2J80A

Structure of citrate-bound periplasmic domain of sensor histidine kinase cita
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
129
structure length
129
Chain Sequence
b'TEERLHYQVGQRALIQAMQISAMPELVEAVQKRDLARIKALIDPMRSFSDATYITVGDASGQRLYHVNPDEIGKSMEGGDSDEALINAKSYVSVRKGSLGSSLRGKSPIQDATGKVIGIVSVGYTIEQL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SENSOR KINASE CITA
publication title A Ligand-Induced Switch in the Periplasmic Domain of Sensor Histidine Kinase Cita.
pubmed doi rcsb
source organism Klebsiella pneumoniae
molecule tags Transferase
total genus 35
structure length 129
sequence length 129
chains with identical sequence B
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2006-10-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2j80A00
5HD5A 4JGRA 2PD7A 1OTIA 3IS2B 1D7EA 3CLOA 3MJQA 3EEHA 1JNUA 5KIZA 4BBVA 3VE3A 3LIEA 2WKQA 1XJ6A 1DP6A 1DP8A 1LSXA 4HQAA 2BASA 2V1AA 3ULFA 4HH2A 1LT0A 4NXEA 2KX6A 1LSVA 2P7JA 4H6JB 4R70A 1T1BA 5DJTA 4HJ3A 2ZOHA 4WN5A 2QJ7A 1MZUA 5HWTA 3IS2A 2PYRA 1GSWA 1GSXA 3FC7A 5AVEA 1DP9A 4R38A 1S4RA 3CAXA 2VEAA 1BYWA 4BBUA 3LI9A 3P7NA 3F1NB 4HNBA 3MXQA 3UB9A 4KUKA 2A24A 1WA9A 5J3WA 5DJUA 5HDCA 1S4SA 3F1PB 2YKHA 3F1OB 4B9OA 2WKRA 3KX0X 4HP9A 1OJGA 1T1CA 2PDRA 4H6JA 3RTYA 4GS9A 3NHQA 2GJ3A 1N9LA 2QWSA 2VV7A 1GSVA 2B02A 2J80A 2V0WA 3E4PA 1XJ3A 1T18A 1T19A 2L0WA 5HD3A 1S1ZA 2KDKA 2YKFA 3H9WA 4PKYA 3A0SA 4PKYG 1OTBA 3VE4A 3ICYA 3LICA 1N9OA 3F1OA 4I3AA 4HI4A 2OWJA 3H7WB 5G4ZA 5F6AA 4MN5A 4WUJA 1DRMA 2W27A 3GDIA 3OLOA 1S67L 2QJ5A 2HV1A 2QHKA 3LIAA 5I5LA 1P97A 3RH8B 4NXGA 4JGOA 5IS1A 4I39A 1N9NA 3HJKA 4EXOA 2D01A 2PHYA 4WF0A 3MR0A 2ZBBA 4GHIB 3PHYA 4BBTA 1F98A 1V9YA 4RQ9A 3IBRA 4HY8A 2VV8A 1XFNA 1EW0A 3H7WA 2V1BA 3K3CA 4NXBA 2PYPA 2PD8A 2W0NA 3UE6A 4M4XA 2D02A 3LIFA 2Z6CA 2OOLA 1UWPX 3SW1A 4HIAA 2QKPA 4LRZE 3NOTC 2VV6A 4NXFA 5HSQA 4R6LA 3HJIA 2L4RA 2M1CA 4L9FA 2WKPA 3GECA 3MQOA 3K3DA 1LSWA 5HZHA 1UGUA 4I5SA 3BWLA 3H82B 1OTAA 1S1YA 3D72A 5HWVA 5AVFA 4EEPA 3ZQ5A 4EW7A 3MQQA 1F9IA 4K08A 1XFQA 2I9VA 3F1NA 4EESA 5J4EA 1TS6A 2JHEA 3F1PA 4I38A 2L1MA 4E04A 4WLAA 4EQ1A 3UMDA 3H82A 3NJAA 4HOIA 1UWNX 4LLOB 4EETB 2INWA 3A0RA 2EA9A 5HDDA 1V9ZA 3LIDA 4WL9A 4EEUA 1NWZA 3C2WA 3LYXA 1LL8A 4XT2B 5IU1A 4KQDA 3BY9A 1P0ZA 4GW9A 1S66L 1TS0A 4DJ3A 2ZOIA 4HJ6A 1KOUA 3UB7A 3UMEA 3G6OA 1OTEA 4L9EA 2PR5A 3PYPA 3LIBA 5HDSA 1XJ4A 2A24B 1OT6A 2V9AA 4KUOA 4JGPA 3C8CA 4R3AA 5F5YA 4L9GA 2VLGA 4I3JA 4GS9B 2R78A 5TBMB 3CWFA 4XT2A 3EWKA 2V0UA 3VOLA 3A0VA 3FG8A 1G28A 4EERA 1Y28A 5J7EA 5G4YA 4GHIA 1OJ5A 5HWWA 1D06A 3UB6A 4LRXC 3BY8A 2H28A 4YWZA 3E4OA 2K7SA 1VB6A 3NOUC 4I3IA 4F3LB 2JN7A 5EFWA 5A8BA 1ODVA 2OWHA 4HH3A 4JGQA 3LUQA 5F69A 1X0OA 4HJ4A 4LRYC 5F68A 3MFXA 5TBMA 5DKLA 3UB8A 3E4QA 3T50A 1TS8A 1XJ2A 1OTDA 2Z6DA 1OT9A 3NOPC 4MN6A 3LI8A 4DJ2A 1T1AA 4GCZA 4LPZA 4HP4A 4F3LA 4HHDA 2CMNA 3B33A 2PR6A 5DKKA 1TS7A
chains in the Genus database with same CATH superfamily
1PIOA 4RX3A 1GHIA 2J9PA 1FSWA 2PRFA 1PWGA 5CERA 3MJQA 4KQOA 3EQVA 5K5BA 1KDSA 1CI8A 4DN0A 1MWTA 5I94A 4D2OA 4B4XA 3NI9A 1XJ6A 4FTXA 4MBKA 3EOIA 2XLNA 2P04A 3ZGAB 3IX3A 2XSSA 1S0WA 2VK3A 1LT0A 1CI9A 1HD8A 2W3EA 4PM9A 1T1BA 4HJ3A 4GDNA 4C6YA 2Q9NA 3QP5A 2XFSA 1J3WA 4B4ZA 2KLIA 5HWTA 3KSHA 1YSPA 2PYRA 5AVEA 4Q0HA 3PBSA 1PFLA 2GZAA 3C7UA 1IKIA 1BLSA 2ZC3B 5FI6A 4N92A 3S4XA 3HLDA 3BFEA 4X56A 5HL1A 4AFIA 3NECA 4BBUA 5M19A 2ZLYA 3O88A 4KUKA 2XR0A 4EU0A 5EM1A 1MPLA 5DJUA 5HDCA 3F1PB 5EM0A 5HFOA 1JVJA 1NXYA 4B9OA 2WADA 4S2KA 4CPKA 4H6JA 3RTYA 3PAGA 4MDZA 1NZOA 3KSGA 4O0PA 5GLCA 4E3JA 2M7VA 1EWZA 1HZOA 3ZNTA 3NHQA 1KDWA 2ZQ7A 3LEQA 1N9LA 2QWSA 1GSVA 2V0WA 4WELA 1BLPA 3T1XA 4MMNA 3PBRA 5G18A 1T18A 2ZC7A 1Y54A 4LV0A 1DY6A 4YFMA 4ME4A 2KDKA 4OQIA 4U0TA 2YKFA 4RYEA 1ES2A 4PKYA 2WKEA 3N8LA 3ITBA 3ICYA 4IBRA 2DNSA 3F1OA 1Q2QA 3IX4A 4IUHA 3T4KA 4E3LA 5CHJA 3KSFA 4HI4A 4X25A 5G4ZA 5F6AA 5AQBA 3QNBA 5KMWA 4R3JA 2ZC4B 2QHKA 3LIAA 1F5MA 1PW1A 4U3TA 4XUZA 5EV0A 3LR3A 3UPOA 3KYQA 2HDQA 5IS1A 4I39A 2G2WA 4BMWA 1ESIA 5AQ7A 1O07A 4X69A 4EXOA 3LCEA 4BBTA 5EVID 3ZDJA 3VOYA 5GLBA 2H0TA 2W1TA 1FILA 4RQ9A 2VKSA 1ERQA 3FPWA 4B93A 4FD8A 1C3BA 1EW0A 1K54A 4JF5A 4O01A 2XD5A 4P6BA 4S2PA 2W0NA 3U4LP 3S1YA 1MBLA 3JVUA 4UA9A 1ZTUA 2DMWA 3BQ8A 3IF5A 2OSUA 1K54C 2CC1A 2VV6A 3CPTA 5HSQA 3MKFA 1LI0A 3HJIA 2W1RA 2L4RA 5DFXA 2HP6A 1E3UD 5FA7A 4L9FA 3CUEA 3GECA 3K3DA 3G2ZA 5HZHA 1YMSA 3BWLA 3CUEC 1FSYA 4A5RA 2OAQ1 3MS6A 3LR0A 5FQJA 1S1YA 4QB8A 3D72A 1MXOA 3D9YA 5AVFA 4EEPA 4EV4A 5HWVA 5M18A 4KG2A 4HEFA 3QP1A 2EX9A 1F9IA 1L0GA 1IKGA 1JWVA 4CLCE 1WYCA 3F1NA 4FCFA 1FCMA 1MC0A 1P9WA 1TS6A 5A91A 4I38A 1K6RA 4QU3A 2Y8HA 2HF6A 2VJWA 4F94A 3MXSA 3HLCA 3RXWA 4WLAA 4WM9A 3HL9A 4LCLA 5EPHA 5CHUA 4LLOB 4GD8A 1PYYA 2INWA 3HUMA 3HCYA 4R0QA 1V9ZA 3LIDA 4LV2A 5HX9A 4CQHA 1S6RA 4BLMA 2H10A 4L0LA 1NJ4A 1TS0A 5F1GA 2KOIA 2PT7A 4HJ6A 1KOUA 3UB7A 4YINA 4L9EA 2FFFB 5CEBA 3UE3A 4CLCB 2K31A 4DXBA 3LIBA 5HDSA 1W63Q 3T4JA 4E6WA 1KVMA 2J8YA 3C8CA 3HLGA 4U0XA 4Z1WA 1NLZA 2HJ9C 4IVKA 1K57A 4I3JA 1N9BA 4GS9B 1A0KA 5TBMB 3TW8A 2Z2MB 2ZQCA 2PBYA 1K57C 1K4EA 4DE3A 2QPNA 3RXXA 2W3DA 3NDEA 1Y28A 3BM6A 5G4YA 2XDMA 1HVBA 3NIAA 4S2LA 3UPNA 3IH8A 4FH4A 4LRXC 1YLWA 3E4OA 4JF4A 4F3LB 2JN7A 2XF3A 5EFWA 4ARZA 3T1RA 1LLBA 4OOMA 1G6OA 1YSQA 2I72A 3Q7VA 3UB8A 5HPFA 4QWOA 3T50A 1ZG4A 2XGNA 4R4SA 3TSGA 1PI5A 1K56D 3OC2A 2Z6DA 4ZBEA 4KZAA 3LI8A 4R3BA 2Y91A 3OPLA 5KZHA 5DTKA 4LPZA 1BZAA 1G6AA 2JKRM 1PI4A 2UWXA 2WGWA 2BG1A 2WKHA 3Q82A 2CMNA 4NKPA 5DKKA 1DJAA 3IF6A 3ZHHA 2PD7A 3IS2B 4NK3A 1ACFA 1D7EA 4N1HA 2AVXA 3IF6C 3V39A 4BBVA 4DE1A 5BOHA 3VE3A 4OVDA 3LIEA 1K25A 1YKDA 3NY4A 2FZ0A 3LGOA 2V1AA 3ULFA 1W79A 4KQRA 5E43A 4WMCA 1DJCA 4O8GA 2B18A 1KE3A 3A3DA 1VQQA 2Y2HA 1W8QA 4GZBA 5FATA 2ZM2A 3AGEA 1H8ZA 3WS1A 2ZOHA 4H8RA 2FFYA 2BLSA 2B95A 3O5YA 1MZUA 3DTMA 4UEYA 2A49A 1GSWA 1ZKJA 1GSXA 4NETA 1DP9A 1KE0A 3A3EA 5JYPA 4R38A 1NLYA 2O9AA 4X1MA 5TR7A 4RA7A 1K4FA 3M6HA 4ETXA 3CAXA 2GNXA 2VEAA 4X53A 3PXPA 3UDIA 3UDXA 2MJ6A 4HNBA 4JPMA 3ISGA 1L0EA 3MXQA 5J3WA 2XFTA 2WKRA 3L7HA 1XGJA 1T1CA 3T4OA 1IFQA 2A3UA 1PNEA 3OCNA 2VV7A 2J80A 4MCWA 5HW3A 3VP4A 2L0WA 2W3HA 5HD3A 4R4RA 3S7NA 3S7QA 2ZM0A 5FDSA 3IBJA 2XK1A 3IXBA 2DCFA 1YLTA 4G3WA 3WRZA 1XA7A 4Z9QA 2ZM8A 5FAOA 1GHPA 3G2YA 4Y3IA 5DTSA 5FQIA 4B88A 1XP4A 3B47A 4P6ZS 3OLOA 3JPUA 1S67L 5CRFA 2QJ5A 3UE0A 3OPHA 4PMAA 3RH8B 1IYPA 3GTCA 4GDBA 1N9NA 4JKTA 4QY5A 3SH7A 5FI7A 1YT4A 4WF0A 4GHIB 2J3WA 4IEDA 2RCXA 3CI6A 4ZJ3A 3Q1FA 4O7DA 1SDNA 3LY3A 1V9YA 1SKOB 3BW6A 3IBRA 4HY8A 3MBZA 4EUVA 2HJEA 5HAQA 3IWIA 4MNRA 1VHMA 2V1BA 2PYPA 3O87A 4WMCD 5EOEA 4M4XA 3LIFA 2EFXA 3UNWA 3GVBA 2OOLA 1UWPX 2BTFP 1QMEA 4KZ9A 2EFUA 3SW1A 2WK0A 4HIAA 4GN2A 3U2AA 2P9VB 1RGZA 3ITAA 2O9CA 2QZ6A 1NZUA 3WS5A 2ZQ9A 2Y2MA 4E6XA 3MKEA 3QP8A 3RFBA 1M6KA 4Y5FA 3VMAA 4ZDXA 2HP9A 3PTEA 4PHTA 3V67A 2Y55A 1ES4A 4OPQA 3H82B 2HDSA 4LV1A 2WZZA 4II7A 1FQGA 1Y4OA 2XEPA 1Z6FA 3BLSA 3E0YA 4EW7A 3D3OA 1BTLA 3C4OA 3VSKA 1ES5A 1Q2PA 3AGDA 3C5AA 4K08A 5C5KA 1H0MA 4S2NA 3W8KA 5EVIB 3T4LA 2XD1A 2Y2PA 4GB7A 1VETA 1MWRA 2L1MA 4BL2A 3BFCA 1FOFA 4S2NC 3GR2A 4ZRRA 3GQZA 3CZDA 1LHYA 3V50A 5CGWA 1YQSA 4HOIA 4K0XA 3DTIA 2P08A 4EETB 1BUEA 3A0RA 3EQUA 5HDDA 4WL9A 2Y59A 1STZA 4X6TA 4EEUA 2HP5A 2XROA 3MZDA 3LYXA 1OPXA 1PW8A 3MQ0A 3W4QA 1ZHHB 3BY9A 3MF0A 4GW9A 3QP2A 4DJ3A 1IELA 2ZOIA 3S7OA 5DF7A 5KSHA 1G68A 1O7EA 3G6OA 2ZJ9A 4GOGA 4IHQA 4OONA 5AQ9A 3MXRA 3PYPA 4HBTA 4G3KA 4QHCA 4KUOA 4JGPA 4PPRA 3DWKA 5F5YA 2EWWA 3KO6A 5MC7A 5IHVA 5HARA 1SDEA 2XA7S 4FSFA 4E3MA 2JKRI 3T12B 4X55A 5U47A 1GA9A 2R9WA 2ZMAA 5FDHA 4Y15A 4WEKA 3A0VA 1G28A 3DWZA 3K2NA 1P9RA 4GJ4A 4QPRA 3E2LA 3T4SA 4OLGA 3EGXC 4S2MA 4CLCA 4KZ8A 4S2OA 1K55A 1VB6A 1VEUA 4OP8A 3G34A 3G32A 1J9MA 3HUOA 2OWHA 4CLCC 1BT5A 1K6SA 2V20A 1MKMA 2GDNA 2WGIA 1X0OA 4HJ4A 1K55C 2VX8A 5FQMA 5EECA 1E4DA 2Y2GA 3HLBA 2IA2A 5TBMA 5TJJA 1W8YA 3BJNA 5DKLA 3E4QA 3GSGA 1ESUA 4YNRA 3N8RA 3NDGA 4PAUA 3IXDA 1SKFA 1TS8A 4RX2A 1H3QA 2JCHA 2QMIA 4R23A 3C7VA 3ZVWA 3UN7A 3A3JA 3NOPC 1L0FA 1KVLA 5KSCA 4GCZA 2Y2OA 3BYDA 5AJGA 3ZG0A 4HP4A 3IQAA 3D4FA 1H8YA 4F3LA 1PRQA 2W1TB 1PZPA 3PAEA 1LL5A 4NEED 5HD5A 1OTIA 5DFYA 1JWPA 5GL9A 4UQIS 3CLOA 5EVEA 1PWCA 1WYBA 1JNUA 3C4PA 4MEZA 2WAFA 3ZG5A 2WKQA 3TOIA 2P74A 1DP8A 3CPTB 3TE8A 3AGFA 3DTKA 4HH2A 1TVFA 4WEJA 5E2HA 2E8JA 3UY6A 4R70A 3N4IA 5J8XA 4WN5A 4BENA 2QJ7A 1E25A 4Y17A 3IS2A 5EUAA 3WS2A 3FC7A 5DF9A 3FPVA 4Q0IA 1S4RA 4JXSA 3WRTA 2X71A 2ZMFA 4DE0A 5L8MA 3LI9A 3P7NA 4EBPA 3F1NB 3A3FA 2A24A 4JXGA 2YKHA 3NULA 4JLFA 2Y4AA 3Q7ZA 4OPYA 1OJGA 2PDRA 3HLWA 4PM7A 3UDFA 3PBOA 3LFVA 2B02A 4MN7A 1XJ3A 2VZWA 1LL9A 2EX2A 1T19A 3FKWA 2EXBA 1S1ZA 1MWUA 1CF0A 5EOOA 1W7FA 4ZTKA 1M40A 3H9WA 3A0SA 2IWCA 1OTBA 3G31A 3VE4A 1IEMA 3BQAA 4EQIA 3KYZA 1YLZA 4Y0TA 3LICA 1N9OA 2H5SA 1HTZA 3H7WB 1FCNA 3R7WB 4DF6A 5DTTA 1IYSA 2O9BA 4MN5A 2LB9A 1DRMA 3UO9A 3VP2A 2WAEA 2HV1A 5FQ9A 3LO7A 1P97A 2OAP1 1I2WA 4JGOA 4BWIA 5HPIA 3MMHA 1BSGA 5FASA 4KG6A 3LEZA 3T4TA 2D01A 1RCJA 2ACGA 3PHYA 3OPPA 1F98A 4RVAA 1YLJA 4LV3A 5FL3A 3G30A 3C30A 5GLDA 3R4KA 1ALQA 1XFNA 4P87A 2ZL1A 4UAAA 2Y2KA 3BLMA 2Q9MA 3DW0A 4PM6A 3BEBA 3K3CA 1ZC2A 2D02A 3PBQA 4OQGA 2K2NA 3M6BA 1XX2A 3SS4A 2IWDA 4EWFA 3VV4A 2QKPA 3Q7VB 3QHYA 3NOTC 1NYYA 1ZG6A 4R6LA 3NCKA 2E8IA 3V3RA 4GNUA 2WKPA 4CJNA 3TG9A 1LSWA 3CG5A 4E3IA 1BLHA 1SKOA 2PU2A 3FKVA 1I5QA 5TFQA 3FWLA 2JKFA 2H0YA 4OLDA 4S2IA 2VGLM 1MY8A 3ZQ5A 3SS5A 3BFGA 3M2KA 3IF6B 3FZCA 3W2ZA 5HL6A 4K0WA 1XFQA 2DRWA 1SHVA 1YMXA 2P9VA 4MBHA 4EESA 3UE1A 3SS3A 1W63M 4C3QA 3E2KA 5E2EA 3PR6A 2JHEA 3F1PA 4E3OA 2JC7A 4NG2A 1PWDA 4E04A 3O3VA 4KZ4A 2EWVA 4BL3A 2J7VA 3NBLA 1NRJA 2ZQAA 4EQ1A 2B5RA 3UMDA 3H82A 3NJAA 1ES3A 4KZ5A 4BD1A 4G3VA 4EBLA 3IXGA 3QP4A 2EA9A 3P01A 4S2JA 2C5WB 3RJUA 2JKGA 1NWZA 1PZOA 1LL8A 4XT2B 1MWSA 4KQDA 1P0ZA 4XXRA 5A92A 3IHBA 1XXMA 1KGFA 1JTDA 1K0KA 3T1SA 3UMEA 5E2FA 3OPRA 5EVIA 3SOIA 1JTGA 4DRTA 1OTEA 1XPBA 3WS0A 2HPBA 1Z09A 5F83A 5A93A 3S7PA 3P09A 3HREA 5CX7A 5EVIC 4Y7PA 4K91A 2V9AA 2G7UA 5CGSA 2V8CA 1XGIA 5F1FA 1W5DA 1H5XA 2R78A 4P85A 1LI9A 5FAPA 2EXAA 4P6ZM 2V0UA 3V3SA 4JXVA 4R1GA 2ZMVA 2EX6A 4JXWA 3WWXA 1E3UA 2LB5A 5HWWA 5AQAA 5GHYA 4OPRA 4OQ0A 3UB6A 3BY8A 4OH0A 4YWZA 3VSLA 2K7SA 1CEFA 4P0MA 3KSIA 3NOUC 2M7UA 3I7JA 1K38A 1DJBA 3N6IA 2ZD8A 3LUQA 4N9KA 5L2FA 3HVFA 4LCMA 3GV9A 3TRCA 1XJ2A 1IYOA 2V2FF 2OLVA 4UHUA 5TGFA 1KE4A 3OBFA 3HUNA 2X02A 2J9OA 1SCWA 3S22A 4DJ2A 2JKTM 3G4PA 2R9XA 5M1AA 5CHMA 1GA0A 4ETZA 2W3FA 3L9KA 4WBGA 3MZEA 1F2KA 1AWIA 1TS7A 2J3TC 1KGGA 4JGRA 4KENB 4HBUA 3O86A 3QNCA 4Y2FA 2VGJA 3EGDC 4M3KA 1TDGA 2ZC6B 4FOFA 3EEHA 3Q07A 5KIZA 1L2SA 3B42A 4MLLA 4Y13A 1NRFA 1TEMA 2UV0E 3CHWP 4E3NA 1ONGA 1DP6A 1LSXA 5GHZA 4GD6A 4HQAA 3VFFA 1XKZA 2Y79A 2BASA 4XUXA 5JYOA 3G35A 1CK3A 4NXEA 5IT5A 2KX6A 1LSVA 2P7JA 4H6JB 4LFUA 5DJTA 2X01A 2HZ5A 4IVIA 2ZC5B 4DMZA 4QY6A 2A2LA 3C38A 1IYQA 1YAXA 1ONHA 5LBRA 1RGYA 3UB5P 3VP3A 5FI2A 4MBFA 1BYWA 1QMFA 1FR6A 3ZNYA 3UB9A 1WA9A 5A90A 4EUZA 3IX8A 4ESPA 1VETB 1S4SA 4D60A 3F1OB 2V1ZA 4FUWA 2PU4A 3KX0X 4HP9A 4JF6A 2WYXA 4GS9A 3T1QB 1D1JA 2GJ3A 4GLQA 3VP0A 4DXCA 2O0YA 3E4PA 1N4OA 2NUTC 1K56A 1CEGA 4KZ6A 2XA7M 5FSRA 2XH9A 4QD4A 3JVVA 2Y2LA 1MKIA 2ZQ8A 3Q81A 4Q8IA 4PKYG 2IWBA 1L3LA 4LENA 3SH9A 4I3AA 3UPPA 5FQKA 3QP6A 3E98A 2OWJA 2ZQDA 1TD5A 2Y2QA 5FAQA 2OLUA 3DBAA 3IT9A 4WUJA 3ZG9B 2J3TD 2W27A 3GDIA 4OOYA 5I5LA 1GHMA 5GLAA 3FYZA 2G2UA 4NXGA 1IOUA 3MSHA 2Y2JA 3VFHA 4OKPA 4BJPA 3PBNA 3HJKA 2C6WB 4PM5A 4IJGA 3LY4A 2PHYA 3V5MA 2JE5A 3MR0A 2ZBBA 3BFFA 3IWOA 1YLYA 2PAVP 3KYEA 4KG5A 3ZVTA 2VV8A 2WZXA 2HDUA 3H7WA 3R7WA 3WS4A 4UA7A 1U60A 1VEUB 4NXBA 1XA1A 2WGVA 2PD8A 1WE4A 3UE6A 4DE2A 2Z6CA 4N1XA 3ZFZA 2OV5A 3PBTA 5DVAA 1TF1A 3CJMA 4LGWA 4JBFA 4Y0OA 4KZBA 4LRZE 1JWZA 4NXFA 4ZAMA 4UQIM 4WZ5A 2JBFA 2XQZA 2M1CA 1BLCA 3EEAA 3MQOA 2RL3A 4E3KA 1CQAA 3HBRA 4WZ5C 2GX5A 4CLCD 5EE8A 1UGUA 5CTNA 4I5SA 4BQMA 2Q0OA 5DF8A 3LR4A 4ZJ2A 4Y0UA 4X68A 3W4PA 1OTAA 3B3XA 4X1LA 5HAPA 3MQQA 5HAIA 4ZJ1A 2EX8A 4FH2A 3TJZC 4WYYA 3SZTA 4DKIA 4DDSA 1FIKA 2I9VA 5CGXA 4C75A 3ZG7B 5CXWA 5J4EA 5D3OA 1NY0A 4ID4A 2NUPC 3ZCZA 1FR1A 4OPZA 3JYIA 4HESA 5CEDA 4DDYA 3IHAA 4KZ3A 1ERMA 3NC8A 4UA6A 4IBXA 4KQQA 3A3IA 3SH8A 1UWNX 4OP5A 1CJFA 3MFDA 5L07A 3OOVA 4GKUA 2O99A 3BECA 4EBNA 3BRMA 4N9LA 3C2WA 5FEGA 1NYMA 3LR5A 5IU1A 1S66L 3IXHA 3VP1A 3CITA 1BULA 2Y2NA 3HLFA 2QYBA 4IUKA 2PR5A 1G5UA 2VGKA 1GCEA 5L09A 2XRNA 2HGVA 1XJ4A 2A24B 1OT6A 2WUQA 1HLUP 4ARZB 3W4OA 1EROA 4R3AA 2Z2LB 2W3GA 2VGLS 4L9GA 5GHXA 2VLGA 2JKTI 1I2SA 3FV7A 4OQHA 2HDRA 3CWFA 3IWQA 4XT2A 3EWKA 3MZFA 1H8MA 2Y2IA 3DTEA 3VOLA 1RP5A 4Q0JA 3FG8A 4YOFA 5E2GA 4EERA 5J7EA 4GHIA 1OJ5A 1OMEA 5CECA 2WKIA 1YM1A 3T4QA 1D06A 1YPRA 2PBDP 5CTMA 1AXBA 3N8SA 5F82A 2H28A 2V8FA 2WGWB 3CMZA 1TDLA 3IH9A 4I3IA 4KZ7A 3HLEA 3N7WA 3GMWA 5A8BA 1ODVA 4HH3A 1YLPA 5FEFA 4JGQA 5F69A 1SZVA 4QJGA 4LRYC 5F68A 3MFXA 1FCOA 3ZG8B 5FQQA 3ZYTA 4WZ4A 5L10A 3P98A 2VA0A 3OCLA 3VOZA 3M2JA 1L0DA 3BFDA 4BD0A 1OTDA 3OZHA 3DAVA 1EI5A 1OT9A 4MN6A 1T1AA 3GRJA 4PM8A 5EVLA 1KGEA 4OOLA 2FH5A 4HHDA 1VM1A 3B33A 2PR6A 2ZL1B
chains in the Genus database with same CATH topology
2J3TC 4NEED 5HD5A 4JGRA 2PD7A 1OTIA 3IS2B 5DFYA 4UQIS 4Y2FA 1D7EA 3CLOA 3EGDC 4EUVA 3MJQA 4KQOA 3EQVA 5K5BA 4FOFA 3EEHA 1JNUA 5KIZA 3B42A 4BBVA 4DN0A 3VE3A 3LIEA 2WKQA 1YKDA 1XJ6A 1DP6A 1DP8A 1LSXA 3TE8A 2FZ0A 3EOIA 4HQAA 2Y79A 2P04A 2BASA 2V1AA 3ULFA 2XSSA 4HH2A 4WEJA 4O8GA 2B18A 1LT0A 4NXEA 5IT5A 2KX6A 2W3EA 1LSVA 2P7JA 4H6JB 4R70A 1T1BA 5DJTA 4HJ3A 2ZOHA 4WN5A 3O5YA 4DMZA 2KLIA 2QJ7A 1MZUA 5HWTA 3KSHA 3IS2A 4UEYA 1YSPA 2PYRA 1GSWA 2A2LA 1GSXA 3FC7A 5AVEA 4Q0HA 3PBSA 5DF9A 3C38A 3FPVA 4Q0IA 1DP9A 1YAXA 4R38A 5LBRA 2GZAA 1NLYA 1S4RA 2O9AA 4ETXA 3CAXA 2ZMFA 2GNXA 5L8MA 2VEAA 3PXPA 1BYWA 4AFIA 4BBUA 3LI9A 3P7NA 2MJ6A 3F1NB 4HNBA 3MXQA 3UB9A 4KUKA 2A24A 1WA9A 5J3WA 4EU0A 5DJUA 5HDCA 1S4SA 3F1PB 2YKHA 3F1OB 4B9OA 2WKRA 3KX0X 4HP9A 1OJGA 1T1CA 2PDRA 4H6JA 3RTYA 4GS9A 4MDZA 3KSGA 1IFQA 4O0PA 3T4OA 2M7VA 3PBOA 3NHQA 3OCNA 2GJ3A 1N9LA 2QWSA 3LFVA 2VV7A 4GLQA 1GSVA 2B02A 2J80A 4MN7A 2V0WA 4WELA 2O0YA 3E4PA 2NUTC 2VZWA 1XJ3A 3PBRA 4MMNA 4MCWA 1T18A 2XA7M 1T19A 2L0WA 2W3HA 5HD3A 1S1ZA 3S7NA 4ME4A 3S7QA 2KDKA 2YKFA 3JVVA 3IBJA 4G3WA 3H9WA 4PKYA 3A0SA 4PKYG 1OTBA 3VE4A 3ICYA 3BQAA 3KYZA 3LICA 1N9OA 4Y3IA 3F1OA 4I3AA 4IUHA 3T4KA 3E98A 3KSFA 4HI4A 2OWJA 3H7WB 5G4ZA 3R7WB 1TD5A 3B47A 5F6AA 4P6ZS 2O9BA 3DBAA 4MN5A 2LB9A 4WUJA 2J3TD 1DRMA 2W27A 3GDIA 3OLOA 1S67L 2QJ5A 2HV1A 2QHKA 3LIAA 5I5LA 1F5MA 1P97A 2OAP1 3LR3A 3RH8B 4NXGA 1IOUA 3KYQA 4JGOA 5IS1A 4BWIA 4I39A 1N9NA 4BMWA 4BJPA 3PBNA 3HJKA 5HPIA 3MMHA 4IJGA 3T4TA 4EXOA 2D01A 2PHYA 4WF0A 3MR0A 2ZBBA 4GHIB 2J3WA 3PHYA 4BBTA 3CI6A 1F98A 2W1TA 1V9YA 5FL3A 4RQ9A 2VKSA 3BW6A 3C30A 3FPWA 2VV8A 3IBRA 2HJEA 3R4KA 4HY8A 1XFNA 4B93A 1EW0A 3H7WA 3R7WA 1VHMA 2V1BA 3K3CA 4NXBA 4O01A 2PYPA 2PD8A 2W0NA 3UE6A 4M4XA 2D02A 3LIFA 2Z6CA 3PBQA 2K2NA 2OOLA 1UWPX 3JVUA 3PBTA 1ZTUA 2DMWA 3BQ8A 1TF1A 3VV4A 3SW1A 4HIAA 2QKPA 4LRZE 3NOTC 2VV6A 4NXFA 3U2AA 5HSQA 4UQIM 2O9CA 4R6LA 3HJIA 2W1RA 2L4RA 5DFXA 3RFBA 2M1CA 4L9FA 3CUEA 3EEAA 2WKPA 3GECA 3MQOA 4Y5FA 3K3DA 1LSWA 4PHTA 3V67A 2GX5A 4CLCD 5HZHA 1UGUA 4I5SA 3BWLA 3H82B 3CUEC 2OAQ1 3LR4A 4II7A 3LR0A 1OTAA 1S1YA 3D72A 5HWVA 5AVFA 4EEPA 2VGLM 3E0YA 3ZQ5A 4EW7A 3D3OA 3MQQA 3W2ZA 1F9IA 5HL6A 3TJZC 4K08A 5C5KA 1XFQA 2I9VA 4CLCE 3F1NA 4EESA 5J4EA 1W63M 1MC0A 2NUPC 3T4LA 1P9WA 1TS6A 3PR6A 2JHEA 3F1PA 4I38A 2L1MA 2Y8HA 2HF6A 2VJWA 4E04A 4ZRRA 2EWVA 4WLAA 1NRJA 4EQ1A 3UMDA 3H82A 3NJAA 4HOIA 1UWNX 4G3VA 4LLOB 2P08A 4EETB 2INWA 3A0RA 2EA9A 3EQUA 3P01A 5HDDA 3HCYA 1V9ZA 3LIDA 4WL9A 3OOVA 1STZA 2O99A 4EEUA 4CQHA 2XROA 1NWZA 3C2WA 3LYXA 1LL8A 4XT2B 1OPXA 3MQ0A 3LR5A 1ZHHB 3BY9A 3MF0A 4KQDA 4L0LA 1P0ZA 5IU1A 4GW9A 1S66L 1TS0A 2KOIA 4DJ3A 2PT7A 2ZOIA 3S7OA 5KSHA 3CITA 4HJ6A 1KOUA 3UB7A 3UMEA 3G6OA 4IHQA 1OTEA 2QYBA 4L9EA 4IUKA 3UE3A 4CLCB 2K31A 2PR5A 3PYPA 3S7PA 3LIBA 2XRNA 2HGVA 5HDSA 1W63Q 4G3KA 5CX7A 1XJ4A 2A24B 3T4JA 1OT6A 2V9AA 4KUOA 4ARZB 4JGPA 3C8CA 4R3AA 2G7UA 4Z1WA 2W3GA 1NLZA 2HJ9C 5F5YA 2EWWA 2VGLS 3KO6A 4L9GA 5MC7A 2VLGA 2JKTI 2XA7S 4FSFA 4I3JA 2JKRI 4GS9B 2R78A 5TBMB 3TW8A 3CWFA 4XT2A 3EWKA 4P6ZM 2V0UA 1H8MA 2ZMVA 3VOLA 4WEKA 4Q0JA 2W3DA 3A0VA 3FG8A 1G28A 4YOFA 4EERA 1Y28A 5J7EA 5G4YA 4GHIA 1OJ5A 3K2NA 2LB5A 5HWWA 1P9RA 4GJ4A 4QPRA 3T4QA 3T4SA 1D06A 3EGXC 3UB6A 4CLCA 4LRXC 3BY8A 2H28A 4YWZA 3E4OA 2K7SA 1VB6A 3KSIA 3NOUC 4I3IA 2JN7A 5EFWA 2M7UA 4ARZA 4F3LB 5A8BA 1ODVA 2OWHA 4HH3A 4CLCC 4OOMA 1MKMA 4JGQA 3LUQA 5F69A 1X0OA 4HJ4A 2VX8A 1G6OA 4LRYC 5F68A 3MFXA 2IA2A 1YSQA 5TBMA 3ZYTA 5TJJA 3BJNA 5DKLA 3UB8A 2VA0A 3E4QA 5HPFA 4YNRA 3T50A 3OCLA 4PAUA 3TRCA 1TS8A 1H3QA 1XJ2A 3OC2A 1OTDA 2Z6DA 3OBFA 1OT9A 3NOPC 4MN6A 3LI8A 4DJ2A 1T1AA 2JKTM 4GCZA 4LPZA 5AJGA 2JKRM 4HP4A 4OOLA 4ETZA 2W3FA 2FH5A 4F3LA 4HHDA 2W1TB 2CMNA 3B33A 2PR6A 4NKPA 5DKKA 1TS7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HD5 A;  4JGR A;  2PD7 A;  1OTI A;  3IS2 B;  1D7E A;  3CLO A;  3MJQ A;  3EEH A;  1JNU A;  5KIZ A;  4BBV A;  3VE3 A;  3LIE A;  2WKQ A;  1XJ6 A;  1DP6 A;  1DP8 A;  1LSX A;  4HQA A;  2BAS A;  2V1A A;  3ULF A;  4HH2 A;  1LT0 A;  4NXE A;  2KX6 A;  1LSV A;  2P7J A;  4H6J B;  4R70 A;  1T1B A;  5DJT A;  4HJ3 A;  2ZOH A;  4WN5 A;  2QJ7 A;  1MZU A;  5HWT A;  3IS2 A;  2PYR A;  1GSW A;  1GSX A;  3FC7 A;  5AVE A;  1DP9 A;  4R38 A;  1S4R A;  3CAX A;  2VEA A;  1BYW A;  4BBU A;  3LI9 A;  3P7N A;  3F1N B;  4HNB A;  3MXQ A;  3UB9 A;  4KUK A;  2A24 A;  1WA9 A;  5J3W A;  5DJU A;  5HDC A;  1S4S A;  3F1P B;  2YKH A;  3F1O B;  4B9O A;  2WKR A;  3KX0 X;  4HP9 A;  1OJG A;  1T1C A;  2PDR A;  4H6J A;  3RTY A;  4GS9 A;  3NHQ A;  2GJ3 A;  1N9L A;  2QWS A;  2VV7 A;  1GSV A;  2B02 A;  2J80 A;  2V0W A;  3E4P A;  1XJ3 A;  1T18 A;  1T19 A;  2L0W A;  5HD3 A;  1S1Z A;  2KDK A;  2YKF A;  3H9W A;  4PKY A;  3A0S A;  4PKY G;  1OTB A;  3VE4 A;  3ICY A;  3LIC A;  1N9O A;  3F1O A;  4I3A A;  4HI4 A;  2OWJ A;  3H7W B;  5G4Z A;  5F6A A;  4MN5 A;  4WUJ A;  1DRM A;  2W27 A;  3GDI A;  3OLO A;  1S67 L;  2QJ5 A;  2HV1 A;  2QHK A;  3LIA A;  5I5L A;  1P97 A;  3RH8 B;  4NXG A;  4JGO A;  5IS1 A;  4I39 A;  1N9N A;  3HJK A;  4EXO A;  2D01 A;  2PHY A;  4WF0 A;  3MR0 A;  2ZBB A;  4GHI B;  3PHY A;  4BBT A;  1F98 A;  1V9Y A;  4RQ9 A;  3IBR A;  4HY8 A;  2VV8 A;  1XFN A;  1EW0 A;  3H7W A;  2V1B A;  3K3C A;  4NXB A;  2PYP A;  2PD8 A;  2W0N A;  3UE6 A;  4M4X A;  2D02 A;  3LIF A;  2Z6C A;  2OOL A;  1UWP X;  3SW1 A;  4HIA A;  2QKP A;  4LRZ E;  3NOT C;  2VV6 A;  4NXF A;  5HSQ A;  4R6L A;  3HJI A;  2L4R A;  2M1C A;  4L9F A;  2WKP A;  3GEC A;  3MQO A;  3K3D A;  1LSW A;  5HZH A;  1UGU A;  4I5S A;  3BWL A;  3H82 B;  1OTA A;  1S1Y A;  3D72 A;  5HWV A;  5AVF A;  4EEP A;  3ZQ5 A;  4EW7 A;  3MQQ A;  1F9I A;  4K08 A;  1XFQ A;  2I9V A;  3F1N A;  4EES A;  5J4E A;  1TS6 A;  2JHE A;  3F1P A;  4I38 A;  2L1M A;  4E04 A;  4WLA A;  4EQ1 A;  3UMD A;  3H82 A;  3NJA A;  4HOI A;  1UWN X;  4LLO B;  4EET B;  2INW A;  3A0R A;  2EA9 A;  5HDD A;  1V9Z A;  3LID A;  4WL9 A;  4EEU A;  1NWZ A;  3C2W A;  3LYX A;  1LL8 A;  4XT2 B;  5IU1 A;  4KQD A;  3BY9 A;  1P0Z A;  4GW9 A;  1S66 L;  1TS0 A;  4DJ3 A;  2ZOI A;  4HJ6 A;  1KOU A;  3UB7 A;  3UME A;  3G6O A;  1OTE A;  4L9E A;  2PR5 A;  3PYP A;  3LIB A;  5HDS A;  1XJ4 A;  2A24 B;  1OT6 A;  2V9A A;  4KUO A;  4JGP A;  3C8C A;  4R3A A;  5F5Y A;  4L9G A;  2VLG A;  4I3J A;  4GS9 B;  2R78 A;  5TBM B;  3CWF A;  4XT2 A;  3EWK A;  2V0U A;  3VOL A;  3A0V A;  3FG8 A;  1G28 A;  4EER A;  1Y28 A;  5J7E A;  5G4Y A;  4GHI A;  1OJ5 A;  5HWW A;  1D06 A;  3UB6 A;  4LRX C;  3BY8 A;  2H28 A;  4YWZ A;  3E4O A;  2K7S A;  1VB6 A;  3NOU C;  4I3I A;  4F3L B;  2JN7 A;  5EFW A;  5A8B A;  1ODV A;  2OWH A;  4HH3 A;  4JGQ A;  3LUQ A;  5F69 A;  1X0O A;  4HJ4 A;  4LRY C;  5F68 A;  3MFX A;  5TBM A;  5DKL A;  3UB8 A;  3E4Q A;  3T50 A;  1TS8 A;  1XJ2 A;  1OTD A;  2Z6D A;  1OT9 A;  3NOP C;  4MN6 A;  3LI8 A;  4DJ2 A;  1T1A A;  4GCZ A;  4LPZ A;  4HP4 A;  4F3L A;  4HHD A;  2CMN A;  3B33 A;  2PR6 A;  5DKK A;  1TS7 A; 
#chains in the Genus database with same CATH topology
 1PIO A;  4RX3 A;  1GHI A;  2J9P A;  1FSW A;  2PRF A;  1PWG A;  5CER A;  3MJQ A;  4KQO A;  3EQV A;  5K5B A;  1KDS A;  1CI8 A;  4DN0 A;  1MWT A;  5I94 A;  4D2O A;  4B4X A;  3NI9 A;  1XJ6 A;  4FTX A;  4MBK A;  3EOI A;  2XLN A;  2P04 A;  3ZGA B;  3IX3 A;  2XSS A;  1S0W A;  2VK3 A;  1LT0 A;  1CI9 A;  1HD8 A;  2W3E A;  4PM9 A;  1T1B A;  4HJ3 A;  4GDN A;  4C6Y A;  2Q9N A;  3QP5 A;  2XFS A;  1J3W A;  4B4Z A;  2KLI A;  5HWT A;  3KSH A;  1YSP A;  2PYR A;  5AVE A;  4Q0H A;  3PBS A;  1PFL A;  2GZA A;  3C7U A;  1IKI A;  1BLS A;  2ZC3 B;  5FI6 A;  4N92 A;  3S4X A;  3HLD A;  3BFE A;  4X56 A;  5HL1 A;  4AFI A;  3NEC A;  4BBU A;  5M19 A;  2ZLY A;  3O88 A;  4KUK A;  2XR0 A;  4EU0 A;  5EM1 A;  1MPL A;  5DJU A;  5HDC A;  3F1P B;  5EM0 A;  5HFO A;  1JVJ A;  1NXY A;  4B9O A;  2WAD A;  4S2K A;  4CPK A;  4H6J A;  3RTY A;  3PAG A;  4MDZ A;  1NZO A;  3KSG A;  4O0P A;  5GLC A;  4E3J A;  2M7V A;  1EWZ A;  1HZO A;  3ZNT A;  3NHQ A;  1KDW A;  2ZQ7 A;  3LEQ A;  1N9L A;  2QWS A;  1GSV A;  2V0W A;  4WEL A;  1BLP A;  3T1X A;  4MMN A;  3PBR A;  5G18 A;  1T18 A;  2ZC7 A;  1Y54 A;  4LV0 A;  1DY6 A;  4YFM A;  4ME4 A;  2KDK A;  4OQI A;  4U0T A;  2YKF A;  4RYE A;  1ES2 A;  4PKY A;  2WKE A;  3N8L A;  3ITB A;  3ICY A;  4IBR A;  2DNS A;  3F1O A;  1Q2Q A;  3IX4 A;  4IUH A;  3T4K A;  4E3L A;  5CHJ A;  3KSF A;  4HI4 A;  4X25 A;  5G4Z A;  5F6A A;  5AQB A;  3QNB A;  5KMW A;  4R3J A;  2ZC4 B;  2QHK A;  3LIA A;  1F5M A;  1PW1 A;  4U3T A;  4XUZ A;  5EV0 A;  3LR3 A;  3UPO A;  3KYQ A;  2HDQ A;  5IS1 A;  4I39 A;  2G2W A;  4BMW A;  1ESI A;  5AQ7 A;  1O07 A;  4X69 A;  4EXO A;  3LCE A;  4BBT A;  5EVI D;  3ZDJ A;  3VOY A;  5GLB A;  2H0T A;  2W1T A;  1FIL A;  4RQ9 A;  2VKS A;  1ERQ A;  3FPW A;  4B93 A;  4FD8 A;  1C3B A;  1EW0 A;  1K54 A;  4JF5 A;  4O01 A;  2XD5 A;  4P6B A;  4S2P A;  2W0N A;  3U4L P;  3S1Y A;  1MBL A;  3JVU A;  4UA9 A;  1ZTU A;  2DMW A;  3BQ8 A;  3IF5 A;  2OSU A;  1K54 C;  2CC1 A;  2VV6 A;  3CPT A;  5HSQ A;  3MKF A;  1LI0 A;  3HJI A;  2W1R A;  2L4R A;  5DFX A;  2HP6 A;  1E3U D;  5FA7 A;  4L9F A;  3CUE A;  3GEC A;  3K3D A;  3G2Z A;  5HZH A;  1YMS A;  3BWL A;  3CUE C;  1FSY A;  4A5R A;  2OAQ 1;  3MS6 A;  3LR0 A;  5FQJ A;  1S1Y A;  4QB8 A;  3D72 A;  1MXO A;  3D9Y A;  5AVF A;  4EEP A;  4EV4 A;  5HWV A;  5M18 A;  4KG2 A;  4HEF A;  3QP1 A;  2EX9 A;  1F9I A;  1L0G A;  1IKG A;  1JWV A;  4CLC E;  1WYC A;  3F1N A;  4FCF A;  1FCM A;  1MC0 A;  1P9W A;  1TS6 A;  5A91 A;  4I38 A;  1K6R A;  4QU3 A;  2Y8H A;  2HF6 A;  2VJW A;  4F94 A;  3MXS A;  3HLC A;  3RXW A;  4WLA A;  4WM9 A;  3HL9 A;  4LCL A;  5EPH A;  5CHU A;  4LLO B;  4GD8 A;  1PYY A;  2INW A;  3HUM A;  3HCY A;  4R0Q A;  1V9Z A;  3LID A;  4LV2 A;  5HX9 A;  4CQH A;  1S6R A;  4BLM A;  2H10 A;  4L0L A;  1NJ4 A;  1TS0 A;  5F1G A;  2KOI A;  2PT7 A;  4HJ6 A;  1KOU A;  3UB7 A;  4YIN A;  4L9E A;  2FFF B;  5CEB A;  3UE3 A;  4CLC B;  2K31 A;  4DXB A;  3LIB A;  5HDS A;  1W63 Q;  3T4J A;  4E6W A;  1KVM A;  2J8Y A;  3C8C A;  3HLG A;  4U0X A;  4Z1W A;  1NLZ A;  2HJ9 C;  4IVK A;  1K57 A;  4I3J A;  1N9B A;  4GS9 B;  1A0K A;  5TBM B;  3TW8 A;  2Z2M B;  2ZQC A;  2PBY A;  1K57 C;  1K4E A;  4DE3 A;  2QPN A;  3RXX A;  2W3D A;  3NDE A;  1Y28 A;  3BM6 A;  5G4Y A;  2XDM A;  1HVB A;  3NIA A;  4S2L A;  3UPN A;  3IH8 A;  4FH4 A;  4LRX C;  1YLW A;  3E4O A;  4JF4 A;  4F3L B;  2JN7 A;  2XF3 A;  5EFW A;  4ARZ A;  3T1R A;  1LLB A;  4OOM A;  1G6O A;  1YSQ A;  2I72 A;  3Q7V A;  3UB8 A;  5HPF A;  4QWO A;  3T50 A;  1ZG4 A;  2XGN A;  4R4S A;  3TSG A;  1PI5 A;  1K56 D;  3OC2 A;  2Z6D A;  4ZBE A;  4KZA A;  3LI8 A;  4R3B A;  2Y91 A;  3OPL A;  5KZH A;  5DTK A;  4LPZ A;  1BZA A;  1G6A A;  2JKR M;  1PI4 A;  2UWX A;  2WGW A;  2BG1 A;  2WKH A;  3Q82 A;  2CMN A;  4NKP A;  5DKK A;  1DJA A;  3IF6 A;  3ZHH A;  2PD7 A;  3IS2 B;  4NK3 A;  1ACF A;  1D7E A;  4N1H A;  2AVX A;  3IF6 C;  3V39 A;  4BBV A;  4DE1 A;  5BOH A;  3VE3 A;  4OVD A;  3LIE A;  1K25 A;  1YKD A;  3NY4 A;  2FZ0 A;  3LGO A;  2V1A A;  3ULF A;  1W79 A;  4KQR A;  5E43 A;  4WMC A;  1DJC A;  4O8G A;  2B18 A;  1KE3 A;  3A3D A;  1VQQ A;  2Y2H A;  1W8Q A;  4GZB A;  5FAT A;  2ZM2 A;  3AGE A;  1H8Z A;  3WS1 A;  2ZOH A;  4H8R A;  2FFY A;  2BLS A;  2B95 A;  3O5Y A;  1MZU A;  3DTM A;  4UEY A;  2A49 A;  1GSW A;  1ZKJ A;  1GSX A;  4NET A;  1DP9 A;  1KE0 A;  3A3E A;  5JYP A;  4R38 A;  1NLY A;  2O9A A;  4X1M A;  5TR7 A;  4RA7 A;  1K4F A;  3M6H A;  4ETX A;  3CAX A;  2GNX A;  2VEA A;  4X53 A;  3PXP A;  3UDI A;  3UDX A;  2MJ6 A;  4HNB A;  4JPM A;  3ISG A;  1L0E A;  3MXQ A;  5J3W A;  2XFT A;  2WKR A;  3L7H A;  1XGJ A;  1T1C A;  3T4O A;  1IFQ A;  2A3U A;  1PNE A;  3OCN A;  2VV7 A;  2J80 A;  4MCW A;  5HW3 A;  3VP4 A;  2L0W A;  2W3H A;  5HD3 A;  4R4R A;  3S7N A;  3S7Q A;  2ZM0 A;  5FDS A;  3IBJ A;  2XK1 A;  3IXB A;  2DCF A;  1YLT A;  4G3W A;  3WRZ A;  1XA7 A;  4Z9Q A;  2ZM8 A;  5FAO A;  1GHP A;  3G2Y A;  4Y3I A;  5DTS A;  5FQI A;  4B88 A;  1XP4 A;  3B47 A;  4P6Z S;  3OLO A;  3JPU A;  1S67 L;  5CRF A;  2QJ5 A;  3UE0 A;  3OPH A;  4PMA A;  3RH8 B;  1IYP A;  3GTC A;  4GDB A;  1N9N A;  4JKT A;  4QY5 A;  3SH7 A;  5FI7 A;  1YT4 A;  4WF0 A;  4GHI B;  2J3W A;  4IED A;  2RCX A;  3CI6 A;  4ZJ3 A;  3Q1F A;  4O7D A;  1SDN A;  3LY3 A;  1V9Y A;  1SKO B;  3BW6 A;  3IBR A;  4HY8 A;  3MBZ A;  4EUV A;  2HJE A;  5HAQ A;  3IWI A;  4MNR A;  1VHM A;  2V1B A;  2PYP A;  3O87 A;  4WMC D;  5EOE A;  4M4X A;  3LIF A;  2EFX A;  3UNW A;  3GVB A;  2OOL A;  1UWP X;  2BTF P;  1QME A;  4KZ9 A;  2EFU A;  3SW1 A;  2WK0 A;  4HIA A;  4GN2 A;  3U2A A;  2P9V B;  1RGZ A;  3ITA A;  2O9C A;  2QZ6 A;  1NZU A;  3WS5 A;  2ZQ9 A;  2Y2M A;  4E6X A;  3MKE A;  3QP8 A;  3RFB A;  1M6K A;  4Y5F A;  3VMA A;  4ZDX A;  2HP9 A;  3PTE A;  4PHT A;  3V67 A;  2Y55 A;  1ES4 A;  4OPQ A;  3H82 B;  2HDS A;  4LV1 A;  2WZZ A;  4II7 A;  1FQG A;  1Y4O A;  2XEP A;  1Z6F A;  3BLS A;  3E0Y A;  4EW7 A;  3D3O A;  1BTL A;  3C4O A;  3VSK A;  1ES5 A;  1Q2P A;  3AGD A;  3C5A A;  4K08 A;  5C5K A;  1H0M A;  4S2N A;  3W8K A;  5EVI B;  3T4L A;  2XD1 A;  2Y2P A;  4GB7 A;  1VET A;  1MWR A;  2L1M A;  4BL2 A;  3BFC A;  1FOF A;  4S2N C;  3GR2 A;  4ZRR A;  3GQZ A;  3CZD A;  1LHY A;  3V50 A;  5CGW A;  1YQS A;  4HOI A;  4K0X A;  3DTI A;  2P08 A;  4EET B;  1BUE A;  3A0R A;  3EQU A;  5HDD A;  4WL9 A;  2Y59 A;  1STZ A;  4X6T A;  4EEU A;  2HP5 A;  2XRO A;  3MZD A;  3LYX A;  1OPX A;  1PW8 A;  3MQ0 A;  3W4Q A;  1ZHH B;  3BY9 A;  3MF0 A;  4GW9 A;  3QP2 A;  4DJ3 A;  1IEL A;  2ZOI A;  3S7O A;  5DF7 A;  5KSH A;  1G68 A;  1O7E A;  3G6O A;  2ZJ9 A;  4GOG A;  4IHQ A;  4OON A;  5AQ9 A;  3MXR A;  3PYP A;  4HBT A;  4G3K A;  4QHC A;  4KUO A;  4JGP A;  4PPR A;  3DWK A;  5F5Y A;  2EWW A;  3KO6 A;  5MC7 A;  5IHV A;  5HAR A;  1SDE A;  2XA7 S;  4FSF A;  4E3M A;  2JKR I;  3T12 B;  4X55 A;  5U47 A;  1GA9 A;  2R9W A;  2ZMA A;  5FDH A;  4Y15 A;  4WEK A;  3A0V A;  1G28 A;  3DWZ A;  3K2N A;  1P9R A;  4GJ4 A;  4QPR A;  3E2L A;  3T4S A;  4OLG A;  3EGX C;  4S2M A;  4CLC A;  4KZ8 A;  4S2O A;  1K55 A;  1VB6 A;  1VEU A;  4OP8 A;  3G34 A;  3G32 A;  1J9M A;  3HUO A;  2OWH A;  4CLC C;  1BT5 A;  1K6S A;  2V20 A;  1MKM A;  2GDN A;  2WGI A;  1X0O A;  4HJ4 A;  1K55 C;  2VX8 A;  5FQM A;  5EEC A;  1E4D A;  2Y2G A;  3HLB A;  2IA2 A;  5TBM A;  5TJJ A;  1W8Y A;  3BJN A;  5DKL A;  3E4Q A;  3GSG A;  1ESU A;  4YNR A;  3N8R A;  3NDG A;  4PAU A;  3IXD A;  1SKF A;  1TS8 A;  4RX2 A;  1H3Q A;  2JCH A;  2QMI A;  4R23 A;  3C7V A;  3ZVW A;  3UN7 A;  3A3J A;  3NOP C;  1L0F A;  1KVL A;  5KSC A;  4GCZ A;  2Y2O A;  3BYD A;  5AJG A;  3ZG0 A;  4HP4 A;  3IQA A;  3D4F A;  1H8Y A;  4F3L A;  1PRQ A;  2W1T B;  1PZP A;  3PAE A;  1LL5 A;  4NEE D;  5HD5 A;  1OTI A;  5DFY A;  1JWP A;  5GL9 A;  4UQI S;  3CLO A;  5EVE A;  1PWC A;  1WYB A;  1JNU A;  3C4P A;  4MEZ A;  2WAF A;  3ZG5 A;  2WKQ A;  3TOI A;  2P74 A;  1DP8 A;  3CPT B;  3TE8 A;  3AGF A;  3DTK A;  4HH2 A;  1TVF A;  4WEJ A;  5E2H A;  2E8J A;  3UY6 A;  4R70 A;  3N4I A;  5J8X A;  4WN5 A;  4BEN A;  2QJ7 A;  1E25 A;  4Y17 A;  3IS2 A;  5EUA A;  3WS2 A;  3FC7 A;  5DF9 A;  3FPV A;  4Q0I A;  1S4R A;  4JXS A;  3WRT A;  2X71 A;  2ZMF A;  4DE0 A;  5L8M A;  3LI9 A;  3P7N A;  4EBP A;  3F1N B;  3A3F A;  2A24 A;  4JXG A;  2YKH A;  3NUL A;  4JLF A;  2Y4A A;  3Q7Z A;  4OPY A;  1OJG A;  2PDR A;  3HLW A;  4PM7 A;  3UDF A;  3PBO A;  3LFV A;  2B02 A;  4MN7 A;  1XJ3 A;  2VZW A;  1LL9 A;  2EX2 A;  1T19 A;  3FKW A;  2EXB A;  1S1Z A;  1MWU A;  1CF0 A;  5EOO A;  1W7F A;  4ZTK A;  1M40 A;  3H9W A;  3A0S A;  2IWC A;  1OTB A;  3G31 A;  3VE4 A;  1IEM A;  3BQA A;  4EQI A;  3KYZ A;  1YLZ A;  4Y0T A;  3LIC A;  1N9O A;  2H5S A;  1HTZ A;  3H7W B;  1FCN A;  3R7W B;  4DF6 A;  5DTT A;  1IYS A;  2O9B A;  4MN5 A;  2LB9 A;  1DRM A;  3UO9 A;  3VP2 A;  2WAE A;  2HV1 A;  5FQ9 A;  3LO7 A;  1P97 A;  2OAP 1;  1I2W A;  4JGO A;  4BWI A;  5HPI A;  3MMH A;  1BSG A;  5FAS A;  4KG6 A;  3LEZ A;  3T4T A;  2D01 A;  1RCJ A;  2ACG A;  3PHY A;  3OPP A;  1F98 A;  4RVA A;  1YLJ A;  4LV3 A;  5FL3 A;  3G30 A;  3C30 A;  5GLD A;  3R4K A;  1ALQ A;  1XFN A;  4P87 A;  2ZL1 A;  4UAA A;  2Y2K A;  3BLM A;  2Q9M A;  3DW0 A;  4PM6 A;  3BEB A;  3K3C A;  1ZC2 A;  2D02 A;  3PBQ A;  4OQG A;  2K2N A;  3M6B A;  1XX2 A;  3SS4 A;  2IWD A;  4EWF A;  3VV4 A;  2QKP A;  3Q7V B;  3QHY A;  3NOT C;  1NYY A;  1ZG6 A;  4R6L A;  3NCK A;  2E8I A;  3V3R A;  4GNU A;  2WKP A;  4CJN A;  3TG9 A;  1LSW A;  3CG5 A;  4E3I A;  1BLH A;  1SKO A;  2PU2 A;  3FKV A;  1I5Q A;  5TFQ A;  3FWL A;  2JKF A;  2H0Y A;  4OLD A;  4S2I A;  2VGL M;  1MY8 A;  3ZQ5 A;  3SS5 A;  3BFG A;  3M2K A;  3IF6 B;  3FZC A;  3W2Z A;  5HL6 A;  4K0W A;  1XFQ A;  2DRW A;  1SHV A;  1YMX A;  2P9V A;  4MBH A;  4EES A;  3UE1 A;  3SS3 A;  1W63 M;  4C3Q A;  3E2K A;  5E2E A;  3PR6 A;  2JHE A;  3F1P A;  4E3O A;  2JC7 A;  4NG2 A;  1PWD A;  4E04 A;  3O3V A;  4KZ4 A;  2EWV A;  4BL3 A;  2J7V A;  3NBL A;  1NRJ A;  2ZQA A;  4EQ1 A;  2B5R A;  3UMD A;  3H82 A;  3NJA A;  1ES3 A;  4KZ5 A;  4BD1 A;  4G3V A;  4EBL A;  3IXG A;  3QP4 A;  2EA9 A;  3P01 A;  4S2J A;  2C5W B;  3RJU A;  2JKG A;  1NWZ A;  1PZO A;  1LL8 A;  4XT2 B;  1MWS A;  4KQD A;  1P0Z A;  4XXR A;  5A92 A;  3IHB A;  1XXM A;  1KGF A;  1JTD A;  1K0K A;  3T1S A;  3UME A;  5E2F A;  3OPR A;  5EVI A;  3SOI A;  1JTG A;  4DRT A;  1OTE A;  1XPB A;  3WS0 A;  2HPB A;  1Z09 A;  5F83 A;  5A93 A;  3S7P A;  3P09 A;  3HRE A;  5CX7 A;  5EVI C;  4Y7P A;  4K91 A;  2V9A A;  2G7U A;  5CGS A;  2V8C A;  1XGI A;  5F1F A;  1W5D A;  1H5X A;  2R78 A;  4P85 A;  1LI9 A;  5FAP A;  2EXA A;  4P6Z M;  2V0U A;  3V3S A;  4JXV A;  4R1G A;  2ZMV A;  2EX6 A;  4JXW A;  3WWX A;  1E3U A;  2LB5 A;  5HWW A;  5AQA A;  5GHY A;  4OPR A;  4OQ0 A;  3UB6 A;  3BY8 A;  4OH0 A;  4YWZ A;  3VSL A;  2K7S A;  1CEF A;  4P0M A;  3KSI A;  3NOU C;  2M7U A;  3I7J A;  1K38 A;  1DJB A;  3N6I A;  2ZD8 A;  3LUQ A;  4N9K A;  5L2F A;  3HVF A;  4LCM A;  3GV9 A;  3TRC A;  1XJ2 A;  1IYO A;  2V2F F;  2OLV A;  4UHU A;  5TGF A;  1KE4 A;  3OBF A;  3HUN A;  2X02 A;  2J9O A;  1SCW A;  3S22 A;  4DJ2 A;  2JKT M;  3G4P A;  2R9X A;  5M1A A;  5CHM A;  1GA0 A;  4ETZ A;  2W3F A;  3L9K A;  4WBG A;  3MZE A;  1F2K A;  1AWI A;  1TS7 A;  2J3T C;  1KGG A;  4JGR A;  4KEN B;  4HBU A;  3O86 A;  3QNC A;  4Y2F A;  2VGJ A;  3EGD C;  4M3K A;  1TDG A;  2ZC6 B;  4FOF A;  3EEH A;  3Q07 A;  5KIZ A;  1L2S A;  3B42 A;  4MLL A;  4Y13 A;  1NRF A;  1TEM A;  2UV0 E;  3CHW P;  4E3N A;  1ONG A;  1DP6 A;  1LSX A;  5GHZ A;  4GD6 A;  4HQA A;  3VFF A;  1XKZ A;  2Y79 A;  2BAS A;  4XUX A;  5JYO A;  3G35 A;  1CK3 A;  4NXE A;  5IT5 A;  2KX6 A;  1LSV A;  2P7J A;  4H6J B;  4LFU A;  5DJT A;  2X01 A;  2HZ5 A;  4IVI A;  2ZC5 B;  4DMZ A;  4QY6 A;  2A2L A;  3C38 A;  1IYQ A;  1YAX A;  1ONH A;  5LBR A;  1RGY A;  3UB5 P;  3VP3 A;  5FI2 A;  4MBF A;  1BYW A;  1QMF A;  1FR6 A;  3ZNY A;  3UB9 A;  1WA9 A;  5A90 A;  4EUZ A;  3IX8 A;  4ESP A;  1VET B;  1S4S A;  4D60 A;  3F1O B;  2V1Z A;  4FUW A;  2PU4 A;  3KX0 X;  4HP9 A;  4JF6 A;  2WYX A;  4GS9 A;  3T1Q B;  1D1J A;  2GJ3 A;  4GLQ A;  3VP0 A;  4DXC A;  2O0Y A;  3E4P A;  1N4O A;  2NUT C;  1K56 A;  1CEG A;  4KZ6 A;  2XA7 M;  5FSR A;  2XH9 A;  4QD4 A;  3JVV A;  2Y2L A;  1MKI A;  2ZQ8 A;  3Q81 A;  4Q8I A;  4PKY G;  2IWB A;  1L3L A;  4LEN A;  3SH9 A;  4I3A A;  3UPP A;  5FQK A;  3QP6 A;  3E98 A;  2OWJ A;  2ZQD A;  1TD5 A;  2Y2Q A;  5FAQ A;  2OLU A;  3DBA A;  3IT9 A;  4WUJ A;  3ZG9 B;  2J3T D;  2W27 A;  3GDI A;  4OOY A;  5I5L A;  1GHM A;  5GLA A;  3FYZ A;  2G2U A;  4NXG A;  1IOU A;  3MSH A;  2Y2J A;  3VFH A;  4OKP A;  4BJP A;  3PBN A;  3HJK A;  2C6W B;  4PM5 A;  4IJG A;  3LY4 A;  2PHY A;  3V5M A;  2JE5 A;  3MR0 A;  2ZBB A;  3BFF A;  3IWO A;  1YLY A;  2PAV P;  3KYE A;  4KG5 A;  3ZVT A;  2VV8 A;  2WZX A;  2HDU A;  3H7W A;  3R7W A;  3WS4 A;  4UA7 A;  1U60 A;  1VEU B;  4NXB A;  1XA1 A;  2WGV A;  2PD8 A;  1WE4 A;  3UE6 A;  4DE2 A;  2Z6C A;  4N1X A;  3ZFZ A;  2OV5 A;  3PBT A;  5DVA A;  1TF1 A;  3CJM A;  4LGW A;  4JBF A;  4Y0O A;  4KZB A;  4LRZ E;  1JWZ A;  4NXF A;  4ZAM A;  4UQI M;  4WZ5 A;  2JBF A;  2XQZ A;  2M1C A;  1BLC A;  3EEA A;  3MQO A;  2RL3 A;  4E3K A;  1CQA A;  3HBR A;  4WZ5 C;  2GX5 A;  4CLC D;  5EE8 A;  1UGU A;  5CTN A;  4I5S A;  4BQM A;  2Q0O A;  5DF8 A;  3LR4 A;  4ZJ2 A;  4Y0U A;  4X68 A;  3W4P A;  1OTA A;  3B3X A;  4X1L A;  5HAP A;  3MQQ A;  5HAI A;  4ZJ1 A;  2EX8 A;  4FH2 A;  3TJZ C;  4WYY A;  3SZT A;  4DKI A;  4DDS A;  1FIK A;  2I9V A;  5CGX A;  4C75 A;  3ZG7 B;  5CXW A;  5J4E A;  5D3O A;  1NY0 A;  4ID4 A;  2NUP C;  3ZCZ A;  1FR1 A;  4OPZ A;  3JYI A;  4HES A;  5CED A;  4DDY A;  3IHA A;  4KZ3 A;  1ERM A;  3NC8 A;  4UA6 A;  4IBX A;  4KQQ A;  3A3I A;  3SH8 A;  1UWN X;  4OP5 A;  1CJF A;  3MFD A;  5L07 A;  3OOV A;  4GKU A;  2O99 A;  3BEC A;  4EBN A;  3BRM A;  4N9L A;  3C2W A;  5FEG A;  1NYM A;  3LR5 A;  5IU1 A;  1S66 L;  3IXH A;  3VP1 A;  3CIT A;  1BUL A;  2Y2N A;  3HLF A;  2QYB A;  4IUK A;  2PR5 A;  1G5U A;  2VGK A;  1GCE A;  5L09 A;  2XRN A;  2HGV A;  1XJ4 A;  2A24 B;  1OT6 A;  2WUQ A;  1HLU P;  4ARZ B;  3W4O A;  1ERO A;  4R3A A;  2Z2L B;  2W3G A;  2VGL S;  4L9G A;  5GHX A;  2VLG A;  2JKT I;  1I2S A;  3FV7 A;  4OQH A;  2HDR A;  3CWF A;  3IWQ A;  4XT2 A;  3EWK A;  3MZF A;  1H8M A;  2Y2I A;  3DTE A;  3VOL A;  1RP5 A;  4Q0J A;  3FG8 A;  4YOF A;  5E2G A;  4EER A;  5J7E A;  4GHI A;  1OJ5 A;  1OME A;  5CEC A;  2WKI A;  1YM1 A;  3T4Q A;  1D06 A;  1YPR A;  2PBD P;  5CTM A;  1AXB A;  3N8S A;  5F82 A;  2H28 A;  2V8F A;  2WGW B;  3CMZ A;  1TDL A;  3IH9 A;  4I3I A;  4KZ7 A;  3HLE A;  3N7W A;  3GMW A;  5A8B A;  1ODV A;  4HH3 A;  1YLP A;  5FEF A;  4JGQ A;  5F69 A;  1SZV A;  4QJG A;  4LRY C;  5F68 A;  3MFX A;  1FCO A;  3ZG8 B;  5FQQ A;  3ZYT A;  4WZ4 A;  5L10 A;  3P98 A;  2VA0 A;  3OCL A;  3VOZ A;  3M2J A;  1L0D A;  3BFD A;  4BD0 A;  1OTD A;  3OZH A;  3DAV A;  1EI5 A;  1OT9 A;  4MN6 A;  1T1A A;  3GRJ A;  4PM8 A;  5EVL A;  1KGE A;  4OOL A;  2FH5 A;  4HHD A;  1VM1 A;  3B33 A;  2PR6 A;  2ZL1 B; 
#chains in the Genus database with same CATH homology
 2J3T C;  4NEE D;  5HD5 A;  4JGR A;  2PD7 A;  1OTI A;  3IS2 B;  5DFY A;  4UQI S;  4Y2F A;  1D7E A;  3CLO A;  3EGD C;  4EUV A;  3MJQ A;  4KQO A;  3EQV A;  5K5B A;  4FOF A;  3EEH A;  1JNU A;  5KIZ A;  3B42 A;  4BBV A;  4DN0 A;  3VE3 A;  3LIE A;  2WKQ A;  1YKD A;  1XJ6 A;  1DP6 A;  1DP8 A;  1LSX A;  3TE8 A;  2FZ0 A;  3EOI A;  4HQA A;  2Y79 A;  2P04 A;  2BAS A;  2V1A A;  3ULF A;  2XSS A;  4HH2 A;  4WEJ A;  4O8G A;  2B18 A;  1LT0 A;  4NXE A;  5IT5 A;  2KX6 A;  2W3E A;  1LSV A;  2P7J A;  4H6J B;  4R70 A;  1T1B A;  5DJT A;  4HJ3 A;  2ZOH A;  4WN5 A;  3O5Y A;  4DMZ A;  2KLI A;  2QJ7 A;  1MZU A;  5HWT A;  3KSH A;  3IS2 A;  4UEY A;  1YSP A;  2PYR A;  1GSW A;  2A2L A;  1GSX A;  3FC7 A;  5AVE A;  4Q0H A;  3PBS A;  5DF9 A;  3C38 A;  3FPV A;  4Q0I A;  1DP9 A;  1YAX A;  4R38 A;  5LBR A;  2GZA A;  1NLY A;  1S4R A;  2O9A A;  4ETX A;  3CAX A;  2ZMF A;  2GNX A;  5L8M A;  2VEA A;  3PXP A;  1BYW A;  4AFI A;  4BBU A;  3LI9 A;  3P7N A;  2MJ6 A;  3F1N B;  4HNB A;  3MXQ A;  3UB9 A;  4KUK A;  2A24 A;  1WA9 A;  5J3W A;  4EU0 A;  5DJU A;  5HDC A;  1S4S A;  3F1P B;  2YKH A;  3F1O B;  4B9O A;  2WKR A;  3KX0 X;  4HP9 A;  1OJG A;  1T1C A;  2PDR A;  4H6J A;  3RTY A;  4GS9 A;  4MDZ A;  3KSG A;  1IFQ A;  4O0P A;  3T4O A;  2M7V A;  3PBO A;  3NHQ A;  3OCN A;  2GJ3 A;  1N9L A;  2QWS A;  3LFV A;  2VV7 A;  4GLQ A;  1GSV A;  2B02 A;  2J80 A;  4MN7 A;  2V0W A;  4WEL A;  2O0Y A;  3E4P A;  2NUT C;  2VZW A;  1XJ3 A;  3PBR A;  4MMN A;  4MCW A;  1T18 A;  2XA7 M;  1T19 A;  2L0W A;  2W3H A;  5HD3 A;  1S1Z A;  3S7N A;  4ME4 A;  3S7Q A;  2KDK A;  2YKF A;  3JVV A;  3IBJ A;  4G3W A;  3H9W A;  4PKY A;  3A0S A;  4PKY G;  1OTB A;  3VE4 A;  3ICY A;  3BQA A;  3KYZ A;  3LIC A;  1N9O A;  4Y3I A;  3F1O A;  4I3A A;  4IUH A;  3T4K A;  3E98 A;  3KSF A;  4HI4 A;  2OWJ A;  3H7W B;  5G4Z A;  3R7W B;  1TD5 A;  3B47 A;  5F6A A;  4P6Z S;  2O9B A;  3DBA A;  4MN5 A;  2LB9 A;  4WUJ A;  2J3T D;  1DRM A;  2W27 A;  3GDI A;  3OLO A;  1S67 L;  2QJ5 A;  2HV1 A;  2QHK A;  3LIA A;  5I5L A;  1F5M A;  1P97 A;  2OAP 1;  3LR3 A;  3RH8 B;  4NXG A;  1IOU A;  3KYQ A;  4JGO A;  5IS1 A;  4BWI A;  4I39 A;  1N9N A;  4BMW A;  4BJP A;  3PBN A;  3HJK A;  5HPI A;  3MMH A;  4IJG A;  3T4T A;  4EXO A;  2D01 A;  2PHY A;  4WF0 A;  3MR0 A;  2ZBB A;  4GHI B;  2J3W A;  3PHY A;  4BBT A;  3CI6 A;  1F98 A;  2W1T A;  1V9Y A;  5FL3 A;  4RQ9 A;  2VKS A;  3BW6 A;  3C30 A;  3FPW A;  2VV8 A;  3IBR A;  2HJE A;  3R4K A;  4HY8 A;  1XFN A;  4B93 A;  1EW0 A;  3H7W A;  3R7W A;  1VHM A;  2V1B A;  3K3C A;  4NXB A;  4O01 A;  2PYP A;  2PD8 A;  2W0N A;  3UE6 A;  4M4X A;  2D02 A;  3LIF A;  2Z6C A;  3PBQ A;  2K2N A;  2OOL A;  1UWP X;  3JVU A;  3PBT A;  1ZTU A;  2DMW A;  3BQ8 A;  1TF1 A;  3VV4 A;  3SW1 A;  4HIA A;  2QKP A;  4LRZ E;  3NOT C;  2VV6 A;  4NXF A;  3U2A A;  5HSQ A;  4UQI M;  2O9C A;  4R6L A;  3HJI A;  2W1R A;  2L4R A;  5DFX A;  3RFB A;  2M1C A;  4L9F A;  3CUE A;  3EEA A;  2WKP A;  3GEC A;  3MQO A;  4Y5F A;  3K3D A;  1LSW A;  4PHT A;  3V67 A;  2GX5 A;  4CLC D;  5HZH A;  1UGU A;  4I5S A;  3BWL A;  3H82 B;  3CUE C;  2OAQ 1;  3LR4 A;  4II7 A;  3LR0 A;  1OTA A;  1S1Y A;  3D72 A;  5HWV A;  5AVF A;  4EEP A;  2VGL M;  3E0Y A;  3ZQ5 A;  4EW7 A;  3D3O A;  3MQQ A;  3W2Z A;  1F9I A;  5HL6 A;  3TJZ C;  4K08 A;  5C5K A;  1XFQ A;  2I9V A;  4CLC E;  3F1N A;  4EES A;  5J4E A;  1W63 M;  1MC0 A;  2NUP C;  3T4L A;  1P9W A;  1TS6 A;  3PR6 A;  2JHE A;  3F1P A;  4I38 A;  2L1M A;  2Y8H A;  2HF6 A;  2VJW A;  4E04 A;  4ZRR A;  2EWV A;  4WLA A;  1NRJ A;  4EQ1 A;  3UMD A;  3H82 A;  3NJA A;  4HOI A;  1UWN X;  4G3V A;  4LLO B;  2P08 A;  4EET B;  2INW A;  3A0R A;  2EA9 A;  3EQU A;  3P01 A;  5HDD A;  3HCY A;  1V9Z A;  3LID A;  4WL9 A;  3OOV A;  1STZ A;  2O99 A;  4EEU A;  4CQH A;  2XRO A;  1NWZ A;  3C2W A;  3LYX A;  1LL8 A;  4XT2 B;  1OPX A;  3MQ0 A;  3LR5 A;  1ZHH B;  3BY9 A;  3MF0 A;  4KQD A;  4L0L A;  1P0Z A;  5IU1 A;  4GW9 A;  1S66 L;  1TS0 A;  2KOI A;  4DJ3 A;  2PT7 A;  2ZOI A;  3S7O A;  5KSH A;  3CIT A;  4HJ6 A;  1KOU A;  3UB7 A;  3UME A;  3G6O A;  4IHQ A;  1OTE A;  2QYB A;  4L9E A;  4IUK A;  3UE3 A;  4CLC B;  2K31 A;  2PR5 A;  3PYP A;  3S7P A;  3LIB A;  2XRN A;  2HGV A;  5HDS A;  1W63 Q;  4G3K A;  5CX7 A;  1XJ4 A;  2A24 B;  3T4J A;  1OT6 A;  2V9A A;  4KUO A;  4ARZ B;  4JGP A;  3C8C A;  4R3A A;  2G7U A;  4Z1W A;  2W3G A;  1NLZ A;  2HJ9 C;  5F5Y A;  2EWW A;  2VGL S;  3KO6 A;  4L9G A;  5MC7 A;  2VLG A;  2JKT I;  2XA7 S;  4FSF A;  4I3J A;  2JKR I;  4GS9 B;  2R78 A;  5TBM B;  3TW8 A;  3CWF A;  4XT2 A;  3EWK A;  4P6Z M;  2V0U A;  1H8M A;  2ZMV A;  3VOL A;  4WEK A;  4Q0J A;  2W3D A;  3A0V A;  3FG8 A;  1G28 A;  4YOF A;  4EER A;  1Y28 A;  5J7E A;  5G4Y A;  4GHI A;  1OJ5 A;  3K2N A;  2LB5 A;  5HWW A;  1P9R A;  4GJ4 A;  4QPR A;  3T4Q A;  3T4S A;  1D06 A;  3EGX C;  3UB6 A;  4CLC A;  4LRX C;  3BY8 A;  2H28 A;  4YWZ A;  3E4O A;  2K7S A;  1VB6 A;  3KSI A;  3NOU C;  4I3I A;  2JN7 A;  5EFW A;  2M7U A;  4ARZ A;  4F3L B;  5A8B A;  1ODV A;  2OWH A;  4HH3 A;  4CLC C;  4OOM A;  1MKM A;  4JGQ A;  3LUQ A;  5F69 A;  1X0O A;  4HJ4 A;  2VX8 A;  1G6O A;  4LRY C;  5F68 A;  3MFX A;  2IA2 A;  1YSQ A;  5TBM A;  3ZYT A;  5TJJ A;  3BJN A;  5DKL A;  3UB8 A;  2VA0 A;  3E4Q A;  5HPF A;  4YNR A;  3T50 A;  3OCL A;  4PAU A;  3TRC A;  1TS8 A;  1H3Q A;  1XJ2 A;  3OC2 A;  1OTD A;  2Z6D A;  3OBF A;  1OT9 A;  3NOP C;  4MN6 A;  3LI8 A;  4DJ2 A;  1T1A A;  2JKT M;  4GCZ A;  4LPZ A;  5AJG A;  2JKR M;  4HP4 A;  4OOL A;  4ETZ A;  2W3F A;  2FH5 A;  4F3L A;  4HHD A;  2W1T B;  2CMN A;  3B33 A;  2PR6 A;  4NKP A;  5DKK A;  1TS7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...