4F94A

Structure of the class d beta-lactamase oxa-24 k84d in acyl-enzyme complex with oxacillin
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
245
structure length
245
Chain Sequence
b'MHISSQQHEKAIKSYFDEAQTQGVIIIKEGKNLSTYGNALARANKEYVPASTFDMLNALIGLENHKATTNEIFKWDGKKRTYPMWEKDMTLGEAMALSAVPVYQELARRTGLELMQKEVKRVNFGNTNIGTQVDNFWLVGPLKITPVQEVNFADDLAHNRLPFKLETQEEVKKMLLIKEVNGSKIYAKSGWGMGVTPQVGWLTGWVEQANGKKIPFSLNLEMKEGMSGSIRNEITYKSLENLGII'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactamase
publication title Structure of the Class D Beta-Lactamase OXA-24 K84D in Acyl-Enzyme Complex with Oxacillin
rcsb
source organism Acinetobacter baumannii
molecule tags Hydrolase/antibiotic
total genus 79
structure length 245
sequence length 245
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2012-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00905 Transpeptidase Penicillin binding protein transpeptidase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 4f94A00
1Y54A 3UNWA 2J9PA 4LCLA 1L2SA 1IKGA 3HREA 3BLMA 4DXCA 2WAEA 4KQQA 1AXBA 4IBRA 1DJAA 2WGVA 4ID4A 2HDRA 2P9VB 3BFFA 3LEZA 4U0TA 1EWZA 1KVLA 4MNRA 2X02A 4S2LA 5CGWA 5CTNA 4MBFA 5FQ9A 2RL3A 5FQIA 1EI5A 3G2ZA 4GB7A 1PWCA 2QZ6A 1SKFA 1BT5A 1H5XA 3QHYA 3NC8A 4MEZA 3VMAA 3UN7A 2Y2GA 4Y0TA 1YLWA 1W8YA 1E3UA 5DF8A 1O07A 2Z2MB 2WYXA 3MZDA 4O7DA 3VP0A 3W4OA 1N4OA 3G4PA 5TR7A 1MWSA 2WAFA 2QMIA 4DE2A 5EPHA 2XD1A 1KE0A 4LCMA 1ZG6A 4Y0UA 1DJBA 1YMXA 4ZBEA 4QY5A 4XUXA 3BFDA 2WZXA 3GSGA 5AQBA 1YLTA 2FFYA 1FOFA 4A5RA 2V20A 3TSGA 4EV4A 1GCEA 1YLYA 3NI9A 1GHIA 4KG6A 1BSGA 1ES2A 3N8LA 3B3XA 3GV9A 1IEMA 3ITBA 4DE3A 3A3IA 3UDIA 5KSCA 2JE5A 4WBGA 3ZHHA 5E43A 1JVJA 4JXGA 1RP5A 1NJ4A 4E3MA 2WADA 4X6TA 3ZVWA 2IWCA 3ZDJA 3OPLA 4LV3A 3P98A 4RX3A 5HARA 3VOZA 3Q82A 3IF6A 1FCOA 4KG5A 2VGKA 5G18A 5GLCA 1ERQA 4HBUA 5FATA 3TOIA 2HP6A 3W8KA 3IWIA 3O88A 2EX9A 3WRTA 2XF3A 2Y2OA 5CRFA 1H8ZA 1BZAA 1KGFA 5HAIA 3Q81A 2C6WB 1YQSA 4JLFA 5FI7A 4ZJ2A 3NDGA 5DF7A 1E4DA 3BRMA 4N1XA 5E2FA 5I94A 1K57C 2IWBA 1K6RA 4X56A 4RA7A 3HVFA 3A3FA 4P6BA 4OQIA 4KZ9A 3QNBA 1WE4A 1XPBA 3MXSA 1HZOA 4UAAA 1BUEA 4KQOA 4RVAA 4C6YA 1XXMA 4ZDXA 4GN2A 4S2KA 2PU4A 1L0EA 1FCNA 3SOIA 3NDEA 4KZ7A 1ES5A 1J9MA 2Z2LB 5KMWA 3TG9A 2UWXA 1ERMA 1JWPA 1TDGA 2ZQDA 4OKPA 4DKIA 4Y0OA 1XP4A 1M6KA 5FDHA 3N6IA 4PM5A 4D2OA 2J8YA 2WGWB 3BECA 4KZ8A 1IKIA 4F94A 3CG5A 1IELA 2HPBA 2ZD8A 4S2NA 3PBSA 5E2EA 1L0DA 4N9LA 3UDXA 5CEDA 1WYCA 5M1AA 4PM8A 4BD1A 4QHCA 4KZAA 3OCLA 3M6BA 2B5RA 4IBXA 3S22A 1XGJA 4S2NC 1I2SA 4ZAMA 4FH4A 1EROA 3G35A 2ZC4B 3FZCA 3C4PA 4QB8A 3UE0A 3V3RA 5DTKA 2WUQA 1SDNA 2XH9A 4WM9A 3CJMA 3D4FA 3HBRA 3ZG0A 3ZFZA 4HEFA 2EXAA 5F82A 2OV5A 2WGIA 2ZM2A 5FASA 4GOGA 2EX8A 3Q7VA 4KZ4A 1SDEA 3DTMA 3W4PA 3CZDA 4S2OA 1N9BA 2BG1A 2WKHA 1K55C 5D3OA 1HD8A 5DF9A 4MLLA 1ZC2A 3MBZA 5U47A 1Q2PA 1NYMA 4UHUA 4EBLA 3HLDA 1KGGA 3FYZA 4JKTA 1M40A 4E3IA 4WELA 1TVFA 1LL9A 2ZM8A 3FV7A 2Y2LA 3IHBA 3IXGA 4C3QA 4UA7A 3SS4A 1VM1A 3UE1A 5A92A 4JBFA 2JBFA 2Y2NA 3G34A 2EFXA 3BFGA 5EOOA 2ZC7A 3UPPA 3SH9A 4GDNA 1BLSA 2XR0A 4R4SA 1PZPA 3V39A 4BJPA 3JYIA 4EQIA 4EWFA 4DF6A 4KENB 4NK3A 4RX2A 4BLMA 3MKFA 1KDWA 4FSFA 2I72A 5CXWA 1MY8A 4PM7A 5CECA 2ZQAA 1NZOA 1GHMA 4JXWA 3IH9A 3HLWA 4RYEA 4ZTKA 5GHZA 5GLDA 5A90A 3VP1A 5CHUA 4KZ6A 2PBYA 3AGDA 3EQVA 3S4XA 4HBTA 4OP8A 4OPRA 3ZCZA 3MFDA 4R3JA 4P0MA 3HUNA 5FQKA 1E25A 3AGEA 1S0WA 3BLSA 3PAEA 3ZGAB 4OPYA 1O7EA 3ITAA 1DJCA 2Y2JA 3GR2A 4Y7PA 2ZMAA 2ZC6B 2H0YA 3RXXA 4S2IA 1BULA 5FAOA 4XXRA 1TDLA 3DWZA 4QU3A 3HLFA 4WZ5A 2Y55A 1HTZA 5CGXA 5DVAA 4X68A 3ZG5A 4CJNA 4GD6A 1GHPA 1G68A 2Y59A 3E2LA 1MWTA 1HVBA 2CC1A 2H5SA 5DTSA 4KQRA 4WZ5C 1XKZA 5CTMA 4LV2A 4GNUA 1K25A 5EVID 3S1YA 4KG2A 2HDQA 1NXYA 1I5QA 3WS5A 3C7UA 1W79A 5A93A 1VQQA 3PBNA 1JWZA 5FQMA 3HLCA 1FSYA 4WYYA 1KGEA 3GRJA 4Q8IA 3SH7A 4H8RA 1K56D 1RCJA 5E2GA 2C5WB 3IF6C 1WYBA 3ISGA 2EFUA 3UPOA 1L0FA 4E3KA 3P09A 3HLBA 3MZFA 2Y2PA 2XFTA 3UE3A 5EUAA 5GL9A 4ZJ1A 3VFHA 1BLPA 1IYSA 1PW8A 5EECA 3SS5A 1CEGA 4R23A 4U3TA 3BFCA 2H0TA 1FQGA 1IYPA 2V1ZA 1JTDA 4BL3A 5FI2A 2HP5A 5JYPA 5FSRA 3LCEA 2ZQCA 3IF6B 3A3JA 2G2UA 1FR6A 4DRTA 5GHXA 5AQAA 3ZNTA 4OLDA 4B4ZA 4E3OA 1ESIA 1I2WA 3DW0A 1RGZA 2XD5A 4MBHA 2EXBA 3Q7ZA 3OPHA 1PZOA 1YT4A 2Y91A 3NCKA 3CMZA 2J9OA 4HESA 1KDSA 5CHMA 5IHVA 4E6XA 1GA9A 1K6SA 3UO9A 3W4QA 1CEFA 2HDUA 2P74A 3HLGA 1NY0A 1ONGA 3PBQA 4K0XA 2X71A 3VP4A 5M19A 4R3BA 1MKIA 2XQZA 4GD8A 3FWLA 1G6AA 3E2KA 4IEDA 4OQGA 1U60A 3EQUA 3GQZA 4X53A 4EUZA 4N9KA 2ZJ9A 4OONA 4NETA 4BD0A 4OH0A 4WZ4A 3PAGA 4PPRA 4YFMA 2E8IA 2EX2A 2FFFB 2Y2KA 3UY6A 3WWXA 3MXRA 4KZ3A 4IVKA 2XGNA 4E3JA 2VGJA 4MBKA 1ES4A 1KVMA 3G2YA 3M6HA 1L0GA 1YLZA 2Y2MA 4FCFA 3C7VA 3GTCA 1FR1A 5HFOA 2Y4AA 5TGFA 5EVIA 1PI5A 3ZG8B 3C4OA 3V3SA 3A3DA 3V5MA 1PYYA 3LO7A 3IWQA 3BM6A 4JF6A 4S2JA 5FA7A 1DY6A 2DCFA 5BOHA 5EVIC 5CGSA 2XDMA 3GMWA 5FAQA 3RJUA 2HDSA 4P85A 5HAPA 2XK1A 4OPQA 3IQAA 2RCXA 4S2PA 3N8SA 5A91A 5CERA 4DE0A 3OPRA 3UDFA 3AGFA 5L2FA 3VSKA 2PU2A 3BEBA 4CPKA 3Q7VB 2WZZA 1LHYA 4B88A 3OC2A 4BENA 2IWDA 1FSWA 2G2WA 4JF4A 2QPNA 3N4IA 3O87A 3HUOA 4JF5A 3IF5A 3VP2A 2WKEA 1IYOA 4OQHA 1MWRA 1YLJA 1Q2QA 4BL2A 3OZHA 1LI9A 2HP9A 5FQJA 4OOLA 3Q07A 5AQ9A 1W7FA 3MKEA 3ZVTA 4B4XA 2ZM0A 1IYQA 2OLUA 3C5AA 4PM6A 1YM1A 5E2HA 4GZBA 4QJGA 1PW1A 3MZEA 2JCHA 3BFEA 5J8XA 1JTGA 3O86A 3G30A 4KZBA 2Q9MA 2Y2IA 2ZLYA 5TFQA 4PM9A 4OOYA 4YINA 4P87A 4M3KA 4UA9A 4ZJ3A 4GKUA 4N1HA 1OMEA 1FCMA 5EE8A 2V2FF 1ZG4A 3QNCA 4LENA 4C75A 5KZHA 3A3EA 4R4RA 5EOEA 4BQMA 4WMCD 4Z9QA 3IWOA 4L0LA 3HLEA 1QMFA 4OVDA 1BLHA 4LV1A 3LY3A 2ZQ8A 5HL1A 1GA0A 4UA6A 1CK3A 3FKWA 2OSUA 3M2JA 2ZQ7A 4E6WA 5HX9A 3RXWA 1RGYA 2R9WA 2R9XA 4K0WA 1SHVA 3IXHA 1K38A 1S6RA 3IHAA 3PBTA 1ALQA 5CEBA 5HAQA 2XFSA 4E3NA 5M18A 3VOYA 1K54A 1W5DA 3ZG7B 2Y2HA 5F1GA 1LI0A 1LLBA 1YMSA 4N92A 4QY6A 3SH8A 5KSHA 3NBLA 1W8QA 4DE1A 3DWKA 5JYOA 3VP3A 5CHJA 3V50A 3SS3A 1PIOA 1K54C 1K57A 4GDBA 5GLBA 5F1FA 1JWVA 2H10A 2DRWA 2Y2QA 1TEMA 3NY4A 4U0XA 2X01A 3WS2A 3M2KA 3Q1FA 3WS1A 1ESUA 3HUMA 5FAPA 4XUZA 4DDSA 1C3BA 4QD4A 2XLNA 4JXSA 2WGWA 1H8YA 1E3UD 4OOMA 1ONHA 3ZNYA 3UPNA 3PBOA 3HL9A 1MBLA 1ZKJA 4LV0A 1XGIA 5GLAA 4DDYA 1Z6FA 2J7VA 4R1GA 4DXBA 1YLPA 4WEKA 2JC7A 2BLSA 3G32A 5FQQA 3LY4A 3PBRA 3BYDA 4WEJA 1PWDA 5FI6A 2Q9NA 2A49A 4EBNA 4EBPA 1CI9A 5GHYA 4K91A 2ZC3B 5DTTA 2GDNA 1ES3A 1LL5A 4X69A 3ZG9B 3IXBA 1QMEA 4E3LA 1PI4A 2EX6A 3O3VA 1XX2A 2DNSA 4OP5A 2ZQ9A 3OPPA 4JPMA 3I7JA 3VFFA 3G31A 1K4EA 1XA7A 4WMCA 1NZUA 2OLVA 3FKVA 1XA1A 1KE4A 1NYYA 3N8RA 4KZ5A 3VSLA 4FD8A 5HW3A 2A3UA 2P9VA 1CI8A 1K56A 1MXOA 1K55A 2WK0A 2XEPA 4OPZA 5AQ7A 3WRZA 4FH2A 4PMAA 4OQ0A 1PWGA 3GVBA 4OLGA 5F83A 4S2MA 3N7WA 1BLCA 3IH8A 3PTEA 4JXVA 3WS0A 5EVLA 2WKIA 4IVIA 3NIAA 1BTLA 3IT9A 4X55A 1SCWA 3WS4A 1MPLA 1K4FA 1NRFA 1MWUA 3OCNA 2ZC5B 3IXDA 5EVIB 1KE3A 4R0QA
chains in the Genus database with same CATH superfamily
2J9PA 1IKGA 3BLMA 2PYRA 4ID4A 3BFFA 4U0TA 5CGWA 4MBFA 2RL3A 1SKFA 1BT5A 4MEZA 1FILA 3D72A 2V1BA 2WYXA 4L9FA 1N4OA 1MWSA 2WAFA 1YSQA 2QMIA 4DE2A 4ETXA 2Q0OA 1KE0A 4MN5A 4Y0UA 1DJBA 1OT9A 5HDCA 1LL8A 3VE3A 2QHKA 1GCEA 3D9YA 3A3IA 4WBGA 5E43A 2PAVP 1DP6A 1RP5A 2WADA 4UEYA 3ZDJA 2WKRA 5HDSA 3E0YA 3VOZA 2K2NA 4KQDA 5J3WA 2VGKA 2VZWA 5GLCA 2VV8A 2EX9A 3WRTA 2XF3A 2Y2OA 3G6OA 2Y8HA 4HJ3A 1YQSA 5FI7A 5L07A 2IWBA 3A3FA 3QNBA 3T4SA 4X1MA 1HZOA 4HIAA 1BUEA 3LIBA 2OAP1 2PU4A 4KZ7A 2HJEA 2Z2LB 3R7WA 5KMWA 4GJ4A 1ERMA 3MFXA 1JWPA 4DKIA 2PYPA 1M6KA 3BECA 1IELA 2HPBA 4S2NA 2HJ9C 4LRYC 5E2EA 3MS6A 1L0DA 1XJ2A 4KZAA 3IS2A 3M6BA 2B5RA 3CHWP 4IBXA 5EVEA 1XGJA 4S2NC 1I2SA 4ZAMA 3G35A 2D01A 2ZC4B 3UE0A 3V3RA 4WM9A 3CJMA 3HBRA 3FG8A 2OV5A 2QJ7A 2EX8A 1XJ4A 1SDEA 3CZDA 4S2OA 4GLQA 3JVVA 4WLAA 4X25A 4HHDA 1Q2PA 4UHUA 3HLDA 3FYZA 1M40A 5KIZA 2XA7M 1TVFA 1LL9A 3FV7A 3V67A 4UA7A 1VM1A 3KYQA 2Y2NA 2VGLM 2KOIA 4JGPA 4R4SA 4EQIA 3JYIA 2PHYA 4KENB 1KDWA 4PM7A 2ZQAA 1GHMA 4HJ6A 2QKPA 2M7UA 2W3FA 3CLOA 4ZTKA 5GHZA 5A90A 4OP8A 1E25A 1S0WA 3LGOA 4OPYA 4Y7PA 4IUKA 2ZMAA 3RXXA 2KDKA 4S2IA 4XXRA 3T1SA 3HLFA 5DVAA 2VA0A 4X68A 3ZG5A 4GD6A 2Y59A 1HVBA 2CC1A 2L1MA 4YOFA 5DTSA 4KQRA 3PYPA 2HDQA 4R6LA 3KSIA 3NOUC 2HV1A 3O5YA 3EWKA 1KGEA 1K56D 5FEFA 3ISGA 3A0SA 3P01A 1L0FA 4E3KA 3P09A 3MZFA 5GL9A 3UB5P 2H0TA 1FQGA 1JTDA 3T4LA 5IS1A 5FI2A 2HP5A 1S1ZA 2ZQCA 1XJ3A 4PAUA 1FR6A 3ZNTA 4OLDA 2BASA 3CPTA 2EXBA 2J9OA 5CHMA 1YKDA 3T1XA 1NY0A 3PBQA 4K0XA 2X71A 5M19A 3FWLA 1GSXA 1U60A 2EA9A 2ZJ9A 4N9KA 3OBFA 1LSVA 2EX2A 3LI8A 3MXRA 4IVKA 3R7WB 2NUPC 2VGJA 3B47A 1L0GA 1UGUA 5HFOA 4JGQA 1PI5A 3ZG8B 3LI9A 4EXOA 3BM6A 3IS2B 5FA7A 1DY6A 5BOHA 4BBUA 1OTBA 1V9YA 4P85A 3IBRA 1D06A 3N8SA 4CLCE 3H82B 4WL9A 3UDFA 2PU2A 4CPKA 2LB5A 1LHYA 4B88A 3KYEA 4EERA 4JF4A 3O87A 3HUOA 4G3KA 3VP2A 4OQHA 4R38A 4BL2A 2HP9A 3ULFA 1J3WA 5FQJA 3MKEA 3QP4A 3C5AA 5HDDA 4GZBA 1BYWA 1TS6A 2ZLYA 4P6ZM 4YINA 1CF0A 4II7A 1YAXA 3IBJA 5KZHA 2FZ0A 1KOUA 1NWZA 4L0LA 4OVDA 3LY3A 4UA6A 3LR4A 5MC7A 4NEED 4LRZE 1ZHHB 3LEQA 5I5LA 1K38A 4WN5A 5CEBA 2XFSA 2V0WA 5CX7A 3ZG7B 4QY6A 1K0KA 3VP3A 1X0OA 5F1FA 1JWVA 1FIKA 3QP1A 4ME4A 5FAPA 1ONHA 2AVXA 3PBOA 3HL9A 4EEUA 1MBLA 1XGIA 3SW1A 2J7VA 2K7SA 4DMZA 1S66L 2JC7A 3EGDC 3BYDA 4EBPA 3CPTB 4MCWA 4K91A 4EQ1A 1ES3A 3ZG9B 1OTEA 1QMEA 3HJIA 2O0YA 3O3VA 4OP5A 2ZQ9A 3I7JA 3VFFA 4H6JA 1HLUP 3VSLA 5DKLA 5AVFA 2A3UA 2WK0A 1MXOA 3WRZA 3P7NA 4JGRA 3LR5A 5F83A 2HGVA 1L3LA 3A0VA 2J3TD 1F98A 2WKIA 3IT9A 4X55A 1STZA 3OCNA 1VEUA 2E8JA 1YSPA 2FH5A 4X1LA 1L2SA 3HREA 3KX0X 1SKOA 1AXBA 2JKRI 2WGVA 4CQHA 3LEZA 1EWZA 4S2LA 1WA9A 5EM1A 1YLWA 3W4OA 3G4PA 1OPXA 4UQIS 3S7QA 4NXBA 4QY5A 4XUXA 2WZXA 1FOFA 4HI4A 2V20A 5DFYA 1BSGA 1TS0A 3N8LA 3GV9A 1IEMA 3UDIA 1JVJA 3ZVWA 3JVUA 3OPLA 4LV3A 3KO6A 4RX3A 4BMWA 3IF6A 4KG5A 3BQAA 5G18A 4HP4A 5FATA 3TOIA 3W8KA 3UB6A 4LPZA 2QYBA 1KGFA 4JLFA 2C6WB 1E4DA 3BRMA 4N1XA 5E2FA 1K57C 5HD5A 4NG2A 4X56A 3HVFA 4P6BA 2O99A 2JKRM 1XXMA 4S2KA 1L0EA 1FCNA 1LSXA 3SOIA 3TG9A 3LIEA 1TDGA 4OKPA 3TRCA 4PM5A 1XP4A 4D2OA 4KZ8A 1IKIA 2JKTM 4F94A 3L7HA 5LBRA 3PBSA 3CUEA 4N9LA 3UDXA 3DTKA 5M1AA 2A2LA 2R78A 4FH4A 3C4PA 3QP5A 1UWNX 4QB8A 1SZVA 3TW8A 1SDNA 4BD0A 3D4FA 4LRXC 5F82A 2EXAA 2ZOHA 2ZM2A 3Q7VA 4MDZA 3DTMA 1N9BA 5D3OA 1K55C 5DF9A 4MLLA 5L09A 4EBLA 1NYMA 2OOLA 4E3IA 3MQOA 2ZM8A 4C3QA 2OWJA 3SS4A 4H6JB 1IFQA 2EFXA 4FUWA 4O8GA 2ZC7A 5EOOA 3UPPA 3SH9A 4EWFA 2M7VA 1PZPA 1ZTUA 3MKFA 5F69A 5F68A 1VEUB 4ETZA 4OPRA 4GW9A 2KX6A 1SKOB 3BLSA 5DKKA 3DTIA 1DJCA 2Y2JA 3GR2A 1TDLA 1HTZA 3F1OA 2ZL1A 3FPVA 3EEHA 4LV2A 4GNUA 1K25A 2L4RA 4KG2A 2PR5A 1I5QA 4HOIA 5A93A 1VQQA 3HLCA 4WYYA 3H9WA 3T12B 3GRJA 3SH7A 1OTIA 4H8RA 1F5MA 5G4ZA 1WYBA 1S1YA 2EFUA 5TBMA 3UE3A 3VFHA 5EUAA 4ZJ1A 5EECA 3SS5A 1S4SA 5FSRA 3LCEA 2XA7S 3IF6B 3A3JA 2G2UA 4DRTA 5AQAA 1ESIA 2VGLS 4FOFA 3MJQA 3UPOA 5EV0A 2HDUA 2P74A 1ONGA 5DJUA 2GX5A 2XQZA 2QWSA 3LUQA 4GD8A 1G6AA 3E2KA 3S7NA 3GQZA 2OWHA 4OONA 4NETA 4HP9A 2JKFA 1N9OA 4PPRA 3UY6A 2Y2KA 2H28A 4KZ3A 2XGNA 3H82A 4E3JA 4MMNA 2ZMVA 1KVMA 3G2YA 3RFBA 1G6OA 3LR3A 5A8BA 1FR1A 2O9AA 3C4OA 3V3SA 5C5KA 1PYYA 3VV4A 3IX3A 1DP8A 2XDMA 2RCXA 1MZUA 4B9OA 1Y28A 1G28A 4DE0A 3OPRA 5EFWA 1VHMA 3Q7VB 2WZZA 1PFLA 3OC2A 2W3GA 2QPNA 4JF5A 3IF5A 2WKEA 3T4JA 1IYOA 4AFIA 1MWRA 1Q2QA 3QP6A 1NLZA 4OOLA 5AQ9A 4B4XA 2PD7A 2HF6A 4PM6A 1YM1A 4QJGA 2JCHA 1JTGA 4KZBA 1XFNA 4PM9A 4OOYA 4UA9A 4N1HA 4C75A 3A3EA 4R4RA 5EOEA 4WMCD 3HLEA 4EUVA 2ZQ8A 4PHTA 4EW7A 1CK3A 3M2JA 3F1OB 3KYZA 2ZL1B 4Y15A 1S6RA 3PBTA 1ALQA 1TS8A 1W5DA 4BWIA 5F1GA 1LI0A 3SH8A 1P0ZA 1YMSA 3NBLA 4DE1A 3DWKA 3V50A 5GLBA 2Y2QA 3UMEA 3WS1A 1ESUA 3HUMA 4DJ3A 2BTFP 5TBMB 4DDSA 1C3BA 3KSHA 2XLNA 4JXSA 2WGWA 1E3UD 2VX8A 2V8CA 4XT2A 4LV0A 5GLAA 2OAQ1 1YLPA 4WEKA 3G32A 5FQQA 3LY4A 3LR0A 4WEJA 1PWDA 2B95A 4EBNA 2IA2A 5FEGA 5GHYA 3F1PA 2ZC3B 1GSVA 2GDNA 5DFXA 4GS9A 4Y3IA 1PNEA 4E3LA 4NXGA 1XX2A 2DNSA 3OPPA 4JPMA 4P6ZS 1K4EA 1XA7A 4WMCA 3T1RA 1NZUA 2OLVA 3N8RA 4KZ5A 5HW3A 1K56A 3NULA 4QWOA 4PMAA 4OLGA 4S2MA 1XJ6A 2I9VA 5EVLA 3NIAA 3HCYA 1SCWA 1MPLA 1NRFA 1MWUA 3D3OA 1Y54A 3UNWA 4DXCA 4KQQA 4IBRA 2P9VB 4MNRA 2VV6A 4GB7A 1PWCA 5J4EA 3VMAA 3NC8A 3UN7A 4IHQA 1E3UA 5DF8A 4O7DA 2UV0E 1ZG6A 2W0NA 4ZBEA 2GZAA 3BFDA 4HQAA 4A5RA 2PDRA 4EV4A 1YLYA 3NI9A 1GHIA 4KG6A 4HH2A 3K3CA 2P04A 5KSCA 4M4XA 3ZHHA 1NJ4A 5HARA 3Q82A 1N9LA 1FCOA 4GCZA 4HBUA 2HP6A 1CJFA 3EGXC 3KSFA 5CRFA 1H8ZA 4QPRA 3Q81A 4CLCD 4ZJ2A 3NOPC 3BJNA 1K6RA 3CWFA 4R3AA 4OQIA 1WE4A 1XPBA 3FPWA 3MXSA 4UAAA 4KQOA 4RVAA 4C6YA 4ZDXA 4Y17A 5FDSA 5F6AA 3MSHA 1ES5A 1S4RA 2UWXA 4Y2FA 2V8FA 2M1CA 2GJ3A 3EOIA 3N6IA 1TS7A 2WGWB 2ZMFA 4XT2B 1EW0A 1WYCA 4BD1A 2O9BA 3RH8B 3OCLA 3CITA 2VKSA 3S22A 2XRNA 1EROA 3FZCA 2B18A 3LIAA 5DTKA 2WUQA 3PXPA 3ZFZA 1TD5A 3ZG0A 4PKYA 5HSQA 3LIFA 5FASA 4GOGA 3F1PB 3BY8A 1W63M 3W4PA 4GS9B 3T50A 5U47A 3MBZA 5HL6A 4KUKA 1KGGA 4JKTA 2PRFA 4WELA 3IHBA 2Y2LA 3IXGA 4I3AA 5A92A 2JBFA 3G34A 3BFGA 2WKPA 1BLSA 3V39A 4BJPA 2V1AA 3GDIA 1H8MA 4BLMA 4CLCA 4LFUA 4FSFA 3EEAA 5CECA 4JXWA 1P9RA 4RYEA 5GLDA 4I5SA 2G7UA 3VP1A 3EQVA 4P0MA 3HUNA 3AGEA 3PAEA 1AWIA 1O7EA 3ITAA 4NXFA 2VLGA 1Z09A 2ZC6B 2H0YA 1BULA 5FAOA 4WZ5A 2Y55A 2GNXA 1GHPA 1G68A 1S67L 4WZ5C 3ZQ5A 1DRMA 5EVID 5AJGA 4ARZA 3BQ8A 3WS5A 3C7UA 1W79A 2VEAA 3PBNA 1JWZA 4PKYG 1FSYA 5E2GA 5EM0A 3MF0A 2P08A 3IF6C 3HJKA 3RTYA 5J7EA 2B02A 1TF1A 1IYSA 2J3TC 1CEGA 4R23A 3BFCA 3LIDA 1IYPA 2V1ZA 4BL3A 2PT7A 2A24A 4HY8A 4E3OA 4B4ZA 3QP8A 1I2WA 2XD5A 4MBHA 2PR6A 2ACGA 3CI6A 1YT4A 2Y91A 4HESA 3CMZA 4E6XA 5L10A 1GA9A 1K6SA 3UO9A 1CEFA 4HH3A 1MKIA 4IEDA 4X53A 3EQUA 2W3EA 3TE8A 3CUEC 3PAGA 4WZ4A 4DN0A 2E8IA 1T19A 3WWXA 4R70A 1OTDA 2INWA 3M6HA 4FCFA 3C7VA 3GTCA 2VV7A 5TGFA 5EVIA 3A3DA 3LO7A 2YKFA 4Z1WA 5HWWA 4JF6A 3C30A 3UE6A 2DCFA 5EVIC 5CGSA 3GMWA 3IX4A 5HAPA 1T1AA 2PBDP 4KUOA 2K31A 3AGFA 5L2FA 3VSKA 4BENA 4L9EA 1VB6A 1D1JA 5K5BA 4YNRA 4E04A 1LI9A 3T4TA 3Q07A 1W7FA 2ZM0A 2OLUA 3R4KA 4FTXA 4CLCB 3TJZC 2D02A 1PW1A 3MZEA 5J8XA 2EWWA 2Q9MA 2W1RA 2L0WA 4P87A 4M3KA 5G4YA 2DMWA 4ZJ3A 3VOLA 1OMEA 1FCMA 5EE8A 2V2FF 1ZG4A 3QNCA 4I3IA 4LENA 1G5UA 2O9CA 3MQ0A 3IWOA 1BLHA 4LV1A 3CAXA 2ZOIA 1GA0A 1RGYA 2R9XA 1SHVA 2XROA 4ARZB 3FC7A 5KSHA 2CMNA 4O0PA 1W8QA 5JYOA 1PIOA 4GDBA 2DRWA 1XFQA 1VETA 1TEMA 4WF0A 4ESPA 4XUZA 1N9NA 4OOMA 1MKMA 1ZKJA 3SZTA 4DXBA 3MMHA 2A24B 2JKGA 2BLSA 3PBRA 4Q0JA 1JNUA 1Y4OA 4Y13A 2XSSA 2W3HA 1H3QA 1LL5A 3B33A 2J80A 1PI4A 4GHIA 1ACFA 2EX6A 3ZYTA 3FKVA 1XA1A 1KE4A 1NYYA 2P7JA 4FD8A 3MQQA 2P9VA 4OPZA 4FH2A 4OQ0A 3S7PA 2W27A 3N7WA 1BLCA 4JXVA 3PTEA 2W1TA 3WS0A 1NLYA 5EVIB 2ZC5B 3IXDA 1KE3A 1A0KA 4LCLA 2Y79A 3UB7A 3NOTC 2WAEA 3BY9A 4G3VA 1DJAA 2HDRA 2VJWA 5CTNA 5FQ9A 1KVLA 2X02A 3UMDA 5FQIA 1EI5A 3G2ZA 2QZ6A 4B93A 1PRQA 1H5XA 3QHYA 4EU0A 2Y2GA 4D60A 4Y0TA 1W8YA 1O07A 2Z2MB 3MZDA 3VP0A 4ZRRA 5TR7A 3LYXA 5EPHA 2XD1A 4LCMA 4G3WA 5F5YA 1YMXA 1F9IA 3GSGA 5AQBA 1YLTA 2FFYA 5FL3A 3LFVA 3TSGA 1IOUA 1ES2A 1GSWA 4NXEA 3B3XA 3ITBA 4DE3A 2JE5A 5HPIA 4JXGA 4JGOA 4E3MA 4X6TA 2IWCA 3P98A 2W3DA 1ERQA 1V9ZA 3IWIA 3O88A 1BZAA 1OJGA 5HAIA 3NDGA 5DF7A 4F3LA 5I94A 3PR6A 4RA7A 3F1NA 4KZ9A 4EESA 3PHYA 3UB9A 4GN2A 3NDEA 1J9MA 1VETB 3C2WA 4MN6A 2ZQDA 4Y0OA 5FDHA 3T4QA 2J8YA 3CG5A 4YWZA 2ZD8A 5CEDA 4PM8A 2EWVA 4QHCA 1OJ5A 1D7EA 3E98A 4HJ4A 5HD3A 4IUHA 2MJ6A 2XH9A 4LGWA 4HEFA 1P9WA 3L9KA 2WGIA 4KZ4A 2LB9A 2BG1A 2WKHA 1HD8A 1ZC2A 3IX8A 4GHIB 3JPUA 1T18A 4L9GA 3LICA 3UE1A 4JBFA 4GDNA 2XR0A 1LSWA 3E4PA 4DF6A 4NK3A 4RX2A 5HZHA 2I72A 5CXWA 1MY8A 2W1TB 3GECA 1NZOA 3MXQA 5L8MA 3IH9A 3HLWA 5CHUA 4KZ6A 2PBYA 3AGDA 3S4XA 4HBTA 3ZCZA 3MFDA 4R3JA 3W2ZA 1OTAA 5FQKA 3ZGAB 5HWTA 5IT5A 2Z6CA 3B42A 3DWZA 4QU3A 5CGXA 3C38A 5HWVA 4CJNA 3E2LA 3UB8A 1MWTA 2H5SA 1XKZA 3K2NA 5CTMA 3S1YA 4O01A 1NXYA 1YPRA 3K3DA 5FQMA 3H7WA 2V9AA 4Q8IA 1RCJA 2C5WB 5DJTA 4IJGA 5IU1A 3KSGA 3HLBA 2Y2PA 2XFTA 1BLPA 1PW8A 4U3TA 4Q0HA 3BWLA 5JYPA 2JN7A 1ODVA 5GHXA 3DW0A 1RGZA 3Q7ZA 3OPHA 1PZOA 3NCKA 5IHVA 1KDSA 2ZBBA 3U2AA 3W4QA 3HLGA 4F3LB 4BBVA 3VP4A 4R3BA 2PD8A 3F1NB 2V0UA 3DTEA 4OQGA 4EUZA 3E4QA 3QP2A 4OH0A 3C8CA 4YFMA 2FFFB 5HPFA 5AVEA 1F2KA 4MBKA 1ES4A 1YLZA 2Y2MA 2Y4AA 3V5MA 3IWQA 2NUTC 2Z6DA 4S2JA 3E4OA 1MC0A 5FAQA 3RJUA 2HDSA 4WUJA 2XK1A 4OPQA 3IQAA 4S2PA 3A0RA 4HNBA 5A91A 5CERA 1P97A 4DJ2A 3BEBA 2IWDA 1DP9A 1FSWA 2G2WA 3N4IA 4CLCC 2HZ5A 1YLJA 3T4KA 3OZHA 3ZVTA 1IYQA 5E2HA 2WKQA 3BFEA 2JKTI 3O86A 3G30A 2Y2IA 2KLIA 2QJ5A 5TFQA 4LLOB 4RQ9A 4GKUA 3DBAA 4BBTA 4BQMA 4Y5FA 4MN7A 4Z9QA 2VK3A 1QMFA 4NKPA 4EEPA 5HL1A 3FKWA 2OSUA 2ZQ7A 4E6WA 5HX9A 3RXWA 2R9WA 4K0WA 3MR0A 3IXHA 3IHAA 5HAQA 4E3NA 5M18A 3VOYA 1K54A 3BW6A 2Y2HA 1UWPX 1T1BA 1LLBA 4EETB 4N92A 3ICYA 3H7WB 5CHJA 3SS3A 1K54C 1K57A 2J3WA 2H10A 1T1CA 4U0XA 3NY4A 3WS2A 2X01A 3M2KA 3Q1FA 3T1QB 4I3JA 4QD4A 3VE4A 3T4OA 1H8YA 3ZNYA 3UPNA 3NHQA 4UQIM 4DDYA 1Z6FA 3OLOA 4R1GA 1W63Q 5FI6A 2Q9NA 2A49A 1CI9A 4Q0IA 1CQAA 5DTTA 3DAVA 4X69A 3IXBA 4I38A 3U4LP 3NJAA 3G31A 2JHEA 3S7OA 5AQ7A 1CI8A 1NRJA 1K55A 2XEPA 2YKHA 1PWGA 1H0MA 3GVBA 4K08A 5TJJA 3IH8A 3OOVA 4IVIA 1BTLA 3WS4A 1K4FA 4I39A 1LT0A 1OT6A 4R0QA 3NECA
chains in the Genus database with same CATH topology
1Y54A 3UNWA 2J9PA 4LCLA 1L2SA 1IKGA 3HREA 3BLMA 4DXCA 2WAEA 4KQQA 1AXBA 4IBRA 1DJAA 2WGVA 4ID4A 2HDRA 2P9VB 3BFFA 3LEZA 4U0TA 1EWZA 1KVLA 4MNRA 2X02A 4S2LA 5CGWA 5CTNA 4MBFA 5FQ9A 2RL3A 5FQIA 1EI5A 3G2ZA 4GB7A 1PWCA 2QZ6A 1SKFA 1BT5A 1H5XA 3QHYA 3NC8A 4MEZA 3VMAA 3UN7A 2Y2GA 4Y0TA 1YLWA 1W8YA 1E3UA 5DF8A 1O07A 2Z2MB 2WYXA 3MZDA 4O7DA 3VP0A 3W4OA 1N4OA 3G4PA 5TR7A 1MWSA 2WAFA 2QMIA 4DE2A 5EPHA 2XD1A 1KE0A 4LCMA 1ZG6A 4Y0UA 1DJBA 1YMXA 4ZBEA 4QY5A 4XUXA 3BFDA 2WZXA 3GSGA 5AQBA 1YLTA 2FFYA 1FOFA 4A5RA 2V20A 3TSGA 4EV4A 1GCEA 1YLYA 3NI9A 1GHIA 4KG6A 1BSGA 1ES2A 3N8LA 3B3XA 3GV9A 1IEMA 3ITBA 4DE3A 3A3IA 3UDIA 5KSCA 2JE5A 4WBGA 3ZHHA 5E43A 1JVJA 4JXGA 1RP5A 1NJ4A 4E3MA 2WADA 4X6TA 3ZVWA 2IWCA 3ZDJA 3OPLA 4LV3A 3P98A 4RX3A 5HARA 3VOZA 3Q82A 3IF6A 1FCOA 4KG5A 2VGKA 5G18A 5GLCA 1ERQA 4HBUA 5FATA 3TOIA 2HP6A 3W8KA 3IWIA 3O88A 2EX9A 3WRTA 2XF3A 2Y2OA 5CRFA 1H8ZA 1BZAA 1KGFA 5HAIA 3Q81A 2C6WB 1YQSA 4JLFA 5FI7A 4ZJ2A 3NDGA 5DF7A 1E4DA 3BRMA 4N1XA 5E2FA 5I94A 1K57C 2IWBA 1K6RA 4X56A 4RA7A 3HVFA 3A3FA 4P6BA 4OQIA 4KZ9A 3QNBA 1WE4A 1XPBA 3MXSA 1HZOA 4UAAA 1BUEA 4KQOA 4RVAA 4C6YA 1XXMA 4ZDXA 4GN2A 4S2KA 2PU4A 1L0EA 1FCNA 3SOIA 3NDEA 4KZ7A 1ES5A 1J9MA 2Z2LB 5KMWA 3TG9A 2UWXA 1ERMA 1JWPA 1TDGA 2ZQDA 4OKPA 4DKIA 4Y0OA 1XP4A 1M6KA 5FDHA 3N6IA 4PM5A 4D2OA 2J8YA 2WGWB 3BECA 4KZ8A 1IKIA 4F94A 3CG5A 1IELA 2HPBA 2ZD8A 4S2NA 3PBSA 5E2EA 1L0DA 4N9LA 3UDXA 5CEDA 1WYCA 5M1AA 4PM8A 4BD1A 4QHCA 4KZAA 3OCLA 3M6BA 2B5RA 4IBXA 3S22A 1XGJA 4S2NC 1I2SA 4ZAMA 4FH4A 1EROA 3G35A 2ZC4B 3FZCA 3C4PA 4QB8A 3UE0A 3V3RA 5DTKA 2WUQA 1SDNA 2XH9A 4WM9A 3CJMA 3D4FA 3HBRA 3ZG0A 3ZFZA 4HEFA 2EXAA 5F82A 2OV5A 2WGIA 2ZM2A 5FASA 4GOGA 2EX8A 3Q7VA 4KZ4A 1SDEA 3DTMA 3W4PA 3CZDA 4S2OA 1N9BA 2BG1A 2WKHA 1K55C 5D3OA 1HD8A 5DF9A 4MLLA 1ZC2A 3MBZA 5U47A 1Q2PA 1NYMA 4UHUA 4EBLA 3HLDA 1KGGA 3FYZA 4JKTA 1M40A 4E3IA 4WELA 1TVFA 1LL9A 2ZM8A 3FV7A 2Y2LA 3IHBA 3IXGA 4C3QA 4UA7A 3SS4A 1VM1A 3UE1A 5A92A 4JBFA 2JBFA 2Y2NA 3G34A 2EFXA 3BFGA 5EOOA 2ZC7A 3UPPA 3SH9A 4GDNA 1BLSA 2XR0A 4R4SA 1PZPA 3V39A 4BJPA 3JYIA 4EQIA 4EWFA 4DF6A 4KENB 4NK3A 4RX2A 4BLMA 3MKFA 1KDWA 4FSFA 2I72A 5CXWA 1MY8A 4PM7A 5CECA 2ZQAA 1NZOA 1GHMA 4JXWA 3IH9A 3HLWA 4RYEA 4ZTKA 5GHZA 5GLDA 5A90A 3VP1A 5CHUA 4KZ6A 2PBYA 3AGDA 3EQVA 3S4XA 4HBTA 4OP8A 4OPRA 3ZCZA 3MFDA 4R3JA 4P0MA 3HUNA 5FQKA 1E25A 3AGEA 1S0WA 3BLSA 3PAEA 3ZGAB 4OPYA 1O7EA 3ITAA 1DJCA 2Y2JA 3GR2A 4Y7PA 2ZMAA 2ZC6B 2H0YA 3RXXA 4S2IA 1BULA 5FAOA 4XXRA 1TDLA 3DWZA 4QU3A 3HLFA 4WZ5A 2Y55A 1HTZA 5CGXA 5DVAA 4X68A 3ZG5A 4CJNA 4GD6A 1GHPA 1G68A 2Y59A 3E2LA 1MWTA 1HVBA 2CC1A 2H5SA 5DTSA 4KQRA 4WZ5C 1XKZA 5CTMA 4LV2A 4GNUA 1K25A 5EVID 3S1YA 4KG2A 2HDQA 1NXYA 1I5QA 3WS5A 3C7UA 1W79A 5A93A 1VQQA 3PBNA 1JWZA 5FQMA 3HLCA 1FSYA 4WYYA 1KGEA 3GRJA 4Q8IA 3SH7A 4H8RA 1K56D 1RCJA 5E2GA 2C5WB 3IF6C 1WYBA 3ISGA 2EFUA 3UPOA 1L0FA 4E3KA 3P09A 3HLBA 3MZFA 2Y2PA 2XFTA 3UE3A 5EUAA 5GL9A 4ZJ1A 3VFHA 1BLPA 1IYSA 1PW8A 5EECA 3SS5A 1CEGA 4R23A 4U3TA 3BFCA 2H0TA 1FQGA 1IYPA 2V1ZA 1JTDA 4BL3A 5FI2A 2HP5A 5JYPA 5FSRA 3LCEA 2ZQCA 3IF6B 3A3JA 2G2UA 1FR6A 4DRTA 5GHXA 5AQAA 3ZNTA 4OLDA 4B4ZA 4E3OA 1ESIA 1I2WA 3DW0A 1RGZA 2XD5A 4MBHA 2EXBA 3Q7ZA 3OPHA 1PZOA 1YT4A 2Y91A 3NCKA 3CMZA 2J9OA 4HESA 1KDSA 5CHMA 5IHVA 4E6XA 1GA9A 1K6SA 3UO9A 3W4QA 1CEFA 2HDUA 2P74A 3HLGA 1NY0A 1ONGA 3PBQA 4K0XA 2X71A 3VP4A 5M19A 4R3BA 1MKIA 2XQZA 4GD8A 3FWLA 1G6AA 3E2KA 4IEDA 4OQGA 1U60A 3EQUA 3GQZA 4X53A 4EUZA 4N9KA 2ZJ9A 4OONA 4NETA 4BD0A 4OH0A 4WZ4A 3PAGA 4PPRA 4YFMA 2E8IA 2EX2A 2FFFB 2Y2KA 3UY6A 3WWXA 3MXRA 4KZ3A 4IVKA 2XGNA 4E3JA 2VGJA 4MBKA 1ES4A 1KVMA 3G2YA 3M6HA 1L0GA 1YLZA 2Y2MA 4FCFA 3C7VA 3GTCA 1FR1A 5HFOA 2Y4AA 5TGFA 5EVIA 1PI5A 3ZG8B 3C4OA 3V3SA 3A3DA 3V5MA 1PYYA 3LO7A 3IWQA 3BM6A 4JF6A 4S2JA 5FA7A 1DY6A 2DCFA 5BOHA 5EVIC 5CGSA 2XDMA 3GMWA 5FAQA 3RJUA 2HDSA 4P85A 5HAPA 2XK1A 4OPQA 3IQAA 2RCXA 4S2PA 3N8SA 5A91A 5CERA 4DE0A 3OPRA 3UDFA 3AGFA 5L2FA 3VSKA 2PU2A 3BEBA 4CPKA 3Q7VB 2WZZA 1LHYA 4B88A 3OC2A 4BENA 2IWDA 1FSWA 2G2WA 4JF4A 2QPNA 3N4IA 3O87A 3HUOA 4JF5A 3IF5A 3VP2A 2WKEA 1IYOA 4OQHA 1MWRA 1YLJA 1Q2QA 4BL2A 3OZHA 1LI9A 2HP9A 5FQJA 4OOLA 3Q07A 5AQ9A 1W7FA 3MKEA 3ZVTA 4B4XA 2ZM0A 1IYQA 2OLUA 3C5AA 4PM6A 1YM1A 5E2HA 4GZBA 4QJGA 1PW1A 3MZEA 2JCHA 3BFEA 5J8XA 1JTGA 3O86A 3G30A 4KZBA 2Q9MA 2Y2IA 2ZLYA 5TFQA 4PM9A 4OOYA 4YINA 4P87A 4M3KA 4UA9A 4ZJ3A 4GKUA 4N1HA 1OMEA 1FCMA 5EE8A 2V2FF 1ZG4A 3QNCA 4LENA 4C75A 5KZHA 3A3EA 4R4RA 5EOEA 4BQMA 4WMCD 4Z9QA 3IWOA 4L0LA 3HLEA 1QMFA 4OVDA 1BLHA 4LV1A 3LY3A 2ZQ8A 5HL1A 1GA0A 4UA6A 1CK3A 3FKWA 2OSUA 3M2JA 2ZQ7A 4E6WA 5HX9A 3RXWA 1RGYA 2R9WA 2R9XA 4K0WA 1SHVA 3IXHA 1K38A 1S6RA 3IHAA 3PBTA 1ALQA 5CEBA 5HAQA 2XFSA 4E3NA 5M18A 3VOYA 1K54A 1W5DA 3ZG7B 2Y2HA 5F1GA 1LI0A 1LLBA 1YMSA 4N92A 4QY6A 3SH8A 5KSHA 3NBLA 1W8QA 4DE1A 3DWKA 5JYOA 3VP3A 5CHJA 3V50A 3SS3A 1PIOA 1K54C 1K57A 4GDBA 5GLBA 5F1FA 1JWVA 2H10A 2DRWA 2Y2QA 1TEMA 3NY4A 4U0XA 2X01A 3WS2A 3M2KA 3Q1FA 3WS1A 1ESUA 3HUMA 5FAPA 4XUZA 4DDSA 1C3BA 4QD4A 2XLNA 4JXSA 2WGWA 1H8YA 1E3UD 4OOMA 1ONHA 3ZNYA 3UPNA 3PBOA 3HL9A 1MBLA 1ZKJA 4LV0A 1XGIA 5GLAA 4DDYA 1Z6FA 2J7VA 4R1GA 4DXBA 1YLPA 4WEKA 2JC7A 2BLSA 3G32A 5FQQA 3LY4A 3PBRA 3BYDA 4WEJA 1PWDA 5FI6A 2Q9NA 2A49A 4EBNA 4EBPA 1CI9A 5GHYA 4K91A 2ZC3B 5DTTA 2GDNA 1ES3A 1LL5A 4X69A 3ZG9B 3IXBA 1QMEA 4E3LA 1PI4A 2EX6A 3O3VA 1XX2A 2DNSA 4OP5A 2ZQ9A 3OPPA 4JPMA 3I7JA 3VFFA 3G31A 1K4EA 1XA7A 4WMCA 1NZUA 2OLVA 3FKVA 1XA1A 1KE4A 1NYYA 3N8RA 4KZ5A 3VSLA 4FD8A 5HW3A 2A3UA 2P9VA 1CI8A 1K56A 1MXOA 1K55A 2WK0A 2XEPA 4OPZA 5AQ7A 3WRZA 4FH2A 4PMAA 4OQ0A 1PWGA 3GVBA 4OLGA 5F83A 4S2MA 3N7WA 1BLCA 3IH8A 3PTEA 4JXVA 3WS0A 5EVLA 2WKIA 4IVIA 3NIAA 1BTLA 3IT9A 4X55A 1SCWA 3WS4A 1MPLA 1K4FA 1NRFA 1MWUA 3OCNA 2ZC5B 3IXDA 5EVIB 1KE3A 4R0QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Y54 A;  3UNW A;  2J9P A;  4LCL A;  1L2S A;  1IKG A;  3HRE A;  3BLM A;  4DXC A;  2WAE A;  4KQQ A;  1AXB A;  4IBR A;  1DJA A;  2WGV A;  4ID4 A;  2HDR A;  2P9V B;  3BFF A;  3LEZ A;  4U0T A;  1EWZ A;  1KVL A;  4MNR A;  2X02 A;  4S2L A;  5CGW A;  5CTN A;  4MBF A;  5FQ9 A;  2RL3 A;  5FQI A;  1EI5 A;  3G2Z A;  4GB7 A;  1PWC A;  2QZ6 A;  1SKF A;  1BT5 A;  1H5X A;  3QHY A;  3NC8 A;  4MEZ A;  3VMA A;  3UN7 A;  2Y2G A;  4Y0T A;  1YLW A;  1W8Y A;  1E3U A;  5DF8 A;  1O07 A;  2Z2M B;  2WYX A;  3MZD A;  4O7D A;  3VP0 A;  3W4O A;  1N4O A;  3G4P A;  5TR7 A;  1MWS A;  2WAF A;  2QMI A;  4DE2 A;  5EPH A;  2XD1 A;  1KE0 A;  4LCM A;  1ZG6 A;  4Y0U A;  1DJB A;  1YMX A;  4ZBE A;  4QY5 A;  4XUX A;  3BFD A;  2WZX A;  3GSG A;  5AQB A;  1YLT A;  2FFY A;  1FOF A;  4A5R A;  2V20 A;  3TSG A;  4EV4 A;  1GCE A;  1YLY A;  3NI9 A;  1GHI A;  4KG6 A;  1BSG A;  1ES2 A;  3N8L A;  3B3X A;  3GV9 A;  1IEM A;  3ITB A;  4DE3 A;  3A3I A;  3UDI A;  5KSC A;  2JE5 A;  4WBG A;  3ZHH A;  5E43 A;  1JVJ A;  4JXG A;  1RP5 A;  1NJ4 A;  4E3M A;  2WAD A;  4X6T A;  3ZVW A;  2IWC A;  3ZDJ A;  3OPL A;  4LV3 A;  3P98 A;  4RX3 A;  5HAR A;  3VOZ A;  3Q82 A;  3IF6 A;  1FCO A;  4KG5 A;  2VGK A;  5G18 A;  5GLC A;  1ERQ A;  4HBU A;  5FAT A;  3TOI A;  2HP6 A;  3W8K A;  3IWI A;  3O88 A;  2EX9 A;  3WRT A;  2XF3 A;  2Y2O A;  5CRF A;  1H8Z A;  1BZA A;  1KGF A;  5HAI A;  3Q81 A;  2C6W B;  1YQS A;  4JLF A;  5FI7 A;  4ZJ2 A;  3NDG A;  5DF7 A;  1E4D A;  3BRM A;  4N1X A;  5E2F A;  5I94 A;  1K57 C;  2IWB A;  1K6R A;  4X56 A;  4RA7 A;  3HVF A;  3A3F A;  4P6B A;  4OQI A;  4KZ9 A;  3QNB A;  1WE4 A;  1XPB A;  3MXS A;  1HZO A;  4UAA A;  1BUE A;  4KQO A;  4RVA A;  4C6Y A;  1XXM A;  4ZDX A;  4GN2 A;  4S2K A;  2PU4 A;  1L0E A;  1FCN A;  3SOI A;  3NDE A;  4KZ7 A;  1ES5 A;  1J9M A;  2Z2L B;  5KMW A;  3TG9 A;  2UWX A;  1ERM A;  1JWP A;  1TDG A;  2ZQD A;  4OKP A;  4DKI A;  4Y0O A;  1XP4 A;  1M6K A;  5FDH A;  3N6I A;  4PM5 A;  4D2O A;  2J8Y A;  2WGW B;  3BEC A;  4KZ8 A;  1IKI A;  4F94 A;  3CG5 A;  1IEL A;  2HPB A;  2ZD8 A;  4S2N A;  3PBS A;  5E2E A;  1L0D A;  4N9L A;  3UDX A;  5CED A;  1WYC A;  5M1A A;  4PM8 A;  4BD1 A;  4QHC A;  4KZA A;  3OCL A;  3M6B A;  2B5R A;  4IBX A;  3S22 A;  1XGJ A;  4S2N C;  1I2S A;  4ZAM A;  4FH4 A;  1ERO A;  3G35 A;  2ZC4 B;  3FZC A;  3C4P A;  4QB8 A;  3UE0 A;  3V3R A;  5DTK A;  2WUQ A;  1SDN A;  2XH9 A;  4WM9 A;  3CJM A;  3D4F A;  3HBR A;  3ZG0 A;  3ZFZ A;  4HEF A;  2EXA A;  5F82 A;  2OV5 A;  2WGI A;  2ZM2 A;  5FAS A;  4GOG A;  2EX8 A;  3Q7V A;  4KZ4 A;  1SDE A;  3DTM A;  3W4P A;  3CZD A;  4S2O A;  1N9B A;  2BG1 A;  2WKH A;  1K55 C;  5D3O A;  1HD8 A;  5DF9 A;  4MLL A;  1ZC2 A;  3MBZ A;  5U47 A;  1Q2P A;  1NYM A;  4UHU A;  4EBL A;  3HLD A;  1KGG A;  3FYZ A;  4JKT A;  1M40 A;  4E3I A;  4WEL A;  1TVF A;  1LL9 A;  2ZM8 A;  3FV7 A;  2Y2L A;  3IHB A;  3IXG A;  4C3Q A;  4UA7 A;  3SS4 A;  1VM1 A;  3UE1 A;  5A92 A;  4JBF A;  2JBF A;  2Y2N A;  3G34 A;  2EFX A;  3BFG A;  5EOO A;  2ZC7 A;  3UPP A;  3SH9 A;  4GDN A;  1BLS A;  2XR0 A;  4R4S A;  1PZP A;  3V39 A;  4BJP A;  3JYI A;  4EQI A;  4EWF A;  4DF6 A;  4KEN B;  4NK3 A;  4RX2 A;  4BLM A;  3MKF A;  1KDW A;  4FSF A;  2I72 A;  5CXW A;  1MY8 A;  4PM7 A;  5CEC A;  2ZQA A;  1NZO A;  1GHM A;  4JXW A;  3IH9 A;  3HLW A;  4RYE A;  4ZTK A;  5GHZ A;  5GLD A;  5A90 A;  3VP1 A;  5CHU A;  4KZ6 A;  2PBY A;  3AGD A;  3EQV A;  3S4X A;  4HBT A;  4OP8 A;  4OPR A;  3ZCZ A;  3MFD A;  4R3J A;  4P0M A;  3HUN A;  5FQK A;  1E25 A;  3AGE A;  1S0W A;  3BLS A;  3PAE A;  3ZGA B;  4OPY A;  1O7E A;  3ITA A;  1DJC A;  2Y2J A;  3GR2 A;  4Y7P A;  2ZMA A;  2ZC6 B;  2H0Y A;  3RXX A;  4S2I A;  1BUL A;  5FAO A;  4XXR A;  1TDL A;  3DWZ A;  4QU3 A;  3HLF A;  4WZ5 A;  2Y55 A;  1HTZ A;  5CGX A;  5DVA A;  4X68 A;  3ZG5 A;  4CJN A;  4GD6 A;  1GHP A;  1G68 A;  2Y59 A;  3E2L A;  1MWT A;  1HVB A;  2CC1 A;  2H5S A;  5DTS A;  4KQR A;  4WZ5 C;  1XKZ A;  5CTM A;  4LV2 A;  4GNU A;  1K25 A;  5EVI D;  3S1Y A;  4KG2 A;  2HDQ A;  1NXY A;  1I5Q A;  3WS5 A;  3C7U A;  1W79 A;  5A93 A;  1VQQ A;  3PBN A;  1JWZ A;  5FQM A;  3HLC A;  1FSY A;  4WYY A;  1KGE A;  3GRJ A;  4Q8I A;  3SH7 A;  4H8R A;  1K56 D;  1RCJ A;  5E2G A;  2C5W B;  3IF6 C;  1WYB A;  3ISG A;  2EFU A;  3UPO A;  1L0F A;  4E3K A;  3P09 A;  3HLB A;  3MZF A;  2Y2P A;  2XFT A;  3UE3 A;  5EUA A;  5GL9 A;  4ZJ1 A;  3VFH A;  1BLP A;  1IYS A;  1PW8 A;  5EEC A;  3SS5 A;  1CEG A;  4R23 A;  4U3T A;  3BFC A;  2H0T A;  1FQG A;  1IYP A;  2V1Z A;  1JTD A;  4BL3 A;  5FI2 A;  2HP5 A;  5JYP A;  5FSR A;  3LCE A;  2ZQC A;  3IF6 B;  3A3J A;  2G2U A;  1FR6 A;  4DRT A;  5GHX A;  5AQA A;  3ZNT A;  4OLD A;  4B4Z A;  4E3O A;  1ESI A;  1I2W A;  3DW0 A;  1RGZ A;  2XD5 A;  4MBH A;  2EXB A;  3Q7Z A;  3OPH A;  1PZO A;  1YT4 A;  2Y91 A;  3NCK A;  3CMZ A;  2J9O A;  4HES A;  1KDS A;  5CHM A;  5IHV A;  4E6X A;  1GA9 A;  1K6S A;  3UO9 A;  3W4Q A;  1CEF A;  2HDU A;  2P74 A;  3HLG A;  1NY0 A;  1ONG A;  3PBQ A;  4K0X A;  2X71 A;  3VP4 A;  5M19 A;  4R3B A;  1MKI A;  2XQZ A;  4GD8 A;  3FWL A;  1G6A A;  3E2K A;  4IED A;  4OQG A;  1U60 A;  3EQU A;  3GQZ A;  4X53 A;  4EUZ A;  4N9K A;  2ZJ9 A;  4OON A;  4NET A;  4BD0 A;  4OH0 A;  4WZ4 A;  3PAG A;  4PPR A;  4YFM A;  2E8I A;  2EX2 A;  2FFF B;  2Y2K A;  3UY6 A;  3WWX A;  3MXR A;  4KZ3 A;  4IVK A;  2XGN A;  4E3J A;  2VGJ A;  4MBK A;  1ES4 A;  1KVM A;  3G2Y A;  3M6H A;  1L0G A;  1YLZ A;  2Y2M A;  4FCF A;  3C7V A;  3GTC A;  1FR1 A;  5HFO A;  2Y4A A;  5TGF A;  5EVI A;  1PI5 A;  3ZG8 B;  3C4O A;  3V3S A;  3A3D A;  3V5M A;  1PYY A;  3LO7 A;  3IWQ A;  3BM6 A;  4JF6 A;  4S2J A;  5FA7 A;  1DY6 A;  2DCF A;  5BOH A;  5EVI C;  5CGS A;  2XDM A;  3GMW A;  5FAQ A;  3RJU A;  2HDS A;  4P85 A;  5HAP A;  2XK1 A;  4OPQ A;  3IQA A;  2RCX A;  4S2P A;  3N8S A;  5A91 A;  5CER A;  4DE0 A;  3OPR A;  3UDF A;  3AGF A;  5L2F A;  3VSK A;  2PU2 A;  3BEB A;  4CPK A;  3Q7V B;  2WZZ A;  1LHY A;  4B88 A;  3OC2 A;  4BEN A;  2IWD A;  1FSW A;  2G2W A;  4JF4 A;  2QPN A;  3N4I A;  3O87 A;  3HUO A;  4JF5 A;  3IF5 A;  3VP2 A;  2WKE A;  1IYO A;  4OQH A;  1MWR A;  1YLJ A;  1Q2Q A;  4BL2 A;  3OZH A;  1LI9 A;  2HP9 A;  5FQJ A;  4OOL A;  3Q07 A;  5AQ9 A;  1W7F A;  3MKE A;  3ZVT A;  4B4X A;  2ZM0 A;  1IYQ A;  2OLU A;  3C5A A;  4PM6 A;  1YM1 A;  5E2H A;  4GZB A;  4QJG A;  1PW1 A;  3MZE A;  2JCH A;  3BFE A;  5J8X A;  1JTG A;  3O86 A;  3G30 A;  4KZB A;  2Q9M A;  2Y2I A;  2ZLY A;  5TFQ A;  4PM9 A;  4OOY A;  4YIN A;  4P87 A;  4M3K A;  4UA9 A;  4ZJ3 A;  4GKU A;  4N1H A;  1OME A;  1FCM A;  5EE8 A;  2V2F F;  1ZG4 A;  3QNC A;  4LEN A;  4C75 A;  5KZH A;  3A3E A;  4R4R A;  5EOE A;  4BQM A;  4WMC D;  4Z9Q A;  3IWO A;  4L0L A;  3HLE A;  1QMF A;  4OVD A;  1BLH A;  4LV1 A;  3LY3 A;  2ZQ8 A;  5HL1 A;  1GA0 A;  4UA6 A;  1CK3 A;  3FKW A;  2OSU A;  3M2J A;  2ZQ7 A;  4E6W A;  5HX9 A;  3RXW A;  1RGY A;  2R9W A;  2R9X A;  4K0W A;  1SHV A;  3IXH A;  1K38 A;  1S6R A;  3IHA A;  3PBT A;  1ALQ A;  5CEB A;  5HAQ A;  2XFS A;  4E3N A;  5M18 A;  3VOY A;  1K54 A;  1W5D A;  3ZG7 B;  2Y2H A;  5F1G A;  1LI0 A;  1LLB A;  1YMS A;  4N92 A;  4QY6 A;  3SH8 A;  5KSH A;  3NBL A;  1W8Q A;  4DE1 A;  3DWK A;  5JYO A;  3VP3 A;  5CHJ A;  3V50 A;  3SS3 A;  1PIO A;  1K54 C;  1K57 A;  4GDB A;  5GLB A;  5F1F A;  1JWV A;  2H10 A;  2DRW A;  2Y2Q A;  1TEM A;  3NY4 A;  4U0X A;  2X01 A;  3WS2 A;  3M2K A;  3Q1F A;  3WS1 A;  1ESU A;  3HUM A;  5FAP A;  4XUZ A;  4DDS A;  1C3B A;  4QD4 A;  2XLN A;  4JXS A;  2WGW A;  1H8Y A;  1E3U D;  4OOM A;  1ONH A;  3ZNY A;  3UPN A;  3PBO A;  3HL9 A;  1MBL A;  1ZKJ A;  4LV0 A;  1XGI A;  5GLA A;  4DDY A;  1Z6F A;  2J7V A;  4R1G A;  4DXB A;  1YLP A;  4WEK A;  2JC7 A;  2BLS A;  3G32 A;  5FQQ A;  3LY4 A;  3PBR A;  3BYD A;  4WEJ A;  1PWD A;  5FI6 A;  2Q9N A;  2A49 A;  4EBN A;  4EBP A;  1CI9 A;  5GHY A;  4K91 A;  2ZC3 B;  5DTT A;  2GDN A;  1ES3 A;  1LL5 A;  4X69 A;  3ZG9 B;  3IXB A;  1QME A;  4E3L A;  1PI4 A;  2EX6 A;  3O3V A;  1XX2 A;  2DNS A;  4OP5 A;  2ZQ9 A;  3OPP A;  4JPM A;  3I7J A;  3VFF A;  3G31 A;  1K4E A;  1XA7 A;  4WMC A;  1NZU A;  2OLV A;  3FKV A;  1XA1 A;  1KE4 A;  1NYY A;  3N8R A;  4KZ5 A;  3VSL A;  4FD8 A;  5HW3 A;  2A3U A;  2P9V A;  1CI8 A;  1K56 A;  1MXO A;  1K55 A;  2WK0 A;  2XEP A;  4OPZ A;  5AQ7 A;  3WRZ A;  4FH2 A;  4PMA A;  4OQ0 A;  1PWG A;  3GVB A;  4OLG A;  5F83 A;  4S2M A;  3N7W A;  1BLC A;  3IH8 A;  3PTE A;  4JXV A;  3WS0 A;  5EVL A;  2WKI A;  4IVI A;  3NIA A;  1BTL A;  3IT9 A;  4X55 A;  1SCW A;  3WS4 A;  1MPL A;  1K4F A;  1NRF A;  1MWU A;  3OCN A;  2ZC5 B;  3IXD A;  5EVI B;  1KE3 A;  4R0Q A; 
#chains in the Genus database with same CATH topology
 2J9P A;  1IKG A;  3BLM A;  2PYR A;  4ID4 A;  3BFF A;  4U0T A;  5CGW A;  4MBF A;  2RL3 A;  1SKF A;  1BT5 A;  4MEZ A;  1FIL A;  3D72 A;  2V1B A;  2WYX A;  4L9F A;  1N4O A;  1MWS A;  2WAF A;  1YSQ A;  2QMI A;  4DE2 A;  4ETX A;  2Q0O A;  1KE0 A;  4MN5 A;  4Y0U A;  1DJB A;  1OT9 A;  5HDC A;  1LL8 A;  3VE3 A;  2QHK A;  1GCE A;  3D9Y A;  3A3I A;  4WBG A;  5E43 A;  2PAV P;  1DP6 A;  1RP5 A;  2WAD A;  4UEY A;  3ZDJ A;  2WKR A;  5HDS A;  3E0Y A;  3VOZ A;  2K2N A;  4KQD A;  5J3W A;  2VGK A;  2VZW A;  5GLC A;  2VV8 A;  2EX9 A;  3WRT A;  2XF3 A;  2Y2O A;  3G6O A;  2Y8H A;  4HJ3 A;  1YQS A;  5FI7 A;  5L07 A;  2IWB A;  3A3F A;  3QNB A;  3T4S A;  4X1M A;  1HZO A;  4HIA A;  1BUE A;  3LIB A;  2OAP 1;  2PU4 A;  4KZ7 A;  2HJE A;  2Z2L B;  3R7W A;  5KMW A;  4GJ4 A;  1ERM A;  3MFX A;  1JWP A;  4DKI A;  2PYP A;  1M6K A;  3BEC A;  1IEL A;  2HPB A;  4S2N A;  2HJ9 C;  4LRY C;  5E2E A;  3MS6 A;  1L0D A;  1XJ2 A;  4KZA A;  3IS2 A;  3M6B A;  2B5R A;  3CHW P;  4IBX A;  5EVE A;  1XGJ A;  4S2N C;  1I2S A;  4ZAM A;  3G35 A;  2D01 A;  2ZC4 B;  3UE0 A;  3V3R A;  4WM9 A;  3CJM A;  3HBR A;  3FG8 A;  2OV5 A;  2QJ7 A;  2EX8 A;  1XJ4 A;  1SDE A;  3CZD A;  4S2O A;  4GLQ A;  3JVV A;  4WLA A;  4X25 A;  4HHD A;  1Q2P A;  4UHU A;  3HLD A;  3FYZ A;  1M40 A;  5KIZ A;  2XA7 M;  1TVF A;  1LL9 A;  3FV7 A;  3V67 A;  4UA7 A;  1VM1 A;  3KYQ A;  2Y2N A;  2VGL M;  2KOI A;  4JGP A;  4R4S A;  4EQI A;  3JYI A;  2PHY A;  4KEN B;  1KDW A;  4PM7 A;  2ZQA A;  1GHM A;  4HJ6 A;  2QKP A;  2M7U A;  2W3F A;  3CLO A;  4ZTK A;  5GHZ A;  5A90 A;  4OP8 A;  1E25 A;  1S0W A;  3LGO A;  4OPY A;  4Y7P A;  4IUK A;  2ZMA A;  3RXX A;  2KDK A;  4S2I A;  4XXR A;  3T1S A;  3HLF A;  5DVA A;  2VA0 A;  4X68 A;  3ZG5 A;  4GD6 A;  2Y59 A;  1HVB A;  2CC1 A;  2L1M A;  4YOF A;  5DTS A;  4KQR A;  3PYP A;  2HDQ A;  4R6L A;  3KSI A;  3NOU C;  2HV1 A;  3O5Y A;  3EWK A;  1KGE A;  1K56 D;  5FEF A;  3ISG A;  3A0S A;  3P01 A;  1L0F A;  4E3K A;  3P09 A;  3MZF A;  5GL9 A;  3UB5 P;  2H0T A;  1FQG A;  1JTD A;  3T4L A;  5IS1 A;  5FI2 A;  2HP5 A;  1S1Z A;  2ZQC A;  1XJ3 A;  4PAU A;  1FR6 A;  3ZNT A;  4OLD A;  2BAS A;  3CPT A;  2EXB A;  2J9O A;  5CHM A;  1YKD A;  3T1X A;  1NY0 A;  3PBQ A;  4K0X A;  2X71 A;  5M19 A;  3FWL A;  1GSX A;  1U60 A;  2EA9 A;  2ZJ9 A;  4N9K A;  3OBF A;  1LSV A;  2EX2 A;  3LI8 A;  3MXR A;  4IVK A;  3R7W B;  2NUP C;  2VGJ A;  3B47 A;  1L0G A;  1UGU A;  5HFO A;  4JGQ A;  1PI5 A;  3ZG8 B;  3LI9 A;  4EXO A;  3BM6 A;  3IS2 B;  5FA7 A;  1DY6 A;  5BOH A;  4BBU A;  1OTB A;  1V9Y A;  4P85 A;  3IBR A;  1D06 A;  3N8S A;  4CLC E;  3H82 B;  4WL9 A;  3UDF A;  2PU2 A;  4CPK A;  2LB5 A;  1LHY A;  4B88 A;  3KYE A;  4EER A;  4JF4 A;  3O87 A;  3HUO A;  4G3K A;  3VP2 A;  4OQH A;  4R38 A;  4BL2 A;  2HP9 A;  3ULF A;  1J3W A;  5FQJ A;  3MKE A;  3QP4 A;  3C5A A;  5HDD A;  4GZB A;  1BYW A;  1TS6 A;  2ZLY A;  4P6Z M;  4YIN A;  1CF0 A;  4II7 A;  1YAX A;  3IBJ A;  5KZH A;  2FZ0 A;  1KOU A;  1NWZ A;  4L0L A;  4OVD A;  3LY3 A;  4UA6 A;  3LR4 A;  5MC7 A;  4NEE D;  4LRZ E;  1ZHH B;  3LEQ A;  5I5L A;  1K38 A;  4WN5 A;  5CEB A;  2XFS A;  2V0W A;  5CX7 A;  3ZG7 B;  4QY6 A;  1K0K A;  3VP3 A;  1X0O A;  5F1F A;  1JWV A;  1FIK A;  3QP1 A;  4ME4 A;  5FAP A;  1ONH A;  2AVX A;  3PBO A;  3HL9 A;  4EEU A;  1MBL A;  1XGI A;  3SW1 A;  2J7V A;  2K7S A;  4DMZ A;  1S66 L;  2JC7 A;  3EGD C;  3BYD A;  4EBP A;  3CPT B;  4MCW A;  4K91 A;  4EQ1 A;  1ES3 A;  3ZG9 B;  1OTE A;  1QME A;  3HJI A;  2O0Y A;  3O3V A;  4OP5 A;  2ZQ9 A;  3I7J A;  3VFF A;  4H6J A;  1HLU P;  3VSL A;  5DKL A;  5AVF A;  2A3U A;  2WK0 A;  1MXO A;  3WRZ A;  3P7N A;  4JGR A;  3LR5 A;  5F83 A;  2HGV A;  1L3L A;  3A0V A;  2J3T D;  1F98 A;  2WKI A;  3IT9 A;  4X55 A;  1STZ A;  3OCN A;  1VEU A;  2E8J A;  1YSP A;  2FH5 A;  4X1L A;  1L2S A;  3HRE A;  3KX0 X;  1SKO A;  1AXB A;  2JKR I;  2WGV A;  4CQH A;  3LEZ A;  1EWZ A;  4S2L A;  1WA9 A;  5EM1 A;  1YLW A;  3W4O A;  3G4P A;  1OPX A;  4UQI S;  3S7Q A;  4NXB A;  4QY5 A;  4XUX A;  2WZX A;  1FOF A;  4HI4 A;  2V20 A;  5DFY A;  1BSG A;  1TS0 A;  3N8L A;  3GV9 A;  1IEM A;  3UDI A;  1JVJ A;  3ZVW A;  3JVU A;  3OPL A;  4LV3 A;  3KO6 A;  4RX3 A;  4BMW A;  3IF6 A;  4KG5 A;  3BQA A;  5G18 A;  4HP4 A;  5FAT A;  3TOI A;  3W8K A;  3UB6 A;  4LPZ A;  2QYB A;  1KGF A;  4JLF A;  2C6W B;  1E4D A;  3BRM A;  4N1X A;  5E2F A;  1K57 C;  5HD5 A;  4NG2 A;  4X56 A;  3HVF A;  4P6B A;  2O99 A;  2JKR M;  1XXM A;  4S2K A;  1L0E A;  1FCN A;  1LSX A;  3SOI A;  3TG9 A;  3LIE A;  1TDG A;  4OKP A;  3TRC A;  4PM5 A;  1XP4 A;  4D2O A;  4KZ8 A;  1IKI A;  2JKT M;  4F94 A;  3L7H A;  5LBR A;  3PBS A;  3CUE A;  4N9L A;  3UDX A;  3DTK A;  5M1A A;  2A2L A;  2R78 A;  4FH4 A;  3C4P A;  3QP5 A;  1UWN X;  4QB8 A;  1SZV A;  3TW8 A;  1SDN A;  4BD0 A;  3D4F A;  4LRX C;  5F82 A;  2EXA A;  2ZOH A;  2ZM2 A;  3Q7V A;  4MDZ A;  3DTM A;  1N9B A;  5D3O A;  1K55 C;  5DF9 A;  4MLL A;  5L09 A;  4EBL A;  1NYM A;  2OOL A;  4E3I A;  3MQO A;  2ZM8 A;  4C3Q A;  2OWJ A;  3SS4 A;  4H6J B;  1IFQ A;  2EFX A;  4FUW A;  4O8G A;  2ZC7 A;  5EOO A;  3UPP A;  3SH9 A;  4EWF A;  2M7V A;  1PZP A;  1ZTU A;  3MKF A;  5F69 A;  5F68 A;  1VEU B;  4ETZ A;  4OPR A;  4GW9 A;  2KX6 A;  1SKO B;  3BLS A;  5DKK A;  3DTI A;  1DJC A;  2Y2J A;  3GR2 A;  1TDL A;  1HTZ A;  3F1O A;  2ZL1 A;  3FPV A;  3EEH A;  4LV2 A;  4GNU A;  1K25 A;  2L4R A;  4KG2 A;  2PR5 A;  1I5Q A;  4HOI A;  5A93 A;  1VQQ A;  3HLC A;  4WYY A;  3H9W A;  3T12 B;  3GRJ A;  3SH7 A;  1OTI A;  4H8R A;  1F5M A;  5G4Z A;  1WYB A;  1S1Y A;  2EFU A;  5TBM A;  3UE3 A;  3VFH A;  5EUA A;  4ZJ1 A;  5EEC A;  3SS5 A;  1S4S A;  5FSR A;  3LCE A;  2XA7 S;  3IF6 B;  3A3J A;  2G2U A;  4DRT A;  5AQA A;  1ESI A;  2VGL S;  4FOF A;  3MJQ A;  3UPO A;  5EV0 A;  2HDU A;  2P74 A;  1ONG A;  5DJU A;  2GX5 A;  2XQZ A;  2QWS A;  3LUQ A;  4GD8 A;  1G6A A;  3E2K A;  3S7N A;  3GQZ A;  2OWH A;  4OON A;  4NET A;  4HP9 A;  2JKF A;  1N9O A;  4PPR A;  3UY6 A;  2Y2K A;  2H28 A;  4KZ3 A;  2XGN A;  3H82 A;  4E3J A;  4MMN A;  2ZMV A;  1KVM A;  3G2Y A;  3RFB A;  1G6O A;  3LR3 A;  5A8B A;  1FR1 A;  2O9A A;  3C4O A;  3V3S A;  5C5K A;  1PYY A;  3VV4 A;  3IX3 A;  1DP8 A;  2XDM A;  2RCX A;  1MZU A;  4B9O A;  1Y28 A;  1G28 A;  4DE0 A;  3OPR A;  5EFW A;  1VHM A;  3Q7V B;  2WZZ A;  1PFL A;  3OC2 A;  2W3G A;  2QPN A;  4JF5 A;  3IF5 A;  2WKE A;  3T4J A;  1IYO A;  4AFI A;  1MWR A;  1Q2Q A;  3QP6 A;  1NLZ A;  4OOL A;  5AQ9 A;  4B4X A;  2PD7 A;  2HF6 A;  4PM6 A;  1YM1 A;  4QJG A;  2JCH A;  1JTG A;  4KZB A;  1XFN A;  4PM9 A;  4OOY A;  4UA9 A;  4N1H A;  4C75 A;  3A3E A;  4R4R A;  5EOE A;  4WMC D;  3HLE A;  4EUV A;  2ZQ8 A;  4PHT A;  4EW7 A;  1CK3 A;  3M2J A;  3F1O B;  3KYZ A;  2ZL1 B;  4Y15 A;  1S6R A;  3PBT A;  1ALQ A;  1TS8 A;  1W5D A;  4BWI A;  5F1G A;  1LI0 A;  3SH8 A;  1P0Z A;  1YMS A;  3NBL A;  4DE1 A;  3DWK A;  3V50 A;  5GLB A;  2Y2Q A;  3UME A;  3WS1 A;  1ESU A;  3HUM A;  4DJ3 A;  2BTF P;  5TBM B;  4DDS A;  1C3B A;  3KSH A;  2XLN A;  4JXS A;  2WGW A;  1E3U D;  2VX8 A;  2V8C A;  4XT2 A;  4LV0 A;  5GLA A;  2OAQ 1;  1YLP A;  4WEK A;  3G32 A;  5FQQ A;  3LY4 A;  3LR0 A;  4WEJ A;  1PWD A;  2B95 A;  4EBN A;  2IA2 A;  5FEG A;  5GHY A;  3F1P A;  2ZC3 B;  1GSV A;  2GDN A;  5DFX A;  4GS9 A;  4Y3I A;  1PNE A;  4E3L A;  4NXG A;  1XX2 A;  2DNS A;  3OPP A;  4JPM A;  4P6Z S;  1K4E A;  1XA7 A;  4WMC A;  3T1R A;  1NZU A;  2OLV A;  3N8R A;  4KZ5 A;  5HW3 A;  1K56 A;  3NUL A;  4QWO A;  4PMA A;  4OLG A;  4S2M A;  1XJ6 A;  2I9V A;  5EVL A;  3NIA A;  3HCY A;  1SCW A;  1MPL A;  1NRF A;  1MWU A;  3D3O A;  1Y54 A;  3UNW A;  4DXC A;  4KQQ A;  4IBR A;  2P9V B;  4MNR A;  2VV6 A;  4GB7 A;  1PWC A;  5J4E A;  3VMA A;  3NC8 A;  3UN7 A;  4IHQ A;  1E3U A;  5DF8 A;  4O7D A;  2UV0 E;  1ZG6 A;  2W0N A;  4ZBE A;  2GZA A;  3BFD A;  4HQA A;  4A5R A;  2PDR A;  4EV4 A;  1YLY A;  3NI9 A;  1GHI A;  4KG6 A;  4HH2 A;  3K3C A;  2P04 A;  5KSC A;  4M4X A;  3ZHH A;  1NJ4 A;  5HAR A;  3Q82 A;  1N9L A;  1FCO A;  4GCZ A;  4HBU A;  2HP6 A;  1CJF A;  3EGX C;  3KSF A;  5CRF A;  1H8Z A;  4QPR A;  3Q81 A;  4CLC D;  4ZJ2 A;  3NOP C;  3BJN A;  1K6R A;  3CWF A;  4R3A A;  4OQI A;  1WE4 A;  1XPB A;  3FPW A;  3MXS A;  4UAA A;  4KQO A;  4RVA A;  4C6Y A;  4ZDX A;  4Y17 A;  5FDS A;  5F6A A;  3MSH A;  1ES5 A;  1S4R A;  2UWX A;  4Y2F A;  2V8F A;  2M1C A;  2GJ3 A;  3EOI A;  3N6I A;  1TS7 A;  2WGW B;  2ZMF A;  4XT2 B;  1EW0 A;  1WYC A;  4BD1 A;  2O9B A;  3RH8 B;  3OCL A;  3CIT A;  2VKS A;  3S22 A;  2XRN A;  1ERO A;  3FZC A;  2B18 A;  3LIA A;  5DTK A;  2WUQ A;  3PXP A;  3ZFZ A;  1TD5 A;  3ZG0 A;  4PKY A;  5HSQ A;  3LIF A;  5FAS A;  4GOG A;  3F1P B;  3BY8 A;  1W63 M;  3W4P A;  4GS9 B;  3T50 A;  5U47 A;  3MBZ A;  5HL6 A;  4KUK A;  1KGG A;  4JKT A;  2PRF A;  4WEL A;  3IHB A;  2Y2L A;  3IXG A;  4I3A A;  5A92 A;  2JBF A;  3G34 A;  3BFG A;  2WKP A;  1BLS A;  3V39 A;  4BJP A;  2V1A A;  3GDI A;  1H8M A;  4BLM A;  4CLC A;  4LFU A;  4FSF A;  3EEA A;  5CEC A;  4JXW A;  1P9R A;  4RYE A;  5GLD A;  4I5S A;  2G7U A;  3VP1 A;  3EQV A;  4P0M A;  3HUN A;  3AGE A;  3PAE A;  1AWI A;  1O7E A;  3ITA A;  4NXF A;  2VLG A;  1Z09 A;  2ZC6 B;  2H0Y A;  1BUL A;  5FAO A;  4WZ5 A;  2Y55 A;  2GNX A;  1GHP A;  1G68 A;  1S67 L;  4WZ5 C;  3ZQ5 A;  1DRM A;  5EVI D;  5AJG A;  4ARZ A;  3BQ8 A;  3WS5 A;  3C7U A;  1W79 A;  2VEA A;  3PBN A;  1JWZ A;  4PKY G;  1FSY A;  5E2G A;  5EM0 A;  3MF0 A;  2P08 A;  3IF6 C;  3HJK A;  3RTY A;  5J7E A;  2B02 A;  1TF1 A;  1IYS A;  2J3T C;  1CEG A;  4R23 A;  3BFC A;  3LID A;  1IYP A;  2V1Z A;  4BL3 A;  2PT7 A;  2A24 A;  4HY8 A;  4E3O A;  4B4Z A;  3QP8 A;  1I2W A;  2XD5 A;  4MBH A;  2PR6 A;  2ACG A;  3CI6 A;  1YT4 A;  2Y91 A;  4HES A;  3CMZ A;  4E6X A;  5L10 A;  1GA9 A;  1K6S A;  3UO9 A;  1CEF A;  4HH3 A;  1MKI A;  4IED A;  4X53 A;  3EQU A;  2W3E A;  3TE8 A;  3CUE C;  3PAG A;  4WZ4 A;  4DN0 A;  2E8I A;  1T19 A;  3WWX A;  4R70 A;  1OTD A;  2INW A;  3M6H A;  4FCF A;  3C7V A;  3GTC A;  2VV7 A;  5TGF A;  5EVI A;  3A3D A;  3LO7 A;  2YKF A;  4Z1W A;  5HWW A;  4JF6 A;  3C30 A;  3UE6 A;  2DCF A;  5EVI C;  5CGS A;  3GMW A;  3IX4 A;  5HAP A;  1T1A A;  2PBD P;  4KUO A;  2K31 A;  3AGF A;  5L2F A;  3VSK A;  4BEN A;  4L9E A;  1VB6 A;  1D1J A;  5K5B A;  4YNR A;  4E04 A;  1LI9 A;  3T4T A;  3Q07 A;  1W7F A;  2ZM0 A;  2OLU A;  3R4K A;  4FTX A;  4CLC B;  3TJZ C;  2D02 A;  1PW1 A;  3MZE A;  5J8X A;  2EWW A;  2Q9M A;  2W1R A;  2L0W A;  4P87 A;  4M3K A;  5G4Y A;  2DMW A;  4ZJ3 A;  3VOL A;  1OME A;  1FCM A;  5EE8 A;  2V2F F;  1ZG4 A;  3QNC A;  4I3I A;  4LEN A;  1G5U A;  2O9C A;  3MQ0 A;  3IWO A;  1BLH A;  4LV1 A;  3CAX A;  2ZOI A;  1GA0 A;  1RGY A;  2R9X A;  1SHV A;  2XRO A;  4ARZ B;  3FC7 A;  5KSH A;  2CMN A;  4O0P A;  1W8Q A;  5JYO A;  1PIO A;  4GDB A;  2DRW A;  1XFQ A;  1VET A;  1TEM A;  4WF0 A;  4ESP A;  4XUZ A;  1N9N A;  4OOM A;  1MKM A;  1ZKJ A;  3SZT A;  4DXB A;  3MMH A;  2A24 B;  2JKG A;  2BLS A;  3PBR A;  4Q0J A;  1JNU A;  1Y4O A;  4Y13 A;  2XSS A;  2W3H A;  1H3Q A;  1LL5 A;  3B33 A;  2J80 A;  1PI4 A;  4GHI A;  1ACF A;  2EX6 A;  3ZYT A;  3FKV A;  1XA1 A;  1KE4 A;  1NYY A;  2P7J A;  4FD8 A;  3MQQ A;  2P9V A;  4OPZ A;  4FH2 A;  4OQ0 A;  3S7P A;  2W27 A;  3N7W A;  1BLC A;  4JXV A;  3PTE A;  2W1T A;  3WS0 A;  1NLY A;  5EVI B;  2ZC5 B;  3IXD A;  1KE3 A;  1A0K A;  4LCL A;  2Y79 A;  3UB7 A;  3NOT C;  2WAE A;  3BY9 A;  4G3V A;  1DJA A;  2HDR A;  2VJW A;  5CTN A;  5FQ9 A;  1KVL A;  2X02 A;  3UMD A;  5FQI A;  1EI5 A;  3G2Z A;  2QZ6 A;  4B93 A;  1PRQ A;  1H5X A;  3QHY A;  4EU0 A;  2Y2G A;  4D60 A;  4Y0T A;  1W8Y A;  1O07 A;  2Z2M B;  3MZD A;  3VP0 A;  4ZRR A;  5TR7 A;  3LYX A;  5EPH A;  2XD1 A;  4LCM A;  4G3W A;  5F5Y A;  1YMX A;  1F9I A;  3GSG A;  5AQB A;  1YLT A;  2FFY A;  5FL3 A;  3LFV A;  3TSG A;  1IOU A;  1ES2 A;  1GSW A;  4NXE A;  3B3X A;  3ITB A;  4DE3 A;  2JE5 A;  5HPI A;  4JXG A;  4JGO A;  4E3M A;  4X6T A;  2IWC A;  3P98 A;  2W3D A;  1ERQ A;  1V9Z A;  3IWI A;  3O88 A;  1BZA A;  1OJG A;  5HAI A;  3NDG A;  5DF7 A;  4F3L A;  5I94 A;  3PR6 A;  4RA7 A;  3F1N A;  4KZ9 A;  4EES A;  3PHY A;  3UB9 A;  4GN2 A;  3NDE A;  1J9M A;  1VET B;  3C2W A;  4MN6 A;  2ZQD A;  4Y0O A;  5FDH A;  3T4Q A;  2J8Y A;  3CG5 A;  4YWZ A;  2ZD8 A;  5CED A;  4PM8 A;  2EWV A;  4QHC A;  1OJ5 A;  1D7E A;  3E98 A;  4HJ4 A;  5HD3 A;  4IUH A;  2MJ6 A;  2XH9 A;  4LGW A;  4HEF A;  1P9W A;  3L9K A;  2WGI A;  4KZ4 A;  2LB9 A;  2BG1 A;  2WKH A;  1HD8 A;  1ZC2 A;  3IX8 A;  4GHI B;  3JPU A;  1T18 A;  4L9G A;  3LIC A;  3UE1 A;  4JBF A;  4GDN A;  2XR0 A;  1LSW A;  3E4P A;  4DF6 A;  4NK3 A;  4RX2 A;  5HZH A;  2I72 A;  5CXW A;  1MY8 A;  2W1T B;  3GEC A;  1NZO A;  3MXQ A;  5L8M A;  3IH9 A;  3HLW A;  5CHU A;  4KZ6 A;  2PBY A;  3AGD A;  3S4X A;  4HBT A;  3ZCZ A;  3MFD A;  4R3J A;  3W2Z A;  1OTA A;  5FQK A;  3ZGA B;  5HWT A;  5IT5 A;  2Z6C A;  3B42 A;  3DWZ A;  4QU3 A;  5CGX A;  3C38 A;  5HWV A;  4CJN A;  3E2L A;  3UB8 A;  1MWT A;  2H5S A;  1XKZ A;  3K2N A;  5CTM A;  3S1Y A;  4O01 A;  1NXY A;  1YPR A;  3K3D A;  5FQM A;  3H7W A;  2V9A A;  4Q8I A;  1RCJ A;  2C5W B;  5DJT A;  4IJG A;  5IU1 A;  3KSG A;  3HLB A;  2Y2P A;  2XFT A;  1BLP A;  1PW8 A;  4U3T A;  4Q0H A;  3BWL A;  5JYP A;  2JN7 A;  1ODV A;  5GHX A;  3DW0 A;  1RGZ A;  3Q7Z A;  3OPH A;  1PZO A;  3NCK A;  5IHV A;  1KDS A;  2ZBB A;  3U2A A;  3W4Q A;  3HLG A;  4F3L B;  4BBV A;  3VP4 A;  4R3B A;  2PD8 A;  3F1N B;  2V0U A;  3DTE A;  4OQG A;  4EUZ A;  3E4Q A;  3QP2 A;  4OH0 A;  3C8C A;  4YFM A;  2FFF B;  5HPF A;  5AVE A;  1F2K A;  4MBK A;  1ES4 A;  1YLZ A;  2Y2M A;  2Y4A A;  3V5M A;  3IWQ A;  2NUT C;  2Z6D A;  4S2J A;  3E4O A;  1MC0 A;  5FAQ A;  3RJU A;  2HDS A;  4WUJ A;  2XK1 A;  4OPQ A;  3IQA A;  4S2P A;  3A0R A;  4HNB A;  5A91 A;  5CER A;  1P97 A;  4DJ2 A;  3BEB A;  2IWD A;  1DP9 A;  1FSW A;  2G2W A;  3N4I A;  4CLC C;  2HZ5 A;  1YLJ A;  3T4K A;  3OZH A;  3ZVT A;  1IYQ A;  5E2H A;  2WKQ A;  3BFE A;  2JKT I;  3O86 A;  3G30 A;  2Y2I A;  2KLI A;  2QJ5 A;  5TFQ A;  4LLO B;  4RQ9 A;  4GKU A;  3DBA A;  4BBT A;  4BQM A;  4Y5F A;  4MN7 A;  4Z9Q A;  2VK3 A;  1QMF A;  4NKP A;  4EEP A;  5HL1 A;  3FKW A;  2OSU A;  2ZQ7 A;  4E6W A;  5HX9 A;  3RXW A;  2R9W A;  4K0W A;  3MR0 A;  3IXH A;  3IHA A;  5HAQ A;  4E3N A;  5M18 A;  3VOY A;  1K54 A;  3BW6 A;  2Y2H A;  1UWP X;  1T1B A;  1LLB A;  4EET B;  4N92 A;  3ICY A;  3H7W B;  5CHJ A;  3SS3 A;  1K54 C;  1K57 A;  2J3W A;  2H10 A;  1T1C A;  4U0X A;  3NY4 A;  3WS2 A;  2X01 A;  3M2K A;  3Q1F A;  3T1Q B;  4I3J A;  4QD4 A;  3VE4 A;  3T4O A;  1H8Y A;  3ZNY A;  3UPN A;  3NHQ A;  4UQI M;  4DDY A;  1Z6F A;  3OLO A;  4R1G A;  1W63 Q;  5FI6 A;  2Q9N A;  2A49 A;  1CI9 A;  4Q0I A;  1CQA A;  5DTT A;  3DAV A;  4X69 A;  3IXB A;  4I38 A;  3U4L P;  3NJA A;  3G31 A;  2JHE A;  3S7O A;  5AQ7 A;  1CI8 A;  1NRJ A;  1K55 A;  2XEP A;  2YKH A;  1PWG A;  1H0M A;  3GVB A;  4K08 A;  5TJJ A;  3IH8 A;  3OOV A;  4IVI A;  1BTL A;  3WS4 A;  1K4F A;  4I39 A;  1LT0 A;  1OT6 A;  4R0Q A;  3NEC A; 
#chains in the Genus database with same CATH homology
 1Y54 A;  3UNW A;  2J9P A;  4LCL A;  1L2S A;  1IKG A;  3HRE A;  3BLM A;  4DXC A;  2WAE A;  4KQQ A;  1AXB A;  4IBR A;  1DJA A;  2WGV A;  4ID4 A;  2HDR A;  2P9V B;  3BFF A;  3LEZ A;  4U0T A;  1EWZ A;  1KVL A;  4MNR A;  2X02 A;  4S2L A;  5CGW A;  5CTN A;  4MBF A;  5FQ9 A;  2RL3 A;  5FQI A;  1EI5 A;  3G2Z A;  4GB7 A;  1PWC A;  2QZ6 A;  1SKF A;  1BT5 A;  1H5X A;  3QHY A;  3NC8 A;  4MEZ A;  3VMA A;  3UN7 A;  2Y2G A;  4Y0T A;  1YLW A;  1W8Y A;  1E3U A;  5DF8 A;  1O07 A;  2Z2M B;  2WYX A;  3MZD A;  4O7D A;  3VP0 A;  3W4O A;  1N4O A;  3G4P A;  5TR7 A;  1MWS A;  2WAF A;  2QMI A;  4DE2 A;  5EPH A;  2XD1 A;  1KE0 A;  4LCM A;  1ZG6 A;  4Y0U A;  1DJB A;  1YMX A;  4ZBE A;  4QY5 A;  4XUX A;  3BFD A;  2WZX A;  3GSG A;  5AQB A;  1YLT A;  2FFY A;  1FOF A;  4A5R A;  2V20 A;  3TSG A;  4EV4 A;  1GCE A;  1YLY A;  3NI9 A;  1GHI A;  4KG6 A;  1BSG A;  1ES2 A;  3N8L A;  3B3X A;  3GV9 A;  1IEM A;  3ITB A;  4DE3 A;  3A3I A;  3UDI A;  5KSC A;  2JE5 A;  4WBG A;  3ZHH A;  5E43 A;  1JVJ A;  4JXG A;  1RP5 A;  1NJ4 A;  4E3M A;  2WAD A;  4X6T A;  3ZVW A;  2IWC A;  3ZDJ A;  3OPL A;  4LV3 A;  3P98 A;  4RX3 A;  5HAR A;  3VOZ A;  3Q82 A;  3IF6 A;  1FCO A;  4KG5 A;  2VGK A;  5G18 A;  5GLC A;  1ERQ A;  4HBU A;  5FAT A;  3TOI A;  2HP6 A;  3W8K A;  3IWI A;  3O88 A;  2EX9 A;  3WRT A;  2XF3 A;  2Y2O A;  5CRF A;  1H8Z A;  1BZA A;  1KGF A;  5HAI A;  3Q81 A;  2C6W B;  1YQS A;  4JLF A;  5FI7 A;  4ZJ2 A;  3NDG A;  5DF7 A;  1E4D A;  3BRM A;  4N1X A;  5E2F A;  5I94 A;  1K57 C;  2IWB A;  1K6R A;  4X56 A;  4RA7 A;  3HVF A;  3A3F A;  4P6B A;  4OQI A;  4KZ9 A;  3QNB A;  1WE4 A;  1XPB A;  3MXS A;  1HZO A;  4UAA A;  1BUE A;  4KQO A;  4RVA A;  4C6Y A;  1XXM A;  4ZDX A;  4GN2 A;  4S2K A;  2PU4 A;  1L0E A;  1FCN A;  3SOI A;  3NDE A;  4KZ7 A;  1ES5 A;  1J9M A;  2Z2L B;  5KMW A;  3TG9 A;  2UWX A;  1ERM A;  1JWP A;  1TDG A;  2ZQD A;  4OKP A;  4DKI A;  4Y0O A;  1XP4 A;  1M6K A;  5FDH A;  3N6I A;  4PM5 A;  4D2O A;  2J8Y A;  2WGW B;  3BEC A;  4KZ8 A;  1IKI A;  4F94 A;  3CG5 A;  1IEL A;  2HPB A;  2ZD8 A;  4S2N A;  3PBS A;  5E2E A;  1L0D A;  4N9L A;  3UDX A;  5CED A;  1WYC A;  5M1A A;  4PM8 A;  4BD1 A;  4QHC A;  4KZA A;  3OCL A;  3M6B A;  2B5R A;  4IBX A;  3S22 A;  1XGJ A;  4S2N C;  1I2S A;  4ZAM A;  4FH4 A;  1ERO A;  3G35 A;  2ZC4 B;  3FZC A;  3C4P A;  4QB8 A;  3UE0 A;  3V3R A;  5DTK A;  2WUQ A;  1SDN A;  2XH9 A;  4WM9 A;  3CJM A;  3D4F A;  3HBR A;  3ZG0 A;  3ZFZ A;  4HEF A;  2EXA A;  5F82 A;  2OV5 A;  2WGI A;  2ZM2 A;  5FAS A;  4GOG A;  2EX8 A;  3Q7V A;  4KZ4 A;  1SDE A;  3DTM A;  3W4P A;  3CZD A;  4S2O A;  1N9B A;  2BG1 A;  2WKH A;  1K55 C;  5D3O A;  1HD8 A;  5DF9 A;  4MLL A;  1ZC2 A;  3MBZ A;  5U47 A;  1Q2P A;  1NYM A;  4UHU A;  4EBL A;  3HLD A;  1KGG A;  3FYZ A;  4JKT A;  1M40 A;  4E3I A;  4WEL A;  1TVF A;  1LL9 A;  2ZM8 A;  3FV7 A;  2Y2L A;  3IHB A;  3IXG A;  4C3Q A;  4UA7 A;  3SS4 A;  1VM1 A;  3UE1 A;  5A92 A;  4JBF A;  2JBF A;  2Y2N A;  3G34 A;  2EFX A;  3BFG A;  5EOO A;  2ZC7 A;  3UPP A;  3SH9 A;  4GDN A;  1BLS A;  2XR0 A;  4R4S A;  1PZP A;  3V39 A;  4BJP A;  3JYI A;  4EQI A;  4EWF A;  4DF6 A;  4KEN B;  4NK3 A;  4RX2 A;  4BLM A;  3MKF A;  1KDW A;  4FSF A;  2I72 A;  5CXW A;  1MY8 A;  4PM7 A;  5CEC A;  2ZQA A;  1NZO A;  1GHM A;  4JXW A;  3IH9 A;  3HLW A;  4RYE A;  4ZTK A;  5GHZ A;  5GLD A;  5A90 A;  3VP1 A;  5CHU A;  4KZ6 A;  2PBY A;  3AGD A;  3EQV A;  3S4X A;  4HBT A;  4OP8 A;  4OPR A;  3ZCZ A;  3MFD A;  4R3J A;  4P0M A;  3HUN A;  5FQK A;  1E25 A;  3AGE A;  1S0W A;  3BLS A;  3PAE A;  3ZGA B;  4OPY A;  1O7E A;  3ITA A;  1DJC A;  2Y2J A;  3GR2 A;  4Y7P A;  2ZMA A;  2ZC6 B;  2H0Y A;  3RXX A;  4S2I A;  1BUL A;  5FAO A;  4XXR A;  1TDL A;  3DWZ A;  4QU3 A;  3HLF A;  4WZ5 A;  2Y55 A;  1HTZ A;  5CGX A;  5DVA A;  4X68 A;  3ZG5 A;  4CJN A;  4GD6 A;  1GHP A;  1G68 A;  2Y59 A;  3E2L A;  1MWT A;  1HVB A;  2CC1 A;  2H5S A;  5DTS A;  4KQR A;  4WZ5 C;  1XKZ A;  5CTM A;  4LV2 A;  4GNU A;  1K25 A;  5EVI D;  3S1Y A;  4KG2 A;  2HDQ A;  1NXY A;  1I5Q A;  3WS5 A;  3C7U A;  1W79 A;  5A93 A;  1VQQ A;  3PBN A;  1JWZ A;  5FQM A;  3HLC A;  1FSY A;  4WYY A;  1KGE A;  3GRJ A;  4Q8I A;  3SH7 A;  4H8R A;  1K56 D;  1RCJ A;  5E2G A;  2C5W B;  3IF6 C;  1WYB A;  3ISG A;  2EFU A;  3UPO A;  1L0F A;  4E3K A;  3P09 A;  3HLB A;  3MZF A;  2Y2P A;  2XFT A;  3UE3 A;  5EUA A;  5GL9 A;  4ZJ1 A;  3VFH A;  1BLP A;  1IYS A;  1PW8 A;  5EEC A;  3SS5 A;  1CEG A;  4R23 A;  4U3T A;  3BFC A;  2H0T A;  1FQG A;  1IYP A;  2V1Z A;  1JTD A;  4BL3 A;  5FI2 A;  2HP5 A;  5JYP A;  5FSR A;  3LCE A;  2ZQC A;  3IF6 B;  3A3J A;  2G2U A;  1FR6 A;  4DRT A;  5GHX A;  5AQA A;  3ZNT A;  4OLD A;  4B4Z A;  4E3O A;  1ESI A;  1I2W A;  3DW0 A;  1RGZ A;  2XD5 A;  4MBH A;  2EXB A;  3Q7Z A;  3OPH A;  1PZO A;  1YT4 A;  2Y91 A;  3NCK A;  3CMZ A;  2J9O A;  4HES A;  1KDS A;  5CHM A;  5IHV A;  4E6X A;  1GA9 A;  1K6S A;  3UO9 A;  3W4Q A;  1CEF A;  2HDU A;  2P74 A;  3HLG A;  1NY0 A;  1ONG A;  3PBQ A;  4K0X A;  2X71 A;  3VP4 A;  5M19 A;  4R3B A;  1MKI A;  2XQZ A;  4GD8 A;  3FWL A;  1G6A A;  3E2K A;  4IED A;  4OQG A;  1U60 A;  3EQU A;  3GQZ A;  4X53 A;  4EUZ A;  4N9K A;  2ZJ9 A;  4OON A;  4NET A;  4BD0 A;  4OH0 A;  4WZ4 A;  3PAG A;  4PPR A;  4YFM A;  2E8I A;  2EX2 A;  2FFF B;  2Y2K A;  3UY6 A;  3WWX A;  3MXR A;  4KZ3 A;  4IVK A;  2XGN A;  4E3J A;  2VGJ A;  4MBK A;  1ES4 A;  1KVM A;  3G2Y A;  3M6H A;  1L0G A;  1YLZ A;  2Y2M A;  4FCF A;  3C7V A;  3GTC A;  1FR1 A;  5HFO A;  2Y4A A;  5TGF A;  5EVI A;  1PI5 A;  3ZG8 B;  3C4O A;  3V3S A;  3A3D A;  3V5M A;  1PYY A;  3LO7 A;  3IWQ A;  3BM6 A;  4JF6 A;  4S2J A;  5FA7 A;  1DY6 A;  2DCF A;  5BOH A;  5EVI C;  5CGS A;  2XDM A;  3GMW A;  5FAQ A;  3RJU A;  2HDS A;  4P85 A;  5HAP A;  2XK1 A;  4OPQ A;  3IQA A;  2RCX A;  4S2P A;  3N8S A;  5A91 A;  5CER A;  4DE0 A;  3OPR A;  3UDF A;  3AGF A;  5L2F A;  3VSK A;  2PU2 A;  3BEB A;  4CPK A;  3Q7V B;  2WZZ A;  1LHY A;  4B88 A;  3OC2 A;  4BEN A;  2IWD A;  1FSW A;  2G2W A;  4JF4 A;  2QPN A;  3N4I A;  3O87 A;  3HUO A;  4JF5 A;  3IF5 A;  3VP2 A;  2WKE A;  1IYO A;  4OQH A;  1MWR A;  1YLJ A;  1Q2Q A;  4BL2 A;  3OZH A;  1LI9 A;  2HP9 A;  5FQJ A;  4OOL A;  3Q07 A;  5AQ9 A;  1W7F A;  3MKE A;  3ZVT A;  4B4X A;  2ZM0 A;  1IYQ A;  2OLU A;  3C5A A;  4PM6 A;  1YM1 A;  5E2H A;  4GZB A;  4QJG A;  1PW1 A;  3MZE A;  2JCH A;  3BFE A;  5J8X A;  1JTG A;  3O86 A;  3G30 A;  4KZB A;  2Q9M A;  2Y2I A;  2ZLY A;  5TFQ A;  4PM9 A;  4OOY A;  4YIN A;  4P87 A;  4M3K A;  4UA9 A;  4ZJ3 A;  4GKU A;  4N1H A;  1OME A;  1FCM A;  5EE8 A;  2V2F F;  1ZG4 A;  3QNC A;  4LEN A;  4C75 A;  5KZH A;  3A3E A;  4R4R A;  5EOE A;  4BQM A;  4WMC D;  4Z9Q A;  3IWO A;  4L0L A;  3HLE A;  1QMF A;  4OVD A;  1BLH A;  4LV1 A;  3LY3 A;  2ZQ8 A;  5HL1 A;  1GA0 A;  4UA6 A;  1CK3 A;  3FKW A;  2OSU A;  3M2J A;  2ZQ7 A;  4E6W A;  5HX9 A;  3RXW A;  1RGY A;  2R9W A;  2R9X A;  4K0W A;  1SHV A;  3IXH A;  1K38 A;  1S6R A;  3IHA A;  3PBT A;  1ALQ A;  5CEB A;  5HAQ A;  2XFS A;  4E3N A;  5M18 A;  3VOY A;  1K54 A;  1W5D A;  3ZG7 B;  2Y2H A;  5F1G A;  1LI0 A;  1LLB A;  1YMS A;  4N92 A;  4QY6 A;  3SH8 A;  5KSH A;  3NBL A;  1W8Q A;  4DE1 A;  3DWK A;  5JYO A;  3VP3 A;  5CHJ A;  3V50 A;  3SS3 A;  1PIO A;  1K54 C;  1K57 A;  4GDB A;  5GLB A;  5F1F A;  1JWV A;  2H10 A;  2DRW A;  2Y2Q A;  1TEM A;  3NY4 A;  4U0X A;  2X01 A;  3WS2 A;  3M2K A;  3Q1F A;  3WS1 A;  1ESU A;  3HUM A;  5FAP A;  4XUZ A;  4DDS A;  1C3B A;  4QD4 A;  2XLN A;  4JXS A;  2WGW A;  1H8Y A;  1E3U D;  4OOM A;  1ONH A;  3ZNY A;  3UPN A;  3PBO A;  3HL9 A;  1MBL A;  1ZKJ A;  4LV0 A;  1XGI A;  5GLA A;  4DDY A;  1Z6F A;  2J7V A;  4R1G A;  4DXB A;  1YLP A;  4WEK A;  2JC7 A;  2BLS A;  3G32 A;  5FQQ A;  3LY4 A;  3PBR A;  3BYD A;  4WEJ A;  1PWD A;  5FI6 A;  2Q9N A;  2A49 A;  4EBN A;  4EBP A;  1CI9 A;  5GHY A;  4K91 A;  2ZC3 B;  5DTT A;  2GDN A;  1ES3 A;  1LL5 A;  4X69 A;  3ZG9 B;  3IXB A;  1QME A;  4E3L A;  1PI4 A;  2EX6 A;  3O3V A;  1XX2 A;  2DNS A;  4OP5 A;  2ZQ9 A;  3OPP A;  4JPM A;  3I7J A;  3VFF A;  3G31 A;  1K4E A;  1XA7 A;  4WMC A;  1NZU A;  2OLV A;  3FKV A;  1XA1 A;  1KE4 A;  1NYY A;  3N8R A;  4KZ5 A;  3VSL A;  4FD8 A;  5HW3 A;  2A3U A;  2P9V A;  1CI8 A;  1K56 A;  1MXO A;  1K55 A;  2WK0 A;  2XEP A;  4OPZ A;  5AQ7 A;  3WRZ A;  4FH2 A;  4PMA A;  4OQ0 A;  1PWG A;  3GVB A;  4OLG A;  5F83 A;  4S2M A;  3N7W A;  1BLC A;  3IH8 A;  3PTE A;  4JXV A;  3WS0 A;  5EVL A;  2WKI A;  4IVI A;  3NIA A;  1BTL A;  3IT9 A;  4X55 A;  1SCW A;  3WS4 A;  1MPL A;  1K4F A;  1NRF A;  1MWU A;  3OCN A;  2ZC5 B;  3IXD A;  5EVI B;  1KE3 A;  4R0Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...