2J80A

Structure of citrate-bound periplasmic domain of sensor histidine kinase cita
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
129
structure length
129
Chain Sequence
TEERLHYQVGQRALIQAMQISAMPELVEAVQKRDLARIKALIDPMRSFSDATYITVGDASGQRLYHVNPDEIGKSMEGGDSDEALINAKSYVSVRKGSLGSSLRGKSPIQDATGKVIGIVSVGYTIEQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SENSOR KINASE CITA
publication title A Ligand-Induced Switch in the Periplasmic Domain of Sensor Histidine Kinase Cita.
pubmed doi rcsb
source organism Klebsiella pneumoniae
molecule tags Transferase
total genus 35
structure length 129
sequence length 129
chains with identical sequence B
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2006-10-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2j80A00
3ZQ5A 4HY8A 4DJ2A 3A0VA 3NJAA 1GSWA 5DKLA 1OJ5A 5HD5A 3VOLA 2L1MA 3LYXA 3NHQA 1V9ZA 3E4PA 2B02A 2H28A 3F1OA 3BY8A 2Z6CA 2PHYA 3MQOA 5AVFA 2ZOIA 1P0ZA 4YWZA 4LRXC 4JGQA 1OTIA 3NOTC 1XJ4A 4M4XA 2VEAA 3LI9A 4HJ6A 5J4EA 4EEPA 4RQ9A 1XFNA 3BWLA 4NXGA 3MQQA 3NOUC 1OTAA 2M1CA 3C8CA 4KUOA 2HV1A 3H7WA 2JHEA 1N9OA 1NWZA 4KUKA 3EEHA 2PDRA 1TS7A 2PR6A 2WKRA 3LIEA 3MJQA 4GCZA 4I39A 4WUJA 3F1NA 1GSXA 2WKPA 2YKHA 3UB9A 2A24B 3UE6A 4MN5A 1X0OA 1Y28A 1T1AA 3F1OB 1JNUA 4XT2A 1BYWA 3NOPC 4LLOB 5IS1A 3PYPA 4E04A 4F3LB 2J80A 2EA9A 1MZUA 1XJ3A 5HZHA 2V0UA 4HHDA 3MR0A 4EXOA 2V1AA 4K08A 4NXFA 4LRZE 3UB8A 4GHIB 4I3JA 3KX0X 3RH8B 5HWWA 4LRYC 2D02A 1T1CA 2PD8A 5F6AA 4GS9B 3LIFA 1D7EA 3BY9A 1F98A 2PYPA 4HOIA 5HD3A 3B33A 4JGOA 4EETB 3C2WA 3CLOA 2KX6A 3LIDA 5TBMB 1G28A 2R78A 1S4SA 1S4RA 5J7EA 4BBTA 4I38A 1T1BA 2INWA 1GSVA 4LPZA 4I3IA 1S1YA 1V9YA 3HJIA 2Z6DA 2QKPA 5EFWA 1N9LA 4I3AA 4H6JA 3E4OA 2YKFA 5F68A 1KOUA 2PD7A 2OWJA 4WLAA 1S1ZA 3HJKA 5I5LA 2QWSA 3F1PA 2V9AA 2V1BA 3H82B 1D06A 5G4ZA 3UB7A 1DP8A 4HH2A 1UWPX 2OOLA 4R70A 2D01A 2VLGA 1EW0A 2I9VA 2QJ5A 4B9OA 1LSWA 1DP9A 4PKYG 4HH3A 3MFXA 4NXEA 3A0RA 4JGPA 1LT0A 3ICYA 3LIBA 5HWTA 2QJ7A 2VV8A 3IS2A 3UB6A 4NXBA 1P97A 2QHKA 3P7NA 1DRMA 1TS8A 1OTEA 5HSQA 4GW9A 3PHYA 3CAXA 5A8BA 1UGUA 3IBRA 5G4YA 5F69A 3H7WB 4L9FA 2BASA 4WF0A 2L0WA 2OWHA 2CMNA 3F1NB 4WN5A 2W0NA 4XT2B 4EESA 1S66L 5HDSA 1OT9A 2PYRA 3E4QA 2W27A 3EWKA 4R6LA 4EQ1A 4DJ3A 5HWVA 5DJTA 1XFQA 2PR5A 2ZBBA 3RTYA 4BBUA 1VB6A 4R38A 5HDCA 3UMDA 1LL8A 5DKKA 1OTDA 4HP9A 4HQAA 4HP4A 4PKYA 2KDKA 4HJ4A 3SW1A 3G6OA 1LSXA 4EEUA 4HI4A 2A24A 1T19A 1TS6A 1XJ6A 4JGRA 1TS0A 5DJUA 3VE4A 4F3LA 3ULFA 3LI8A 5IU1A 3A0SA 1DP6A 3LICA 4EW7A 3GDIA 4I5SA 5AVEA 2GJ3A 2JN7A 2P7JA 5J3WA 3OLOA 4MN6A 3MXQA 3FG8A 1UWNX 3LUQA 4GHIA 3D72A 4R3AA 1OJGA 2ZOHA 1F9IA 4GS9A 2V0WA 4HJ3A 4H6JB 4KQDA 3VE3A 2VV6A 3FC7A 5KIZA 1ODVA 5HDDA 2K7SA 1T18A 1N9NA 3F1PB 4EERA 1XJ2A 5TBMA 4HNBA 3LIAA 3T50A 5F5YA 4BBVA 4L9EA 1LSVA 3H9WA 3UMEA 1S67L 2VV7A 2L4RA 3K3DA 3IS2B 4L9GA 3CWFA 1WA9A 4HIAA 2WKQA 4WL9A 1OTBA 3H82A 3GECA 3K3CA 1OT6A
chains in the Genus database with same CATH superfamily
3ZQ5A 3MS6A 2B18A 4BWIA 3A0VA 5E2EA 1RP5A 5DKLA 2X71A 1OJ5A 4JF4A 2V20A 3QP6A 2JC7A 2L1MA 3IXBA 1L0DA 3K2NA 1V9ZA 3CUEC 1MBLA 3F1OA 3BY8A 3MQOA 1P0ZA 5L2FA 2W3EA 1K54A 3GQZA 4EU0A 4JKTA 3CHWP 2Y4AA 2PBDP 2EFXA 5F1FA 5KZHA 1W63M 3W4OA 2EX2A 3IH8A 1HVBA 2ZQ9A 2J3WA 4X56A 2M1CA 1BZAA 3IF6C 4KUOA 2W1RA 2WADA 2E8JA 2JHEA 1YMXA 4BL2A 1NZOA 3N7WA 2HDSA 2XEPA 3PAEA 3MZDA 1NRFA 2WKRA 4I39A 5DTSA 5M19A 1ZC2A 2WK0A 3AGDA 3VV4A 3MZEA 4MN5A 4S2OA 3UE6A 1X0OA 1Y28A 3ZG9B 4FCFA 3FPWA 1BYWA 2VGLS 1H8ZA 3DTMA 3KYEA 5EM1A 4E04A 1K6RA 1OMEA 2EA9A 4UA6A 1MZUA 4R3JA 5K5BA 2W3DA 4LENA 4WZ5A 2XLNA 1HTZA 1ZG6A 1W8QA 2LB9A 1YKDA 2V0UA 1DY6A 2E8IA 1ES3A 3IWOA 4S2LA 5DF7A 1K54C 3WS2A 4GHIB 5EM0A 4WBGA 4IBRA 4LRYC 3BECA 2WGWA 5F6AA 3LIFA 3HUNA 4Y5FA 2PYPA 4EWFA 4OP5A 4HOIA 4KZ3A 1WE4A 2P9VB 5HARA 3HCYA 4BJPA 3BLSA 4P0MA 2ZC6B 1HLUP 3ZFZA 3DAVA 3W4QA 5CGSA 3WS4A 1K0KA 5FEFA 2UWXA 1G28A 4L0LA 1S4SA 4N9LA 3DBAA 1S4RA 5J7EA 3PBOA 4GNUA 1IYOA 1E4DA 1T1BA 1GSVA 4LPZA 5FQQA 4X68A 4IUHA 3OZHA 5IHVA 3IXDA 2OLUA 2FZ0A 3ZDJA 1ERMA 3UDXA 1N9LA 4I3AA 5GLCA 3PBSA 4GDBA 3E4OA 2G2WA 3S1YA 2OWJA 4D60A 4WLAA 1S1ZA 3N8SA 4UEYA 3HJKA 1FOFA 4YNRA 1YLYA 1IFQA 3EGXC 5U47A 2V9AA 1W7FA 4KENB 3UB7A 5GLBA 4ZJ2A 2H0YA 4RX3A 4PM5A 4Q0JA 2O9AA 3CPTA 1PNEA 1LSWA 1EROA 5EVEA 2HDQA 5FASA 4JGPA 1AXBA 2HZ5A 3ICYA 3LIBA 5HL1A 1PZOA 2O9BA 4Y17A 4IJGA 1K6SA 1W79A 3IS2A 3SS4A 1CI8A 4U0XA 3C4OA 5DFYA 3R7WA 2OAQ1 1OTEA 4ETXA 3S7PA 3TJZC 4GW9A 1I5QA 3PHYA 1SDEA 4LFUA 4PMAA 4ETZA 1YT4A 3OOVA 3U2AA 5F69A 4P6ZM 3UE1A 2HP6A 1YLPA 5HAPA 4X55A 4WF0A 3EQVA 2OWHA 2CMNA 4S2MA 5FQJA 3G35A 4WN5A 2I72A 3LEZA 1L0EA 2W0NA 5FL3A 4XT2B 1S66L 3ZGAB 3B3XA 5HDSA 4Y2FA 4QPRA 2JKFA 4KZAA 1GHPA 2W27A 1M40A 3S7NA 2XROA 5HWVA 1XFQA 3LEQA 2ZBBA 5DTKA 4EUZA 1MWSA 3G34A 3T1SA 5FDHA 3HLDA 3BLMA 2ZM8A 4HQAA 4HP4A 2BLSA 2J9OA 2KDKA 1XKZA 3IF6B 3OPRA 4OPQA 1JTGA 2BTFP 1PI4A 2HDUA 3S4XA 4S2NA 2Y91A 4PHTA 3LY4A 4K0XA 2W3HA 4MDZA 1XJ6A 2M7UA 4A5RA 5TJJA 1MXOA 4NEED 5CRFA 4JXVA 3N4IA 3ZVWA 3QP8A 3LI8A 2HP5A 1IKIA 4EW7A 4E3NA 5AVEA 3UE0A 5HAIA 3HL9A 1BUEA 2XK1A 3UPPA 1JWVA 4H8RA 5FQMA 4Y15A 3LUQA 3WWXA 4GHIA 3TOIA 1GHIA 1MWTA 4HJ3A 5CHMA 4KQDA 2VV6A 5E2GA 1ODVA 2P9VA 5HDDA 3HLBA 3S7QA 4YFMA 5KMWA 1TEMA 2HJ9C 4X25A 4EBNA 1VM1A 2PBYA 1ONHA 1YLWA 4KZ9A 2IWDA 3IXGA 4GD8A 4S2NC 4L9EA 1LL9A 1LSVA 2ACGA 1VHMA 4X6TA 1XA7A 1S67L 5EECA 5FQKA 2HP9A 4GOGA 3DTEA 1M6KA 3K3DA 3N8RA 3CMZA 1Q2PA 4L9GA 3BFEA 1SHVA 3HUOA 4N1XA 2WKQA 4WL9A 2J8YA 2ZQCA 1OT6A 1H8MA 3S7OA 3LR3A 4HY8A 1MWRA 4KQRA 3ZG0A 1F2KA 2HDRA 5FQIA 3UDIA 3VOLA 2P04A 3LYXA 3RFBA 3G4PA 2EFUA 5CHJA 5CEBA 3IBJA 4N9KA 1NYYA 2EWVA 2H28A 2JKTI 1H0MA 3OC2A 5G18A 3Q1FA 3PAGA 5HFOA 3QP1A 1RGYA 2KLIA 4LRXC 4JGQA 1OTIA 3CI6A 4UQIS 3Q7ZA 1BLPA 3IHAA 3V5MA 2EXBA 4JPMA 3PBTA 1XJ4A 4M4XA 3BFCA 1P9RA 2Z2MB 2G7UA 2VEAA 5EPHA 4EEPA 1CEGA 3BWLA 4NXGA 5GLDA 1NJ4A 5DVAA 1OTAA 5CX7A 1BLCA 3C8CA 4QD4A 4DN0A 4X69A 1P9WA 1N9OA 1NWZA 4CLCE 3MJQA 4WUJA 3ZHHA 2A24B 5CECA 2VX8A 3CUEA 4XT2A 1MWUA 3W8KA 2PT7A 3UDFA 3NOPC 4DXCA 3NBLA 5IS1A 3PYPA 4F3LB 2Q9NA 2J80A 3LFVA 1XJ3A 2LB5A 3HUMA 1KDSA 1PW1A 3IX4A 4UQIM 2V1AA 3T1QB 4NXFA 3HREA 4LRZE 3UB8A 2ZMAA 4I3JA 4E6WA 3IF6A 5HWWA 4PM9A 4UHUA 5M18A 4OLGA 5AJGA 4E3JA 4GS9B 1YLTA 2O0YA 2XSSA 3BY9A 3MMHA 3VOZA 5L09A 1F5MA 3NDGA 1KGEA 2W1TB 2C6WB 4N92A 1L0FA 3BM6A 3VP0A 2DRWA 1L0GA 4EETB 3C2WA 1JTDA 1TVFA 1FIKA 1I2SA 2V1ZA 2HGVA 3TE8A 1I2WA 4NETA 3WS0A 1JVJA 4P85A 4KG2A 2WGIA 4B4XA 4XUXA 4PPRA 4ARZB 1J3WA 3HJIA 5CGXA 1IYSA 5EE8A 2HPBA 2Y2NA 4Q8IA 1IOUA 2EXAA 1CQAA 3ZG5A 3V39A 1KVLA 2YKFA 4MLLA 3DWZA 1XGJA 4FD8A 3OPPA 1OPXA 2QPNA 3H82B 1D06A 5G4ZA 1XXMA 4OLDA 1UWPX 3C4PA 2D01A 3UB5P 4MN7A 1EW0A 1SCWA 3ITAA 4Z9QA 4KZ7A 3ZG7B 3NECA 4OPZA 2NUTC 1LLBA 2GNXA 4UA7A 1K55C 1DJBA 3T4SA 3A0RA 2Y2JA 1FCNA 4DE3A 5GHZA 3P98A 5HWTA 2QJ7A 4CLCC 2VV8A 1ESIA 1W63Q 4X53A 1YSQA 3UB6A 2PRFA 3ZNYA 5FEGA 3P7NA 4IVIA 1ES5A 3G31A 1N9BA 1IEMA 3VOYA 4GN2A 4RVAA 5HAQA 3SH8A 1LI9A 1H5XA 2WZXA 3CAXA 5A8BA 1UGUA 2XGNA 3T12B 2WKEA 4GDNA 3H7WB 1U60A 4WMCA 4Z1WA 3HBRA 4R4SA 2JBFA 2ZC4B 3HLFA 2FFFB 2IWBA 1YPRA 4KG5A 4R0QA 3F1NB 3GRJA 1Z6FA 1TDGA 3S22A 3LR5A 1DJAA 2FFYA 2PYRA 3VSLA 3RXXA 3KO6A 2XQZA 4R6LA 4S2IA 4EQ1A 1FSWA 1XGIA 4JBFA 2PR5A 2BG1A 3RTYA 4BBUA 2WUQA 4WZ4A 4U0TA 2H5SA 3UMDA 5DKKA 1IYPA 3KSIA 1OTDA 4HP9A 3BYDA 4WELA 2HF6A 4OQGA 2ZM0A 4PKYA 4DE1A 3SW1A 4FTXA 3KYQA 4EEUA 2ZMFA 2OSUA 1N4OA 1G6AA 5F82A 2A24A 4JLFA 1T19A 1XA1A 1BLHA 4UA9A 1KGGA 4F94A 4P6ZS 5KSCA 3NDEA 2Y2HA 1YQSA 1NLYA 4CLCD 2NUPC 5L10A 4F3LA 3ULFA 4II7A 4C3QA 3LICA 2Q9MA 2WGVA 4UAAA 2GDNA 2A49A 2XF3A 4LGWA 5J3WA 3P09A 3OLOA 1UWNX 1PW8A 4BENA 2GX5A 1GCEA 3D72A 1OJGA 2ZOHA 1WYCA 4EBPA 4S2JA 4GS9A 2V0WA 3C30A 4H6JB 3IT9A 2UV0E 2Y2MA 4RYEA 2A2LA 3A3JA 3FC7A 5LBRA 4KQOA 1H8YA 5KIZA 2W1TA 1T18A 1N9NA 3AGEA 3IX3A 4EERA 1PFLA 1S6RA 4QJGA 5JYPA 3ZNTA 1XJ2A 2VGJA 1ZKJA 3OPHA 4S2PA 1J9MA 4HNBA 3OBFA 4OH0A 1XP4A 2H10A 3HLGA 1CJFA 1VETB 3D9YA 1PWCA 4BBVA 4ARZA 4WM9A 4JXSA 3W2ZA 3Q81A 2L4RA 4EQIA 2O99A 5HL6A 3T1XA 4PM6A 3IQAA 2DCFA 5A93A 4KQQA 3H82A 4ZDXA 3T4TA 2VJWA 1FR1A 1NYMA 1PWGA 3Q7VB 3MXSA 2X02A 4DJ2A 4B4ZA 3HLWA 4CPKA 3NJAA 1GSWA 2VKSA 4WMCD 5HPFA 4MCWA 1TD5A 4LV3A 3IXHA 4DF6A 3E4PA 2B02A 4Y0UA 1SKOB 4K0WA 2Z6CA 5FDSA 2PHYA 3LO7A 2XFSA 3NY4A 3MSHA 1FQGA 2PU4A 3ZG8B 4DRTA 3SS5A 4OQHA 4CLCB 5J8XA 5E2HA 1GA9A 4DE0A 2XA7M 3KYZA 4CQHA 3NOTC 2HJEA 3DTKA 4HJ6A 3SOIA 3VSKA 3GV9A 1Y4OA 1L3LA 3HVFA 2PU2A 3EOIA 3H7WA 3B42A 1NZUA 3V67A 4KUKA 4WYYA 2PDRA 2PR6A 3LIEA 4OP8A 4GCZA 3TSGA 1BLSA 3F1NA 2RCXA 3TRCA 1D1JA 4YINA 3UB9A 3MQ0A 4XUZA 1T1AA 3F1OB 3E2KA 2ZMVA 4RA7A 4BL3A 2JKRM 5CTMA 4EUVA 1FSYA 5FI6A 2ZM2A 4OQ0A 4OQIA 4EV4A 2WYXA 4HBTA 5HZHA 5FI2A 5I94A 4GLQA 3M6HA 3R4KA 4HHDA 4X1LA 3OCNA 3IWIA 5EVIC 4KZ8A 1KDWA 5HW3A 1WYBA 3RH8B 2D02A 3RJUA 1HD8A 2Y2GA 4M3KA 3T4KA 4ZRRA 2P74A 5EV0A 5EOEA 4U3TA 3WRZA 1LHYA 4B88A 4JGOA 4HEFA 2KX6A 1MPLA 5TBMB 2ZQ8A 2R9WA 3PXPA 4G3VA 3NCKA 5A90A 3UNWA 4I3IA 4FOFA 1S1YA 2H0TA 3D4FA 3Q82A 4R1GA 4BQMA 5EFWA 3FWLA 4H6JA 4EBLA 1ERQA 5FSRA 5TGFA 5HX9A 2PD7A 3IHBA 3V3SA 1MKMA 1SZVA 4P87A 3E0YA 2VK3A 2V1BA 1DP8A 4HH2A 2OOLA 3SZTA 2Y2LA 3BFGA 4Y0TA 3GVBA 2I9VA 4B9OA 1H3QA 3M6BA 4BMWA 4GZBA 1YLJA 4JF6A 1DP9A 4PKYG 2B95A 3CZDA 1VETA 4HH3A 4LCMA 1O07A 3O87A 5CERA 3O88A 2OLVA 1LT0A 2ZQDA 4MBFA 5EVID 3G2ZA 1K38A 1ACFA 1NY0A 4JXWA 2Y2PA 3IH9A 1P97A 4O0PA 2WZZA 4ME4A 1DRMA 1K57C 4NK3A 3A3DA 3MZFA 5JYOA 3Q7VA 5HSQA 1E3UD 2W3GA 1NXYA 3BJNA 2K31A 3DWKA 3ZYTA 4ZBEA 3NI9A 2V8FA 2FH5A 3IBRA 4O01A 5GLAA 2WKHA 1CEFA 5DF8A 3JPUA 4OONA 1ESUA 2GZAA 3FKVA 5F83A 5GHYA 3UPNA 3VP2A 1SKOA 2IA2A 1K55A 4QU3A 1ALQA 3T4OA 2WAEA 4QHCA 3M2JA 2QZ6A 4E6XA 1IYQA 4CLCA 3BEBA 1OT9A 5L8MA 3VP3A 5FAPA 3MXRA 3E4QA 3PR6A 4ZJ1A 3ITBA 1NRJA 4DJ3A 3CJMA 5DJTA 3MBZA 1VB6A 1ONGA 2Y2QA 1EWZA 4R38A 5DTTA 1Y54A 3D3OA 3LGOA 5A91A 2VA0A 3KSFA 4S2KA 4Y3IA 4QY5A 1EI5A 4HJ4A 3G6OA 1LSXA 2XFTA 2O9CA 2EX6A 1BULA 1K4EA 4IUKA 1HZOA 1DJCA 1YAXA 3BFFA 1TS6A 4KZ4A 1K25A 4E3IA 2ZC7A 3BFDA 3VE4A 4BD1A 1O7EA 1KGFA 5IU1A 3A0SA 4ZTKA 3PBQA 2K2NA 2KOIA 3GDIA 4I5SA 2GJ3A 4OOLA 3IX8A 4MN6A 3N6IA 2Y79A 3G30A 3UN7A 4G3KA 3QHYA 4C75A 4R3AA 3OPLA 2XD1A 5EVIB 2G2UA 5CEDA 2XR0A 3ZCZA 4ZAMA 3VE3A 3MFDA 2EWWA 4NKPA 4ESPA 3DW0A 2DNSA 2K7SA 2XD5A 4GJ4A 1FR6A 3F1PB 4FUWA 3ISGA 3PBNA 1XPBA 3V50A 4E3OA 3WS5A 5TBMA 1CI9A 5GL9A 1NLZA 5TFQA 1W8YA 5D3OA 1ES2A 4Q0IA 3L9KA 4KZ6A 5F5YA 4WEJA 3H9WA 4LV0A 2AVXA 1BT5A 2VV7A 3O3VA 1W5DA 3UO9A 1JWZA 4Q0HA 4NG2A 1KE0A 4DDYA 3CWFA 2VGKA 1WA9A 1PI5A 5FI7A 1QMEA 2V2FF 1KE3A 4IVKA 1OTBA 4OPRA 4XXRA 3GMWA 4C6YA 3T4QA 4O8GA 2XRNA 5IT5A 2M7VA 1YSPA 5HD5A 2VGLM 2PAVP 1QMFA 5C5KA 1GHMA 3NHQA 5L07A 3T1RA 3HLEA 3DTIA 5CTNA 4KZ5A 3TG9A 4K91A 5AVFA 2ZOIA 3B47A 1YLZA 2Y55A 4D2OA 1S0WA 4YWZA 1GA0A 4E3MA 3G2YA 4WZ5C 4FSFA 4DKIA 3T4JA 1AWIA 3LI9A 3NULA 5J4EA 5MC7A 4RQ9A 4CJNA 3HLCA 1XFNA 1BSGA 3MQQA 2R9XA 3NOUC 1PRQA 1VEUB 2HV1A 3EEHA 3CG5A 1TS7A 2WAFA 3CITA 2J7VA 3G32A 4MEZA 2ZL1B 1CK3A 1GSXA 4OOYA 2WKPA 2YKHA 1CF0A 4WEKA 3FPVA 2CC1A 1JNUA 4IHQA 1YMSA 4MMNA 4R3BA 4LLOB 2ZQAA 1ZG4A 5EOOA 1RCJA 1ZHHB 1VQQA 4N1HA 3P01A 3VMAA 4DE2A 2JCHA 2JE5A 3VFHA 4KZBA 3E2LA 3GSGA 3SH7A 3VP4A 1E25A 5EVLA 2JKGA 3MR0A 4EXOA 1FILA 5M1AA 5CXWA 1K56A 4K08A 4HBUA 2XA7S 4IEDA 3QNBA 1KVMA 3UPOA 5EUAA 3KX0X 1FCOA 1T1CA 2PD8A 3NC8A 3LR4A 1D7EA 1F98A 3I7JA 1JWPA 4OOMA 3MF0A 5HD3A 4YOFA 3ZVTA 4GKUA 3N8LA 3B33A 4ID4A 5BOHA 2WKIA 3C7UA 4LCLA 3CLOA 3LIDA 2R78A 3QP4A 4BBTA 5E2FA 4QB8A 4I38A 2INWA 4R4RA 1IELA 2ZC3B 1V9YA 4BLMA 2IWCA 3A3FA 2Z6DA 5FAOA 5EVIA 3BRMA 2QKPA 3AGFA 1ZTUA 5HPIA 5AQ7A 4AFIA 5F68A 1XX2A 1KOUA 1G6OA 3OCLA 5I5LA 2MJ6A 3IF5A 2QWSA 2XH9A 4R23A 2ZLYA 3F1PA 1E3UA 1G68A 4R70A 4MBKA 3SS3A 2VLGA 2QJ5A 5TR7A 2DMWA 3M2KA 1MY8A 1PWDA 4ZJ3A 1RGZA 3MFXA 3GTCA 2Y2KA 4NXEA 3UE3A 1L2SA 4OVDA 3SH9A 3WS1A 3C38A 2Z2LB 2J3TC 1G5UA 1SKFA 5FATA 2X01A 4KG6A 4DDSA 3C5AA 4NXBA 3BW6A 3U4LP 4LV2A 1LI0A 3O5YA 5AQAA 2ZQ7A 2QHKA 1MC0A 3W4PA 2Y2IA 4Y13A 2ZC5B 1TS8A 4B93A 3QP5A 2JKRI 4MNRA 4PM7A 2OAP1 4P6BA 3KSHA 1ES4A 5G4YA 3FZCA 2B5RA 4PM8A 4DMZA 4X1MA 3L7HA 3FYZA 4L9FA 2BASA 2L0WA 1TDLA 3NIAA 5CHUA 3E98A 5AQBA 4O7DA 4EESA 3LCEA 5DFXA 3MKFA 2A3UA 4FH2A 1MKIA 2Y2OA 3JYIA 3EWKA 3Q07A 5CGWA 4Y0OA 3IWQA 3QNCA 5KSHA 1K57A 2ZD8A 1YM1A 5GHXA 2OV5A 5HDCA 1K56D 1PIOA 3MKEA 1VEUA 3VFFA 1LL8A 2JKTM 4LV1A 5AQ9A 4IBXA 3TW8A 2ZJ9A 3RXWA 5A92A 1LL5A 2WGWB 3PTEA 2C5WB 2ZL1A 4HI4A 4RX2A 4OPYA 2W3FA 5FQ9A 4JGRA 4MBHA 3KSGA 2J3TD 4E3LA 2J9PA 1TS0A 5DJUA 3BQAA 1C3BA 4GD6A 5F1GA 4DXBA 1DP6A 4E3KA 3V3RA 1IKGA 4PAUA 4QWOA 2JN7A 2P7JA 4GB7A 3MXQA 3T4LA 3FG8A 4G3WA 4BD0A 4FH4A 1K4FA 2Y59A 3O86A 4JF5A 1F9IA 1PZPA 3A3EA 3PBRA 3UY6A 2P08A 3VP1A 1Q2QA 3GR2A 5E43A 1BTLA 1PYYA 3EGDC 5DF9A 3FKWA 3BQ8A 1Z09A 3WRTA 3JVUA 1STZA 2QYBA 3CPTB 3LIAA 3EQUA 3T50A 4QY6A 4OKPA 3JVVA 3EEAA 1A0KA 3LY3A 3UMEA 4Y7PA 4HESA 3C7VA 2V8CA 3FV7A 3A3IA 3IS2B 2XDMA 2Y8HA 5FAQA 3QP2A 4JXGA 1SDNA 1FCMA 4HIAA 5FA7A 1KE4A 1TF1A 2QMIA 2EX9A 3LR0A 2Q0OA 3GECA 2EX8A 3K3CA 2RL3A 3R7WB 2VZWA
chains in the Genus database with same CATH topology
3ZQ5A 3LR3A 2B18A 4HY8A 4DJ2A 4BWIA 3A0VA 3T4QA 3NJAA 1GSWA 4O8GA 5DKLA 2XRNA 5IT5A 2M7VA 1OJ5A 1YSPA 2VKSA 5HD5A 5HPFA 3VOLA 2L1MA 2VGLM 2P04A 3LYXA 5C5KA 3RFBA 4MCWA 1TD5A 3K2NA 3NHQA 3IBJA 1V9ZA 3E4PA 3CUEC 2B02A 2EWVA 2H28A 3F1OA 3BY8A 2Z6CA 2PHYA 3MQOA 2JKTI 5AVFA 2ZOIA 3B47A 1P0ZA 3OC2A 4YWZA 2W3EA 2KLIA 4LRXC 4JGQA 1OTIA 3CI6A 4EU0A 4UQIS 4CLCB 2XA7M 4FSFA 3KYZA 4CQHA 3NOTC 3T4JA 3PBTA 1XJ4A 2HJEA 4M4XA 1P9RA 2G7UA 1W63M 2VEAA 3LI9A 4HJ6A 5J4EA 5MC7A 4EEPA 4RQ9A 1XFNA 3BWLA 4NXGA 3MQQA 3NOUC 2J3WA 1OTAA 5CX7A 2M1CA 3C8CA 4KUOA 3EOIA 4DN0A 2W1RA 1P9WA 2HV1A 3H7WA 2JHEA 3B42A 3V67A 1N9OA 1NWZA 4KUKA 3EEHA 2PDRA 3LIEA 1TS7A 2PR6A 2WKRA 3CITA 3MJQA 4GCZA 4I39A 4WUJA 4CLCE 3F1NA 3TRCA 1GSXA 2WKPA 2YKHA 3VV4A 3UB9A 3MQ0A 2A24B 4MN5A 3UE6A 2VX8A 4WEKA 1X0OA 1Y28A 3FPVA 1T1AA 3CUEA 3F1OB 1JNUA 2ZMVA 4XT2A 4IHQA 4MMNA 3FPWA 1BYWA 2PT7A 2VGLS 2JKRM 3NOPC 4LLOB 4EUVA 1ZHHB 5IS1A 3PYPA 4E04A 4F3LB 2J80A 2EA9A 3P01A 1MZUA 5K5BA 3LFVA 2W3DA 1XJ3A 5HZHA 2LB5A 2LB9A 4GLQA 1YKDA 2V0UA 3R4KA 4HHDA 4UQIM 3MR0A 4EXOA 3OCNA 2V1AA 4K08A 2XA7S 4NXFA 4LRZE 3UB8A 4GHIB 4I3JA 3KX0X 3RH8B 5HWWA 4LRYC 2D02A 1T1CA 2PD8A 5AJGA 5F6AA 4GS9B 2O0YA 2XSSA 3LIFA 1D7EA 3LR4A 3BY9A 1F98A 3MMHA 4Y5FA 2PYPA 1F5MA 4HOIA 4OOMA 3MF0A 5HD3A 4YOFA 2W1TB 3T4KA 4ZRRA 3HCYA 4BJPA 3B33A 4JGOA 4EETB 3C2WA 3CLOA 2KX6A 3LIDA 5TBMB 1G28A 2R78A 4L0LA 3PXPA 1S4SA 3DBAA 1S4RA 2HGVA 4G3VA 5J7EA 3TE8A 3PBOA 4BBTA 4I38A 1T1BA 2INWA 1GSVA 4LPZA 4IUHA 4I3IA 4FOFA 1S1YA 1V9YA 4ARZB 3HJIA 2FZ0A 2Z6DA 1IOUA 2QKPA 5EFWA 1ZTUA 5HPIA 1N9LA 4I3AA 3PBSA 4H6JA 3E4OA 4AFIA 2YKFA 5F68A 1KOUA 2PD7A 2OWJA 4WLAA 1G6OA 1S1ZA 4UEYA 3HJKA 1MKMA 3OCLA 4YNRA 5I5LA 1IFQA 2MJ6A 1OPXA 2QWSA 3EGXC 3F1PA 3E0YA 2V9AA 2V1BA 3H82B 1D06A 5G4ZA 3UB7A 1DP8A 4HH2A 1UWPX 2OOLA 4R70A 2D01A 2VLGA 4MN7A 1EW0A 2I9VA 4Q0JA 2O9AA 2QJ5A 4B9OA 1H3QA 1LSWA 4BMWA 2DMWA 1DP9A 4PKYG 4HH3A 2NUTC 3MFXA 2GNXA 3UE3A 4NXEA 3T4SA 3A0RA 4JGPA 1LT0A 3ICYA 3LIBA 3C38A 2O9BA 2J3TC 4IJGA 5HWTA 2QJ7A 4CLCC 2VV8A 1W63Q 3IS2A 3UB6A 1YSQA 4NXBA 3BW6A 1P97A 4O0PA 3O5YA 2QHKA 5DFYA 1MC0A 3P7NA 4ME4A 1DRMA 3R7WA 1TS8A 2OAQ1 1OTEA 4B93A 4ETXA 5HSQA 2W3GA 2JKRI 3S7PA 3BJNA 3TJZC 4GW9A 2K31A 3PHYA 3ZYTA 2OAP1 3CAXA 3KSHA 4ETZA 5A8BA 1UGUA 2FH5A 3IBRA 5G4YA 4O01A 3OOVA 3U2AA 4DMZA 5F69A 4P6ZM 3H7WB 4L9FA 4Z1WA 2GZAA 2BASA 3EQVA 4WF0A 2L0WA 2OWHA 2CMNA 3F1NB 2IA2A 4WN5A 3T4OA 3E98A 2W0NA 5FL3A 4XT2B 4EESA 3LR5A 1S66L 4CLCA 5HDSA 5DFXA 1OT9A 4Y2FA 2PYRA 5L8MA 4QPRA 3E4QA 3PR6A 2W27A 3EWKA 3KO6A 4R6LA 3S7NA 1NRJA 4EQ1A 4DJ3A 2XROA 5KSHA 5HWVA 5DJTA 1XFQA 2PR5A 2ZBBA 3RTYA 4BBUA 1VB6A 4R38A 5HDCA 3UMDA 3D3OA 1LL8A 5DKKA 3KSIA 1OTDA 4HP9A 4HQAA 4HP4A 4WELA 2JKTM 2HF6A 2VA0A 3KSFA 4Y3IA 4PKYA 2KDKA 4HJ4A 3SW1A 3G6OA 3TW8A 1LSXA 3KYQA 4EEUA 2ZMFA 2O9CA 4HI4A 4PHTA 2A24A 4IUKA 1T19A 1YAXA 2W3HA 4MDZA 2W3FA 1TS6A 1XJ6A 2M7UA 5TJJA 4JGRA 4P6ZS 3KSGA 2J3TD 4NEED 1TS0A 5DJUA 3VE4A 1NLYA 4CLCD 2NUPC 3BQAA 4F3LA 3ULFA 4II7A 3LI8A 5IU1A 3A0SA 1DP6A 3LICA 3PBQA 4EW7A 2K2NA 2KOIA 3GDIA 4I5SA 5AVEA 2GJ3A 4PAUA 2JN7A 4OOLA 2P7JA 5J3WA 3OLOA 4MN6A 3MXQA 3T4LA 3FG8A 4G3WA 2Y79A 1UWNX 4G3KA 2GX5A 3LUQA 4GHIA 3D72A 4R3AA 1OJGA 2ZOHA 1F9IA 4GS9A 2V0WA 3C30A 4HJ3A 4H6JB 4KQDA 3PBRA 2A2LA 2P08A 3VE3A 2EWWA 2VV6A 3FC7A 5LBRA 4KQOA 4NKPA 5KIZA 1ODVA 2W1TA 5HDDA 2K7SA 1T18A 3S7QA 1N9NA 4GJ4A 3F1PB 4EERA 2HJ9C 3EGDC 5DF9A 3PBNA 1XJ2A 3BQ8A 5TBMA 4HNBA 1NLZA 3OBFA 3JVUA 1STZA 2QYBA 3LIAA 3EQUA 3T50A 4Q0IA 3JVVA 5F5YA 4BBVA 3EEAA 4L9EA 4ARZA 4WEJA 1LSVA 3H9WA 1VHMA 3UMEA 1S67L 2VV7A 3W2ZA 2L4RA 2O99A 3K3DA 3IS2B 4L9GA 5HL6A 4Q0HA 2Y8HA 3CWFA 1WA9A 4HIAA 1TF1A 2WKQA 4WL9A 1OTBA 3H82A 3LR0A 3GECA 3K3CA 1OT6A 3T4TA 1H8MA 2VJWA 3R7WB 2VZWA 3S7OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZQ5 A;  4HY8 A;  4DJ2 A;  3A0V A;  3NJA A;  1GSW A;  5DKL A;  1OJ5 A;  5HD5 A;  3VOL A;  2L1M A;  3LYX A;  3NHQ A;  1V9Z A;  3E4P A;  2B02 A;  2H28 A;  3F1O A;  3BY8 A;  2Z6C A;  2PHY A;  3MQO A;  5AVF A;  2ZOI A;  1P0Z A;  4YWZ A;  4LRX C;  4JGQ A;  1OTI A;  3NOT C;  1XJ4 A;  4M4X A;  2VEA A;  3LI9 A;  4HJ6 A;  5J4E A;  4EEP A;  4RQ9 A;  1XFN A;  3BWL A;  4NXG A;  3MQQ A;  3NOU C;  1OTA A;  2M1C A;  3C8C A;  4KUO A;  2HV1 A;  3H7W A;  2JHE A;  1N9O A;  1NWZ A;  4KUK A;  3EEH A;  2PDR A;  1TS7 A;  2PR6 A;  2WKR A;  3LIE A;  3MJQ A;  4GCZ A;  4I39 A;  4WUJ A;  3F1N A;  1GSX A;  2WKP A;  2YKH A;  3UB9 A;  2A24 B;  3UE6 A;  4MN5 A;  1X0O A;  1Y28 A;  1T1A A;  3F1O B;  1JNU A;  4XT2 A;  1BYW A;  3NOP C;  4LLO B;  5IS1 A;  3PYP A;  4E04 A;  4F3L B;  2J80 A;  2EA9 A;  1MZU A;  1XJ3 A;  5HZH A;  2V0U A;  4HHD A;  3MR0 A;  4EXO A;  2V1A A;  4K08 A;  4NXF A;  4LRZ E;  3UB8 A;  4GHI B;  4I3J A;  3KX0 X;  3RH8 B;  5HWW A;  4LRY C;  2D02 A;  1T1C A;  2PD8 A;  5F6A A;  4GS9 B;  3LIF A;  1D7E A;  3BY9 A;  1F98 A;  2PYP A;  4HOI A;  5HD3 A;  3B33 A;  4JGO A;  4EET B;  3C2W A;  3CLO A;  2KX6 A;  3LID A;  5TBM B;  1G28 A;  2R78 A;  1S4S A;  1S4R A;  5J7E A;  4BBT A;  4I38 A;  1T1B A;  2INW A;  1GSV A;  4LPZ A;  4I3I A;  1S1Y A;  1V9Y A;  3HJI A;  2Z6D A;  2QKP A;  5EFW A;  1N9L A;  4I3A A;  4H6J A;  3E4O A;  2YKF A;  5F68 A;  1KOU A;  2PD7 A;  2OWJ A;  4WLA A;  1S1Z A;  3HJK A;  5I5L A;  2QWS A;  3F1P A;  2V9A A;  2V1B A;  3H82 B;  1D06 A;  5G4Z A;  3UB7 A;  1DP8 A;  4HH2 A;  1UWP X;  2OOL A;  4R70 A;  2D01 A;  2VLG A;  1EW0 A;  2I9V A;  2QJ5 A;  4B9O A;  1LSW A;  1DP9 A;  4PKY G;  4HH3 A;  3MFX A;  4NXE A;  3A0R A;  4JGP A;  1LT0 A;  3ICY A;  3LIB A;  5HWT A;  2QJ7 A;  2VV8 A;  3IS2 A;  3UB6 A;  4NXB A;  1P97 A;  2QHK A;  3P7N A;  1DRM A;  1TS8 A;  1OTE A;  5HSQ A;  4GW9 A;  3PHY A;  3CAX A;  5A8B A;  1UGU A;  3IBR A;  5G4Y A;  5F69 A;  3H7W B;  4L9F A;  2BAS A;  4WF0 A;  2L0W A;  2OWH A;  2CMN A;  3F1N B;  4WN5 A;  2W0N A;  4XT2 B;  4EES A;  1S66 L;  5HDS A;  1OT9 A;  2PYR A;  3E4Q A;  2W27 A;  3EWK A;  4R6L A;  4EQ1 A;  4DJ3 A;  5HWV A;  5DJT A;  1XFQ A;  2PR5 A;  2ZBB A;  3RTY A;  4BBU A;  1VB6 A;  4R38 A;  5HDC A;  3UMD A;  1LL8 A;  5DKK A;  1OTD A;  4HP9 A;  4HQA A;  4HP4 A;  4PKY A;  2KDK A;  4HJ4 A;  3SW1 A;  3G6O A;  1LSX A;  4EEU A;  4HI4 A;  2A24 A;  1T19 A;  1TS6 A;  1XJ6 A;  4JGR A;  1TS0 A;  5DJU A;  3VE4 A;  4F3L A;  3ULF A;  3LI8 A;  5IU1 A;  3A0S A;  1DP6 A;  3LIC A;  4EW7 A;  3GDI A;  4I5S A;  5AVE A;  2GJ3 A;  2JN7 A;  2P7J A;  5J3W A;  3OLO A;  4MN6 A;  3MXQ A;  3FG8 A;  1UWN X;  3LUQ A;  4GHI A;  3D72 A;  4R3A A;  1OJG A;  2ZOH A;  1F9I A;  4GS9 A;  2V0W A;  4HJ3 A;  4H6J B;  4KQD A;  3VE3 A;  2VV6 A;  3FC7 A;  5KIZ A;  1ODV A;  5HDD A;  2K7S A;  1T18 A;  1N9N A;  3F1P B;  4EER A;  1XJ2 A;  5TBM A;  4HNB A;  3LIA A;  3T50 A;  5F5Y A;  4BBV A;  4L9E A;  1LSV A;  3H9W A;  3UME A;  1S67 L;  2VV7 A;  2L4R A;  3K3D A;  3IS2 B;  4L9G A;  3CWF A;  1WA9 A;  4HIA A;  2WKQ A;  4WL9 A;  1OTB A;  3H82 A;  3GEC A;  3K3C A;  1OT6 A; 
#chains in the Genus database with same CATH topology
 3ZQ5 A;  3MS6 A;  2B18 A;  4BWI A;  3A0V A;  5E2E A;  1RP5 A;  5DKL A;  2X71 A;  1OJ5 A;  4JF4 A;  2V20 A;  3QP6 A;  2JC7 A;  2L1M A;  3IXB A;  1L0D A;  3K2N A;  1V9Z A;  3CUE C;  1MBL A;  3F1O A;  3BY8 A;  3MQO A;  1P0Z A;  5L2F A;  2W3E A;  1K54 A;  3GQZ A;  4EU0 A;  4JKT A;  3CHW P;  2Y4A A;  2PBD P;  2EFX A;  5F1F A;  5KZH A;  1W63 M;  3W4O A;  2EX2 A;  3IH8 A;  1HVB A;  2ZQ9 A;  2J3W A;  4X56 A;  2M1C A;  1BZA A;  3IF6 C;  4KUO A;  2W1R A;  2WAD A;  2E8J A;  2JHE A;  1YMX A;  4BL2 A;  1NZO A;  3N7W A;  2HDS A;  2XEP A;  3PAE A;  3MZD A;  1NRF A;  2WKR A;  4I39 A;  5DTS A;  5M19 A;  1ZC2 A;  2WK0 A;  3AGD A;  3VV4 A;  3MZE A;  4MN5 A;  4S2O A;  3UE6 A;  1X0O A;  1Y28 A;  3ZG9 B;  4FCF A;  3FPW A;  1BYW A;  2VGL S;  1H8Z A;  3DTM A;  3KYE A;  5EM1 A;  4E04 A;  1K6R A;  1OME A;  2EA9 A;  4UA6 A;  1MZU A;  4R3J A;  5K5B A;  2W3D A;  4LEN A;  4WZ5 A;  2XLN A;  1HTZ A;  1ZG6 A;  1W8Q A;  2LB9 A;  1YKD A;  2V0U A;  1DY6 A;  2E8I A;  1ES3 A;  3IWO A;  4S2L A;  5DF7 A;  1K54 C;  3WS2 A;  4GHI B;  5EM0 A;  4WBG A;  4IBR A;  4LRY C;  3BEC A;  2WGW A;  5F6A A;  3LIF A;  3HUN A;  4Y5F A;  2PYP A;  4EWF A;  4OP5 A;  4HOI A;  4KZ3 A;  1WE4 A;  2P9V B;  5HAR A;  3HCY A;  4BJP A;  3BLS A;  4P0M A;  2ZC6 B;  1HLU P;  3ZFZ A;  3DAV A;  3W4Q A;  5CGS A;  3WS4 A;  1K0K A;  5FEF A;  2UWX A;  1G28 A;  4L0L A;  1S4S A;  4N9L A;  3DBA A;  1S4R A;  5J7E A;  3PBO A;  4GNU A;  1IYO A;  1E4D A;  1T1B A;  1GSV A;  4LPZ A;  5FQQ A;  4X68 A;  4IUH A;  3OZH A;  5IHV A;  3IXD A;  2OLU A;  2FZ0 A;  3ZDJ A;  1ERM A;  3UDX A;  1N9L A;  4I3A A;  5GLC A;  3PBS A;  4GDB A;  3E4O A;  2G2W A;  3S1Y A;  2OWJ A;  4D60 A;  4WLA A;  1S1Z A;  3N8S A;  4UEY A;  3HJK A;  1FOF A;  4YNR A;  1YLY A;  1IFQ A;  3EGX C;  5U47 A;  2V9A A;  1W7F A;  4KEN B;  3UB7 A;  5GLB A;  4ZJ2 A;  2H0Y A;  4RX3 A;  4PM5 A;  4Q0J A;  2O9A A;  3CPT A;  1PNE A;  1LSW A;  1ERO A;  5EVE A;  2HDQ A;  5FAS A;  4JGP A;  1AXB A;  2HZ5 A;  3ICY A;  3LIB A;  5HL1 A;  1PZO A;  2O9B A;  4Y17 A;  4IJG A;  1K6S A;  1W79 A;  3IS2 A;  3SS4 A;  1CI8 A;  4U0X A;  3C4O A;  5DFY A;  3R7W A;  2OAQ 1;  1OTE A;  4ETX A;  3S7P A;  3TJZ C;  4GW9 A;  1I5Q A;  3PHY A;  1SDE A;  4LFU A;  4PMA A;  4ETZ A;  1YT4 A;  3OOV A;  3U2A A;  5F69 A;  4P6Z M;  3UE1 A;  2HP6 A;  1YLP A;  5HAP A;  4X55 A;  4WF0 A;  3EQV A;  2OWH A;  2CMN A;  4S2M A;  5FQJ A;  3G35 A;  4WN5 A;  2I72 A;  3LEZ A;  1L0E A;  2W0N A;  5FL3 A;  4XT2 B;  1S66 L;  3ZGA B;  3B3X A;  5HDS A;  4Y2F A;  4QPR A;  2JKF A;  4KZA A;  1GHP A;  2W27 A;  1M40 A;  3S7N A;  2XRO A;  5HWV A;  1XFQ A;  3LEQ A;  2ZBB A;  5DTK A;  4EUZ A;  1MWS A;  3G34 A;  3T1S A;  5FDH A;  3HLD A;  3BLM A;  2ZM8 A;  4HQA A;  4HP4 A;  2BLS A;  2J9O A;  2KDK A;  1XKZ A;  3IF6 B;  3OPR A;  4OPQ A;  1JTG A;  2BTF P;  1PI4 A;  2HDU A;  3S4X A;  4S2N A;  2Y91 A;  4PHT A;  3LY4 A;  4K0X A;  2W3H A;  4MDZ A;  1XJ6 A;  2M7U A;  4A5R A;  5TJJ A;  1MXO A;  4NEE D;  5CRF A;  4JXV A;  3N4I A;  3ZVW A;  3QP8 A;  3LI8 A;  2HP5 A;  1IKI A;  4EW7 A;  4E3N A;  5AVE A;  3UE0 A;  5HAI A;  3HL9 A;  1BUE A;  2XK1 A;  3UPP A;  1JWV A;  4H8R A;  5FQM A;  4Y15 A;  3LUQ A;  3WWX A;  4GHI A;  3TOI A;  1GHI A;  1MWT A;  4HJ3 A;  5CHM A;  4KQD A;  2VV6 A;  5E2G A;  1ODV A;  2P9V A;  5HDD A;  3HLB A;  3S7Q A;  4YFM A;  5KMW A;  1TEM A;  2HJ9 C;  4X25 A;  4EBN A;  1VM1 A;  2PBY A;  1ONH A;  1YLW A;  4KZ9 A;  2IWD A;  3IXG A;  4GD8 A;  4S2N C;  4L9E A;  1LL9 A;  1LSV A;  2ACG A;  1VHM A;  4X6T A;  1XA7 A;  1S67 L;  5EEC A;  5FQK A;  2HP9 A;  4GOG A;  3DTE A;  1M6K A;  3K3D A;  3N8R A;  3CMZ A;  1Q2P A;  4L9G A;  3BFE A;  1SHV A;  3HUO A;  4N1X A;  2WKQ A;  4WL9 A;  2J8Y A;  2ZQC A;  1OT6 A;  1H8M A;  3S7O A;  3LR3 A;  4HY8 A;  1MWR A;  4KQR A;  3ZG0 A;  1F2K A;  2HDR A;  5FQI A;  3UDI A;  3VOL A;  2P04 A;  3LYX A;  3RFB A;  3G4P A;  2EFU A;  5CHJ A;  5CEB A;  3IBJ A;  4N9K A;  1NYY A;  2EWV A;  2H28 A;  2JKT I;  1H0M A;  3OC2 A;  5G18 A;  3Q1F A;  3PAG A;  5HFO A;  3QP1 A;  1RGY A;  2KLI A;  4LRX C;  4JGQ A;  1OTI A;  3CI6 A;  4UQI S;  3Q7Z A;  1BLP A;  3IHA A;  3V5M A;  2EXB A;  4JPM A;  3PBT A;  1XJ4 A;  4M4X A;  3BFC A;  1P9R A;  2Z2M B;  2G7U A;  2VEA A;  5EPH A;  4EEP A;  1CEG A;  3BWL A;  4NXG A;  5GLD A;  1NJ4 A;  5DVA A;  1OTA A;  5CX7 A;  1BLC A;  3C8C A;  4QD4 A;  4DN0 A;  4X69 A;  1P9W A;  1N9O A;  1NWZ A;  4CLC E;  3MJQ A;  4WUJ A;  3ZHH A;  2A24 B;  5CEC A;  2VX8 A;  3CUE A;  4XT2 A;  1MWU A;  3W8K A;  2PT7 A;  3UDF A;  3NOP C;  4DXC A;  3NBL A;  5IS1 A;  3PYP A;  4F3L B;  2Q9N A;  2J80 A;  3LFV A;  1XJ3 A;  2LB5 A;  3HUM A;  1KDS A;  1PW1 A;  3IX4 A;  4UQI M;  2V1A A;  3T1Q B;  4NXF A;  3HRE A;  4LRZ E;  3UB8 A;  2ZMA A;  4I3J A;  4E6W A;  3IF6 A;  5HWW A;  4PM9 A;  4UHU A;  5M18 A;  4OLG A;  5AJG A;  4E3J A;  4GS9 B;  1YLT A;  2O0Y A;  2XSS A;  3BY9 A;  3MMH A;  3VOZ A;  5L09 A;  1F5M A;  3NDG A;  1KGE A;  2W1T B;  2C6W B;  4N92 A;  1L0F A;  3BM6 A;  3VP0 A;  2DRW A;  1L0G A;  4EET B;  3C2W A;  1JTD A;  1TVF A;  1FIK A;  1I2S A;  2V1Z A;  2HGV A;  3TE8 A;  1I2W A;  4NET A;  3WS0 A;  1JVJ A;  4P85 A;  4KG2 A;  2WGI A;  4B4X A;  4XUX A;  4PPR A;  4ARZ B;  1J3W A;  3HJI A;  5CGX A;  1IYS A;  5EE8 A;  2HPB A;  2Y2N A;  4Q8I A;  1IOU A;  2EXA A;  1CQA A;  3ZG5 A;  3V39 A;  1KVL A;  2YKF A;  4MLL A;  3DWZ A;  1XGJ A;  4FD8 A;  3OPP A;  1OPX A;  2QPN A;  3H82 B;  1D06 A;  5G4Z A;  1XXM A;  4OLD A;  1UWP X;  3C4P A;  2D01 A;  3UB5 P;  4MN7 A;  1EW0 A;  1SCW A;  3ITA A;  4Z9Q A;  4KZ7 A;  3ZG7 B;  3NEC A;  4OPZ A;  2NUT C;  1LLB A;  2GNX A;  4UA7 A;  1K55 C;  1DJB A;  3T4S A;  3A0R A;  2Y2J A;  1FCN A;  4DE3 A;  5GHZ A;  3P98 A;  5HWT A;  2QJ7 A;  4CLC C;  2VV8 A;  1ESI A;  1W63 Q;  4X53 A;  1YSQ A;  3UB6 A;  2PRF A;  3ZNY A;  5FEG A;  3P7N A;  4IVI A;  1ES5 A;  3G31 A;  1N9B A;  1IEM A;  3VOY A;  4GN2 A;  4RVA A;  5HAQ A;  3SH8 A;  1LI9 A;  1H5X A;  2WZX A;  3CAX A;  5A8B A;  1UGU A;  2XGN A;  3T12 B;  2WKE A;  4GDN A;  3H7W B;  1U60 A;  4WMC A;  4Z1W A;  3HBR A;  4R4S A;  2JBF A;  2ZC4 B;  3HLF A;  2FFF B;  2IWB A;  1YPR A;  4KG5 A;  4R0Q A;  3F1N B;  3GRJ A;  1Z6F A;  1TDG A;  3S22 A;  3LR5 A;  1DJA A;  2FFY A;  2PYR A;  3VSL A;  3RXX A;  3KO6 A;  2XQZ A;  4R6L A;  4S2I A;  4EQ1 A;  1FSW A;  1XGI A;  4JBF A;  2PR5 A;  2BG1 A;  3RTY A;  4BBU A;  2WUQ A;  4WZ4 A;  4U0T A;  2H5S A;  3UMD A;  5DKK A;  1IYP A;  3KSI A;  1OTD A;  4HP9 A;  3BYD A;  4WEL A;  2HF6 A;  4OQG A;  2ZM0 A;  4PKY A;  4DE1 A;  3SW1 A;  4FTX A;  3KYQ A;  4EEU A;  2ZMF A;  2OSU A;  1N4O A;  1G6A A;  5F82 A;  2A24 A;  4JLF A;  1T19 A;  1XA1 A;  1BLH A;  4UA9 A;  1KGG A;  4F94 A;  4P6Z S;  5KSC A;  3NDE A;  2Y2H A;  1YQS A;  1NLY A;  4CLC D;  2NUP C;  5L10 A;  4F3L A;  3ULF A;  4II7 A;  4C3Q A;  3LIC A;  2Q9M A;  2WGV A;  4UAA A;  2GDN A;  2A49 A;  2XF3 A;  4LGW A;  5J3W A;  3P09 A;  3OLO A;  1UWN X;  1PW8 A;  4BEN A;  2GX5 A;  1GCE A;  3D72 A;  1OJG A;  2ZOH A;  1WYC A;  4EBP A;  4S2J A;  4GS9 A;  2V0W A;  3C30 A;  4H6J B;  3IT9 A;  2UV0 E;  2Y2M A;  4RYE A;  2A2L A;  3A3J A;  3FC7 A;  5LBR A;  4KQO A;  1H8Y A;  5KIZ A;  2W1T A;  1T18 A;  1N9N A;  3AGE A;  3IX3 A;  4EER A;  1PFL A;  1S6R A;  4QJG A;  5JYP A;  3ZNT A;  1XJ2 A;  2VGJ A;  1ZKJ A;  3OPH A;  4S2P A;  1J9M A;  4HNB A;  3OBF A;  4OH0 A;  1XP4 A;  2H10 A;  3HLG A;  1CJF A;  1VET B;  3D9Y A;  1PWC A;  4BBV A;  4ARZ A;  4WM9 A;  4JXS A;  3W2Z A;  3Q81 A;  2L4R A;  4EQI A;  2O99 A;  5HL6 A;  3T1X A;  4PM6 A;  3IQA A;  2DCF A;  5A93 A;  4KQQ A;  3H82 A;  4ZDX A;  3T4T A;  2VJW A;  1FR1 A;  1NYM A;  1PWG A;  3Q7V B;  3MXS A;  2X02 A;  4DJ2 A;  4B4Z A;  3HLW A;  4CPK A;  3NJA A;  1GSW A;  2VKS A;  4WMC D;  5HPF A;  4MCW A;  1TD5 A;  4LV3 A;  3IXH A;  4DF6 A;  3E4P A;  2B02 A;  4Y0U A;  1SKO B;  4K0W A;  2Z6C A;  5FDS A;  2PHY A;  3LO7 A;  2XFS A;  3NY4 A;  3MSH A;  1FQG A;  2PU4 A;  3ZG8 B;  4DRT A;  3SS5 A;  4OQH A;  4CLC B;  5J8X A;  5E2H A;  1GA9 A;  4DE0 A;  2XA7 M;  3KYZ A;  4CQH A;  3NOT C;  2HJE A;  3DTK A;  4HJ6 A;  3SOI A;  3VSK A;  3GV9 A;  1Y4O A;  1L3L A;  3HVF A;  2PU2 A;  3EOI A;  3H7W A;  3B42 A;  1NZU A;  3V67 A;  4KUK A;  4WYY A;  2PDR A;  2PR6 A;  3LIE A;  4OP8 A;  4GCZ A;  3TSG A;  1BLS A;  3F1N A;  2RCX A;  3TRC A;  1D1J A;  4YIN A;  3UB9 A;  3MQ0 A;  4XUZ A;  1T1A A;  3F1O B;  3E2K A;  2ZMV A;  4RA7 A;  4BL3 A;  2JKR M;  5CTM A;  4EUV A;  1FSY A;  5FI6 A;  2ZM2 A;  4OQ0 A;  4OQI A;  4EV4 A;  2WYX A;  4HBT A;  5HZH A;  5FI2 A;  5I94 A;  4GLQ A;  3M6H A;  3R4K A;  4HHD A;  4X1L A;  3OCN A;  3IWI A;  5EVI C;  4KZ8 A;  1KDW A;  5HW3 A;  1WYB A;  3RH8 B;  2D02 A;  3RJU A;  1HD8 A;  2Y2G A;  4M3K A;  3T4K A;  4ZRR A;  2P74 A;  5EV0 A;  5EOE A;  4U3T A;  3WRZ A;  1LHY A;  4B88 A;  4JGO A;  4HEF A;  2KX6 A;  1MPL A;  5TBM B;  2ZQ8 A;  2R9W A;  3PXP A;  4G3V A;  3NCK A;  5A90 A;  3UNW A;  4I3I A;  4FOF A;  1S1Y A;  2H0T A;  3D4F A;  3Q82 A;  4R1G A;  4BQM A;  5EFW A;  3FWL A;  4H6J A;  4EBL A;  1ERQ A;  5FSR A;  5TGF A;  5HX9 A;  2PD7 A;  3IHB A;  3V3S A;  1MKM A;  1SZV A;  4P87 A;  3E0Y A;  2VK3 A;  2V1B A;  1DP8 A;  4HH2 A;  2OOL A;  3SZT A;  2Y2L A;  3BFG A;  4Y0T A;  3GVB A;  2I9V A;  4B9O A;  1H3Q A;  3M6B A;  4BMW A;  4GZB A;  1YLJ A;  4JF6 A;  1DP9 A;  4PKY G;  2B95 A;  3CZD A;  1VET A;  4HH3 A;  4LCM A;  1O07 A;  3O87 A;  5CER A;  3O88 A;  2OLV A;  1LT0 A;  2ZQD A;  4MBF A;  5EVI D;  3G2Z A;  1K38 A;  1ACF A;  1NY0 A;  4JXW A;  2Y2P A;  3IH9 A;  1P97 A;  4O0P A;  2WZZ A;  4ME4 A;  1DRM A;  1K57 C;  4NK3 A;  3A3D A;  3MZF A;  5JYO A;  3Q7V A;  5HSQ A;  1E3U D;  2W3G A;  1NXY A;  3BJN A;  2K31 A;  3DWK A;  3ZYT A;  4ZBE A;  3NI9 A;  2V8F A;  2FH5 A;  3IBR A;  4O01 A;  5GLA A;  2WKH A;  1CEF A;  5DF8 A;  3JPU A;  4OON A;  1ESU A;  2GZA A;  3FKV A;  5F83 A;  5GHY A;  3UPN A;  3VP2 A;  1SKO A;  2IA2 A;  1K55 A;  4QU3 A;  1ALQ A;  3T4O A;  2WAE A;  4QHC A;  3M2J A;  2QZ6 A;  4E6X A;  1IYQ A;  4CLC A;  3BEB A;  1OT9 A;  5L8M A;  3VP3 A;  5FAP A;  3MXR A;  3E4Q A;  3PR6 A;  4ZJ1 A;  3ITB A;  1NRJ A;  4DJ3 A;  3CJM A;  5DJT A;  3MBZ A;  1VB6 A;  1ONG A;  2Y2Q A;  1EWZ A;  4R38 A;  5DTT A;  1Y54 A;  3D3O A;  3LGO A;  5A91 A;  2VA0 A;  3KSF A;  4S2K A;  4Y3I A;  4QY5 A;  1EI5 A;  4HJ4 A;  3G6O A;  1LSX A;  2XFT A;  2O9C A;  2EX6 A;  1BUL A;  1K4E A;  4IUK A;  1HZO A;  1DJC A;  1YAX A;  3BFF A;  1TS6 A;  4KZ4 A;  1K25 A;  4E3I A;  2ZC7 A;  3BFD A;  3VE4 A;  4BD1 A;  1O7E A;  1KGF A;  5IU1 A;  3A0S A;  4ZTK A;  3PBQ A;  2K2N A;  2KOI A;  3GDI A;  4I5S A;  2GJ3 A;  4OOL A;  3IX8 A;  4MN6 A;  3N6I A;  2Y79 A;  3G30 A;  3UN7 A;  4G3K A;  3QHY A;  4C75 A;  4R3A A;  3OPL A;  2XD1 A;  5EVI B;  2G2U A;  5CED A;  2XR0 A;  3ZCZ A;  4ZAM A;  3VE3 A;  3MFD A;  2EWW A;  4NKP A;  4ESP A;  3DW0 A;  2DNS A;  2K7S A;  2XD5 A;  4GJ4 A;  1FR6 A;  3F1P B;  4FUW A;  3ISG A;  3PBN A;  1XPB A;  3V50 A;  4E3O A;  3WS5 A;  5TBM A;  1CI9 A;  5GL9 A;  1NLZ A;  5TFQ A;  1W8Y A;  5D3O A;  1ES2 A;  4Q0I A;  3L9K A;  4KZ6 A;  5F5Y A;  4WEJ A;  3H9W A;  4LV0 A;  2AVX A;  1BT5 A;  2VV7 A;  3O3V A;  1W5D A;  3UO9 A;  1JWZ A;  4Q0H A;  4NG2 A;  1KE0 A;  4DDY A;  3CWF A;  2VGK A;  1WA9 A;  1PI5 A;  5FI7 A;  1QME A;  2V2F F;  1KE3 A;  4IVK A;  1OTB A;  4OPR A;  4XXR A;  3GMW A;  4C6Y A;  3T4Q A;  4O8G A;  2XRN A;  5IT5 A;  2M7V A;  1YSP A;  5HD5 A;  2VGL M;  2PAV P;  1QMF A;  5C5K A;  1GHM A;  3NHQ A;  5L07 A;  3T1R A;  3HLE A;  3DTI A;  5CTN A;  4KZ5 A;  3TG9 A;  4K91 A;  5AVF A;  2ZOI A;  3B47 A;  1YLZ A;  2Y55 A;  4D2O A;  1S0W A;  4YWZ A;  1GA0 A;  4E3M A;  3G2Y A;  4WZ5 C;  4FSF A;  4DKI A;  3T4J A;  1AWI A;  3LI9 A;  3NUL A;  5J4E A;  5MC7 A;  4RQ9 A;  4CJN A;  3HLC A;  1XFN A;  1BSG A;  3MQQ A;  2R9X A;  3NOU C;  1PRQ A;  1VEU B;  2HV1 A;  3EEH A;  3CG5 A;  1TS7 A;  2WAF A;  3CIT A;  2J7V A;  3G32 A;  4MEZ A;  2ZL1 B;  1CK3 A;  1GSX A;  4OOY A;  2WKP A;  2YKH A;  1CF0 A;  4WEK A;  3FPV A;  2CC1 A;  1JNU A;  4IHQ A;  1YMS A;  4MMN A;  4R3B A;  4LLO B;  2ZQA A;  1ZG4 A;  5EOO A;  1RCJ A;  1ZHH B;  1VQQ A;  4N1H A;  3P01 A;  3VMA A;  4DE2 A;  2JCH A;  2JE5 A;  3VFH A;  4KZB A;  3E2L A;  3GSG A;  3SH7 A;  3VP4 A;  1E25 A;  5EVL A;  2JKG A;  3MR0 A;  4EXO A;  1FIL A;  5M1A A;  5CXW A;  1K56 A;  4K08 A;  4HBU A;  2XA7 S;  4IED A;  3QNB A;  1KVM A;  3UPO A;  5EUA A;  3KX0 X;  1FCO A;  1T1C A;  2PD8 A;  3NC8 A;  3LR4 A;  1D7E A;  1F98 A;  3I7J A;  1JWP A;  4OOM A;  3MF0 A;  5HD3 A;  4YOF A;  3ZVT A;  4GKU A;  3N8L A;  3B33 A;  4ID4 A;  5BOH A;  2WKI A;  3C7U A;  4LCL A;  3CLO A;  3LID A;  2R78 A;  3QP4 A;  4BBT A;  5E2F A;  4QB8 A;  4I38 A;  2INW A;  4R4R A;  1IEL A;  2ZC3 B;  1V9Y A;  4BLM A;  2IWC A;  3A3F A;  2Z6D A;  5FAO A;  5EVI A;  3BRM A;  2QKP A;  3AGF A;  1ZTU A;  5HPI A;  5AQ7 A;  4AFI A;  5F68 A;  1XX2 A;  1KOU A;  1G6O A;  3OCL A;  5I5L A;  2MJ6 A;  3IF5 A;  2QWS A;  2XH9 A;  4R23 A;  2ZLY A;  3F1P A;  1E3U A;  1G68 A;  4R70 A;  4MBK A;  3SS3 A;  2VLG A;  2QJ5 A;  5TR7 A;  2DMW A;  3M2K A;  1MY8 A;  1PWD A;  4ZJ3 A;  1RGZ A;  3MFX A;  3GTC A;  2Y2K A;  4NXE A;  3UE3 A;  1L2S A;  4OVD A;  3SH9 A;  3WS1 A;  3C38 A;  2Z2L B;  2J3T C;  1G5U A;  1SKF A;  5FAT A;  2X01 A;  4KG6 A;  4DDS A;  3C5A A;  4NXB A;  3BW6 A;  3U4L P;  4LV2 A;  1LI0 A;  3O5Y A;  5AQA A;  2ZQ7 A;  2QHK A;  1MC0 A;  3W4P A;  2Y2I A;  4Y13 A;  2ZC5 B;  1TS8 A;  4B93 A;  3QP5 A;  2JKR I;  4MNR A;  4PM7 A;  2OAP 1;  4P6B A;  3KSH A;  1ES4 A;  5G4Y A;  3FZC A;  2B5R A;  4PM8 A;  4DMZ A;  4X1M A;  3L7H A;  3FYZ A;  4L9F A;  2BAS A;  2L0W A;  1TDL A;  3NIA A;  5CHU A;  3E98 A;  5AQB A;  4O7D A;  4EES A;  3LCE A;  5DFX A;  3MKF A;  2A3U A;  4FH2 A;  1MKI A;  2Y2O A;  3JYI A;  3EWK A;  3Q07 A;  5CGW A;  4Y0O A;  3IWQ A;  3QNC A;  5KSH A;  1K57 A;  2ZD8 A;  1YM1 A;  5GHX A;  2OV5 A;  5HDC A;  1K56 D;  1PIO A;  3MKE A;  1VEU A;  3VFF A;  1LL8 A;  2JKT M;  4LV1 A;  5AQ9 A;  4IBX A;  3TW8 A;  2ZJ9 A;  3RXW A;  5A92 A;  1LL5 A;  2WGW B;  3PTE A;  2C5W B;  2ZL1 A;  4HI4 A;  4RX2 A;  4OPY A;  2W3F A;  5FQ9 A;  4JGR A;  4MBH A;  3KSG A;  2J3T D;  4E3L A;  2J9P A;  1TS0 A;  5DJU A;  3BQA A;  1C3B A;  4GD6 A;  5F1G A;  4DXB A;  1DP6 A;  4E3K A;  3V3R A;  1IKG A;  4PAU A;  4QWO A;  2JN7 A;  2P7J A;  4GB7 A;  3MXQ A;  3T4L A;  3FG8 A;  4G3W A;  4BD0 A;  4FH4 A;  1K4F A;  2Y59 A;  3O86 A;  4JF5 A;  1F9I A;  1PZP A;  3A3E A;  3PBR A;  3UY6 A;  2P08 A;  3VP1 A;  1Q2Q A;  3GR2 A;  5E43 A;  1BTL A;  1PYY A;  3EGD C;  5DF9 A;  3FKW A;  3BQ8 A;  1Z09 A;  3WRT A;  3JVU A;  1STZ A;  2QYB A;  3CPT B;  3LIA A;  3EQU A;  3T50 A;  4QY6 A;  4OKP A;  3JVV A;  3EEA A;  1A0K A;  3LY3 A;  3UME A;  4Y7P A;  4HES A;  3C7V A;  2V8C A;  3FV7 A;  3A3I A;  3IS2 B;  2XDM A;  2Y8H A;  5FAQ A;  3QP2 A;  4JXG A;  1SDN A;  1FCM A;  4HIA A;  5FA7 A;  1KE4 A;  1TF1 A;  2QMI A;  2EX9 A;  3LR0 A;  2Q0O A;  3GEC A;  2EX8 A;  3K3C A;  2RL3 A;  3R7W B;  2VZW A; 
#chains in the Genus database with same CATH homology
 3ZQ5 A;  3LR3 A;  2B18 A;  4HY8 A;  4DJ2 A;  4BWI A;  3A0V A;  3T4Q A;  3NJA A;  1GSW A;  4O8G A;  5DKL A;  2XRN A;  5IT5 A;  2M7V A;  1OJ5 A;  1YSP A;  2VKS A;  5HD5 A;  5HPF A;  3VOL A;  2L1M A;  2VGL M;  2P04 A;  3LYX A;  5C5K A;  3RFB A;  4MCW A;  1TD5 A;  3K2N A;  3NHQ A;  3IBJ A;  1V9Z A;  3E4P A;  3CUE C;  2B02 A;  2EWV A;  2H28 A;  3F1O A;  3BY8 A;  2Z6C A;  2PHY A;  3MQO A;  2JKT I;  5AVF A;  2ZOI A;  3B47 A;  1P0Z A;  3OC2 A;  4YWZ A;  2W3E A;  2KLI A;  4LRX C;  4JGQ A;  1OTI A;  3CI6 A;  4EU0 A;  4UQI S;  4CLC B;  2XA7 M;  4FSF A;  3KYZ A;  4CQH A;  3NOT C;  3T4J A;  3PBT A;  1XJ4 A;  2HJE A;  4M4X A;  1P9R A;  2G7U A;  1W63 M;  2VEA A;  3LI9 A;  4HJ6 A;  5J4E A;  5MC7 A;  4EEP A;  4RQ9 A;  1XFN A;  3BWL A;  4NXG A;  3MQQ A;  3NOU C;  2J3W A;  1OTA A;  5CX7 A;  2M1C A;  3C8C A;  4KUO A;  3EOI A;  4DN0 A;  2W1R A;  1P9W A;  2HV1 A;  3H7W A;  2JHE A;  3B42 A;  3V67 A;  1N9O A;  1NWZ A;  4KUK A;  3EEH A;  2PDR A;  3LIE A;  1TS7 A;  2PR6 A;  2WKR A;  3CIT A;  3MJQ A;  4GCZ A;  4I39 A;  4WUJ A;  4CLC E;  3F1N A;  3TRC A;  1GSX A;  2WKP A;  2YKH A;  3VV4 A;  3UB9 A;  3MQ0 A;  2A24 B;  4MN5 A;  3UE6 A;  2VX8 A;  4WEK A;  1X0O A;  1Y28 A;  3FPV A;  1T1A A;  3CUE A;  3F1O B;  1JNU A;  2ZMV A;  4XT2 A;  4IHQ A;  4MMN A;  3FPW A;  1BYW A;  2PT7 A;  2VGL S;  2JKR M;  3NOP C;  4LLO B;  4EUV A;  1ZHH B;  5IS1 A;  3PYP A;  4E04 A;  4F3L B;  2J80 A;  2EA9 A;  3P01 A;  1MZU A;  5K5B A;  3LFV A;  2W3D A;  1XJ3 A;  5HZH A;  2LB5 A;  2LB9 A;  4GLQ A;  1YKD A;  2V0U A;  3R4K A;  4HHD A;  4UQI M;  3MR0 A;  4EXO A;  3OCN A;  2V1A A;  4K08 A;  2XA7 S;  4NXF A;  4LRZ E;  3UB8 A;  4GHI B;  4I3J A;  3KX0 X;  3RH8 B;  5HWW A;  4LRY C;  2D02 A;  1T1C A;  2PD8 A;  5AJG A;  5F6A A;  4GS9 B;  2O0Y A;  2XSS A;  3LIF A;  1D7E A;  3LR4 A;  3BY9 A;  1F98 A;  3MMH A;  4Y5F A;  2PYP A;  1F5M A;  4HOI A;  4OOM A;  3MF0 A;  5HD3 A;  4YOF A;  2W1T B;  3T4K A;  4ZRR A;  3HCY A;  4BJP A;  3B33 A;  4JGO A;  4EET B;  3C2W A;  3CLO A;  2KX6 A;  3LID A;  5TBM B;  1G28 A;  2R78 A;  4L0L A;  3PXP A;  1S4S A;  3DBA A;  1S4R A;  2HGV A;  4G3V A;  5J7E A;  3TE8 A;  3PBO A;  4BBT A;  4I38 A;  1T1B A;  2INW A;  1GSV A;  4LPZ A;  4IUH A;  4I3I A;  4FOF A;  1S1Y A;  1V9Y A;  4ARZ B;  3HJI A;  2FZ0 A;  2Z6D A;  1IOU A;  2QKP A;  5EFW A;  1ZTU A;  5HPI A;  1N9L A;  4I3A A;  3PBS A;  4H6J A;  3E4O A;  4AFI A;  2YKF A;  5F68 A;  1KOU A;  2PD7 A;  2OWJ A;  4WLA A;  1G6O A;  1S1Z A;  4UEY A;  3HJK A;  1MKM A;  3OCL A;  4YNR A;  5I5L A;  1IFQ A;  2MJ6 A;  1OPX A;  2QWS A;  3EGX C;  3F1P A;  3E0Y A;  2V9A A;  2V1B A;  3H82 B;  1D06 A;  5G4Z A;  3UB7 A;  1DP8 A;  4HH2 A;  1UWP X;  2OOL A;  4R70 A;  2D01 A;  2VLG A;  4MN7 A;  1EW0 A;  2I9V A;  4Q0J A;  2O9A A;  2QJ5 A;  4B9O A;  1H3Q A;  1LSW A;  4BMW A;  2DMW A;  1DP9 A;  4PKY G;  4HH3 A;  2NUT C;  3MFX A;  2GNX A;  3UE3 A;  4NXE A;  3T4S A;  3A0R A;  4JGP A;  1LT0 A;  3ICY A;  3LIB A;  3C38 A;  2O9B A;  2J3T C;  4IJG A;  5HWT A;  2QJ7 A;  4CLC C;  2VV8 A;  1W63 Q;  3IS2 A;  3UB6 A;  1YSQ A;  4NXB A;  3BW6 A;  1P97 A;  4O0P A;  3O5Y A;  2QHK A;  5DFY A;  1MC0 A;  3P7N A;  4ME4 A;  1DRM A;  3R7W A;  1TS8 A;  2OAQ 1;  1OTE A;  4B93 A;  4ETX A;  5HSQ A;  2W3G A;  2JKR I;  3S7P A;  3BJN A;  3TJZ C;  4GW9 A;  2K31 A;  3PHY A;  3ZYT A;  2OAP 1;  3CAX A;  3KSH A;  4ETZ A;  5A8B A;  1UGU A;  2FH5 A;  3IBR A;  5G4Y A;  4O01 A;  3OOV A;  3U2A A;  4DMZ A;  5F69 A;  4P6Z M;  3H7W B;  4L9F A;  4Z1W A;  2GZA A;  2BAS A;  3EQV A;  4WF0 A;  2L0W A;  2OWH A;  2CMN A;  3F1N B;  2IA2 A;  4WN5 A;  3T4O A;  3E98 A;  2W0N A;  5FL3 A;  4XT2 B;  4EES A;  3LR5 A;  1S66 L;  4CLC A;  5HDS A;  5DFX A;  1OT9 A;  4Y2F A;  2PYR A;  5L8M A;  4QPR A;  3E4Q A;  3PR6 A;  2W27 A;  3EWK A;  3KO6 A;  4R6L A;  3S7N A;  1NRJ A;  4EQ1 A;  4DJ3 A;  2XRO A;  5KSH A;  5HWV A;  5DJT A;  1XFQ A;  2PR5 A;  2ZBB A;  3RTY A;  4BBU A;  1VB6 A;  4R38 A;  5HDC A;  3UMD A;  3D3O A;  1LL8 A;  5DKK A;  3KSI A;  1OTD A;  4HP9 A;  4HQA A;  4HP4 A;  4WEL A;  2JKT M;  2HF6 A;  2VA0 A;  3KSF A;  4Y3I A;  4PKY A;  2KDK A;  4HJ4 A;  3SW1 A;  3G6O A;  3TW8 A;  1LSX A;  3KYQ A;  4EEU A;  2ZMF A;  2O9C A;  4HI4 A;  4PHT A;  2A24 A;  4IUK A;  1T19 A;  1YAX A;  2W3H A;  4MDZ A;  2W3F A;  1TS6 A;  1XJ6 A;  2M7U A;  5TJJ A;  4JGR A;  4P6Z S;  3KSG A;  2J3T D;  4NEE D;  1TS0 A;  5DJU A;  3VE4 A;  1NLY A;  4CLC D;  2NUP C;  3BQA A;  4F3L A;  3ULF A;  4II7 A;  3LI8 A;  5IU1 A;  3A0S A;  1DP6 A;  3LIC A;  3PBQ A;  4EW7 A;  2K2N A;  2KOI A;  3GDI A;  4I5S A;  5AVE A;  2GJ3 A;  4PAU A;  2JN7 A;  4OOL A;  2P7J A;  5J3W A;  3OLO A;  4MN6 A;  3MXQ A;  3T4L A;  3FG8 A;  4G3W A;  2Y79 A;  1UWN X;  4G3K A;  2GX5 A;  3LUQ A;  4GHI A;  3D72 A;  4R3A A;  1OJG A;  2ZOH A;  1F9I A;  4GS9 A;  2V0W A;  3C30 A;  4HJ3 A;  4H6J B;  4KQD A;  3PBR A;  2A2L A;  2P08 A;  3VE3 A;  2EWW A;  2VV6 A;  3FC7 A;  5LBR A;  4KQO A;  4NKP A;  5KIZ A;  1ODV A;  2W1T A;  5HDD A;  2K7S A;  1T18 A;  3S7Q A;  1N9N A;  4GJ4 A;  3F1P B;  4EER A;  2HJ9 C;  3EGD C;  5DF9 A;  3PBN A;  1XJ2 A;  3BQ8 A;  5TBM A;  4HNB A;  1NLZ A;  3OBF A;  3JVU A;  1STZ A;  2QYB A;  3LIA A;  3EQU A;  3T50 A;  4Q0I A;  3JVV A;  5F5Y A;  4BBV A;  3EEA A;  4L9E A;  4ARZ A;  4WEJ A;  1LSV A;  3H9W A;  1VHM A;  3UME A;  1S67 L;  2VV7 A;  3W2Z A;  2L4R A;  2O99 A;  3K3D A;  3IS2 B;  4L9G A;  5HL6 A;  4Q0H A;  2Y8H A;  3CWF A;  1WA9 A;  4HIA A;  1TF1 A;  2WKQ A;  4WL9 A;  1OTB A;  3H82 A;  3LR0 A;  3GEC A;  3K3C A;  1OT6 A;  3T4T A;  1H8M A;  2VJW A;  3R7W B;  2VZW A;  3S7O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...