A3J A;  1BLP A;  4GNU A;  1PWC A;  4UAA A;  1VB6 A;  3UME A;  3VV4 A;  2MJ6 A;  1I2W A;  3SZT A;  4S2I A;  5GHZ A;  4ARZ A;  2ZLY A;  1IEM A;  1Y4O A;  2XH9 A;  1TDG A;  4LV1 A;  3FPW A;  4E3N A;  4L9F A;  2WGI A;  4YNR A;  5CEC A;  1LSX A;  1MZU A;  4HH3 A;  3DTE A;  2XQZ A;  1BZA A;  5HD3 A;  2OLV A;  3NCK A;  4EW7 A;  2QHK A;  3HL9 A;  1LT0 A;  1NY0 A;  2PBY A;  2OWJ A;  1NRF A;  5EUA A;  3H7W A;  3BFF A;  4D2O A;  4ZRR A;  1WA9 A;  1ES5 A;  5DF8 A;  4KQR A;  4P85 A;  1WE4 A;  3T1R A;  1XKZ A;  5CTM A;  1T1B A;  1D06 A;  2C5W B;  3G31 A;  1PZO A;  2J3T C;  1EWZ A;  5CER A;  1YLZ A;  3UDX A;  5FQM A;  5FDS A;  4RVA A;  5F1F A;  1ES4 A;  2XA7 S;  3S1Y A;  2PBD P;  4EUZ A;  5FAP A;  5FI7 A;  4MN7 A;  4QY6 A;  1KE4 A;  4WEJ A;  2EWW A;  3N8L A;  4OPY A;  2WUQ A;  2VV8 A;  4I3I A;  4WL9 A;  1D1J A;  4R0Q A;  1DJC A;  2EX6 A;  3ZNY A;  1NYY A;  1PYY A;  1DRM A;  1VQQ A;  1P97 A;  1OT6 A;  1PZP A;  2EWV A;  1XP4 A;  4PPR A;  4JXS A;  5GHX A;  3E2L A;  2EX9 A;  4WZ5 A;  2XRO A;  3B33 A;  3OPR A;  1ESU A;  3U4L P;  3O88 A;  4FUW A;  3ZG8 B;  3CI6 A;  3CLO A;  4X1L A;  4PKY A;  4ESP A;  4R4R A;  4JXV A;  4HY8 A;  2XD5 A;  1RCJ A;  1PW8 A;  2GJ3 A;  4GLQ A;  2ZBB A;  3GTC A;  3TSG A;  1ERQ A;  4GD6 A;  5CGW A;  5L8M A;  3FC7 A;  4DJ3 A;  3FKW A;  3RTY A;  3IH8 A;  3OLO A;  2OWH A;  1MKI A;  3W4O A;  3H82 A;  4X6T A;  4OH0 A;  4E3O A;  2Y2G A;  1TEM A;  3LIC A;  1F5M A;  4NET A;  5HAQ A;  3B47 A;  3MXS A;  1LHY A;  4KZ9 A;  3T4J A;  2Y55 A;  1G6A A;  1KE0 A;  3V3S A;  2HJE A;  3HVF A;  2FZ0 A;  5HZH A;  5CHM A;  1TD5 A;  4D60 A;  5E43 A;  2Q9M A;  2D01 A;  3TRC A;  1ZTU A;  1MWT A;  1YMS A;  4L9E A;  2ZOI A;  3SH7 A;  3BLS A;  5F1G A;  3T4L A;  2O9B A;  3C38 A;  3WRT A;  3JPU A;  2ZM2 A;  2UV0 E;  3UPN A;  4OOY A;  3G30 A;  3M6H A;  3NBL A;  5FL3 A;  3IS2 A;  5A91 A;  1MY8 A;  3NC8 A;  5EOE A;  5GLD A;  5L10 A;  2W0N A;  3HJI A;  4IUK A;  4X69 A;  3ZHH A;  3LYX A;  5A93 A;  4N1X A;  4OVD A;  2ZC7 A;  3NOP C;  5E2F A;  4R23 A;  1GSW A;  4JGP A;  4OPQ A;  3MKF A;  1QME A;  1H5X A;  1VHM A;  3HLB A;  3QP2 A;  3O3V A;  3LGO A;  4KQO A;  3DTM A;  1I2S A;  1MWU A;  1AXB A;  4PM7 A;  4AFI A;  3UE0 A;  2Y4A A;  3A3F A;  3GVB A;  4EBN A;  4IVK A;  1PWD A;  2GNX A;  3DBA A;  4LRY C;  1XX2 A;  4MNR A;  2OV5 A;  2P74 A;  4ME4 A;  1V9Z A;  3T4Q A;  3ZQ5 A;  2C6W B;  1S67 L;  4Q0J A;  4KZ5 A;  3V50 A;  2Y2P A;  2G2U A;  2J3T D;  3NHQ A;  3G6O A;  3IBJ A;  3QHY A;  3V67 A;  1RGZ A;  4R38 A;  4I39 A;  4P6Z M;  1PFL A;  3K3C A;  3T1X A;  2P7J A;  3DW0 A;  4DMZ A;  1M6K A;  2GX5 A;  4HQA A;  1ERO A;  1VEU B;  3OBF A;  3UE1 A;  2X71 A;  3UN7 A;  3HUO A;  3VP3 A;  3GEC A;  3IHA A;  1FSW A;  1IYO A;  3N4I A;  2V2F F;  4OP8 A;  4JLF A;  4K0X A;  4KEN B;  4QPR A;  2RCX A;  4ARZ B;  5EM1 A;  4IUH A;  3E4O A;  1F98 A;  3R4K A;  1S4R A;  3BQ8 A;  5CEB A;  4S2N C;  3H7W B;  1NJ4 A;  3F1N B;  3E2K A;  4HI4 A;  3BY8 A;  2Z6C A;  1HLU P;  3R7W A;  4P6Z S;  3FPV A;  4CLC A;  4E6X A;  3UB5 P;  4I38 A;  2J9O A;  1IYS A;  1OT9 A;  2DCF A;  2PYP A;  5IT5 A;  4H6J B;  2OLU A;  4WLA A;  3WS4 A;  4X53 A;  3HLW A;  4I3J A;  1K57 C;  3IBR A;  5HAP A;  5GHY A;  4S2L A;  1GA9 A;  5G18 A;  2VX8 A;  1N4O A;  3ZCZ A;  5CXW A;  3EQV A;  4OLD A;  2JKR M;  2L0W A;  3Q1F A;  3CG5 A;  2Y2I A;  3W4P A;  2L4R A;  1FOF A;  1VM1 A;  4C3Q A;  5HD5 A;  4OON A;  1L0D A;  2CC1 A;  4Y17 A;  1LI9 A;  2JN7 A;  1XGI A;  2R9W A;  4IHQ A;  2PD8 A;  2WKP A;  3ZG7 B;  4IBR A;  1S1Z A;  2E8I A;  1YSQ A;  4H8R A;  2D02 A;  1MXO A;  5EVL A;  4CLC E;  1C3B A;  4DE3 A;  5FI2 A;  3AGE A;  1IFQ A;  4WF0 A;  1L0G A;  3EEH A;  1H8M A;  1Y54 A;  3A0R A;  1HD8 A;  3LY4 A;  3VE4 A;  5DTK A;  1Z6F A;  3MQQ A;  4PM8 A;  1CI9 A;  5F68 A;  3ZDJ A;  3M2K A;  4RX2 A;  3IF6 C;  1NXY A;  4I5S A;  1K56 D;  3VSL A;  4MLL A;  4EES A;  4II7 A;  3E4P A;  1O07 A;  3E98 A;  1JWZ A;  1Q2P A;  4C6Y A;  4O01 A;  3GDI A;  4RQ9 A;  4BL2 A;  1PRQ A;  3E0Y A;  5E2E A;  4BMW A;  5HWW A;  2WYX A;  4NEE D;  2EA9 A;  1BLH A;  2FFY A;  4IED A;  4G3V A;  3MQO A; 
#chains in the Genus database with same CATH homology
 3PBO A;  4RYE A;  2XLN A;  4WYY A;  3N8L A;  4OPY A;  5FQQ A;  1W8Q A;  2OSU A;  4KZ4 A;  2WUQ A;  4CPK A;  3HLC A;  2WGW A;  4OLG A;  1PI4 A;  2Y2H A;  4JF4 A;  4R0Q A;  5FQK A;  2HP5 A;  2HP9 A;  4K91 A;  2EXB A;  1DJA A;  4QD4 A;  1DJC A;  2EX6 A;  3UE3 A;  1K6S A;  3ZNY A;  3UDI A;  3Q82 A;  2EX8 A;  1MWS A;  5FI6 A;  3VP1 A;  3BEB A;  1K55 A;  1KDW A;  4DE2 A;  3N8R A;  2Y91 A;  5KSC A;  5M18 A;  3G35 A;  1LL9 A;  2DRW A;  4MBH A;  4GKU A;  4WMC D;  1IKI A;  4R3B A;  5AQA A;  4DE0 A;  1NYY A;  3IH9 A;  1PYY A;  4KZ3 A;  2PU4 A;  5HAR A;  1VQQ A;  3ZG5 A;  3MBZ A;  3NDE A;  2HDU A;  4S2O A;  1HZO A;  5GL9 A;  5CED A;  2ZM0 A;  5DTS A;  1ZG4 A;  3ZNT A;  4MEZ A;  3IF6 A;  1RGY A;  2Y2Q A;  4PM6 A;  4UA9 A;  3SH8 A;  5HAI A;  4WZ5 C;  1PZP A;  1GHI A;  2ZQ9 A;  1XP4 A;  5F83 A;  1PWG A;  4FD8 A;  4PPR A;  4JXS A;  4NK3 A;  3PBQ A;  5GHX A;  3W4Q A;  3OCN A;  2R9X A;  4Y7P A;  4HEF A;  1FCM A;  2EX9 A;  3E2L A;  2I72 A;  2Z2L B;  4ZTK A;  3SH9 A;  3UDF A;  4E3I A;  3OZH A;  1XA1 A;  4WZ5 A;  2H5S A;  1ALQ A;  1MBL A;  5AQB A;  2HDQ A;  3OPR A;  2HP6 A;  1ESU A;  3BFE A;  4GB7 A;  4N9L A;  3WS5 A;  3O88 A;  2FFF B;  4WEL A;  4Y0U A;  5HX9 A;  1YM1 A;  4M3K A;  4U3T A;  3ZG8 B;  1E4D A;  2P9V A;  4X56 A;  1K4E A;  2HPB A;  4EBP A;  2WAE A;  3V39 A;  1U60 A;  3VFH A;  1K55 C;  1ERM A;  4R4R A;  4S2J A;  1L0F A;  3GRJ A;  4JXV A;  4QU3 A;  4KZA A;  1KGE A;  1RCJ A;  2XD5 A;  1PW8 A;  1IYQ A;  4MBK A;  4WBG A;  1SHV A;  3ZVW A;  5EVI B;  1GHP A;  4MBF A;  4X68 A;  4ZJ2 A;  2WGV A;  1L0E A;  3GTC A;  3TSG A;  1ERQ A;  4GD6 A;  5CGW A;  4IVI A;  3V3R A;  3FKW A;  3W8K A;  2XFS A;  2IWB A;  2IWC A;  2H10 A;  3GV9 A;  3PBS A;  2XFT A;  4JKT A;  3ITB A;  3IH8 A;  1MKI A;  4R3J A;  3Q81 A;  3QNB A;  3BFD A;  1W8Y A;  3W4O A;  5L2F A;  3LY3 A;  2JBF A;  3C5A A;  4OH0 A;  4GDN A;  4X6T A;  3HLD A;  3ZVT A;  4DKI A;  4E3O A;  1G68 A;  2XK1 A;  3HLG A;  4EBL A;  2Y2G A;  1TEM A;  3RJU A;  4GN2 A;  2WGW B;  3ZG9 B;  2A3U A;  5HW3 A;  3HUM A;  3GSG A;  4OKP A;  4IBX A;  1NZU A;  4NET A;  3A3E A;  4U0T A;  5HAQ A;  2QPN A;  3MXS A;  4PMA A;  1LHY A;  4FSF A;  4KZ9 A;  5GLA A;  3C7V A;  3VSK A;  1HVB A;  4OPZ A;  1SDE A;  2Y55 A;  2VGK A;  1G6A A;  3HBR A;  1KE0 A;  4E3M A;  3V3S A;  3B3X A;  4RX3 A;  2HDS A;  3IQA A;  3UPP A;  3IWO A;  2RL3 A;  5HL1 A;  2J8Y A;  1H8Y A;  4LCM A;  3HVF A;  3A3D A;  1FR6 A;  3BFC A;  2HDR A;  4B4X A;  2WZZ A;  3C4O A;  5CHM A;  2XF3 A;  4JPM A;  2XD1 A;  3ISG A;  3G4P A;  3IF6 B;  5CHJ A;  3FWL A;  5E43 A;  2Q9M A;  1IYP A;  4ID4 A;  3VMA A;  2V20 A;  3M2J A;  1QMF A;  2B5R A;  4BLM A;  4FH4 A;  4WEK A;  1K56 A;  4XXR A;  5FQ9 A;  1MWT A;  1JWV A;  1YMS A;  5CGS A;  4OQI A;  1ZKJ A;  3S22 A;  3SH7 A;  4KZ7 A;  1LLB A;  1ES3 A;  1FR1 A;  3BLS A;  5F1G A;  2A49 A;  5FQJ A;  3C7U A;  4HES A;  1IEL A;  1KVM A;  4E3J A;  3WRT A;  1W7F A;  3OPL A;  2ZM2 A;  3UPN A;  5D3O A;  2WKE A;  5E2H A;  4OOY A;  1W5D A;  3G30 A;  1XA7 A;  4KG5 A;  5E2G A;  1KVL A;  3M6H A;  1K4F A;  1K6R A;  3NBL A;  4DXC A;  2UWX A;  4KG6 A;  3UO9 A;  1FCO A;  5A91 A;  1MY8 A;  1GA0 A;  3ITA A;  3NC8 A;  5EOE A;  5GLD A;  2JC7 A;  2XGN A;  4Z9Q A;  5KZH A;  3P98 A;  4E3K A;  3IXG A;  5EOO A;  1KGG A;  3UPO A;  1ZC2 A;  3RXW A;  1FSY A;  4B88 A;  4X69 A;  3ZHH A;  3WS0 A;  3WS2 A;  4OQ0 A;  5A93 A;  4K0W A;  5FSR A;  5TR7 A;  1PIO A;  2WZX A;  5KSH A;  1JTD A;  2DNS A;  4N1X A;  5KMW A;  2P9V B;  4OVD A;  1LL5 A;  2ZC7 A;  2Y2J A;  5E2F A;  1Q2Q A;  4R23 A;  1MWR A;  4DXB A;  2XDM A;  3IXB A;  4JXG A;  1SKF A;  2V1Z A;  3D4F A;  1CK3 A;  3GMW A;  1ONG A;  4OPQ A;  3MKF A;  1QME A;  1H5X A;  2EX2 A;  3HLB A;  3RXX A;  4QHC A;  3O3V A;  1PI5 A;  4KG2 A;  4N9K A;  4KQO A;  3DTM A;  1N9B A;  1I2S A;  1MWU A;  1YLY A;  1AXB A;  4PM7 A;  5A92 A;  3BLM A;  3UE0 A;  3G2Z A;  5BOH A;  1FCN A;  4OP5 A;  4C75 A;  4BQM A;  2Y4A A;  3A3F A;  3CMZ A;  3GVB A;  4XUZ A;  4EBN A;  2ZD8 A;  3PAE A;  3MFD A;  3IWI A;  4IVK A;  4FH2 A;  5AQ9 A;  1PWD A;  3ZG0 A;  4BD1 A;  2XR0 A;  3PBN A;  5CRF A;  3PBT A;  1XX2 A;  1XGJ A;  5EVI A;  4A5R A;  3OCL A;  4GOG A;  5I94 A;  4MNR A;  2OV5 A;  2P74 A;  3SOI A;  1ES2 A;  5DTT A;  5FAQ A;  3WS1 A;  3O86 A;  3VFF A;  4R4S A;  2C6W B;  5EVI C;  1BLC A;  4X55 A;  4U0X A;  4JXW A;  4WMC A;  4JF5 A;  1K57 A;  1YT4 A;  4N1H A;  4KZ5 A;  3G2Y A;  3V50 A;  4KQQ A;  2Y2P A;  5JYP A;  1SCW A;  2G2U A;  1FQG A;  4JF6 A;  5DVA A;  2ZC3 B;  2X01 A;  1E3U A;  3QNC A;  3NDG A;  3VP2 A;  4LCL A;  4DRT A;  2ZQC A;  3QHY A;  5HFO A;  4BD0 A;  3UNW A;  1RGZ A;  5TGF A;  1YLJ A;  1BTL A;  4ZBE A;  3HLE A;  4QY5 A;  3DWZ A;  1GCE A;  3WWX A;  1TVF A;  3G34 A;  3MZE A;  3FZC A;  1K25 A;  3DW0 A;  1M6K A;  3N8S A;  1ERO A;  3NY4 A;  3IXH A;  5CGX A;  4DE1 A;  4LEN A;  2Y2K A;  3OPP A;  3AGF A;  3VOZ A;  1XPB A;  3UE1 A;  3OC2 A;  1YLW A;  2X71 A;  3OPH A;  3UN7 A;  2GDN A;  1L2S A;  3HUO A;  4OOM A;  4WZ4 A;  1WYC A;  3VP3 A;  1BUL A;  5M1A A;  2WK0 A;  1KE3 A;  1OME A;  4EQI A;  1MPL A;  1H8Z A;  4YIN A;  3IHA A;  3BEC A;  1FSW A;  3VP0 A;  4P6B A;  1IYO A;  1K38 A;  1KGF A;  4B4Z A;  2ZQ8 A;  2ZMA A;  3GR2 A;  1ONH A;  3N4I A;  3S4X A;  2V2F F;  3HUN A;  5FAS A;  4OP8 A;  1DY6 A;  4XUX A;  2PU2 A;  4JLF A;  4K0X A;  4KEN B;  4JBF A;  2RCX A;  3FV7 A;  3PAG A;  1K54 A;  5CTN A;  2JCH A;  1LI0 A;  1O7E A;  3N7W A;  3VP4 A;  4GZB A;  4DF6 A;  4HBT A;  3FYZ A;  5AQ7 A;  2H0Y A;  5FDH A;  2Z2M B;  5CEB A;  2ZC6 B;  4S2N C;  1K54 C;  1NJ4 A;  2ZQA A;  1CEG A;  3FKV A;  1NZO A;  1KDS A;  2Y59 A;  4DDY A;  3E2K A;  5FAT A;  1IKG A;  3BFG A;  1BT5 A;  5IHV A;  4KZB A;  5J8X A;  4KZ6 A;  2ZC4 B;  2JE5 A;  1PW1 A;  1W79 A;  2ZC5 B;  4LV0 A;  2BLS A;  2ZJ9 A;  3CJM A;  3N6I A;  5TFQ A;  4Q8I A;  4E6X A;  2Y2L A;  5A90 A;  3Q7V B;  4YFM A;  4GD8 A;  3SS5 A;  2J9O A;  1IYS A;  3TG9 A;  1ZG6 A;  3DWK A;  3ZGA B;  4PM5 A;  2DCF A;  1DJB A;  1XXM A;  1E3U D;  3IXD A;  1S6R A;  4UA7 A;  3MKE A;  1JTG A;  2OLU A;  4KZ8 A;  5DF9 A;  3WS4 A;  4X53 A;  3HLW A;  3TOI A;  1K57 C;  3G32 A;  1JWP A;  1CI8 A;  5HAP A;  2Y2O A;  4E3L A;  1WYB A;  3Q07 A;  3MXR A;  2Y2N A;  4S2M A;  5GHY A;  4S2L A;  1GA9 A;  5G18 A;  4F94 A;  1YQS A;  1N4O A;  3MZD A;  5FAO A;  5F82 A;  4BL3 A;  3Q7Z A;  2XEP A;  3ZCZ A;  5CXW A;  4N92 A;  3EQV A;  1YMX A;  4OLD A;  1M40 A;  3Q1F A;  5EEC A;  2EFU A;  5EPH A;  3PBR A;  4DDS A;  4ZJ3 A;  3CG5 A;  2Y2I A;  3UY6 A;  2EFX A;  3W4P A;  3HRE A;  2WAF A;  1FOF A;  1VM1 A;  5U47 A;  4C3Q A;  4Y0T A;  3A3J A;  5M19 A;  1BLP A;  2ZQ7 A;  1L0D A;  2CC1 A;  4GNU A;  4OON A;  1LI9 A;  2QMI A;  1XGI A;  2R9W A;  1PWC A;  3P09 A;  3O87 A;  4IBR A;  3ZG7 B;  2QZ6 A;  2ZQD A;  4UAA A;  4UA6 A;  2Q9N A;  3HLF A;  4OOL A;  2VGJ A;  3MZF A;  1J9M A;  1I2W A;  2E8I A;  3SS3 A;  4H8R A;  4BEN A;  4CJN A;  4S2I A;  3CZD A;  5GHZ A;  1MXO A;  2ZLY A;  1IEM A;  4EWF A;  3JYI A;  4E6W A;  5EVL A;  2XH9 A;  1C3B A;  5GLB A;  1TDG A;  4DE3 A;  4EV4 A;  3AGD A;  4RA7 A;  2H0T A;  1BLS A;  3AGE A;  3LEZ A;  4OPR A;  4P87 A;  1E25 A;  5CHU A;  2EXA A;  2G2W A;  3LCE A;  5FI2 A;  4GDB A;  1HTZ A;  3V5M A;  1L0G A;  4LV1 A;  3C4P A;  4BJP A;  1Y54 A;  4E3N A;  1HD8 A;  3LY4 A;  3PTE A;  4R1G A;  5DTK A;  2WGI A;  2Y2M A;  5CEC A;  1Z6F A;  1YLT A;  4PM8 A;  1CI9 A;  5FQI A;  2XQZ A;  1BZA A;  3A3I A;  3BYD A;  1SDN A;  4LV3 A;  5GLC A;  5DF7 A;  2OLV A;  4LV2 A;  3NCK A;  1BUE A;  4ZJ1 A;  4QJG A;  3HL9 A;  3ZDJ A;  3VOY A;  4PM9 A;  1NY0 A;  2J9P A;  3IWQ A;  2PBY A;  3M2K A;  3Q7V A;  1NRF A;  1YLP A;  3IHB A;  3IF5 A;  4L0L A;  4RX2 A;  5EUA A;  3BFF A;  3IF6 C;  4D2O A;  3EQU A;  4S2P A;  3ZFZ A;  1NXY A;  4S2K A;  1ES5 A;  3NI9 A;  1K56 D;  2WAD A;  3VSL A;  2ZM8 A;  4MLL A;  5DF8 A;  3BRM A;  3BM6 A;  4KQR A;  1WE4 A;  4P85 A;  3LO7 A;  1O07 A;  2WKI A;  1XKZ A;  5CTM A;  2X02 A;  2C5W B;  1GHM A;  4ZDX A;  1JWZ A;  3WRZ A;  1Q2P A;  1BSG A;  3NIA A;  3G31 A;  4C6Y A;  1PZO A;  1EWZ A;  4O7D A;  5JYO A;  1TDL A;  3IT9 A;  1EI5 A;  4S2N A;  5CER A;  4OQH A;  4BL2 A;  4FCF A;  5E2E A;  2WYX A;  1YLZ A;  3UDX A;  5EVI D;  5FQM A;  2IWD A;  2J7V A;  1BLH A;  3SS4 A;  2BG1 A;  4P0M A;  4RVA A;  4UHU A;  5F1F A;  1ES4 A;  2FFY A;  1RP5 A;  3S1Y A;  4ZAM A;  4EUZ A;  5EE8 A;  5FAP A;  4Y0O A;  5FI7 A;  2WKH A;  3GQZ A;  4HBU A;  4IED A;  3M6B A;  1JVJ A;  1I5Q A;  4WM9 A;  1NYM A;  4QY6 A;  4OQG A;  5FA7 A;  3I7J A;  4QB8 A;  1KE4 A;  1CEF A;  1ESI A;  4WEJ A;  1S0W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...