4GDNA

Structure of fmta-like protein
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
336
structure length
336
Chain Sequence
RLTNDSQQQIDKIIEHDLQKGHIPGASILIVKNGKVFLNKGYGYQDVDKKVKASPTTKYEIASNTKAFTGLAILKLAQEGRLNLNDDVSKHVPHFKMNYNGQNETITIKQLLAQTSGIPSDITSEDAVTNKNNRLNDVTRAIMGDELHHKPGEEFEYSNMNYDLLGLIIQNVTKQSYTKYITNSWLKPLHMTHTSFKQTNNKSKHDAIGYELQGSTPVVSKPEFNLWDTPSAYMMTSTEDLEHWIKFQLNPPDKYKSLVQQSHKNLSSTIGEPNANAYASGWFTNNDEHLVFHSGTLDNFSSFILLNPKQNYGIVVLANLNSEYVPKLVEHLNTQI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Protein flp
publication title Analysis of Structure-Function Relationships in the Colibactin-Maturating Enzyme ClbP.
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 90
structure length 336
sequence length 336
chains with identical sequence B, C, D
ec nomenclature ec 3.5.-.-:
pdb deposition date 2012-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00144 Beta-lactamase Beta-lactamase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 4gdnA00
4QD4A 2C6WB 4JPMA 1O7EA 4IBXA 1YM1A 4U3TA 2Y2NA 3HLDA 3N6IA 2XEPA 5I94A 1XP4A 4FH4A 4LV0A 5FASA 1CEGA 2IWDA 4GDNA 4X56A 5TFQA 3EQUA 5FI2A 1KVLA 1K4EA 1YQSA 2ZD8A 3SH7A 1YT4A 1KE0A 1XA7A 3BFCA 5EE8A 1ZG6A 3V50A 4N9LA 1PYYA 2Z2MB 1NXYA 3QHYA 3QNCA 1WYBA 1HD8A 1XGIA 4UA7A 3ZHHA 2Y2JA 5J8XA 4GOGA 4S2OA 1XKZA 3UY6A 4B88A 4FH2A 3WS1A 3HREA 3VSKA 1S6RA 5IHVA 5GLAA 3ZGAB 4KZ3A 4PPRA 3E2LA 3NDEA 1K56D 4WZ4A 4HBUA 2HDSA 1YMSA 4ZJ3A 3AGEA 3BFEA 5EPHA 3ZG8B 1JWZA 1M40A 1PIOA 2WAFA 4LCMA 4WZ5C 3ISGA 3VFFA 3ZG5A 4KQOA 4NK3A 1YMXA 3LY3A 2XD1A 1ES2A 5HAQA 3ITAA 5EVIA 1K6SA 4WM9A 4E3KA 4OQ0A 5KZHA 4K91A 1ES4A 3NBLA 1LI9A 2JBFA 3M6BA 5HARA 3IXBA 3ZNYA 4GD8A 4KG5A 3LO7A 5F82A 5FAPA 5HL1A 2XH9A 4IBRA 1W7FA 5GLBA 3EQVA 4DE1A 3OZHA 2Y2MA 1I2WA 4GD6A 4ZJ1A 2EFXA 1K55C 4DXBA 1XA1A 2XD5A 3NIAA 5DF8A 1PI4A 1PWCA 3HLGA 4JF5A 3ZVTA 2OSUA 4OONA 3RXXA 5HAPA 2ZQ7A 2DNSA 1FCMA 4HESA 5E43A 3NY4A 3IH8A 4GN2A 4N1HA 4JBFA 2ZQCA 3FZCA 1K57C 1W8QA 5FSRA 1BSGA 2XQZA 3OPHA 3HLEA 2X01A 1AXBA 1ALQA 1DJAA 4PM9A 3ZCZA 5CEDA 2Y59A 4OOYA 4KENB 1TDGA 4CPKA 4RX2A 3PBTA 4WMCA 3MXRA 1BLCA 5GLDA 2EXBA 5A90A 4S2NA 4EBPA 1YLZA 4HBTA 3OPRA 1CEFA 1KGGA 1XPBA 4C75A 2ZC4B 4MEZA 3CMZA 5GLCA 3IF6A 3MKFA 1SHVA 4UHUA 3W4OA 4E3JA 2Y2OA 2J9PA 3TSGA 4XUZA 4OPQA 3MFDA 3V3RA 4DE0A 3UNWA 2ZQAA 3WRZA 3GV9A 4EBNA 4PMAA 2UWXA 3IWIA 1GA9A 2JE5A 2P74A 3A3DA 3M2JA 4KZ5A 3SH9A 2QZ6A 3HLFA 3WS4A 2XGNA 3N4IA 3ZG0A 3JYIA 3S4XA 1Q2QA 2Y2PA 4RYEA 1ES3A 1K6RA 3BECA 3UDXA 3G31A 1K56A 3ZFZA 1TVFA 1HTZA 4Z9QA 2JCHA 5TR7A 2WKIA 1KDSA 2WGWB 3Q7VA 4OQIA 4LV1A 4Y0OA 1K4FA 4QU3A 1RCJA 4X69A 3IXGA 1RGYA 4KQRA 4KQQA 1N4OA 4R0QA 2V20A 1KDWA 3VFHA 1MPLA 3W8KA 5KSCA 1Z6FA 2P9VA 1CI8A 5FI6A 4ZDXA 3BRMA 2WK0A 4WMCD 5FATA 4P0MA 4GKUA 4ID4A 3BLMA 1FSYA 1ZC2A 1PWDA 2QPNA 4PM6A 4RX3A 4DDYA 4OPZA 1H8ZA 1IYSA 5EVIC 2X71A 4BD1A 1G6AA 3BFDA 2ZC3B 1BUEA 4H8RA 1BULA 1BLSA 5L2FA 1PZPA 1WYCA 2WGIA 2WYXA 1K54A 1TEMA 4E3IA 3NCKA 5CERA 1Y54A 4KZAA 4Y0TA 5EUAA 1L0GA 4C6YA 4X68A 4R4SA 5EOEA 4PM7A 3GRJA 3WS5A 3M2KA 2OLUA 3UE3A 2HP6A 1QMEA 2ZC5B 4KZ6A 4FD8A 4UA9A 1GHMA 3PAEA 4YINA 5FI7A 1LLBA 1W79A 4C3QA 3E2KA 3ZNTA 4JXGA 3A3IA 2ZQ9A 3N8LA 4KG2A 4R4RA 1EROA 2EFUA 2OLVA 2Y2LA 3HLCA 3UPNA 4BENA 1ERQA 4DE2A 2Z2LB 5BOHA 2Y2KA 3C5AA 3GR2A 2ZMAA 1YLTA 3N8RA 4N92A 3G34A 5F1GA 4KZ4A 3BEBA 1NZUA 3G32A 2Y55A 1SDNA 5FQ9A 1ES5A 4WEJA 3SS3A 2WAEA 1XX2A 2J8YA 4DXCA 5CHJA 3GVBA 3O87A 5HW3A 1FCOA 4EV4A 1CK3A 4S2NC 4WYYA 1H5XA 1J9MA 5CECA 4GZBA 1MKIA 2ZLYA 4IVKA 5DTKA 1SKFA 1K38A 2HP9A 4M3KA 1IYOA 1XXMA 2E8IA 2HP5A 3IF6C 3WS2A 4DKIA 2J9OA 3ITBA 4N9KA 4DF6A 4LV3A 5CRFA 4QB8A 5DTTA 5JYPA 4FCFA 4U0TA 2HDUA 1FCNA 5CHMA 4P85A 2XR0A 3HUMA 3N7WA 4U0XA 1IKIA 2XK1A 5CGXA 1JWVA 2V1ZA 2VGKA 3HUOA 4R23A 4DRTA 5F1FA 4S2IA 1HVBA 1NJ4A 4QY6A 2XFTA 1KGEA 4P87A 5CHUA 5GHZA 2ZJ9A 3FKVA 3HVFA 4KZBA 5CXWA 1MBLA 4P6BA 4E3OA 3PTEA 3C4PA 1QMFA 1NZOA 3O3VA 4BQMA 3N8SA 2PU2A 1L0DA 3OCNA 4EQIA 1LL5A 2DCFA 3GSGA 4S2KA 4O7DA 3GMWA 3V5MA 1L0EA 3HUNA 3Q81A 5A91A 2H5SA 2HPBA 1GCEA 3PBRA 4BJPA 3PAGA 1L0FA 1NY0A 2VGJA 3AGDA 2WGVA 3BYDA 1S0WA 4PM8A 5HAIA 4E6XA 1OMEA 2WKHA 5AQ9A 1SDEA 3UDIA 5CEBA 5DF9A 3ZDJA 1O07A 1PW8A 4BL3A 4EUZA 4Y0UA 3PBQA 2EXAA 5JYOA 4LENA 4ZTKA 3FWLA 1MY8A 3IF5A 4XXRA 1E3UA 1FQGA 5EVLA 3G2ZA 1ZKJA 2RCXA 1K54C 3IH9A 5CGSA 3I7JA 2H10A 2WUQA 3DTMA 1IKGA 2OV5A 1PWGA 1MWUA 3Q7ZA 1DJCA 4OLGA 4UA6A 5G18A 2PU4A 3A3EA 2XFSA 5FQKA 5GHYA 3Q7VB 1L2SA 4LCLA 5E2HA 2R9XA 3UE0A 2RL3A 3UDFA 4R3BA 4FSFA 1Q2PA 3A3FA 2G2WA 3OC2A 2EX2A 1PZOA 3SOIA 4KZ9A 4OOMA 1E25A 5E2GA 3VOYA 3V3SA 3LEZA 1FOFA 2ZQDA 4E3MA 1IELA 4OPRA 3QNBA 4DE3A 3C7VA 2R9WA 2XF3A 3GQZA 5FAOA 2ZQ8A 5E2EA 3CG5A 2B5RA 3VP3A 1EWZA 4X55A 3PBSA 1IYPA 2WGWA 3VP0A 2G2UA 5U47A 4BLMA 1BLPA 2ZM8A 3VP2A 3RXWA 3M6HA 1XGJA 2Y4AA 2FFFB 3AGFA 3IHBA 4K0XA 4OQGA 4S2PA 1JTDA 5KMWA 1JTGA 4RA7A 3BFGA 5AQBA 3G30A 5HFOA 3LY4A 5FA7A 1PW1A 3OPLA 3TG9A 4OP8A 1KGFA 3Q07A 4WEKA 3VP4A 1JWPA 4OPYA 4S2LA 2IWBA 3ZG9B 2FFYA 2WZXA 1E3UD 1GA0A 1ZG4A 2XDMA 2H0YA 1IYQA 3P98A 2EX8A 2ZC6B 3IQAA 3PBNA 1GHIA 3C4OA 3CJMA 3DWZA 3HLWA 1NRFA 4IEDA 4S2JA 4BL2A 3NDGA 4EWFA 2Y2QA 1I5QA 1FR1A 3SH8A 3WRTA 1MWRA 3VSLA 4OP5A 4R3JA 3IWOA 4WBGA 5EOOA 2WADA 2QMIA 4X6TA 4JF6A 4Y7PA 5CTNA 2I72A 3UPPA 5A92A 5EVIB 5M1AA 3SS5A 3HLBA 5FAQA 4JXVA 1YLPA 1VQQA 3MXSA 4F94A 3VMAA 4MLLA 5HX9A 1RP5A 3IT9A 3LCEA 4PM5A 1BT5A 2Y2GA 2Y2IA 3BLSA 2XLNA 3MZDA 1EI5A 1BLHA 4B4ZA 1LHYA 4L0LA 5GHXA 5KSHA 1U60A 4E3LA 3S22A 5AQAA 4CJNA 3O86A 3UE1A 4MBKA 4OLDA 4ZBEA 3V39A 2J7VA 4JXSA 5DVAA 1FR6A 1N9BA 3BM6A 4S2MA 1MXOA 3OPPA 1C3BA 4N1XA 2JC7A 3B3XA 2Y91A 3FKWA 3UPOA 4OKPA 4R1GA 3CZDA 2H0TA 4JF4A 3SS4A 4QJGA 3BFFA 4OOLA 4EBLA 1YLWA 4HEFA 2WKEA 2C5WB 4XUXA 5M19A 3O88A 4OQHA 4BD0A 4JLFA 1ESIA 3W4QA 4RVAA 2ZC7A 2ZM0A 1KE4A 3WWXA 1JVJA 2HDRA 3MZEA 4D2OA 3RJUA 3P09A 1ESUA 4MBFA 4E6WA 3DW0A 4JKTA 1H8YA 1CI9A 1YLJA 3G35A 3IF6B 4WZ5A 4GNUA 3NI9A 4GDBA 1ONHA 4NETA 1W8YA 4KZ8A 3G2YA 4IVIA 4WELA 2Q9MA 4UAAA 3MBZA 1M6KA 3C7UA 4MBHA 2BLSA 1ERMA 1PI5A 4YFMA 3TOIA 2PBYA 3ZVWA 1MWTA 3A3JA 5E2FA 5A93A 3Q1FA 2EX6A 5TGFA 1I2SA 1DY6A 2HDQA 3MKEA 3Q82A 1DJBA 1IEMA 4KZ7A 2DRWA 4GB7A 2A3UA 1G68A 3UN7A 4A5RA 2Y2HA 3MZFA 3IXDA 5EECA 5EVID 3DWKA 1K55A 3GTCA 1TDLA 5FQJA 5GL9A 3G4PA 2WZZA 5M18A 1W5DA 1KVMA 1E4DA 3W4PA 3VP1A 1K25A 3VOZA 4KG6A 1HZOA 2BG1A 1LI0A 2ZM2A 1SCWA 3D4FA 3NC8A 5D3OA 4ZAMA 4B4XA 3IHAA 2V2FF 5DF7A 1K57A 4QY5A 3HL9A 2GDNA 5F83A 1FSWA 2P9VB 1GHPA 1WE4A 1KE3A 4QHCA 1NYMA 3ZG7B 4X53A 3FV7A 2IWCA 3PBOA 4MNRA 5FDHA 1MWSA 2CC1A 4K0WA 4E3NA 3S1YA 5FQMA 1BZAA 3IWQA 3HBRA 3OCLA 5CTMA 1BTLA 4OH0A 1VM1A 5CGWA 4Q8IA 5DTSA 4DDSA 4JXWA 4ZJ2A 2X02A 1NYYA 1YLYA 4LV2A 5FQQA 3UO9A 1ONGA 2EX9A 5AQ7A 3FYZA 1RGZA 3IXHA 5FQIA 4OVDA 1LL9A 2A49A 2Q9NA 3WS0A
chains in the Genus database with same CATH superfamily
4QD4A 1JNUA 3SZTA 3HLDA 5EM0A 2XEPA 2E8JA 4MN6A 4UQIM 5TFQA 2V9AA 3NOTC 2EWVA 3CAXA 4D60A 1NXYA 1HD8A 4UA7A 1T18A 2B95A 2Y2JA 4GOGA 2QYBA 1XKZA 4FH2A 1XJ2A 5HDCA 5GLAA 3NDEA 1YMSA 3KSIA 3VE3A 3AGEA 3BFEA 2J3WA 4WZ5C 2JKTM 3DAVA 1YMXA 2XD1A 3H9WA 4CLCE 3H7WB 4DJ3A 5EVIA 3H82B 4E3KA 4OQ0A 3M6BA 3ZNYA 2D02A 4GD8A 4KG5A 5F82A 2HV1A 2Q9NA 3F1OA 4HP4A 2Y2MA 4ZJ1A 2EFXA 4M4XA 1PWCA 2OSUA 4OONA 2ZQ7A 1FCMA 3IH8A 1G6OA 1TS0A 3FZCA 4PHTA 2XQZA 3HLEA 2X01A 1DJAA 4PM9A 5GLDA 1YLZA 5GLCA 3C2WA 3C38A 4UHUA 5F68A 2I9VA 3MQ0A 4R70A 4DE0A 3CI6A 3WRZA 4EBNA 3M2JA 4KZ5A 2Q0OA 3HLFA 3F1PB 2JN7A 3LI9A 3ZG0A 3JYIA 2K2NA 3S4XA 1ES3A 1K6RA 5I5LA 4CLCA 2R78A 1K56A 3G31A 3ZYTA 3S7NA 2WKIA 1KDSA 3QP8A 1NRJA 4OQIA 4Y0OA 3ZQ5A 4QU3A 1RGYA 4R0QA 3BRMA 3UB8A 4GKUA 3BLMA 4HQAA 2QPNA 4PM6A 4OPZA 4NXFA 4H8RA 1CF0A 1P9WA 1K54A 3VE4A 5CERA 4R4SA 4PM7A 3GRJA 3UMEA 2W1TB 4UA9A 1GHMA 3QP5A 3KX0X 2O99A 2PT7A 4DN0A 4KG2A 1EROA 2EFUA 3D72A 2Y2LA 5FEGA 5HD3A 2K31A 3ICYA 3N8RA 4N92A 3UE6A 1W63Q 2Y55A 2W0NA 1XX2A 3BY9A 3GVBA 3O87A 4EV4A 1CK3A 1J9MA 2VGLS 2VEAA 1DP6A 4M3KA 4JGQA 3ITBA 4I39A 4DF6A 4QB8A 3GECA 4FCFA 1T1BA 4I38A 4IUKA 1IKIA 1PFLA 2V1ZA 2AVXA 1NJ4A 3KSHA 5GHZA 4I5SA 3O3VA 1NZOA 1A0KA 2YKFA 3GMWA 3V5MA 1L0EA 2ZOHA 1DRMA 3FPVA 4Z1WA 4BBTA 1L0FA 2VGJA 2WGVA 1S0WA 2WKHA 4B93A 3UDIA 5DF9A 5L8MA 3ZDJA 4Y0UA 4ZTKA 3T4QA 4XXRA 1E3UA 3G2ZA 1ZKJA 2IA2A 4LRYC 5A8BA 4P6ZM 1DJCA 2XFSA 3NHQA 2R9XA 5E2HA 3UE0A 5K5BA 4XT2A 4R3BA 3UDFA 4PAUA 1UGUA 3OC2A 2EX2A 1PZOA 4Y2FA 4OOMA 3CUEC 3QP4A 5E2GA 1T1AA 2ACGA 3VOYA 4OPRA 4DE3A 2XF3A 2ZQ8A 2B5RA 1EWZA 4FUWA 1OJGA 3M6HA 2FFFB 3IHBA 1JTDA 1V9YA 3TG9A 3EEHA 3Q07A 4WEKA 2WZXA 5HWWA 1IYQA 3B33A 3VOLA 2P08A 1VEUB 2QKPA 3CWFA 1MWRA 3VSLA 4WBGA 5EOOA 4ME4A 3U4LP 5IS1A 4GHIA 5A92A 3HLBA 5HX9A 4HH3A 4PM5A 3LCEA 2M1CA 2XLNA 1BLHA 4MN5A 1LHYA 2OAP1 4MBKA 4OLDA 4JXSA 1FR6A 1N9BA 3PR6A 4S2MA 1YSPA 3OPPA 1YPRA 3FKWA 3UPOA 2KLIA 2VLGA 1W63M 4OOLA 3DBAA 4BD0A 4JLFA 3W4QA 1VB6A 1KE4A 2JKGA 3MZEA 3RJUA 4MBFA 1H3QA 4X1MA 4JKTA 1H8YA 1CI9A 3TRCA 4EEUA 2QWSA 4GDBA 2Q9MA 4UAAA 1M6KA 3IBRA 2BLSA 3TOIA 2PBYA 4B9OA 1MWTA 1VHMA 3A3JA 5A93A 3Q82A 1DP8A 4UQIS 2A3UA 3K2NA 5DJUA 3IXDA 1SKOB 3DWKA 4NXBA 5FQJA 2KOIA 5HWTA 2LB9A 3G4PA 4CQHA 1S4SA 1E4DA 1OTDA 3VP1A 3VOZA 1XFNA 5D3OA 4ZAMA 4HJ3A 3IHAA 5F83A 1FSWA 2P9VB 1F9IA 1FIKA 3IBJA 3OOVA 1MWSA 4K0WA 3S1YA 3T4KA 1GSVA 3IWQA 2QHKA 3VV4A 5HD5A 4OH0A 4KUOA 5CGWA 4DDSA 4JXWA 4ZJ2A 5FQQA 2EX9A 4I3JA 1RGZA 5FQIA 5KSHA 1YM1A 2D01A 3JVUA 2Y2NA 1OTEA 1XP4A 4FH4A 1CEGA 3LUQA 1KVLA 3EEAA 1K4EA 3W2ZA 1YT4A 1KE0A 2Z2MB 3QNCA 1WYBA 3ZHHA 3F1NA 3U2AA 3LFVA 3UY6A 3WS1A 3LIEA 3ZGAB 4PPRA 3A0SA 5HZHA 4WZ4A 4HBUA 2HDSA 3KYEA 1P0ZA 3ZG8B 1N9OA 4ARZB 1P97A 4EW7A 4KQOA 2V1BA 5HAQA 3T50A 4EUVA 1K6SA 4WM9A 1OTAA 4IBRA 1LSXA 3NOPC 5GLBA 1P9RA 3EQVA 4II7A 1K55C 4DXBA 2XD5A 3BY8A 4G3VA 2EA9A 2XSSA 4JF5A 3HLGA 3ZVTA 4GJ4A 3RXXA 2B18A 4HESA 4E04A 3NY4A 4GN2A 3RFBA 4JBFA 1VETA 1K57C 3DTIA 5FSRA 1D7EA 1ALQA 1K0KA 4KENB 1TDGA 4CPKA 3PBTA 2EXBA 5A90A 2VZWA 3OPRA 1KGGA 3CMZA 2OAQ1 1SHVA 3MFDA 3V3RA 2ZQAA 4PMAA 1GA9A 2JE5A 3SH9A 3N4IA 5IU1A 3UDXA 5TR7A 4BWIA 3Q7VA 5IT5A 4G3KA 4LV1A 2W3DA 1K4FA 3LI8A 4KQQA 1N4OA 2V20A 1KDWA 3VFHA 3W8KA 1Z6FA 1CI8A 1L3LA 5HPIA 1PWDA 4DDYA 2W3GA 1IYSA 4BD1A 3T1RA 2M7UA 4WLAA 5L2FA 1PZPA 1WYCA 2ZMVA 4L9GA 3D3OA 4Y0TA 1L0GA 5EOEA 2FZ0A 4F3LA 3M2KA 2OLUA 4Y13A 3JVVA 2PYRA 1QMEA 3LICA 4KZ6A 4FD8A 3PAEA 4YINA 1W79A 3E2KA 5HWVA 3B47A 4JGRA 4DE2A 2Y2KA 3C5AA 3T12B 3T4JA 2ZMAA 1YLTA 3LIBA 1NZUA 3G32A 2PR5A 4Y5FA 3SS3A 5CHJA 4S2NC 5CECA 4GZBA 4O01A 1OTIA 2HP9A 4BBUA 1XXMA 2HP5A 2E8IA 3IF6C 3UB5P 4N9KA 3H7WA 5JYPA 5DTTA 4U0TA 4P6ZS 2XR0A 3HUMA 3N7WA 4U0XA 5EVEA 4DRTA 5FL3A 1HVBA 2ZJ9A 3FKVA 5CXWA 4E3OA 3C4PA 2BASA 3K3DA 3N8SA 1L0DA 5LBRA 2DCFA 3GSGA 2VX8A 4O7DA 3HUNA 2HPBA 4WL9A 3UB7A 3MR0A 1NY0A 3AGDA 3BW6A 4PM8A 4I3IA 4E6XA 1OMEA 5AQ9A 1PW8A 4BL3A 4EUZA 2EXAA 5JYOA 3IF5A 2PAVP 2XA7M 3IH9A 3I7JA 2WUQA 4NXEA 2HJEA 2PU4A 3A3EA 5FQKA 4ETXA 2RL3A 1Q2PA 3A3FA 3BJNA 3SOIA 4KZ9A 1FOFA 2ZQDA 2QJ7A 3QNBA 2R9WA 3GQZA 5E2EA 3VP0A 2G2UA 4BLMA 1BLPA 2V8FA 4EU0A 2W3EA 3AGFA 5KIZA 1MKMA 3G30A 5FA7A 4OP8A 2FH5A 2L0WA 3T4SA 4WUJA 2V0WA 2H0YA 4K08A 2EX8A 2ZC6B 3IQAA 2B02A 4HP9A 2YKHA 4S2JA 3QP1A 3NDGA 3CPTB 4EWFA 1I5QA 3E0YA 3EOIA 1N9LA 2QMIA 1XFQA 4JF6A 4Y7PA 4AFIA 2W1TA 3HJKA 4ZRRA 1VQQA 3MXSA 3VMAA 4MLLA 1BT5A 5J7EA 4L0LA 1U60A 4E3LA 3EWKA 3S22A 2K7SA 3O86A 2INWA 4GS9A 3BM6A 3CZDA 2H0TA 4JF4A 5DJTA 3BFFA 2PRFA 2WKEA 3LIAA 4XUXA 5L09A 1ESIA 4RVAA 2ZC7A 3KSFA 1JVJA 2HDRA 4D2OA 3P09A 1ESUA 4IUHA 4E6WA 5HPFA 1OT6A 5TBMB 3G35A 3IF6B 4WZ5A 4NETA 4IVIA 3T4OA 3KSGA 4HI4A 1PI5A 4JGPA 5E2FA 2EX6A 3LIFA 1I2SA 1DY6A 2HDQA 3MKEA 4A5RA 1G68A 3MZFA 4LGWA 5EECA 5EVID 3GTCA 5GL9A 1S1YA 5DKKA 3DTEA 2WZZA 1KVMA 3W4PA 3FG8A 1K25A 3R4KA 2KDKA 1HZOA 2BG1A 2GJ3A 1SCWA 3NC8A 2O0YA 5DF7A 1Y28A 2MJ6A 3UMDA 2Y8HA 1KE3A 2LB5A 3PBOA 3S7QA 2PR6A 4GCZA 5DTSA 1NYYA 1YLYA 4LV2A 3FYZA 4OVDA 4S2OA 5F69A 2VJWA 5I94A 4O8GA 5AVEA 2IWDA 3LR0A 4GDNA 5FASA 4GLQA 1YQSA 2ZD8A 3SH7A 1XA7A 3BFCA 5EE8A 1ZG6A 3V50A 4N9LA 1PYYA 4LRZE 3JPUA 3E4PA 3HREA 4KZ3A 4CLCD 1VEUA 3E2LA 1K56D 4ZJ3A 2W3HA 4WN5A 5EPHA 1Y4OA 3L9KA 1PIOA 2WAFA 3ISGA 3HJIA 3T1SA 4NK3A 3MMHA 2Z6CA 4DJ2A 3LY3A 1NWZA 2JHEA 4HHDA 4K91A 1ES4A 3NBLA 1IOUA 3LYXA 3IXBA 4Y15A 3LO7A 2XH9A 2ZMFA 2O9CA 1I2WA 3KYZA 1TS8A 2HGVA 4N1HA 4EXOA 1W8QA 2Z6DA 3OPHA 1AXBA 5HDSA 5CEDA 4R3AA 3TE8A 2A2LA 4EBPA 1CEFA 1XPBA 2ZC4B 4MEZA 3LGOA 4ESPA 3W4OA 3C8CA 2Y2OA 3TSGA 4XUZA 1N9NA 4OPQA 4NXGA 5CX7A 2UWXA 3IX3A 4H6JB 2P74A 3A3DA 3PXPA 3LIDA 4RYEA 4LLOB 3E4QA 2V8CA 4PKYG 2A24B 1SKOA 3ZFZA 1TVFA 4X1LA 2JCHA 2WGWB 1RCJA 5L07A 1MPLA 4G3WA 5KSCA 1S67L 2P9VA 5FI6A 4ZDXA 2P04A 1EW0A 2WK0A 4WMCD 5FATA 4P0MA 5L10A 1ZC2A 1ZHHB 2ZL1B 5EVIC 3BFDA 3IS2B 4HIAA 2V1AA 1BLSA 2WKPA 1NLZA 4C6YA 4X68A 3WS5A 3OBFA 3UE3A 2HP6A 1ODVA 2ZC5B 3ZNTA 4JXGA 3A3IA 3N8LA 3CUEA 4R4RA 1ERQA 2Z2LB 5BOHA 3NOUC 3GR2A 4Y3IA 3E98A 5F1GA 1S1ZA 3BEBA 1SDNA 5FQ9A 1ES5A 4WEJA 1OTBA 2J8YA 5J3WA 1F98A 2XA7S 4ARZA 4DKIA 2J9OA 2GNXA 4MMNA 4X25A 3R7WB 3S7OA 5CRFA 1F2KA 4JGOA 1FCNA 4P85A 2JKRI 3UB6A 1JWVA 2VGKA 3HUOA 1VETB 5F1FA 3MQQA 4S2IA 1KOUA 3GDIA 4CLCC 1ZTUA 1MBLA 4P6BA 1QMFA 3OCNA 1LL5A 3CITA 1GCEA 2PBDP 4Y17A 1CQAA 4BJPA 3PAGA 5HAIA 4WF0A 2L1MA 1NLYA 3FC7A 1H0MA 4EESA 3L7HA 3PBQA 4LPZA 3FWLA 5EVLA 2CMNA 3A0VA 1K54C 5CGSA 2H10A 1IKGA 1PWGA 1MWUA 4Q0IA 4UA6A 4OLGA 5G18A 1TF1A 5GHYA 3Q7VB 1L2SA 4FSFA 5DKLA 5F5YA 4E3MA 1IELA 2W3FA 3C7VA 2JKTI 3VP2A 3RXWA 1XGJA 2Y4AA 4OQGA 5KMWA 4S2PA 1JTGA 4HJ4A 4RA7A 3NECA 5AQBA 5HFOA 3LY4A 2P7JA 1PW1A 3OPLA 1LSVA 1JWPA 3ZG9B 3NJAA 4F3LB 1ZG4A 3P98A 1PNEA 3DWZA 1NRFA 5AJGA 2OOLA 2Y2QA 1FR1A 5C5KA 3WRTA 3T4LA 1HLUP 3IWOA 1X0OA 4R38A 3MS6A 5G4YA 4LRXC 5CTNA 5EVIB 5EV0A 1YLPA 4F94A 4YNRA 3IT9A 3D9YA 3QP6A 2Y2IA 3BLSA 3F1OB 1EI5A 4EEPA 4B4ZA 1DP9A 1V9ZA 2H28A 3UE1A 3BWLA 4ZBEA 5DVAA 3H82A 1MXOA 1C3BA 2JC7A 3B3XA 3MQOA 2XRNA 4OKPA 3SS4A 1T1CA 3T4TA 4QJGA 4QWOA 4EBLA 1YLWA 4HEFA 4OQHA 2ZM0A 2PYPA 4Q0HA 3FPWA 3TW8A 4EETB 1GSWA 2VV8A 4QPRA 1YLJA 4I3AA 4MDZA 5G4ZA 2VV7A 4DMZA 3EGXC 5EM1A 5TJJA 4KZ8A 4WELA 4YWZA 1YAXA 4BBVA 4YFMA 3ZVWA 1MC0A 3Q1FA 3C30A 5TGFA 1IEMA 4KZ7A 2ZBBA 4GB7A 4CLCB 1K55A 1TDLA 2VV6A 5M18A 1W5DA 1D1JA 1CJFA 5HDDA 4KG6A 3F1PA 1LI0A 1OT9A 3D4FA 4B4XA 1K57A 2GDNA 4QHCA 3ZG7B 1GSXA 4MNRA 4RQ9A 2CC1A 5F6AA 3HBRA 3MSHA 3OCLA 1BTLA 1VM1A 1TS7A 4Q8IA 3T1XA 3IXHA 5FEFA 1LL9A 3WS0A 2C6WB 4JPMA 1O7EA 4IBXA 4U3TA 3N6IA 4LV0A 4X56A 4GW9A 2J80A 3EQUA 5FI2A 2G7UA 4MCWA 2PHYA 3QHYA 5J8XA 1XGIA 3VSKA 1S6RA 5IHVA 3KYQA 1YKDA 3CPTA 1JWZA 1M40A 3VFFA 4LCMA 3ZG5A 2PD8A 3DTKA 1ES2A 1STZA 1XJ3A 4GS9B 3ITAA 5KZHA 2V0UA 3HCYA 1LI9A 2JBFA 5HARA 2BTFP 5FAPA 5HL1A 1W7FA 2J3TD 4DE1A 3OZHA 3ULFA 4GD6A 1XA1A 5HL6A 3NIAA 5DF8A 1PI4A 5MC7A 5HAPA 2DNSA 5E43A 3MFXA 2ZQCA 1BSGA 3RTYA 3ZCZA 2Y59A 4OOYA 4RX2A 2GX5A 4WMCA 3MXRA 1BLCA 3A0RA 4S2NA 4HBTA 4C75A 5TBMA 3BQ8A 4Q0JA 3IF6A 3CLOA 3MKFA 3K3CA 4E3JA 2J9PA 3P01A 3UNWA 3P7NA 2Y79A 3GV9A 4R6LA 3IWIA 4XT2B 2QZ6A 3WS4A 2XGNA 4HOIA 1Q2QA 2Y2PA 4BMWA 3BECA 4MN7A 4UEYA 1HTZA 4Z9QA 5FDSA 3LEQA 1WA9A 3MJQA 3SW1A 4X69A 2VK3A 3IXGA 4LFUA 4KQRA 1Z09A 4ID4A 1FSYA 1FILA 4RX3A 1H8ZA 2X71A 1G6AA 4L9EA 2VKSA 1BUEA 2ZC3B 1BULA 2WGIA 2WYXA 1TEMA 4E3IA 3NCKA 4IJGA 1Y54A 4KZAA 5EUAA 1LT0A 2GZAA 3TJZC 4FOFA 4KQDA 4GHIB 3O5YA 3V67A 5FI7A 1LLBA 2O9AA 4C3QA 2ZQ9A 4EERA 2OLVA 3HLCA 3UPNA 4BENA 2ZOIA 1SZVA 3G34A 4KZ4A 5AVFA 4EQ1A 2WAEA 4DXCA 1BYWA 5HW3A 1FCOA 4IHQA 3QP2A 4WYYA 1H5XA 1S4RA 1MKIA 2ZLYA 4IVKA 5DTKA 1SKFA 1K38A 3S7PA 5HSQA 1IYOA 3WS2A 1MZUA 4LV3A 3OLOA 1OPXA 2HDUA 5CHMA 1UWNX 2XK1A 5CGXA 4R23A 3LR5A 4O0PA 4QY6A 1KGEA 2XFTA 4P87A 5CHUA 3HVFA 4KZBA 3PTEA 4BQMA 2PU2A 4EQIA 4S2KA 3Q81A 3E4OA 5A91A 2H5SA 3PBRA 3BYDA 1SDEA 2HF6A 5CEBA 1O07A 2J3TC 4LENA 2VGLM 1MY8A 1FQGA 1TS6A 2PD7A 2RCXA 3DTMA 2OV5A 3G6OA 3IX4A 3T1QB 3Q7ZA 4LCLA 4KUKA 4H6JA 2G2WA 1E25A 3V3SA 3LEZA 3CHWP 3MF0A 2A24A 1J3WA 5FAOA 3CG5A 3VP3A 3KO6A 4X55A 3PBSA 1IYPA 2WGWA 1LSWA 5U47A 2WKRA 2ZM8A 4ETZA 4K0XA 3NULA 3BFGA 2L4RA 1KGFA 2M7VA 3VP4A 4OPYA 4S2LA 2IWBA 2FFYA 2OWHA 1E3UD 1GA0A 3F1NB 2XDMA 3PBNA 2ZL1A 2NUPC 1GHIA 3C4OA 3CJMA 3HLWA 3IS2A 4IEDA 5DFXA 4BL2A 2JKFA 2O9BA 3SH8A 4OP5A 4R3JA 2WADA 4X6TA 3UPPA 1XJ4A 2I72A 4HH2A 3PYPA 5M1AA 3SS5A 1S66L 1PRQA 5FAQA 1AWIA 4JXVA 1RP5A 1T19A 3UB9A 2Y2GA 3MZDA 1G28A 2EWWA 2PDRA 3MXQA 5GHXA 2QJ5A 2DMWA 5AQAA 4CJNA 3V39A 1H8MA 2J7VA 1UWPX 4HY8A 4N1XA 4L9FA 2Y91A 3PHYA 4R1GA 4YOFA 5DFYA 1D06A 3IX8A 1TD5A 2C5WB 3R7WA 5M19A 3O88A 2W1RA 4NG2A 3WWXA 2NUTC 3DW0A 1LL8A 3B42A 4GNUA 1OJ5A 3NI9A 1ONHA 1W8YA 4HNBA 3G2YA 1IFQA 3MBZA 4FTXA 3C7UA 4MBHA 1ERMA 5J4EA 2HZ5A 4B88A 1DJBA 3UN7A 2DRWA 1XJ6A 2Y2HA 3LR4A 4NKPA 1F5MA 2OWJA 3EGDC 2JKRM 2ZM2A 2VA0A 2V2FF 3LR3A 3HL9A 4QY5A 1GHPA 3BQAA 1WE4A 1NYMA 2XROA 4X53A 3FV7A 2IWCA 2KX6A 5FDHA 1YSQA 4E3NA 4NEED 2HJ9C 5FQMA 1BZAA 2UV0E 4HJ6A 1G5UA 4PKYA 5CTMA 1ACFA 5EFWA 2W27A 2X02A 3UO9A 1ONGA 5AQ7A 3RH8B 2A49A 2WKQA
chains in the Genus database with same CATH topology
4QD4A 2C6WB 4JPMA 1O7EA 4IBXA 1YM1A 4U3TA 2Y2NA 3HLDA 3N6IA 2XEPA 5I94A 1XP4A 4FH4A 4LV0A 5FASA 1CEGA 2IWDA 4GDNA 4X56A 5TFQA 3EQUA 5FI2A 1KVLA 1K4EA 1YQSA 2ZD8A 3SH7A 1YT4A 1KE0A 1XA7A 3BFCA 5EE8A 1ZG6A 3V50A 4N9LA 1PYYA 2Z2MB 1NXYA 3QHYA 3QNCA 1WYBA 1HD8A 1XGIA 4UA7A 3ZHHA 2Y2JA 5J8XA 4GOGA 4S2OA 1XKZA 3UY6A 4B88A 4FH2A 3WS1A 3HREA 3VSKA 1S6RA 5IHVA 5GLAA 3ZGAB 4KZ3A 4PPRA 3E2LA 3NDEA 1K56D 4WZ4A 4HBUA 2HDSA 1YMSA 4ZJ3A 3AGEA 3BFEA 5EPHA 3ZG8B 1JWZA 1M40A 1PIOA 2WAFA 4LCMA 4WZ5C 3ISGA 3VFFA 3ZG5A 4KQOA 4NK3A 1YMXA 3LY3A 2XD1A 1ES2A 5HAQA 3ITAA 5EVIA 1K6SA 4WM9A 4E3KA 4OQ0A 5KZHA 4K91A 1ES4A 3NBLA 1LI9A 2JBFA 3M6BA 5HARA 3IXBA 3ZNYA 4GD8A 4KG5A 3LO7A 5F82A 5FAPA 5HL1A 2XH9A 4IBRA 1W7FA 5GLBA 3EQVA 4DE1A 3OZHA 2Y2MA 1I2WA 4GD6A 4ZJ1A 2EFXA 1K55C 4DXBA 1XA1A 2XD5A 3NIAA 5DF8A 1PI4A 1PWCA 3HLGA 4JF5A 3ZVTA 2OSUA 4OONA 3RXXA 5HAPA 2ZQ7A 2DNSA 1FCMA 4HESA 5E43A 3NY4A 3IH8A 4GN2A 4N1HA 4JBFA 2ZQCA 3FZCA 1K57C 1W8QA 5FSRA 1BSGA 2XQZA 3OPHA 3HLEA 2X01A 1AXBA 1ALQA 1DJAA 4PM9A 3ZCZA 5CEDA 2Y59A 4OOYA 4KENB 1TDGA 4CPKA 4RX2A 3PBTA 4WMCA 3MXRA 1BLCA 5GLDA 2EXBA 5A90A 4S2NA 4EBPA 1YLZA 4HBTA 3OPRA 1CEFA 1KGGA 1XPBA 4C75A 2ZC4B 4MEZA 3CMZA 5GLCA 3IF6A 3MKFA 1SHVA 4UHUA 3W4OA 4E3JA 2Y2OA 2J9PA 3TSGA 4XUZA 4OPQA 3MFDA 3V3RA 4DE0A 3UNWA 2ZQAA 3WRZA 3GV9A 4EBNA 4PMAA 2UWXA 3IWIA 1GA9A 2JE5A 2P74A 3A3DA 3M2JA 4KZ5A 3SH9A 2QZ6A 3HLFA 3WS4A 2XGNA 3N4IA 3ZG0A 3JYIA 3S4XA 1Q2QA 2Y2PA 4RYEA 1ES3A 1K6RA 3BECA 3UDXA 3G31A 1K56A 3ZFZA 1TVFA 1HTZA 4Z9QA 2JCHA 5TR7A 2WKIA 1KDSA 2WGWB 3Q7VA 4OQIA 4LV1A 4Y0OA 1K4FA 4QU3A 1RCJA 4X69A 3IXGA 1RGYA 4KQRA 4KQQA 1N4OA 4R0QA 2V20A 1KDWA 3VFHA 1MPLA 3W8KA 5KSCA 1Z6FA 2P9VA 1CI8A 5FI6A 4ZDXA 3BRMA 2WK0A 4WMCD 5FATA 4P0MA 4GKUA 4ID4A 3BLMA 1FSYA 1ZC2A 1PWDA 2QPNA 4PM6A 4RX3A 4DDYA 4OPZA 1H8ZA 1IYSA 5EVIC 2X71A 4BD1A 1G6AA 3BFDA 2ZC3B 1BUEA 4H8RA 1BULA 1BLSA 5L2FA 1PZPA 1WYCA 2WGIA 2WYXA 1K54A 1TEMA 4E3IA 3NCKA 5CERA 1Y54A 4KZAA 4Y0TA 5EUAA 1L0GA 4C6YA 4X68A 4R4SA 5EOEA 4PM7A 3GRJA 3WS5A 3M2KA 2OLUA 3UE3A 2HP6A 1QMEA 2ZC5B 4KZ6A 4FD8A 4UA9A 1GHMA 3PAEA 4YINA 5FI7A 1LLBA 1W79A 4C3QA 3E2KA 3ZNTA 4JXGA 3A3IA 2ZQ9A 3N8LA 4KG2A 4R4RA 1EROA 2EFUA 2OLVA 2Y2LA 3HLCA 3UPNA 4BENA 1ERQA 4DE2A 2Z2LB 5BOHA 2Y2KA 3C5AA 3GR2A 2ZMAA 1YLTA 3N8RA 4N92A 3G34A 5F1GA 4KZ4A 3BEBA 1NZUA 3G32A 2Y55A 1SDNA 5FQ9A 1ES5A 4WEJA 3SS3A 2WAEA 1XX2A 2J8YA 4DXCA 5CHJA 3GVBA 3O87A 5HW3A 1FCOA 4EV4A 1CK3A 4S2NC 4WYYA 1H5XA 1J9MA 5CECA 4GZBA 1MKIA 2ZLYA 4IVKA 5DTKA 1SKFA 1K38A 2HP9A 4M3KA 1IYOA 1XXMA 2E8IA 2HP5A 3IF6C 3WS2A 4DKIA 2J9OA 3ITBA 4N9KA 4DF6A 4LV3A 5CRFA 4QB8A 5DTTA 5JYPA 4FCFA 4U0TA 2HDUA 1FCNA 5CHMA 4P85A 2XR0A 3HUMA 3N7WA 4U0XA 1IKIA 2XK1A 5CGXA 1JWVA 2V1ZA 2VGKA 3HUOA 4R23A 4DRTA 5F1FA 4S2IA 1HVBA 1NJ4A 4QY6A 2XFTA 1KGEA 4P87A 5CHUA 5GHZA 2ZJ9A 3FKVA 3HVFA 4KZBA 5CXWA 1MBLA 4P6BA 4E3OA 3PTEA 3C4PA 1QMFA 1NZOA 3O3VA 4BQMA 3N8SA 2PU2A 1L0DA 3OCNA 4EQIA 1LL5A 2DCFA 3GSGA 4S2KA 4O7DA 3GMWA 3V5MA 1L0EA 3HUNA 3Q81A 5A91A 2H5SA 2HPBA 1GCEA 3PBRA 4BJPA 3PAGA 1L0FA 1NY0A 2VGJA 3AGDA 2WGVA 3BYDA 1S0WA 4PM8A 5HAIA 4E6XA 1OMEA 2WKHA 5AQ9A 1SDEA 3UDIA 5CEBA 5DF9A 3ZDJA 1O07A 1PW8A 4BL3A 4EUZA 4Y0UA 3PBQA 2EXAA 5JYOA 4LENA 4ZTKA 3FWLA 1MY8A 3IF5A 4XXRA 1E3UA 1FQGA 5EVLA 3G2ZA 1ZKJA 2RCXA 1K54C 3IH9A 5CGSA 3I7JA 2H10A 2WUQA 3DTMA 1IKGA 2OV5A 1PWGA 1MWUA 3Q7ZA 1DJCA 4OLGA 4UA6A 5G18A 2PU4A 3A3EA 2XFSA 5FQKA 5GHYA 3Q7VB 1L2SA 4LCLA 5E2HA 2R9XA 3UE0A 2RL3A 3UDFA 4R3BA 4FSFA 1Q2PA 3A3FA 2G2WA 3OC2A 2EX2A 1PZOA 3SOIA 4KZ9A 4OOMA 1E25A 5E2GA 3VOYA 3V3SA 3LEZA 1FOFA 2ZQDA 4E3MA 1IELA 4OPRA 3QNBA 4DE3A 3C7VA 2R9WA 2XF3A 3GQZA 5FAOA 2ZQ8A 5E2EA 3CG5A 2B5RA 3VP3A 1EWZA 4X55A 3PBSA 1IYPA 2WGWA 3VP0A 2G2UA 5U47A 4BLMA 1BLPA 2ZM8A 3VP2A 3RXWA 3M6HA 1XGJA 2Y4AA 2FFFB 3AGFA 3IHBA 4K0XA 4OQGA 4S2PA 1JTDA 5KMWA 1JTGA 4RA7A 3BFGA 5AQBA 3G30A 5HFOA 3LY4A 5FA7A 1PW1A 3OPLA 3TG9A 4OP8A 1KGFA 3Q07A 4WEKA 3VP4A 1JWPA 4OPYA 4S2LA 2IWBA 3ZG9B 2FFYA 2WZXA 1E3UD 1GA0A 1ZG4A 2XDMA 2H0YA 1IYQA 3P98A 2EX8A 2ZC6B 3IQAA 3PBNA 1GHIA 3C4OA 3CJMA 3DWZA 3HLWA 1NRFA 4IEDA 4S2JA 4BL2A 3NDGA 4EWFA 2Y2QA 1I5QA 1FR1A 3SH8A 3WRTA 1MWRA 3VSLA 4OP5A 4R3JA 3IWOA 4WBGA 5EOOA 2WADA 2QMIA 4X6TA 4JF6A 4Y7PA 5CTNA 2I72A 3UPPA 5A92A 5EVIB 5M1AA 3SS5A 3HLBA 5FAQA 4JXVA 1YLPA 1VQQA 3MXSA 4F94A 3VMAA 4MLLA 5HX9A 1RP5A 3IT9A 3LCEA 4PM5A 1BT5A 2Y2GA 2Y2IA 3BLSA 2XLNA 3MZDA 1EI5A 1BLHA 4B4ZA 1LHYA 4L0LA 5GHXA 5KSHA 1U60A 4E3LA 3S22A 5AQAA 4CJNA 3O86A 3UE1A 4MBKA 4OLDA 4ZBEA 3V39A 2J7VA 4JXSA 5DVAA 1FR6A 1N9BA 3BM6A 4S2MA 1MXOA 3OPPA 1C3BA 4N1XA 2JC7A 3B3XA 2Y91A 3FKWA 3UPOA 4OKPA 4R1GA 3CZDA 2H0TA 4JF4A 3SS4A 4QJGA 3BFFA 4OOLA 4EBLA 1YLWA 4HEFA 2WKEA 2C5WB 4XUXA 5M19A 3O88A 4OQHA 4BD0A 4JLFA 1ESIA 3W4QA 4RVAA 2ZC7A 2ZM0A 1KE4A 3WWXA 1JVJA 2HDRA 3MZEA 4D2OA 3RJUA 3P09A 1ESUA 4MBFA 4E6WA 3DW0A 4JKTA 1H8YA 1CI9A 1YLJA 3G35A 3IF6B 4WZ5A 4GNUA 3NI9A 4GDBA 1ONHA 4NETA 1W8YA 4KZ8A 3G2YA 4IVIA 4WELA 2Q9MA 4UAAA 3MBZA 1M6KA 3C7UA 4MBHA 2BLSA 1ERMA 1PI5A 4YFMA 3TOIA 2PBYA 3ZVWA 1MWTA 3A3JA 5E2FA 5A93A 3Q1FA 2EX6A 5TGFA 1I2SA 1DY6A 2HDQA 3MKEA 3Q82A 1DJBA 1IEMA 4KZ7A 2DRWA 4GB7A 2A3UA 1G68A 3UN7A 4A5RA 2Y2HA 3MZFA 3IXDA 5EECA 5EVID 3DWKA 1K55A 3GTCA 1TDLA 5FQJA 5GL9A 3G4PA 2WZZA 5M18A 1W5DA 1KVMA 1E4DA 3W4PA 3VP1A 1K25A 3VOZA 4KG6A 1HZOA 2BG1A 1LI0A 2ZM2A 1SCWA 3D4FA 3NC8A 5D3OA 4ZAMA 4B4XA 3IHAA 2V2FF 5DF7A 1K57A 4QY5A 3HL9A 2GDNA 5F83A 1FSWA 2P9VB 1GHPA 1WE4A 1KE3A 4QHCA 1NYMA 3ZG7B 4X53A 3FV7A 2IWCA 3PBOA 4MNRA 5FDHA 1MWSA 2CC1A 4K0WA 4E3NA 3S1YA 5FQMA 1BZAA 3IWQA 3HBRA 3OCLA 5CTMA 1BTLA 4OH0A 1VM1A 5CGWA 4Q8IA 5DTSA 4DDSA 4JXWA 4ZJ2A 2X02A 1NYYA 1YLYA 4LV2A 5FQQA 3UO9A 1ONGA 2EX9A 5AQ7A 3FYZA 1RGZA 3IXHA 5FQIA 4OVDA 1LL9A 2A49A 2Q9NA 3WS0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QD4 A;  2C6W B;  4JPM A;  1O7E A;  4IBX A;  1YM1 A;  4U3T A;  2Y2N A;  3HLD A;  3N6I A;  2XEP A;  5I94 A;  1XP4 A;  4FH4 A;  4LV0 A;  5FAS A;  1CEG A;  2IWD A;  4GDN A;  4X56 A;  5TFQ A;  3EQU A;  5FI2 A;  1KVL A;  1K4E A;  1YQS A;  2ZD8 A;  3SH7 A;  1YT4 A;  1KE0 A;  1XA7 A;  3BFC A;  5EE8 A;  1ZG6 A;  3V50 A;  4N9L A;  1PYY A;  2Z2M B;  1NXY A;  3QHY A;  3QNC A;  1WYB A;  1HD8 A;  1XGI A;  4UA7 A;  3ZHH A;  2Y2J A;  5J8X A;  4GOG A;  4S2O A;  1XKZ A;  3UY6 A;  4B88 A;  4FH2 A;  3WS1 A;  3HRE A;  3VSK A;  1S6R A;  5IHV A;  5GLA A;  3ZGA B;  4KZ3 A;  4PPR A;  3E2L A;  3NDE A;  1K56 D;  4WZ4 A;  4HBU A;  2HDS A;  1YMS A;  4ZJ3 A;  3AGE A;  3BFE A;  5EPH A;  3ZG8 B;  1JWZ A;  1M40 A;  1PIO A;  2WAF A;  4LCM A;  4WZ5 C;  3ISG A;  3VFF A;  3ZG5 A;  4KQO A;  4NK3 A;  1YMX A;  3LY3 A;  2XD1 A;  1ES2 A;  5HAQ A;  3ITA A;  5EVI A;  1K6S A;  4WM9 A;  4E3K A;  4OQ0 A;  5KZH A;  4K91 A;  1ES4 A;  3NBL A;  1LI9 A;  2JBF A;  3M6B A;  5HAR A;  3IXB A;  3ZNY A;  4GD8 A;  4KG5 A;  3LO7 A;  5F82 A;  5FAP A;  5HL1 A;  2XH9 A;  4IBR A;  1W7F A;  5GLB A;  3EQV A;  4DE1 A;  3OZH A;  2Y2M A;  1I2W A;  4GD6 A;  4ZJ1 A;  2EFX A;  1K55 C;  4DXB A;  1XA1 A;  2XD5 A;  3NIA A;  5DF8 A;  1PI4 A;  1PWC A;  3HLG A;  4JF5 A;  3ZVT A;  2OSU A;  4OON A;  3RXX A;  5HAP A;  2ZQ7 A;  2DNS A;  1FCM A;  4HES A;  5E43 A;  3NY4 A;  3IH8 A;  4GN2 A;  4N1H A;  4JBF A;  2ZQC A;  3FZC A;  1K57 C;  1W8Q A;  5FSR A;  1BSG A;  2XQZ A;  3OPH A;  3HLE A;  2X01 A;  1AXB A;  1ALQ A;  1DJA A;  4PM9 A;  3ZCZ A;  5CED A;  2Y59 A;  4OOY A;  4KEN B;  1TDG A;  4CPK A;  4RX2 A;  3PBT A;  4WMC A;  3MXR A;  1BLC A;  5GLD A;  2EXB A;  5A90 A;  4S2N A;  4EBP A;  1YLZ A;  4HBT A;  3OPR A;  1CEF A;  1KGG A;  1XPB A;  4C75 A;  2ZC4 B;  4MEZ A;  3CMZ A;  5GLC A;  3IF6 A;  3MKF A;  1SHV A;  4UHU A;  3W4O A;  4E3J A;  2Y2O A;  2J9P A;  3TSG A;  4XUZ A;  4OPQ A;  3MFD A;  3V3R A;  4DE0 A;  3UNW A;  2ZQA A;  3WRZ A;  3GV9 A;  4EBN A;  4PMA A;  2UWX A;  3IWI A;  1GA9 A;  2JE5 A;  2P74 A;  3A3D A;  3M2J A;  4KZ5 A;  3SH9 A;  2QZ6 A;  3HLF A;  3WS4 A;  2XGN A;  3N4I A;  3ZG0 A;  3JYI A;  3S4X A;  1Q2Q A;  2Y2P A;  4RYE A;  1ES3 A;  1K6R A;  3BEC A;  3UDX A;  3G31 A;  1K56 A;  3ZFZ A;  1TVF A;  1HTZ A;  4Z9Q A;  2JCH A;  5TR7 A;  2WKI A;  1KDS A;  2WGW B;  3Q7V A;  4OQI A;  4LV1 A;  4Y0O A;  1K4F A;  4QU3 A;  1RCJ A;  4X69 A;  3IXG A;  1RGY A;  4KQR A;  4KQQ A;  1N4O A;  4R0Q A;  2V20 A;  1KDW A;  3VFH A;  1MPL A;  3W8K A;  5KSC A;  1Z6F A;  2P9V A;  1CI8 A;  5FI6 A;  4ZDX A;  3BRM A;  2WK0 A;  4WMC D;  5FAT A;  4P0M A;  4GKU A;  4ID4 A;  3BLM A;  1FSY A;  1ZC2 A;  1PWD A;  2QPN A;  4PM6 A;  4RX3 A;  4DDY A;  4OPZ A;  1H8Z A;  1IYS A;  5EVI C;  2X71 A;  4BD1 A;  1G6A A;  3BFD A;  2ZC3 B;  1BUE A;  4H8R A;  1BUL A;  1BLS A;  5L2F A;  1PZP A;  1WYC A;  2WGI A;  2WYX A;  1K54 A;  1TEM A;  4E3I A;  3NCK A;  5CER A;  1Y54 A;  4KZA A;  4Y0T A;  5EUA A;  1L0G A;  4C6Y A;  4X68 A;  4R4S A;  5EOE A;  4PM7 A;  3GRJ A;  3WS5 A;  3M2K A;  2OLU A;  3UE3 A;  2HP6 A;  1QME A;  2ZC5 B;  4KZ6 A;  4FD8 A;  4UA9 A;  1GHM A;  3PAE A;  4YIN A;  5FI7 A;  1LLB A;  1W79 A;  4C3Q A;  3E2K A;  3ZNT A;  4JXG A;  3A3I A;  2ZQ9 A;  3N8L A;  4KG2 A;  4R4R A;  1ERO A;  2EFU A;  2OLV A;  2Y2L A;  3HLC A;  3UPN A;  4BEN A;  1ERQ A;  4DE2 A;  2Z2L B;  5BOH A;  2Y2K A;  3C5A A;  3GR2 A;  2ZMA A;  1YLT A;  3N8R A;  4N92 A;  3G34 A;  5F1G A;  4KZ4 A;  3BEB A;  1NZU A;  3G32 A;  2Y55 A;  1SDN A;  5FQ9 A;  1ES5 A;  4WEJ A;  3SS3 A;  2WAE A;  1XX2 A;  2J8Y A;  4DXC A;  5CHJ A;  3GVB A;  3O87 A;  5HW3 A;  1FCO A;  4EV4 A;  1CK3 A;  4S2N C;  4WYY A;  1H5X A;  1J9M A;  5CEC A;  4GZB A;  1MKI A;  2ZLY A;  4IVK A;  5DTK A;  1SKF A;  1K38 A;  2HP9 A;  4M3K A;  1IYO A;  1XXM A;  2E8I A;  2HP5 A;  3IF6 C;  3WS2 A;  4DKI A;  2J9O A;  3ITB A;  4N9K A;  4DF6 A;  4LV3 A;  5CRF A;  4QB8 A;  5DTT A;  5JYP A;  4FCF A;  4U0T A;  2HDU A;  1FCN A;  5CHM A;  4P85 A;  2XR0 A;  3HUM A;  3N7W A;  4U0X A;  1IKI A;  2XK1 A;  5CGX A;  1JWV A;  2V1Z A;  2VGK A;  3HUO A;  4R23 A;  4DRT A;  5F1F A;  4S2I A;  1HVB A;  1NJ4 A;  4QY6 A;  2XFT A;  1KGE A;  4P87 A;  5CHU A;  5GHZ A;  2ZJ9 A;  3FKV A;  3HVF A;  4KZB A;  5CXW A;  1MBL A;  4P6B A;  4E3O A;  3PTE A;  3C4P A;  1QMF A;  1NZO A;  3O3V A;  4BQM A;  3N8S A;  2PU2 A;  1L0D A;  3OCN A;  4EQI A;  1LL5 A;  2DCF A;  3GSG A;  4S2K A;  4O7D A;  3GMW A;  3V5M A;  1L0E A;  3HUN A;  3Q81 A;  5A91 A;  2H5S A;  2HPB A;  1GCE A;  3PBR A;  4BJP A;  3PAG A;  1L0F A;  1NY0 A;  2VGJ A;  3AGD A;  2WGV A;  3BYD A;  1S0W A;  4PM8 A;  5HAI A;  4E6X A;  1OME A;  2WKH A;  5AQ9 A;  1SDE A;  3UDI A;  5CEB A;  5DF9 A;  3ZDJ A;  1O07 A;  1PW8 A;  4BL3 A;  4EUZ A;  4Y0U A;  3PBQ A;  2EXA A;  5JYO A;  4LEN A;  4ZTK A;  3FWL A;  1MY8 A;  3IF5 A;  4XXR A;  1E3U A;  1FQG A;  5EVL A;  3G2Z A;  1ZKJ A;  2RCX A;  1K54 C;  3IH9 A;  5CGS A;  3I7J A;  2H10 A;  2WUQ A;  3DTM A;  1IKG A;  2OV5 A;  1PWG A;  1MWU A;  3Q7Z A;  1DJC A;  4OLG A;  4UA6 A;  5G18 A;  2PU4 A;  3A3E A;  2XFS A;  5FQK A;  5GHY A;  3Q7V B;  1L2S A;  4LCL A;  5E2H A;  2R9X A;  3UE0 A;  2RL3 A;  3UDF A;  4R3B A;  4FSF A;  1Q2P A;  3A3F A;  2G2W A;  3OC2 A;  2EX2 A;  1PZO A;  3SOI A;  4KZ9 A;  4OOM A;  1E25 A;  5E2G A;  3VOY A;  3V3S A;  3LEZ A;  1FOF A;  2ZQD A;  4E3M A;  1IEL A;  4OPR A;  3QNB A;  4DE3 A;  3C7V A;  2R9W A;  2XF3 A;  3GQZ A;  5FAO A;  2ZQ8 A;  5E2E A;  3CG5 A;  2B5R A;  3VP3 A;  1EWZ A;  4X55 A;  3PBS A;  1IYP A;  2WGW A;  3VP0 A;  2G2U A;  5U47 A;  4BLM A;  1BLP A;  2ZM8 A;  3VP2 A;  3RXW A;  3M6H A;  1XGJ A;  2Y4A A;  2FFF B;  3AGF A;  3IHB A;  4K0X A;  4OQG A;  4S2P A;  1JTD A;  5KMW A;  1JTG A;  4RA7 A;  3BFG A;  5AQB A;  3G30 A;  5HFO A;  3LY4 A;  5FA7 A;  1PW1 A;  3OPL A;  3TG9 A;  4OP8 A;  1KGF A;  3Q07 A;  4WEK A;  3VP4 A;  1JWP A;  4OPY A;  4S2L A;  2IWB A;  3ZG9 B;  2FFY A;  2WZX A;  1E3U D;  1GA0 A;  1ZG4 A;  2XDM A;  2H0Y A;  1IYQ A;  3P98 A;  2EX8 A;  2ZC6 B;  3IQA A;  3PBN A;  1GHI A;  3C4O A;  3CJM A;  3DWZ A;  3HLW A;  1NRF A;  4IED A;  4S2J A;  4BL2 A;  3NDG A;  4EWF A;  2Y2Q A;  1I5Q A;  1FR1 A;  3SH8 A;  3WRT A;  1MWR A;  3VSL A;  4OP5 A;  4R3J A;  3IWO A;  4WBG A;  5EOO A;  2WAD A;  2QMI A;  4X6T A;  4JF6 A;  4Y7P A;  5CTN A;  2I72 A;  3UPP A;  5A92 A;  5EVI B;  5M1A A;  3SS5 A;  3HLB A;  5FAQ A;  4JXV A;  1YLP A;  1VQQ A;  3MXS A;  4F94 A;  3VMA A;  4MLL A;  5HX9 A;  1RP5 A;  3IT9 A;  3LCE A;  4PM5 A;  1BT5 A;  2Y2G A;  2Y2I A;  3BLS A;  2XLN A;  3MZD A;  1EI5 A;  1BLH A;  4B4Z A;  1LHY A;  4L0L A;  5GHX A;  5KSH A;  1U60 A;  4E3L A;  3S22 A;  5AQA A;  4CJN A;  3O86 A;  3UE1 A;  4MBK A;  4OLD A;  4ZBE A;  3V39 A;  2J7V A;  4JXS A;  5DVA A;  1FR6 A;  1N9B A;  3BM6 A;  4S2M A;  1MXO A;  3OPP A;  1C3B A;  4N1X A;  2JC7 A;  3B3X A;  2Y91 A;  3FKW A;  3UPO A;  4OKP A;  4R1G A;  3CZD A;  2H0T A;  4JF4 A;  3SS4 A;  4QJG A;  3BFF A;  4OOL A;  4EBL A;  1YLW A;  4HEF A;  2WKE A;  2C5W B;  4XUX A;  5M19 A;  3O88 A;  4OQH A;  4BD0 A;  4JLF A;  1ESI A;  3W4Q A;  4RVA A;  2ZC7 A;  2ZM0 A;  1KE4 A;  3WWX A;  1JVJ A;  2HDR A;  3MZE A;  4D2O A;  3RJU A;  3P09 A;  1ESU A;  4MBF A;  4E6W A;  3DW0 A;  4JKT A;  1H8Y A;  1CI9 A;  1YLJ A;  3G35 A;  3IF6 B;  4WZ5 A;  4GNU A;  3NI9 A;  4GDB A;  1ONH A;  4NET A;  1W8Y A;  4KZ8 A;  3G2Y A;  4IVI A;  4WEL A;  2Q9M A;  4UAA A;  3MBZ A;  1M6K A;  3C7U A;  4MBH A;  2BLS A;  1ERM A;  1PI5 A;  4YFM A;  3TOI A;  2PBY A;  3ZVW A;  1MWT A;  3A3J A;  5E2F A;  5A93 A;  3Q1F A;  2EX6 A;  5TGF A;  1I2S A;  1DY6 A;  2HDQ A;  3MKE A;  3Q82 A;  1DJB A;  1IEM A;  4KZ7 A;  2DRW A;  4GB7 A;  2A3U A;  1G68 A;  3UN7 A;  4A5R A;  2Y2H A;  3MZF A;  3IXD A;  5EEC A;  5EVI D;  3DWK A;  1K55 A;  3GTC A;  1TDL A;  5FQJ A;  5GL9 A;  3G4P A;  2WZZ A;  5M18 A;  1W5D A;  1KVM A;  1E4D A;  3W4P A;  3VP1 A;  1K25 A;  3VOZ A;  4KG6 A;  1HZO A;  2BG1 A;  1LI0 A;  2ZM2 A;  1SCW A;  3D4F A;  3NC8 A;  5D3O A;  4ZAM A;  4B4X A;  3IHA A;  2V2F F;  5DF7 A;  1K57 A;  4QY5 A;  3HL9 A;  2GDN A;  5F83 A;  1FSW A;  2P9V B;  1GHP A;  1WE4 A;  1KE3 A;  4QHC A;  1NYM A;  3ZG7 B;  4X53 A;  3FV7 A;  2IWC A;  3PBO A;  4MNR A;  5FDH A;  1MWS A;  2CC1 A;  4K0W A;  4E3N A;  3S1Y A;  5FQM A;  1BZA A;  3IWQ A;  3HBR A;  3OCL A;  5CTM A;  1BTL A;  4OH0 A;  1VM1 A;  5CGW A;  4Q8I A;  5DTS A;  4DDS A;  4JXW A;  4ZJ2 A;  2X02 A;  1NYY A;  1YLY A;  4LV2 A;  5FQQ A;  3UO9 A;  1ONG A;  2EX9 A;  5AQ7 A;  3FYZ A;  1RGZ A;  3IXH A;  5FQI A;  4OVD A;  1LL9 A;  2A49 A;  2Q9N A;  3WS0 A; 
#chains in the Genus database with same CATH topology
 4QD4 A;  1JNU A;  3SZT A;  3HLD A;  5EM0 A;  2XEP A;  2E8J A;  4MN6 A;  4UQI M;  5TFQ A;  2V9A A;  3NOT C;  2EWV A;  3CAX A;  4D60 A;  1NXY A;  1HD8 A;  4UA7 A;  1T18 A;  2B95 A;  2Y2J A;  4GOG A;  2QYB A;  1XKZ A;  4FH2 A;  1XJ2 A;  5HDC A;  5GLA A;  3NDE A;  1YMS A;  3KSI A;  3VE3 A;  3AGE A;  3BFE A;  2J3W A;  4WZ5 C;  2JKT M;  3DAV A;  1YMX A;  2XD1 A;  3H9W A;  4CLC E;  3H7W B;  4DJ3 A;  5EVI A;  3H82 B;  4E3K A;  4OQ0 A;  3M6B A;  3ZNY A;  2D02 A;  4GD8 A;  4KG5 A;  5F82 A;  2HV1 A;  2Q9N A;  3F1O A;  4HP4 A;  2Y2M A;  4ZJ1 A;  2EFX A;  4M4X A;  1PWC A;  2OSU A;  4OON A;  2ZQ7 A;  1FCM A;  3IH8 A;  1G6O A;  1TS0 A;  3FZC A;  4PHT A;  2XQZ A;  3HLE A;  2X01 A;  1DJA A;  4PM9 A;  5GLD A;  1YLZ A;  5GLC A;  3C2W A;  3C38 A;  4UHU A;  5F68 A;  2I9V A;  3MQ0 A;  4R70 A;  4DE0 A;  3CI6 A;  3WRZ A;  4EBN A;  3M2J A;  4KZ5 A;  2Q0O A;  3HLF A;  3F1P B;  2JN7 A;  3LI9 A;  3ZG0 A;  3JYI A;  2K2N A;  3S4X A;  1ES3 A;  1K6R A;  5I5L A;  4CLC A;  2R78 A;  1K56 A;  3G31 A;  3ZYT A;  3S7N A;  2WKI A;  1KDS A;  3QP8 A;  1NRJ A;  4OQI A;  4Y0O A;  3ZQ5 A;  4QU3 A;  1RGY A;  4R0Q A;  3BRM A;  3UB8 A;  4GKU A;  3BLM A;  4HQA A;  2QPN A;  4PM6 A;  4OPZ A;  4NXF A;  4H8R A;  1CF0 A;  1P9W A;  1K54 A;  3VE4 A;  5CER A;  4R4S A;  4PM7 A;  3GRJ A;  3UME A;  2W1T B;  4UA9 A;  1GHM A;  3QP5 A;  3KX0 X;  2O99 A;  2PT7 A;  4DN0 A;  4KG2 A;  1ERO A;  2EFU A;  3D72 A;  2Y2L A;  5FEG A;  5HD3 A;  2K31 A;  3ICY A;  3N8R A;  4N92 A;  3UE6 A;  1W63 Q;  2Y55 A;  2W0N A;  1XX2 A;  3BY9 A;  3GVB A;  3O87 A;  4EV4 A;  1CK3 A;  1J9M A;  2VGL S;  2VEA A;  1DP6 A;  4M3K A;  4JGQ A;  3ITB A;  4I39 A;  4DF6 A;  4QB8 A;  3GEC A;  4FCF A;  1T1B A;  4I38 A;  4IUK A;  1IKI A;  1PFL A;  2V1Z A;  2AVX A;  1NJ4 A;  3KSH A;  5GHZ A;  4I5S A;  3O3V A;  1NZO A;  1A0K A;  2YKF A;  3GMW A;  3V5M A;  1L0E A;  2ZOH A;  1DRM A;  3FPV A;  4Z1W A;  4BBT A;  1L0F A;  2VGJ A;  2WGV A;  1S0W A;  2WKH A;  4B93 A;  3UDI A;  5DF9 A;  5L8M A;  3ZDJ A;  4Y0U A;  4ZTK A;  3T4Q A;  4XXR A;  1E3U A;  3G2Z A;  1ZKJ A;  2IA2 A;  4LRY C;  5A8B A;  4P6Z M;  1DJC A;  2XFS A;  3NHQ A;  2R9X A;  5E2H A;  3UE0 A;  5K5B A;  4XT2 A;  4R3B A;  3UDF A;  4PAU A;  1UGU A;  3OC2 A;  2EX2 A;  1PZO A;  4Y2F A;  4OOM A;  3CUE C;  3QP4 A;  5E2G A;  1T1A A;  2ACG A;  3VOY A;  4OPR A;  4DE3 A;  2XF3 A;  2ZQ8 A;  2B5R A;  1EWZ A;  4FUW A;  1OJG A;  3M6H A;  2FFF B;  3IHB A;  1JTD A;  1V9Y A;  3TG9 A;  3EEH A;  3Q07 A;  4WEK A;  2WZX A;  5HWW A;  1IYQ A;  3B33 A;  3VOL A;  2P08 A;  1VEU B;  2QKP A;  3CWF A;  1MWR A;  3VSL A;  4WBG A;  5EOO A;  4ME4 A;  3U4L P;  5IS1 A;  4GHI A;  5A92 A;  3HLB A;  5HX9 A;  4HH3 A;  4PM5 A;  3LCE A;  2M1C A;  2XLN A;  1BLH A;  4MN5 A;  1LHY A;  2OAP 1;  4MBK A;  4OLD A;  4JXS A;  1FR6 A;  1N9B A;  3PR6 A;  4S2M A;  1YSP A;  3OPP A;  1YPR A;  3FKW A;  3UPO A;  2KLI A;  2VLG A;  1W63 M;  4OOL A;  3DBA A;  4BD0 A;  4JLF A;  3W4Q A;  1VB6 A;  1KE4 A;  2JKG A;  3MZE A;  3RJU A;  4MBF A;  1H3Q A;  4X1M A;  4JKT A;  1H8Y A;  1CI9 A;  3TRC A;  4EEU A;  2QWS A;  4GDB A;  2Q9M A;  4UAA A;  1M6K A;  3IBR A;  2BLS A;  3TOI A;  2PBY A;  4B9O A;  1MWT A;  1VHM A;  3A3J A;  5A93 A;  3Q82 A;  1DP8 A;  4UQI S;  2A3U A;  3K2N A;  5DJU A;  3IXD A;  1SKO B;  3DWK A;  4NXB A;  5FQJ A;  2KOI A;  5HWT A;  2LB9 A;  3G4P A;  4CQH A;  1S4S A;  1E4D A;  1OTD A;  3VP1 A;  3VOZ A;  1XFN A;  5D3O A;  4ZAM A;  4HJ3 A;  3IHA A;  5F83 A;  1FSW A;  2P9V B;  1F9I A;  1FIK A;  3IBJ A;  3OOV A;  1MWS A;  4K0W A;  3S1Y A;  3T4K A;  1GSV A;  3IWQ A;  2QHK A;  3VV4 A;  5HD5 A;  4OH0 A;  4KUO A;  5CGW A;  4DDS A;  4JXW A;  4ZJ2 A;  5FQQ A;  2EX9 A;  4I3J A;  1RGZ A;  5FQI A;  5KSH A;  1YM1 A;  2D01 A;  3JVU A;  2Y2N A;  1OTE A;  1XP4 A;  4FH4 A;  1CEG A;  3LUQ A;  1KVL A;  3EEA A;  1K4E A;  3W2Z A;  1YT4 A;  1KE0 A;  2Z2M B;  3QNC A;  1WYB A;  3ZHH A;  3F1N A;  3U2A A;  3LFV A;  3UY6 A;  3WS1 A;  3LIE A;  3ZGA B;  4PPR A;  3A0S A;  5HZH A;  4WZ4 A;  4HBU A;  2HDS A;  3KYE A;  1P0Z A;  3ZG8 B;  1N9O A;  4ARZ B;  1P97 A;  4EW7 A;  4KQO A;  2V1B A;  5HAQ A;  3T50 A;  4EUV A;  1K6S A;  4WM9 A;  1OTA A;  4IBR A;  1LSX A;  3NOP C;  5GLB A;  1P9R A;  3EQV A;  4II7 A;  1K55 C;  4DXB A;  2XD5 A;  3BY8 A;  4G3V A;  2EA9 A;  2XSS A;  4JF5 A;  3HLG A;  3ZVT A;  4GJ4 A;  3RXX A;  2B18 A;  4HES A;  4E04 A;  3NY4 A;  4GN2 A;  3RFB A;  4JBF A;  1VET A;  1K57 C;  3DTI A;  5FSR A;  1D7E A;  1ALQ A;  1K0K A;  4KEN B;  1TDG A;  4CPK A;  3PBT A;  2EXB A;  5A90 A;  2VZW A;  3OPR A;  1KGG A;  3CMZ A;  2OAQ 1;  1SHV A;  3MFD A;  3V3R A;  2ZQA A;  4PMA A;  1GA9 A;  2JE5 A;  3SH9 A;  3N4I A;  5IU1 A;  3UDX A;  5TR7 A;  4BWI A;  3Q7V A;  5IT5 A;  4G3K A;  4LV1 A;  2W3D A;  1K4F A;  3LI8 A;  4KQQ A;  1N4O A;  2V20 A;  1KDW A;  3VFH A;  3W8K A;  1Z6F A;  1CI8 A;  1L3L A;  5HPI A;  1PWD A;  4DDY A;  2W3G A;  1IYS A;  4BD1 A;  3T1R A;  2M7U A;  4WLA A;  5L2F A;  1PZP A;  1WYC A;  2ZMV A;  4L9G A;  3D3O A;  4Y0T A;  1L0G A;  5EOE A;  2FZ0 A;  4F3L A;  3M2K A;  2OLU A;  4Y13 A;  3JVV A;  2PYR A;  1QME A;  3LIC A;  4KZ6 A;  4FD8 A;  3PAE A;  4YIN A;  1W79 A;  3E2K A;  5HWV A;  3B47 A;  4JGR A;  4DE2 A;  2Y2K A;  3C5A A;  3T12 B;  3T4J A;  2ZMA A;  1YLT A;  3LIB A;  1NZU A;  3G32 A;  2PR5 A;  4Y5F A;  3SS3 A;  5CHJ A;  4S2N C;  5CEC A;  4GZB A;  4O01 A;  1OTI A;  2HP9 A;  4BBU A;  1XXM A;  2HP5 A;  2E8I A;  3IF6 C;  3UB5 P;  4N9K A;  3H7W A;  5JYP A;  5DTT A;  4U0T A;  4P6Z S;  2XR0 A;  3HUM A;  3N7W A;  4U0X A;  5EVE A;  4DRT A;  5FL3 A;  1HVB A;  2ZJ9 A;  3FKV A;  5CXW A;  4E3O A;  3C4P A;  2BAS A;  3K3D A;  3N8S A;  1L0D A;  5LBR A;  2DCF A;  3GSG A;  2VX8 A;  4O7D A;  3HUN A;  2HPB A;  4WL9 A;  3UB7 A;  3MR0 A;  1NY0 A;  3AGD A;  3BW6 A;  4PM8 A;  4I3I A;  4E6X A;  1OME A;  5AQ9 A;  1PW8 A;  4BL3 A;  4EUZ A;  2EXA A;  5JYO A;  3IF5 A;  2PAV P;  2XA7 M;  3IH9 A;  3I7J A;  2WUQ A;  4NXE A;  2HJE A;  2PU4 A;  3A3E A;  5FQK A;  4ETX A;  2RL3 A;  1Q2P A;  3A3F A;  3BJN A;  3SOI A;  4KZ9 A;  1FOF A;  2ZQD A;  2QJ7 A;  3QNB A;  2R9W A;  3GQZ A;  5E2E A;  3VP0 A;  2G2U A;  4BLM A;  1BLP A;  2V8F A;  4EU0 A;  2W3E A;  3AGF A;  5KIZ A;  1MKM A;  3G30 A;  5FA7 A;  4OP8 A;  2FH5 A;  2L0W A;  3T4S A;  4WUJ A;  2V0W A;  2H0Y A;  4K08 A;  2EX8 A;  2ZC6 B;  3IQA A;  2B02 A;  4HP9 A;  2YKH A;  4S2J A;  3QP1 A;  3NDG A;  3CPT B;  4EWF A;  1I5Q A;  3E0Y A;  3EOI A;  1N9L A;  2QMI A;  1XFQ A;  4JF6 A;  4Y7P A;  4AFI A;  2W1T A;  3HJK A;  4ZRR A;  1VQQ A;  3MXS A;  3VMA A;  4MLL A;  1BT5 A;  5J7E A;  4L0L A;  1U60 A;  4E3L A;  3EWK A;  3S22 A;  2K7S A;  3O86 A;  2INW A;  4GS9 A;  3BM6 A;  3CZD A;  2H0T A;  4JF4 A;  5DJT A;  3BFF A;  2PRF A;  2WKE A;  3LIA A;  4XUX A;  5L09 A;  1ESI A;  4RVA A;  2ZC7 A;  3KSF A;  1JVJ A;  2HDR A;  4D2O A;  3P09 A;  1ESU A;  4IUH A;  4E6W A;  5HPF A;  1OT6 A;  5TBM B;  3G35 A;  3IF6 B;  4WZ5 A;  4NET A;  4IVI A;  3T4O A;  3KSG A;  4HI4 A;  1PI5 A;  4JGP A;  5E2F A;  2EX6 A;  3LIF A;  1I2S A;  1DY6 A;  2HDQ A;  3MKE A;  4A5R A;  1G68 A;  3MZF A;  4LGW A;  5EEC A;  5EVI D;  3GTC A;  5GL9 A;  1S1Y A;  5DKK A;  3DTE A;  2WZZ A;  1KVM A;  3W4P A;  3FG8 A;  1K25 A;  3R4K A;  2KDK A;  1HZO A;  2BG1 A;  2GJ3 A;  1SCW A;  3NC8 A;  2O0Y A;  5DF7 A;  1Y28 A;  2MJ6 A;  3UMD A;  2Y8H A;  1KE3 A;  2LB5 A;  3PBO A;  3S7Q A;  2PR6 A;  4GCZ A;  5DTS A;  1NYY A;  1YLY A;  4LV2 A;  3FYZ A;  4OVD A;  4S2O A;  5F69 A;  2VJW A;  5I94 A;  4O8G A;  5AVE A;  2IWD A;  3LR0 A;  4GDN A;  5FAS A;  4GLQ A;  1YQS A;  2ZD8 A;  3SH7 A;  1XA7 A;  3BFC A;  5EE8 A;  1ZG6 A;  3V50 A;  4N9L A;  1PYY A;  4LRZ E;  3JPU A;  3E4P A;  3HRE A;  4KZ3 A;  4CLC D;  1VEU A;  3E2L A;  1K56 D;  4ZJ3 A;  2W3H A;  4WN5 A;  5EPH A;  1Y4O A;  3L9K A;  1PIO A;  2WAF A;  3ISG A;  3HJI A;  3T1S A;  4NK3 A;  3MMH A;  2Z6C A;  4DJ2 A;  3LY3 A;  1NWZ A;  2JHE A;  4HHD A;  4K91 A;  1ES4 A;  3NBL A;  1IOU A;  3LYX A;  3IXB A;  4Y15 A;  3LO7 A;  2XH9 A;  2ZMF A;  2O9C A;  1I2W A;  3KYZ A;  1TS8 A;  2HGV A;  4N1H A;  4EXO A;  1W8Q A;  2Z6D A;  3OPH A;  1AXB A;  5HDS A;  5CED A;  4R3A A;  3TE8 A;  2A2L A;  4EBP A;  1CEF A;  1XPB A;  2ZC4 B;  4MEZ A;  3LGO A;  4ESP A;  3W4O A;  3C8C A;  2Y2O A;  3TSG A;  4XUZ A;  1N9N A;  4OPQ A;  4NXG A;  5CX7 A;  2UWX A;  3IX3 A;  4H6J B;  2P74 A;  3A3D A;  3PXP A;  3LID A;  4RYE A;  4LLO B;  3E4Q A;  2V8C A;  4PKY G;  2A24 B;  1SKO A;  3ZFZ A;  1TVF A;  4X1L A;  2JCH A;  2WGW B;  1RCJ A;  5L07 A;  1MPL A;  4G3W A;  5KSC A;  1S67 L;  2P9V A;  5FI6 A;  4ZDX A;  2P04 A;  1EW0 A;  2WK0 A;  4WMC D;  5FAT A;  4P0M A;  5L10 A;  1ZC2 A;  1ZHH B;  2ZL1 B;  5EVI C;  3BFD A;  3IS2 B;  4HIA A;  2V1A A;  1BLS A;  2WKP A;  1NLZ A;  4C6Y A;  4X68 A;  3WS5 A;  3OBF A;  3UE3 A;  2HP6 A;  1ODV A;  2ZC5 B;  3ZNT A;  4JXG A;  3A3I A;  3N8L A;  3CUE A;  4R4R A;  1ERQ A;  2Z2L B;  5BOH A;  3NOU C;  3GR2 A;  4Y3I A;  3E98 A;  5F1G A;  1S1Z A;  3BEB A;  1SDN A;  5FQ9 A;  1ES5 A;  4WEJ A;  1OTB A;  2J8Y A;  5J3W A;  1F98 A;  2XA7 S;  4ARZ A;  4DKI A;  2J9O A;  2GNX A;  4MMN A;  4X25 A;  3R7W B;  3S7O A;  5CRF A;  1F2K A;  4JGO A;  1FCN A;  4P85 A;  2JKR I;  3UB6 A;  1JWV A;  2VGK A;  3HUO A;  1VET B;  5F1F A;  3MQQ A;  4S2I A;  1KOU A;  3GDI A;  4CLC C;  1ZTU A;  1MBL A;  4P6B A;  1QMF A;  3OCN A;  1LL5 A;  3CIT A;  1GCE A;  2PBD P;  4Y17 A;  1CQA A;  4BJP A;  3PAG A;  5HAI A;  4WF0 A;  2L1M A;  1NLY A;  3FC7 A;  1H0M A;  4EES A;  3L7H A;  3PBQ A;  4LPZ A;  3FWL A;  5EVL A;  2CMN A;  3A0V A;  1K54 C;  5CGS A;  2H10 A;  1IKG A;  1PWG A;  1MWU A;  4Q0I A;  4UA6 A;  4OLG A;  5G18 A;  1TF1 A;  5GHY A;  3Q7V B;  1L2S A;  4FSF A;  5DKL A;  5F5Y A;  4E3M A;  1IEL A;  2W3F A;  3C7V A;  2JKT I;  3VP2 A;  3RXW A;  1XGJ A;  2Y4A A;  4OQG A;  5KMW A;  4S2P A;  1JTG A;  4HJ4 A;  4RA7 A;  3NEC A;  5AQB A;  5HFO A;  3LY4 A;  2P7J A;  1PW1 A;  3OPL A;  1LSV A;  1JWP A;  3ZG9 B;  3NJA A;  4F3L B;  1ZG4 A;  3P98 A;  1PNE A;  3DWZ A;  1NRF A;  5AJG A;  2OOL A;  2Y2Q A;  1FR1 A;  5C5K A;  3WRT A;  3T4L A;  1HLU P;  3IWO A;  1X0O A;  4R38 A;  3MS6 A;  5G4Y A;  4LRX C;  5CTN A;  5EVI B;  5EV0 A;  1YLP A;  4F94 A;  4YNR A;  3IT9 A;  3D9Y A;  3QP6 A;  2Y2I A;  3BLS A;  3F1O B;  1EI5 A;  4EEP A;  4B4Z A;  1DP9 A;  1V9Z A;  2H28 A;  3UE1 A;  3BWL A;  4ZBE A;  5DVA A;  3H82 A;  1MXO A;  1C3B A;  2JC7 A;  3B3X A;  3MQO A;  2XRN A;  4OKP A;  3SS4 A;  1T1C A;  3T4T A;  4QJG A;  4QWO A;  4EBL A;  1YLW A;  4HEF A;  4OQH A;  2ZM0 A;  2PYP A;  4Q0H A;  3FPW A;  3TW8 A;  4EET B;  1GSW A;  2VV8 A;  4QPR A;  1YLJ A;  4I3A A;  4MDZ A;  5G4Z A;  2VV7 A;  4DMZ A;  3EGX C;  5EM1 A;  5TJJ A;  4KZ8 A;  4WEL A;  4YWZ A;  1YAX A;  4BBV A;  4YFM A;  3ZVW A;  1MC0 A;  3Q1F A;  3C30 A;  5TGF A;  1IEM A;  4KZ7 A;  2ZBB A;  4GB7 A;  4CLC B;  1K55 A;  1TDL A;  2VV6 A;  5M18 A;  1W5D A;  1D1J A;  1CJF A;  5HDD A;  4KG6 A;  3F1P A;  1LI0 A;  1OT9 A;  3D4F A;  4B4X A;  1K57 A;  2GDN A;  4QHC A;  3ZG7 B;  1GSX A;  4MNR A;  4RQ9 A;  2CC1 A;  5F6A A;  3HBR A;  3MSH A;  3OCL A;  1BTL A;  1VM1 A;  1TS7 A;  4Q8I A;  3T1X A;  3IXH A;  5FEF A;  1LL9 A;  3WS0 A;  2C6W B;  4JPM A;  1O7E A;  4IBX A;  4U3T A;  3N6I A;  4LV0 A;  4X56 A;  4GW9 A;  2J80 A;  3EQU A;  5FI2 A;  2G7U A;  4MCW A;  2PHY A;  3QHY A;  5J8X A;  1XGI A;  3VSK A;  1S6R A;  5IHV A;  3KYQ A;  1YKD A;  3CPT A;  1JWZ A;  1M40 A;  3VFF A;  4LCM A;  3ZG5 A;  2PD8 A;  3DTK A;  1ES2 A;  1STZ A;  1XJ3 A;  4GS9 B;  3ITA A;  5KZH A;  2V0U A;  3HCY A;  1LI9 A;  2JBF A;  5HAR A;  2BTF P;  5FAP A;  5HL1 A;  1W7F A;  2J3T D;  4DE1 A;  3OZH A;  3ULF A;  4GD6 A;  1XA1 A;  5HL6 A;  3NIA A;  5DF8 A;  1PI4 A;  5MC7 A;  5HAP A;  2DNS A;  5E43 A;  3MFX A;  2ZQC A;  1BSG A;  3RTY A;  3ZCZ A;  2Y59 A;  4OOY A;  4RX2 A;  2GX5 A;  4WMC A;  3MXR A;  1BLC A;  3A0R A;  4S2N A;  4HBT A;  4C75 A;  5TBM A;  3BQ8 A;  4Q0J A;  3IF6 A;  3CLO A;  3MKF A;  3K3C A;  4E3J A;  2J9P A;  3P01 A;  3UNW A;  3P7N A;  2Y79 A;  3GV9 A;  4R6L A;  3IWI A;  4XT2 B;  2QZ6 A;  3WS4 A;  2XGN A;  4HOI A;  1Q2Q A;  2Y2P A;  4BMW A;  3BEC A;  4MN7 A;  4UEY A;  1HTZ A;  4Z9Q A;  5FDS A;  3LEQ A;  1WA9 A;  3MJQ A;  3SW1 A;  4X69 A;  2VK3 A;  3IXG A;  4LFU A;  4KQR A;  1Z09 A;  4ID4 A;  1FSY A;  1FIL A;  4RX3 A;  1H8Z A;  2X71 A;  1G6A A;  4L9E A;  2VKS A;  1BUE A;  2ZC3 B;  1BUL A;  2WGI A;  2WYX A;  1TEM A;  4E3I A;  3NCK A;  4IJG A;  1Y54 A;  4KZA A;  5EUA A;  1LT0 A;  2GZA A;  3TJZ C;  4FOF A;  4KQD A;  4GHI B;  3O5Y A;  3V67 A;  5FI7 A;  1LLB A;  2O9A A;  4C3Q A;  2ZQ9 A;  4EER A;  2OLV A;  3HLC A;  3UPN A;  4BEN A;  2ZOI A;  1SZV A;  3G34 A;  4KZ4 A;  5AVF A;  4EQ1 A;  2WAE A;  4DXC A;  1BYW A;  5HW3 A;  1FCO A;  4IHQ A;  3QP2 A;  4WYY A;  1H5X A;  1S4R A;  1MKI A;  2ZLY A;  4IVK A;  5DTK A;  1SKF A;  1K38 A;  3S7P A;  5HSQ A;  1IYO A;  3WS2 A;  1MZU A;  4LV3 A;  3OLO A;  1OPX A;  2HDU A;  5CHM A;  1UWN X;  2XK1 A;  5CGX A;  4R23 A;  3LR5 A;  4O0P A;  4QY6 A;  1KGE A;  2XFT A;  4P87 A;  5CHU A;  3HVF A;  4KZB A;  3PTE A;  4BQM A;  2PU2 A;  4EQI A;  4S2K A;  3Q81 A;  3E4O A;  5A91 A;  2H5S A;  3PBR A;  3BYD A;  1SDE A;  2HF6 A;  5CEB A;  1O07 A;  2J3T C;  4LEN A;  2VGL M;  1MY8 A;  1FQG A;  1TS6 A;  2PD7 A;  2RCX A;  3DTM A;  2OV5 A;  3G6O A;  3IX4 A;  3T1Q B;  3Q7Z A;  4LCL A;  4KUK A;  4H6J A;  2G2W A;  1E25 A;  3V3S A;  3LEZ A;  3CHW P;  3MF0 A;  2A24 A;  1J3W A;  5FAO A;  3CG5 A;  3VP3 A;  3KO6 A;  4X55 A;  3PBS A;  1IYP A;  2WGW A;  1LSW A;  5U47 A;  2WKR A;  2ZM8 A;  4ETZ A;  4K0X A;  3NUL A;  3BFG A;  2L4R A;  1KGF A;  2M7V A;  3VP4 A;  4OPY A;  4S2L A;  2IWB A;  2FFY A;  2OWH A;  1E3U D;  1GA0 A;  3F1N B;  2XDM A;  3PBN A;  2ZL1 A;  2NUP C;  1GHI A;  3C4O A;  3CJM A;  3HLW A;  3IS2 A;  4IED A;  5DFX A;  4BL2 A;  2JKF A;  2O9B A;  3SH8 A;  4OP5 A;  4R3J A;  2WAD A;  4X6T A;  3UPP A;  1XJ4 A;  2I72 A;  4HH2 A;  3PYP A;  5M1A A;  3SS5 A;  1S66 L;  1PRQ A;  5FAQ A;  1AWI A;  4JXV A;  1RP5 A;  1T19 A;  3UB9 A;  2Y2G A;  3MZD A;  1G28 A;  2EWW A;  2PDR A;  3MXQ A;  5GHX A;  2QJ5 A;  2DMW A;  5AQA A;  4CJN A;  3V39 A;  1H8M A;  2J7V A;  1UWP X;  4HY8 A;  4N1X A;  4L9F A;  2Y91 A;  3PHY A;  4R1G A;  4YOF A;  5DFY A;  1D06 A;  3IX8 A;  1TD5 A;  2C5W B;  3R7W A;  5M19 A;  3O88 A;  2W1R A;  4NG2 A;  3WWX A;  2NUT C;  3DW0 A;  1LL8 A;  3B42 A;  4GNU A;  1OJ5 A;  3NI9 A;  1ONH A;  1W8Y A;  4HNB A;  3G2Y A;  1IFQ A;  3MBZ A;  4FTX A;  3C7U A;  4MBH A;  1ERM A;  5J4E A;  2HZ5 A;  4B88 A;  1DJB A;  3UN7 A;  2DRW A;  1XJ6 A;  2Y2H A;  3LR4 A;  4NKP A;  1F5M A;  2OWJ A;  3EGD C;  2JKR M;  2ZM2 A;  2VA0 A;  2V2F F;  3LR3 A;  3HL9 A;  4QY5 A;  1GHP A;  3BQA A;  1WE4 A;  1NYM A;  2XRO A;  4X53 A;  3FV7 A;  2IWC A;  2KX6 A;  5FDH A;  1YSQ A;  4E3N A;  4NEE D;  2HJ9 C;  5FQM A;  1BZA A;  2UV0 E;  4HJ6 A;  1G5U A;  4PKY A;  5CTM A;  1ACF A;  5EFW A;  2W27 A;  2X02 A;  3UO9 A;  1ONG A;  5AQ7 A;  3RH8 B;  2A49 A;  2WKQ A; 
#chains in the Genus database with same CATH homology
 4QD4 A;  2C6W B;  4JPM A;  1O7E A;  4IBX A;  1YM1 A;  4U3T A;  2Y2N A;  3HLD A;  3N6I A;  2XEP A;  5I94 A;  1XP4 A;  4FH4 A;  4LV0 A;  5FAS A;  1CEG A;  2IWD A;  4GDN A;  4X56 A;  5TFQ A;  3EQU A;  5FI2 A;  1KVL A;  1K4E A;  1YQS A;  2ZD8 A;  3SH7 A;  1YT4 A;  1KE0 A;  1XA7 A;  3BFC A;  5EE8 A;  1ZG6 A;  3V50 A;  4N9L A;  1PYY A;  2Z2M B;  1NXY A;  3QHY A;  3QNC A;  1WYB A;  1HD8 A;  1XGI A;  4UA7 A;  3ZHH A;  2Y2J A;  5J8X A;  4GOG A;  4S2O A;  1XKZ A;  3UY6 A;  4B88 A;  4FH2 A;  3WS1 A;  3HRE A;  3VSK A;  1S6R A;  5IHV A;  5GLA A;  3ZGA B;  4KZ3 A;  4PPR A;  3E2L A;  3NDE A;  1K56 D;  4WZ4 A;  4HBU A;  2HDS A;  1YMS A;  4ZJ3 A;  3AGE A;  3BFE A;  5EPH A;  3ZG8 B;  1JWZ A;  1M40 A;  1PIO A;  2WAF A;  4LCM A;  4WZ5 C;  3ISG A;  3VFF A;  3ZG5 A;  4KQO A;  4NK3 A;  1YMX A;  3LY3 A;  2XD1 A;  1ES2 A;  5HAQ A;  3ITA A;  5EVI A;  1K6S A;  4WM9 A;  4E3K A;  4OQ0 A;  5KZH A;  4K91 A;  1ES4 A;  3NBL A;  1LI9 A;  2JBF A;  3M6B A;  5HAR A;  3IXB A;  3ZNY A;  4GD8 A;  4KG5 A;  3LO7 A;  5F82 A;  5FAP A;  5HL1 A;  2XH9 A;  4IBR A;  1W7F A;  5GLB A;  3EQV A;  4DE1 A;  3OZH A;  2Y2M A;  1I2W A;  4GD6 A;  4ZJ1 A;  2EFX A;  1K55 C;  4DXB A;  1XA1 A;  2XD5 A;  3NIA A;  5DF8 A;  1PI4 A;  1PWC A;  3HLG A;  4JF5 A;  3ZVT A;  2OSU A;  4OON A;  3RXX A;  5HAP A;  2ZQ7 A;  2DNS A;  1FCM A;  4HES A;  5E43 A;  3NY4 A;  3IH8 A;  4GN2 A;  4N1H A;  4JBF A;  2ZQC A;  3FZC A;  1K57 C;  1W8Q A;  5FSR A;  1BSG A;  2XQZ A;  3OPH A;  3HLE A;  2X01 A;  1AXB A;  1ALQ A;  1DJA A;  4PM9 A;  3ZCZ A;  5CED A;  2Y59 A;  4OOY A;  4KEN B;  1TDG A;  4CPK A;  4RX2 A;  3PBT A;  4WMC A;  3MXR A;  1BLC A;  5GLD A;  2EXB A;  5A90 A;  4S2N A;  4EBP A;  1YLZ A;  4HBT A;  3OPR A;  1CEF A;  1KGG A;  1XPB A;  4C75 A;  2ZC4 B;  4MEZ A;  3CMZ A;  5GLC A;  3IF6 A;  3MKF A;  1SHV A;  4UHU A;  3W4O A;  4E3J A;  2Y2O A;  2J9P A;  3TSG A;  4XUZ A;  4OPQ A;  3MFD A;  3V3R A;  4DE0 A;  3UNW A;  2ZQA A;  3WRZ A;  3GV9 A;  4EBN A;  4PMA A;  2UWX A;  3IWI A;  1GA9 A;  2JE5 A;  2P74 A;  3A3D A;  3M2J A;  4KZ5 A;  3SH9 A;  2QZ6 A;  3HLF A;  3WS4 A;  2XGN A;  3N4I A;  3ZG0 A;  3JYI A;  3S4X A;  1Q2Q A;  2Y2P A;  4RYE A;  1ES3 A;  1K6R A;  3BEC A;  3UDX A;  3G31 A;  1K56 A;  3ZFZ A;  1TVF A;  1HTZ A;  4Z9Q A;  2JCH A;  5TR7 A;  2WKI A;  1KDS A;  2WGW B;  3Q7V A;  4OQI A;  4LV1 A;  4Y0O A;  1K4F A;  4QU3 A;  1RCJ A;  4X69 A;  3IXG A;  1RGY A;  4KQR A;  4KQQ A;  1N4O A;  4R0Q A;  2V20 A;  1KDW A;  3VFH A;  1MPL A;  3W8K A;  5KSC A;  1Z6F A;  2P9V A;  1CI8 A;  5FI6 A;  4ZDX A;  3BRM A;  2WK0 A;  4WMC D;  5FAT A;  4P0M A;  4GKU A;  4ID4 A;  3BLM A;  1FSY A;  1ZC2 A;  1PWD A;  2QPN A;  4PM6 A;  4RX3 A;  4DDY A;  4OPZ A;  1H8Z A;  1IYS A;  5EVI C;  2X71 A;  4BD1 A;  1G6A A;  3BFD A;  2ZC3 B;  1BUE A;  4H8R A;  1BUL A;  1BLS A;  5L2F A;  1PZP A;  1WYC A;  2WGI A;  2WYX A;  1K54 A;  1TEM A;  4E3I A;  3NCK A;  5CER A;  1Y54 A;  4KZA A;  4Y0T A;  5EUA A;  1L0G A;  4C6Y A;  4X68 A;  4R4S A;  5EOE A;  4PM7 A;  3GRJ A;  3WS5 A;  3M2K A;  2OLU A;  3UE3 A;  2HP6 A;  1QME A;  2ZC5 B;  4KZ6 A;  4FD8 A;  4UA9 A;  1GHM A;  3PAE A;  4YIN A;  5FI7 A;  1LLB A;  1W79 A;  4C3Q A;  3E2K A;  3ZNT A;  4JXG A;  3A3I A;  2ZQ9 A;  3N8L A;  4KG2 A;  4R4R A;  1ERO A;  2EFU A;  2OLV A;  2Y2L A;  3HLC A;  3UPN A;  4BEN A;  1ERQ A;  4DE2 A;  2Z2L B;  5BOH A;  2Y2K A;  3C5A A;  3GR2 A;  2ZMA A;  1YLT A;  3N8R A;  4N92 A;  3G34 A;  5F1G A;  4KZ4 A;  3BEB A;  1NZU A;  3G32 A;  2Y55 A;  1SDN A;  5FQ9 A;  1ES5 A;  4WEJ A;  3SS3 A;  2WAE A;  1XX2 A;  2J8Y A;  4DXC A;  5CHJ A;  3GVB A;  3O87 A;  5HW3 A;  1FCO A;  4EV4 A;  1CK3 A;  4S2N C;  4WYY A;  1H5X A;  1J9M A;  5CEC A;  4GZB A;  1MKI A;  2ZLY A;  4IVK A;  5DTK A;  1SKF A;  1K38 A;  2HP9 A;  4M3K A;  1IYO A;  1XXM A;  2E8I A;  2HP5 A;  3IF6 C;  3WS2 A;  4DKI A;  2J9O A;  3ITB A;  4N9K A;  4DF6 A;  4LV3 A;  5CRF A;  4QB8 A;  5DTT A;  5JYP A;  4FCF A;  4U0T A;  2HDU A;  1FCN A;  5CHM A;  4P85 A;  2XR0 A;  3HUM A;  3N7W A;  4U0X A;  1IKI A;  2XK1 A;  5CGX A;  1JWV A;  2V1Z A;  2VGK A;  3HUO A;  4R23 A;  4DRT A;  5F1F A;  4S2I A;  1HVB A;  1NJ4 A;  4QY6 A;  2XFT A;  1KGE A;  4P87 A;  5CHU A;  5GHZ A;  2ZJ9 A;  3FKV A;  3HVF A;  4KZB A;  5CXW A;  1MBL A;  4P6B A;  4E3O A;  3PTE A;  3C4P A;  1QMF A;  1NZO A;  3O3V A;  4BQM A;  3N8S A;  2PU2 A;  1L0D A;  3OCN A;  4EQI A;  1LL5 A;  2DCF A;  3GSG A;  4S2K A;  4O7D A;  3GMW A;  3V5M A;  1L0E A;  3HUN A;  3Q81 A;  5A91 A;  2H5S A;  2HPB A;  1GCE A;  3PBR A;  4BJP A;  3PAG A;  1L0F A;  1NY0 A;  2VGJ A;  3AGD A;  2WGV A;  3BYD A;  1S0W A;  4PM8 A;  5HAI A;  4E6X A;  1OME A;  2WKH A;  5AQ9 A;  1SDE A;  3UDI A;  5CEB A;  5DF9 A;  3ZDJ A;  1O07 A;  1PW8 A;  4BL3 A;  4EUZ A;  4Y0U A;  3PBQ A;  2EXA A;  5JYO A;  4LEN A;  4ZTK A;  3FWL A;  1MY8 A;  3IF5 A;  4XXR A;  1E3U A;  1FQG A;  5EVL A;  3G2Z A;  1ZKJ A;  2RCX A;  1K54 C;  3IH9 A;  5CGS A;  3I7J A;  2H10 A;  2WUQ A;  3DTM A;  1IKG A;  2OV5 A;  1PWG A;  1MWU A;  3Q7Z A;  1DJC A;  4OLG A;  4UA6 A;  5G18 A;  2PU4 A;  3A3E A;  2XFS A;  5FQK A;  5GHY A;  3Q7V B;  1L2S A;  4LCL A;  5E2H A;  2R9X A;  3UE0 A;  2RL3 A;  3UDF A;  4R3B A;  4FSF A;  1Q2P A;  3A3F A;  2G2W A;  3OC2 A;  2EX2 A;  1PZO A;  3SOI A;  4KZ9 A;  4OOM A;  1E25 A;  5E2G A;  3VOY A;  3V3S A;  3LEZ A;  1FOF A;  2ZQD A;  4E3M A;  1IEL A;  4OPR A;  3QNB A;  4DE3 A;  3C7V A;  2R9W A;  2XF3 A;  3GQZ A;  5FAO A;  2ZQ8 A;  5E2E A;  3CG5 A;  2B5R A;  3VP3 A;  1EWZ A;  4X55 A;  3PBS A;  1IYP A;  2WGW A;  3VP0 A;  2G2U A;  5U47 A;  4BLM A;  1BLP A;  2ZM8 A;  3VP2 A;  3RXW A;  3M6H A;  1XGJ A;  2Y4A A;  2FFF B;  3AGF A;  3IHB A;  4K0X A;  4OQG A;  4S2P A;  1JTD A;  5KMW A;  1JTG A;  4RA7 A;  3BFG A;  5AQB A;  3G30 A;  5HFO A;  3LY4 A;  5FA7 A;  1PW1 A;  3OPL A;  3TG9 A;  4OP8 A;  1KGF A;  3Q07 A;  4WEK A;  3VP4 A;  1JWP A;  4OPY A;  4S2L A;  2IWB A;  3ZG9 B;  2FFY A;  2WZX A;  1E3U D;  1GA0 A;  1ZG4 A;  2XDM A;  2H0Y A;  1IYQ A;  3P98 A;  2EX8 A;  2ZC6 B;  3IQA A;  3PBN A;  1GHI A;  3C4O A;  3CJM A;  3DWZ A;  3HLW A;  1NRF A;  4IED A;  4S2J A;  4BL2 A;  3NDG A;  4EWF A;  2Y2Q A;  1I5Q A;  1FR1 A;  3SH8 A;  3WRT A;  1MWR A;  3VSL A;  4OP5 A;  4R3J A;  3IWO A;  4WBG A;  5EOO A;  2WAD A;  2QMI A;  4X6T A;  4JF6 A;  4Y7P A;  5CTN A;  2I72 A;  3UPP A;  5A92 A;  5EVI B;  5M1A A;  3SS5 A;  3HLB A;  5FAQ A;  4JXV A;  1YLP A;  1VQQ A;  3MXS A;  4F94 A;  3VMA A;  4MLL A;  5HX9 A;  1RP5 A;  3IT9 A;  3LCE A;  4PM5 A;  1BT5 A;  2Y2G A;  2Y2I A;  3BLS A;  2XLN A;  3MZD A;  1EI5 A;  1BLH A;  4B4Z A;  1LHY A;  4L0L A;  5GHX A;  5KSH A;  1U60 A;  4E3L A;  3S22 A;  5AQA A;  4CJN A;  3O86 A;  3UE1 A;  4MBK A;  4OLD A;  4ZBE A;  3V39 A;  2J7V A;  4JXS A;  5DVA A;  1FR6 A;  1N9B A;  3BM6 A;  4S2M A;  1MXO A;  3OPP A;  1C3B A;  4N1X A;  2JC7 A;  3B3X A;  2Y91 A;  3FKW A;  3UPO A;  4OKP A;  4R1G A;  3CZD A;  2H0T A;  4JF4 A;  3SS4 A;  4QJG A;  3BFF A;  4OOL A;  4EBL A;  1YLW A;  4HEF A;  2WKE A;  2C5W B;  4XUX A;  5M19 A;  3O88 A;  4OQH A;  4BD0 A;  4JLF A;  1ESI A;  3W4Q A;  4RVA A;  2ZC7 A;  2ZM0 A;  1KE4 A;  3WWX A;  1JVJ A;  2HDR A;  3MZE A;  4D2O A;  3RJU A;  3P09 A;  1ESU A;  4MBF A;  4E6W A;  3DW0 A;  4JKT A;  1H8Y A;  1CI9 A;  1YLJ A;  3G35 A;  3IF6 B;  4WZ5 A;  4GNU A;  3NI9 A;  4GDB A;  1ONH A;  4NET A;  1W8Y A;  4KZ8 A;  3G2Y A;  4IVI A;  4WEL A;  2Q9M A;  4UAA A;  3MBZ A;  1M6K A;  3C7U A;  4MBH A;  2BLS A;  1ERM A;  1PI5 A;  4YFM A;  3TOI A;  2PBY A;  3ZVW A;  1MWT A;  3A3J A;  5E2F A;  5A93 A;  3Q1F A;  2EX6 A;  5TGF A;  1I2S A;  1DY6 A;  2HDQ A;  3MKE A;  3Q82 A;  1DJB A;  1IEM A;  4KZ7 A;  2DRW A;  4GB7 A;  2A3U A;  1G68 A;  3UN7 A;  4A5R A;  2Y2H A;  3MZF A;  3IXD A;  5EEC A;  5EVI D;  3DWK A;  1K55 A;  3GTC A;  1TDL A;  5FQJ A;  5GL9 A;  3G4P A;  2WZZ A;  5M18 A;  1W5D A;  1KVM A;  1E4D A;  3W4P A;  3VP1 A;  1K25 A;  3VOZ A;  4KG6 A;  1HZO A;  2BG1 A;  1LI0 A;  2ZM2 A;  1SCW A;  3D4F A;  3NC8 A;  5D3O A;  4ZAM A;  4B4X A;  3IHA A;  2V2F F;  5DF7 A;  1K57 A;  4QY5 A;  3HL9 A;  2GDN A;  5F83 A;  1FSW A;  2P9V B;  1GHP A;  1WE4 A;  1KE3 A;  4QHC A;  1NYM A;  3ZG7 B;  4X53 A;  3FV7 A;  2IWC A;  3PBO A;  4MNR A;  5FDH A;  1MWS A;  2CC1 A;  4K0W A;  4E3N A;  3S1Y A;  5FQM A;  1BZA A;  3IWQ A;  3HBR A;  3OCL A;  5CTM A;  1BTL A;  4OH0 A;  1VM1 A;  5CGW A;  4Q8I A;  5DTS A;  4DDS A;  4JXW A;  4ZJ2 A;  2X02 A;  1NYY A;  1YLY A;  4LV2 A;  5FQQ A;  3UO9 A;  1ONG A;  2EX9 A;  5AQ7 A;  3FYZ A;  1RGZ A;  3IXH A;  5FQI A;  4OVD A;  1LL9 A;  2A49 A;  2Q9N A;  3WS0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...