2J80A

Structure of citrate-bound periplasmic domain of sensor histidine kinase cita
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
129
structure length
129
Chain Sequence
TEERLHYQVGQRALIQAMQISAMPELVEAVQKRDLARIKALIDPMRSFSDATYITVGDASGQRLYHVNPDEIGKSMEGGDSDEALINAKSYVSVRKGSLGSSLRGKSPIQDATGKVIGIVSVGYTIEQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords SENSOR KINASE CITA
publication title A Ligand-Induced Switch in the Periplasmic Domain of Sensor Histidine Kinase Cita.
pubmed doi rcsb
source organism Klebsiella pneumoniae
total genus 35
structure length 129
sequence length 129
chains with identical sequence B
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2006-10-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2j80A00
5AVEA 5J7EA 2PHYA 2A24A 3UMEA 4HQAA 4HP9A 4R38A 5HDSA 4BBTA 3CWFA 5A8BA 1OT6A 5HWVA 2YKHA 3FG8A 2ZOHA 1T19A 2OWHA 1F98A 4JGRA 2B02A 1TS0A 5IU1A 5TBMB 3IBRA 1D06A 2QHKA 3LICA 2GJ3A 5TBMA 4NXBA 4K08A 1LSVA 1S66L 1DP8A 1MZUA 4LLOB 4LPZA 4HH2A 5J3WA 1T1CA 4MN6A 4EXOA 1GSVA 1WA9A 2QKPA 4I3IA 4BBUA 3MFXA 4EEUA 4NXGA 5IS1A 2INWA 4HOIA 4EETB 3MJQA 4JGPA 4GCZA 3MR0A 5G4YA 2PR6A 1JNUA 4DJ3A 2PR5A 3F1NB 3A0RA 4WN5A 3LIFA 4R70A 3F1NA 3F1OB 5HSQA 3EEHA 1S4SA 1EW0A 1S1ZA 4GHIB 3F1OA 3E4QA 3LIEA 3IS2B 2BASA 2PYPA 1T18A 4EEPA 1V9YA 2K7SA 3FC7A 3IS2A 3H7WA 4WF0A 3OLOA 3SW1A 4F3LB 1TS7A 1GSWA 2A24B 2H28A 2ZBBA 3C8CA 4F3LA 4EQ1A 4M4XA 1S1YA 4H6JB 3ICYA 2V0UA 3LI9A 3NOTC 4KUOA 4L9FA 1S67L 4HH3A 3VOLA 3LIBA 3UB9A 1LSXA 4H6JA 4PKYA 3UE6A 1OJGA 4PKYG 3E4OA 4MN5A 3VE3A 2PDRA 2VLGA 1X0OA 2ZOIA 2PD7A 4BBVA 1F9IA 2VV6A 1GSXA 4GS9B 5HDCA 2D01A 4GS9A 1XJ6A 4I3JA 4I3AA 3MQQA 4KUKA 2V1AA 5KIZA 1UGUA 4I5SA 3RTYA 1NWZA 3ULFA 3CAXA 1OTBA 2WKPA 3NHQA 3K3CA 3LIAA 4HP4A 4HJ3A 2JHEA 4EESA 2W27A 2V0WA 2R78A 5J4EA 2VV7A 2D02A 2JN7A 3BY8A 1DRMA 3LIDA 1S4RA 3NOPC 2PD8A 3UMDA 1ODVA 4JGOA 2OOLA 4EERA 4I39A 3LYXA 3H7WB 3A0SA 1LL8A 4WL9A 3C2WA 2WKRA 3NOUC 4HJ4A 5F5YA 3RH8B 5HWTA 1OT9A 1OTEA 4NXFA 3CLOA 4XT2A 3BWLA 3UB8A 1OTAA 5I5LA 4LRYC 3MQOA 1XFNA 1KOUA 4RQ9A 2VV8A 3D72A 4R3AA 2YKFA 4JGQA 2L0WA 2QWSA 3NJAA 5F6AA 4NXEA 3H82A 4HI4A 1OTDA 1TS6A 2P7JA 2W0NA 1V9ZA 3G6OA 3H9WA 3PYPA 4R6LA 4LRXC 1XJ4A 1D7EA 2V9AA 4YWZA 3T50A 5HD5A 4I38A 3PHYA 2J80A 2Z6DA 3HJIA 1UWNX 4L9EA 5F69A 2QJ5A 3KX0X 5AVFA 2Z6CA 5DJUA 2VEAA 3HJKA 4HNBA 4E04A 2KDKA 3MXQA 1BYWA 4B9OA 2L1MA 4HJ6A 4HHDA 5DJTA 1OTIA 3F1PB 1LSWA 4L9GA 3F1PA 1XFQA 5G4ZA 3B33A 3VE4A 4EW7A 1TS8A 2V1BA 1N9LA 1T1AA 5EFWA 4WLAA 1VB6A 1OJ5A 5HWWA 1N9OA 2WKQA 5HZHA 1Y28A 1T1BA 3LI8A 1P0ZA 3E4PA 3UB6A 3P7NA 2L4RA 4DJ2A 2PYRA 5F68A 2EA9A 2QJ7A 3UB7A 4XT2B 4LRZE 1DP6A 4GW9A 1UWPX 5HD3A 2OWJA 2M1CA 4WUJA 3A0VA 3GECA 1N9NA 4GHIA 1P97A 3H82B 3ZQ5A 5HDDA 3LUQA 1DP9A 1XJ2A 2I9VA 5DKLA 4HY8A 2KX6A 1G28A 2HV1A 3EWKA 5DKKA 2CMNA 1XJ3A 4KQDA 3BY9A 4HIAA 1LT0A 3GDIA 3K3DA
chains in the Genus database with same CATH superfamily
1KVLA 5J7EA 5G18A 4HQAA 4R38A 3KSGA 1W8YA 5A8BA 3ZCZA 1VETA 1FQGA 2ZOHA 3GTCA 3NC8A 3T1XA 4S2IA 2OWHA 3FWLA 4YNRA 4JGRA 2B02A 3G34A 1ZHHB 1TS0A 3P98A 4A5RA 2VGJA 4GJ4A 3CG5A 3BYDA 5AQ7A 1IYSA 5TBMA 3S22A 4AFIA 1BZAA 1LSVA 4DF6A 4BWIA 1YLPA 1JVJA 2QMIA 5J3WA 4MN6A 4EXOA 3FZCA 1D1JA 1XPBA 2ZLYA 3SH7A 2QKPA 4I3IA 2R9WA 1K56D 4F94A 2BLSA 3NULA 1IYPA 5IS1A 5HAIA 4H8RA 5DTSA 5HL6A 2IA2A 4OH0A 5EM0A 4HOIA 5E2HA 1FCNA 1L0FA 3MQ0A 3IXHA 3IF5A 5G4YA 1PW1A 5A93A 3GRJA 3BFEA 3N8LA 4HBUA 5EVIC 5CERA 4QPRA 4K0XA 1QMEA 1Z6FA 3A0RA 2XDMA 3IHAA 2J3TD 2MJ6A 3C5AA 4KQOA 4EBLA 4OOLA 3E2LA 3EEHA 5EOEA 2XFTA 2VGLM 4KZ7A 3ZFZA 4E6XA 1QMFA 2VZWA 4R3JA 1EW0A 4IHQA 5L10A 2EX9A 3F1OA 5CXWA 4NETA 2BASA 1T18A 4PHTA 2PBYA 2W1RA 3FC7A 3M6BA 3PAGA 3IXDA 3UPOA 4UA6A 1VEUB 4BD0A 4LV0A 3Q7VB 2VJWA 3MBZA 3V3SA 3GQZA 3NDEA 1TS7A 2WGIA 1YLZA 4UQIS 3LY3A 2P9VB 2ZBBA 3C8CA 3IT9A 4CQHA 3EGDC 4WMCD 3BM6A 3UNWA 4E3JA 3NOTC 2OLVA 3VOLA 2VX8A 2AVXA 1LSXA 3QP5A 1SKOA 4ID4A 2V1ZA 5HPFA 3VE3A 3RXWA 2WGWB 4OQHA 2B18A 5HL1A 4X53A 3GSGA 3HVFA 2ZOIA 1K38A 2P74A 3JVUA 3N8RA 2VA0A 3OPRA 3DTIA 5A90A 3ZNTA 2J9OA 3V3RA 3OZHA 1ZC2A 1BT5A 3W4PA 1CJFA 2RL3A 4I3AA 3G35A 2V1AA 3CZDA 4FUWA 3TG9A 5DF9A 3ULFA 3ZG0A 3VSLA 2Y59A 2NUPC 2EX6A 3ZG9B 3S7NA 2WKPA 2FH5A 1EI5A 2O99A 5FI7A 3V5MA 1IFQA 3UDXA 4GDBA 4HJ3A 2JHEA 1NZOA 2JKGA 3GR2A 3HLBA 2W27A 2Y2KA 4E3NA 2CC1A 5J4EA 1OMEA 3PAEA 5MC7A 4O8GA 2G7UA 1S0WA 3LR4A 3UMDA 4S2LA 1ODVA 2V8CA 4JGOA 2OOLA 1FOFA 5TR7A 1WYBA 1FSYA 1OPXA 3IHBA 4RX3A 3RXXA 2O0YA 2A49A 4HJ4A 3RH8B 3A3FA 3S4XA 4QB8A 1GHPA 4R23A 3IH8A 3CLOA 4JPMA 4ARZA 1MKIA 4P6BA 2QZ6A 5FA7A 3UB8A 1RGZA 3MQOA 5E2GA 4ZJ2A 2H0YA 3D72A 2HZ5A 4R3AA 1ESUA 3HLEA 1N9BA 2HGVA 3VFHA 2KOIA 3AGEA 4GZBA 5GLAA 2Y91A 3T4JA 3PTEA 3S1YA 2HPBA 3G6OA 3H9WA 4O0PA 1G5UA 1K25A 1XJ4A 1D7EA 1PWDA 4S2MA 4YWZA 3VFFA 2C5WB 1AXBA 1KVMA 3BFGA 5LBRA 4D60A 2JCHA 5HD5A 4UA9A 1TD5A 5CHJA 3HJIA 1UWNX 4NEED 4KZ5A 5F69A 2QJ5A 5TJJA 1K56A 1TDLA 1L3LA 5CGSA 3HJKA 4HNBA 4CJNA 4RA7A 4OPQA 1LL9A 4LCLA 4B9OA 1PZPA 1MWUA 4GKUA 4B4XA 4PM8A 4G3KA 1Q2QA 2E8IA 3HCYA 4N9KA 1LSWA 1XA1A 5AQAA 2ZC7A 2LB5A 1KE0A 1XFQA 4G3VA 1NZUA 3VP3A 4OP8A 1CEFA 5HPIA 2PT7A 5U47A 1H3QA 2V1BA 1PRQA 3C7UA 3QNBA 1M40A 5GHXA 4Y3IA 2WADA 4GDNA 1SCWA 3G30A 5EFWA 2IWCA 1F2KA 2Y55A 1OJ5A 5E43A 1MWTA 1T1BA 1BSGA 3WS5A 4P6ZM 1P0ZA 3E4PA 2JKRI 2FFFB 5GLBA 2W3HA 1JWZA 2XQZA 4ZRRA 5F68A 1KE3A 2XK1A 2WYXA 3G32A 4ZJ1A 3CPTA 1L2SA 5L07A 1DP6A 3EQUA 3VOYA 5EM1A 1K55A 5HD3A 2OWJA 4RVAA 3A0VA 4Y15A 4E3KA 3GECA 2ZJ9A 4WMCA 3BFFA 1CI9A 2ZMFA 1J3WA 4FOFA 1NYYA 4KG2A 1MBLA 5EE8A 4PM7A 1Y54A 2XA7S 3ZDJA 1H8YA 2QYBA 3EWKA 1KGGA 4GD8A 3O5YA 3B3XA 3GDIA 3A3EA 1LHYA 2A24A 4Z9QA 2ZM8A 2ZQ8A 4BBTA 4Y0UA 1OT6A 2YKHA 4S2NC 4N9LA 4DE0A 1PWGA 1K57A 2Q0OA 3KYEA 3ZNYA 2HDQA 4MMNA 3KSIA 3ZG5A 2GJ3A 1W7FA 1SKFA 1TDGA 2GNXA 2HDUA 1MZUA 3ZVTA 4BJPA 2Y2NA 3AGFA 2HF6A 4Y0OA 1TF1A 4ESPA 3GVBA 1GSVA 4BBUA 4EEUA 4MBHA 3UE1A 4DRTA 4EETB 3MJQA 4JGPA 1SHVA 3IX4A 5FQMA 3IX8A 2ZM2A 2PR6A 3TE8A 3F1NB 5KMWA 1CEGA 4WN5A 2Y4AA 5FAOA 5EVLA 3W4QA 3TW8A 5E2FA 1S4SA 3T4KA 3MZEA 5M19A 3LIEA 3IS2B 2PYPA 3G4PA 1V9YA 1JTDA 4X69A 2V2FF 3Q07A 1YLWA 5CX7A 5DTTA 4Y13A 1MPLA 2VGLS 2Y2JA 1WE4A 5FAQA 3IXBA 3DTEA 3SW1A 4L0LA 1XA7A 1KE4A 4MN7A 2A24B 2H28A 3Q7VA 3OCLA 3LCEA 4MBKA 1S1YA 4EU0A 3I7JA 1SZVA 2P9VA 2JKFA 5CECA 3BLSA 2PU2A 2XGNA 1DJCA 4L9FA 4KUOA 4S2KA 4BL2A 1FR1A 1YMXA 2ZQCA 1FCMA 3CUEC 1ACFA 2ZC4B 1NY0A 1FR6A 2DRWA 3EQVA 2PDRA 4GB7A 4EBPA 1YLTA 3BJNA 2PD7A 2WGWA 2VV6A 1YM1A 4GS9B 2OSUA 2D01A 4JXVA 2XD5A 3DWKA 3M2KA 3IXGA 2LB9A 3NY4A 4EBNA 1NLZA 2HP5A 3LGOA 1FSWA 3G2YA 5M1AA 2OAP1 3OCNA 3CAXA 1OTBA 4FSFA 5HARA 1MY8A 5FI2A 4ZJ3A 3OPLA 4OKPA 3OOVA 2PBDP 5D3OA 1SDNA 4XUZA 5TGFA 1PFLA 3GMWA 1RP5A 3ZG8B 5L2FA 2V0WA 2ZD8A 1XGIA 2R78A 3HLFA 4BL3A 3A3JA 3BY8A 2Y2QA 5HFOA 1HVBA 3VP4A 1GA0A 4KZBA 5GLDA 4EQIA 3DAVA 1YMSA 4EERA 2OV5A 3LYXA 4Q8IA 2EXAA 3Q81A 3QP1A 4WL9A 3HUNA 2NUTC 1KDWA 5HAPA 5F5YA 5HWTA 4NXFA 3D3OA 2J3WA 2GX5A 1JWPA 2ZQAA 1OTAA 5EECA 5I5LA 5IT5A 1EROA 2M7VA 3QP6A 1XFNA 4RX2A 1H5XA 1VHMA 2V8FA 4Q0JA 2QWSA 3S7OA 5EVIB 3G2ZA 3DW0A 1OTDA 2P7JA 5CGWA 3LO7A 3KSHA 4BMWA 4LRXC 2V9AA 1Z09A 4QY6A 1IEMA 3PHYA 2J80A 4EWFA 1L0DA 2XH9A 5CGXA 4PAUA 2XFSA 3BECA 3HLCA 5CEDA 3G31A 1ZG6A 3UDIA 4HJ6A 4HHDA 5I94A 5DJTA 1OTIA 2GDNA 3O86A 2K31A 2IWBA 1W79A 4L9GA 4QWOA 2EWVA 4WYYA 3JPUA 1G68A 3B33A 3C30A 2WGVA 3OC2A 4B4ZA 1F5MA 5FL3A 1W8QA 2FZ0A 3LR0A 2Y2PA 1HZOA 3WWXA 3W8KA 4KQRA 1CI8A 2WKQA 1ZTUA 4YINA 5F82A 1Y28A 3K2NA 2KLIA 3UB6A 3P7NA 2JKTI 2JKTM 3T12B 4KG5A 1HD8A 1H0MA 3UB7A 3MZFA 4CLCC 2ZQDA 4P6ZS 3TOIA 2JBFA 1UWPX 1BLCA 1YPRA 4WUJA 1ERMA 1BLSA 2Q9NA 3PBOA 5DF7A 5F83A 3MXRA 4GHIA 2ZL1B 5DVAA 5HDDA 3IBJA 3EEAA 4EUZA 2EX2A 2XD1A 2I9VA 2Y2HA 3UN7A 3SH8A 2G2UA 1S6RA 4U0XA 2KX6A 2HV1A 5DKKA 3R7WB 1XJ3A 3BY9A 3HREA 3ITAA 1LT0A 1NYMA 1E4DA 5AVEA 1XX2A 2X02A 4JKTA 2PHYA 4HP9A 5HDSA 3TJZC 5HWVA 5JYOA 5A92A 5EV0A 3V50A 4Y7PA 4N1HA 1NRFA 1YAXA 1T19A 2Z2LB 4CLCB 4E3LA 4QU3A 5FDHA 2ZC3B 1GHIA 5EVID 1D06A 2E8JA 3VP0A 2QHKA 3LICA 1GCEA 4NXBA 2EFUA 1S66L 1K54A 3O3VA 2B95A 3VP1A 4QY5A 4WZ5A 4E3MA 4HH2A 4LGWA 2C6WB 4KZ9A 1BLHA 3IQAA 1WA9A 1CK3A 2JE5A 4KG6A 3PBSA 1K4FA 3C4OA 3S7QA 3FKWA 4JF5A 4OP5A 1I2WA 3PXPA 3LR5A 1GA9A 4FH4A 3QP8A 2ZQ7A 3NDGA 3O87A 3IWOA 3M2JA 4DJ3A 2PR5A 3W4OA 2IWDA 2FFYA 4PPRA 1K0KA 3LIFA 2BG1A 4R70A 3F1NA 3MS6A 3UO9A 3CMZA 3DWZA 3PR6A 1K6SA 4IVIA 4YOFA 4GHIB 4MBFA 3C4PA 3IF6C 3U4LP 1IOUA 3UY6A 1O7EA 2ZC6B 3MKFA 4GD6A 4GN2A 4X6TA 5CRFA 2K7SA 5BOHA 2W1TB 3IS2A 1LI9A 4WF0A 5JYPA 3OLOA 1NJ4A 4FH2A 3WS2A 4PM9A 3E2KA 1A0KA 4WM9A 4F3LB 3SS4A 3LY4A 4YFMA 3MXSA 2DCFA 2X71A 3Q82A 5C5KA 2W3DA 5CTNA 4M4XA 3IWQA 4WELA 4R0QA 1XP4A 4H6JB 1YLJA 4X56A 1S67L 4HH3A 3PBQA 1W63M 3KO6A 1XGJA 4BD1A 4DDYA 4PKYA 3UE6A 3VSKA 1YQSA 4R1GA 4PKYG 2GZAA 4MN5A 2HP9A 4U3TA 5DFXA 3T4SA 4FCFA 2ZMVA 3HBRA 3EOIA 4D2OA 1YKDA 1ZKJA 4KZ6A 1F9IA 4B93A 1GSXA 4BLMA 3P09A 1MWRA 4X1MA 4HEFA 5CHMA 4DE3A 4E6WA 5EPHA 4Y17A 1ZG4A 4GS9A 3T4OA 2UV0E 4KUKA 1UGUA 5HX9A 3UPNA 4CLCD 1NWZA 4ETZA 2WAFA 1JTGA 3T1RA 5E2EA 4ETXA 3DBAA 3K3CA 3O88A 2XSSA 1BLPA 4EESA 1IKIA 2XEPA 1RGYA 2D02A 4BQMA 2JN7A 1PNEA 1ALQA 1DRMA 4OQGA 3LIDA 1S4RA 3NOPC 2HJ9C 4OPZA 4JXWA 1BUEA 4IUHA 3KYQA 3OPHA 4UA7A 1FIKA 3NIAA 2PAVP 1K57C 3M6HA 3A0SA 5DTKA 3C2WA 3NOUC 4KZ3A 1O07A 5HW3A 1OTEA 1I2SA 3MSHA 1LI0A 5GL9A 1SDEA 5EOOA 2Y79A 4XT2A 3BWLA 2JC7A 2ACGA 4QHCA 4LRYC 1JWVA 1PI4A 4RQ9A 1NRJA 2VV8A 4LFUA 5AJGA 3T4QA 3L9KA 1FCOA 1XKZA 1PWCA 4GOGA 2WKIA 1KGFA 3NJAA 5F6AA 4NXEA 3H82A 4HI4A 5F1FA 3UE3A 5EVIA 5F1GA 4R6LA 3U2AA 1H8ZA 3UB5P 1IELA 2Y2LA 4C6YA 4OVDA 1ONGA 3C7VA 2W3EA 2O9CA 4K0WA 2Z6DA 3IX3A 3QNCA 1IKGA 4L9EA 3SS3A 2J7VA 5DJUA 2VEAA 4E04A 4ZDXA 4KZAA 3MXQA 1BYWA 2L1MA 3BQAA 4ZBEA 3SH9A 2H0TA 3F1PB 4OPRA 5L8MA 5J8XA 4IEDA 5CHUA 4OQ0A 3VOZA 3C38A 4XUXA 5G4ZA 1BTLA 5FQKA 2EFXA 4EW7A 1TS8A 1DJBA 3R4KA 4NG2A 3D9YA 4EUVA 4P87A 4II7A 4WLAA 3OBFA 4Z1WA 2O9BA 1LL5A 3QHYA 4PM6A 4N1XA 3W2ZA 5DF8A 2DMWA 3NBLA 1K4EA 3RJUA 1EWZA 1E3UD 3FKVA 3Q7ZA 3PBRA 2HDRA 2Y2OA 2EA9A 3N4IA 2P04A 5FAPA 2QJ7A 3FYZA 1TVFA 4XT2B 1GHMA 3VP2A 5DFYA 2Z2MB 3D4FA 4UAAA 4DXBA 4GW9A 4X55A 3FPVA 2PU4A 3DTKA 1CQAA 1P97A 1PIOA 5FASA 2WUQA 4WEJA 3H82B 3ZQ5A 2XROA 4QD4A 2ZC5B 1XJ2A 4N92A 1IYQA 2ZL1A 3NI9A 5DKLA 4HY8A 3BEBA 3BQ8A 1G28A 4DDSA 4KQDA 4LV1A 2Y8HA 4IJGA 2DNSA 4HIAA 5K5BA 3R7WA 4HBTA 3T4LA 1PZOA 1VETB 1FILA 2XLNA 3UMEA 1AWIA 3T1QB 2WK0A 3CWFA 3FG8A 2HDSA 4GLQA 3VMAA 1STZA 1F98A 4B88A 4LV3A 2WKHA 2H5SA 5IU1A 4UEYA 2I72A 3AGDA 5TBMB 3N8SA 3IBRA 4OLDA 4CLCA 4OOMA 3TSGA 4K08A 2RCXA 2A3UA 1DP8A 2VKSA 2EX8A 4LLOB 4KQQA 4LPZA 1T1CA 1BULA 3HLDA 5GHZA 5TFQA 1MWSA 5FQ9A 2VK3A 3MFXA 4OONA 4NXGA 3WS4A 3ITBA 2INWA 2EXBA 1PYYA 4GCZA 1C3BA 3UE0A 4DE2A 3MR0A 4DKIA 2H10A 4NK3A 4S2JA 1JNUA 5AQ9A 5L09A 4IUKA 3UDFA 3DTMA 2UWXA 2Q9MA 4R3BA 3T4TA 3E98A 5KSCA 2QPNA 4CPKA 1G6AA 3F1OB 5HSQA 3KSFA 5M18A 1ONHA 3BRMA 3NECA 5IHVA 1DJAA 3WRZA 1S1ZA 4DMZA 3E4QA 2VGKA 3ZVWA 3CJMA 4C75A 4UQIM 5FQQA 4EEPA 4MDZA 4LCMA 4X1LA 1P9WA 4IVKA 1L0GA 3H7WA 3LR3A 3MF0A 5GLCA 2W1TA 3LEQA 3QP2A 3S7PA 3BW6A 4E3IA 2ZQ9A 1GSWA 3IH9A 4KZ8A 2V20A 5FEGA 4F3LA 4OQIA 3FPWA 3MMHA 1YT4A 4EQ1A 4WZ4A 4BENA 3ZYTA 2XRNA 4ZTKA 2X01A 3ICYA 2V0UA 1SKOB 5GHYA 3LI9A 1W63Q 4X68A 1VM1A 3LIBA 4OOYA 3UB9A 5KSHA 3ZG7B 1HLUP 1ES2A 3N6IA 3WS1A 4H6JA 3ISGA 1XXMA 4P0MA 3NCKA 1OJGA 3E4OA 4PM5A 3SZTA 2ZMAA 1Q2PA 1MXOA 2PRFA 5A91A 2VLGA 2XR0A 1X0OA 2W3FA 4BBVA 1ERQA 4G3WA 4UHUA 2OLUA 3BFCA 3IF6A 2O9AA 5HDCA 4C3QA 1DY6A 2A2LA 5HAQA 1ESIA 4MEZA 1XJ6A 4I3JA 5FATA 2B5RA 3MQQA 3HLGA 1WYCA 4PMAA 3PBTA 5KIZA 4MCWA 5KZHA 4Y2FA 3KYZA 4I5SA 3P01A 3RTYA 1E3UA 3ZGAB 4E3OA 1Y4OA 5FQIA 4Y5FA 4X25A 4MLLA 3LFVA 4IBXA 3NHQA 3ZHHA 2WKEA 3LIAA 4HP4A 1NXYA 2ZM0A 3SS5A 4LENA 4Y0TA 2VV7A 4XXRA 4S2NA 4U0TA 2XF3A 2P08A 1ES4A 2PD8A 3RFBA 3TRCA 2JKRM 3A3DA 4I39A 3Q1FA 3H7WB 3MZDA 1LL8A 2WKRA 4HESA 3B42A 4ARZB 1KGEA 1OT9A 4DXCA 4S2PA 1K54C 4O7DA 2HP6A 2HJEA 4WZ5C 4JF4A 1ES5A 1KOUA 2J3TC 2WZZA 3B47A 1MKMA 1VQQA 1ES3A 2YKFA 3IWIA 3E0YA 3WRTA 4JGQA 2L0WA 1PW8A 3HUMA 4DE1A 3QP4A 2WZXA 4OLGA 4WBGA 1TS6A 4S2OA 2W3GA 1IYOA 2W0NA 1V9ZA 4MNRA 3WS0A 3CITA 2OAQ1 4R4RA 1CF0A 3PYPA 5FDSA 3BLMA 4JXSA 3VV4A 3T50A 3V39A 3JYIA 2WAEA 4I38A 4ZAMA 2Y2IA 4EV4A 3IF6B 4Q0IA 3MKEA 1YSQA 3KX0X 5AVFA 4WEKA 2Z6CA 3V67A 2BTFP 4NKPA 1K55C 2KDKA 5FSRA 4GNUA 3HL9A 4R4SA 3UPPA 3GV9A 1E25A 3A3IA 3BFDA 1KDSA 3HUOA 3F1PA 4JLFA 4JF6A 2G2WA 1NLYA 3JVVA 3VE4A 2J8YA 5FEFA 3LEZA 2K2NA 1N9LA 3L7HA 1N4OA 1T1AA 4OPYA 3CHWP 5EVEA 1MC0A 1H8MA 1VB6A 1L0EA 5HWWA 1N9OA 5HZHA 4M3KA 1M6KA 3CUEA 3T1SA 3LI8A 3MFDA 4KENB 5CTMA 2L4RA 1P9RA 3HLWA 4DJ2A 3CPTB 3N7WA 1YSPA 2PYRA 1W5DA 2EWWA 4ME4A 1K6RA 1PI5A 1RCJA 3OPPA 4LRZE 5AQBA 1LLBA 3SOIA 2XA7M 2J9PA 4KZ4A 2Y2MA 2M1CA 1HTZA 4LV2A 5FI6A 1N9NA 2Y2GA 1U60A 4FTXA 3CI6A 4IBRA 4RYEA 4JBFA 4K91A 4QJGA 3EGXC 3LUQA 4O01A 4P85A 1DP9A 2M7UA 4JXGA 1I5QA 5EUAA 4DN0A 4FD8A 4Q0HA 2CMNA 1VEUA 1TEMA 5CEBA 1J9MA 5FQJA 4CLCE 3FV7A 2R9XA 1G6OA 3K3DA 3PBNA 1YLYA
chains in the Genus database with same CATH topology
5AVEA 3T4LA 5J7EA 2PHYA 2A24A 3UMEA 4HQAA 4HP9A 4R38A 5HDSA 3TJZC 4BBTA 3KSGA 3CWFA 5A8BA 1OT6A 5HWVA 2YKHA 3FG8A 2ZOHA 4GLQA 1YAXA 1T19A 1STZA 2OWHA 4YNRA 1F98A 4JGRA 2B02A 4CLCB 1ZHHB 1TS0A 5IU1A 4UEYA 5TBMB 3IBRA 4GJ4A 4MMNA 3KSIA 4CLCA 1D06A 2QHKA 3LICA 2GJ3A 4OOMA 5TBMA 4NXBA 4AFIA 4K08A 1LSVA 1S66L 1DP8A 2GNXA 2VKSA 1MZUA 4BWIA 4LLOB 4BJPA 4LPZA 4HH2A 5J3WA 1T1CA 2HF6A 4MN6A 4EXOA 1TF1A 1GSVA 1WA9A 2QKPA 4I3IA 4BBUA 3MFXA 4EEUA 4NXGA 5IS1A 5HL6A 2INWA 2IA2A 3PBSA 4HOIA 4EETB 3MJQA 4JGPA 4GCZA 3S7QA 3MQ0A 3MR0A 5G4YA 3PXPA 3LR5A 2PR6A 1JNUA 4IUKA 3TE8A 4DJ3A 2PR5A 3F1NB 4QPRA 3T4TA 3A0RA 4WN5A 2J3TD 3E98A 3LIFA 2MJ6A 4R70A 3F1NA 4KQOA 4OOLA 3F1OB 5HSQA 3EEHA 3TW8A 3KSFA 2VGLM 3PR6A 1S4SA 2VZWA 3T4KA 4YOFA 1EW0A 1S1ZA 4IHQA 4DMZA 4GHIB 3F1OA 3E4QA 3LIEA 3IS2B 2BASA 2PYPA 1IOUA 1T18A 4PHTA 4UQIM 4EEPA 1V9YA 2K7SA 2W1RA 4MDZA 2W1TB 3FC7A 3IS2A 1P9WA 5CX7A 3H7WA 4WF0A 2VGLS 3LR3A 3OLOA 3MF0A 2W1TA 3S7PA 3SW1A 3BW6A 2VJWA 4F3LB 1TS7A 1GSWA 4L0LA 4UQIS 4MN7A 2A24B 2H28A 2ZBBA 2W3DA 5C5KA 3C8CA 4F3LA 3FPWA 3MMHA 3OCLA 4EQ1A 4M4XA 1S1YA 4WELA 4CQHA 3EGDC 4EU0A 3ZYTA 2XRNA 4H6JB 3ICYA 2V0UA 3LI9A 1W63Q 3NOTC 4KUOA 4L9FA 1S67L 4HH3A 3VOLA 3LIBA 2VX8A 1W63M 3KO6A 3PBQA 3UB9A 5KSHA 1LSXA 4H6JA 3CUEC 4PKYA 3UE6A 1OJGA 4PKYG 2GZAA 3E4OA 4MN5A 5HPFA 5DFXA 3VE3A 3T4SA 3EQVA 2ZMVA 2B18A 3EOIA 2PDRA 2VLGA 1YKDA 1X0OA 2ZOIA 3BJNA 3JVUA 2PD7A 2W3FA 4BBVA 1F9IA 4B93A 2VA0A 2VV6A 4G3WA 1GSXA 4GS9B 5HDCA 2O9AA 2D01A 2A2LA 2LB9A 4GS9A 1XJ6A 4I3JA 4I3AA 3T4OA 3MQQA 4KUKA 1NLZA 2V1AA 3PBTA 5KIZA 4MCWA 4Y2FA 3KYZA 1UGUA 4I5SA 3P01A 3RTYA 5DF9A 4CLCD 4Y5FA 1NWZA 2OAP1 3OCNA 3CAXA 3ULFA 4ETZA 1OTBA 4FSFA 2NUPC 3LFVA 3S7NA 2WKPA 3NHQA 4ETXA 2FH5A 3OOVA 3DBAA 2O99A 3K3CA 3LIAA 4HP4A 2XSSA 1IFQA 4HJ3A 2JHEA 4EESA 2W27A 2V0WA 2R78A 5J4EA 2VV7A 5MC7A 2D02A 2JN7A 3BY8A 1DRMA 4O8GA 2G7UA 3LIDA 1S4RA 2P08A 3LR4A 3NOPC 2HJ9C 2PD8A 3RFBA 3TRCA 3UMDA 2JKRM 1ODVA 4JGOA 4IUHA 2OOLA 3KYQA 4EERA 4I39A 1OPXA 3LYXA 3H7WB 3A0SA 1LL8A 2O0YA 4WL9A 3C2WA 2NUTC 2WKRA 3NOUC 4HJ4A 5F5YA 3RH8B 3B42A 4ARZB 5HWTA 1OT9A 1OTEA 4NXFA 3D3OA 2J3WA 2GX5A 3CLOA 2Y79A 4ARZA 4XT2A 3BWLA 3UB8A 1OTAA 2HJEA 5I5LA 5IT5A 4LRYC 3MQOA 2M7VA 1XFNA 1KOUA 2J3TC 3B47A 4RQ9A 1NRJA 2VV8A 3D72A 1MKMA 5AJGA 4R3AA 3T4QA 2YKFA 3E0YA 1VHMA 2HGVA 2KOIA 4Q0JA 4JGQA 2L0WA 2QWSA 3NJAA 3T4JA 3S7OA 5F6AA 4NXEA 3H82A 4HI4A 1OTDA 1TS6A 2P7JA 2W3GA 3UE3A 2W0NA 1V9ZA 3CITA 3KSHA 3G6OA 3H9WA 4O0PA 4BMWA 2OAQ1 3PYPA 4R6LA 4LRXC 3U2AA 1XJ4A 1D7EA 2V9AA 4YWZA 3VV4A 3T50A 5LBRA 5HD5A 4I38A 3PHYA 2W3EA 2J80A 2O9CA 1TD5A 2Z6DA 3HJIA 4Q0IA 1UWNX 4NEED 4L9EA 5TJJA 1YSQA 2QJ5A 3KX0X 5F69A 5AVFA 4WEKA 2Z6CA 5DJUA 4PAUA 3V67A 2VEAA 3HJKA 4HNBA 4NKPA 4E04A 2KDKA 3MXQA 1BYWA 4B9OA 2L1MA 3BQAA 4HJ6A 4HHDA 4G3KA 5DJTA 1OTIA 3F1PB 3HCYA 5L8MA 1LSWA 2K31A 2LB5A 4L9GA 3C38A 3F1PA 1XFQA 4G3VA 2EWVA 5HPIA 5G4ZA 1NLYA 2PT7A 1H3QA 3B33A 3JVVA 3VE4A 3C30A 3OC2A 4EW7A 1TS8A 2K2NA 2V1BA 1F5MA 1N9LA 5FL3A 1T1AA 3R4KA 2FZ0A 3LR0A 4Y3IA 5EFWA 4EUVA 1MC0A 4II7A 4WLAA 1H8MA 3OBFA 1VB6A 4Z1WA 1OJ5A 5HWWA 1N9OA 2WKQA 2O9BA 1ZTUA 5HZHA 1Y28A 1T1BA 3W2ZA 2DMWA 3CUEA 3K2NA 2KLIA 4P6ZM 3LI8A 1P0ZA 3E4PA 3UB6A 2JKRI 3P7NA 2JKTI 2L4RA 2JKTM 1P9RA 2W3HA 3PBRA 4DJ2A 1YSPA 2PYRA 4ZRRA 5F68A 2EA9A 2EWWA 2P04A 2QJ7A 4ME4A 3UB7A 4XT2B 4CLCC 4LRZE 1DP6A 4P6ZS 5DFYA 2XA7M 3EQUA 4GW9A 1UWPX 5HD3A 2OWJA 2M1CA 4WUJA 3A0VA 3FPVA 3PBOA 3GECA 1N9NA 4GHIA 2ZMFA 4FOFA 1P97A 3CI6A 4WEJA 3EGXC 3H82B 3ZQ5A 5HDDA 2XROA 3LUQA 4O01A 3IBJA 3EEAA 1DP9A 1XJ2A 2M7UA 2XA7S 2I9VA 5DKLA 4HY8A 2QYBA 3BQ8A 4DN0A 2KX6A 1G28A 2HV1A 3EWKA 5DKKA 3R7WB 4Q0HA 2CMNA 3O5YA 1XJ3A 4KQDA 3BY9A 2Y8HA 4IJGA 4CLCE 4HIAA 1G6OA 1LT0A 3GDIA 5K5BA 3K3DA 3PBNA 3R7WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AVE A;  5J7E A;  2PHY A;  2A24 A;  3UME A;  4HQA A;  4HP9 A;  4R38 A;  5HDS A;  4BBT A;  3CWF A;  5A8B A;  1OT6 A;  5HWV A;  2YKH A;  3FG8 A;  2ZOH A;  1T19 A;  2OWH A;  1F98 A;  4JGR A;  2B02 A;  1TS0 A;  5IU1 A;  5TBM B;  3IBR A;  1D06 A;  2QHK A;  3LIC A;  2GJ3 A;  5TBM A;  4NXB A;  4K08 A;  1LSV A;  1S66 L;  1DP8 A;  1MZU A;  4LLO B;  4LPZ A;  4HH2 A;  5J3W A;  1T1C A;  4MN6 A;  4EXO A;  1GSV A;  1WA9 A;  2QKP A;  4I3I A;  4BBU A;  3MFX A;  4EEU A;  4NXG A;  5IS1 A;  2INW A;  4HOI A;  4EET B;  3MJQ A;  4JGP A;  4GCZ A;  3MR0 A;  5G4Y A;  2PR6 A;  1JNU A;  4DJ3 A;  2PR5 A;  3F1N B;  3A0R A;  4WN5 A;  3LIF A;  4R70 A;  3F1N A;  3F1O B;  5HSQ A;  3EEH A;  1S4S A;  1EW0 A;  1S1Z A;  4GHI B;  3F1O A;  3E4Q A;  3LIE A;  3IS2 B;  2BAS A;  2PYP A;  1T18 A;  4EEP A;  1V9Y A;  2K7S A;  3FC7 A;  3IS2 A;  3H7W A;  4WF0 A;  3OLO A;  3SW1 A;  4F3L B;  1TS7 A;  1GSW A;  2A24 B;  2H28 A;  2ZBB A;  3C8C A;  4F3L A;  4EQ1 A;  4M4X A;  1S1Y A;  4H6J B;  3ICY A;  2V0U A;  3LI9 A;  3NOT C;  4KUO A;  4L9F A;  1S67 L;  4HH3 A;  3VOL A;  3LIB A;  3UB9 A;  1LSX A;  4H6J A;  4PKY A;  3UE6 A;  1OJG A;  4PKY G;  3E4O A;  4MN5 A;  3VE3 A;  2PDR A;  2VLG A;  1X0O A;  2ZOI A;  2PD7 A;  4BBV A;  1F9I A;  2VV6 A;  1GSX A;  4GS9 B;  5HDC A;  2D01 A;  4GS9 A;  1XJ6 A;  4I3J A;  4I3A A;  3MQQ A;  4KUK A;  2V1A A;  5KIZ A;  1UGU A;  4I5S A;  3RTY A;  1NWZ A;  3ULF A;  3CAX A;  1OTB A;  2WKP A;  3NHQ A;  3K3C A;  3LIA A;  4HP4 A;  4HJ3 A;  2JHE A;  4EES A;  2W27 A;  2V0W A;  2R78 A;  5J4E A;  2VV7 A;  2D02 A;  2JN7 A;  3BY8 A;  1DRM A;  3LID A;  1S4R A;  3NOP C;  2PD8 A;  3UMD A;  1ODV A;  4JGO A;  2OOL A;  4EER A;  4I39 A;  3LYX A;  3H7W B;  3A0S A;  1LL8 A;  4WL9 A;  3C2W A;  2WKR A;  3NOU C;  4HJ4 A;  5F5Y A;  3RH8 B;  5HWT A;  1OT9 A;  1OTE A;  4NXF A;  3CLO A;  4XT2 A;  3BWL A;  3UB8 A;  1OTA A;  5I5L A;  4LRY C;  3MQO A;  1XFN A;  1KOU A;  4RQ9 A;  2VV8 A;  3D72 A;  4R3A A;  2YKF A;  4JGQ A;  2L0W A;  2QWS A;  3NJA A;  5F6A A;  4NXE A;  3H82 A;  4HI4 A;  1OTD A;  1TS6 A;  2P7J A;  2W0N A;  1V9Z A;  3G6O A;  3H9W A;  3PYP A;  4R6L A;  4LRX C;  1XJ4 A;  1D7E A;  2V9A A;  4YWZ A;  3T50 A;  5HD5 A;  4I38 A;  3PHY A;  2J80 A;  2Z6D A;  3HJI A;  1UWN X;  4L9E A;  5F69 A;  2QJ5 A;  3KX0 X;  5AVF A;  2Z6C A;  5DJU A;  2VEA A;  3HJK A;  4HNB A;  4E04 A;  2KDK A;  3MXQ A;  1BYW A;  4B9O A;  2L1M A;  4HJ6 A;  4HHD A;  5DJT A;  1OTI A;  3F1P B;  1LSW A;  4L9G A;  3F1P A;  1XFQ A;  5G4Z A;  3B33 A;  3VE4 A;  4EW7 A;  1TS8 A;  2V1B A;  1N9L A;  1T1A A;  5EFW A;  4WLA A;  1VB6 A;  1OJ5 A;  5HWW A;  1N9O A;  2WKQ A;  5HZH A;  1Y28 A;  1T1B A;  3LI8 A;  1P0Z A;  3E4P A;  3UB6 A;  3P7N A;  2L4R A;  4DJ2 A;  2PYR A;  5F68 A;  2EA9 A;  2QJ7 A;  3UB7 A;  4XT2 B;  4LRZ E;  1DP6 A;  4GW9 A;  1UWP X;  5HD3 A;  2OWJ A;  2M1C A;  4WUJ A;  3A0V A;  3GEC A;  1N9N A;  4GHI A;  1P97 A;  3H82 B;  3ZQ5 A;  5HDD A;  3LUQ A;  1DP9 A;  1XJ2 A;  2I9V A;  5DKL A;  4HY8 A;  2KX6 A;  1G28 A;  2HV1 A;  3EWK A;  5DKK A;  2CMN A;  1XJ3 A;  4KQD A;  3BY9 A;  4HIA A;  1LT0 A;  3GDI A;  3K3D A; 
#chains in the Genus database with same CATH topology
 1KVL A;  5J7E A;  5G18 A;  4HQA A;  4R38 A;  3KSG A;  1W8Y A;  5A8B A;  3ZCZ A;  1VET A;  1FQG A;  2ZOH A;  3GTC A;  3NC8 A;  3T1X A;  4S2I A;  2OWH A;  3FWL A;  4YNR A;  4JGR A;  2B02 A;  3G34 A;  1ZHH B;  1TS0 A;  3P98 A;  4A5R A;  2VGJ A;  4GJ4 A;  3CG5 A;  3BYD A;  5AQ7 A;  1IYS A;  5TBM A;  3S22 A;  4AFI A;  1BZA A;  1LSV A;  4DF6 A;  4BWI A;  1YLP A;  1JVJ A;  2QMI A;  5J3W A;  4MN6 A;  4EXO A;  3FZC A;  1D1J A;  1XPB A;  2ZLY A;  3SH7 A;  2QKP A;  4I3I A;  2R9W A;  1K56 D;  4F94 A;  2BLS A;  3NUL A;  1IYP A;  5IS1 A;  5HAI A;  4H8R A;  5DTS A;  5HL6 A;  2IA2 A;  4OH0 A;  5EM0 A;  4HOI A;  5E2H A;  1FCN A;  1L0F A;  3MQ0 A;  3IXH A;  3IF5 A;  5G4Y A;  1PW1 A;  5A93 A;  3GRJ A;  3BFE A;  3N8L A;  4HBU A;  5EVI C;  5CER A;  4QPR A;  4K0X A;  1QME A;  1Z6F A;  3A0R A;  2XDM A;  3IHA A;  2J3T D;  2MJ6 A;  3C5A A;  4KQO A;  4EBL A;  4OOL A;  3E2L A;  3EEH A;  5EOE A;  2XFT A;  2VGL M;  4KZ7 A;  3ZFZ A;  4E6X A;  1QMF A;  2VZW A;  4R3J A;  1EW0 A;  4IHQ A;  5L10 A;  2EX9 A;  3F1O A;  5CXW A;  4NET A;  2BAS A;  1T18 A;  4PHT A;  2PBY A;  2W1R A;  3FC7 A;  3M6B A;  3PAG A;  3IXD A;  3UPO A;  4UA6 A;  1VEU B;  4BD0 A;  4LV0 A;  3Q7V B;  2VJW A;  3MBZ A;  3V3S A;  3GQZ A;  3NDE A;  1TS7 A;  2WGI A;  1YLZ A;  4UQI S;  3LY3 A;  2P9V B;  2ZBB A;  3C8C A;  3IT9 A;  4CQH A;  3EGD C;  4WMC D;  3BM6 A;  3UNW A;  4E3J A;  3NOT C;  2OLV A;  3VOL A;  2VX8 A;  2AVX A;  1LSX A;  3QP5 A;  1SKO A;  4ID4 A;  2V1Z A;  5HPF A;  3VE3 A;  3RXW A;  2WGW B;  4OQH A;  2B18 A;  5HL1 A;  4X53 A;  3GSG A;  3HVF A;  2ZOI A;  1K38 A;  2P74 A;  3JVU A;  3N8R A;  2VA0 A;  3OPR A;  3DTI A;  5A90 A;  3ZNT A;  2J9O A;  3V3R A;  3OZH A;  1ZC2 A;  1BT5 A;  3W4P A;  1CJF A;  2RL3 A;  4I3A A;  3G35 A;  2V1A A;  3CZD A;  4FUW A;  3TG9 A;  5DF9 A;  3ULF A;  3ZG0 A;  3VSL A;  2Y59 A;  2NUP C;  2EX6 A;  3ZG9 B;  3S7N A;  2WKP A;  2FH5 A;  1EI5 A;  2O99 A;  5FI7 A;  3V5M A;  1IFQ A;  3UDX A;  4GDB A;  4HJ3 A;  2JHE A;  1NZO A;  2JKG A;  3GR2 A;  3HLB A;  2W27 A;  2Y2K A;  4E3N A;  2CC1 A;  5J4E A;  1OME A;  3PAE A;  5MC7 A;  4O8G A;  2G7U A;  1S0W A;  3LR4 A;  3UMD A;  4S2L A;  1ODV A;  2V8C A;  4JGO A;  2OOL A;  1FOF A;  5TR7 A;  1WYB A;  1FSY A;  1OPX A;  3IHB A;  4RX3 A;  3RXX A;  2O0Y A;  2A49 A;  4HJ4 A;  3RH8 B;  3A3F A;  3S4X A;  4QB8 A;  1GHP A;  4R23 A;  3IH8 A;  3CLO A;  4JPM A;  4ARZ A;  1MKI A;  4P6B A;  2QZ6 A;  5FA7 A;  3UB8 A;  1RGZ A;  3MQO A;  5E2G A;  4ZJ2 A;  2H0Y A;  3D72 A;  2HZ5 A;  4R3A A;  1ESU A;  3HLE A;  1N9B A;  2HGV A;  3VFH A;  2KOI A;  3AGE A;  4GZB A;  5GLA A;  2Y91 A;  3T4J A;  3PTE A;  3S1Y A;  2HPB A;  3G6O A;  3H9W A;  4O0P A;  1G5U A;  1K25 A;  1XJ4 A;  1D7E A;  1PWD A;  4S2M A;  4YWZ A;  3VFF A;  2C5W B;  1AXB A;  1KVM A;  3BFG A;  5LBR A;  4D60 A;  2JCH A;  5HD5 A;  4UA9 A;  1TD5 A;  5CHJ A;  3HJI A;  1UWN X;  4NEE D;  4KZ5 A;  5F69 A;  2QJ5 A;  5TJJ A;  1K56 A;  1TDL A;  1L3L A;  5CGS A;  3HJK A;  4HNB A;  4CJN A;  4RA7 A;  4OPQ A;  1LL9 A;  4LCL A;  4B9O A;  1PZP A;  1MWU A;  4GKU A;  4B4X A;  4PM8 A;  4G3K A;  1Q2Q A;  2E8I A;  3HCY A;  4N9K A;  1LSW A;  1XA1 A;  5AQA A;  2ZC7 A;  2LB5 A;  1KE0 A;  1XFQ A;  4G3V A;  1NZU A;  3VP3 A;  4OP8 A;  1CEF A;  5HPI A;  2PT7 A;  5U47 A;  1H3Q A;  2V1B A;  1PRQ A;  3C7U A;  3QNB A;  1M40 A;  5GHX A;  4Y3I A;  2WAD A;  4GDN A;  1SCW A;  3G30 A;  5EFW A;  2IWC A;  1F2K A;  2Y55 A;  1OJ5 A;  5E43 A;  1MWT A;  1T1B A;  1BSG A;  3WS5 A;  4P6Z M;  1P0Z A;  3E4P A;  2JKR I;  2FFF B;  5GLB A;  2W3H A;  1JWZ A;  2XQZ A;  4ZRR A;  5F68 A;  1KE3 A;  2XK1 A;  2WYX A;  3G32 A;  4ZJ1 A;  3CPT A;  1L2S A;  5L07 A;  1DP6 A;  3EQU A;  3VOY A;  5EM1 A;  1K55 A;  5HD3 A;  2OWJ A;  4RVA A;  3A0V A;  4Y15 A;  4E3K A;  3GEC A;  2ZJ9 A;  4WMC A;  3BFF A;  1CI9 A;  2ZMF A;  1J3W A;  4FOF A;  1NYY A;  4KG2 A;  1MBL A;  5EE8 A;  4PM7 A;  1Y54 A;  2XA7 S;  3ZDJ A;  1H8Y A;  2QYB A;  3EWK A;  1KGG A;  4GD8 A;  3O5Y A;  3B3X A;  3GDI A;  3A3E A;  1LHY A;  2A24 A;  4Z9Q A;  2ZM8 A;  2ZQ8 A;  4BBT A;  4Y0U A;  1OT6 A;  2YKH A;  4S2N C;  4N9L A;  4DE0 A;  1PWG A;  1K57 A;  2Q0O A;  3KYE A;  3ZNY A;  2HDQ A;  4MMN A;  3KSI A;  3ZG5 A;  2GJ3 A;  1W7F A;  1SKF A;  1TDG A;  2GNX A;  2HDU A;  1MZU A;  3ZVT A;  4BJP A;  2Y2N A;  3AGF A;  2HF6 A;  4Y0O A;  1TF1 A;  4ESP A;  3GVB A;  1GSV A;  4BBU A;  4EEU A;  4MBH A;  3UE1 A;  4DRT A;  4EET B;  3MJQ A;  4JGP A;  1SHV A;  3IX4 A;  5FQM A;  3IX8 A;  2ZM2 A;  2PR6 A;  3TE8 A;  3F1N B;  5KMW A;  1CEG A;  4WN5 A;  2Y4A A;  5FAO A;  5EVL A;  3W4Q A;  3TW8 A;  5E2F A;  1S4S A;  3T4K A;  3MZE A;  5M19 A;  3LIE A;  3IS2 B;  2PYP A;  3G4P A;  1V9Y A;  1JTD A;  4X69 A;  2V2F F;  3Q07 A;  1YLW A;  5CX7 A;  5DTT A;  4Y13 A;  1MPL A;  2VGL S;  2Y2J A;  1WE4 A;  5FAQ A;  3IXB A;  3DTE A;  3SW1 A;  4L0L A;  1XA7 A;  1KE4 A;  4MN7 A;  2A24 B;  2H28 A;  3Q7V A;  3OCL A;  3LCE A;  4MBK A;  1S1Y A;  4EU0 A;  3I7J A;  1SZV A;  2P9V A;  2JKF A;  5CEC A;  3BLS A;  2PU2 A;  2XGN A;  1DJC A;  4L9F A;  4KUO A;  4S2K A;  4BL2 A;  1FR1 A;  1YMX A;  2ZQC A;  1FCM A;  3CUE C;  1ACF A;  2ZC4 B;  1NY0 A;  1FR6 A;  2DRW A;  3EQV A;  2PDR A;  4GB7 A;  4EBP A;  1YLT A;  3BJN A;  2PD7 A;  2WGW A;  2VV6 A;  1YM1 A;  4GS9 B;  2OSU A;  2D01 A;  4JXV A;  2XD5 A;  3DWK A;  3M2K A;  3IXG A;  2LB9 A;  3NY4 A;  4EBN A;  1NLZ A;  2HP5 A;  3LGO A;  1FSW A;  3G2Y A;  5M1A A;  2OAP 1;  3OCN A;  3CAX A;  1OTB A;  4FSF A;  5HAR A;  1MY8 A;  5FI2 A;  4ZJ3 A;  3OPL A;  4OKP A;  3OOV A;  2PBD P;  5D3O A;  1SDN A;  4XUZ A;  5TGF A;  1PFL A;  3GMW A;  1RP5 A;  3ZG8 B;  5L2F A;  2V0W A;  2ZD8 A;  1XGI A;  2R78 A;  3HLF A;  4BL3 A;  3A3J A;  3BY8 A;  2Y2Q A;  5HFO A;  1HVB A;  3VP4 A;  1GA0 A;  4KZB A;  5GLD A;  4EQI A;  3DAV A;  1YMS A;  4EER A;  2OV5 A;  3LYX A;  4Q8I A;  2EXA A;  3Q81 A;  3QP1 A;  4WL9 A;  3HUN A;  2NUT C;  1KDW A;  5HAP A;  5F5Y A;  5HWT A;  4NXF A;  3D3O A;  2J3W A;  2GX5 A;  1JWP A;  2ZQA A;  1OTA A;  5EEC A;  5I5L A;  5IT5 A;  1ERO A;  2M7V A;  3QP6 A;  1XFN A;  4RX2 A;  1H5X A;  1VHM A;  2V8F A;  4Q0J A;  2QWS A;  3S7O A;  5EVI B;  3G2Z A;  3DW0 A;  1OTD A;  2P7J A;  5CGW A;  3LO7 A;  3KSH A;  4BMW A;  4LRX C;  2V9A A;  1Z09 A;  4QY6 A;  1IEM A;  3PHY A;  2J80 A;  4EWF A;  1L0D A;  2XH9 A;  5CGX A;  4PAU A;  2XFS A;  3BEC A;  3HLC A;  5CED A;  3G31 A;  1ZG6 A;  3UDI A;  4HJ6 A;  4HHD A;  5I94 A;  5DJT A;  1OTI A;  2GDN A;  3O86 A;  2K31 A;  2IWB A;  1W79 A;  4L9G A;  4QWO A;  2EWV A;  4WYY A;  3JPU A;  1G68 A;  3B33 A;  3C30 A;  2WGV A;  3OC2 A;  4B4Z A;  1F5M A;  5FL3 A;  1W8Q A;  2FZ0 A;  3LR0 A;  2Y2P A;  1HZO A;  3WWX A;  3W8K A;  4KQR A;  1CI8 A;  2WKQ A;  1ZTU A;  4YIN A;  5F82 A;  1Y28 A;  3K2N A;  2KLI A;  3UB6 A;  3P7N A;  2JKT I;  2JKT M;  3T12 B;  4KG5 A;  1HD8 A;  1H0M A;  3UB7 A;  3MZF A;  4CLC C;  2ZQD A;  4P6Z S;  3TOI A;  2JBF A;  1UWP X;  1BLC A;  1YPR A;  4WUJ A;  1ERM A;  1BLS A;  2Q9N A;  3PBO A;  5DF7 A;  5F83 A;  3MXR A;  4GHI A;  2ZL1 B;  5DVA A;  5HDD A;  3IBJ A;  3EEA A;  4EUZ A;  2EX2 A;  2XD1 A;  2I9V A;  2Y2H A;  3UN7 A;  3SH8 A;  2G2U A;  1S6R A;  4U0X A;  2KX6 A;  2HV1 A;  5DKK A;  3R7W B;  1XJ3 A;  3BY9 A;  3HRE A;  3ITA A;  1LT0 A;  1NYM A;  1E4D A;  5AVE A;  1XX2 A;  2X02 A;  4JKT A;  2PHY A;  4HP9 A;  5HDS A;  3TJZ C;  5HWV A;  5JYO A;  5A92 A;  5EV0 A;  3V50 A;  4Y7P A;  4N1H A;  1NRF A;  1YAX A;  1T19 A;  2Z2L B;  4CLC B;  4E3L A;  4QU3 A;  5FDH A;  2ZC3 B;  1GHI A;  5EVI D;  1D06 A;  2E8J A;  3VP0 A;  2QHK A;  3LIC A;  1GCE A;  4NXB A;  2EFU A;  1S66 L;  1K54 A;  3O3V A;  2B95 A;  3VP1 A;  4QY5 A;  4WZ5 A;  4E3M A;  4HH2 A;  4LGW A;  2C6W B;  4KZ9 A;  1BLH A;  3IQA A;  1WA9 A;  1CK3 A;  2JE5 A;  4KG6 A;  3PBS A;  1K4F A;  3C4O A;  3S7Q A;  3FKW A;  4JF5 A;  4OP5 A;  1I2W A;  3PXP A;  3LR5 A;  1GA9 A;  4FH4 A;  3QP8 A;  2ZQ7 A;  3NDG A;  3O87 A;  3IWO A;  3M2J A;  4DJ3 A;  2PR5 A;  3W4O A;  2IWD A;  2FFY A;  4PPR A;  1K0K A;  3LIF A;  2BG1 A;  4R70 A;  3F1N A;  3MS6 A;  3UO9 A;  3CMZ A;  3DWZ A;  3PR6 A;  1K6S A;  4IVI A;  4YOF A;  4GHI B;  4MBF A;  3C4P A;  3IF6 C;  3U4L P;  1IOU A;  3UY6 A;  1O7E A;  2ZC6 B;  3MKF A;  4GD6 A;  4GN2 A;  4X6T A;  5CRF A;  2K7S A;  5BOH A;  2W1T B;  3IS2 A;  1LI9 A;  4WF0 A;  5JYP A;  3OLO A;  1NJ4 A;  4FH2 A;  3WS2 A;  4PM9 A;  3E2K A;  1A0K A;  4WM9 A;  4F3L B;  3SS4 A;  3LY4 A;  4YFM A;  3MXS A;  2DCF A;  2X71 A;  3Q82 A;  5C5K A;  2W3D A;  5CTN A;  4M4X A;  3IWQ A;  4WEL A;  4R0Q A;  1XP4 A;  4H6J B;  1YLJ A;  4X56 A;  1S67 L;  4HH3 A;  3PBQ A;  1W63 M;  3KO6 A;  1XGJ A;  4BD1 A;  4DDY A;  4PKY A;  3UE6 A;  3VSK A;  1YQS A;  4R1G A;  4PKY G;  2GZA A;  4MN5 A;  2HP9 A;  4U3T A;  5DFX A;  3T4S A;  4FCF A;  2ZMV A;  3HBR A;  3EOI A;  4D2O A;  1YKD A;  1ZKJ A;  4KZ6 A;  1F9I A;  4B93 A;  1GSX A;  4BLM A;  3P09 A;  1MWR A;  4X1M A;  4HEF A;  5CHM A;  4DE3 A;  4E6W A;  5EPH A;  4Y17 A;  1ZG4 A;  4GS9 A;  3T4O A;  2UV0 E;  4KUK A;  1UGU A;  5HX9 A;  3UPN A;  4CLC D;  1NWZ A;  4ETZ A;  2WAF A;  1JTG A;  3T1R A;  5E2E A;  4ETX A;  3DBA A;  3K3C A;  3O88 A;  2XSS A;  1BLP A;  4EES A;  1IKI A;  2XEP A;  1RGY A;  2D02 A;  4BQM A;  2JN7 A;  1PNE A;  1ALQ A;  1DRM A;  4OQG A;  3LID A;  1S4R A;  3NOP C;  2HJ9 C;  4OPZ A;  4JXW A;  1BUE A;  4IUH A;  3KYQ A;  3OPH A;  4UA7 A;  1FIK A;  3NIA A;  2PAV P;  1K57 C;  3M6H A;  3A0S A;  5DTK A;  3C2W A;  3NOU C;  4KZ3 A;  1O07 A;  5HW3 A;  1OTE A;  1I2S A;  3MSH A;  1LI0 A;  5GL9 A;  1SDE A;  5EOO A;  2Y79 A;  4XT2 A;  3BWL A;  2JC7 A;  2ACG A;  4QHC A;  4LRY C;  1JWV A;  1PI4 A;  4RQ9 A;  1NRJ A;  2VV8 A;  4LFU A;  5AJG A;  3T4Q A;  3L9K A;  1FCO A;  1XKZ A;  1PWC A;  4GOG A;  2WKI A;  1KGF A;  3NJA A;  5F6A A;  4NXE A;  3H82 A;  4HI4 A;  5F1F A;  3UE3 A;  5EVI A;  5F1G A;  4R6L A;  3U2A A;  1H8Z A;  3UB5 P;  1IEL A;  2Y2L A;  4C6Y A;  4OVD A;  1ONG A;  3C7V A;  2W3E A;  2O9C A;  4K0W A;  2Z6D A;  3IX3 A;  3QNC A;  1IKG A;  4L9E A;  3SS3 A;  2J7V A;  5DJU A;  2VEA A;  4E04 A;  4ZDX A;  4KZA A;  3MXQ A;  1BYW A;  2L1M A;  3BQA A;  4ZBE A;  3SH9 A;  2H0T A;  3F1P B;  4OPR A;  5L8M A;  5J8X A;  4IED A;  5CHU A;  4OQ0 A;  3VOZ A;  3C38 A;  4XUX A;  5G4Z A;  1BTL A;  5FQK A;  2EFX A;  4EW7 A;  1TS8 A;  1DJB A;  3R4K A;  4NG2 A;  3D9Y A;  4EUV A;  4P87 A;  4II7 A;  4WLA A;  3OBF A;  4Z1W A;  2O9B A;  1LL5 A;  3QHY A;  4PM6 A;  4N1X A;  3W2Z A;  5DF8 A;  2DMW A;  3NBL A;  1K4E A;  3RJU A;  1EWZ A;  1E3U D;  3FKV A;  3Q7Z A;  3PBR A;  2HDR A;  2Y2O A;  2EA9 A;  3N4I A;  2P04 A;  5FAP A;  2QJ7 A;  3FYZ A;  1TVF A;  4XT2 B;  1GHM A;  3VP2 A;  5DFY A;  2Z2M B;  3D4F A;  4UAA A;  4DXB A;  4GW9 A;  4X55 A;  3FPV A;  2PU4 A;  3DTK A;  1CQA A;  1P97 A;  1PIO A;  5FAS A;  2WUQ A;  4WEJ A;  3H82 B;  3ZQ5 A;  2XRO A;  4QD4 A;  2ZC5 B;  1XJ2 A;  4N92 A;  1IYQ A;  2ZL1 A;  3NI9 A;  5DKL A;  4HY8 A;  3BEB A;  3BQ8 A;  1G28 A;  4DDS A;  4KQD A;  4LV1 A;  2Y8H A;  4IJG A;  2DNS A;  4HIA A;  5K5B A;  3R7W A;  4HBT A;  3T4L A;  1PZO A;  1VET B;  1FIL A;  2XLN A;  3UME A;  1AWI A;  3T1Q B;  2WK0 A;  3CWF A;  3FG8 A;  2HDS A;  4GLQ A;  3VMA A;  1STZ A;  1F98 A;  4B88 A;  4LV3 A;  2WKH A;  2H5S A;  5IU1 A;  4UEY A;  2I72 A;  3AGD A;  5TBM B;  3N8S A;  3IBR A;  4OLD A;  4CLC A;  4OOM A;  3TSG A;  4K08 A;  2RCX A;  2A3U A;  1DP8 A;  2VKS A;  2EX8 A;  4LLO B;  4KQQ A;  4LPZ A;  1T1C A;  1BUL A;  3HLD A;  5GHZ A;  5TFQ A;  1MWS A;  5FQ9 A;  2VK3 A;  3MFX A;  4OON A;  4NXG A;  3WS4 A;  3ITB A;  2INW A;  2EXB A;  1PYY A;  4GCZ A;  1C3B A;  3UE0 A;  4DE2 A;  3MR0 A;  4DKI A;  2H10 A;  4NK3 A;  4S2J A;  1JNU A;  5AQ9 A;  5L09 A;  4IUK A;  3UDF A;  3DTM A;  2UWX A;  2Q9M A;  4R3B A;  3T4T A;  3E98 A;  5KSC A;  2QPN A;  4CPK A;  1G6A A;  3F1O B;  5HSQ A;  3KSF A;  5M18 A;  1ONH A;  3BRM A;  3NEC A;  5IHV A;  1DJA A;  3WRZ A;  1S1Z A;  4DMZ A;  3E4Q A;  2VGK A;  3ZVW A;  3CJM A;  4C75 A;  4UQI M;  5FQQ A;  4EEP A;  4MDZ A;  4LCM A;  4X1L A;  1P9W A;  4IVK A;  1L0G A;  3H7W A;  3LR3 A;  3MF0 A;  5GLC A;  2W1T A;  3LEQ A;  3QP2 A;  3S7P A;  3BW6 A;  4E3I A;  2ZQ9 A;  1GSW A;  3IH9 A;  4KZ8 A;  2V20 A;  5FEG A;  4F3L A;  4OQI A;  3FPW A;  3MMH A;  1YT4 A;  4EQ1 A;  4WZ4 A;  4BEN A;  3ZYT A;  2XRN A;  4ZTK A;  2X01 A;  3ICY A;  2V0U A;  1SKO B;  5GHY A;  3LI9 A;  1W63 Q;  4X68 A;  1VM1 A;  3LIB A;  4OOY A;  3UB9 A;  5KSH A;  3ZG7 B;  1HLU P;  1ES2 A;  3N6I A;  3WS1 A;  4H6J A;  3ISG A;  1XXM A;  4P0M A;  3NCK A;  1OJG A;  3E4O A;  4PM5 A;  3SZT A;  2ZMA A;  1Q2P A;  1MXO A;  2PRF A;  5A91 A;  2VLG A;  2XR0 A;  1X0O A;  2W3F A;  4BBV A;  1ERQ A;  4G3W A;  4UHU A;  2OLU A;  3BFC A;  3IF6 A;  2O9A A;  5HDC A;  4C3Q A;  1DY6 A;  2A2L A;  5HAQ A;  1ESI A;  4MEZ A;  1XJ6 A;  4I3J A;  5FAT A;  2B5R A;  3MQQ A;  3HLG A;  1WYC A;  4PMA A;  3PBT A;  5KIZ A;  4MCW A;  5KZH A;  4Y2F A;  3KYZ A;  4I5S A;  3P01 A;  3RTY A;  1E3U A;  3ZGA B;  4E3O A;  1Y4O A;  5FQI A;  4Y5F A;  4X25 A;  4MLL A;  3LFV A;  4IBX A;  3NHQ A;  3ZHH A;  2WKE A;  3LIA A;  4HP4 A;  1NXY A;  2ZM0 A;  3SS5 A;  4LEN A;  4Y0T A;  2VV7 A;  4XXR A;  4S2N A;  4U0T A;  2XF3 A;  2P08 A;  1ES4 A;  2PD8 A;  3RFB A;  3TRC A;  2JKR M;  3A3D A;  4I39 A;  3Q1F A;  3H7W B;  3MZD A;  1LL8 A;  2WKR A;  4HES A;  3B42 A;  4ARZ B;  1KGE A;  1OT9 A;  4DXC A;  4S2P A;  1K54 C;  4O7D A;  2HP6 A;  2HJE A;  4WZ5 C;  4JF4 A;  1ES5 A;  1KOU A;  2J3T C;  2WZZ A;  3B47 A;  1MKM A;  1VQQ A;  1ES3 A;  2YKF A;  3IWI A;  3E0Y A;  3WRT A;  4JGQ A;  2L0W A;  1PW8 A;  3HUM A;  4DE1 A;  3QP4 A;  2WZX A;  4OLG A;  4WBG A;  1TS6 A;  4S2O A;  2W3G A;  1IYO A;  2W0N A;  1V9Z A;  4MNR A;  3WS0 A;  3CIT A;  2OAQ 1;  4R4R A;  1CF0 A;  3PYP A;  5FDS A;  3BLM A;  4JXS A;  3VV4 A;  3T50 A;  3V39 A;  3JYI A;  2WAE A;  4I38 A;  4ZAM A;  2Y2I A;  4EV4 A;  3IF6 B;  4Q0I A;  3MKE A;  1YSQ A;  3KX0 X;  5AVF A;  4WEK A;  2Z6C A;  3V67 A;  2BTF P;  4NKP A;  1K55 C;  2KDK A;  5FSR A;  4GNU A;  3HL9 A;  4R4S A;  3UPP A;  3GV9 A;  1E25 A;  3A3I A;  3BFD A;  1KDS A;  3HUO A;  3F1P A;  4JLF A;  4JF6 A;  2G2W A;  1NLY A;  3JVV A;  3VE4 A;  2J8Y A;  5FEF A;  3LEZ A;  2K2N A;  1N9L A;  3L7H A;  1N4O A;  1T1A A;  4OPY A;  3CHW P;  5EVE A;  1MC0 A;  1H8M A;  1VB6 A;  1L0E A;  5HWW A;  1N9O A;  5HZH A;  4M3K A;  1M6K A;  3CUE A;  3T1S A;  3LI8 A;  3MFD A;  4KEN B;  5CTM A;  2L4R A;  1P9R A;  3HLW A;  4DJ2 A;  3CPT B;  3N7W A;  1YSP A;  2PYR A;  1W5D A;  2EWW A;  4ME4 A;  1K6R A;  1PI5 A;  1RCJ A;  3OPP A;  4LRZ E;  5AQB A;  1LLB A;  3SOI A;  2XA7 M;  2J9P A;  4KZ4 A;  2Y2M A;  2M1C A;  1HTZ A;  4LV2 A;  5FI6 A;  1N9N A;  2Y2G A;  1U60 A;  4FTX A;  3CI6 A;  4IBR A;  4RYE A;  4JBF A;  4K91 A;  4QJG A;  3EGX C;  3LUQ A;  4O01 A;  4P85 A;  1DP9 A;  2M7U A;  4JXG A;  1I5Q A;  5EUA A;  4DN0 A;  4FD8 A;  4Q0H A;  2CMN A;  1VEU A;  1TEM A;  5CEB A;  1J9M A;  5FQJ A;  4CLC E;  3FV7 A;  2R9X A;  1G6O A;  3K3D A;  3PBN A;  1YLY A; 
#chains in the Genus database with same CATH homology
 5AVE A;  3T4L A;  5J7E A;  2PHY A;  2A24 A;  3UME A;  4HQA A;  4HP9 A;  4R38 A;  5HDS A;  3TJZ C;  4BBT A;  3KSG A;  3CWF A;  5A8B A;  1OT6 A;  5HWV A;  2YKH A;  3FG8 A;  2ZOH A;  4GLQ A;  1YAX A;  1T19 A;  1STZ A;  2OWH A;  4YNR A;  1F98 A;  4JGR A;  2B02 A;  4CLC B;  1ZHH B;  1TS0 A;  5IU1 A;  4UEY A;  5TBM B;  3IBR A;  4GJ4 A;  4MMN A;  3KSI A;  4CLC A;  1D06 A;  2QHK A;  3LIC A;  2GJ3 A;  4OOM A;  5TBM A;  4NXB A;  4AFI A;  4K08 A;  1LSV A;  1S66 L;  1DP8 A;  2GNX A;  2VKS A;  1MZU A;  4BWI A;  4LLO B;  4BJP A;  4LPZ A;  4HH2 A;  5J3W A;  1T1C A;  2HF6 A;  4MN6 A;  4EXO A;  1TF1 A;  1GSV A;  1WA9 A;  2QKP A;  4I3I A;  4BBU A;  3MFX A;  4EEU A;  4NXG A;  5IS1 A;  5HL6 A;  2INW A;  2IA2 A;  3PBS A;  4HOI A;  4EET B;  3MJQ A;  4JGP A;  4GCZ A;  3S7Q A;  3MQ0 A;  3MR0 A;  5G4Y A;  3PXP A;  3LR5 A;  2PR6 A;  1JNU A;  4IUK A;  3TE8 A;  4DJ3 A;  2PR5 A;  3F1N B;  4QPR A;  3T4T A;  3A0R A;  4WN5 A;  2J3T D;  3E98 A;  3LIF A;  2MJ6 A;  4R70 A;  3F1N A;  4KQO A;  4OOL A;  3F1O B;  5HSQ A;  3EEH A;  3TW8 A;  3KSF A;  2VGL M;  3PR6 A;  1S4S A;  2VZW A;  3T4K A;  4YOF A;  1EW0 A;  1S1Z A;  4IHQ A;  4DMZ A;  4GHI B;  3F1O A;  3E4Q A;  3LIE A;  3IS2 B;  2BAS A;  2PYP A;  1IOU A;  1T18 A;  4PHT A;  4UQI M;  4EEP A;  1V9Y A;  2K7S A;  2W1R A;  4MDZ A;  2W1T B;  3FC7 A;  3IS2 A;  1P9W A;  5CX7 A;  3H7W A;  4WF0 A;  2VGL S;  3LR3 A;  3OLO A;  3MF0 A;  2W1T A;  3S7P A;  3SW1 A;  3BW6 A;  2VJW A;  4F3L B;  1TS7 A;  1GSW A;  4L0L A;  4UQI S;  4MN7 A;  2A24 B;  2H28 A;  2ZBB A;  2W3D A;  5C5K A;  3C8C A;  4F3L A;  3FPW A;  3MMH A;  3OCL A;  4EQ1 A;  4M4X A;  1S1Y A;  4WEL A;  4CQH A;  3EGD C;  4EU0 A;  3ZYT A;  2XRN A;  4H6J B;  3ICY A;  2V0U A;  3LI9 A;  1W63 Q;  3NOT C;  4KUO A;  4L9F A;  1S67 L;  4HH3 A;  3VOL A;  3LIB A;  2VX8 A;  1W63 M;  3KO6 A;  3PBQ A;  3UB9 A;  5KSH A;  1LSX A;  4H6J A;  3CUE C;  4PKY A;  3UE6 A;  1OJG A;  4PKY G;  2GZA A;  3E4O A;  4MN5 A;  5HPF A;  5DFX A;  3VE3 A;  3T4S A;  3EQV A;  2ZMV A;  2B18 A;  3EOI A;  2PDR A;  2VLG A;  1YKD A;  1X0O A;  2ZOI A;  3BJN A;  3JVU A;  2PD7 A;  2W3F A;  4BBV A;  1F9I A;  4B93 A;  2VA0 A;  2VV6 A;  4G3W A;  1GSX A;  4GS9 B;  5HDC A;  2O9A A;  2D01 A;  2A2L A;  2LB9 A;  4GS9 A;  1XJ6 A;  4I3J A;  4I3A A;  3T4O A;  3MQQ A;  4KUK A;  1NLZ A;  2V1A A;  3PBT A;  5KIZ A;  4MCW A;  4Y2F A;  3KYZ A;  1UGU A;  4I5S A;  3P01 A;  3RTY A;  5DF9 A;  4CLC D;  4Y5F A;  1NWZ A;  2OAP 1;  3OCN A;  3CAX A;  3ULF A;  4ETZ A;  1OTB A;  4FSF A;  2NUP C;  3LFV A;  3S7N A;  2WKP A;  3NHQ A;  4ETX A;  2FH5 A;  3OOV A;  3DBA A;  2O99 A;  3K3C A;  3LIA A;  4HP4 A;  2XSS A;  1IFQ A;  4HJ3 A;  2JHE A;  4EES A;  2W27 A;  2V0W A;  2R78 A;  5J4E A;  2VV7 A;  5MC7 A;  2D02 A;  2JN7 A;  3BY8 A;  1DRM A;  4O8G A;  2G7U A;  3LID A;  1S4R A;  2P08 A;  3LR4 A;  3NOP C;  2HJ9 C;  2PD8 A;  3RFB A;  3TRC A;  3UMD A;  2JKR M;  1ODV A;  4JGO A;  4IUH A;  2OOL A;  3KYQ A;  4EER A;  4I39 A;  1OPX A;  3LYX A;  3H7W B;  3A0S A;  1LL8 A;  2O0Y A;  4WL9 A;  3C2W A;  2NUT C;  2WKR A;  3NOU C;  4HJ4 A;  5F5Y A;  3RH8 B;  3B42 A;  4ARZ B;  5HWT A;  1OT9 A;  1OTE A;  4NXF A;  3D3O A;  2J3W A;  2GX5 A;  3CLO A;  2Y79 A;  4ARZ A;  4XT2 A;  3BWL A;  3UB8 A;  1OTA A;  2HJE A;  5I5L A;  5IT5 A;  4LRY C;  3MQO A;  2M7V A;  1XFN A;  1KOU A;  2J3T C;  3B47 A;  4RQ9 A;  1NRJ A;  2VV8 A;  3D72 A;  1MKM A;  5AJG A;  4R3A A;  3T4Q A;  2YKF A;  3E0Y A;  1VHM A;  2HGV A;  2KOI A;  4Q0J A;  4JGQ A;  2L0W A;  2QWS A;  3NJA A;  3T4J A;  3S7O A;  5F6A A;  4NXE A;  3H82 A;  4HI4 A;  1OTD A;  1TS6 A;  2P7J A;  2W3G A;  3UE3 A;  2W0N A;  1V9Z A;  3CIT A;  3KSH A;  3G6O A;  3H9W A;  4O0P A;  4BMW A;  2OAQ 1;  3PYP A;  4R6L A;  4LRX C;  3U2A A;  1XJ4 A;  1D7E A;  2V9A A;  4YWZ A;  3VV4 A;  3T50 A;  5LBR A;  5HD5 A;  4I38 A;  3PHY A;  2W3E A;  2J80 A;  2O9C A;  1TD5 A;  2Z6D A;  3HJI A;  4Q0I A;  1UWN X;  4NEE D;  4L9E A;  5TJJ A;  1YSQ A;  2QJ5 A;  3KX0 X;  5F69 A;  5AVF A;  4WEK A;  2Z6C A;  5DJU A;  4PAU A;  3V67 A;  2VEA A;  3HJK A;  4HNB A;  4NKP A;  4E04 A;  2KDK A;  3MXQ A;  1BYW A;  4B9O A;  2L1M A;  3BQA A;  4HJ6 A;  4HHD A;  4G3K A;  5DJT A;  1OTI A;  3F1P B;  3HCY A;  5L8M A;  1LSW A;  2K31 A;  2LB5 A;  4L9G A;  3C38 A;  3F1P A;  1XFQ A;  4G3V A;  2EWV A;  5HPI A;  5G4Z A;  1NLY A;  2PT7 A;  1H3Q A;  3B33 A;  3JVV A;  3VE4 A;  3C30 A;  3OC2 A;  4EW7 A;  1TS8 A;  2K2N A;  2V1B A;  1F5M A;  1N9L A;  5FL3 A;  1T1A A;  3R4K A;  2FZ0 A;  3LR0 A;  4Y3I A;  5EFW A;  4EUV A;  1MC0 A;  4II7 A;  4WLA A;  1H8M A;  3OBF A;  1VB6 A;  4Z1W A;  1OJ5 A;  5HWW A;  1N9O A;  2WKQ A;  2O9B A;  1ZTU A;  5HZH A;  1Y28 A;  1T1B A;  3W2Z A;  2DMW A;  3CUE A;  3K2N A;  2KLI A;  4P6Z M;  3LI8 A;  1P0Z A;  3E4P A;  3UB6 A;  2JKR I;  3P7N A;  2JKT I;  2L4R A;  2JKT M;  1P9R A;  2W3H A;  3PBR A;  4DJ2 A;  1YSP A;  2PYR A;  4ZRR A;  5F68 A;  2EA9 A;  2EWW A;  2P04 A;  2QJ7 A;  4ME4 A;  3UB7 A;  4XT2 B;  4CLC C;  4LRZ E;  1DP6 A;  4P6Z S;  5DFY A;  2XA7 M;  3EQU A;  4GW9 A;  1UWP X;  5HD3 A;  2OWJ A;  2M1C A;  4WUJ A;  3A0V A;  3FPV A;  3PBO A;  3GEC A;  1N9N A;  4GHI A;  2ZMF A;  4FOF A;  1P97 A;  3CI6 A;  4WEJ A;  3EGX C;  3H82 B;  3ZQ5 A;  5HDD A;  2XRO A;  3LUQ A;  4O01 A;  3IBJ A;  3EEA A;  1DP9 A;  1XJ2 A;  2M7U A;  2XA7 S;  2I9V A;  5DKL A;  4HY8 A;  2QYB A;  3BQ8 A;  4DN0 A;  2KX6 A;  1G28 A;  2HV1 A;  3EWK A;  5DKK A;  3R7W B;  4Q0H A;  2CMN A;  3O5Y A;  1XJ3 A;  4KQD A;  3BY9 A;  2Y8H A;  4IJG A;  4CLC E;  4HIA A;  1G6O A;  1LT0 A;  3GDI A;  5K5B A;  3K3D A;  3PBN A;  3R7W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...