4F94A

Structure of the class d beta-lactamase oxa-24 k84d in acyl-enzyme complex with oxacillin
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
245
structure length
245
Chain Sequence
MHISSQQHEKAIKSYFDEAQTQGVIIIKEGKNLSTYGNALARANKEYVPASTFDMLNALIGLENHKATTNEIFKWDGKKRTYPMWEKDMTLGEAMALSAVPVYQELARRTGLELMQKEVKRVNFGNTNIGTQVDNFWLVGPLKITPVQEVNFADDLAHNRLPFKLETQEEVKKMLLIKEVNGSKIYAKSGWGMGVTPQVGWLTGWVEQANGKKIPFSLNLEMKEGMSGSIRNEITYKSLENLGII
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/antibiotic
molecule keywords Beta-lactamase
publication title Structure of the Class D Beta-Lactamase OXA-24 K84D in Acyl-Enzyme Complex with Oxacillin
rcsb
source organism Acinetobacter baumannii
total genus 79
structure length 245
sequence length 245
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2012-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00905 Transpeptidase Penicillin binding protein transpeptidase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 4f94A00
4KZ7A 1YLJA 2QMIA 1SKFA 2BLSA 4N92A 4E6WA 4EUZA 2H0TA 3N8LA 1WE4A 4UHUA 1E3UD 4KZ3A 1GHIA 1ONGA 3PBNA 4FCFA 2WAEA 1M6KA 1VM1A 3UE0A 4DF6A 1PI5A 3AGEA 1KDSA 4OLDA 4WZ4A 4PM8A 3ZG8B 1XP4A 5AQBA 2XQZA 5EOOA 4OH0A 4R23A 2G2WA 3A3DA 4WEKA 2X71A 1DJAA 1BLSA 1XGJA 1K56A 2V2FF 4GD8A 3BEBA 2PU2A 1OMEA 5CECA 1PZPA 3HLFA 1L0DA 5FATA 1S0WA 4OQ0A 2P9VB 1GCEA 4C75A 4LCMA 1W7FA 3RXWA 1PWCA 1IYOA 1YT4A 2WAFA 2HP5A 3A3EA 4N9LA 4KZ9A 4LENA 4B88A 3GV9A 4DRTA 3M2JA 4ZJ3A 1PW1A 3S1YA 1K57C 1IELA 1RP5A 2J9OA 5DF9A 1PWDA 3TG9A 4CPKA 3G2ZA 3TOIA 4OPRA 3UE1A 3VMAA 1JTGA 1SCWA 4ZBEA 4U0TA 2HDSA 4BL3A 2FFYA 3HLCA 3VP2A 4WYYA 1W79A 3VSKA 4WEJA 3S4XA 1GHPA 1TDGA 3MKEA 1MXOA 1KE0A 4OVDA 4E6XA 5M18A 1FCMA 3O86A 4O7DA 3W4OA 2RCXA 3RJUA 4OQGA 5HW3A 3ZFZA 1NYYA 4C3QA 3MXSA 4DE2A 2ZC5B 2QZ6A 1IEMA 5L2FA 2ZC7A 2EX2A 5FAQA 3VOYA 4EWFA 1ZC2A 3PBTA 3QNBA 5TGFA 2Y2HA 2JE5A 1NY0A 1O07A 2ZM0A 3C4OA 2Z2MB 3IHBA 2ZC6B 1MY8A 3NDEA 1XA7A 2Y2MA 4OKPA 3PTEA 3A3FA 2P9VA 4P85A 1BLPA 4IEDA 4P0MA 5A91A 5KSHA 1M40A 2IWDA 2WYXA 3IF6C 3N6IA 2H10A 1TDLA 4GDNA 3VSLA 4Y0TA 3HREA 2J7VA 2DNSA 1K55A 2RL3A 3FKVA 5JYOA 4OOYA 1RCJA 3HLBA 1CEFA 4MNRA 4RVAA 3SS5A 4S2NC 4JBFA 4RX3A 1Y54A 4BLMA 2IWCA 3O88A 3MZFA 4X68A 4NK3A 5DF7A 4DXCA 2JC7A 2WKEA 1YMSA 4DE1A 4M3KA 4D2OA 4KZ6A 4PM6A 5BOHA 5F1GA 1CK3A 4KZAA 4CJNA 3IXHA 2Y2JA 3HLGA 5AQ9A 1IYSA 5CHUA 3DWKA 3N8SA 4JF5A 3V39A 2C6WB 4KQRA 5TR7A 4LV2A 4ZDXA 2GDNA 2EX9A 1XGIA 5E2EA 1JTDA 3IXGA 4WZ5A 3ZNTA 2ZD8A 1XA1A 3SH9A 1CI8A 4RYEA 1BSGA 2ZM2A 1BUEA 5DF8A 4UA6A 4E3NA 1KVMA 3GRJA 1ESUA 2Y2NA 3LO7A 1Q2PA 4R3JA 5EVIC 5A92A 3IXBA 4R4RA 4GD6A 4JLFA 3SH8A 1H5XA 5CHMA 1FR6A 5EVID 3E2KA 2OLUA 1IYQA 2J9PA 2XR0A 1MKIA 3VP3A 1W8YA 2XFTA 3ZHHA 4A5RA 1BLHA 1LI0A 4R3BA 5FQKA 1HTZA 4PM5A 1LLBA 3OCLA 3WS2A 1NZUA 5FQJA 1RGYA 2OSUA 4B4XA 4QJGA 4OP5A 4IVIA 4OQIA 4RA7A 2H5SA 3HUNA 2JCHA 4JF6A 4KQQA 1PWGA 4S2OA 2C5WB 5GLDA 3G34A 4GOGA 2HDRA 1KE3A 2Q9NA 2WK0A 1KGGA 3QHYA 3HUMA 3HLEA 3Q7VB 3ZG9B 4DE3A 3N4IA 4NETA 4R0QA 3UN7A 3VP1A 2Y4AA 3VFHA 2WGVA 3C7VA 3Q07A 4U3TA 3HLWA 2Y2PA 3QNCA 1HD8A 5HAPA 2PBYA 3EQVA 2XDMA 1DJBA 2Q9MA 2XFSA 2ZLYA 3GVBA 1NRFA 3UPOA 2HDQA 2ZM8A 2WUQA 2QPNA 3FV7A 4GDBA 4F94A 3NIAA 3IWOA 1H8ZA 3BECA 1W8QA 3BYDA 5HFOA 5FI7A 3IH9A 1K6SA 2X01A 4KG6A 2Y2IA 4X6TA 3AGFA 5CTMA 4ZAMA 5JYPA 4FSFA 1O7EA 1K56D 2ZJ9A 4ID4A 1IKGA 2XK1A 1N9BA 1EI5A 3W8KA 4KZ8A 4MBKA 1K54A 1KGFA 3GQZA 4QY5A 4P87A 2ZQ8A 1SDEA 4OONA 3UDIA 3Q7VA 4HESA 3PBOA 1YLTA 4KZ5A 3MZDA 3LY4A 5CERA 3ZCZA 3BFDA 1DJCA 3DWZA 3ITBA 1IKIA 3FKWA 1ESIA 1FCOA 3O87A 5AQAA 3IWIA 3V5MA 1BLCA 1BZAA 1YM1A 2H0YA 3CJMA 1L0EA 5HAQA 4EQIA 3GTCA 3V3RA 3C7UA 3CZDA 5HAIA 5CEBA 3SH7A 3PAGA 5GL9A 2R9XA 1YLYA 4UA9A 1MWSA 1W5DA 4LV3A 5EUAA 1MWUA 5DTSA 4BL2A 4FH4A 1Z6FA 4XUXA 1K4EA 3HBRA 4MBHA 4P6BA 5FASA 5I94A 4EV4A 1TVFA 5J8XA 2ZQDA 2ZQCA 1I5QA 3BFGA 3EQUA 4JXVA 3DTMA 4X56A 3SOIA 4DKIA 3DW0A 5U47A 1WYBA 2G2UA 1ONHA 3C5AA 4E3MA 3PBSA 3BFFA 4DXBA 5A93A 2CC1A 1QMFA 1I2WA 5KSCA 2I72A 5EVLA 3LCEA 1AXBA 2Y2LA 1ERQA 4R4SA 4B4ZA 1FOFA 1YLZA 1GHMA 3ZG5A 4JF4A 4X55A 5G18A 1FCNA 4X69A 1CEGA 2Y55A 4S2KA 1YLWA 4UAAA 3GR2A 1CI9A 3OCNA 2EXBA 4HBUA 2DCFA 1K6RA 4BENA 1K4FA 1WYCA 2Y2OA 1K55C 5E2FA 4GZBA 4S2PA 3B3XA 5GLAA 2OV5A 4MEZA 1BULA 2X02A 5DTKA 3FYZA 5EECA 2J8YA 1EWZA 4JKTA 4KG5A 3NCKA 1NYMA 2V20A 3BFCA 4IVKA 3IHAA 3BRMA 3I7JA 3HLDA 3SS3A 4H8RA 1E4DA 3NI9A 4KZ4A 3W4PA 3FZCA 4S2MA 1NZOA 3ZVTA 4OLGA 2ZMAA 4K91A 3NC8A 3WS4A 3UE3A 1JWVA 1L0FA 1XPBA 3RXXA 3UDXA 4DDSA 1HZOA 3P09A 5CEDA 2HPBA 3HVFA 3OZHA 5E2HA 2Z2LB 3C4PA 4K0WA 1ERMA 3M6BA 3PAEA 4WZ5C 3ZGAB 1BTLA 5F83A 2EX8A 2XD5A 4OOLA 2B5RA 4E3JA 3IWQA 3BM6A 3N7WA 3O3VA 4U0XA 3UY6A 5CRFA 5DVAA 2HP6A 2WZZA 3PBRA 1MPLA 4BD0A 5A90A 4EBLA 2Y59A 5FQMA 1LL9A 5HARA 2XD1A 4S2JA 1MBLA 4MBFA 4N1HA 2ZQ7A 2PU4A 4E3KA 3N8RA 3M2KA 4WM9A 1N4OA 4YFMA 1YMXA 4MLLA 5FSRA 3ZG7B 3PBQA 5FQQA 2ZC4B 1I2SA 4N9KA 4KG2A 3G35A 3IXDA 2A49A 3BLMA 5FI2A 5GHZA 4BD1A 3MFDA 4E3OA 4FD8A 1L0GA 4K0XA 1KDWA 3WRTA 1H8YA 1QMEA 4FH2A 4YINA 4EBNA 1PW8A 4Y0UA 4E3LA 3UNWA 4PMAA 2OLVA 3IF6B 3UPPA 4Y0OA 3G30A 3ISGA 2VGJA 3G4PA 4GB7A 1YLPA 2HP9A 3OC2A 5CHJA 5AQ7A 3NDGA 1K57A 1PYYA 2Y2QA 1YQSA 3OPPA 5DTTA 4E3IA 1U60A 3D4FA 3CG5A 1C3BA 3G32A 4QD4A 5FQIA 5M1AA 3SS4A 4WELA 1ZKJA 2EFUA 1PIOA 2BG1A 4LCLA 5M19A 3MBZA 1PI4A 5FA7A 5GHXA 5EE8A 3LEZA 4BJPA 2WGIA 2VGKA 2Y2GA 4EBPA 3ZG0A 3S22A 5GHYA 5KMWA 3G31A 4JXSA 4ZTKA 5FAOA 4QU3A 3UPNA 3WWXA 2WKIA 3WRZA 3V3SA 2E8IA 1XX2A 3IT9A 5CGSA 5F1FA 1KGEA 3GMWA 1ZG6A 5HX9A 4Z9QA 1FR1A 4L0LA 2P74A 3FWLA 3G2YA 3ZVWA 4GKUA 4DDYA 4Q8IA 5CTNA 5KZHA 5E2GA 3VP0A 3MKFA 3GSGA 1JWPA 4XUZA 4R1GA 2XH9A 1E25A 3IF6A 3A3JA 2HDUA 3P98A 2IWBA 1K54C 5EVIB 1BT5A 5FDHA 4C6YA 1SHVA 4OP8A 1K25A 4ZJ1A 2ZC3B 1DY6A 4WMCA 4S2LA 2V1ZA 2XGNA 4S2NA 3ITAA 4KZBA 2WADA 4X53A 1LL5A 3OPRA 3WS5A 3JYIA 4GNUA 2ZQAA 1FQGA 4QHCA 2WGWB 2XEPA 1ES2A 3HL9A 4Y7PA 2JBFA 4JPMA 2R9WA 1ZG4A 4PM9A 2EFXA 5FAPA 1PZOA 1ALQA 3LY3A 4BQMA 4IBRA 1L2SA 4QY6A 5FQ9A 5IHVA 3V50A 4HEFA 1ES4A 3OPHA 4QB8A 5GLCA 2ZQ9A 1FSYA 3OPLA 3IH8A 1G6AA 1NJ4A 3IQAA 5D3OA 3UO9A 4JXGA 5TFQA 4WMCD 4JXWA 1NXYA 4PM7A 1Q2QA 2XF3A 1EROA 3TSGA 2UWXA 4LV1A 3UDFA 1MWTA 1G68A 2WKHA 3WS0A 4XXRA 2DRWA 5EOEA 1RGZA 5CGWA 1KVLA 4UA7A 4OPYA 2Y2KA 1KE4A 4IBXA 1SDNA 1MWRA 1S6RA 2EX6A 5EVIA 3Q1FA 1HVBA 4KQOA 5GLBA 3M6HA 1LHYA 4HBTA 3NY4A 2Y91A 3IF5A 2EXAA 5E43A 4KENB 5CXWA 4S2IA 1LI9A 3WS1A 3ZNYA 5HL1A 3Q7ZA 1XXMA 3BFEA 4OOMA 4OPZA 4N1XA 1JVJA 2WGWA 2XLNA 3MXRA 1IYPA 1JWZA 3W4QA 1XKZA 5F82A 1GA9A 1E3UA 3Q82A 1FSWA 5EPHA 5CGXA 3VOZA 1GA0A 1ES5A 3CMZA 3ZDJA 3VP4A 3A3IA 4ZJ2A 4LV0A 2FFFB 1TEMA 4DE0A 2A3UA 4OPQA 3E2LA 3BLSA 3AGDA 3MZEA 3HUOA 1VQQA 2WZXA 4RX2A 4GN2A 4OQHA 5FI6A 3Q81A 1J9MA 4WBGA 3VFFA 1ES3A 1K38A 3NBLA 4PPRA
chains in the Genus database with same CATH superfamily
1YLJA 4IUKA 4UHUA 1GHIA 2WAEA 4OLDA 3AGEA 1KDSA 4WZ4A 1DP9A 5EOOA 4L9GA 3A3DA 1XGJA 5FATA 4EU0A 3KYQA 1OTBA 1GCEA 4C75A 1W7FA 3C38A 5HPIA 4N9LA 1S1YA 3GV9A 4DRTA 3M2JA 1PW1A 1H3QA 1RP5A 1PWDA 2PBDP 2WKRA 3MQ0A 3UE1A 1JTGA 1SCWA 4BL3A 3VP2A 4WEJA 3S4XA 1GHPA 3MKEA 4OVDA 5M18A 3L9KA 3E4PA 3O86A 3LUQA 5HWVA 2VGLS 4C3QA 2O0YA 2ZC5B 4LPZA 5L2FA 4CLCC 2EX2A 4IHQA 4EWFA 4CLCD 2ZC6B 2Y2MA 1IFQA 3A3FA 2XSSA 4IEDA 2I9VA 2IWDA 3IF6C 2WKPA 3C8CA 3FKVA 3IS2B 1RCJA 3HLBA 4HH2A 4S2NC 4JBFA 1Y54A 4HOIA 4BLMA 4NKPA 2LB5A 4O0PA 4L9FA 2YKFA 2EWVA 3V39A 5TR7A 4LV2A 3EEAA 1XGIA 3IXGA 4WZ5A 5IT5A 1D06A 1D7EA 3CAXA 4I39A 5DF8A 3GRJA 2Y2NA 5EVIC 3IXBA 3SH8A 2GX5A 2JKTM 1H5XA 5EVID 4CPKA 3VP3A 1BLHA 1HTZA 4ETZA 3OCLA 5DFXA 4B4XA 4OP5A 4RA7A 3HUNA 1PWGA 4WF0A 2J80A 1Z09A 3G34A 3QHYA 3DTKA 3Q7VB 3BY9A 2ZOIA 3IBRA 3VP1A 1H0MA 2Y4AA 3VFHA 4Q0HA 2WGVA 3K3CA 4Y3IA 3QNCA 4R3AA 1KOUA 3LIFA 2PT7A 3KYZA 1NLYA 2W1TB 2ZM8A 3IWOA 2ZMFA 2PD7A 5HFOA 2A2LA 2W3HA 4I5SA 1S67L 4ZAMA 1K56D 4II7A 1IKGA 1N9BA 3LR5A 1SDEA 3Q7VA 3MZDA 5CERA 4MDZA 3BFDA 4HI4A 5HZHA 3FKWA 1ESIA 2W0NA 1BZAA 1L0EA 4EQIA 1YLYA 4UA9A 3TW8A 1W5DA 5EUAA 2W1TA 4P6BA 1DRMA 4O8GA 4EV4A 1XFQA 3DW0A 2PR5A 3S7QA 4E3MA 4PKYA 3PBSA 4GHIB 1QMFA 2VZWA 1YLZA 3FC7A 2WKQA 5G18A 4X69A 1CEGA 4S2KA 1CI9A 1K6RA 5TBMB 3BJNA 3NCKA 3R4KA 1NYMA 3CITA 3IHAA 1X0OA 3D3OA 3HLDA 4H8RA 1OTDA 3FZCA 2V8CA 2P08A 3UE3A 2KDKA 1JWVA 1L0FA 4DDSA 5CEDA 1J3WA 1Y4OA 1N9NA 3OLOA 1BTLA 2JKRI 2EX8A 2XD5A 2B5RA 3G6OA 3N7WA 5C5KA 3UY6A 5F68A 1MPLA 4HNBA 2Y59A 5EFWA 3LICA 5HARA 2XD1A 4MBFA 5TBMA 2ZQ7A 2PU4A 2OOLA 3ZYTA 1N4OA 1YMXA 3BWLA 4N9KA 2W3EA 3G35A 4CLCB 5AVEA 4FD8A 2Q0OA 3K3DA 3WRTA 1OT9A 3UNWA 1F2KA 2VJWA 2KX6A 3IF6B 3UPPA 3ISGA 3UB6A 2O9AA 5AQ7A 3OPPA 3P01A 2XROA 5M1AA 1ZKJA 4CQHA 1PI4A 5GHXA 4GLQA 4BJPA 5KIZA 2HV1A 3A0SA 4EBPA 3ZG0A 3CPTB 2VA0A 5KMWA 3G31A 4JXSA 5CGSA 4CLCA 1ZG6A 2VLGA 2B95A 5A8BA 4X1LA 5CTNA 3CUEC 3IF6A 3UB7A 5EVIB 3IX8A 4EW7A 4S2NA 3B33A 3ITAA 4KZBA 3OPRA 3FPVA 3WS5A 1F5MA 2WGWB 3HL9A 4LRYC 4PM9A 2P04A 3ZQ5A 3LY3A 4M4XA 3GDIA 1NRJA 1TF1A 5TFQA 4WMCD 4JXWA 1SKOB 2VV8A 1EROA 1PNEA 3TSGA 4LV1A 3UDFA 1MWTA 5EOEA 3D9YA 4IBXA 4EETB 5EVIA 3DTEA 4KQOA 4HBTA 2V1AA 2Y91A 5E43A 5CXWA 4S2IA 1LI9A 3ZNYA 3Q7ZA 4B93A 4N1XA 3NECA 2WGWA 3MXRA 3T4OA 1XKZA 5F82A 4KQDA 5AJGA 4HJ3A 4LV0A 1SZVA 4OPQA 3AGDA 2WZXA 1SKOA 4DN0A 1J9MA 4GJ4A 3SW1A 3VFFA 1XJ2A 1VETB 1OT6A 4N92A 2H0TA 2UV0E 3E98A 2VK3A 4KZ3A 1M6KA 2ZL1A 1VM1A 3UE0A 1XP4A 2W3FA 1TS7A 4R23A 2G2WA 1DJAA 1K56A 2V2FF 4HJ4A 1OMEA 1VEUB 2P9VB 1IOUA 5DJTA 4LCMA 3RXWA 3LIEA 1IYOA 2WAFA 4KZ9A 4LENA 4I38A 1LT0A 4ZJ3A 4EXOA 2PRFA 3S1YA 2J9OA 3KYEA 3IBJA 1VETA 2VV6A 2FFYA 1P9WA 5DKKA 1KE0A 2RCXA 3RJUA 4OQGA 5HW3A 4P6ZS 1NYYA 3MXSA 4I3IA 2QZ6A 1IEMA 2W3DA 3PBTA 3QNBA 1MY8A 1XA7A 4OKPA 1VEUA 4P85A 2P9VA 5KSHA 4Q0JA 2WYXA 3N6IA 2J7VA 2RL3A 1PRQA 4HY8A 5J3WA 5IU1A 2IWCA 3EGXC 4R6LA 4X68A 4NK3A 1LSWA 4D2OA 3LR3A 5F1GA 4KZAA 5J4EA 2Y2JA 3N8SA 4JF5A 5HWTA 2EX9A 5E2EA 4G3VA 2ZD8A 5HD5A 1BSGA 3T50A 2YKHA 4G3KA 3LO7A 4DJ3A 1FR6A 5J8XA 4I3JA 2XA7M 1IYQA 4A5RA 2XFTA 3ZHHA 3H9WA 2VEAA 5FQKA 3WS2A 4QJGA 4OQIA 2W3GA 4JF6A 4KQQA 4FUWA 1G6OA 1KE3A 1NWZA 1V9ZA 2WK0A 4EESA 1DP8A 1ODVA 3C7VA 3QP8A 1OTAA 4U3TA 5TJJA 2Y2PA 3LYXA 1HD8A 3LEQA 2OWJA 4HIAA 2PBYA 3EQVA 2Q9MA 2ZLYA 2XRNA 1NRFA 2HDQA 2BTFP 2WUQA 3NOPC 4GDBA 4F94A 3NIAA 1YSQA 4QWOA 3BECA 3BYDA 5FI7A 4Y15A 2Y2IA 4Y17A 3AGFA 5CTMA 5G4ZA 3LR0A 3UB5P 3V67A 3UMDA 1OJGA 2XK1A 3CUEA 3VE3A 3T1QB 2ZQ8A 1DP6A 4OONA 4KZ5A 1YLTA 3S7NA 3ZCZA 3LY4A 3U2AA 3DWZA 3ITBA 2M1CA 1YSPA 3IWIA 3EWKA 3V5MA 1BLCA 1YM1A 3KSHA 3GTCA 5GL9A 2IA2A 2GZAA 1MWUA 5DTSA 5AVFA 4FH4A 1XJ6A 1K4EA 3HBRA 3NULA 2AVXA 5I94A 2ZQCA 4X56A 3BFGA 3EQUA 3SOIA 3DTMA 5U47A 2G2UA 1ONHA 4CLCE 1UGUA 3BFFA 5A93A 2CC1A 1P97A 2INWA 5KSCA 2I72A 4UQIS 5EVLA 3MQQA 1ERQA 3NHQA 2V0WA 3D72A 3GR2A 3OCNA 4HBUA 2QJ7A 1K4FA 4HJ6A 4S2PA 3B3XA 5GLAA 4MEZA 3FYZA 4KG5A 2A24B 1E4DA 4OLGA 2ZMAA 2G7UA 4K91A 3IS2A 3RXXA 3UDXA 3ULFA 1HZOA 3IX4A 2HPBA 3OZHA 3K2NA 3M6BA 3PAEA 4BBTA 1VB6A 2PD8A 4E3JA 3IWQA 3O3VA 3EOIA 2HP6A 5A90A 4BD0A 5FQMA 1LL9A 2FH5A 3C2WA 3M2KA 5L09A 4DJ2A 2A49A 2A24A 1LL8A 4HH3A 4BD1A 3MFDA 5IS1A 3HJKA 4K0XA 1KDWA 1QMEA 3T4SA 2L4RA 2Z6CA 4E3LA 4PMAA 3KX0X 3QP5A 3G4PA 1YLPA 2Z6DA 2EWWA 3OC2A 2KLIA 3NDGA 4WUJA 3D4FA 3CG5A 4WN5A 3SS4A 4WELA 1K0KA 2JKGA 5M19A 4LCLA 3MBZA 4MN5A 1S1ZA 5EE8A 3C30A 3T12B 3VOLA 3WWXA 3V3SA 2J3WA 3IT9A 1KGEA 5HX9A 4R70A 4Z9QA 4MMNA 2P74A 3ZVWA 4DDYA 4Q8IA 3PXPA 3MKFA 1JWPA 3MF0A 1GSWA 2IWBA 3S7PA 3T4JA 4C6YA 1K25A 3DAVA 4NXEA 1DY6A 4S2LA 4JGRA 1ZHHB 2V1ZA 3JVUA 2XGNA 2WADA 2ZQAA 4QHCA 1ES2A 3OBFA 2EFXA 1PZOA 1ALQA 3JVVA 4UEYA 4HEFA 1ES4A 1HLUP 2ZQ9A 5HD3A 1FSYA 3IH8A 5D3OA 4JXGA 1NXYA 4PM7A 5L10A 2XF3A 3B42A 2UWXA 1T1BA 1G68A 2WKHA 3WS0A 4XXRA 2QHKA 4PKYG 3U4LP 4BBVA 2JKTI 3NY4A 4KENB 3T1SA 4GHIA 3BFEA 5FEFA 3ICYA 3T4TA 3E4OA 3Q82A 1FSWA 2JN7A 1GA0A 1FILA 3ZDJA 3A3IA 3CLOA 2VKSA 2FFFB 1T1AA 4GN2A 4OQHA 3BQAA 3A0RA 4FSFA 4PPRA 5CX7A 4EUZA 3EEHA 3UB8A 5HDSA 5EM0A 2PYRA 1E3UD 3F1PB 4DF6A 1PI5A 3ZG8B 4H6JB 4PM8A 2B02A 4DMZA 4OH0A 3R7WB 5HPFA 4GD8A 3BEBA 2PU2A 5CECA 4YNRA 1S0WA 1PWCA 3LIDA 1T1CA 2HP5A 3A3EA 4B88A 2BASA 1OJ5A 1K57C 2B18A 4HP9A 1L3LA 3TOIA 4OPRA 3VMAA 3L7HA 1TS8A 4JGQA 1JNUA 1W79A 4MN7A 4WLAA 3W4OA 4RQ9A 5G4YA 2PHYA 3ZFZA 4H6JA 2HZ5A 3R7WA 5FAQA 3VOYA 1ZC2A 5TGFA 2DMWA 2Y2HA 3C4OA 2Z2MB 3KSGA 4P0MA 1M40A 1TDLA 3VSLA 3CPTA 4Y0TA 1S4SA 3NJAA 1XFNA 4PHTA 4RVAA 4RX3A 3NOUC 3CHWP 2VX8A 3VV4A 4DXCA 2JC7A 4M3KA 3PR6A 4X1MA 4KZ6A 4PM6A 4X25A 4NXGA 1P9RA 3F1OB 3IXHA 5CHUA 3DWKA 3KSFA 1YKDA 4KQRA 4ZDXA 2GDNA 3DBAA 4R38A 1T19A 1XA1A 3LI8A 3SH9A 4EEPA 4EUVA 3SZTA 2ZM2A 1BYWA 4UA6A 4E3NA 2MJ6A 1ESUA 1OPXA 1Q2PA 4R3JA 5A92A 4R4RA 4ESPA 2CMNA 1TD5A 5CHMA 2OLUA 1F98A 1LI0A 1ACFA 4PM5A 1LLBA 2OSUA 4KUKA 1PFLA 2H5SA 2JCHA 4WL9A 4S2OA 2FZ0A 5GLDA 4GOGA 3F1OA 3BQ8A 3MQOA 3QP1A 1KGGA 4LRXC 3HUMA 3HLEA 3ZG9B 4DE3A 3N4IA 4HP4A 3UN7A 3LI9A 2D01A 3MXQA 3HLWA 5LBRA 5HAPA 2D02A 1CJFA 3S7OA 2V8FA 1DJBA 2XFSA 3GVBA 2QJ5A 2QPNA 1W8QA 4GS9B 3FPWA 2O9CA 2HJ9C 3IH9A 2X01A 4X6TA 1S4RA 4LRZE 2ZJ9A 3BW6A 3VE4A 3P7NA 1EI5A 1ZTUA 3EGDC 1KGFA 3GQZA 4QY5A 3BY8A 4P87A 3UMEA 3UDIA 4HQAA 2LB9A 4K08A 3O87A 3E4QA 3V3RA 3C7UA 5FDSA 3PAGA 3SH7A 2R9XA 5HDCA 1F9IA 4B9OA 4BL2A 3KSIA 3LGOA 4GS9A 2H28A 4DKIA 3H7WB 1WYBA 3C5AA 2HJEA 2KOIA 1I2WA 1AXBA 4R4SA 1FOFA 1A0KA 1YAXA 4JF4A 1FCNA 2Y55A 5DFYA 4BENA 1K55C 3O5YA 2OV5A 1EWZA 4MCWA 2V20A 3BFCA 4IVKA 4JGOA 3UE6A 3BRMA 3I7JA 2VGLM 3GECA 5I5LA 4S2MA 1NZOA 1TS0A 4QPRA 2O9BA 3NC8A 3H7WA 3B47A 3IX3A 5E2HA 2V0UA 4K0WA 3C4PA 1ERMA 5F83A 5CRFA 3PBRA 3MR0A 4EBLA 5L07A 1P0ZA 3RH8B 2JKFA 4S2JA 1MBLA 4N1HA 3N8RA 4WM9A 2EA9A 5FSRA 3A0VA 3PBQA 1W63Q 5FQQA 4EEUA 1I2SA 2Y8HA 4MN6A 3IXDA 5HWWA 5GHZA 3T1RA 4E3OA 4EERA 1L0GA 1H8YA 4FH2A 5K5BA 1PW8A 2OLVA 3CI6A 4GB7A 5DKLA 1K57A 1YQSA 5DTTA 4IJGA 1C3BA 3G32A 5EV0A 5FQIA 1PIOA 2BG1A 2OAP1 5FA7A 3T4KA 2WGIA 4F3LB 3NOTC 3FG8A 3S22A 1UWPX 4QU3A 2WKIA 3WRZA 2E8IA 1XX2A 3GMWA 1FR1A 4YWZA 4L0LA 3G2YA 5E2GA 3GSGA 4GW9A 4XUZA 2XH9A 1E25A 1K54C 5FDHA 1BT5A 1GSXA 4OP8A 2ZC3B 4WMCA 4ARZB 3PHYA 4X53A 3JYIA 4GNUA 1LSXA 1FQGA 2NUPC 2XA7S 5MC7A 2JBFA 4JPMA 1ZG4A 5FL3A 4F3LA 4BQMA 4IBRA 4QY6A 5FQ9A 5IHVA 3V50A 2J3TC 3OPHA 4QB8A 5F6AA 2J3TD 3OPLA 4EQ1A 2PDRA 4JGPA 4E04A 3UB9A 4ZRRA 1YPRA 4UA7A 4OPYA 2Y2KA 1SDNA 1MWRA 1S6RA 4G3WA 1OTIA 3Q1FA 1HVBA 5FEGA 4NG2A 4ARZA 3MS6A 2PYPA 5HL1A 1XXMA 4OPZA 1JVJA 2XLNA 1IYPA 1JWZA 3W4QA 1GA9A 3F1NB 2ZMVA 2QYBA 3LR4A 5EPHA 5CGXA 3MFXA 3OOVA 3VP4A 4ZJ2A 3E2LA 3RTYA 1WA9A 3HUOA 1VQQA 1S66L 1K38A 2JKRM 4KZ7A 2L0WA 2QMIA 1SKFA 2BLSA 4E6WA 3N8LA 1WE4A 4FCFA 1ONGA 3PBNA 5AQBA 1GSVA 2XQZA 4WEKA 2X71A 1BLSA 4XT2B 1PZPA 3HLFA 1L0DA 3F1NA 4OQ0A 1YT4A 2NUTC 3QP4A 2PAVP 3CWFA 3E0YA 1IELA 4Y5FA 4FOFA 5DF9A 3TG9A 3G2ZA 4BBUA 4ZBEA 4U0TA 2HDSA 3HLCA 1N9OA 4WYYA 3VSKA 1TDGA 1MXOA 4E6XA 1FCMA 4O7DA 1NLZA 4DE2A 2ZC7A 4KUOA 4XT2A 2JE5A 1NY0A 1O07A 2ZM0A 3IHBA 3NDEA 3PTEA 3MJQA 1BLPA 1D1JA 5A91A 4NEED 4GDNA 2H10A 3HREA 2DNSA 1K55A 5JYOA 4OOYA 5HSQA 1CEFA 4MNRA 3SS5A 3W2ZA 3O88A 3MZFA 5DF7A 2WKEA 1YMSA 4DE1A 2W27A 4LGWA 3JPUA 5BOHA 1CK3A 3LIBA 4CJNA 3HLGA 1VHMA 1IYSA 2OAQ1 5AQ9A 3T1XA 2ZOHA 1MZUA 2C6WB 3QP6A 1JTDA 3ZNTA 1CI8A 4RYEA 2V1BA 1BUEA 5HL6A 1KVMA 2K31A 4GD6A 4JLFA 2JHEA 3E2KA 2XR0A 1FIKA 2J9PA 2V9AA 1MKIA 1W8YA 2HGVA 4R3BA 4AFIA 1NZUA 5FQJA 1RGYA 4YOFA 4IVIA 3KO6A 3LFVA 2C5WB 1N9LA 2HDRA 2Q9NA 1T18A 3MSHA 4NETA 4R0QA 1TS6A 4BWIA 5L8MA 3Q07A 2Y79A 5EVEA 2XDMA 2QKPA 4I3AA 3UPOA 3FV7A 1H8ZA 1AWIA 4IUHA 1K6SA 1V9YA 4KG6A 2K2NA 2E8JA 5JYPA 1O7EA 4ID4A 2M7VA 3W8KA 4KZ8A 4MBKA 1K54A 4HESA 3F1PA 3PBOA 1DJCA 1IKIA 1FCOA 5AQAA 1XJ4A 3CJMA 2H0YA 5HAQA 1STZA 3CZDA 5HAIA 5CEBA 3PYPA 3H82B 2OWHA 2HF6A 1MWSA 5HDDA 4LV3A 2ACGA 1Z6FA 4XUXA 4MBHA 5FASA 1TVFA 2ZQDA 4JXVA 1I5QA 4PAUA 3TRCA 4DXBA 3LCEA 2Y2LA 4B4ZA 4Q0IA 1GHMA 3ZG5A 4X55A 4UAAA 1YLWA 2EXBA 5J7EA 2DCFA 1WYCA 2Y2OA 5E2FA 4GZBA 1BULA 2X02A 5DTKA 5EECA 2J8YA 4JKTA 1CQAA 1EW0A 3QP2A 4P6ZM 3H82A 3SS3A 3NI9A 4KZ4A 2GNXA 3W4PA 3ZVTA 3WS4A 1UWNX 2ZL1B 1XPBA 3P09A 3HVFA 2Z2LB 4WZ5C 3ZGAB 2W1RA 4LLOB 2VV7A 3HJIA 4OOLA 4U0XA 3BM6A 5DVAA 2WZZA 3RFBA 2PR6A 4E3KA 4YFMA 3ZG7B 4MLLA 2ZC4B 4KG2A 3BLMA 2ZBBA 5FI2A 2K7SA 4O01A 3T4QA 4NXBA 4YINA 3HCYA 4EBNA 4Y0UA 4Y0OA 3G30A 2VGJA 2HP9A 5CHJA 2GJ3A 2L1MA 2Y2QA 1PYYA 3T4LA 4E3IA 1U60A 2O99A 4QD4A 1CF0A 4D60A 2EFUA 1G28A 3LEZA 1OTEA 2VGKA 2Y2GA 5GHYA 4ZTKA 5FAOA 3UPNA 4Y2FA 4ETXA 4FTXA 5F1FA 5DJUA 1MKMA 2R78A 3FWLA 4GKUA 4BMWA 5KZHA 3VP0A 4R1GA 1LSVA 3A3JA 4LFUA 2HDUA 3P98A 1SHVA 4ZJ1A 3TJZC 2P7JA 4L9EA 1LL5A 1W63M 5F5YA 1H8MA 2XEPA 4Y7PA 2R9WA 5FAPA 1L2SA 2QWSA 1XJ3A 5GLCA 3MMHA 1G6AA 1NJ4A 3IQAA 3UO9A 5EM1A 1Q2QA 3TE8A 2DRWA 4NXFA 1RGZA 5CGWA 1KVLA 3LIAA 4HHDA 1KE4A 2EX6A 4Z1WA 5F69A 5GLBA 3M6HA 1Y28A 1LHYA 3IF5A 2EXAA 3DTIA 3WS1A 2M7UA 4OOMA 4Y13A 1E3UA 1G5UA 3VOZA 1ES5A 3CMZA 1TEMA 4DE0A 2A3UA 4UQIM 3BLSA 3MZEA 4ME4A 1MC0A 4RX2A 5FI6A 4GCZA 3Q81A 4WBGA 1ES3A 3NBLA
chains in the Genus database with same CATH topology
4KZ7A 1YLJA 2QMIA 1SKFA 2BLSA 4N92A 4E6WA 4EUZA 2H0TA 3N8LA 1WE4A 4UHUA 1E3UD 4KZ3A 1GHIA 1ONGA 3PBNA 4FCFA 2WAEA 1M6KA 1VM1A 3UE0A 4DF6A 1PI5A 3AGEA 1KDSA 4OLDA 4WZ4A 4PM8A 3ZG8B 1XP4A 5AQBA 2XQZA 5EOOA 4OH0A 4R23A 2G2WA 3A3DA 4WEKA 2X71A 1DJAA 1BLSA 1XGJA 1K56A 2V2FF 4GD8A 3BEBA 2PU2A 1OMEA 5CECA 1PZPA 3HLFA 1L0DA 5FATA 1S0WA 4OQ0A 2P9VB 1GCEA 4C75A 4LCMA 1W7FA 3RXWA 1PWCA 1IYOA 1YT4A 2WAFA 2HP5A 3A3EA 4N9LA 4KZ9A 4LENA 4B88A 3GV9A 4DRTA 3M2JA 4ZJ3A 1PW1A 3S1YA 1K57C 1IELA 1RP5A 2J9OA 5DF9A 1PWDA 3TG9A 4CPKA 3G2ZA 3TOIA 4OPRA 3UE1A 3VMAA 1JTGA 1SCWA 4ZBEA 4U0TA 2HDSA 4BL3A 2FFYA 3HLCA 3VP2A 4WYYA 1W79A 3VSKA 4WEJA 3S4XA 1GHPA 1TDGA 3MKEA 1MXOA 1KE0A 4OVDA 4E6XA 5M18A 1FCMA 3O86A 4O7DA 3W4OA 2RCXA 3RJUA 4OQGA 5HW3A 3ZFZA 1NYYA 4C3QA 3MXSA 4DE2A 2ZC5B 2QZ6A 1IEMA 5L2FA 2ZC7A 2EX2A 5FAQA 3VOYA 4EWFA 1ZC2A 3PBTA 3QNBA 5TGFA 2Y2HA 2JE5A 1NY0A 1O07A 2ZM0A 3C4OA 2Z2MB 3IHBA 2ZC6B 1MY8A 3NDEA 1XA7A 2Y2MA 4OKPA 3PTEA 3A3FA 2P9VA 4P85A 1BLPA 4IEDA 4P0MA 5A91A 5KSHA 1M40A 2IWDA 2WYXA 3IF6C 3N6IA 2H10A 1TDLA 4GDNA 3VSLA 4Y0TA 3HREA 2J7VA 2DNSA 1K55A 2RL3A 3FKVA 5JYOA 4OOYA 1RCJA 3HLBA 1CEFA 4MNRA 4RVAA 3SS5A 4S2NC 4JBFA 4RX3A 1Y54A 4BLMA 2IWCA 3O88A 3MZFA 4X68A 4NK3A 5DF7A 4DXCA 2JC7A 2WKEA 1YMSA 4DE1A 4M3KA 4D2OA 4KZ6A 4PM6A 5BOHA 5F1GA 1CK3A 4KZAA 4CJNA 3IXHA 2Y2JA 3HLGA 5AQ9A 1IYSA 5CHUA 3DWKA 3N8SA 4JF5A 3V39A 2C6WB 4KQRA 5TR7A 4LV2A 4ZDXA 2GDNA 2EX9A 1XGIA 5E2EA 1JTDA 3IXGA 4WZ5A 3ZNTA 2ZD8A 1XA1A 3SH9A 1CI8A 4RYEA 1BSGA 2ZM2A 1BUEA 5DF8A 4UA6A 4E3NA 1KVMA 3GRJA 1ESUA 2Y2NA 3LO7A 1Q2PA 4R3JA 5EVIC 5A92A 3IXBA 4R4RA 4GD6A 4JLFA 3SH8A 1H5XA 5CHMA 1FR6A 5EVID 3E2KA 2OLUA 1IYQA 2J9PA 2XR0A 1MKIA 3VP3A 1W8YA 2XFTA 3ZHHA 4A5RA 1BLHA 1LI0A 4R3BA 5FQKA 1HTZA 4PM5A 1LLBA 3OCLA 3WS2A 1NZUA 5FQJA 1RGYA 2OSUA 4B4XA 4QJGA 4OP5A 4IVIA 4OQIA 4RA7A 2H5SA 3HUNA 2JCHA 4JF6A 4KQQA 1PWGA 4S2OA 2C5WB 5GLDA 3G34A 4GOGA 2HDRA 1KE3A 2Q9NA 2WK0A 1KGGA 3QHYA 3HUMA 3HLEA 3Q7VB 3ZG9B 4DE3A 3N4IA 4NETA 4R0QA 3UN7A 3VP1A 2Y4AA 3VFHA 2WGVA 3C7VA 3Q07A 4U3TA 3HLWA 2Y2PA 3QNCA 1HD8A 5HAPA 2PBYA 3EQVA 2XDMA 1DJBA 2Q9MA 2XFSA 2ZLYA 3GVBA 1NRFA 3UPOA 2HDQA 2ZM8A 2WUQA 2QPNA 3FV7A 4GDBA 4F94A 3NIAA 3IWOA 1H8ZA 3BECA 1W8QA 3BYDA 5HFOA 5FI7A 3IH9A 1K6SA 2X01A 4KG6A 2Y2IA 4X6TA 3AGFA 5CTMA 4ZAMA 5JYPA 4FSFA 1O7EA 1K56D 2ZJ9A 4ID4A 1IKGA 2XK1A 1N9BA 1EI5A 3W8KA 4KZ8A 4MBKA 1K54A 1KGFA 3GQZA 4QY5A 4P87A 2ZQ8A 1SDEA 4OONA 3UDIA 3Q7VA 4HESA 3PBOA 1YLTA 4KZ5A 3MZDA 3LY4A 5CERA 3ZCZA 3BFDA 1DJCA 3DWZA 3ITBA 1IKIA 3FKWA 1ESIA 1FCOA 3O87A 5AQAA 3IWIA 3V5MA 1BLCA 1BZAA 1YM1A 2H0YA 3CJMA 1L0EA 5HAQA 4EQIA 3GTCA 3V3RA 3C7UA 3CZDA 5HAIA 5CEBA 3SH7A 3PAGA 5GL9A 2R9XA 1YLYA 4UA9A 1MWSA 1W5DA 4LV3A 5EUAA 1MWUA 5DTSA 4BL2A 4FH4A 1Z6FA 4XUXA 1K4EA 3HBRA 4MBHA 4P6BA 5FASA 5I94A 4EV4A 1TVFA 5J8XA 2ZQDA 2ZQCA 1I5QA 3BFGA 3EQUA 4JXVA 3DTMA 4X56A 3SOIA 4DKIA 3DW0A 5U47A 1WYBA 2G2UA 1ONHA 3C5AA 4E3MA 3PBSA 3BFFA 4DXBA 5A93A 2CC1A 1QMFA 1I2WA 5KSCA 2I72A 5EVLA 3LCEA 1AXBA 2Y2LA 1ERQA 4R4SA 4B4ZA 1FOFA 1YLZA 1GHMA 3ZG5A 4JF4A 4X55A 5G18A 1FCNA 4X69A 1CEGA 2Y55A 4S2KA 1YLWA 4UAAA 3GR2A 1CI9A 3OCNA 2EXBA 4HBUA 2DCFA 1K6RA 4BENA 1K4FA 1WYCA 2Y2OA 1K55C 5E2FA 4GZBA 4S2PA 3B3XA 5GLAA 2OV5A 4MEZA 1BULA 2X02A 5DTKA 3FYZA 5EECA 2J8YA 1EWZA 4JKTA 4KG5A 3NCKA 1NYMA 2V20A 3BFCA 4IVKA 3IHAA 3BRMA 3I7JA 3HLDA 3SS3A 4H8RA 1E4DA 3NI9A 4KZ4A 3W4PA 3FZCA 4S2MA 1NZOA 3ZVTA 4OLGA 2ZMAA 4K91A 3NC8A 3WS4A 3UE3A 1JWVA 1L0FA 1XPBA 3RXXA 3UDXA 4DDSA 1HZOA 3P09A 5CEDA 2HPBA 3HVFA 3OZHA 5E2HA 2Z2LB 3C4PA 4K0WA 1ERMA 3M6BA 3PAEA 4WZ5C 3ZGAB 1BTLA 5F83A 2EX8A 2XD5A 4OOLA 2B5RA 4E3JA 3IWQA 3BM6A 3N7WA 3O3VA 4U0XA 3UY6A 5CRFA 5DVAA 2HP6A 2WZZA 3PBRA 1MPLA 4BD0A 5A90A 4EBLA 2Y59A 5FQMA 1LL9A 5HARA 2XD1A 4S2JA 1MBLA 4MBFA 4N1HA 2ZQ7A 2PU4A 4E3KA 3N8RA 3M2KA 4WM9A 1N4OA 4YFMA 1YMXA 4MLLA 5FSRA 3ZG7B 3PBQA 5FQQA 2ZC4B 1I2SA 4N9KA 4KG2A 3G35A 3IXDA 2A49A 3BLMA 5FI2A 5GHZA 4BD1A 3MFDA 4E3OA 4FD8A 1L0GA 4K0XA 1KDWA 3WRTA 1H8YA 1QMEA 4FH2A 4YINA 4EBNA 1PW8A 4Y0UA 4E3LA 3UNWA 4PMAA 2OLVA 3IF6B 3UPPA 4Y0OA 3G30A 3ISGA 2VGJA 3G4PA 4GB7A 1YLPA 2HP9A 3OC2A 5CHJA 5AQ7A 3NDGA 1K57A 1PYYA 2Y2QA 1YQSA 3OPPA 5DTTA 4E3IA 1U60A 3D4FA 3CG5A 1C3BA 3G32A 4QD4A 5FQIA 5M1AA 3SS4A 4WELA 1ZKJA 2EFUA 1PIOA 2BG1A 4LCLA 5M19A 3MBZA 1PI4A 5FA7A 5GHXA 5EE8A 3LEZA 4BJPA 2WGIA 2VGKA 2Y2GA 4EBPA 3ZG0A 3S22A 5GHYA 5KMWA 3G31A 4JXSA 4ZTKA 5FAOA 4QU3A 3UPNA 3WWXA 2WKIA 3WRZA 3V3SA 2E8IA 1XX2A 3IT9A 5CGSA 5F1FA 1KGEA 3GMWA 1ZG6A 5HX9A 4Z9QA 1FR1A 4L0LA 2P74A 3FWLA 3G2YA 3ZVWA 4GKUA 4DDYA 4Q8IA 5CTNA 5KZHA 5E2GA 3VP0A 3MKFA 3GSGA 1JWPA 4XUZA 4R1GA 2XH9A 1E25A 3IF6A 3A3JA 2HDUA 3P98A 2IWBA 1K54C 5EVIB 1BT5A 5FDHA 4C6YA 1SHVA 4OP8A 1K25A 4ZJ1A 2ZC3B 1DY6A 4WMCA 4S2LA 2V1ZA 2XGNA 4S2NA 3ITAA 4KZBA 2WADA 4X53A 1LL5A 3OPRA 3WS5A 3JYIA 4GNUA 2ZQAA 1FQGA 4QHCA 2WGWB 2XEPA 1ES2A 3HL9A 4Y7PA 2JBFA 4JPMA 2R9WA 1ZG4A 4PM9A 2EFXA 5FAPA 1PZOA 1ALQA 3LY3A 4BQMA 4IBRA 1L2SA 4QY6A 5FQ9A 5IHVA 3V50A 4HEFA 1ES4A 3OPHA 4QB8A 5GLCA 2ZQ9A 1FSYA 3OPLA 3IH8A 1G6AA 1NJ4A 3IQAA 5D3OA 3UO9A 4JXGA 5TFQA 4WMCD 4JXWA 1NXYA 4PM7A 1Q2QA 2XF3A 1EROA 3TSGA 2UWXA 4LV1A 3UDFA 1MWTA 1G68A 2WKHA 3WS0A 4XXRA 2DRWA 5EOEA 1RGZA 5CGWA 1KVLA 4UA7A 4OPYA 2Y2KA 1KE4A 4IBXA 1SDNA 1MWRA 1S6RA 2EX6A 5EVIA 3Q1FA 1HVBA 4KQOA 5GLBA 3M6HA 1LHYA 4HBTA 3NY4A 2Y91A 3IF5A 2EXAA 5E43A 4KENB 5CXWA 4S2IA 1LI9A 3WS1A 3ZNYA 5HL1A 3Q7ZA 1XXMA 3BFEA 4OOMA 4OPZA 4N1XA 1JVJA 2WGWA 2XLNA 3MXRA 1IYPA 1JWZA 3W4QA 1XKZA 5F82A 1GA9A 1E3UA 3Q82A 1FSWA 5EPHA 5CGXA 3VOZA 1GA0A 1ES5A 3CMZA 3ZDJA 3VP4A 3A3IA 4ZJ2A 4LV0A 2FFFB 1TEMA 4DE0A 2A3UA 4OPQA 3E2LA 3BLSA 3AGDA 3MZEA 3HUOA 1VQQA 2WZXA 4RX2A 4GN2A 4OQHA 5FI6A 3Q81A 1J9MA 4WBGA 3VFFA 1ES3A 1K38A 3NBLA 4PPRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KZ7 A;  1YLJ A;  2QMI A;  1SKF A;  2BLS A;  4N92 A;  4E6W A;  4EUZ A;  2H0T A;  3N8L A;  1WE4 A;  4UHU A;  1E3U D;  4KZ3 A;  1GHI A;  1ONG A;  3PBN A;  4FCF A;  2WAE A;  1M6K A;  1VM1 A;  3UE0 A;  4DF6 A;  1PI5 A;  3AGE A;  1KDS A;  4OLD A;  4WZ4 A;  4PM8 A;  3ZG8 B;  1XP4 A;  5AQB A;  2XQZ A;  5EOO A;  4OH0 A;  4R23 A;  2G2W A;  3A3D A;  4WEK A;  2X71 A;  1DJA A;  1BLS A;  1XGJ A;  1K56 A;  2V2F F;  4GD8 A;  3BEB A;  2PU2 A;  1OME A;  5CEC A;  1PZP A;  3HLF A;  1L0D A;  5FAT A;  1S0W A;  4OQ0 A;  2P9V B;  1GCE A;  4C75 A;  4LCM A;  1W7F A;  3RXW A;  1PWC A;  1IYO A;  1YT4 A;  2WAF A;  2HP5 A;  3A3E A;  4N9L A;  4KZ9 A;  4LEN A;  4B88 A;  3GV9 A;  4DRT A;  3M2J A;  4ZJ3 A;  1PW1 A;  3S1Y A;  1K57 C;  1IEL A;  1RP5 A;  2J9O A;  5DF9 A;  1PWD A;  3TG9 A;  4CPK A;  3G2Z A;  3TOI A;  4OPR A;  3UE1 A;  3VMA A;  1JTG A;  1SCW A;  4ZBE A;  4U0T A;  2HDS A;  4BL3 A;  2FFY A;  3HLC A;  3VP2 A;  4WYY A;  1W79 A;  3VSK A;  4WEJ A;  3S4X A;  1GHP A;  1TDG A;  3MKE A;  1MXO A;  1KE0 A;  4OVD A;  4E6X A;  5M18 A;  1FCM A;  3O86 A;  4O7D A;  3W4O A;  2RCX A;  3RJU A;  4OQG A;  5HW3 A;  3ZFZ A;  1NYY A;  4C3Q A;  3MXS A;  4DE2 A;  2ZC5 B;  2QZ6 A;  1IEM A;  5L2F A;  2ZC7 A;  2EX2 A;  5FAQ A;  3VOY A;  4EWF A;  1ZC2 A;  3PBT A;  3QNB A;  5TGF A;  2Y2H A;  2JE5 A;  1NY0 A;  1O07 A;  2ZM0 A;  3C4O A;  2Z2M B;  3IHB A;  2ZC6 B;  1MY8 A;  3NDE A;  1XA7 A;  2Y2M A;  4OKP A;  3PTE A;  3A3F A;  2P9V A;  4P85 A;  1BLP A;  4IED A;  4P0M A;  5A91 A;  5KSH A;  1M40 A;  2IWD A;  2WYX A;  3IF6 C;  3N6I A;  2H10 A;  1TDL A;  4GDN A;  3VSL A;  4Y0T A;  3HRE A;  2J7V A;  2DNS A;  1K55 A;  2RL3 A;  3FKV A;  5JYO A;  4OOY A;  1RCJ A;  3HLB A;  1CEF A;  4MNR A;  4RVA A;  3SS5 A;  4S2N C;  4JBF A;  4RX3 A;  1Y54 A;  4BLM A;  2IWC A;  3O88 A;  3MZF A;  4X68 A;  4NK3 A;  5DF7 A;  4DXC A;  2JC7 A;  2WKE A;  1YMS A;  4DE1 A;  4M3K A;  4D2O A;  4KZ6 A;  4PM6 A;  5BOH A;  5F1G A;  1CK3 A;  4KZA A;  4CJN A;  3IXH A;  2Y2J A;  3HLG A;  5AQ9 A;  1IYS A;  5CHU A;  3DWK A;  3N8S A;  4JF5 A;  3V39 A;  2C6W B;  4KQR A;  5TR7 A;  4LV2 A;  4ZDX A;  2GDN A;  2EX9 A;  1XGI A;  5E2E A;  1JTD A;  3IXG A;  4WZ5 A;  3ZNT A;  2ZD8 A;  1XA1 A;  3SH9 A;  1CI8 A;  4RYE A;  1BSG A;  2ZM2 A;  1BUE A;  5DF8 A;  4UA6 A;  4E3N A;  1KVM A;  3GRJ A;  1ESU A;  2Y2N A;  3LO7 A;  1Q2P A;  4R3J A;  5EVI C;  5A92 A;  3IXB A;  4R4R A;  4GD6 A;  4JLF A;  3SH8 A;  1H5X A;  5CHM A;  1FR6 A;  5EVI D;  3E2K A;  2OLU A;  1IYQ A;  2J9P A;  2XR0 A;  1MKI A;  3VP3 A;  1W8Y A;  2XFT A;  3ZHH A;  4A5R A;  1BLH A;  1LI0 A;  4R3B A;  5FQK A;  1HTZ A;  4PM5 A;  1LLB A;  3OCL A;  3WS2 A;  1NZU A;  5FQJ A;  1RGY A;  2OSU A;  4B4X A;  4QJG A;  4OP5 A;  4IVI A;  4OQI A;  4RA7 A;  2H5S A;  3HUN A;  2JCH A;  4JF6 A;  4KQQ A;  1PWG A;  4S2O A;  2C5W B;  5GLD A;  3G34 A;  4GOG A;  2HDR A;  1KE3 A;  2Q9N A;  2WK0 A;  1KGG A;  3QHY A;  3HUM A;  3HLE A;  3Q7V B;  3ZG9 B;  4DE3 A;  3N4I A;  4NET A;  4R0Q A;  3UN7 A;  3VP1 A;  2Y4A A;  3VFH A;  2WGV A;  3C7V A;  3Q07 A;  4U3T A;  3HLW A;  2Y2P A;  3QNC A;  1HD8 A;  5HAP A;  2PBY A;  3EQV A;  2XDM A;  1DJB A;  2Q9M A;  2XFS A;  2ZLY A;  3GVB A;  1NRF A;  3UPO A;  2HDQ A;  2ZM8 A;  2WUQ A;  2QPN A;  3FV7 A;  4GDB A;  4F94 A;  3NIA A;  3IWO A;  1H8Z A;  3BEC A;  1W8Q A;  3BYD A;  5HFO A;  5FI7 A;  3IH9 A;  1K6S A;  2X01 A;  4KG6 A;  2Y2I A;  4X6T A;  3AGF A;  5CTM A;  4ZAM A;  5JYP A;  4FSF A;  1O7E A;  1K56 D;  2ZJ9 A;  4ID4 A;  1IKG A;  2XK1 A;  1N9B A;  1EI5 A;  3W8K A;  4KZ8 A;  4MBK A;  1K54 A;  1KGF A;  3GQZ A;  4QY5 A;  4P87 A;  2ZQ8 A;  1SDE A;  4OON A;  3UDI A;  3Q7V A;  4HES A;  3PBO A;  1YLT A;  4KZ5 A;  3MZD A;  3LY4 A;  5CER A;  3ZCZ A;  3BFD A;  1DJC A;  3DWZ A;  3ITB A;  1IKI A;  3FKW A;  1ESI A;  1FCO A;  3O87 A;  5AQA A;  3IWI A;  3V5M A;  1BLC A;  1BZA A;  1YM1 A;  2H0Y A;  3CJM A;  1L0E A;  5HAQ A;  4EQI A;  3GTC A;  3V3R A;  3C7U A;  3CZD A;  5HAI A;  5CEB A;  3SH7 A;  3PAG A;  5GL9 A;  2R9X A;  1YLY A;  4UA9 A;  1MWS A;  1W5D A;  4LV3 A;  5EUA A;  1MWU A;  5DTS A;  4BL2 A;  4FH4 A;  1Z6F A;  4XUX A;  1K4E A;  3HBR A;  4MBH A;  4P6B A;  5FAS A;  5I94 A;  4EV4 A;  1TVF A;  5J8X A;  2ZQD A;  2ZQC A;  1I5Q A;  3BFG A;  3EQU A;  4JXV A;  3DTM A;  4X56 A;  3SOI A;  4DKI A;  3DW0 A;  5U47 A;  1WYB A;  2G2U A;  1ONH A;  3C5A A;  4E3M A;  3PBS A;  3BFF A;  4DXB A;  5A93 A;  2CC1 A;  1QMF A;  1I2W A;  5KSC A;  2I72 A;  5EVL A;  3LCE A;  1AXB A;  2Y2L A;  1ERQ A;  4R4S A;  4B4Z A;  1FOF A;  1YLZ A;  1GHM A;  3ZG5 A;  4JF4 A;  4X55 A;  5G18 A;  1FCN A;  4X69 A;  1CEG A;  2Y55 A;  4S2K A;  1YLW A;  4UAA A;  3GR2 A;  1CI9 A;  3OCN A;  2EXB A;  4HBU A;  2DCF A;  1K6R A;  4BEN A;  1K4F A;  1WYC A;  2Y2O A;  1K55 C;  5E2F A;  4GZB A;  4S2P A;  3B3X A;  5GLA A;  2OV5 A;  4MEZ A;  1BUL A;  2X02 A;  5DTK A;  3FYZ A;  5EEC A;  2J8Y A;  1EWZ A;  4JKT A;  4KG5 A;  3NCK A;  1NYM A;  2V20 A;  3BFC A;  4IVK A;  3IHA A;  3BRM A;  3I7J A;  3HLD A;  3SS3 A;  4H8R A;  1E4D A;  3NI9 A;  4KZ4 A;  3W4P A;  3FZC A;  4S2M A;  1NZO A;  3ZVT A;  4OLG A;  2ZMA A;  4K91 A;  3NC8 A;  3WS4 A;  3UE3 A;  1JWV A;  1L0F A;  1XPB A;  3RXX A;  3UDX A;  4DDS A;  1HZO A;  3P09 A;  5CED A;  2HPB A;  3HVF A;  3OZH A;  5E2H A;  2Z2L B;  3C4P A;  4K0W A;  1ERM A;  3M6B A;  3PAE A;  4WZ5 C;  3ZGA B;  1BTL A;  5F83 A;  2EX8 A;  2XD5 A;  4OOL A;  2B5R A;  4E3J A;  3IWQ A;  3BM6 A;  3N7W A;  3O3V A;  4U0X A;  3UY6 A;  5CRF A;  5DVA A;  2HP6 A;  2WZZ A;  3PBR A;  1MPL A;  4BD0 A;  5A90 A;  4EBL A;  2Y59 A;  5FQM A;  1LL9 A;  5HAR A;  2XD1 A;  4S2J A;  1MBL A;  4MBF A;  4N1H A;  2ZQ7 A;  2PU4 A;  4E3K A;  3N8R A;  3M2K A;  4WM9 A;  1N4O A;  4YFM A;  1YMX A;  4MLL A;  5FSR A;  3ZG7 B;  3PBQ A;  5FQQ A;  2ZC4 B;  1I2S A;  4N9K A;  4KG2 A;  3G35 A;  3IXD A;  2A49 A;  3BLM A;  5FI2 A;  5GHZ A;  4BD1 A;  3MFD A;  4E3O A;  4FD8 A;  1L0G A;  4K0X A;  1KDW A;  3WRT A;  1H8Y A;  1QME A;  4FH2 A;  4YIN A;  4EBN A;  1PW8 A;  4Y0U A;  4E3L A;  3UNW A;  4PMA A;  2OLV A;  3IF6 B;  3UPP A;  4Y0O A;  3G30 A;  3ISG A;  2VGJ A;  3G4P A;  4GB7 A;  1YLP A;  2HP9 A;  3OC2 A;  5CHJ A;  5AQ7 A;  3NDG A;  1K57 A;  1PYY A;  2Y2Q A;  1YQS A;  3OPP A;  5DTT A;  4E3I A;  1U60 A;  3D4F A;  3CG5 A;  1C3B A;  3G32 A;  4QD4 A;  5FQI A;  5M1A A;  3SS4 A;  4WEL A;  1ZKJ A;  2EFU A;  1PIO A;  2BG1 A;  4LCL A;  5M19 A;  3MBZ A;  1PI4 A;  5FA7 A;  5GHX A;  5EE8 A;  3LEZ A;  4BJP A;  2WGI A;  2VGK A;  2Y2G A;  4EBP A;  3ZG0 A;  3S22 A;  5GHY A;  5KMW A;  3G31 A;  4JXS A;  4ZTK A;  5FAO A;  4QU3 A;  3UPN A;  3WWX A;  2WKI A;  3WRZ A;  3V3S A;  2E8I A;  1XX2 A;  3IT9 A;  5CGS A;  5F1F A;  1KGE A;  3GMW A;  1ZG6 A;  5HX9 A;  4Z9Q A;  1FR1 A;  4L0L A;  2P74 A;  3FWL A;  3G2Y A;  3ZVW A;  4GKU A;  4DDY A;  4Q8I A;  5CTN A;  5KZH A;  5E2G A;  3VP0 A;  3MKF A;  3GSG A;  1JWP A;  4XUZ A;  4R1G A;  2XH9 A;  1E25 A;  3IF6 A;  3A3J A;  2HDU A;  3P98 A;  2IWB A;  1K54 C;  5EVI B;  1BT5 A;  5FDH A;  4C6Y A;  1SHV A;  4OP8 A;  1K25 A;  4ZJ1 A;  2ZC3 B;  1DY6 A;  4WMC A;  4S2L A;  2V1Z A;  2XGN A;  4S2N A;  3ITA A;  4KZB A;  2WAD A;  4X53 A;  1LL5 A;  3OPR A;  3WS5 A;  3JYI A;  4GNU A;  2ZQA A;  1FQG A;  4QHC A;  2WGW B;  2XEP A;  1ES2 A;  3HL9 A;  4Y7P A;  2JBF A;  4JPM A;  2R9W A;  1ZG4 A;  4PM9 A;  2EFX A;  5FAP A;  1PZO A;  1ALQ A;  3LY3 A;  4BQM A;  4IBR A;  1L2S A;  4QY6 A;  5FQ9 A;  5IHV A;  3V50 A;  4HEF A;  1ES4 A;  3OPH A;  4QB8 A;  5GLC A;  2ZQ9 A;  1FSY A;  3OPL A;  3IH8 A;  1G6A A;  1NJ4 A;  3IQA A;  5D3O A;  3UO9 A;  4JXG A;  5TFQ A;  4WMC D;  4JXW A;  1NXY A;  4PM7 A;  1Q2Q A;  2XF3 A;  1ERO A;  3TSG A;  2UWX A;  4LV1 A;  3UDF A;  1MWT A;  1G68 A;  2WKH A;  3WS0 A;  4XXR A;  2DRW A;  5EOE A;  1RGZ A;  5CGW A;  1KVL A;  4UA7 A;  4OPY A;  2Y2K A;  1KE4 A;  4IBX A;  1SDN A;  1MWR A;  1S6R A;  2EX6 A;  5EVI A;  3Q1F A;  1HVB A;  4KQO A;  5GLB A;  3M6H A;  1LHY A;  4HBT A;  3NY4 A;  2Y91 A;  3IF5 A;  2EXA A;  5E43 A;  4KEN B;  5CXW A;  4S2I A;  1LI9 A;  3WS1 A;  3ZNY A;  5HL1 A;  3Q7Z A;  1XXM A;  3BFE A;  4OOM A;  4OPZ A;  4N1X A;  1JVJ A;  2WGW A;  2XLN A;  3MXR A;  1IYP A;  1JWZ A;  3W4Q A;  1XKZ A;  5F82 A;  1GA9 A;  1E3U A;  3Q82 A;  1FSW A;  5EPH A;  5CGX A;  3VOZ A;  1GA0 A;  1ES5 A;  3CMZ A;  3ZDJ A;  3VP4 A;  3A3I A;  4ZJ2 A;  4LV0 A;  2FFF B;  1TEM A;  4DE0 A;  2A3U A;  4OPQ A;  3E2L A;  3BLS A;  3AGD A;  3MZE A;  3HUO A;  1VQQ A;  2WZX A;  4RX2 A;  4GN2 A;  4OQH A;  5FI6 A;  3Q81 A;  1J9M A;  4WBG A;  3VFF A;  1ES3 A;  1K38 A;  3NBL A;  4PPR A; 
#chains in the Genus database with same CATH topology
 1YLJ A;  4IUK A;  4UHU A;  1GHI A;  2WAE A;  4OLD A;  3AGE A;  1KDS A;  4WZ4 A;  1DP9 A;  5EOO A;  4L9G A;  3A3D A;  1XGJ A;  5FAT A;  4EU0 A;  3KYQ A;  1OTB A;  1GCE A;  4C75 A;  1W7F A;  3C38 A;  5HPI A;  4N9L A;  1S1Y A;  3GV9 A;  4DRT A;  3M2J A;  1PW1 A;  1H3Q A;  1RP5 A;  1PWD A;  2PBD P;  2WKR A;  3MQ0 A;  3UE1 A;  1JTG A;  1SCW A;  4BL3 A;  3VP2 A;  4WEJ A;  3S4X A;  1GHP A;  3MKE A;  4OVD A;  5M18 A;  3L9K A;  3E4P A;  3O86 A;  3LUQ A;  5HWV A;  2VGL S;  4C3Q A;  2O0Y A;  2ZC5 B;  4LPZ A;  5L2F A;  4CLC C;  2EX2 A;  4IHQ A;  4EWF A;  4CLC D;  2ZC6 B;  2Y2M A;  1IFQ A;  3A3F A;  2XSS A;  4IED A;  2I9V A;  2IWD A;  3IF6 C;  2WKP A;  3C8C A;  3FKV A;  3IS2 B;  1RCJ A;  3HLB A;  4HH2 A;  4S2N C;  4JBF A;  1Y54 A;  4HOI A;  4BLM A;  4NKP A;  2LB5 A;  4O0P A;  4L9F A;  2YKF A;  2EWV A;  3V39 A;  5TR7 A;  4LV2 A;  3EEA A;  1XGI A;  3IXG A;  4WZ5 A;  5IT5 A;  1D06 A;  1D7E A;  3CAX A;  4I39 A;  5DF8 A;  3GRJ A;  2Y2N A;  5EVI C;  3IXB A;  3SH8 A;  2GX5 A;  2JKT M;  1H5X A;  5EVI D;  4CPK A;  3VP3 A;  1BLH A;  1HTZ A;  4ETZ A;  3OCL A;  5DFX A;  4B4X A;  4OP5 A;  4RA7 A;  3HUN A;  1PWG A;  4WF0 A;  2J80 A;  1Z09 A;  3G34 A;  3QHY A;  3DTK A;  3Q7V B;  3BY9 A;  2ZOI A;  3IBR A;  3VP1 A;  1H0M A;  2Y4A A;  3VFH A;  4Q0H A;  2WGV A;  3K3C A;  4Y3I A;  3QNC A;  4R3A A;  1KOU A;  3LIF A;  2PT7 A;  3KYZ A;  1NLY A;  2W1T B;  2ZM8 A;  3IWO A;  2ZMF A;  2PD7 A;  5HFO A;  2A2L A;  2W3H A;  4I5S A;  1S67 L;  4ZAM A;  1K56 D;  4II7 A;  1IKG A;  1N9B A;  3LR5 A;  1SDE A;  3Q7V A;  3MZD A;  5CER A;  4MDZ A;  3BFD A;  4HI4 A;  5HZH A;  3FKW A;  1ESI A;  2W0N A;  1BZA A;  1L0E A;  4EQI A;  1YLY A;  4UA9 A;  3TW8 A;  1W5D A;  5EUA A;  2W1T A;  4P6B A;  1DRM A;  4O8G A;  4EV4 A;  1XFQ A;  3DW0 A;  2PR5 A;  3S7Q A;  4E3M A;  4PKY A;  3PBS A;  4GHI B;  1QMF A;  2VZW A;  1YLZ A;  3FC7 A;  2WKQ A;  5G18 A;  4X69 A;  1CEG A;  4S2K A;  1CI9 A;  1K6R A;  5TBM B;  3BJN A;  3NCK A;  3R4K A;  1NYM A;  3CIT A;  3IHA A;  1X0O A;  3D3O A;  3HLD A;  4H8R A;  1OTD A;  3FZC A;  2V8C A;  2P08 A;  3UE3 A;  2KDK A;  1JWV A;  1L0F A;  4DDS A;  5CED A;  1J3W A;  1Y4O A;  1N9N A;  3OLO A;  1BTL A;  2JKR I;  2EX8 A;  2XD5 A;  2B5R A;  3G6O A;  3N7W A;  5C5K A;  3UY6 A;  5F68 A;  1MPL A;  4HNB A;  2Y59 A;  5EFW A;  3LIC A;  5HAR A;  2XD1 A;  4MBF A;  5TBM A;  2ZQ7 A;  2PU4 A;  2OOL A;  3ZYT A;  1N4O A;  1YMX A;  3BWL A;  4N9K A;  2W3E A;  3G35 A;  4CLC B;  5AVE A;  4FD8 A;  2Q0O A;  3K3D A;  3WRT A;  1OT9 A;  3UNW A;  1F2K A;  2VJW A;  2KX6 A;  3IF6 B;  3UPP A;  3ISG A;  3UB6 A;  2O9A A;  5AQ7 A;  3OPP A;  3P01 A;  2XRO A;  5M1A A;  1ZKJ A;  4CQH A;  1PI4 A;  5GHX A;  4GLQ A;  4BJP A;  5KIZ A;  2HV1 A;  3A0S A;  4EBP A;  3ZG0 A;  3CPT B;  2VA0 A;  5KMW A;  3G31 A;  4JXS A;  5CGS A;  4CLC A;  1ZG6 A;  2VLG A;  2B95 A;  5A8B A;  4X1L A;  5CTN A;  3CUE C;  3IF6 A;  3UB7 A;  5EVI B;  3IX8 A;  4EW7 A;  4S2N A;  3B33 A;  3ITA A;  4KZB A;  3OPR A;  3FPV A;  3WS5 A;  1F5M A;  2WGW B;  3HL9 A;  4LRY C;  4PM9 A;  2P04 A;  3ZQ5 A;  3LY3 A;  4M4X A;  3GDI A;  1NRJ A;  1TF1 A;  5TFQ A;  4WMC D;  4JXW A;  1SKO B;  2VV8 A;  1ERO A;  1PNE A;  3TSG A;  4LV1 A;  3UDF A;  1MWT A;  5EOE A;  3D9Y A;  4IBX A;  4EET B;  5EVI A;  3DTE A;  4KQO A;  4HBT A;  2V1A A;  2Y91 A;  5E43 A;  5CXW A;  4S2I A;  1LI9 A;  3ZNY A;  3Q7Z A;  4B93 A;  4N1X A;  3NEC A;  2WGW A;  3MXR A;  3T4O A;  1XKZ A;  5F82 A;  4KQD A;  5AJG A;  4HJ3 A;  4LV0 A;  1SZV A;  4OPQ A;  3AGD A;  2WZX A;  1SKO A;  4DN0 A;  1J9M A;  4GJ4 A;  3SW1 A;  3VFF A;  1XJ2 A;  1VET B;  1OT6 A;  4N92 A;  2H0T A;  2UV0 E;  3E98 A;  2VK3 A;  4KZ3 A;  1M6K A;  2ZL1 A;  1VM1 A;  3UE0 A;  1XP4 A;  2W3F A;  1TS7 A;  4R23 A;  2G2W A;  1DJA A;  1K56 A;  2V2F F;  4HJ4 A;  1OME A;  1VEU B;  2P9V B;  1IOU A;  5DJT A;  4LCM A;  3RXW A;  3LIE A;  1IYO A;  2WAF A;  4KZ9 A;  4LEN A;  4I38 A;  1LT0 A;  4ZJ3 A;  4EXO A;  2PRF A;  3S1Y A;  2J9O A;  3KYE A;  3IBJ A;  1VET A;  2VV6 A;  2FFY A;  1P9W A;  5DKK A;  1KE0 A;  2RCX A;  3RJU A;  4OQG A;  5HW3 A;  4P6Z S;  1NYY A;  3MXS A;  4I3I A;  2QZ6 A;  1IEM A;  2W3D A;  3PBT A;  3QNB A;  1MY8 A;  1XA7 A;  4OKP A;  1VEU A;  4P85 A;  2P9V A;  5KSH A;  4Q0J A;  2WYX A;  3N6I A;  2J7V A;  2RL3 A;  1PRQ A;  4HY8 A;  5J3W A;  5IU1 A;  2IWC A;  3EGX C;  4R6L A;  4X68 A;  4NK3 A;  1LSW A;  4D2O A;  3LR3 A;  5F1G A;  4KZA A;  5J4E A;  2Y2J A;  3N8S A;  4JF5 A;  5HWT A;  2EX9 A;  5E2E A;  4G3V A;  2ZD8 A;  5HD5 A;  1BSG A;  3T50 A;  2YKH A;  4G3K A;  3LO7 A;  4DJ3 A;  1FR6 A;  5J8X A;  4I3J A;  2XA7 M;  1IYQ A;  4A5R A;  2XFT A;  3ZHH A;  3H9W A;  2VEA A;  5FQK A;  3WS2 A;  4QJG A;  4OQI A;  2W3G A;  4JF6 A;  4KQQ A;  4FUW A;  1G6O A;  1KE3 A;  1NWZ A;  1V9Z A;  2WK0 A;  4EES A;  1DP8 A;  1ODV A;  3C7V A;  3QP8 A;  1OTA A;  4U3T A;  5TJJ A;  2Y2P A;  3LYX A;  1HD8 A;  3LEQ A;  2OWJ A;  4HIA A;  2PBY A;  3EQV A;  2Q9M A;  2ZLY A;  2XRN A;  1NRF A;  2HDQ A;  2BTF P;  2WUQ A;  3NOP C;  4GDB A;  4F94 A;  3NIA A;  1YSQ A;  4QWO A;  3BEC A;  3BYD A;  5FI7 A;  4Y15 A;  2Y2I A;  4Y17 A;  3AGF A;  5CTM A;  5G4Z A;  3LR0 A;  3UB5 P;  3V67 A;  3UMD A;  1OJG A;  2XK1 A;  3CUE A;  3VE3 A;  3T1Q B;  2ZQ8 A;  1DP6 A;  4OON A;  4KZ5 A;  1YLT A;  3S7N A;  3ZCZ A;  3LY4 A;  3U2A A;  3DWZ A;  3ITB A;  2M1C A;  1YSP A;  3IWI A;  3EWK A;  3V5M A;  1BLC A;  1YM1 A;  3KSH A;  3GTC A;  5GL9 A;  2IA2 A;  2GZA A;  1MWU A;  5DTS A;  5AVF A;  4FH4 A;  1XJ6 A;  1K4E A;  3HBR A;  3NUL A;  2AVX A;  5I94 A;  2ZQC A;  4X56 A;  3BFG A;  3EQU A;  3SOI A;  3DTM A;  5U47 A;  2G2U A;  1ONH A;  4CLC E;  1UGU A;  3BFF A;  5A93 A;  2CC1 A;  1P97 A;  2INW A;  5KSC A;  2I72 A;  4UQI S;  5EVL A;  3MQQ A;  1ERQ A;  3NHQ A;  2V0W A;  3D72 A;  3GR2 A;  3OCN A;  4HBU A;  2QJ7 A;  1K4F A;  4HJ6 A;  4S2P A;  3B3X A;  5GLA A;  4MEZ A;  3FYZ A;  4KG5 A;  2A24 B;  1E4D A;  4OLG A;  2ZMA A;  2G7U A;  4K91 A;  3IS2 A;  3RXX A;  3UDX A;  3ULF A;  1HZO A;  3IX4 A;  2HPB A;  3OZH A;  3K2N A;  3M6B A;  3PAE A;  4BBT A;  1VB6 A;  2PD8 A;  4E3J A;  3IWQ A;  3O3V A;  3EOI A;  2HP6 A;  5A90 A;  4BD0 A;  5FQM A;  1LL9 A;  2FH5 A;  3C2W A;  3M2K A;  5L09 A;  4DJ2 A;  2A49 A;  2A24 A;  1LL8 A;  4HH3 A;  4BD1 A;  3MFD A;  5IS1 A;  3HJK A;  4K0X A;  1KDW A;  1QME A;  3T4S A;  2L4R A;  2Z6C A;  4E3L A;  4PMA A;  3KX0 X;  3QP5 A;  3G4P A;  1YLP A;  2Z6D A;  2EWW A;  3OC2 A;  2KLI A;  3NDG A;  4WUJ A;  3D4F A;  3CG5 A;  4WN5 A;  3SS4 A;  4WEL A;  1K0K A;  2JKG A;  5M19 A;  4LCL A;  3MBZ A;  4MN5 A;  1S1Z A;  5EE8 A;  3C30 A;  3T12 B;  3VOL A;  3WWX A;  3V3S A;  2J3W A;  3IT9 A;  1KGE A;  5HX9 A;  4R70 A;  4Z9Q A;  4MMN A;  2P74 A;  3ZVW A;  4DDY A;  4Q8I A;  3PXP A;  3MKF A;  1JWP A;  3MF0 A;  1GSW A;  2IWB A;  3S7P A;  3T4J A;  4C6Y A;  1K25 A;  3DAV A;  4NXE A;  1DY6 A;  4S2L A;  4JGR A;  1ZHH B;  2V1Z A;  3JVU A;  2XGN A;  2WAD A;  2ZQA A;  4QHC A;  1ES2 A;  3OBF A;  2EFX A;  1PZO A;  1ALQ A;  3JVV A;  4UEY A;  4HEF A;  1ES4 A;  1HLU P;  2ZQ9 A;  5HD3 A;  1FSY A;  3IH8 A;  5D3O A;  4JXG A;  1NXY A;  4PM7 A;  5L10 A;  2XF3 A;  3B42 A;  2UWX A;  1T1B A;  1G68 A;  2WKH A;  3WS0 A;  4XXR A;  2QHK A;  4PKY G;  3U4L P;  4BBV A;  2JKT I;  3NY4 A;  4KEN B;  3T1S A;  4GHI A;  3BFE A;  5FEF A;  3ICY A;  3T4T A;  3E4O A;  3Q82 A;  1FSW A;  2JN7 A;  1GA0 A;  1FIL A;  3ZDJ A;  3A3I A;  3CLO A;  2VKS A;  2FFF B;  1T1A A;  4GN2 A;  4OQH A;  3BQA A;  3A0R A;  4FSF A;  4PPR A;  5CX7 A;  4EUZ A;  3EEH A;  3UB8 A;  5HDS A;  5EM0 A;  2PYR A;  1E3U D;  3F1P B;  4DF6 A;  1PI5 A;  3ZG8 B;  4H6J B;  4PM8 A;  2B02 A;  4DMZ A;  4OH0 A;  3R7W B;  5HPF A;  4GD8 A;  3BEB A;  2PU2 A;  5CEC A;  4YNR A;  1S0W A;  1PWC A;  3LID A;  1T1C A;  2HP5 A;  3A3E A;  4B88 A;  2BAS A;  1OJ5 A;  1K57 C;  2B18 A;  4HP9 A;  1L3L A;  3TOI A;  4OPR A;  3VMA A;  3L7H A;  1TS8 A;  4JGQ A;  1JNU A;  1W79 A;  4MN7 A;  4WLA A;  3W4O A;  4RQ9 A;  5G4Y A;  2PHY A;  3ZFZ A;  4H6J A;  2HZ5 A;  3R7W A;  5FAQ A;  3VOY A;  1ZC2 A;  5TGF A;  2DMW A;  2Y2H A;  3C4O A;  2Z2M B;  3KSG A;  4P0M A;  1M40 A;  1TDL A;  3VSL A;  3CPT A;  4Y0T A;  1S4S A;  3NJA A;  1XFN A;  4PHT A;  4RVA A;  4RX3 A;  3NOU C;  3CHW P;  2VX8 A;  3VV4 A;  4DXC A;  2JC7 A;  4M3K A;  3PR6 A;  4X1M A;  4KZ6 A;  4PM6 A;  4X25 A;  4NXG A;  1P9R A;  3F1O B;  3IXH A;  5CHU A;  3DWK A;  3KSF A;  1YKD A;  4KQR A;  4ZDX A;  2GDN A;  3DBA A;  4R38 A;  1T19 A;  1XA1 A;  3LI8 A;  3SH9 A;  4EEP A;  4EUV A;  3SZT A;  2ZM2 A;  1BYW A;  4UA6 A;  4E3N A;  2MJ6 A;  1ESU A;  1OPX A;  1Q2P A;  4R3J A;  5A92 A;  4R4R A;  4ESP A;  2CMN A;  1TD5 A;  5CHM A;  2OLU A;  1F98 A;  1LI0 A;  1ACF A;  4PM5 A;  1LLB A;  2OSU A;  4KUK A;  1PFL A;  2H5S A;  2JCH A;  4WL9 A;  4S2O A;  2FZ0 A;  5GLD A;  4GOG A;  3F1O A;  3BQ8 A;  3MQO A;  3QP1 A;  1KGG A;  4LRX C;  3HUM A;  3HLE A;  3ZG9 B;  4DE3 A;  3N4I A;  4HP4 A;  3UN7 A;  3LI9 A;  2D01 A;  3MXQ A;  3HLW A;  5LBR A;  5HAP A;  2D02 A;  1CJF A;  3S7O A;  2V8F A;  1DJB A;  2XFS A;  3GVB A;  2QJ5 A;  2QPN A;  1W8Q A;  4GS9 B;  3FPW A;  2O9C A;  2HJ9 C;  3IH9 A;  2X01 A;  4X6T A;  1S4R A;  4LRZ E;  2ZJ9 A;  3BW6 A;  3VE4 A;  3P7N A;  1EI5 A;  1ZTU A;  3EGD C;  1KGF A;  3GQZ A;  4QY5 A;  3BY8 A;  4P87 A;  3UME A;  3UDI A;  4HQA A;  2LB9 A;  4K08 A;  3O87 A;  3E4Q A;  3V3R A;  3C7U A;  5FDS A;  3PAG A;  3SH7 A;  2R9X A;  5HDC A;  1F9I A;  4B9O A;  4BL2 A;  3KSI A;  3LGO A;  4GS9 A;  2H28 A;  4DKI A;  3H7W B;  1WYB A;  3C5A A;  2HJE A;  2KOI A;  1I2W A;  1AXB A;  4R4S A;  1FOF A;  1A0K A;  1YAX A;  4JF4 A;  1FCN A;  2Y55 A;  5DFY A;  4BEN A;  1K55 C;  3O5Y A;  2OV5 A;  1EWZ A;  4MCW A;  2V20 A;  3BFC A;  4IVK A;  4JGO A;  3UE6 A;  3BRM A;  3I7J A;  2VGL M;  3GEC A;  5I5L A;  4S2M A;  1NZO A;  1TS0 A;  4QPR A;  2O9B A;  3NC8 A;  3H7W A;  3B47 A;  3IX3 A;  5E2H A;  2V0U A;  4K0W A;  3C4P A;  1ERM A;  5F83 A;  5CRF A;  3PBR A;  3MR0 A;  4EBL A;  5L07 A;  1P0Z A;  3RH8 B;  2JKF A;  4S2J A;  1MBL A;  4N1H A;  3N8R A;  4WM9 A;  2EA9 A;  5FSR A;  3A0V A;  3PBQ A;  1W63 Q;  5FQQ A;  4EEU A;  1I2S A;  2Y8H A;  4MN6 A;  3IXD A;  5HWW A;  5GHZ A;  3T1R A;  4E3O A;  4EER A;  1L0G A;  1H8Y A;  4FH2 A;  5K5B A;  1PW8 A;  2OLV A;  3CI6 A;  4GB7 A;  5DKL A;  1K57 A;  1YQS A;  5DTT A;  4IJG A;  1C3B A;  3G32 A;  5EV0 A;  5FQI A;  1PIO A;  2BG1 A;  2OAP 1;  5FA7 A;  3T4K A;  2WGI A;  4F3L B;  3NOT C;  3FG8 A;  3S22 A;  1UWP X;  4QU3 A;  2WKI A;  3WRZ A;  2E8I A;  1XX2 A;  3GMW A;  1FR1 A;  4YWZ A;  4L0L A;  3G2Y A;  5E2G A;  3GSG A;  4GW9 A;  4XUZ A;  2XH9 A;  1E25 A;  1K54 C;  5FDH A;  1BT5 A;  1GSX A;  4OP8 A;  2ZC3 B;  4WMC A;  4ARZ B;  3PHY A;  4X53 A;  3JYI A;  4GNU A;  1LSX A;  1FQG A;  2NUP C;  2XA7 S;  5MC7 A;  2JBF A;  4JPM A;  1ZG4 A;  5FL3 A;  4F3L A;  4BQM A;  4IBR A;  4QY6 A;  5FQ9 A;  5IHV A;  3V50 A;  2J3T C;  3OPH A;  4QB8 A;  5F6A A;  2J3T D;  3OPL A;  4EQ1 A;  2PDR A;  4JGP A;  4E04 A;  3UB9 A;  4ZRR A;  1YPR A;  4UA7 A;  4OPY A;  2Y2K A;  1SDN A;  1MWR A;  1S6R A;  4G3W A;  1OTI A;  3Q1F A;  1HVB A;  5FEG A;  4NG2 A;  4ARZ A;  3MS6 A;  2PYP A;  5HL1 A;  1XXM A;  4OPZ A;  1JVJ A;  2XLN A;  1IYP A;  1JWZ A;  3W4Q A;  1GA9 A;  3F1N B;  2ZMV A;  2QYB A;  3LR4 A;  5EPH A;  5CGX A;  3MFX A;  3OOV A;  3VP4 A;  4ZJ2 A;  3E2L A;  3RTY A;  1WA9 A;  3HUO A;  1VQQ A;  1S66 L;  1K38 A;  2JKR M;  4KZ7 A;  2L0W A;  2QMI A;  1SKF A;  2BLS A;  4E6W A;  3N8L A;  1WE4 A;  4FCF A;  1ONG A;  3PBN A;  5AQB A;  1GSV A;  2XQZ A;  4WEK A;  2X71 A;  1BLS A;  4XT2 B;  1PZP A;  3HLF A;  1L0D A;  3F1N A;  4OQ0 A;  1YT4 A;  2NUT C;  3QP4 A;  2PAV P;  3CWF A;  3E0Y A;  1IEL A;  4Y5F A;  4FOF A;  5DF9 A;  3TG9 A;  3G2Z A;  4BBU A;  4ZBE A;  4U0T A;  2HDS A;  3HLC A;  1N9O A;  4WYY A;  3VSK A;  1TDG A;  1MXO A;  4E6X A;  1FCM A;  4O7D A;  1NLZ A;  4DE2 A;  2ZC7 A;  4KUO A;  4XT2 A;  2JE5 A;  1NY0 A;  1O07 A;  2ZM0 A;  3IHB A;  3NDE A;  3PTE A;  3MJQ A;  1BLP A;  1D1J A;  5A91 A;  4NEE D;  4GDN A;  2H10 A;  3HRE A;  2DNS A;  1K55 A;  5JYO A;  4OOY A;  5HSQ A;  1CEF A;  4MNR A;  3SS5 A;  3W2Z A;  3O88 A;  3MZF A;  5DF7 A;  2WKE A;  1YMS A;  4DE1 A;  2W27 A;  4LGW A;  3JPU A;  5BOH A;  1CK3 A;  3LIB A;  4CJN A;  3HLG A;  1VHM A;  1IYS A;  2OAQ 1;  5AQ9 A;  3T1X A;  2ZOH A;  1MZU A;  2C6W B;  3QP6 A;  1JTD A;  3ZNT A;  1CI8 A;  4RYE A;  2V1B A;  1BUE A;  5HL6 A;  1KVM A;  2K31 A;  4GD6 A;  4JLF A;  2JHE A;  3E2K A;  2XR0 A;  1FIK A;  2J9P A;  2V9A A;  1MKI A;  1W8Y A;  2HGV A;  4R3B A;  4AFI A;  1NZU A;  5FQJ A;  1RGY A;  4YOF A;  4IVI A;  3KO6 A;  3LFV A;  2C5W B;  1N9L A;  2HDR A;  2Q9N A;  1T18 A;  3MSH A;  4NET A;  4R0Q A;  1TS6 A;  4BWI A;  5L8M A;  3Q07 A;  2Y79 A;  5EVE A;  2XDM A;  2QKP A;  4I3A A;  3UPO A;  3FV7 A;  1H8Z A;  1AWI A;  4IUH A;  1K6S A;  1V9Y A;  4KG6 A;  2K2N A;  2E8J A;  5JYP A;  1O7E A;  4ID4 A;  2M7V A;  3W8K A;  4KZ8 A;  4MBK A;  1K54 A;  4HES A;  3F1P A;  3PBO A;  1DJC A;  1IKI A;  1FCO A;  5AQA A;  1XJ4 A;  3CJM A;  2H0Y A;  5HAQ A;  1STZ A;  3CZD A;  5HAI A;  5CEB A;  3PYP A;  3H82 B;  2OWH A;  2HF6 A;  1MWS A;  5HDD A;  4LV3 A;  2ACG A;  1Z6F A;  4XUX A;  4MBH A;  5FAS A;  1TVF A;  2ZQD A;  4JXV A;  1I5Q A;  4PAU A;  3TRC A;  4DXB A;  3LCE A;  2Y2L A;  4B4Z A;  4Q0I A;  1GHM A;  3ZG5 A;  4X55 A;  4UAA A;  1YLW A;  2EXB A;  5J7E A;  2DCF A;  1WYC A;  2Y2O A;  5E2F A;  4GZB A;  1BUL A;  2X02 A;  5DTK A;  5EEC A;  2J8Y A;  4JKT A;  1CQA A;  1EW0 A;  3QP2 A;  4P6Z M;  3H82 A;  3SS3 A;  3NI9 A;  4KZ4 A;  2GNX A;  3W4P A;  3ZVT A;  3WS4 A;  1UWN X;  2ZL1 B;  1XPB A;  3P09 A;  3HVF A;  2Z2L B;  4WZ5 C;  3ZGA B;  2W1R A;  4LLO B;  2VV7 A;  3HJI A;  4OOL A;  4U0X A;  3BM6 A;  5DVA A;  2WZZ A;  3RFB A;  2PR6 A;  4E3K A;  4YFM A;  3ZG7 B;  4MLL A;  2ZC4 B;  4KG2 A;  3BLM A;  2ZBB A;  5FI2 A;  2K7S A;  4O01 A;  3T4Q A;  4NXB A;  4YIN A;  3HCY A;  4EBN A;  4Y0U A;  4Y0O A;  3G30 A;  2VGJ A;  2HP9 A;  5CHJ A;  2GJ3 A;  2L1M A;  2Y2Q A;  1PYY A;  3T4L A;  4E3I A;  1U60 A;  2O99 A;  4QD4 A;  1CF0 A;  4D60 A;  2EFU A;  1G28 A;  3LEZ A;  1OTE A;  2VGK A;  2Y2G A;  5GHY A;  4ZTK A;  5FAO A;  3UPN A;  4Y2F A;  4ETX A;  4FTX A;  5F1F A;  5DJU A;  1MKM A;  2R78 A;  3FWL A;  4GKU A;  4BMW A;  5KZH A;  3VP0 A;  4R1G A;  1LSV A;  3A3J A;  4LFU A;  2HDU A;  3P98 A;  1SHV A;  4ZJ1 A;  3TJZ C;  2P7J A;  4L9E A;  1LL5 A;  1W63 M;  5F5Y A;  1H8M A;  2XEP A;  4Y7P A;  2R9W A;  5FAP A;  1L2S A;  2QWS A;  1XJ3 A;  5GLC A;  3MMH A;  1G6A A;  1NJ4 A;  3IQA A;  3UO9 A;  5EM1 A;  1Q2Q A;  3TE8 A;  2DRW A;  4NXF A;  1RGZ A;  5CGW A;  1KVL A;  3LIA A;  4HHD A;  1KE4 A;  2EX6 A;  4Z1W A;  5F69 A;  5GLB A;  3M6H A;  1Y28 A;  1LHY A;  3IF5 A;  2EXA A;  3DTI A;  3WS1 A;  2M7U A;  4OOM A;  4Y13 A;  1E3U A;  1G5U A;  3VOZ A;  1ES5 A;  3CMZ A;  1TEM A;  4DE0 A;  2A3U A;  4UQI M;  3BLS A;  3MZE A;  4ME4 A;  1MC0 A;  4RX2 A;  5FI6 A;  4GCZ A;  3Q81 A;  4WBG A;  1ES3 A;  3NBL A; 
#chains in the Genus database with same CATH homology
 4KZ7 A;  1YLJ A;  2QMI A;  1SKF A;  2BLS A;  4N92 A;  4E6W A;  4EUZ A;  2H0T A;  3N8L A;  1WE4 A;  4UHU A;  1E3U D;  4KZ3 A;  1GHI A;  1ONG A;  3PBN A;  4FCF A;  2WAE A;  1M6K A;  1VM1 A;  3UE0 A;  4DF6 A;  1PI5 A;  3AGE A;  1KDS A;  4OLD A;  4WZ4 A;  4PM8 A;  3ZG8 B;  1XP4 A;  5AQB A;  2XQZ A;  5EOO A;  4OH0 A;  4R23 A;  2G2W A;  3A3D A;  4WEK A;  2X71 A;  1DJA A;  1BLS A;  1XGJ A;  1K56 A;  2V2F F;  4GD8 A;  3BEB A;  2PU2 A;  1OME A;  5CEC A;  1PZP A;  3HLF A;  1L0D A;  5FAT A;  1S0W A;  4OQ0 A;  2P9V B;  1GCE A;  4C75 A;  4LCM A;  1W7F A;  3RXW A;  1PWC A;  1IYO A;  1YT4 A;  2WAF A;  2HP5 A;  3A3E A;  4N9L A;  4KZ9 A;  4LEN A;  4B88 A;  3GV9 A;  4DRT A;  3M2J A;  4ZJ3 A;  1PW1 A;  3S1Y A;  1K57 C;  1IEL A;  1RP5 A;  2J9O A;  5DF9 A;  1PWD A;  3TG9 A;  4CPK A;  3G2Z A;  3TOI A;  4OPR A;  3UE1 A;  3VMA A;  1JTG A;  1SCW A;  4ZBE A;  4U0T A;  2HDS A;  4BL3 A;  2FFY A;  3HLC A;  3VP2 A;  4WYY A;  1W79 A;  3VSK A;  4WEJ A;  3S4X A;  1GHP A;  1TDG A;  3MKE A;  1MXO A;  1KE0 A;  4OVD A;  4E6X A;  5M18 A;  1FCM A;  3O86 A;  4O7D A;  3W4O A;  2RCX A;  3RJU A;  4OQG A;  5HW3 A;  3ZFZ A;  1NYY A;  4C3Q A;  3MXS A;  4DE2 A;  2ZC5 B;  2QZ6 A;  1IEM A;  5L2F A;  2ZC7 A;  2EX2 A;  5FAQ A;  3VOY A;  4EWF A;  1ZC2 A;  3PBT A;  3QNB A;  5TGF A;  2Y2H A;  2JE5 A;  1NY0 A;  1O07 A;  2ZM0 A;  3C4O A;  2Z2M B;  3IHB A;  2ZC6 B;  1MY8 A;  3NDE A;  1XA7 A;  2Y2M A;  4OKP A;  3PTE A;  3A3F A;  2P9V A;  4P85 A;  1BLP A;  4IED A;  4P0M A;  5A91 A;  5KSH A;  1M40 A;  2IWD A;  2WYX A;  3IF6 C;  3N6I A;  2H10 A;  1TDL A;  4GDN A;  3VSL A;  4Y0T A;  3HRE A;  2J7V A;  2DNS A;  1K55 A;  2RL3 A;  3FKV A;  5JYO A;  4OOY A;  1RCJ A;  3HLB A;  1CEF A;  4MNR A;  4RVA A;  3SS5 A;  4S2N C;  4JBF A;  4RX3 A;  1Y54 A;  4BLM A;  2IWC A;  3O88 A;  3MZF A;  4X68 A;  4NK3 A;  5DF7 A;  4DXC A;  2JC7 A;  2WKE A;  1YMS A;  4DE1 A;  4M3K A;  4D2O A;  4KZ6 A;  4PM6 A;  5BOH A;  5F1G A;  1CK3 A;  4KZA A;  4CJN A;  3IXH A;  2Y2J A;  3HLG A;  5AQ9 A;  1IYS A;  5CHU A;  3DWK A;  3N8S A;  4JF5 A;  3V39 A;  2C6W B;  4KQR A;  5TR7 A;  4LV2 A;  4ZDX A;  2GDN A;  2EX9 A;  1XGI A;  5E2E A;  1JTD A;  3IXG A;  4WZ5 A;  3ZNT A;  2ZD8 A;  1XA1 A;  3SH9 A;  1CI8 A;  4RYE A;  1BSG A;  2ZM2 A;  1BUE A;  5DF8 A;  4UA6 A;  4E3N A;  1KVM A;  3GRJ A;  1ESU A;  2Y2N A;  3LO7 A;  1Q2P A;  4R3J A;  5EVI C;  5A92 A;  3IXB A;  4R4R A;  4GD6 A;  4JLF A;  3SH8 A;  1H5X A;  5CHM A;  1FR6 A;  5EVI D;  3E2K A;  2OLU A;  1IYQ A;  2J9P A;  2XR0 A;  1MKI A;  3VP3 A;  1W8Y A;  2XFT A;  3ZHH A;  4A5R A;  1BLH A;  1LI0 A;  4R3B A;  5FQK A;  1HTZ A;  4PM5 A;  1LLB A;  3OCL A;  3WS2 A;  1NZU A;  5FQJ A;  1RGY A;  2OSU A;  4B4X A;  4QJG A;  4OP5 A;  4IVI A;  4OQI A;  4RA7 A;  2H5S A;  3HUN A;  2JCH A;  4JF6 A;  4KQQ A;  1PWG A;  4S2O A;  2C5W B;  5GLD A;  3G34 A;  4GOG A;  2HDR A;  1KE3 A;  2Q9N A;  2WK0 A;  1KGG A;  3QHY A;  3HUM A;  3HLE A;  3Q7V B;  3ZG9 B;  4DE3 A;  3N4I A;  4NET A;  4R0Q A;  3UN7 A;  3VP1 A;  2Y4A A;  3VFH A;  2WGV A;  3C7V A;  3Q07 A;  4U3T A;  3HLW A;  2Y2P A;  3QNC A;  1HD8 A;  5HAP A;  2PBY A;  3EQV A;  2XDM A;  1DJB A;  2Q9M A;  2XFS A;  2ZLY A;  3GVB A;  1NRF A;  3UPO A;  2HDQ A;  2ZM8 A;  2WUQ A;  2QPN A;  3FV7 A;  4GDB A;  4F94 A;  3NIA A;  3IWO A;  1H8Z A;  3BEC A;  1W8Q A;  3BYD A;  5HFO A;  5FI7 A;  3IH9 A;  1K6S A;  2X01 A;  4KG6 A;  2Y2I A;  4X6T A;  3AGF A;  5CTM A;  4ZAM A;  5JYP A;  4FSF A;  1O7E A;  1K56 D;  2ZJ9 A;  4ID4 A;  1IKG A;  2XK1 A;  1N9B A;  1EI5 A;  3W8K A;  4KZ8 A;  4MBK A;  1K54 A;  1KGF A;  3GQZ A;  4QY5 A;  4P87 A;  2ZQ8 A;  1SDE A;  4OON A;  3UDI A;  3Q7V A;  4HES A;  3PBO A;  1YLT A;  4KZ5 A;  3MZD A;  3LY4 A;  5CER A;  3ZCZ A;  3BFD A;  1DJC A;  3DWZ A;  3ITB A;  1IKI A;  3FKW A;  1ESI A;  1FCO A;  3O87 A;  5AQA A;  3IWI A;  3V5M A;  1BLC A;  1BZA A;  1YM1 A;  2H0Y A;  3CJM A;  1L0E A;  5HAQ A;  4EQI A;  3GTC A;  3V3R A;  3C7U A;  3CZD A;  5HAI A;  5CEB A;  3SH7 A;  3PAG A;  5GL9 A;  2R9X A;  1YLY A;  4UA9 A;  1MWS A;  1W5D A;  4LV3 A;  5EUA A;  1MWU A;  5DTS A;  4BL2 A;  4FH4 A;  1Z6F A;  4XUX A;  1K4E A;  3HBR A;  4MBH A;  4P6B A;  5FAS A;  5I94 A;  4EV4 A;  1TVF A;  5J8X A;  2ZQD A;  2ZQC A;  1I5Q A;  3BFG A;  3EQU A;  4JXV A;  3DTM A;  4X56 A;  3SOI A;  4DKI A;  3DW0 A;  5U47 A;  1WYB A;  2G2U A;  1ONH A;  3C5A A;  4E3M A;  3PBS A;  3BFF A;  4DXB A;  5A93 A;  2CC1 A;  1QMF A;  1I2W A;  5KSC A;  2I72 A;  5EVL A;  3LCE A;  1AXB A;  2Y2L A;  1ERQ A;  4R4S A;  4B4Z A;  1FOF A;  1YLZ A;  1GHM A;  3ZG5 A;  4JF4 A;  4X55 A;  5G18 A;  1FCN A;  4X69 A;  1CEG A;  2Y55 A;  4S2K A;  1YLW A;  4UAA A;  3GR2 A;  1CI9 A;  3OCN A;  2EXB A;  4HBU A;  2DCF A;  1K6R A;  4BEN A;  1K4F A;  1WYC A;  2Y2O A;  1K55 C;  5E2F A;  4GZB A;  4S2P A;  3B3X A;  5GLA A;  2OV5 A;  4MEZ A;  1BUL A;  2X02 A;  5DTK A;  3FYZ A;  5EEC A;  2J8Y A;  1EWZ A;  4JKT A;  4KG5 A;  3NCK A;  1NYM A;  2V20 A;  3BFC A;  4IVK A;  3IHA A;  3BRM A;  3I7J A;  3HLD A;  3SS3 A;  4H8R A;  1E4D A;  3NI9 A;  4KZ4 A;  3W4P A;  3FZC A;  4S2M A;  1NZO A;  3ZVT A;  4OLG A;  2ZMA A;  4K91 A;  3NC8 A;  3WS4 A;  3UE3 A;  1JWV A;  1L0F A;  1XPB A;  3RXX A;  3UDX A;  4DDS A;  1HZO A;  3P09 A;  5CED A;  2HPB A;  3HVF A;  3OZH A;  5E2H A;  2Z2L B;  3C4P A;  4K0W A;  1ERM A;  3M6B A;  3PAE A;  4WZ5 C;  3ZGA B;  1BTL A;  5F83 A;  2EX8 A;  2XD5 A;  4OOL A;  2B5R A;  4E3J A;  3IWQ A;  3BM6 A;  3N7W A;  3O3V A;  4U0X A;  3UY6 A;  5CRF A;  5DVA A;  2HP6 A;  2WZZ A;  3PBR A;  1MPL A;  4BD0 A;  5A90 A;  4EBL A;  2Y59 A;  5FQM A;  1LL9 A;  5HAR A;  2XD1 A;  4S2J A;  1MBL A;  4MBF A;  4N1H A;  2ZQ7 A;  2PU4 A;  4E3K A;  3N8R A;  3M2K A;  4WM9 A;  1N4O A;  4YFM A;  1YMX A;  4MLL A;  5FSR A;  3ZG7 B;  3PBQ A;  5FQQ A;  2ZC4 B;  1I2S A;  4N9K A;  4KG2 A;  3G35 A;  3IXD A;  2A49 A;  3BLM A;  5FI2 A;  5GHZ A;  4BD1 A;  3MFD A;  4E3O A;  4FD8 A;  1L0G A;  4K0X A;  1KDW A;  3WRT A;  1H8Y A;  1QME A;  4FH2 A;  4YIN A;  4EBN A;  1PW8 A;  4Y0U A;  4E3L A;  3UNW A;  4PMA A;  2OLV A;  3IF6 B;  3UPP A;  4Y0O A;  3G30 A;  3ISG A;  2VGJ A;  3G4P A;  4GB7 A;  1YLP A;  2HP9 A;  3OC2 A;  5CHJ A;  5AQ7 A;  3NDG A;  1K57 A;  1PYY A;  2Y2Q A;  1YQS A;  3OPP A;  5DTT A;  4E3I A;  1U60 A;  3D4F A;  3CG5 A;  1C3B A;  3G32 A;  4QD4 A;  5FQI A;  5M1A A;  3SS4 A;  4WEL A;  1ZKJ A;  2EFU A;  1PIO A;  2BG1 A;  4LCL A;  5M19 A;  3MBZ A;  1PI4 A;  5FA7 A;  5GHX A;  5EE8 A;  3LEZ A;  4BJP A;  2WGI A;  2VGK A;  2Y2G A;  4EBP A;  3ZG0 A;  3S22 A;  5GHY A;  5KMW A;  3G31 A;  4JXS A;  4ZTK A;  5FAO A;  4QU3 A;  3UPN A;  3WWX A;  2WKI A;  3WRZ A;  3V3S A;  2E8I A;  1XX2 A;  3IT9 A;  5CGS A;  5F1F A;  1KGE A;  3GMW A;  1ZG6 A;  5HX9 A;  4Z9Q A;  1FR1 A;  4L0L A;  2P74 A;  3FWL A;  3G2Y A;  3ZVW A;  4GKU A;  4DDY A;  4Q8I A;  5CTN A;  5KZH A;  5E2G A;  3VP0 A;  3MKF A;  3GSG A;  1JWP A;  4XUZ A;  4R1G A;  2XH9 A;  1E25 A;  3IF6 A;  3A3J A;  2HDU A;  3P98 A;  2IWB A;  1K54 C;  5EVI B;  1BT5 A;  5FDH A;  4C6Y A;  1SHV A;  4OP8 A;  1K25 A;  4ZJ1 A;  2ZC3 B;  1DY6 A;  4WMC A;  4S2L A;  2V1Z A;  2XGN A;  4S2N A;  3ITA A;  4KZB A;  2WAD A;  4X53 A;  1LL5 A;  3OPR A;  3WS5 A;  3JYI A;  4GNU A;  2ZQA A;  1FQG A;  4QHC A;  2WGW B;  2XEP A;  1ES2 A;  3HL9 A;  4Y7P A;  2JBF A;  4JPM A;  2R9W A;  1ZG4 A;  4PM9 A;  2EFX A;  5FAP A;  1PZO A;  1ALQ A;  3LY3 A;  4BQM A;  4IBR A;  1L2S A;  4QY6 A;  5FQ9 A;  5IHV A;  3V50 A;  4HEF A;  1ES4 A;  3OPH A;  4QB8 A;  5GLC A;  2ZQ9 A;  1FSY A;  3OPL A;  3IH8 A;  1G6A A;  1NJ4 A;  3IQA A;  5D3O A;  3UO9 A;  4JXG A;  5TFQ A;  4WMC D;  4JXW A;  1NXY A;  4PM7 A;  1Q2Q A;  2XF3 A;  1ERO A;  3TSG A;  2UWX A;  4LV1 A;  3UDF A;  1MWT A;  1G68 A;  2WKH A;  3WS0 A;  4XXR A;  2DRW A;  5EOE A;  1RGZ A;  5CGW A;  1KVL A;  4UA7 A;  4OPY A;  2Y2K A;  1KE4 A;  4IBX A;  1SDN A;  1MWR A;  1S6R A;  2EX6 A;  5EVI A;  3Q1F A;  1HVB A;  4KQO A;  5GLB A;  3M6H A;  1LHY A;  4HBT A;  3NY4 A;  2Y91 A;  3IF5 A;  2EXA A;  5E43 A;  4KEN B;  5CXW A;  4S2I A;  1LI9 A;  3WS1 A;  3ZNY A;  5HL1 A;  3Q7Z A;  1XXM A;  3BFE A;  4OOM A;  4OPZ A;  4N1X A;  1JVJ A;  2WGW A;  2XLN A;  3MXR A;  1IYP A;  1JWZ A;  3W4Q A;  1XKZ A;  5F82 A;  1GA9 A;  1E3U A;  3Q82 A;  1FSW A;  5EPH A;  5CGX A;  3VOZ A;  1GA0 A;  1ES5 A;  3CMZ A;  3ZDJ A;  3VP4 A;  3A3I A;  4ZJ2 A;  4LV0 A;  2FFF B;  1TEM A;  4DE0 A;  2A3U A;  4OPQ A;  3E2L A;  3BLS A;  3AGD A;  3MZE A;  3HUO A;  1VQQ A;  2WZX A;  4RX2 A;  4GN2 A;  4OQH A;  5FI6 A;  3Q81 A;  1J9M A;  4WBG A;  3VFF A;  1ES3 A;  1K38 A;  3NBL A;  4PPR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...