4F94A

Structure of the class d beta-lactamase oxa-24 k84d in acyl-enzyme complex with oxacillin
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
245
structure length
245
Chain Sequence
MHISSQQHEKAIKSYFDEAQTQGVIIIKEGKNLSTYGNALARANKEYVPASTFDMLNALIGLENHKATTNEIFKWDGKKRTYPMWEKDMTLGEAMALSAVPVYQELARRTGLELMQKEVKRVNFGNTNIGTQVDNFWLVGPLKITPVQEVNFADDLAHNRLPFKLETQEEVKKMLLIKEVNGSKIYAKSGWGMGVTPQVGWLTGWVEQANGKKIPFSLNLEMKEGMSGSIRNEITYKSLENLGII
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactamase
publication title Structure of the Class D Beta-Lactamase OXA-24 K84D in Acyl-Enzyme Complex with Oxacillin
rcsb
source organism Acinetobacter baumannii
molecule tags Hydrolase/antibiotic
total genus 79
structure length 245
sequence length 245
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2012-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00905 Transpeptidase Penicillin binding protein transpeptidase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 4f94A00
4R3BA 5DTTA 2ZQAA 1K56D 3O88A 3B3XA 4O7DA 4PMAA 1XXMA 4FH4A 3IQAA 4OKPA 4QHCA 4Y0TA 4N92A 3PBSA 5GLDA 3VSLA 4DF6A 1E3UD 1ES5A 1W8QA 3EQVA 1O7EA 3V39A 3ZG0A 5FA7A 3RXXA 1KDSA 2IWCA 3HLCA 4N1HA 3M6BA 3G34A 2FFYA 1K57C 4KQRA 2XQZA 4KZ9A 4BQMA 5HARA 2H10A 3BYDA 4GNUA 5FSRA 1LL9A 4GOGA 4EQIA 4OP5A 5AQBA 2XEPA 3CZDA 2Y2PA 4BLMA 4OOYA 3C4OA 3TOIA 1DJBA 5FAOA 4MBHA 3ZFZA 2HPBA 4IBXA 2HP6A 3UPNA 1L2SA 3HL9A 3OPHA 5CGXA 5CEDA 4X68A 3MXRA 3HLFA 1BLCA 5FQIA 2Y2GA 2Y2OA 2R9WA 4JKTA 3IXBA 4IVKA 3UDXA 5HAPA 2EX8A 3M2KA 5FQQA 3UY6A 4DXCA 4LV3A 2EXAA 1N9BA 5F1FA 3BEBA 1Z6FA 5E43A 5AQ9A 4B4ZA 1EWZA 3FZCA 3O3VA 4OPRA 1FSWA 3Q7VB 5FAQA 3ZG8B 1ONGA 2I72A 3SH8A 5FASA 3LY3A 1K54C 3M2JA 4DDYA 4JPMA 3RJUA 2V20A 3IHBA 3V50A 2X01A 3PBNA 1K6RA 2ZQDA 5CERA 5CGSA 3WS2A 4DE1A 1RGZA 4UA7A 1PW8A 3ZNTA 3ZDJA 1WE4A 3NI9A 3VOZA 3A3IA 3UE0A 4X69A 1YLWA 3ISGA 3N8RA 4OP8A 5JYOA 2H0YA 2XH9A 1XGIA 1SDEA 1L0DA 1CI9A 2ZC3B 1IYQA 3PAGA 4UHUA 1VQQA 1PI4A 3V5MA 2G2UA 1KVLA 3IF6B 3Q7VA 4EV4A 4WBGA 2V2FF 2B5RA 4B88A 4JF5A 4S2MA 2H5SA 1ONHA 3NDEA 1YQSA 4Z9QA 3HLBA 2Y91A 4HESA 1MPLA 3C7VA 3G35A 4CPKA 1ZG6A 4B4XA 4L0LA 3MZDA 1ES3A 4QY5A 3TSGA 1C3BA 3MZFA 5GLAA 5GHXA 3BM6A 4DE0A 4WZ5A 3S22A 5EOOA 1GHMA 1KDWA 4BD0A 3ZCZA 3LO7A 1GA0A 3DWZA 4RVAA 1O07A 4E3LA 2Q9NA 4KZ7A 3Q81A 3S4XA 1PW1A 2WGWB 4HEFA 4RX3A 3WS4A 2JE5A 1VM1A 4YFMA 3IF6A 2RCXA 1N4OA 3Q82A 2WUQA 3HUOA 1NXYA 4ZBEA 5E2GA 1K4FA 2XD1A 4M3KA 4GB7A 4DDSA 4OOLA 1K6SA 2PU2A 4N1XA 4UA6A 1G6AA 1ERQA 1XKZA 3DWKA 2BG1A 1M40A 4OPQA 5GL9A 5M1AA 3UNWA 2ZQ8A 3MXSA 5M18A 5EE8A 1PZOA 3IH8A 1CEFA 2PU4A 3PTEA 5EVIC 3Q7ZA 5F83A 1LLBA 1FSYA 3OCNA 3NY4A 4KZ5A 2PBYA 4S2JA 2OLUA 5L2FA 3UDIA 4ZDXA 1KVMA 1MXOA 4XUXA 4BENA 2EFUA 1PWDA 2WGWA 2XFTA 3E2KA 1XP4A 4UA9A 5E2HA 1FR1A 1PWGA 1IKGA 2ZM0A 4RYEA 2Y55A 4KG2A 1HD8A 2Y2QA 1KE3A 4HBUA 5E2EA 4WM9A 1ES2A 1FCMA 5FDHA 2G2WA 1NYYA 5EECA 2OSUA 1K56A 2H0TA 2Z2MB 1YMSA 5DF9A 2C5WB 5FQJA 1DJCA 3UN7A 4IBRA 1CK3A 1I2WA 3SOIA 1E3UA 3OPLA 2XDMA 4KZBA 4U3TA 1LI0A 3V3RA 3BFCA 5DVAA 3MFDA 1MWUA 2HDRA 5EOEA 4E6WA 1MWTA 3GR2A 4S2KA 1XGJA 5A91A 5IHVA 2Y2NA 4YINA 4GDBA 2EX9A 3NBLA 2VGKA 3W4OA 3ITAA 5HAQA 4ID4A 2J9OA 3MKEA 4WELA 5A93A 4EBPA 4C6YA 3DW0A 1FOFA 3NC8A 3LCEA 1TDLA 3PBQA 5BOHA 2UWXA 3VP4A 5FQMA 4WZ5C 3BRMA 5KZHA 4KZAA 1GHPA 1IYOA 1JVJA 3GV9A 5FQKA 5FQ9A 4DE2A 1W8YA 2Y2KA 1FR6A 3PBRA 2J9PA 2WKEA 3IF6C 2RL3A 3A3EA 5F82A 4EBNA 4QY6A 4ZJ3A 1YLPA 2EFXA 3A3FA 1W5DA 2R9XA 2WZZA 3P98A 4NK3A 3IWOA 3VFFA 3FKWA 3BLMA 3LY4A 5CHMA 3C4PA 3OC2A 4PM8A 1BZAA 4E3MA 2ZLYA 3AGFA 3AGDA 3QNCA 3G2ZA 4QU3A 3ZVTA 4U0TA 4WEJA 1H8YA 4GN2A 4X55A 3W4QA 1DY6A 3PAEA 3A3DA 4KG5A 4LV2A 2ZMAA 3BLSA 5HL1A 1Q2QA 4Y7PA 1MY8A 3IXGA 3IWQA 4BJPA 4S2IA 4JBFA 1SKFA 3SH9A 4JXVA 4EUZA 3ZVWA 3VP2A 5HX9A 3NDGA 3IXDA 3WS0A 2WGIA 5F1GA 1L0FA 1PIOA 4KZ4A 4JXWA 4K0WA 1KGGA 4P85A 1JTGA 3UE1A 4NETA 1QMFA 4H8RA 4BD1A 1LHYA 2ZC4B 2JBFA 1TVFA 3IWIA 3VP3A 1BLPA 1K57A 1L0EA 1SHVA 1KGFA 1GCEA 4K91A 3VP1A 3IF5A 4QD4A 2J7VA 3D4FA 3V3SA 4WEKA 2HP5A 2XK1A 3GQZA 3OCLA 4OQHA 3G32A 3OPPA 1K25A 4UAAA 3RXWA 4X53A 4LV0A 2Y4AA 4OLDA 5D3OA 4ZAMA 2ZC6B 5CTNA 4E3JA 3IHAA 4QJGA 3E2LA 3FYZA 4OVDA 5CGWA 4ZTKA 1NY0A 4OPZA 4GZBA 5U47A 3VP0A 1EI5A 3ZHHA 3BFEA 1W7FA 5A92A 3FKVA 1BT5A 1NJ4A 3N8SA 1S6RA 3OPRA 3UDFA 4OONA 5G18A 1YLTA 4R4SA 4JF4A 1I5QA 1SCWA 4FCFA 1BLSA 2Y2LA 1LI9A 4JF6A 3HLGA 3FWLA 3ITBA 4IEDA 2Y2IA 5FI7A 4CJNA 1NZUA 3G2YA 1E4DA 4Q8IA 2ZQCA 4RX2A 2WAFA 2ZC7A 5CHUA 4WYYA 4X6TA 4A5RA 2ZC5B 4E3NA 5GLBA 4XUZA 5AQAA 4OOMA 2WZXA 4KQQA 4S2OA 2WK0A 1I2SA 1YLYA 3VFHA 3HREA 4S2NA 3UE3A 1ERMA 1RP5A 1XPBA 2P9VB 5TFQA 4OQIA 4OQ0A 5GLCA 3C7UA 3SS4A 2GDNA 1ESUA 1HZOA 2DCFA 2X71A 4WMCD 3CMZA 2QPNA 4PM7A 2WYXA 4LENA 3UO9A 4P0MA 3N4IA 4P87A 2XD5A 1IYSA 3BFGA 3HLWA 2Y2JA 5J8XA 1IEMA 2JC7A 4MBFA 4RA7A 4D2OA 4WMCA 1E25A 1FCOA 3N8LA 5HFOA 1IKIA 1NZOA 4R0QA 1G68A 4LCLA 3WRTA 1ZC2A 1BLHA 2XFSA 3QHYA 5EVLA 4C75A 1WYCA 1RCJA 1S0WA 2XLNA 1AXBA 2FFFB 3WWXA 1Y54A 2Y2MA 3VOYA 2WGVA 5KMWA 2QMIA 3SS3A 3GMWA 4BL2A 2ZM2A 3MZEA 5EVIB 4ZJ2A 2P9VA 2VGJA 5EUAA 3ZG9B 2WKIA 1ES4A 1FQGA 3ZG5A 2OLVA 3QNBA 1YM1A 3HVFA 4R3JA 4WZ4A 3WS5A 1JWVA 3PBTA 4ZJ1A 1K55A 2ZD8A 2HDQA 3P09A 4Y0OA 3G4PA 4F94A 1IELA 2A3UA 3N7WA 3BFDA 2HP9A 3CJMA 2EX6A 3I7JA 4QB8A 4BL3A 3VMAA 4GD8A 2C6WB 3IXHA 2IWBA 5KSCA 1JWPA 5EVID 4MBKA 2WAEA 1MKIA 2XGNA 3GRJA 1MWSA 1BSGA 4FD8A 3W8KA 1XX2A 3CG5A 3S1YA 5DF8A 5CRFA 5DTSA 5EVIA 2ZQ7A 5GHZA 3GTCA 1PYYA 5HAIA 4LV1A 4S2LA 3NCKA 5AQ7A 1U60A 1NYMA 4C3QA 1XA7A 5KSHA 3MBZA 4MNRA 4E3KA 1W79A 4DXBA 4XXRA 4EBLA 5CTMA 1BTLA 5FI2A 3C5AA 4JXGA 4KG6A 2J8YA 3HUMA 3Q1FA 3WS1A 1J9MA 1KE0A 1K38A 1QMEA 4S2NC 2ZM8A 5GHYA 2A49A 4PM6A 1HTZA 4S2PA 5DF7A 1ALQA 2Y2HA 2OV5A 3ZNYA 1M6KA 2EX2A 2JCHA 3IT9A 4IVIA 4JLFA 4E3OA 5A90A 1YT4A 1CEGA 4PPRA 1WYBA 5CEBA 1EROA 1GHIA 3FV7A 3SH7A 4GDNA 3W4PA 3AGEA 1K4EA 5CHJA 1JWZA 3G30A 4DRTA 4OQGA 1ESIA 5FATA 3SS5A 3HBRA 5FAPA 3Q07A 3IH9A 1PZPA 2WADA 3M6HA 2DRWA 5M19A 4Y0UA 3TG9A 1SDNA 4EWFA 1OMEA 5E2FA 5CECA 2CC1A 2IWDA 1GA9A 4PM9A 1H8ZA 1YLJA 1YLZA 2DNSA 3EQUA 5TGFA 2Z2LB 4R1GA 1TDGA 4LCMA 4OLGA 4FH2A 4MEZA 2HDSA 4KZ6A 4JXSA 3N6IA 4N9KA 3OZHA 4KENB 4KZ8A 1FCNA 2XF3A 1YMXA 5EPHA 4KZ3A 1BUEA 4X56A 5TR7A 2Q9MA 3WRZA 3BFFA 3G31A 5DTKA 3BECA 3GSGA 1ZG4A 2ZJ9A 1CI8A 3O87A 1K55C 3UPPA 1KGEA 2ZQ9A 1K54A 1HVBA 4E6XA 5I94A 3HLEA 1MWRA 1MBLA 4DE3A 1L0GA 2HDUA 4R23A 3JYIA 4U0XA 1IYPA 3LEZA 3HUNA 1RGYA 1ZKJA 1NRFA 4OH0A 1DJAA 4PM5A 4FSFA 1BULA 1XA1A 3HLDA 5FI6A 3VSKA 3DTMA 2P74A 2V1ZA 3NIAA 4R4RA 1H5XA 3PBOA 5JYPA 4HBTA 4N9LA 4P6BA 2QZ6A 3A3JA 2BLSA 4GD6A 3ZG7B 1KE4A 1TEMA 4KQOA 2X02A 2XR0A 3UPOA 4OPYA 1LL5A 4E3IA 2WKHA 5HW3A 2Y59A 4GKUA 3GVBA 3MKFA 5CXWA 1Q2PA 4K0XA 4MLLA 2EXBA 3ZGAB 3O86A 1JTDA 1PWCA 1PI5A 2E8IA 4DKIA
chains in the Genus database with same CATH superfamily
2ZQAA 3O88A 3IQAA 1S66L 4OKPA 4HOIA 4QHCA 3PBSA 3RXXA 3HLCA 3M6BA 2FFYA 1K57C 4KQRA 4KZ9A 3HCYA 3JVUA 5HARA 4HJ4A 5FSRA 1SKOB 4OP5A 3S7OA 2Y2PA 4BLMA 4OOYA 2OWJA 2HPBA 4AFIA 3U4LP 3OPHA 2OOLA 1S1YA 2E8JA 3MXRA 3HLFA 4HP4A 4JKTA 2EX8A 3M2KA 3UY6A 5F1FA 3BEBA 5MC7A 3FG8A 1SKOA 2I72A 5FASA 1OTDA 1UWPX 4JGRA 2CMNA 2X01A 2ZQDA 5CGSA 4L9FA 1PW8A 3VOZA 4Y2FA 4X69A 2VX8A 3T4SA 3KSGA 1YLWA 2L0WA 2XH9A 1SDEA 2ZC3B 3PAGA 3TW8A 2B5RA 3MQ0A 5DKLA 3NDEA 4KQDA 3TSGA 4WZ5A 5EOOA 3ZQ5A 2D01A 4BD0A 3ZCZA 2JKTI 4RVAA 4KZ7A 3Q81A 4G3KA 1PW1A 3QP6A 2RCXA 2Z6CA 3LI8A 1NXYA 4DDSA 1G6AA 1ERQA 3CUEC 4GLQA 2BG1A 2P04A 1Y4OA 4OPQA 3D72A 5EE8A 1CEFA 3MSHA 3OCNA 3LIBA 4KZ5A 2OLUA 5L2FA 4ZDXA 1MXOA 4BENA 2QJ5A 2EFUA 2XFTA 3EEHA 1PRQA 4LRXC 4ARZB 4KG2A 2PAVP 4HBUA 4WM9A 1ES2A 2G2WA 5DF9A 2K2NA 5FQJA 1DJCA 4HH3A 3UN7A 3OPLA 4HP9A 4E6WA 1MWTA 2P08A 5IHVA 2Y2NA 1S1ZA 3W4OA 4ARZA 3MKEA 3UB6A 4EBPA 3BRMA 3LR0A 1IYOA 1G28A 1JVJA 4LGWA 3RTYA 4DE2A 1NRJA 1OTIA 3LIAA 2WKEA 4R38A 3A3EA 4QY6A 3H7WB 4Q0HA 3VFFA 4CLCD 3BLMA 4MN7A 4EESA 4PM8A 1H0MA 4B9OA 3MQOA 3ZVTA 4X55A 1DY6A 3IXGA 3SH9A 1GSXA 2VGLS 3NDGA 5HX9A 3IXDA 3VP2A 5KIZA 4G3VA 1L0FA 1CQAA 4JXWA 1KGGA 4P85A 4JGQA 4NETA 4H8RA 2ZC4B 1TVFA 3IWIA 3VP3A 1BLPA 1KGFA 2M1CA 3V3SA 2KX6A 2XK1A 3GQZA 3OCLA 3OPPA 3LGOA 3T50A 4X53A 1OTBA 5LBRA 4OLDA 5D3OA 4BMWA 2JKGA 2A24B 5CTNA 2YKFA 5EV0A 3BFEA 1S6RA 4P6ZM 4R4SA 1BLSA 3FWLA 1Z09A 2K31A 2VV6A 3QP1A 1L3LA 5CHUA 4KUKA 4OOMA 2A24A 4S2OA 2W3HA 1ODVA 3MR0A 3GDIA 2QHKA 2P9VB 2OAQ1 5GLCA 3SS4A 2QPNA 2WYXA 3UO9A 5AVEA 2B95A 3N4IA 4P87A 3HLWA 5J8XA 3LICA 2Y2JA 1IEMA 5HFOA 1NZOA 3TJZC 5HWWA 1BLHA 3QHYA 5EVLA 5IS1A 4HNBA 1WYCA 4K08A 2PD7A 2FFFB 1Y54A 3MZEA 5EVIB 4ZJ2A 2P9VA 4RQ9A 3ZG5A 5F6AA 4CLCE 3QP5A 1K55A 4I38A 4I39A 1OTAA 2O9BA 3BFDA 2EX6A 3I7JA 4QB8A 4UEYA 4GD8A 5F5YA 3QP4A 4FD8A 5DKKA 3CG5A 2V8FA 5CRFA 5DTSA 5EVIA 5GHZA 3NCKA 3ULFA 3T1XA 4Q0JA 3MBZA 4MNRA 1W79A 3T4QA 4DXBA 3C2WA 4XT2B 5DFXA 1BTLA 5FI2A 3C5AA 3FPVA 5AVFA 3VE3A 1IOUA 2V8CA 1STZA 3Q1FA 4S2NC 4WF0A 4PM6A 2HGVA 5DF7A 3TRCA 2EX2A 1YT4A 3T4JA 4GDNA 1JWZA 3HBRA 4HQAA 2JKRM 3M6HA 2DRWA 4XT2A 1SDNA 4EWFA 1OMEA 1H8ZA 2DNSA 3EQUA 5HDCA 5TGFA 2IA2A 1LSVA 4JGPA 1YMXA 3CLOA 4KZ3A 1BUEA 5DTKA 3BECA 3GSGA 1H3QA 1ZG4A 2PYRA 2ZQ9A 5EM1A 1K54A 1HVBA 2XRNA 2INWA 2HDUA 2ZMVA 1IYPA 3HUNA 4DJ3A 1V9ZA 3QP2A 4OH0A 1BULA 1XA1A 3VSKA 2V1ZA 4R4RA 4CLCC 1TEMA 3GVBA 3CITA 1Q2PA 2PR5A 1PI5A 2E8IA 4ME4A 3B3XA 1XXMA 2XA7M 4Y0TA 4N92A 2W3DA 1ES5A 1O7EA 3V39A 3LUQA 2XQZA 2H10A 4GNUA 4EQIA 4GOGA 1S67L 4EEPA 2JHEA 3CZDA 1OT6A 3C4OA 3TOIA 5FAOA 2P7JA 3UPNA 4GS9B 1L2SA 5CEDA 5FQIA 3EOIA 3T1RA 2R9WA 4MN6A 5HAPA 3JPUA 5DFYA 1Z6FA 1A0KA 1W63Q 1K0KA 4OPRA 3ZG8B 1ONGA 3SH8A 3KSIA 3P7NA 1JNUA 3V50A 3PBNA 1K6RA 4GS9A 4DE1A 3ZNTA 3ZDJA 3NI9A 3A3IA 3N8RA 4FTXA 4OP8A 3F1NB 2XSSA 2KLIA 3NOTC 4UHUA 1VQQA 4HH2A 1KVLA 2V2FF 4B88A 2HZ5A 3BQAA 1DP8A 3BW6A 3G35A 4CQHA 1BYWA 4B4XA 2LB9A 4L0LA 3MZDA 1C3BA 3MZFA 3RH8B 1GHMA 3F1NA 4MMNA 2OWHA 2Q9NA 4EUVA 4F3LB 2O9CA 4YFMA 3U2AA 1N4OA 2L1MA 5F69A 1K4FA 1K6SA 1TD5A 4UA6A 1M40A 5GL9A 3UNWA 3R4KA 2ZQ8A 2G7UA 3MXSA 2H28A 3Q7ZA 5F83A 2VZWA 1CF0A 4IUKA 2EWVA 4NXGA 5FL3A 1NWZA 4XUXA 1NLYA 1PWDA 5FEGA 4F3LA 1FR1A 1PWGA 1IKGA 2B02A 4MDZA 2Y2QA 1KE3A 3OBFA 5E2EA 2V1AA 3K2NA 4M4XA 2ACGA 4IHQA 3B42A 4IBRA 1CK3A 3S7NA 3BFCA 4Y3IA 2HDRA 3DTEA 3F1PB 5A91A 4PKYA 4HJ6A 4C6YA 3DW0A 1FOFA 3NC8A 3LCEA 1TDLA 3IX4A 3VP4A 3IX3A 4O8GA 5FQMA 4WZ5C 4KZAA 1G5UA 2FZ0A 1GHPA 3F1OA 4WLAA 3EEAA 3E4PA 5J3WA 1CJFA 4IJGA 2ZOHA 4Y13A 3H82B 1OPXA 4ZJ3A 2VV7A 2WZZA 2R9XA 3F1PA 3P98A 4Y15A 3IWOA 2O9AA 1BZAA 1XJ6A 3AGDA 3DBAA 1OJ5A 4LV2A 2ZMAA 3BLSA 1Q2QA 4Y7PA 1MY8A 4JXVA 5DJUA 4EUZA 4NXBA 1N9NA 4Q0IA 3WS0A 1YSPA 3H82A 4K0WA 1D06A 4R3AA 4P6ZS 3UE1A 4II7A 1LHYA 1K57A 1L0EA 1SHVA 3C8CA 4QD4A 2J7VA 3SW1A 3HJKA 1DP6A 2QYBA 4LV0A 4LLOB 4BBUA 4QJGA 3E2LA 4ZTKA 5HD3A 1W7FA 3FKVA 3N8SA 3UDFA 3OPRA 3TE8A 4OONA 4ETXA 4JF4A 1I5QA 2AVXA 1SCWA 3E0YA 2Y2LA 1LI9A 3G2YA 4Q8IA 4X1LA 4A5RA 4E3NA 3LR3A 5GLBA 4XUZA 5AQAA 1IFQA 5J7EA 2WK0A 1YLYA 5TFQA 4OQIA 3CAXA 2GDNA 2X71A 4WMCD 4PM7A 3BFGA 3PXPA 1FCOA 3N8LA 4R0QA 3WRTA 3HJIA 4UQIS 1ZC2A 3NOUC 1RCJA 3WWXA 3VOYA 1T1AA 4EETB 5FEFA 4I3AA 1FQGA 3L7HA 3HVFA 3T4OA 2O0YA 3P01A 4QPRA 4MCWA 3N7WA 3LFVA 3VMAA 3PR6A 3CUEA 3UB5P 3W8KA 2W3EA 1N9OA 2ZQ7A 5HAIA 4S2LA 1NYMA 1XA7A 2A2LA 2WKRA 3LI9A 4JXGA 4KG6A 4GW9A 2HV1A 2NUTC 4NEED 3VOLA 3ZNYA 3QP8A 1M6KA 4IVIA 4JLFA 1CEGA 3VV4A 5CEBA 3SH7A 3IX8A 3G30A 5G4ZA 5FATA 2Z6DA 5FAPA 3NHQA 3IH9A 1OJGA 1PZPA 3TG9A 5E2FA 5CECA 2CC1A 1GA9A 1YLJA 1TDGA 4OLGA 1OTEA 4KZ6A 4KENB 4HJ3A 3MFXA 2Q9MA 1TS6A 3BFFA 1EW0A 2ZJ9A 1K55C 4IUHA 2XA7S 4E6XA 4U0XA 4R23A 1PNEA 5C5KA 4D60A 4PM5A 1DJAA 3T1QB 2P74A 2KDKA 5JYPA 4JGOA 4P6BA 3A3JA 4GD6A 2X02A 2XR0A 3UPOA 4OPYA 1LL5A 5HW3A 5I5LA 3MKFA 4K0XA 1PWCA 2VK3A 4R3BA 5DTTA 4BWIA 4O7DA 4PMAA 3T4LA 3S7PA 2MJ6A 4DF6A 5GLDA 3VSLA 5HPIA 1YSQA 3ZG0A 5FA7A 4N1HA 3G34A 3SZTA 3BYDA 2XEPA 4HHDA 1Y28A 1DJBA 3B33A 2HP6A 3HL9A 5CGXA 3CHWP 1BLCA 4UQIM 2Y2GA 2QWSA 2Y2OA 4IVKA 4DXCA 1XJ4A 2EXAA 1N9BA 5E43A 4B4ZA 3O3VA 3Q7VB 5K5BA 1K54C 3ZYTA 4DDYA 4JPMA 2V20A 3IHBA 5EVEA 1UGUA 5TBMB 1VHMA 3WS2A 1G6OA 1WE4A 3UE0A 3ISGA 1MKMA 5JYOA 4ZRRA 2J3TD 1L0DA 1CI9A 3A0RA 3UMEA 1PI4A 3V5MA 3BWLA 2G2UA 3LIEA 1T19A 3FC7A 3H9WA 3IF6B 3Q7VA 4EV4A 4WBGA 4JF5A 4S2MA 1ONHA 1YQSA 3E4OA 4Z9QA 3HLBA 2Y91A 2V0UA 4CPKA 5TBMA 5J4EA 4QY5A 1ES3A 5HZHA 5GLAA 1XJ3A 5GHXA 1GSVA 3BM6A 4DE0A 4HY8A 1KDWA 2Y79A 3DWZA 1O07A 4E3LA 3WS4A 2WGWB 2YKHA 4HEFA 4LRYC 1VM1A 3IF6A 3GECA 3Q82A 3HUOA 4ZBEA 2W3GA 1XKZA 2UV0E 3DWKA 4GJ4A 4L9EA 2EA9A 3IH8A 3FPWA 3PTEA 3CI6A 3NULA 2PBYA 4S2JA 3UDIA 1KVMA 2WGWA 4UA9A 3E2KA 1XP4A 2VLGA 2XROA 5E2HA 4RYEA 1YAXA 2VA0A 4NKPA 3K3CA 1FCMA 5FDHA 1NYYA 5TJJA 5EECA 2OSUA 1K56A 3BY9A 2C5WB 3LEQA 4BBTA 3SOIA 1E3UA 4KZBA 1LI0A 4DN0A 3V3RA 3MFDA 1MWUA 1XGJA 4R6LA 2VGKA 5HAQA 3KYQA 4WELA 4LRZE 1S4RA 2Y8HA 2UWXA 2PRFA 4NXFA 2HJ9C 1DP9A 4E04A 3C38A 3UE6A 5FQKA 2V9AA 3UMDA 1FR6A 3PBRA 3T4KA 2J9PA 3LIDA 1W63M 2RL3A 5L8MA 1OT9A 1HLUP 5F82A 4EBNA 1YLPA 2EFXA 3A3FA 1W5DA 3FKWA 3C4PA 3NOPC 4E3MA 4QU3A 2JKFA 4WEJA 1H8YA 4GN2A 4PAUA 4HI4A 3W4QA 3A3DA 4KG5A 1XFNA 1SKFA 3ZVWA 2WGIA 5F1GA 2GNXA 4MN5A 1JTGA 1QMFA 2ZOIA 4BD1A 4B93A 3VP1A 3EGDC 4OQHA 4LFUA 4ZAMA 5HWTA 3IHAA 2PHYA 5CGWA 4OVDA 2JKTM 1NY0A 1ZTUA 3K3DA 4GZBA 1YKDA 1EI5A 3ZHHA 1GSWA 3L9KA 1LSXA 1NJ4A 2W0NA 1DRMA 4X25A 4FCFA 4JF6A 5FI7A 4CJNA 1NZUA 1E4DA 2ZQCA 2W1RA 2ZC7A 4WYYA 4X6TA 2ZC5B 2WZXA 4KQQA 1I2SA 4DMZA 4KUOA 1RP5A 1F5MA 1XPBA 3C7UA 1ESUA 4FOFA 2WKQA 1P0ZA 1SZVA 4LENA 3F1OB 4P0MA 3B47A 3E98A 4MBFA 1ZHHB 1E25A 2J3TC 1G68A 4LCLA 2EWWA 4C75A 1S0WA 2XLNA 1AXBA 1PFLA 2ZL1B 2Y2MA 2WGVA 5KMWA 3SS3A 5L10A 4NG2A 5EUAA 2WKIA 2ZBBA 2OLVA 2Q0OA 3KX0X 1YM1A 2BTFP 3WS5A 3PBTA 1X0OA 3D3OA 3G4PA 2W27A 3LIFA 4BL3A 3IXHA 2IWBA 5KSCA 1JWPA 5EVID 2WAEA 2XGNA 3BY8A 1MWSA 2ZL1A 1BSGA 3KO6A 5HL6A 5DF8A 3GTCA 4LV1A 3UB8A 1U60A 4C3QA 4O0PA 1P9RA 4E3KA 5CX7A 4XXRA 5CTMA 4I5SA 2B18A 2J8YA 3HUMA 1KE0A 1TS0A 1QMEA 5GHYA 2A49A 4EQ1A 5EFWA 2Y2HA 2OV5A 1F98A 2JCHA 4PPRA 1WYBA 1EROA 3FV7A 3W4PA 3AGEA 5CHJA 3KYZA 2L4RA 3Q07A 1H8MA 1T18A 2IWDA 4PM9A 1YLZA 2QKPA 4LCMA 4FH2A 4N9KA 3N6IA 4EXOA 4KZ8A 2XF3A 5EPHA 5TR7A 4X56A 3G31A 3O87A 1KGEA 1YPRA 5I94A 2PYPA 1MBLA 4DE3A 2VEAA 3JYIA 1T1BA 1NLZA 1FIKA 3OLOA 1KOUA 2M7UA 1RGYA 1ZKJA 2PDRA 4FSFA 3DAVA 2V1BA 2BLSA 2J80A 4I3IA 2WKHA 1S4SA 2Y59A 1WA9A 5CXWA 1JTDA 5L07A 1K56D 4FH4A 4EW7A 1TS7A 2LB5A 5HD5A 1E3UD 1W8QA 3EQVA 1KDSA 2IWCA 4BQMA 4QWOA 3A0VA 1LL9A 1LL8A 5AQBA 1P9WA 2W1TB 4MBHA 3ZFZA 5HWVA 4IBXA 4BBVA 4X68A 3KSHA 2PT7A 3IXBA 3UDXA 5FQQA 4LV3A 4DJ2A 4GHIB 3CPTB 5AQ9A 4WUJA 4YOFA 1EWZA 3FZCA 5FAQA 1FSWA 1V9YA 4HIAA 3LY3A 3M2JA 3RJUA 2I9VA 3DTKA 2W1TA 5CERA 1VB6A 4EU0A 1RGZA 2BASA 2HF6A 4UA7A 3EGXC 2H0YA 1XGIA 5G4YA 4GHIA 1IYQA 3CPTA 3G6OA 3T1SA 2M7VA 2GJ3A 2H5SA 3NECA 3R7WB 4HESA 1MPLA 3C7VA 1ZG6A 3LYXA 3H7WA 5HSQA 3A0SA 3OOVA 4PKYG 3S22A 3C30A 2J3WA 2V0WA 3LO7A 1GA0A 2VKSA 3S4XA 4RX3A 2JE5A 2WUQA 2JN7A 5E2GA 2XD1A 4M3KA 4GB7A 4OOLA 2PU2A 4N1XA 3R7WA 4I3JA 5M1AA 1MC0A 3MS6A 1ACFA 5M18A 3LR5A 1PZOA 2PU4A 5EVIC 1FILA 3VE4A 1LLBA 1FSYA 3NY4A 4X1MA 5DJTA 2R78A 2PBDP 2ZM0A 2Y55A 5IT5A 2QJ7A 1HD8A 2H0TA 2Z2MB 1YMSA 5HPFA 1XJ2A 2ZMFA 1T1CA 3UB7A 1I2WA 2XDMA 4U3TA 3CWFA 5FDSA 5DVAA 5EOEA 3GR2A 4S2KA 4YINA 4GDBA 3S7QA 2EX9A 3NBLA 4Y5FA 3ITAA 4H6JB 1VETB 4ID4A 2J9OA 5A93A 5BOHA 3PBQA 3IBRA 5KZHA 3GV9A 2K7SA 5FQ9A 5IU1A 1W8YA 2Y2KA 3UB9A 3DTIA 4Z1WA 2W3FA 4NXEA 3IF6C 1XFQA 4NK3A 3LY4A 5CHMA 3OC2A 3MXQA 1MZUA 4H6JA 1VETA 2ZLYA 3AGFA 3QNCA 3G2ZA 4U0TA 5HDSA 2VV8A 3PAEA 5HL1A 4ETZA 4BJPA 3IWQA 4S2IA 4JBFA 5HDDA 1PIOA 4KZ4A 4YWZA 2WKPA 2JBFA 2KOIA 1P97A 3PYPA 1GCEA 4K91A 1D1JA 3IF5A 4PHTA 3IBJA 4YNRA 3D4FA 4WEKA 2HP5A 3G32A 3KYEA 2FH5A 3E4QA 1K25A 4UAAA 3RXWA 2Y4AA 4WN5A 2ZC6B 4E3JA 3FYZA 2VGLM 4OPZA 5U47A 3VP0A 1VEUB 5EM0A 3D9YA 5A92A 1BT5A 1UWNX 5G18A 1YLTA 3KSFA 3HLGA 3ITBA 4IEDA 2Y2IA 4RX2A 2WAFA 1D7EA 1F9IA 2PR6A 4LPZA 3VFHA 5AJGA 3HREA 4S2NA 3UE3A 1ERMA 4OQ0A 1VEUA 1HZOA 2DCFA 3CMZA 2XD5A 1IYSA 2JC7A 4RA7A 4D2OA 4WMCA 2HJEA 1IKIA 2VJWA 3IS2B 2XFSA 3T4TA 3MMHA 2QMIA 3GMWA 3PHYA 4BL2A 2ZM2A 2VGJA 4EERA 4CLCB 3ZG9B 1ES4A 3QNBA 4R3JA 4WZ4A 3ICYA 2NUPC 1JWVA 3BQ8A 3RFBA 4ZJ1A 2ZD8A 2HDQA 3MQQA 3P09A 1AWIA 4Y0OA 4GCZA 4F94A 1IELA 2A3UA 2HP9A 3CJMA 3IS2A 2C6WB 3W2ZA 3T12B 4MBKA 1MKIA 3LR4A 3GRJA 1LT0A 3MF0A 1XX2A 3S1YA 4EEUA 4G3WA 1PYYA 4CLCA 5AQ7A 5KSHA 4R70A 3EWKA 4EBLA 1TS8A 5F68A 2DMWA 3V67A 3WS1A 1J9MA 1K38A 4WL9A 2O99A 2ZM8A 1HTZA 4ESPA 2GX5A 4S2PA 1ALQA 4E3OA 3IT9A 5A90A 2JKRI 1GHIA 1K4EA 3BJNA 4DRTA 4OQGA 1ESIA 2OAP1 3SS5A 4O01A 2WADA 5M19A 4Y0UA 1TF1A 2Z2LB 1N9LA 2PD8A 4R1GA 4MEZA 2HDSA 4JXSA 1LSWA 3OZHA 1FCNA 3WRZA 4FUWA 5L09A 2D02A 3JVVA 1CI8A 3UPPA 4Y17A 3HLEA 1MWRA 5A8BA 1L0GA 3LEZA 1NRFA 3O5YA 3HLDA 5FI6A 3DTMA 3NIAA 1H5XA 3PBOA 4HBTA 4L9GA 4N9LA 2QZ6A 3ZG7B 1KE4A 4KQOA 1J3WA 3NJAA 4E3IA 3MJQA 4GKUA 4MLLA 2EXBA 3ZGAB 2GZAA 1F2KA 3O86A 4DKIA
chains in the Genus database with same CATH topology
4R3BA 5DTTA 2ZQAA 1K56D 3O88A 3B3XA 4O7DA 4PMAA 1XXMA 4FH4A 3IQAA 4OKPA 4QHCA 4Y0TA 4N92A 3PBSA 5GLDA 3VSLA 4DF6A 1E3UD 1ES5A 1W8QA 3EQVA 1O7EA 3V39A 3ZG0A 5FA7A 3RXXA 1KDSA 2IWCA 3HLCA 4N1HA 3M6BA 3G34A 2FFYA 1K57C 4KQRA 2XQZA 4KZ9A 4BQMA 5HARA 2H10A 3BYDA 4GNUA 5FSRA 1LL9A 4GOGA 4EQIA 4OP5A 5AQBA 2XEPA 3CZDA 2Y2PA 4BLMA 4OOYA 3C4OA 3TOIA 1DJBA 5FAOA 4MBHA 3ZFZA 2HPBA 4IBXA 2HP6A 3UPNA 1L2SA 3HL9A 3OPHA 5CGXA 5CEDA 4X68A 3MXRA 3HLFA 1BLCA 5FQIA 2Y2GA 2Y2OA 2R9WA 4JKTA 3IXBA 4IVKA 3UDXA 5HAPA 2EX8A 3M2KA 5FQQA 3UY6A 4DXCA 4LV3A 2EXAA 1N9BA 5F1FA 3BEBA 1Z6FA 5E43A 5AQ9A 4B4ZA 1EWZA 3FZCA 3O3VA 4OPRA 1FSWA 3Q7VB 5FAQA 3ZG8B 1ONGA 2I72A 3SH8A 5FASA 3LY3A 1K54C 3M2JA 4DDYA 4JPMA 3RJUA 2V20A 3IHBA 3V50A 2X01A 3PBNA 1K6RA 2ZQDA 5CERA 5CGSA 3WS2A 4DE1A 1RGZA 4UA7A 1PW8A 3ZNTA 3ZDJA 1WE4A 3NI9A 3VOZA 3A3IA 3UE0A 4X69A 1YLWA 3ISGA 3N8RA 4OP8A 5JYOA 2H0YA 2XH9A 1XGIA 1SDEA 1L0DA 1CI9A 2ZC3B 1IYQA 3PAGA 4UHUA 1VQQA 1PI4A 3V5MA 2G2UA 1KVLA 3IF6B 3Q7VA 4EV4A 4WBGA 2V2FF 2B5RA 4B88A 4JF5A 4S2MA 2H5SA 1ONHA 3NDEA 1YQSA 4Z9QA 3HLBA 2Y91A 4HESA 1MPLA 3C7VA 3G35A 4CPKA 1ZG6A 4B4XA 4L0LA 3MZDA 1ES3A 4QY5A 3TSGA 1C3BA 3MZFA 5GLAA 5GHXA 3BM6A 4DE0A 4WZ5A 3S22A 5EOOA 1GHMA 1KDWA 4BD0A 3ZCZA 3LO7A 1GA0A 3DWZA 4RVAA 1O07A 4E3LA 2Q9NA 4KZ7A 3Q81A 3S4XA 1PW1A 2WGWB 4HEFA 4RX3A 3WS4A 2JE5A 1VM1A 4YFMA 3IF6A 2RCXA 1N4OA 3Q82A 2WUQA 3HUOA 1NXYA 4ZBEA 5E2GA 1K4FA 2XD1A 4M3KA 4GB7A 4DDSA 4OOLA 1K6SA 2PU2A 4N1XA 4UA6A 1G6AA 1ERQA 1XKZA 3DWKA 2BG1A 1M40A 4OPQA 5GL9A 5M1AA 3UNWA 2ZQ8A 3MXSA 5M18A 5EE8A 1PZOA 3IH8A 1CEFA 2PU4A 3PTEA 5EVIC 3Q7ZA 5F83A 1LLBA 1FSYA 3OCNA 3NY4A 4KZ5A 2PBYA 4S2JA 2OLUA 5L2FA 3UDIA 4ZDXA 1KVMA 1MXOA 4XUXA 4BENA 2EFUA 1PWDA 2WGWA 2XFTA 3E2KA 1XP4A 4UA9A 5E2HA 1FR1A 1PWGA 1IKGA 2ZM0A 4RYEA 2Y55A 4KG2A 1HD8A 2Y2QA 1KE3A 4HBUA 5E2EA 4WM9A 1ES2A 1FCMA 5FDHA 2G2WA 1NYYA 5EECA 2OSUA 1K56A 2H0TA 2Z2MB 1YMSA 5DF9A 2C5WB 5FQJA 1DJCA 3UN7A 4IBRA 1CK3A 1I2WA 3SOIA 1E3UA 3OPLA 2XDMA 4KZBA 4U3TA 1LI0A 3V3RA 3BFCA 5DVAA 3MFDA 1MWUA 2HDRA 5EOEA 4E6WA 1MWTA 3GR2A 4S2KA 1XGJA 5A91A 5IHVA 2Y2NA 4YINA 4GDBA 2EX9A 3NBLA 2VGKA 3W4OA 3ITAA 5HAQA 4ID4A 2J9OA 3MKEA 4WELA 5A93A 4EBPA 4C6YA 3DW0A 1FOFA 3NC8A 3LCEA 1TDLA 3PBQA 5BOHA 2UWXA 3VP4A 5FQMA 4WZ5C 3BRMA 5KZHA 4KZAA 1GHPA 1IYOA 1JVJA 3GV9A 5FQKA 5FQ9A 4DE2A 1W8YA 2Y2KA 1FR6A 3PBRA 2J9PA 2WKEA 3IF6C 2RL3A 3A3EA 5F82A 4EBNA 4QY6A 4ZJ3A 1YLPA 2EFXA 3A3FA 1W5DA 2R9XA 2WZZA 3P98A 4NK3A 3IWOA 3VFFA 3FKWA 3BLMA 3LY4A 5CHMA 3C4PA 3OC2A 4PM8A 1BZAA 4E3MA 2ZLYA 3AGFA 3AGDA 3QNCA 3G2ZA 4QU3A 3ZVTA 4U0TA 4WEJA 1H8YA 4GN2A 4X55A 3W4QA 1DY6A 3PAEA 3A3DA 4KG5A 4LV2A 2ZMAA 3BLSA 5HL1A 1Q2QA 4Y7PA 1MY8A 3IXGA 3IWQA 4BJPA 4S2IA 4JBFA 1SKFA 3SH9A 4JXVA 4EUZA 3ZVWA 3VP2A 5HX9A 3NDGA 3IXDA 3WS0A 2WGIA 5F1GA 1L0FA 1PIOA 4KZ4A 4JXWA 4K0WA 1KGGA 4P85A 1JTGA 3UE1A 4NETA 1QMFA 4H8RA 4BD1A 1LHYA 2ZC4B 2JBFA 1TVFA 3IWIA 3VP3A 1BLPA 1K57A 1L0EA 1SHVA 1KGFA 1GCEA 4K91A 3VP1A 3IF5A 4QD4A 2J7VA 3D4FA 3V3SA 4WEKA 2HP5A 2XK1A 3GQZA 3OCLA 4OQHA 3G32A 3OPPA 1K25A 4UAAA 3RXWA 4X53A 4LV0A 2Y4AA 4OLDA 5D3OA 4ZAMA 2ZC6B 5CTNA 4E3JA 3IHAA 4QJGA 3E2LA 3FYZA 4OVDA 5CGWA 4ZTKA 1NY0A 4OPZA 4GZBA 5U47A 3VP0A 1EI5A 3ZHHA 3BFEA 1W7FA 5A92A 3FKVA 1BT5A 1NJ4A 3N8SA 1S6RA 3OPRA 3UDFA 4OONA 5G18A 1YLTA 4R4SA 4JF4A 1I5QA 1SCWA 4FCFA 1BLSA 2Y2LA 1LI9A 4JF6A 3HLGA 3FWLA 3ITBA 4IEDA 2Y2IA 5FI7A 4CJNA 1NZUA 3G2YA 1E4DA 4Q8IA 2ZQCA 4RX2A 2WAFA 2ZC7A 5CHUA 4WYYA 4X6TA 4A5RA 2ZC5B 4E3NA 5GLBA 4XUZA 5AQAA 4OOMA 2WZXA 4KQQA 4S2OA 2WK0A 1I2SA 1YLYA 3VFHA 3HREA 4S2NA 3UE3A 1ERMA 1RP5A 1XPBA 2P9VB 5TFQA 4OQIA 4OQ0A 5GLCA 3C7UA 3SS4A 2GDNA 1ESUA 1HZOA 2DCFA 2X71A 4WMCD 3CMZA 2QPNA 4PM7A 2WYXA 4LENA 3UO9A 4P0MA 3N4IA 4P87A 2XD5A 1IYSA 3BFGA 3HLWA 2Y2JA 5J8XA 1IEMA 2JC7A 4MBFA 4RA7A 4D2OA 4WMCA 1E25A 1FCOA 3N8LA 5HFOA 1IKIA 1NZOA 4R0QA 1G68A 4LCLA 3WRTA 1ZC2A 1BLHA 2XFSA 3QHYA 5EVLA 4C75A 1WYCA 1RCJA 1S0WA 2XLNA 1AXBA 2FFFB 3WWXA 1Y54A 2Y2MA 3VOYA 2WGVA 5KMWA 2QMIA 3SS3A 3GMWA 4BL2A 2ZM2A 3MZEA 5EVIB 4ZJ2A 2P9VA 2VGJA 5EUAA 3ZG9B 2WKIA 1ES4A 1FQGA 3ZG5A 2OLVA 3QNBA 1YM1A 3HVFA 4R3JA 4WZ4A 3WS5A 1JWVA 3PBTA 4ZJ1A 1K55A 2ZD8A 2HDQA 3P09A 4Y0OA 3G4PA 4F94A 1IELA 2A3UA 3N7WA 3BFDA 2HP9A 3CJMA 2EX6A 3I7JA 4QB8A 4BL3A 3VMAA 4GD8A 2C6WB 3IXHA 2IWBA 5KSCA 1JWPA 5EVID 4MBKA 2WAEA 1MKIA 2XGNA 3GRJA 1MWSA 1BSGA 4FD8A 3W8KA 1XX2A 3CG5A 3S1YA 5DF8A 5CRFA 5DTSA 5EVIA 2ZQ7A 5GHZA 3GTCA 1PYYA 5HAIA 4LV1A 4S2LA 3NCKA 5AQ7A 1U60A 1NYMA 4C3QA 1XA7A 5KSHA 3MBZA 4MNRA 4E3KA 1W79A 4DXBA 4XXRA 4EBLA 5CTMA 1BTLA 5FI2A 3C5AA 4JXGA 4KG6A 2J8YA 3HUMA 3Q1FA 3WS1A 1J9MA 1KE0A 1K38A 1QMEA 4S2NC 2ZM8A 5GHYA 2A49A 4PM6A 1HTZA 4S2PA 5DF7A 1ALQA 2Y2HA 2OV5A 3ZNYA 1M6KA 2EX2A 2JCHA 3IT9A 4IVIA 4JLFA 4E3OA 5A90A 1YT4A 1CEGA 4PPRA 1WYBA 5CEBA 1EROA 1GHIA 3FV7A 3SH7A 4GDNA 3W4PA 3AGEA 1K4EA 5CHJA 1JWZA 3G30A 4DRTA 4OQGA 1ESIA 5FATA 3SS5A 3HBRA 5FAPA 3Q07A 3IH9A 1PZPA 2WADA 3M6HA 2DRWA 5M19A 4Y0UA 3TG9A 1SDNA 4EWFA 1OMEA 5E2FA 5CECA 2CC1A 2IWDA 1GA9A 4PM9A 1H8ZA 1YLJA 1YLZA 2DNSA 3EQUA 5TGFA 2Z2LB 4R1GA 1TDGA 4LCMA 4OLGA 4FH2A 4MEZA 2HDSA 4KZ6A 4JXSA 3N6IA 4N9KA 3OZHA 4KENB 4KZ8A 1FCNA 2XF3A 1YMXA 5EPHA 4KZ3A 1BUEA 4X56A 5TR7A 2Q9MA 3WRZA 3BFFA 3G31A 5DTKA 3BECA 3GSGA 1ZG4A 2ZJ9A 1CI8A 3O87A 1K55C 3UPPA 1KGEA 2ZQ9A 1K54A 1HVBA 4E6XA 5I94A 3HLEA 1MWRA 1MBLA 4DE3A 1L0GA 2HDUA 4R23A 3JYIA 4U0XA 1IYPA 3LEZA 3HUNA 1RGYA 1ZKJA 1NRFA 4OH0A 1DJAA 4PM5A 4FSFA 1BULA 1XA1A 3HLDA 5FI6A 3VSKA 3DTMA 2P74A 2V1ZA 3NIAA 4R4RA 1H5XA 3PBOA 5JYPA 4HBTA 4N9LA 4P6BA 2QZ6A 3A3JA 2BLSA 4GD6A 3ZG7B 1KE4A 1TEMA 4KQOA 2X02A 2XR0A 3UPOA 4OPYA 1LL5A 4E3IA 2WKHA 5HW3A 2Y59A 4GKUA 3GVBA 3MKFA 5CXWA 1Q2PA 4K0XA 4MLLA 2EXBA 3ZGAB 3O86A 1JTDA 1PWCA 1PI5A 2E8IA 4DKIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4R3B A;  5DTT A;  2ZQA A;  1K56 D;  3O88 A;  3B3X A;  4O7D A;  4PMA A;  1XXM A;  4FH4 A;  3IQA A;  4OKP A;  4QHC A;  4Y0T A;  4N92 A;  3PBS A;  5GLD A;  3VSL A;  4DF6 A;  1E3U D;  1ES5 A;  1W8Q A;  3EQV A;  1O7E A;  3V39 A;  3ZG0 A;  5FA7 A;  3RXX A;  1KDS A;  2IWC A;  3HLC A;  4N1H A;  3M6B A;  3G34 A;  2FFY A;  1K57 C;  4KQR A;  2XQZ A;  4KZ9 A;  4BQM A;  5HAR A;  2H10 A;  3BYD A;  4GNU A;  5FSR A;  1LL9 A;  4GOG A;  4EQI A;  4OP5 A;  5AQB A;  2XEP A;  3CZD A;  2Y2P A;  4BLM A;  4OOY A;  3C4O A;  3TOI A;  1DJB A;  5FAO A;  4MBH A;  3ZFZ A;  2HPB A;  4IBX A;  2HP6 A;  3UPN A;  1L2S A;  3HL9 A;  3OPH A;  5CGX A;  5CED A;  4X68 A;  3MXR A;  3HLF A;  1BLC A;  5FQI A;  2Y2G A;  2Y2O A;  2R9W A;  4JKT A;  3IXB A;  4IVK A;  3UDX A;  5HAP A;  2EX8 A;  3M2K A;  5FQQ A;  3UY6 A;  4DXC A;  4LV3 A;  2EXA A;  1N9B A;  5F1F A;  3BEB A;  1Z6F A;  5E43 A;  5AQ9 A;  4B4Z A;  1EWZ A;  3FZC A;  3O3V A;  4OPR A;  1FSW A;  3Q7V B;  5FAQ A;  3ZG8 B;  1ONG A;  2I72 A;  3SH8 A;  5FAS A;  3LY3 A;  1K54 C;  3M2J A;  4DDY A;  4JPM A;  3RJU A;  2V20 A;  3IHB A;  3V50 A;  2X01 A;  3PBN A;  1K6R A;  2ZQD A;  5CER A;  5CGS A;  3WS2 A;  4DE1 A;  1RGZ A;  4UA7 A;  1PW8 A;  3ZNT A;  3ZDJ A;  1WE4 A;  3NI9 A;  3VOZ A;  3A3I A;  3UE0 A;  4X69 A;  1YLW A;  3ISG A;  3N8R A;  4OP8 A;  5JYO A;  2H0Y A;  2XH9 A;  1XGI A;  1SDE A;  1L0D A;  1CI9 A;  2ZC3 B;  1IYQ A;  3PAG A;  4UHU A;  1VQQ A;  1PI4 A;  3V5M A;  2G2U A;  1KVL A;  3IF6 B;  3Q7V A;  4EV4 A;  4WBG A;  2V2F F;  2B5R A;  4B88 A;  4JF5 A;  4S2M A;  2H5S A;  1ONH A;  3NDE A;  1YQS A;  4Z9Q A;  3HLB A;  2Y91 A;  4HES A;  1MPL A;  3C7V A;  3G35 A;  4CPK A;  1ZG6 A;  4B4X A;  4L0L A;  3MZD A;  1ES3 A;  4QY5 A;  3TSG A;  1C3B A;  3MZF A;  5GLA A;  5GHX A;  3BM6 A;  4DE0 A;  4WZ5 A;  3S22 A;  5EOO A;  1GHM A;  1KDW A;  4BD0 A;  3ZCZ A;  3LO7 A;  1GA0 A;  3DWZ A;  4RVA A;  1O07 A;  4E3L A;  2Q9N A;  4KZ7 A;  3Q81 A;  3S4X A;  1PW1 A;  2WGW B;  4HEF A;  4RX3 A;  3WS4 A;  2JE5 A;  1VM1 A;  4YFM A;  3IF6 A;  2RCX A;  1N4O A;  3Q82 A;  2WUQ A;  3HUO A;  1NXY A;  4ZBE A;  5E2G A;  1K4F A;  2XD1 A;  4M3K A;  4GB7 A;  4DDS A;  4OOL A;  1K6S A;  2PU2 A;  4N1X A;  4UA6 A;  1G6A A;  1ERQ A;  1XKZ A;  3DWK A;  2BG1 A;  1M40 A;  4OPQ A;  5GL9 A;  5M1A A;  3UNW A;  2ZQ8 A;  3MXS A;  5M18 A;  5EE8 A;  1PZO A;  3IH8 A;  1CEF A;  2PU4 A;  3PTE A;  5EVI C;  3Q7Z A;  5F83 A;  1LLB A;  1FSY A;  3OCN A;  3NY4 A;  4KZ5 A;  2PBY A;  4S2J A;  2OLU A;  5L2F A;  3UDI A;  4ZDX A;  1KVM A;  1MXO A;  4XUX A;  4BEN A;  2EFU A;  1PWD A;  2WGW A;  2XFT A;  3E2K A;  1XP4 A;  4UA9 A;  5E2H A;  1FR1 A;  1PWG A;  1IKG A;  2ZM0 A;  4RYE A;  2Y55 A;  4KG2 A;  1HD8 A;  2Y2Q A;  1KE3 A;  4HBU A;  5E2E A;  4WM9 A;  1ES2 A;  1FCM A;  5FDH A;  2G2W A;  1NYY A;  5EEC A;  2OSU A;  1K56 A;  2H0T A;  2Z2M B;  1YMS A;  5DF9 A;  2C5W B;  5FQJ A;  1DJC A;  3UN7 A;  4IBR A;  1CK3 A;  1I2W A;  3SOI A;  1E3U A;  3OPL A;  2XDM A;  4KZB A;  4U3T A;  1LI0 A;  3V3R A;  3BFC A;  5DVA A;  3MFD A;  1MWU A;  2HDR A;  5EOE A;  4E6W A;  1MWT A;  3GR2 A;  4S2K A;  1XGJ A;  5A91 A;  5IHV A;  2Y2N A;  4YIN A;  4GDB A;  2EX9 A;  3NBL A;  2VGK A;  3W4O A;  3ITA A;  5HAQ A;  4ID4 A;  2J9O A;  3MKE A;  4WEL A;  5A93 A;  4EBP A;  4C6Y A;  3DW0 A;  1FOF A;  3NC8 A;  3LCE A;  1TDL A;  3PBQ A;  5BOH A;  2UWX A;  3VP4 A;  5FQM A;  4WZ5 C;  3BRM A;  5KZH A;  4KZA A;  1GHP A;  1IYO A;  1JVJ A;  3GV9 A;  5FQK A;  5FQ9 A;  4DE2 A;  1W8Y A;  2Y2K A;  1FR6 A;  3PBR A;  2J9P A;  2WKE A;  3IF6 C;  2RL3 A;  3A3E A;  5F82 A;  4EBN A;  4QY6 A;  4ZJ3 A;  1YLP A;  2EFX A;  3A3F A;  1W5D A;  2R9X A;  2WZZ A;  3P98 A;  4NK3 A;  3IWO A;  3VFF A;  3FKW A;  3BLM A;  3LY4 A;  5CHM A;  3C4P A;  3OC2 A;  4PM8 A;  1BZA A;  4E3M A;  2ZLY A;  3AGF A;  3AGD A;  3QNC A;  3G2Z A;  4QU3 A;  3ZVT A;  4U0T A;  4WEJ A;  1H8Y A;  4GN2 A;  4X55 A;  3W4Q A;  1DY6 A;  3PAE A;  3A3D A;  4KG5 A;  4LV2 A;  2ZMA A;  3BLS A;  5HL1 A;  1Q2Q A;  4Y7P A;  1MY8 A;  3IXG A;  3IWQ A;  4BJP A;  4S2I A;  4JBF A;  1SKF A;  3SH9 A;  4JXV A;  4EUZ A;  3ZVW A;  3VP2 A;  5HX9 A;  3NDG A;  3IXD A;  3WS0 A;  2WGI A;  5F1G A;  1L0F A;  1PIO A;  4KZ4 A;  4JXW A;  4K0W A;  1KGG A;  4P85 A;  1JTG A;  3UE1 A;  4NET A;  1QMF A;  4H8R A;  4BD1 A;  1LHY A;  2ZC4 B;  2JBF A;  1TVF A;  3IWI A;  3VP3 A;  1BLP A;  1K57 A;  1L0E A;  1SHV A;  1KGF A;  1GCE A;  4K91 A;  3VP1 A;  3IF5 A;  4QD4 A;  2J7V A;  3D4F A;  3V3S A;  4WEK A;  2HP5 A;  2XK1 A;  3GQZ A;  3OCL A;  4OQH A;  3G32 A;  3OPP A;  1K25 A;  4UAA A;  3RXW A;  4X53 A;  4LV0 A;  2Y4A A;  4OLD A;  5D3O A;  4ZAM A;  2ZC6 B;  5CTN A;  4E3J A;  3IHA A;  4QJG A;  3E2L A;  3FYZ A;  4OVD A;  5CGW A;  4ZTK A;  1NY0 A;  4OPZ A;  4GZB A;  5U47 A;  3VP0 A;  1EI5 A;  3ZHH A;  3BFE A;  1W7F A;  5A92 A;  3FKV A;  1BT5 A;  1NJ4 A;  3N8S A;  1S6R A;  3OPR A;  3UDF A;  4OON A;  5G18 A;  1YLT A;  4R4S A;  4JF4 A;  1I5Q A;  1SCW A;  4FCF A;  1BLS A;  2Y2L A;  1LI9 A;  4JF6 A;  3HLG A;  3FWL A;  3ITB A;  4IED A;  2Y2I A;  5FI7 A;  4CJN A;  1NZU A;  3G2Y A;  1E4D A;  4Q8I A;  2ZQC A;  4RX2 A;  2WAF A;  2ZC7 A;  5CHU A;  4WYY A;  4X6T A;  4A5R A;  2ZC5 B;  4E3N A;  5GLB A;  4XUZ A;  5AQA A;  4OOM A;  2WZX A;  4KQQ A;  4S2O A;  2WK0 A;  1I2S A;  1YLY A;  3VFH A;  3HRE A;  4S2N A;  3UE3 A;  1ERM A;  1RP5 A;  1XPB A;  2P9V B;  5TFQ A;  4OQI A;  4OQ0 A;  5GLC A;  3C7U A;  3SS4 A;  2GDN A;  1ESU A;  1HZO A;  2DCF A;  2X71 A;  4WMC D;  3CMZ A;  2QPN A;  4PM7 A;  2WYX A;  4LEN A;  3UO9 A;  4P0M A;  3N4I A;  4P87 A;  2XD5 A;  1IYS A;  3BFG A;  3HLW A;  2Y2J A;  5J8X A;  1IEM A;  2JC7 A;  4MBF A;  4RA7 A;  4D2O A;  4WMC A;  1E25 A;  1FCO A;  3N8L A;  5HFO A;  1IKI A;  1NZO A;  4R0Q A;  1G68 A;  4LCL A;  3WRT A;  1ZC2 A;  1BLH A;  2XFS A;  3QHY A;  5EVL A;  4C75 A;  1WYC A;  1RCJ A;  1S0W A;  2XLN A;  1AXB A;  2FFF B;  3WWX A;  1Y54 A;  2Y2M A;  3VOY A;  2WGV A;  5KMW A;  2QMI A;  3SS3 A;  3GMW A;  4BL2 A;  2ZM2 A;  3MZE A;  5EVI B;  4ZJ2 A;  2P9V A;  2VGJ A;  5EUA A;  3ZG9 B;  2WKI A;  1ES4 A;  1FQG A;  3ZG5 A;  2OLV A;  3QNB A;  1YM1 A;  3HVF A;  4R3J A;  4WZ4 A;  3WS5 A;  1JWV A;  3PBT A;  4ZJ1 A;  1K55 A;  2ZD8 A;  2HDQ A;  3P09 A;  4Y0O A;  3G4P A;  4F94 A;  1IEL A;  2A3U A;  3N7W A;  3BFD A;  2HP9 A;  3CJM A;  2EX6 A;  3I7J A;  4QB8 A;  4BL3 A;  3VMA A;  4GD8 A;  2C6W B;  3IXH A;  2IWB A;  5KSC A;  1JWP A;  5EVI D;  4MBK A;  2WAE A;  1MKI A;  2XGN A;  3GRJ A;  1MWS A;  1BSG A;  4FD8 A;  3W8K A;  1XX2 A;  3CG5 A;  3S1Y A;  5DF8 A;  5CRF A;  5DTS A;  5EVI A;  2ZQ7 A;  5GHZ A;  3GTC A;  1PYY A;  5HAI A;  4LV1 A;  4S2L A;  3NCK A;  5AQ7 A;  1U60 A;  1NYM A;  4C3Q A;  1XA7 A;  5KSH A;  3MBZ A;  4MNR A;  4E3K A;  1W79 A;  4DXB A;  4XXR A;  4EBL A;  5CTM A;  1BTL A;  5FI2 A;  3C5A A;  4JXG A;  4KG6 A;  2J8Y A;  3HUM A;  3Q1F A;  3WS1 A;  1J9M A;  1KE0 A;  1K38 A;  1QME A;  4S2N C;  2ZM8 A;  5GHY A;  2A49 A;  4PM6 A;  1HTZ A;  4S2P A;  5DF7 A;  1ALQ A;  2Y2H A;  2OV5 A;  3ZNY A;  1M6K A;  2EX2 A;  2JCH A;  3IT9 A;  4IVI A;  4JLF A;  4E3O A;  5A90 A;  1YT4 A;  1CEG A;  4PPR A;  1WYB A;  5CEB A;  1ERO A;  1GHI A;  3FV7 A;  3SH7 A;  4GDN A;  3W4P A;  3AGE A;  1K4E A;  5CHJ A;  1JWZ A;  3G30 A;  4DRT A;  4OQG A;  1ESI A;  5FAT A;  3SS5 A;  3HBR A;  5FAP A;  3Q07 A;  3IH9 A;  1PZP A;  2WAD A;  3M6H A;  2DRW A;  5M19 A;  4Y0U A;  3TG9 A;  1SDN A;  4EWF A;  1OME A;  5E2F A;  5CEC A;  2CC1 A;  2IWD A;  1GA9 A;  4PM9 A;  1H8Z A;  1YLJ A;  1YLZ A;  2DNS A;  3EQU A;  5TGF A;  2Z2L B;  4R1G A;  1TDG A;  4LCM A;  4OLG A;  4FH2 A;  4MEZ A;  2HDS A;  4KZ6 A;  4JXS A;  3N6I A;  4N9K A;  3OZH A;  4KEN B;  4KZ8 A;  1FCN A;  2XF3 A;  1YMX A;  5EPH A;  4KZ3 A;  1BUE A;  4X56 A;  5TR7 A;  2Q9M A;  3WRZ A;  3BFF A;  3G31 A;  5DTK A;  3BEC A;  3GSG A;  1ZG4 A;  2ZJ9 A;  1CI8 A;  3O87 A;  1K55 C;  3UPP A;  1KGE A;  2ZQ9 A;  1K54 A;  1HVB A;  4E6X A;  5I94 A;  3HLE A;  1MWR A;  1MBL A;  4DE3 A;  1L0G A;  2HDU A;  4R23 A;  3JYI A;  4U0X A;  1IYP A;  3LEZ A;  3HUN A;  1RGY A;  1ZKJ A;  1NRF A;  4OH0 A;  1DJA A;  4PM5 A;  4FSF A;  1BUL A;  1XA1 A;  3HLD A;  5FI6 A;  3VSK A;  3DTM A;  2P74 A;  2V1Z A;  3NIA A;  4R4R A;  1H5X A;  3PBO A;  5JYP A;  4HBT A;  4N9L A;  4P6B A;  2QZ6 A;  3A3J A;  2BLS A;  4GD6 A;  3ZG7 B;  1KE4 A;  1TEM A;  4KQO A;  2X02 A;  2XR0 A;  3UPO A;  4OPY A;  1LL5 A;  4E3I A;  2WKH A;  5HW3 A;  2Y59 A;  4GKU A;  3GVB A;  3MKF A;  5CXW A;  1Q2P A;  4K0X A;  4MLL A;  2EXB A;  3ZGA B;  3O86 A;  1JTD A;  1PWC A;  1PI5 A;  2E8I A;  4DKI A; 
#chains in the Genus database with same CATH topology
 2ZQA A;  3O88 A;  3IQA A;  1S66 L;  4OKP A;  4HOI A;  4QHC A;  3PBS A;  3RXX A;  3HLC A;  3M6B A;  2FFY A;  1K57 C;  4KQR A;  4KZ9 A;  3HCY A;  3JVU A;  5HAR A;  4HJ4 A;  5FSR A;  1SKO B;  4OP5 A;  3S7O A;  2Y2P A;  4BLM A;  4OOY A;  2OWJ A;  2HPB A;  4AFI A;  3U4L P;  3OPH A;  2OOL A;  1S1Y A;  2E8J A;  3MXR A;  3HLF A;  4HP4 A;  4JKT A;  2EX8 A;  3M2K A;  3UY6 A;  5F1F A;  3BEB A;  5MC7 A;  3FG8 A;  1SKO A;  2I72 A;  5FAS A;  1OTD A;  1UWP X;  4JGR A;  2CMN A;  2X01 A;  2ZQD A;  5CGS A;  4L9F A;  1PW8 A;  3VOZ A;  4Y2F A;  4X69 A;  2VX8 A;  3T4S A;  3KSG A;  1YLW A;  2L0W A;  2XH9 A;  1SDE A;  2ZC3 B;  3PAG A;  3TW8 A;  2B5R A;  3MQ0 A;  5DKL A;  3NDE A;  4KQD A;  3TSG A;  4WZ5 A;  5EOO A;  3ZQ5 A;  2D01 A;  4BD0 A;  3ZCZ A;  2JKT I;  4RVA A;  4KZ7 A;  3Q81 A;  4G3K A;  1PW1 A;  3QP6 A;  2RCX A;  2Z6C A;  3LI8 A;  1NXY A;  4DDS A;  1G6A A;  1ERQ A;  3CUE C;  4GLQ A;  2BG1 A;  2P04 A;  1Y4O A;  4OPQ A;  3D72 A;  5EE8 A;  1CEF A;  3MSH A;  3OCN A;  3LIB A;  4KZ5 A;  2OLU A;  5L2F A;  4ZDX A;  1MXO A;  4BEN A;  2QJ5 A;  2EFU A;  2XFT A;  3EEH A;  1PRQ A;  4LRX C;  4ARZ B;  4KG2 A;  2PAV P;  4HBU A;  4WM9 A;  1ES2 A;  2G2W A;  5DF9 A;  2K2N A;  5FQJ A;  1DJC A;  4HH3 A;  3UN7 A;  3OPL A;  4HP9 A;  4E6W A;  1MWT A;  2P08 A;  5IHV A;  2Y2N A;  1S1Z A;  3W4O A;  4ARZ A;  3MKE A;  3UB6 A;  4EBP A;  3BRM A;  3LR0 A;  1IYO A;  1G28 A;  1JVJ A;  4LGW A;  3RTY A;  4DE2 A;  1NRJ A;  1OTI A;  3LIA A;  2WKE A;  4R38 A;  3A3E A;  4QY6 A;  3H7W B;  4Q0H A;  3VFF A;  4CLC D;  3BLM A;  4MN7 A;  4EES A;  4PM8 A;  1H0M A;  4B9O A;  3MQO A;  3ZVT A;  4X55 A;  1DY6 A;  3IXG A;  3SH9 A;  1GSX A;  2VGL S;  3NDG A;  5HX9 A;  3IXD A;  3VP2 A;  5KIZ A;  4G3V A;  1L0F A;  1CQA A;  4JXW A;  1KGG A;  4P85 A;  4JGQ A;  4NET A;  4H8R A;  2ZC4 B;  1TVF A;  3IWI A;  3VP3 A;  1BLP A;  1KGF A;  2M1C A;  3V3S A;  2KX6 A;  2XK1 A;  3GQZ A;  3OCL A;  3OPP A;  3LGO A;  3T50 A;  4X53 A;  1OTB A;  5LBR A;  4OLD A;  5D3O A;  4BMW A;  2JKG A;  2A24 B;  5CTN A;  2YKF A;  5EV0 A;  3BFE A;  1S6R A;  4P6Z M;  4R4S A;  1BLS A;  3FWL A;  1Z09 A;  2K31 A;  2VV6 A;  3QP1 A;  1L3L A;  5CHU A;  4KUK A;  4OOM A;  2A24 A;  4S2O A;  2W3H A;  1ODV A;  3MR0 A;  3GDI A;  2QHK A;  2P9V B;  2OAQ 1;  5GLC A;  3SS4 A;  2QPN A;  2WYX A;  3UO9 A;  5AVE A;  2B95 A;  3N4I A;  4P87 A;  3HLW A;  5J8X A;  3LIC A;  2Y2J A;  1IEM A;  5HFO A;  1NZO A;  3TJZ C;  5HWW A;  1BLH A;  3QHY A;  5EVL A;  5IS1 A;  4HNB A;  1WYC A;  4K08 A;  2PD7 A;  2FFF B;  1Y54 A;  3MZE A;  5EVI B;  4ZJ2 A;  2P9V A;  4RQ9 A;  3ZG5 A;  5F6A A;  4CLC E;  3QP5 A;  1K55 A;  4I38 A;  4I39 A;  1OTA A;  2O9B A;  3BFD A;  2EX6 A;  3I7J A;  4QB8 A;  4UEY A;  4GD8 A;  5F5Y A;  3QP4 A;  4FD8 A;  5DKK A;  3CG5 A;  2V8F A;  5CRF A;  5DTS A;  5EVI A;  5GHZ A;  3NCK A;  3ULF A;  3T1X A;  4Q0J A;  3MBZ A;  4MNR A;  1W79 A;  3T4Q A;  4DXB A;  3C2W A;  4XT2 B;  5DFX A;  1BTL A;  5FI2 A;  3C5A A;  3FPV A;  5AVF A;  3VE3 A;  1IOU A;  2V8C A;  1STZ A;  3Q1F A;  4S2N C;  4WF0 A;  4PM6 A;  2HGV A;  5DF7 A;  3TRC A;  2EX2 A;  1YT4 A;  3T4J A;  4GDN A;  1JWZ A;  3HBR A;  4HQA A;  2JKR M;  3M6H A;  2DRW A;  4XT2 A;  1SDN A;  4EWF A;  1OME A;  1H8Z A;  2DNS A;  3EQU A;  5HDC A;  5TGF A;  2IA2 A;  1LSV A;  4JGP A;  1YMX A;  3CLO A;  4KZ3 A;  1BUE A;  5DTK A;  3BEC A;  3GSG A;  1H3Q A;  1ZG4 A;  2PYR A;  2ZQ9 A;  5EM1 A;  1K54 A;  1HVB A;  2XRN A;  2INW A;  2HDU A;  2ZMV A;  1IYP A;  3HUN A;  4DJ3 A;  1V9Z A;  3QP2 A;  4OH0 A;  1BUL A;  1XA1 A;  3VSK A;  2V1Z A;  4R4R A;  4CLC C;  1TEM A;  3GVB A;  3CIT A;  1Q2P A;  2PR5 A;  1PI5 A;  2E8I A;  4ME4 A;  3B3X A;  1XXM A;  2XA7 M;  4Y0T A;  4N92 A;  2W3D A;  1ES5 A;  1O7E A;  3V39 A;  3LUQ A;  2XQZ A;  2H10 A;  4GNU A;  4EQI A;  4GOG A;  1S67 L;  4EEP A;  2JHE A;  3CZD A;  1OT6 A;  3C4O A;  3TOI A;  5FAO A;  2P7J A;  3UPN A;  4GS9 B;  1L2S A;  5CED A;  5FQI A;  3EOI A;  3T1R A;  2R9W A;  4MN6 A;  5HAP A;  3JPU A;  5DFY A;  1Z6F A;  1A0K A;  1W63 Q;  1K0K A;  4OPR A;  3ZG8 B;  1ONG A;  3SH8 A;  3KSI A;  3P7N A;  1JNU A;  3V50 A;  3PBN A;  1K6R A;  4GS9 A;  4DE1 A;  3ZNT A;  3ZDJ A;  3NI9 A;  3A3I A;  3N8R A;  4FTX A;  4OP8 A;  3F1N B;  2XSS A;  2KLI A;  3NOT C;  4UHU A;  1VQQ A;  4HH2 A;  1KVL A;  2V2F F;  4B88 A;  2HZ5 A;  3BQA A;  1DP8 A;  3BW6 A;  3G35 A;  4CQH A;  1BYW A;  4B4X A;  2LB9 A;  4L0L A;  3MZD A;  1C3B A;  3MZF A;  3RH8 B;  1GHM A;  3F1N A;  4MMN A;  2OWH A;  2Q9N A;  4EUV A;  4F3L B;  2O9C A;  4YFM A;  3U2A A;  1N4O A;  2L1M A;  5F69 A;  1K4F A;  1K6S A;  1TD5 A;  4UA6 A;  1M40 A;  5GL9 A;  3UNW A;  3R4K A;  2ZQ8 A;  2G7U A;  3MXS A;  2H28 A;  3Q7Z A;  5F83 A;  2VZW A;  1CF0 A;  4IUK A;  2EWV A;  4NXG A;  5FL3 A;  1NWZ A;  4XUX A;  1NLY A;  1PWD A;  5FEG A;  4F3L A;  1FR1 A;  1PWG A;  1IKG A;  2B02 A;  4MDZ A;  2Y2Q A;  1KE3 A;  3OBF A;  5E2E A;  2V1A A;  3K2N A;  4M4X A;  2ACG A;  4IHQ A;  3B42 A;  4IBR A;  1CK3 A;  3S7N A;  3BFC A;  4Y3I A;  2HDR A;  3DTE A;  3F1P B;  5A91 A;  4PKY A;  4HJ6 A;  4C6Y A;  3DW0 A;  1FOF A;  3NC8 A;  3LCE A;  1TDL A;  3IX4 A;  3VP4 A;  3IX3 A;  4O8G A;  5FQM A;  4WZ5 C;  4KZA A;  1G5U A;  2FZ0 A;  1GHP A;  3F1O A;  4WLA A;  3EEA A;  3E4P A;  5J3W A;  1CJF A;  4IJG A;  2ZOH A;  4Y13 A;  3H82 B;  1OPX A;  4ZJ3 A;  2VV7 A;  2WZZ A;  2R9X A;  3F1P A;  3P98 A;  4Y15 A;  3IWO A;  2O9A A;  1BZA A;  1XJ6 A;  3AGD A;  3DBA A;  1OJ5 A;  4LV2 A;  2ZMA A;  3BLS A;  1Q2Q A;  4Y7P A;  1MY8 A;  4JXV A;  5DJU A;  4EUZ A;  4NXB A;  1N9N A;  4Q0I A;  3WS0 A;  1YSP A;  3H82 A;  4K0W A;  1D06 A;  4R3A A;  4P6Z S;  3UE1 A;  4II7 A;  1LHY A;  1K57 A;  1L0E A;  1SHV A;  3C8C A;  4QD4 A;  2J7V A;  3SW1 A;  3HJK A;  1DP6 A;  2QYB A;  4LV0 A;  4LLO B;  4BBU A;  4QJG A;  3E2L A;  4ZTK A;  5HD3 A;  1W7F A;  3FKV A;  3N8S A;  3UDF A;  3OPR A;  3TE8 A;  4OON A;  4ETX A;  4JF4 A;  1I5Q A;  2AVX A;  1SCW A;  3E0Y A;  2Y2L A;  1LI9 A;  3G2Y A;  4Q8I A;  4X1L A;  4A5R A;  4E3N A;  3LR3 A;  5GLB A;  4XUZ A;  5AQA A;  1IFQ A;  5J7E A;  2WK0 A;  1YLY A;  5TFQ A;  4OQI A;  3CAX A;  2GDN A;  2X71 A;  4WMC D;  4PM7 A;  3BFG A;  3PXP A;  1FCO A;  3N8L A;  4R0Q A;  3WRT A;  3HJI A;  4UQI S;  1ZC2 A;  3NOU C;  1RCJ A;  3WWX A;  3VOY A;  1T1A A;  4EET B;  5FEF A;  4I3A A;  1FQG A;  3L7H A;  3HVF A;  3T4O A;  2O0Y A;  3P01 A;  4QPR A;  4MCW A;  3N7W A;  3LFV A;  3VMA A;  3PR6 A;  3CUE A;  3UB5 P;  3W8K A;  2W3E A;  1N9O A;  2ZQ7 A;  5HAI A;  4S2L A;  1NYM A;  1XA7 A;  2A2L A;  2WKR A;  3LI9 A;  4JXG A;  4KG6 A;  4GW9 A;  2HV1 A;  2NUT C;  4NEE D;  3VOL A;  3ZNY A;  3QP8 A;  1M6K A;  4IVI A;  4JLF A;  1CEG A;  3VV4 A;  5CEB A;  3SH7 A;  3IX8 A;  3G30 A;  5G4Z A;  5FAT A;  2Z6D A;  5FAP A;  3NHQ A;  3IH9 A;  1OJG A;  1PZP A;  3TG9 A;  5E2F A;  5CEC A;  2CC1 A;  1GA9 A;  1YLJ A;  1TDG A;  4OLG A;  1OTE A;  4KZ6 A;  4KEN B;  4HJ3 A;  3MFX A;  2Q9M A;  1TS6 A;  3BFF A;  1EW0 A;  2ZJ9 A;  1K55 C;  4IUH A;  2XA7 S;  4E6X A;  4U0X A;  4R23 A;  1PNE A;  5C5K A;  4D60 A;  4PM5 A;  1DJA A;  3T1Q B;  2P74 A;  2KDK A;  5JYP A;  4JGO A;  4P6B A;  3A3J A;  4GD6 A;  2X02 A;  2XR0 A;  3UPO A;  4OPY A;  1LL5 A;  5HW3 A;  5I5L A;  3MKF A;  4K0X A;  1PWC A;  2VK3 A;  4R3B A;  5DTT A;  4BWI A;  4O7D A;  4PMA A;  3T4L A;  3S7P A;  2MJ6 A;  4DF6 A;  5GLD A;  3VSL A;  5HPI A;  1YSQ A;  3ZG0 A;  5FA7 A;  4N1H A;  3G34 A;  3SZT A;  3BYD A;  2XEP A;  4HHD A;  1Y28 A;  1DJB A;  3B33 A;  2HP6 A;  3HL9 A;  5CGX A;  3CHW P;  1BLC A;  4UQI M;  2Y2G A;  2QWS A;  2Y2O A;  4IVK A;  4DXC A;  1XJ4 A;  2EXA A;  1N9B A;  5E43 A;  4B4Z A;  3O3V A;  3Q7V B;  5K5B A;  1K54 C;  3ZYT A;  4DDY A;  4JPM A;  2V20 A;  3IHB A;  5EVE A;  1UGU A;  5TBM B;  1VHM A;  3WS2 A;  1G6O A;  1WE4 A;  3UE0 A;  3ISG A;  1MKM A;  5JYO A;  4ZRR A;  2J3T D;  1L0D A;  1CI9 A;  3A0R A;  3UME A;  1PI4 A;  3V5M A;  3BWL A;  2G2U A;  3LIE A;  1T19 A;  3FC7 A;  3H9W A;  3IF6 B;  3Q7V A;  4EV4 A;  4WBG A;  4JF5 A;  4S2M A;  1ONH A;  1YQS A;  3E4O A;  4Z9Q A;  3HLB A;  2Y91 A;  2V0U A;  4CPK A;  5TBM A;  5J4E A;  4QY5 A;  1ES3 A;  5HZH A;  5GLA A;  1XJ3 A;  5GHX A;  1GSV A;  3BM6 A;  4DE0 A;  4HY8 A;  1KDW A;  2Y79 A;  3DWZ A;  1O07 A;  4E3L A;  3WS4 A;  2WGW B;  2YKH A;  4HEF A;  4LRY C;  1VM1 A;  3IF6 A;  3GEC A;  3Q82 A;  3HUO A;  4ZBE A;  2W3G A;  1XKZ A;  2UV0 E;  3DWK A;  4GJ4 A;  4L9E A;  2EA9 A;  3IH8 A;  3FPW A;  3PTE A;  3CI6 A;  3NUL A;  2PBY A;  4S2J A;  3UDI A;  1KVM A;  2WGW A;  4UA9 A;  3E2K A;  1XP4 A;  2VLG A;  2XRO A;  5E2H A;  4RYE A;  1YAX A;  2VA0 A;  4NKP A;  3K3C A;  1FCM A;  5FDH A;  1NYY A;  5TJJ A;  5EEC A;  2OSU A;  1K56 A;  3BY9 A;  2C5W B;  3LEQ A;  4BBT A;  3SOI A;  1E3U A;  4KZB A;  1LI0 A;  4DN0 A;  3V3R A;  3MFD A;  1MWU A;  1XGJ A;  4R6L A;  2VGK A;  5HAQ A;  3KYQ A;  4WEL A;  4LRZ E;  1S4R A;  2Y8H A;  2UWX A;  2PRF A;  4NXF A;  2HJ9 C;  1DP9 A;  4E04 A;  3C38 A;  3UE6 A;  5FQK A;  2V9A A;  3UMD A;  1FR6 A;  3PBR A;  3T4K A;  2J9P A;  3LID A;  1W63 M;  2RL3 A;  5L8M A;  1OT9 A;  1HLU P;  5F82 A;  4EBN A;  1YLP A;  2EFX A;  3A3F A;  1W5D A;  3FKW A;  3C4P A;  3NOP C;  4E3M A;  4QU3 A;  2JKF A;  4WEJ A;  1H8Y A;  4GN2 A;  4PAU A;  4HI4 A;  3W4Q A;  3A3D A;  4KG5 A;  1XFN A;  1SKF A;  3ZVW A;  2WGI A;  5F1G A;  2GNX A;  4MN5 A;  1JTG A;  1QMF A;  2ZOI A;  4BD1 A;  4B93 A;  3VP1 A;  3EGD C;  4OQH A;  4LFU A;  4ZAM A;  5HWT A;  3IHA A;  2PHY A;  5CGW A;  4OVD A;  2JKT M;  1NY0 A;  1ZTU A;  3K3D A;  4GZB A;  1YKD A;  1EI5 A;  3ZHH A;  1GSW A;  3L9K A;  1LSX A;  1NJ4 A;  2W0N A;  1DRM A;  4X25 A;  4FCF A;  4JF6 A;  5FI7 A;  4CJN A;  1NZU A;  1E4D A;  2ZQC A;  2W1R A;  2ZC7 A;  4WYY A;  4X6T A;  2ZC5 B;  2WZX A;  4KQQ A;  1I2S A;  4DMZ A;  4KUO A;  1RP5 A;  1F5M A;  1XPB A;  3C7U A;  1ESU A;  4FOF A;  2WKQ A;  1P0Z A;  1SZV A;  4LEN A;  3F1O B;  4P0M A;  3B47 A;  3E98 A;  4MBF A;  1ZHH B;  1E25 A;  2J3T C;  1G68 A;  4LCL A;  2EWW A;  4C75 A;  1S0W A;  2XLN A;  1AXB A;  1PFL A;  2ZL1 B;  2Y2M A;  2WGV A;  5KMW A;  3SS3 A;  5L10 A;  4NG2 A;  5EUA A;  2WKI A;  2ZBB A;  2OLV A;  2Q0O A;  3KX0 X;  1YM1 A;  2BTF P;  3WS5 A;  3PBT A;  1X0O A;  3D3O A;  3G4P A;  2W27 A;  3LIF A;  4BL3 A;  3IXH A;  2IWB A;  5KSC A;  1JWP A;  5EVI D;  2WAE A;  2XGN A;  3BY8 A;  1MWS A;  2ZL1 A;  1BSG A;  3KO6 A;  5HL6 A;  5DF8 A;  3GTC A;  4LV1 A;  3UB8 A;  1U60 A;  4C3Q A;  4O0P A;  1P9R A;  4E3K A;  5CX7 A;  4XXR A;  5CTM A;  4I5S A;  2B18 A;  2J8Y A;  3HUM A;  1KE0 A;  1TS0 A;  1QME A;  5GHY A;  2A49 A;  4EQ1 A;  5EFW A;  2Y2H A;  2OV5 A;  1F98 A;  2JCH A;  4PPR A;  1WYB A;  1ERO A;  3FV7 A;  3W4P A;  3AGE A;  5CHJ A;  3KYZ A;  2L4R A;  3Q07 A;  1H8M A;  1T18 A;  2IWD A;  4PM9 A;  1YLZ A;  2QKP A;  4LCM A;  4FH2 A;  4N9K A;  3N6I A;  4EXO A;  4KZ8 A;  2XF3 A;  5EPH A;  5TR7 A;  4X56 A;  3G31 A;  3O87 A;  1KGE A;  1YPR A;  5I94 A;  2PYP A;  1MBL A;  4DE3 A;  2VEA A;  3JYI A;  1T1B A;  1NLZ A;  1FIK A;  3OLO A;  1KOU A;  2M7U A;  1RGY A;  1ZKJ A;  2PDR A;  4FSF A;  3DAV A;  2V1B A;  2BLS A;  2J80 A;  4I3I A;  2WKH A;  1S4S A;  2Y59 A;  1WA9 A;  5CXW A;  1JTD A;  5L07 A;  1K56 D;  4FH4 A;  4EW7 A;  1TS7 A;  2LB5 A;  5HD5 A;  1E3U D;  1W8Q A;  3EQV A;  1KDS A;  2IWC A;  4BQM A;  4QWO A;  3A0V A;  1LL9 A;  1LL8 A;  5AQB A;  1P9W A;  2W1T B;  4MBH A;  3ZFZ A;  5HWV A;  4IBX A;  4BBV A;  4X68 A;  3KSH A;  2PT7 A;  3IXB A;  3UDX A;  5FQQ A;  4LV3 A;  4DJ2 A;  4GHI B;  3CPT B;  5AQ9 A;  4WUJ A;  4YOF A;  1EWZ A;  3FZC A;  5FAQ A;  1FSW A;  1V9Y A;  4HIA A;  3LY3 A;  3M2J A;  3RJU A;  2I9V A;  3DTK A;  2W1T A;  5CER A;  1VB6 A;  4EU0 A;  1RGZ A;  2BAS A;  2HF6 A;  4UA7 A;  3EGX C;  2H0Y A;  1XGI A;  5G4Y A;  4GHI A;  1IYQ A;  3CPT A;  3G6O A;  3T1S A;  2M7V A;  2GJ3 A;  2H5S A;  3NEC A;  3R7W B;  4HES A;  1MPL A;  3C7V A;  1ZG6 A;  3LYX A;  3H7W A;  5HSQ A;  3A0S A;  3OOV A;  4PKY G;  3S22 A;  3C30 A;  2J3W A;  2V0W A;  3LO7 A;  1GA0 A;  2VKS A;  3S4X A;  4RX3 A;  2JE5 A;  2WUQ A;  2JN7 A;  5E2G A;  2XD1 A;  4M3K A;  4GB7 A;  4OOL A;  2PU2 A;  4N1X A;  3R7W A;  4I3J A;  5M1A A;  1MC0 A;  3MS6 A;  1ACF A;  5M18 A;  3LR5 A;  1PZO A;  2PU4 A;  5EVI C;  1FIL A;  3VE4 A;  1LLB A;  1FSY A;  3NY4 A;  4X1M A;  5DJT A;  2R78 A;  2PBD P;  2ZM0 A;  2Y55 A;  5IT5 A;  2QJ7 A;  1HD8 A;  2H0T A;  2Z2M B;  1YMS A;  5HPF A;  1XJ2 A;  2ZMF A;  1T1C A;  3UB7 A;  1I2W A;  2XDM A;  4U3T A;  3CWF A;  5FDS A;  5DVA A;  5EOE A;  3GR2 A;  4S2K A;  4YIN A;  4GDB A;  3S7Q A;  2EX9 A;  3NBL A;  4Y5F A;  3ITA A;  4H6J B;  1VET B;  4ID4 A;  2J9O A;  5A93 A;  5BOH A;  3PBQ A;  3IBR A;  5KZH A;  3GV9 A;  2K7S A;  5FQ9 A;  5IU1 A;  1W8Y A;  2Y2K A;  3UB9 A;  3DTI A;  4Z1W A;  2W3F A;  4NXE A;  3IF6 C;  1XFQ A;  4NK3 A;  3LY4 A;  5CHM A;  3OC2 A;  3MXQ A;  1MZU A;  4H6J A;  1VET A;  2ZLY A;  3AGF A;  3QNC A;  3G2Z A;  4U0T A;  5HDS A;  2VV8 A;  3PAE A;  5HL1 A;  4ETZ A;  4BJP A;  3IWQ A;  4S2I A;  4JBF A;  5HDD A;  1PIO A;  4KZ4 A;  4YWZ A;  2WKP A;  2JBF A;  2KOI A;  1P97 A;  3PYP A;  1GCE A;  4K91 A;  1D1J A;  3IF5 A;  4PHT A;  3IBJ A;  4YNR A;  3D4F A;  4WEK A;  2HP5 A;  3G32 A;  3KYE A;  2FH5 A;  3E4Q A;  1K25 A;  4UAA A;  3RXW A;  2Y4A A;  4WN5 A;  2ZC6 B;  4E3J A;  3FYZ A;  2VGL M;  4OPZ A;  5U47 A;  3VP0 A;  1VEU B;  5EM0 A;  3D9Y A;  5A92 A;  1BT5 A;  1UWN X;  5G18 A;  1YLT A;  3KSF A;  3HLG A;  3ITB A;  4IED A;  2Y2I A;  4RX2 A;  2WAF A;  1D7E A;  1F9I A;  2PR6 A;  4LPZ A;  3VFH A;  5AJG A;  3HRE A;  4S2N A;  3UE3 A;  1ERM A;  4OQ0 A;  1VEU A;  1HZO A;  2DCF A;  3CMZ A;  2XD5 A;  1IYS A;  2JC7 A;  4RA7 A;  4D2O A;  4WMC A;  2HJE A;  1IKI A;  2VJW A;  3IS2 B;  2XFS A;  3T4T A;  3MMH A;  2QMI A;  3GMW A;  3PHY A;  4BL2 A;  2ZM2 A;  2VGJ A;  4EER A;  4CLC B;  3ZG9 B;  1ES4 A;  3QNB A;  4R3J A;  4WZ4 A;  3ICY A;  2NUP C;  1JWV A;  3BQ8 A;  3RFB A;  4ZJ1 A;  2ZD8 A;  2HDQ A;  3MQQ A;  3P09 A;  1AWI A;  4Y0O A;  4GCZ A;  4F94 A;  1IEL A;  2A3U A;  2HP9 A;  3CJM A;  3IS2 A;  2C6W B;  3W2Z A;  3T12 B;  4MBK A;  1MKI A;  3LR4 A;  3GRJ A;  1LT0 A;  3MF0 A;  1XX2 A;  3S1Y A;  4EEU A;  4G3W A;  1PYY A;  4CLC A;  5AQ7 A;  5KSH A;  4R70 A;  3EWK A;  4EBL A;  1TS8 A;  5F68 A;  2DMW A;  3V67 A;  3WS1 A;  1J9M A;  1K38 A;  4WL9 A;  2O99 A;  2ZM8 A;  1HTZ A;  4ESP A;  2GX5 A;  4S2P A;  1ALQ A;  4E3O A;  3IT9 A;  5A90 A;  2JKR I;  1GHI A;  1K4E A;  3BJN A;  4DRT A;  4OQG A;  1ESI A;  2OAP 1;  3SS5 A;  4O01 A;  2WAD A;  5M19 A;  4Y0U A;  1TF1 A;  2Z2L B;  1N9L A;  2PD8 A;  4R1G A;  4MEZ A;  2HDS A;  4JXS A;  1LSW A;  3OZH A;  1FCN A;  3WRZ A;  4FUW A;  5L09 A;  2D02 A;  3JVV A;  1CI8 A;  3UPP A;  4Y17 A;  3HLE A;  1MWR A;  5A8B A;  1L0G A;  3LEZ A;  1NRF A;  3O5Y A;  3HLD A;  5FI6 A;  3DTM A;  3NIA A;  1H5X A;  3PBO A;  4HBT A;  4L9G A;  4N9L A;  2QZ6 A;  3ZG7 B;  1KE4 A;  4KQO A;  1J3W A;  3NJA A;  4E3I A;  3MJQ A;  4GKU A;  4MLL A;  2EXB A;  3ZGA B;  2GZA A;  1F2K A;  3O86 A;  4DKI A; 
#chains in the Genus database with same CATH homology
 4R3B A;  5DTT A;  2ZQA A;  1K56 D;  3O88 A;  3B3X A;  4O7D A;  4PMA A;  1XXM A;  4FH4 A;  3IQA A;  4OKP A;  4QHC A;  4Y0T A;  4N92 A;  3PBS A;  5GLD A;  3VSL A;  4DF6 A;  1E3U D;  1ES5 A;  1W8Q A;  3EQV A;  1O7E A;  3V39 A;  3ZG0 A;  5FA7 A;  3RXX A;  1KDS A;  2IWC A;  3HLC A;  4N1H A;  3M6B A;  3G34 A;  2FFY A;  1K57 C;  4KQR A;  2XQZ A;  4KZ9 A;  4BQM A;  5HAR A;  2H10 A;  3BYD A;  4GNU A;  5FSR A;  1LL9 A;  4GOG A;  4EQI A;  4OP5 A;  5AQB A;  2XEP A;  3CZD A;  2Y2P A;  4BLM A;  4OOY A;  3C4O A;  3TOI A;  1DJB A;  5FAO A;  4MBH A;  3ZFZ A;  2HPB A;  4IBX A;  2HP6 A;  3UPN A;  1L2S A;  3HL9 A;  3OPH A;  5CGX A;  5CED A;  4X68 A;  3MXR A;  3HLF A;  1BLC A;  5FQI A;  2Y2G A;  2Y2O A;  2R9W A;  4JKT A;  3IXB A;  4IVK A;  3UDX A;  5HAP A;  2EX8 A;  3M2K A;  5FQQ A;  3UY6 A;  4DXC A;  4LV3 A;  2EXA A;  1N9B A;  5F1F A;  3BEB A;  1Z6F A;  5E43 A;  5AQ9 A;  4B4Z A;  1EWZ A;  3FZC A;  3O3V A;  4OPR A;  1FSW A;  3Q7V B;  5FAQ A;  3ZG8 B;  1ONG A;  2I72 A;  3SH8 A;  5FAS A;  3LY3 A;  1K54 C;  3M2J A;  4DDY A;  4JPM A;  3RJU A;  2V20 A;  3IHB A;  3V50 A;  2X01 A;  3PBN A;  1K6R A;  2ZQD A;  5CER A;  5CGS A;  3WS2 A;  4DE1 A;  1RGZ A;  4UA7 A;  1PW8 A;  3ZNT A;  3ZDJ A;  1WE4 A;  3NI9 A;  3VOZ A;  3A3I A;  3UE0 A;  4X69 A;  1YLW A;  3ISG A;  3N8R A;  4OP8 A;  5JYO A;  2H0Y A;  2XH9 A;  1XGI A;  1SDE A;  1L0D A;  1CI9 A;  2ZC3 B;  1IYQ A;  3PAG A;  4UHU A;  1VQQ A;  1PI4 A;  3V5M A;  2G2U A;  1KVL A;  3IF6 B;  3Q7V A;  4EV4 A;  4WBG A;  2V2F F;  2B5R A;  4B88 A;  4JF5 A;  4S2M A;  2H5S A;  1ONH A;  3NDE A;  1YQS A;  4Z9Q A;  3HLB A;  2Y91 A;  4HES A;  1MPL A;  3C7V A;  3G35 A;  4CPK A;  1ZG6 A;  4B4X A;  4L0L A;  3MZD A;  1ES3 A;  4QY5 A;  3TSG A;  1C3B A;  3MZF A;  5GLA A;  5GHX A;  3BM6 A;  4DE0 A;  4WZ5 A;  3S22 A;  5EOO A;  1GHM A;  1KDW A;  4BD0 A;  3ZCZ A;  3LO7 A;  1GA0 A;  3DWZ A;  4RVA A;  1O07 A;  4E3L A;  2Q9N A;  4KZ7 A;  3Q81 A;  3S4X A;  1PW1 A;  2WGW B;  4HEF A;  4RX3 A;  3WS4 A;  2JE5 A;  1VM1 A;  4YFM A;  3IF6 A;  2RCX A;  1N4O A;  3Q82 A;  2WUQ A;  3HUO A;  1NXY A;  4ZBE A;  5E2G A;  1K4F A;  2XD1 A;  4M3K A;  4GB7 A;  4DDS A;  4OOL A;  1K6S A;  2PU2 A;  4N1X A;  4UA6 A;  1G6A A;  1ERQ A;  1XKZ A;  3DWK A;  2BG1 A;  1M40 A;  4OPQ A;  5GL9 A;  5M1A A;  3UNW A;  2ZQ8 A;  3MXS A;  5M18 A;  5EE8 A;  1PZO A;  3IH8 A;  1CEF A;  2PU4 A;  3PTE A;  5EVI C;  3Q7Z A;  5F83 A;  1LLB A;  1FSY A;  3OCN A;  3NY4 A;  4KZ5 A;  2PBY A;  4S2J A;  2OLU A;  5L2F A;  3UDI A;  4ZDX A;  1KVM A;  1MXO A;  4XUX A;  4BEN A;  2EFU A;  1PWD A;  2WGW A;  2XFT A;  3E2K A;  1XP4 A;  4UA9 A;  5E2H A;  1FR1 A;  1PWG A;  1IKG A;  2ZM0 A;  4RYE A;  2Y55 A;  4KG2 A;  1HD8 A;  2Y2Q A;  1KE3 A;  4HBU A;  5E2E A;  4WM9 A;  1ES2 A;  1FCM A;  5FDH A;  2G2W A;  1NYY A;  5EEC A;  2OSU A;  1K56 A;  2H0T A;  2Z2M B;  1YMS A;  5DF9 A;  2C5W B;  5FQJ A;  1DJC A;  3UN7 A;  4IBR A;  1CK3 A;  1I2W A;  3SOI A;  1E3U A;  3OPL A;  2XDM A;  4KZB A;  4U3T A;  1LI0 A;  3V3R A;  3BFC A;  5DVA A;  3MFD A;  1MWU A;  2HDR A;  5EOE A;  4E6W A;  1MWT A;  3GR2 A;  4S2K A;  1XGJ A;  5A91 A;  5IHV A;  2Y2N A;  4YIN A;  4GDB A;  2EX9 A;  3NBL A;  2VGK A;  3W4O A;  3ITA A;  5HAQ A;  4ID4 A;  2J9O A;  3MKE A;  4WEL A;  5A93 A;  4EBP A;  4C6Y A;  3DW0 A;  1FOF A;  3NC8 A;  3LCE A;  1TDL A;  3PBQ A;  5BOH A;  2UWX A;  3VP4 A;  5FQM A;  4WZ5 C;  3BRM A;  5KZH A;  4KZA A;  1GHP A;  1IYO A;  1JVJ A;  3GV9 A;  5FQK A;  5FQ9 A;  4DE2 A;  1W8Y A;  2Y2K A;  1FR6 A;  3PBR A;  2J9P A;  2WKE A;  3IF6 C;  2RL3 A;  3A3E A;  5F82 A;  4EBN A;  4QY6 A;  4ZJ3 A;  1YLP A;  2EFX A;  3A3F A;  1W5D A;  2R9X A;  2WZZ A;  3P98 A;  4NK3 A;  3IWO A;  3VFF A;  3FKW A;  3BLM A;  3LY4 A;  5CHM A;  3C4P A;  3OC2 A;  4PM8 A;  1BZA A;  4E3M A;  2ZLY A;  3AGF A;  3AGD A;  3QNC A;  3G2Z A;  4QU3 A;  3ZVT A;  4U0T A;  4WEJ A;  1H8Y A;  4GN2 A;  4X55 A;  3W4Q A;  1DY6 A;  3PAE A;  3A3D A;  4KG5 A;  4LV2 A;  2ZMA A;  3BLS A;  5HL1 A;  1Q2Q A;  4Y7P A;  1MY8 A;  3IXG A;  3IWQ A;  4BJP A;  4S2I A;  4JBF A;  1SKF A;  3SH9 A;  4JXV A;  4EUZ A;  3ZVW A;  3VP2 A;  5HX9 A;  3NDG A;  3IXD A;  3WS0 A;  2WGI A;  5F1G A;  1L0F A;  1PIO A;  4KZ4 A;  4JXW A;  4K0W A;  1KGG A;  4P85 A;  1JTG A;  3UE1 A;  4NET A;  1QMF A;  4H8R A;  4BD1 A;  1LHY A;  2ZC4 B;  2JBF A;  1TVF A;  3IWI A;  3VP3 A;  1BLP A;  1K57 A;  1L0E A;  1SHV A;  1KGF A;  1GCE A;  4K91 A;  3VP1 A;  3IF5 A;  4QD4 A;  2J7V A;  3D4F A;  3V3S A;  4WEK A;  2HP5 A;  2XK1 A;  3GQZ A;  3OCL A;  4OQH A;  3G32 A;  3OPP A;  1K25 A;  4UAA A;  3RXW A;  4X53 A;  4LV0 A;  2Y4A A;  4OLD A;  5D3O A;  4ZAM A;  2ZC6 B;  5CTN A;  4E3J A;  3IHA A;  4QJG A;  3E2L A;  3FYZ A;  4OVD A;  5CGW A;  4ZTK A;  1NY0 A;  4OPZ A;  4GZB A;  5U47 A;  3VP0 A;  1EI5 A;  3ZHH A;  3BFE A;  1W7F A;  5A92 A;  3FKV A;  1BT5 A;  1NJ4 A;  3N8S A;  1S6R A;  3OPR A;  3UDF A;  4OON A;  5G18 A;  1YLT A;  4R4S A;  4JF4 A;  1I5Q A;  1SCW A;  4FCF A;  1BLS A;  2Y2L A;  1LI9 A;  4JF6 A;  3HLG A;  3FWL A;  3ITB A;  4IED A;  2Y2I A;  5FI7 A;  4CJN A;  1NZU A;  3G2Y A;  1E4D A;  4Q8I A;  2ZQC A;  4RX2 A;  2WAF A;  2ZC7 A;  5CHU A;  4WYY A;  4X6T A;  4A5R A;  2ZC5 B;  4E3N A;  5GLB A;  4XUZ A;  5AQA A;  4OOM A;  2WZX A;  4KQQ A;  4S2O A;  2WK0 A;  1I2S A;  1YLY A;  3VFH A;  3HRE A;  4S2N A;  3UE3 A;  1ERM A;  1RP5 A;  1XPB A;  2P9V B;  5TFQ A;  4OQI A;  4OQ0 A;  5GLC A;  3C7U A;  3SS4 A;  2GDN A;  1ESU A;  1HZO A;  2DCF A;  2X71 A;  4WMC D;  3CMZ A;  2QPN A;  4PM7 A;  2WYX A;  4LEN A;  3UO9 A;  4P0M A;  3N4I A;  4P87 A;  2XD5 A;  1IYS A;  3BFG A;  3HLW A;  2Y2J A;  5J8X A;  1IEM A;  2JC7 A;  4MBF A;  4RA7 A;  4D2O A;  4WMC A;  1E25 A;  1FCO A;  3N8L A;  5HFO A;  1IKI A;  1NZO A;  4R0Q A;  1G68 A;  4LCL A;  3WRT A;  1ZC2 A;  1BLH A;  2XFS A;  3QHY A;  5EVL A;  4C75 A;  1WYC A;  1RCJ A;  1S0W A;  2XLN A;  1AXB A;  2FFF B;  3WWX A;  1Y54 A;  2Y2M A;  3VOY A;  2WGV A;  5KMW A;  2QMI A;  3SS3 A;  3GMW A;  4BL2 A;  2ZM2 A;  3MZE A;  5EVI B;  4ZJ2 A;  2P9V A;  2VGJ A;  5EUA A;  3ZG9 B;  2WKI A;  1ES4 A;  1FQG A;  3ZG5 A;  2OLV A;  3QNB A;  1YM1 A;  3HVF A;  4R3J A;  4WZ4 A;  3WS5 A;  1JWV A;  3PBT A;  4ZJ1 A;  1K55 A;  2ZD8 A;  2HDQ A;  3P09 A;  4Y0O A;  3G4P A;  4F94 A;  1IEL A;  2A3U A;  3N7W A;  3BFD A;  2HP9 A;  3CJM A;  2EX6 A;  3I7J A;  4QB8 A;  4BL3 A;  3VMA A;  4GD8 A;  2C6W B;  3IXH A;  2IWB A;  5KSC A;  1JWP A;  5EVI D;  4MBK A;  2WAE A;  1MKI A;  2XGN A;  3GRJ A;  1MWS A;  1BSG A;  4FD8 A;  3W8K A;  1XX2 A;  3CG5 A;  3S1Y A;  5DF8 A;  5CRF A;  5DTS A;  5EVI A;  2ZQ7 A;  5GHZ A;  3GTC A;  1PYY A;  5HAI A;  4LV1 A;  4S2L A;  3NCK A;  5AQ7 A;  1U60 A;  1NYM A;  4C3Q A;  1XA7 A;  5KSH A;  3MBZ A;  4MNR A;  4E3K A;  1W79 A;  4DXB A;  4XXR A;  4EBL A;  5CTM A;  1BTL A;  5FI2 A;  3C5A A;  4JXG A;  4KG6 A;  2J8Y A;  3HUM A;  3Q1F A;  3WS1 A;  1J9M A;  1KE0 A;  1K38 A;  1QME A;  4S2N C;  2ZM8 A;  5GHY A;  2A49 A;  4PM6 A;  1HTZ A;  4S2P A;  5DF7 A;  1ALQ A;  2Y2H A;  2OV5 A;  3ZNY A;  1M6K A;  2EX2 A;  2JCH A;  3IT9 A;  4IVI A;  4JLF A;  4E3O A;  5A90 A;  1YT4 A;  1CEG A;  4PPR A;  1WYB A;  5CEB A;  1ERO A;  1GHI A;  3FV7 A;  3SH7 A;  4GDN A;  3W4P A;  3AGE A;  1K4E A;  5CHJ A;  1JWZ A;  3G30 A;  4DRT A;  4OQG A;  1ESI A;  5FAT A;  3SS5 A;  3HBR A;  5FAP A;  3Q07 A;  3IH9 A;  1PZP A;  2WAD A;  3M6H A;  2DRW A;  5M19 A;  4Y0U A;  3TG9 A;  1SDN A;  4EWF A;  1OME A;  5E2F A;  5CEC A;  2CC1 A;  2IWD A;  1GA9 A;  4PM9 A;  1H8Z A;  1YLJ A;  1YLZ A;  2DNS A;  3EQU A;  5TGF A;  2Z2L B;  4R1G A;  1TDG A;  4LCM A;  4OLG A;  4FH2 A;  4MEZ A;  2HDS A;  4KZ6 A;  4JXS A;  3N6I A;  4N9K A;  3OZH A;  4KEN B;  4KZ8 A;  1FCN A;  2XF3 A;  1YMX A;  5EPH A;  4KZ3 A;  1BUE A;  4X56 A;  5TR7 A;  2Q9M A;  3WRZ A;  3BFF A;  3G31 A;  5DTK A;  3BEC A;  3GSG A;  1ZG4 A;  2ZJ9 A;  1CI8 A;  3O87 A;  1K55 C;  3UPP A;  1KGE A;  2ZQ9 A;  1K54 A;  1HVB A;  4E6X A;  5I94 A;  3HLE A;  1MWR A;  1MBL A;  4DE3 A;  1L0G A;  2HDU A;  4R23 A;  3JYI A;  4U0X A;  1IYP A;  3LEZ A;  3HUN A;  1RGY A;  1ZKJ A;  1NRF A;  4OH0 A;  1DJA A;  4PM5 A;  4FSF A;  1BUL A;  1XA1 A;  3HLD A;  5FI6 A;  3VSK A;  3DTM A;  2P74 A;  2V1Z A;  3NIA A;  4R4R A;  1H5X A;  3PBO A;  5JYP A;  4HBT A;  4N9L A;  4P6B A;  2QZ6 A;  3A3J A;  2BLS A;  4GD6 A;  3ZG7 B;  1KE4 A;  1TEM A;  4KQO A;  2X02 A;  2XR0 A;  3UPO A;  4OPY A;  1LL5 A;  4E3I A;  2WKH A;  5HW3 A;  2Y59 A;  4GKU A;  3GVB A;  3MKF A;  5CXW A;  1Q2P A;  4K0X A;  4MLL A;  2EXB A;  3ZGA B;  3O86 A;  1JTD A;  1PWC A;  1PI5 A;  2E8I A;  4DKI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...