4GDNA

Structure of fmta-like protein
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
336
structure length
336
Chain Sequence
RLTNDSQQQIDKIIEHDLQKGHIPGASILIVKNGKVFLNKGYGYQDVDKKVKASPTTKYEIASNTKAFTGLAILKLAQEGRLNLNDDVSKHVPHFKMNYNGQNETITIKQLLAQTSGIPSDITSEDAVTNKNNRLNDVTRAIMGDELHHKPGEEFEYSNMNYDLLGLIIQNVTKQSYTKYITNSWLKPLHMTHTSFKQTNNKSKHDAIGYELQGSTPVVSKPEFNLWDTPSAYMMTSTEDLEHWIKFQLNPPDKYKSLVQQSHKNLSSTIGEPNANAYASGWFTNNDEHLVFHSGTLDNFSSFILLNPKQNYGIVVLANLNSEYVPKLVEHLNTQI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein flp
publication title Analysis of Structure-Function Relationships in the Colibactin-Maturating Enzyme ClbP.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 90
structure length 336
sequence length 336
chains with identical sequence B, C, D
ec nomenclature ec 3.5.-.-:
pdb deposition date 2012-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00144 Beta-lactamase Beta-lactamase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 4gdnA00
4HESA 1OMEA 3SH9A 2Q9MA 4GD8A 1DJAA 5KSHA 1XP4A 2XFSA 5CECA 5EVIB 5EVIC 1W5DA 3HLCA 2WGWA 1IYSA 1EWZA 4LV1A 1XGIA 1M6KA 3HLWA 2OLUA 2ZJ9A 3A3JA 4U3TA 5AQAA 4BENA 4YFMA 2WGVA 1I5QA 3BFDA 4BL3A 3A3FA 4GZBA 3M2KA 2IWBA 1FSWA 3FV7A 2E8IA 4WEKA 3ZVWA 4BJPA 1JWPA 4NETA 1ONGA 4RVAA 1XA7A 2IWCA 3CMZA 4LENA 3WWXA 4C3QA 4KZ5A 2HDSA 2Y2MA 4QD4A 3UE3A 5M19A 1QMEA 3ZNYA 4EBLA 5EVID 3MKEA 3BEBA 5E43A 2WZZA 2V2FF 3Q1FA 4UA6A 4WELA 1W79A 2ZC5B 2JCHA 5TFQA 4IBRA 2BG1A 1N9BA 2QZ6A 3HVFA 2EFXA 1EI5A 2Y55A 1E3UD 1K6SA 2WGWB 3BFEA 4DE2A 3NCKA 1MWRA 3BFFA 3P09A 4EV4A 3RJUA 4OPQA 4LV3A 3UE0A 1SKFA 2Y2OA 4Y0UA 4ZJ3A 3BM6A 1YLJA 1GCEA 1GHIA 1K4FA 2Z2LB 3IHAA 3CZDA 3E2KA 3PBSA 2B5RA 5E2FA 5AQ7A 3NBLA 3IQAA 3ISGA 1LL5A 1PZPA 4UAAA 3W4OA 2HPBA 3UN7A 1JWZA 1RP5A 2ZLYA 3WRZA 2WK0A 1ES5A 4EQIA 3AGDA 1K38A 3Q82A 3HREA 5D3OA 3FKWA 4RYEA 1KVLA 4Y0OA 4Q8IA 2WKIA 4WZ5C 3HUNA 1LI9A 4N9KA 4KQOA 2X01A 4PPRA 4E3JA 5FAPA 1PWCA 5HFOA 1H8YA 5GHXA 5DF8A 1G68A 4IBXA 4X6TA 4KZBA 2DNSA 3BFCA 1C3BA 1IYOA 4DDYA 4R3JA 3N8SA 3N7WA 1PIOA 3C4OA 5CGWA 5JYPA 2Y2NA 4UHUA 5EE8A 4PM6A 4F94A 4BD1A 5U47A 5FAQA 1DY6A 1YT4A 5FQ9A 4EUZA 1PYYA 4GD6A 4OQGA 4E3IA 3QNBA 4R23A 4OPYA 1H8ZA 1YLYA 1JTDA 3ZFZA 3FWLA 1MY8A 1ALQA 4OONA 2EX9A 1H5XA 3GSGA 3PAEA 4Z9QA 4EWFA 3M6BA 2XEPA 4Y0TA 1ERQA 3NC8A 2V1ZA 3O3VA 1FR6A 1EROA 4UA7A 5KSCA 1SCWA 4E3NA 5CHMA 1WYCA 2Y4AA 4DRTA 1E25A 4OPRA 5FQQA 1FR1A 3IT9A 2HP6A 3HLDA 4MNRA 1BLSA 2XGNA 5FI2A 3C7VA 1L2SA 1ZG4A 3N8LA 2OLVA 5EECA 1ES3A 4JF4A 5DF7A 3AGFA 3PBTA 4OPZA 1HZOA 5DTSA 1LLBA 2RL3A 3UPPA 2FFFB 3SS5A 3OCLA 3UDIA 2ZC3B 2HP9A 1Q2PA 2ZQ7A 5HL1A 3DWKA 1PWGA 3G32A 1BSGA 1NY0A 3SS3A 2DCFA 2R9WA 4ID4A 3CJMA 5HAPA 3ZG5A 5FAOA 4WBGA 1LL9A 3UY6A 3WS0A 5J8XA 3OCNA 3UNWA 3SH8A 4C6YA 2Y91A 4MBHA 2WKHA 1RCJA 1KE4A 1L0DA 3V5MA 2XD1A 1ES2A 3ZNTA 5TGFA 5EOOA 3SOIA 3QNCA 3E2LA 2EXBA 3UPOA 3HUMA 1PI5A 3IXBA 3OPHA 2ZC6B 3W8KA 2RCXA 4DE3A 3D4FA 5CHJA 5CTNA 3VP0A 4JXSA 1PWDA 3VP2A 5E2HA 3TOIA 5M1AA 1RGZA 1YQSA 3WS2A 2H0TA 2PU2A 4DE0A 1K54A 4FD8A 3LO7A 2WKEA 4DXBA 3DW0A 4LCMA 4U0XA 3SH7A 1ERMA 3MFDA 2X02A 1XA1A 2J8YA 4WM9A 4U0TA 4C75A 1NYMA 1SDEA 3OPLA 4LCLA 2IWDA 1GA0A 2DRWA 3FZCA 3C7UA 2WZXA 4Y7PA 5FSRA 5FDHA 4GOGA 1RGYA 2XQZA 3GR2A 4S2IA 1LHYA 1XKZA 4WZ5A 2XR0A 4QB8A 3VFFA 3V3RA 3MBZA 2J7VA 2J9OA 5E2EA 5I94A 2Y2LA 2ZQDA 3QHYA 3G2ZA 2G2UA 4BLMA 4GKUA 4KG6A 5DF9A 2XF3A 3HL9A 4KENB 1K54C 1ESIA 3LY3A 2C6WB 4PM7A 2WADA 1KDSA 2ZM0A 4R0QA 4S2KA 1ZC2A 1K56A 4QY5A 2I72A 3O86A 4X53A 1HTZA 3VOZA 5HW3A 4RA7A 2VGKA 2PU4A 4OQ0A 4R4SA 1IKGA 1KGEA 4PMAA 1ZKJA 5CERA 1NXYA 4P0MA 5FI6A 5FQIA 1BUEA 4FCFA 4ZTKA 4ZAMA 3CG5A 3C4PA 1TDLA 5EUAA 3NDEA 4JKTA 1YLWA 5G18A 5FASA 5CTMA 4E3OA 4ZJ2A 3W4PA 4R1GA 1NRFA 3O88A 2Y2GA 4R4RA 1JVJA 4KZ7A 2XFTA 1XXMA 2P9VA 3NY4A 4L0LA 1MXOA 4DXCA 4DF6A 4JLFA 4R3BA 2EXAA 3IH9A 1NZUA 5CXWA 4B4XA 3S1YA 4OLGA 3RXWA 3BYDA 4KZ9A 1YM1A 4E6WA 4IEDA 1L0EA 4X69A 3VP3A 3WS4A 5CGSA 1KGGA 3B3XA 1DJBA 3O87A 5CEBA 4N1XA 1O7EA 3HBRA 4GDBA 4WEJA 3IWOA 3Q7VA 4X56A 3SS4A 4CPKA 4B4ZA 1BLHA 2C5WB 4P85A 1PZOA 5HARA 1MWTA 2VGJA 4ZJ1A 5A91A 3HLFA 4BL2A 4UA9A 1BULA 3S4XA 1XGJA 1IKIA 3G31A 4M3KA 3UE1A 5F1GA 3ZG9B 2P9VB 3GVBA 5A90A 3TG9A 1ES4A 3UDXA 1MKIA 3PAGA 4P6BA 3ZGAB 5CEDA 4BQMA 4O7DA 1TEMA 5FQMA 1L0FA 1VQQA 4OKPA 3IF6A 3VOYA 5HAIA 2FFYA 4GB7A 5BOHA 1I2WA 1FCMA 5F83A 2QMIA 3Q7VB 4KZ6A 1W8YA 1K57A 2EX6A 3HLGA 5GLBA 2P74A 1MWSA 2PBYA 1G6AA 1HVBA 1LI0A 3P98A 1W8QA 3BECA 1K25A 2EFUA 4OQHA 1J9MA 4GDNA 3A3IA 1ZG6A 3N8RA 2XK1A 4KQQA 4QY6A 3MXRA 5TR7A 3GRJA 2OV5A 4S2NA 3IWQA 3UPNA 4JF6A 3IH8A 4K91A 2HDUA 4PM8A 4LV2A 5CRFA 3LCEA 1IYQA 1KGFA 4KZAA 3IF6B 1MWUA 3IF6C 5CHUA 1YLZA 3NDGA 4D2OA 4PM5A 3VMAA 4S2LA 5F1FA 4XUXA 3PTEA 2V20A 1N4OA 3HUOA 1K57C 2ZC4B 3MZDA 3ZHHA 4MLLA 4S2MA 3IXDA 2CC1A 4OH0A 1BZAA 1IELA 4OLDA 4EBNA 4N92A 3A3EA 2Y2HA 3BRMA 1VM1A 1FSYA 3JYIA 4OOMA 4RX3A 2H0YA 2JC7A 3N4IA 1KE3A 3TSGA 3OZHA 4S2NC 2XLNA 1CK3A 1NYYA 3MZEA 1S6RA 3UO9A 3LY4A 2A49A 4OP5A 4KG2A 1NJ4A 2Y2JA 4JF5A 2BLSA 2ZMAA 3ZG0A 4B88A 1CI8A 4WMCA 5GLCA 4WZ4A 3IXGA 3GMWA 4JXWA 4DDSA 4HEFA 4E3KA 4QJGA 5GL9A 4MBFA 3WRTA 4N1HA 2ZC7A 3I7JA 2JE5A 2WAEA 2Y2KA 2XDMA 1KE0A 1NZOA 1U60A 5EVLA 3VSKA 4CJNA 2R9XA 2H10A 1JTGA 1KVMA 2Y2PA 5CGXA 5GLDA 4DE1A 1SHVA 2H5SA 4HBTA 3S22A 4K0XA 4E3LA 2HDQA 1YLPA 4QU3A 4A5RA 4FSFA 1W7FA 1Z6FA 3PBNA 1ONHA 3OPPA 3MXSA 2EX2A 2ZQ9A 1PW1A 3Q7ZA 3ITBA 3ZVTA 1AXBA 1ESUA 4X55A 3G34A 1XX2A 4BD0A 3GV9A 1FOFA 2XD5A 2OSUA 3AGEA 1TVFA 2Z2MB 4ZDXA 4IVIA 2HP5A 4E6XA 4OQIA 1PI4A 3EQVA 5DTKA 1SDNA 1IYPA 1FCNA 4N9LA 3BFGA 5DTTA 1GHPA 1DJCA 4S2PA 4FH2A 4OOLA 1FQGA 3DWZA 4KG5A 4WYYA 1K4EA 3FYZA 4S2JA 4XXRA 3IWIA 3VP1A 5AQBA 1BT5A 3VP4A 1BLPA 3MZFA 1IEMA 3N6IA 4WMCD 3Q81A 3GTCA 1WE4A 4OP8A 3M6HA 5EOEA 1KDWA 1BTLA 2WGIA 2HDRA 2ZD8A 4HBUA 4IVKA 2ZQ8A 2J9PA 2ZQCA 1L0GA 3V3SA 4KZ4A 1MBLA 3PBOA 1YLTA 1QMFA 2ZM8A 3A3DA 5F82A 3ZG7B 2QPNA 3ZDJA 2WAFA 1S0WA 2ZM2A 1CEFA 1PW8A 4E3MA 1M40A 2JBFA 3NIAA 4OOYA 1K56D 1JWVA 4K0WA 2Y59A 5A93A 3V39A 1MPLA 2G2WA 3VFHA 3HLEA 3G35A 5A92A 2XH9A 4ZBEA 2X71A 3OPRA 1K55A 3HLBA 5KMWA 3W4QA 1FCOA 5HX9A 5FA7A 5HAQA 4MEZA 3PBQA 5GHZA 2WUQA 3IXHA 5E2GA 1BLCA 4JBFA 4XUZA 3ITAA 5AQ9A 3G30A 1CEGA 4JPMA 3BLSA 4H8RA 1Q2QA 4JXGA 5GLAA 3EQUA 4KZ3A 3FKVA 4S2OA 4LV0A 1XPBA 3V50A 4KZ8A 4YINA 3G2YA 3ZCZA 1Y54A 2EX8A 5M18A 4JXVA 4GN2A 2UWXA 4X68A 4GNUA 3IHBA 3G4PA 4PM9A 1O07A 3NI9A 5GHYA 3UDFA 1WYBA 5EVIA 3GQZA 1K55C 5EPHA 2ZQAA 5FQKA 5FATA 1I2SA 4MBKA 2Y2QA 4P87A 2WYXA 4KQRA 1GA9A 3WS1A 1K6RA 3DTMA 3RXXA 5L2FA 1E3UA 2GDNA 4FH4A 3LEZA 1E4DA 3M2JA 1HD8A 4NK3A 3WS5A 5IHVA 4EBPA 3MKFA 1CI9A 5JYOA 1YMSA 2Y2IA 2Q9NA 3Q07A 1TDGA 5KZHA 5DVAA 4QHCA 1GHMA 4RX2A 4DKIA 3VSLA 5FI7A 3ZG8B 4OVDA 3OC2A 1YMXA 2A3UA 3BLMA 3C5AA 5FQJA 3PBRA 3IF5A
chains in the Genus database with same CATH superfamily
1OMEA 3SH9A 2Q9MA 1XP4A 2INWA 1W5DA 1IYSA 4P6ZM 3HLWA 2M7UA 4U3TA 5AQAA 3QP6A 4F3LA 4BL3A 3NHQA 4WEKA 3ZVWA 4I3AA 4BJPA 1LSVA 1ONGA 3WWXA 3CMZA 4KZ5A 2Y2MA 1L3LA 3BQ8A 3ZNYA 4EBLA 3MKEA 2V2FF 3Q1FA 4WELA 3LFVA 2JCHA 2W3FA 3VV4A 1TS6A 4DE2A 1MWRA 3P09A 4R6LA 4EV4A 3QP4A 2Y2OA 3JVVA 4Y0UA 1YLJA 1GCEA 1GHIA 2Z2LB 3CZDA 3E2KA 5IT5A 3S7NA 3ISGA 4UAAA 3TE8A 2ZLYA 1D06A 1ES5A 1K38A 5D3OA 4Y0OA 4Q8IA 4WZ5C 2X01A 2ZBBA 5FAPA 2V8FA 3KYQA 5GHXA 4X6TA 4KZBA 4DDYA 3K2NA 3N7WA 1EW0A 4PM6A 1YT4A 4OQGA 4OPYA 1H8ZA 1JTDA 4UQIS 1ALQA 2EX9A 4LFUA 4EWFA 3O3VA 2V1ZA 1FR6A 1EROA 1LT0A 4BBTA 1SCWA 5CHMA 1WYCA 2Y4AA 4DRTA 3TJZC 5FQQA 1FR1A 2HP6A 3CAXA 2XGNA 4R3AA 5FI2A 1L2SA 1ZG4A 1ES3A 5DFYA 1HZOA 2RL3A 4BBUA 3MQOA 1Q2PA 1PWGA 2R9WA 5HAPA 5FAOA 4WBGA 5J8XA 3EEHA 3UNWA 4C6YA 1DP9A 1KE4A 1L0DA 4XT2A 2BASA 1NRJA 4MN6A 5EOOA 2KDKA 2Y79A 3QNCA 2EXBA 2VV6A 3HUMA 1LL8A 2RCXA 1XJ4A 5CTNA 2WKPA 1KOUA 2VLGA 2QHKA 2VKSA 1GSXA 4LCMA 3SH7A 1NLYA 2X02A 4U0TA 4XT2B 5IS1A 1SDEA 3C2WA 2VGLS 3LIEA 2WZXA 4Y7PA 2XQZA 1HLUP 2XR0A 3V3RA 4I39A 5I94A 3G2ZA 2G2UA 2O9CA 4KG6A 2C6WB 4O8GA 4PM7A 3DTKA 4S2KA 1FIKA 2I72A 3VOZA 3D9YA 2VGKA 4BWIA 1IKGA 1ZKJA 5CERA 1PFLA 2CMNA 3QP5A 5FQIA 4ZAMA 3T4JA 2VX8A 5IU1A 1YLWA 4E3OA 3T1XA 4R4RA 1JVJA 4KZ7A 3HCYA 2P9VA 4L0LA 4DXCA 4JGPA 4JLFA 2QJ5A 3IH9A 4B4XA 1MC0A 1Y28A 1VETA 2HJ9C 4KZ9A 2Z6CA 4L9EA 2HZ5A 5DKKA 3HBRA 3SS4A 4RQ9A 1PZOA 1MWTA 1V9YA 2VGJA 3H9WA 2FH5A 2KLIA 5F1GA 2P9VB 4Q0HA 3LGOA 3UDXA 1XJ3A 3PAGA 1VETB 1L0FA 3VOYA 2FFYA 3C38A 3PYPA 1K57A 4UEYA 4LRZE 5GLBA 3LIFA 1HVBA 3HJIA 5FDSA 4Z1WA 5MC7A 1SKOA 5TR7A 2OV5A 4S2NA 3BW6A 2PD8A 2HDUA 3RTYA 1IYQA 4KZAA 3T4OA 3P7NA 5CHUA 1YLZA 1G6OA 5F1FA 4FUWA 3HUOA 2PBDP 1K57C 1ODVA 1A0KA 4MLLA 2QYBA 1IELA 4N92A 2Y2HA 1VM1A 1FSYA 4PKYG 1CJFA 3O5YA 1G28A 1KE3A 3TSGA 4S2NC 3B33A 3UO9A 4OP5A 3UMEA 1NJ4A 1CQAA 4HEFA 5GL9A 4HY8A 2Y2KA 3VSKA 2Y2PA 1JTGA 4DE1A 3S22A 3BY9A 4A5RA 3MR0A 1W7FA 2XRNA 3PBNA 1ONHA 3ITBA 4Y15A 1ESUA 5EM0A 4LLOB 1YAXA 4YWZA 3AGEA 1PI4A 3EQVA 5DTKA 1SDNA 1FCNA 4ETXA 3BFGA 1GHPA 1DJCA 3IS2A 3IWIA 1BT5A 1BLPA 4M4XA 3TRCA 4OP8A 3M6HA 5EOEA 2ZD8A 4HP4A 4HBUA 2J9PA 1L0GA 3T12B 3A3DA 2O0YA 3ZG7B 2QPNA 3ZDJA 3KSFA 2ZM2A 4HJ3A 1CEFA 4EETB 1M40A 4OOYA 1P97A 2NUPC 1K56D 1JWVA 2Y59A 3IS2B 3F1PA 1MPLA 2G2WA 3ICYA 3V67A 4O0PA 5A92A 3C30A 2X71A 1FCOA 3L9KA 3UE6A 3IXHA 4DMZA 4HH2A 3G30A 1CEGA 4EEPA 3BLSA 1GSWA 3EQUA 2W3EA 3V50A 1S1YA 4WL9A 2W3GA 4GN2A 4GNUA 3G4PA 3F1PB 1O07A 5GHYA 5EVIA 4NXBA 5EVEA 2ZQAA 4MBKA 2Y2QA 2J3TC 5L2FA 2GDNA 4FH4A 5G4ZA 1E4DA 3BY8A 5IHVA 1TD5A 3WS5A 4EBPA 2QJ7A 2ZOIA 1F5MA 3BLMA 4B4ZA 3IF5A 1UGUA 1DJAA 2XFSA 3T1QB 5EVIB 5EVIC 4HIAA 2WGWA 1LSWA 1ACFA 4LV1A 1OPXA 1XGIA 4R70A 4YFMA 4PAUA 2WGVA 3BFDA 3A3FA 1N9LA 3HJKA 1P0ZA 3T4QA 2E8IA 1JWPA 4C3QA 3UE3A 2HDSA 4UA6A 1W79A 2ZC5B 5TFQA 2EFXA 2Y55A 1E3UD 3T4SA 2WGWB 3KYEA 2O9BA 2XA7M 3DBAA 4LV3A 2W1TA 3IHAA 2IA2A 2B5RA 5AQ7A 3NBLA 4JGQA 5F6AA 5HDSA 4KQDA 2Q0OA 1JWZA 1RP5A 4EW7A 2XSSA 3AGDA 3MFXA 3FKWA 4RYEA 2WKIA 4N9KA 4KQOA 5F69A 1PWCA 1G68A 2DNSA 3BFCA 1IYOA 3F1OA 3PR6A 3LR4A 4EESA 5CGWA 2W1TB 1F9IA 2Y2NA 5EE8A 4BD1A 3VE4A 1PYYA 2W3HA 2HGVA 1WA9A 3GSGA 4Z9QA 3H82A 1UWPX 3NC8A 3F1NA 4UA7A 5HWVA 4FOFA 2M7VA 3CLOA 4OPRA 3F1OB 3HLDA 4HH3A 3GDIA 3DTIA 1S66L 2VA0A 5DF7A 4OPZA 3PBTA 5DTSA 1LLBA 2FFFB 1YSQA 3OCLA 3UDIA 3DWKA 1STZA 3SS3A 3H82B 3CJMA 1BYWA 3ZG5A 3F1NB 2ZMFA 3SH8A 2Y91A 2PD7A 3V5MA 3ZNTA 5TGFA 3KSIA 3SOIA 3UPOA 1PI5A 4E04A 3IXBA 3W8KA 3VP0A 1PWDA 3VP2A 5E2HA 2PYRA 1G5UA 3KO6A 1MZUA 1OTEA 1NLZA 3LO7A 3LIBA 3U2AA 4U0XA 2J8YA 4I38A 4LCLA 3C7UA 5FDHA 4GOGA 3CI6A 2VEAA 1XKZA 2Z6DA 4WZ5A 3VFFA 3MBZA 2J7VA 2J9OA 1YSPA 2ZQDA 3QHYA 4BLMA 4GKUA 2P7JA 3IBJA 5DF9A 2XF3A 3HL9A 5L07A 3EWKA 4WN5A 1ZC2A 1HTZA 5HW3A 3CWFA 4P6ZS 1NXYA 1OT6A 4PKYA 4ZTKA 4QWOA 3CG5A 3OOVA 3C4PA 1TDLA 2G7UA 5EUAA 3BJNA 5CTMA 1NRFA 4GW9A 3O88A 1XXMA 4Q0IA 3NY4A 4R3BA 2EXAA 4OLGA 1YM1A 3EEAA 2A2LA 1KGGA 2PHYA 1O7EA 3JPUA 4GDBA 4WEJA 4X56A 1BLHA 3B42A 4P85A 4ZJ1A 1GSVA 3HLFA 4UA9A 3FG8A 4NXEA 3GECA 3G31A 4M3KA 3NULA 2B95A 3ZG9B 3GVBA 3R7WA 5A90A 1YPRA 1ES4A 3ZGAB 4O7DA 1TEMA 4KUKA 2WKQA 2V0WA 4II7A 1FCMA 5F83A 4KZ6A 2EX6A 2D02A 2P74A 2ACGA 2PBYA 3P98A 1W8QA 4OQHA 1J9MA 3A3IA 4HJ4A 3N8RA 3T4KA 1S1ZA 4QY6A 3GRJA 3R7WB 1AWIA 3IH8A 4K91A 4LV2A 5CRFA 3LCEA 2GJ3A 1MWUA 3NDGA 3VMAA 3DTEA 4XUXA 3MZDA 4S2MA 3NOTC 3A3EA 2W0NA 4GHIA 3JYIA 2H0YA 1NYYA 3MZEA 2A49A 3ZG0A 2Y2JA 1CI8A 4WMCA 4E3KA 4DDSA 4QJGA 1W63Q 1S4SA 2JE5A 1JNUA 4CJNA 1N9OA 2R9XA 5GLDA 1KVMA 1D1JA 3IX4A 3LIDA 4GHIB 4E3LA 2HDQA 4QU3A 3KSGA 2ZQ9A 1PW1A 2KX6A 3G34A 4BD0A 2XD5A 4EU0A 5TJJA 1T1AA 3FPVA 5DTTA 1FILA 4WYYA 3FYZA 3LIAA 1IEMA 3NOPC 2HV1A 3N6IA 3Q81A 1WE4A 1BTLA 3CPTA 2HDRA 2XROA 2ZQ8A 3PBOA 3LR3A 5F82A 5HPFA 4CLCE 2JBFA 4K0WA 3V39A 1IFQA 3HLEA 4G3WA 4ZBEA 5I5LA 3C8CA 3W4QA 5HAQA 4MEZA 3CPTB 2WUQA 1OTAA 5HD3A 5E2GA 4GJ4A 2K2NA 4JBFA 1TS8A 2QKPA 2L4RA 4JPMA 4I5SA 4H8RA 4KZ3A 3FKVA 1XPBA 2O99A 3G2YA 3ZCZA 5M18A 4JXVA 3IHBA 4PM9A 3MQ0A 5FQKA 4HQAA 5FATA 3WS1A 4CQHA 1K6RA 2JKRI 2OAP1 2ZOHA 3RXXA 1K0KA 1T18A 3M2JA 1HD8A 3MKFA 2FZ0A 1YMSA 2Y2IA 4Y13A 1TDGA 5A8BA 4QHCA 4DKIA 5HDDA 4EERA 4IUHA 1TS7A 3OC2A 3C5AA 2J3TD 4HESA 5CECA 2HF6A 5F68A 2QWSA 1M6KA 2OLUA 1I5QA 2IWBA 4Y3IA 1FSWA 4Y2FA 4NETA 1XA7A 2IWCA 4LENA 5M19A 3MSHA 5LBRA 1QMEA 5EVID 4EXOA 3BEBA 5E43A 4I3JA 2WZZA 4ESPA 2BG1A 1N9BA 1EI5A 5HWTA 1X0OA 1T19A 3BFEA 3NCKA 1OTBA 3RJUA 4OPQA 1SKFA 3MS6A 5HL6A 4ZJ3A 3T1RA 4CLCA 3K3DA 2P08A 1OT9A 5E2FA 3IQAA 2HPBA 4HP9A 3WRZA 3OBFA 3Q82A 3HREA 1KVLA 1P9RA 2OWJA 3E0YA 1H8YA 5DF8A 1C3BA 2NUTC 1PRQA 3N8SA 1PIOA 2PT7A 4F94A 5U47A 4CLCB 4CLCC 1DY6A 5FQ9A 4GD6A 4YNRA 4R23A 1D7EA 1MY8A 4G3VA 4OONA 1H5XA 3PAEA 1OTIA 1Z09A 3M6BA 2XEPA 1ERQA 2W3DA 1ZHHB 4E3NA 1E25A 2VV8A 4NXFA 1PNEA 1J3WA 3EGXC 3N8LA 2OLVA 2OWHA 4JF4A 3AGFA 3SS5A 2ZC3B 2HP9A 3G32A 1NY0A 4ID4A 3UY6A 1H3QA 1Y4OA 4B93A 4MBHA 2PAVP 2WKHA 5KIZA 2R78A 3E2LA 2OAQ1 3CUEA 2ZC6B 2JKGA 2L1MA 4JXSA 4X25A 2VK3A 4DN0A 1RGZA 1YQSA 2H0TA 2P04A 4DE0A 3MXQA 4DXBA 4ARZA 1T1CA 3MFDA 1XA1A 4WM9A 3G6OA 1GA0A 2DRWA 1N9NA 3CUEC 4BMWA 4QPRA 4QB8A 5E2EA 3U4LP 2Y2LA 2W27A 4ME4A 2E8JA 4KENB 5FEFA 2WADA 1KDSA 2LB9A 4ARZB 5K5BA 3ZQ5A 1K56A 4QY5A 4X53A 3W2ZA 2PU4A 4R4SA 2JN7A 1KGEA 4PMAA 4P0MA 4DJ3A 1BUEA 4FCFA 1V9ZA 3NDEA 4JKTA 4ZJ2A 3W4PA 4R1GA 2Y2GA 3MMHA 4DF6A 1NZUA 5CXWA 3S1YA 3BYDA 1VHMA 4E6WA 4IEDA 1L0EA 4GS9A 4X69A 4HI4A 1DJBA 2XA7S 2B18A 3O87A 5CEBA 3IWOA 4WLAA 4CPKA 2C5WB 4JGOA 2LB5A 3FC7A 4JGRA 4BL2A 3BWLA 3S4XA 2PR6A 1XGJA 2V0UA 3CHWP 2PYPA 3TG9A 2JKTI 1MKIA 4LPZA 5F5YA 5FQMA 4OKPA 3IF6A 3LI9A 4GLQA 4GS9B 5BOHA 1F2KA 5AVEA 3A0VA 4HJ6A 4X1LA 3HLGA 2WKRA 1MWSA 1G6AA 2J80A 1LI0A 2EFUA 4WUJA 4GDNA 3BQAA 4KQQA 3IWQA 3D72A 3UPNA 4JF6A 3B47A 4PM8A 3IF6B 3IF6C 5HPIA 2H28A 4LRXC 4PM5A 3CITA 4NXGA 4S2LA 3PTEA 3T50A 1N4OA 4NG2A 2OOLA 1TF1A 1NWZA 5J3WA 4OH0A 4OLDA 3BRMA 3PHYA 3SW1A 1CK3A 1S6RA 3LY4A 4KG2A 4B88A 2ZMAA 3E98A 5GLCA 2V1BA 4WZ4A 3GMWA 2ZC7A 3I7JA 1KE0A 2XDMA 1U60A 5EVLA 3S7OA 2H10A 1SHVA 1T1BA 4K0XA 2EWWA 1Z6FA 5G4YA 3Q7ZA 3ZVTA 4X55A 1XX2A 3NJAA 2OSUA 1TVFA 4ZDXA 4UQIM 2HP5A 2YKHA 4F3LB 5HD5A 2UV0E 3TW8A 4S2PA 1FQGA 4KG5A 2AVXA 1K4EA 3VP1A 4XXRA 5AQBA 3MZFA 1DP8A 4WMCD 3GTCA 3V3SA 4KZ4A 4BBVA 2ZM8A 3UB6A 5DJTA 2WAFA 1S0WA 1PW8A 3NIAA 5HSQA 2K31A 5A93A 3G35A 4MN7A 4G3KA 1K55A 5KMWA 5HX9A 3EGDC 3PBQA 5AQ9A 4D60A 1Q2QA 1OJ5A 1DRMA 4S2OA 3S7QA 1Y54A 2EX8A 1ZTUA 2UWXA 4X68A 3NI9A 3UDFA 3MQQA 3GQZA 1K55C 5EPHA 3L7HA 2WYXA 2VGLM 3SZTA 4EUVA 2ZL1A 1P9WA 3UB9A 2A24A 2GZAA 4NK3A 5DVAA 4RX2A 3VSLA 3ZG8B 5FQJA 3PBRA 5HWWA 4MCWA 4GD8A 3UB5P 5KSHA 3KYZA 3H7WA 3E4PA 3HLCA 5TBMA 1EWZA 3A3JA 2ZJ9A 5EV0A 4BENA 1OTDA 4GZBA 3M2KA 3NOUC 2ZL1B 3FV7A 2A24B 4RVAA 1CF0A 4QD4A 3E4QA 2Y8HA 4IBRA 2QZ6A 3HVFA 5FEGA 3IX8A 3H7WB 4HHDA 1K6SA 3QP2A 4AFIA 5TBMB 1F98A 3BFFA 3RFBA 1TS0A 4IHQA 2PDRA 3UE0A 2JKRM 3BM6A 1K4FA 1S67L 1XFNA 3PBSA 1LL5A 1PZPA 3W4OA 3UN7A 1MKMA 2WK0A 4Y5FA 4EQIA 4R38A 3HUNA 1LI9A 4E3JA 4PPRA 5HFOA 4ZRRA 4IBXA 4X1MA 5L09A 3DAVA 4R3JA 5JYPA 3C4OA 4UHUA 5FAQA 4EUZA 4E3IA 3QNBA 1YLYA 2I9VA 3ZFZA 3FWLA 2V8CA 2V1AA 4Y0TA 4B9OA 5KSCA 4CLCD 3S7PA 3IT9A 4MNRA 1BLSA 3C7VA 5HDCA 5EECA 5L8MA 2MJ6A 5HZHA 1H0MA 3UPPA 1DP6A 2ZQ7A 5HL1A 1BSGA 2DCFA 3E4OA 3A0RA 1LL9A 3WS0A 5CX7A 3OCNA 1W63M 1RCJA 2JKFA 2XD1A 1ES2A 3MJQA 3OPHA 4DE3A 4IJGA 3D4FA 3KSHA 5CHJA 4O01A 3LI8A 3TOIA 1S4RA 5M1AA 1IOUA 5EFWA 3WS2A 2PU2A 1K54A 3UB8A 4FD8A 1SKOB 3LICA 3PXPA 2WKEA 5J4EA 3DW0A 1ERMA 2ZMVA 4C75A 1NYMA 4MMNA 1H8MA 3OPLA 2IWDA 3FZCA 5FSRA 1RGYA 3GR2A 4S2IA 1LHYA 5DJUA 4H6JA 2EWVA 3LUQA 1K54C 1ESIA 3LY3A 2YKFA 2ZM0A 4R0QA 2W1RA 3O86A 4DJ2A 4RA7A 4OQ0A 5FI6A 4NKPA 4GCZA 4H6JB 5FASA 5G18A 5FL3A 1VEUA 4NEED 2XFTA 1MXOA 4FTXA 3NECA 3OLOA 3RXWA 3VP3A 3WS4A 5CGSA 3B3XA 4KUOA 2VV7A 4N1XA 3P01A 2M1CA 3Q7VA 5HARA 5A91A 2GX5A 2V9AA 1BULA 1IKIA 1VEUB 3UE1A 5AJGA 1LSXA 4EQ1A 4L9FA 5AVFA 2VJWA 4P6BA 5CEDA 4BQMA 1XJ6A 4MDZA 1VQQA 5HAIA 4GB7A 1I2WA 3K3CA 2B02A 4Q0JA 4LRYC 2QMIA 3Q7VB 1W8YA 3LEQA 1OJGA 1SZVA 4WF0A 1XFQA 3BECA 1K25A 2EA9A 1ZG6A 2XK1A 3MXRA 4L9GA 2PRFA 4ETZA 1KGFA 4D2OA 3EOIA 2V20A 2ZC4B 3ZHHA 3IXDA 2CC1A 1BZAA 1YKDA 4EBNA 1UWNX 4OOMA 4RX3A 2JC7A 3N4IA 3OZHA 4YOFA 2XLNA 4K08A 2JHEA 2BTFP 4MN5A 2JKTM 4JF5A 2BLSA 4HOIA 3VE3A 3LR0A 3IXGA 5DFXA 4JXWA 3T4LA 3WRTA 4MBFA 4N1HA 2WAEA 3QP8A 1NZOA 5CGXA 2H5SA 3IBRA 4HBTA 4IUKA 4LGWA 1YLPA 4FSFA 2DMWA 3OPPA 2EX2A 1AXBA 3ZYTA 3R4KA 3GV9A 1FOFA 2Z2MB 5EM1A 4IVIA 2KOIA 3LR5A 4E6XA 4EEUA 2K7SA 4OQIA 4N9LA 1IYPA 4HNBA 3JVUA 4FH2A 4OOLA 3DWZA 4S2JA 2D01A 3VP4A 3IX3A 2O9AA 1XJ2A 1KDWA 2WGIA 4IVKA 3UB7A 2ZQCA 2GNXA 4Y17A 1MBLA 1YLTA 1QMFA 3A0SA 2J3WA 5L10A 4E3MA 4PHTA 3T4TA 2VZWA 5DKLA 3VFHA 4I3IA 2XH9A 3OPRA 3HLBA 3VOLA 5FA7A 5GHZA 2PR5A 1BLCA 4XUZA 3ITAA 3D3OA 4JXGA 5GLAA 1VB6A 4LV0A 3RH8B 5C5KA 4KZ8A 4YINA 2L0WA 3ULFA 1WYBA 3LYXA 3MF0A 3FPWA 3T1SA 1I2SA 4P87A 4KQRA 1GA9A 3DTMA 1E3UA 5J7EA 3LEZA 1CI9A 5JYOA 3QP1A 2Q9NA 2HJEA 3Q07A 5KZHA 1GHMA 5FI7A 4OVDA 1YMXA 2A3UA 3UMDA 3KX0X 3MXSA
chains in the Genus database with same CATH topology
4HESA 1OMEA 3SH9A 2Q9MA 4GD8A 1DJAA 5KSHA 1XP4A 2XFSA 5CECA 5EVIB 5EVIC 1W5DA 3HLCA 2WGWA 1IYSA 1EWZA 4LV1A 1XGIA 1M6KA 3HLWA 2OLUA 2ZJ9A 3A3JA 4U3TA 5AQAA 4BENA 4YFMA 2WGVA 1I5QA 3BFDA 4BL3A 3A3FA 4GZBA 3M2KA 2IWBA 1FSWA 3FV7A 2E8IA 4WEKA 3ZVWA 4BJPA 1JWPA 4NETA 1ONGA 4RVAA 1XA7A 2IWCA 3CMZA 4LENA 3WWXA 4C3QA 4KZ5A 2HDSA 2Y2MA 4QD4A 3UE3A 5M19A 1QMEA 3ZNYA 4EBLA 5EVID 3MKEA 3BEBA 5E43A 2WZZA 2V2FF 3Q1FA 4UA6A 4WELA 1W79A 2ZC5B 2JCHA 5TFQA 4IBRA 2BG1A 1N9BA 2QZ6A 3HVFA 2EFXA 1EI5A 2Y55A 1E3UD 1K6SA 2WGWB 3BFEA 4DE2A 3NCKA 1MWRA 3BFFA 3P09A 4EV4A 3RJUA 4OPQA 4LV3A 3UE0A 1SKFA 2Y2OA 4Y0UA 4ZJ3A 3BM6A 1YLJA 1GCEA 1GHIA 1K4FA 2Z2LB 3IHAA 3CZDA 3E2KA 3PBSA 2B5RA 5E2FA 5AQ7A 3NBLA 3IQAA 3ISGA 1LL5A 1PZPA 4UAAA 3W4OA 2HPBA 3UN7A 1JWZA 1RP5A 2ZLYA 3WRZA 2WK0A 1ES5A 4EQIA 3AGDA 1K38A 3Q82A 3HREA 5D3OA 3FKWA 4RYEA 1KVLA 4Y0OA 4Q8IA 2WKIA 4WZ5C 3HUNA 1LI9A 4N9KA 4KQOA 2X01A 4PPRA 4E3JA 5FAPA 1PWCA 5HFOA 1H8YA 5GHXA 5DF8A 1G68A 4IBXA 4X6TA 4KZBA 2DNSA 3BFCA 1C3BA 1IYOA 4DDYA 4R3JA 3N8SA 3N7WA 1PIOA 3C4OA 5CGWA 5JYPA 2Y2NA 4UHUA 5EE8A 4PM6A 4F94A 4BD1A 5U47A 5FAQA 1DY6A 1YT4A 5FQ9A 4EUZA 1PYYA 4GD6A 4OQGA 4E3IA 3QNBA 4R23A 4OPYA 1H8ZA 1YLYA 1JTDA 3ZFZA 3FWLA 1MY8A 1ALQA 4OONA 2EX9A 1H5XA 3GSGA 3PAEA 4Z9QA 4EWFA 3M6BA 2XEPA 4Y0TA 1ERQA 3NC8A 2V1ZA 3O3VA 1FR6A 1EROA 4UA7A 5KSCA 1SCWA 4E3NA 5CHMA 1WYCA 2Y4AA 4DRTA 1E25A 4OPRA 5FQQA 1FR1A 3IT9A 2HP6A 3HLDA 4MNRA 1BLSA 2XGNA 5FI2A 3C7VA 1L2SA 1ZG4A 3N8LA 2OLVA 5EECA 1ES3A 4JF4A 5DF7A 3AGFA 3PBTA 4OPZA 1HZOA 5DTSA 1LLBA 2RL3A 3UPPA 2FFFB 3SS5A 3OCLA 3UDIA 2ZC3B 2HP9A 1Q2PA 2ZQ7A 5HL1A 3DWKA 1PWGA 3G32A 1BSGA 1NY0A 3SS3A 2DCFA 2R9WA 4ID4A 3CJMA 5HAPA 3ZG5A 5FAOA 4WBGA 1LL9A 3UY6A 3WS0A 5J8XA 3OCNA 3UNWA 3SH8A 4C6YA 2Y91A 4MBHA 2WKHA 1RCJA 1KE4A 1L0DA 3V5MA 2XD1A 1ES2A 3ZNTA 5TGFA 5EOOA 3SOIA 3QNCA 3E2LA 2EXBA 3UPOA 3HUMA 1PI5A 3IXBA 3OPHA 2ZC6B 3W8KA 2RCXA 4DE3A 3D4FA 5CHJA 5CTNA 3VP0A 4JXSA 1PWDA 3VP2A 5E2HA 3TOIA 5M1AA 1RGZA 1YQSA 3WS2A 2H0TA 2PU2A 4DE0A 1K54A 4FD8A 3LO7A 2WKEA 4DXBA 3DW0A 4LCMA 4U0XA 3SH7A 1ERMA 3MFDA 2X02A 1XA1A 2J8YA 4WM9A 4U0TA 4C75A 1NYMA 1SDEA 3OPLA 4LCLA 2IWDA 1GA0A 2DRWA 3FZCA 3C7UA 2WZXA 4Y7PA 5FSRA 5FDHA 4GOGA 1RGYA 2XQZA 3GR2A 4S2IA 1LHYA 1XKZA 4WZ5A 2XR0A 4QB8A 3VFFA 3V3RA 3MBZA 2J7VA 2J9OA 5E2EA 5I94A 2Y2LA 2ZQDA 3QHYA 3G2ZA 2G2UA 4BLMA 4GKUA 4KG6A 5DF9A 2XF3A 3HL9A 4KENB 1K54C 1ESIA 3LY3A 2C6WB 4PM7A 2WADA 1KDSA 2ZM0A 4R0QA 4S2KA 1ZC2A 1K56A 4QY5A 2I72A 3O86A 4X53A 1HTZA 3VOZA 5HW3A 4RA7A 2VGKA 2PU4A 4OQ0A 4R4SA 1IKGA 1KGEA 4PMAA 1ZKJA 5CERA 1NXYA 4P0MA 5FI6A 5FQIA 1BUEA 4FCFA 4ZTKA 4ZAMA 3CG5A 3C4PA 1TDLA 5EUAA 3NDEA 4JKTA 1YLWA 5G18A 5FASA 5CTMA 4E3OA 4ZJ2A 3W4PA 4R1GA 1NRFA 3O88A 2Y2GA 4R4RA 1JVJA 4KZ7A 2XFTA 1XXMA 2P9VA 3NY4A 4L0LA 1MXOA 4DXCA 4DF6A 4JLFA 4R3BA 2EXAA 3IH9A 1NZUA 5CXWA 4B4XA 3S1YA 4OLGA 3RXWA 3BYDA 4KZ9A 1YM1A 4E6WA 4IEDA 1L0EA 4X69A 3VP3A 3WS4A 5CGSA 1KGGA 3B3XA 1DJBA 3O87A 5CEBA 4N1XA 1O7EA 3HBRA 4GDBA 4WEJA 3IWOA 3Q7VA 4X56A 3SS4A 4CPKA 4B4ZA 1BLHA 2C5WB 4P85A 1PZOA 5HARA 1MWTA 2VGJA 4ZJ1A 5A91A 3HLFA 4BL2A 4UA9A 1BULA 3S4XA 1XGJA 1IKIA 3G31A 4M3KA 3UE1A 5F1GA 3ZG9B 2P9VB 3GVBA 5A90A 3TG9A 1ES4A 3UDXA 1MKIA 3PAGA 4P6BA 3ZGAB 5CEDA 4BQMA 4O7DA 1TEMA 5FQMA 1L0FA 1VQQA 4OKPA 3IF6A 3VOYA 5HAIA 2FFYA 4GB7A 5BOHA 1I2WA 1FCMA 5F83A 2QMIA 3Q7VB 4KZ6A 1W8YA 1K57A 2EX6A 3HLGA 5GLBA 2P74A 1MWSA 2PBYA 1G6AA 1HVBA 1LI0A 3P98A 1W8QA 3BECA 1K25A 2EFUA 4OQHA 1J9MA 4GDNA 3A3IA 1ZG6A 3N8RA 2XK1A 4KQQA 4QY6A 3MXRA 5TR7A 3GRJA 2OV5A 4S2NA 3IWQA 3UPNA 4JF6A 3IH8A 4K91A 2HDUA 4PM8A 4LV2A 5CRFA 3LCEA 1IYQA 1KGFA 4KZAA 3IF6B 1MWUA 3IF6C 5CHUA 1YLZA 3NDGA 4D2OA 4PM5A 3VMAA 4S2LA 5F1FA 4XUXA 3PTEA 2V20A 1N4OA 3HUOA 1K57C 2ZC4B 3MZDA 3ZHHA 4MLLA 4S2MA 3IXDA 2CC1A 4OH0A 1BZAA 1IELA 4OLDA 4EBNA 4N92A 3A3EA 2Y2HA 3BRMA 1VM1A 1FSYA 3JYIA 4OOMA 4RX3A 2H0YA 2JC7A 3N4IA 1KE3A 3TSGA 3OZHA 4S2NC 2XLNA 1CK3A 1NYYA 3MZEA 1S6RA 3UO9A 3LY4A 2A49A 4OP5A 4KG2A 1NJ4A 2Y2JA 4JF5A 2BLSA 2ZMAA 3ZG0A 4B88A 1CI8A 4WMCA 5GLCA 4WZ4A 3IXGA 3GMWA 4JXWA 4DDSA 4HEFA 4E3KA 4QJGA 5GL9A 4MBFA 3WRTA 4N1HA 2ZC7A 3I7JA 2JE5A 2WAEA 2Y2KA 2XDMA 1KE0A 1NZOA 1U60A 5EVLA 3VSKA 4CJNA 2R9XA 2H10A 1JTGA 1KVMA 2Y2PA 5CGXA 5GLDA 4DE1A 1SHVA 2H5SA 4HBTA 3S22A 4K0XA 4E3LA 2HDQA 1YLPA 4QU3A 4A5RA 4FSFA 1W7FA 1Z6FA 3PBNA 1ONHA 3OPPA 3MXSA 2EX2A 2ZQ9A 1PW1A 3Q7ZA 3ITBA 3ZVTA 1AXBA 1ESUA 4X55A 3G34A 1XX2A 4BD0A 3GV9A 1FOFA 2XD5A 2OSUA 3AGEA 1TVFA 2Z2MB 4ZDXA 4IVIA 2HP5A 4E6XA 4OQIA 1PI4A 3EQVA 5DTKA 1SDNA 1IYPA 1FCNA 4N9LA 3BFGA 5DTTA 1GHPA 1DJCA 4S2PA 4FH2A 4OOLA 1FQGA 3DWZA 4KG5A 4WYYA 1K4EA 3FYZA 4S2JA 4XXRA 3IWIA 3VP1A 5AQBA 1BT5A 3VP4A 1BLPA 3MZFA 1IEMA 3N6IA 4WMCD 3Q81A 3GTCA 1WE4A 4OP8A 3M6HA 5EOEA 1KDWA 1BTLA 2WGIA 2HDRA 2ZD8A 4HBUA 4IVKA 2ZQ8A 2J9PA 2ZQCA 1L0GA 3V3SA 4KZ4A 1MBLA 3PBOA 1YLTA 1QMFA 2ZM8A 3A3DA 5F82A 3ZG7B 2QPNA 3ZDJA 2WAFA 1S0WA 2ZM2A 1CEFA 1PW8A 4E3MA 1M40A 2JBFA 3NIAA 4OOYA 1K56D 1JWVA 4K0WA 2Y59A 5A93A 3V39A 1MPLA 2G2WA 3VFHA 3HLEA 3G35A 5A92A 2XH9A 4ZBEA 2X71A 3OPRA 1K55A 3HLBA 5KMWA 3W4QA 1FCOA 5HX9A 5FA7A 5HAQA 4MEZA 3PBQA 5GHZA 2WUQA 3IXHA 5E2GA 1BLCA 4JBFA 4XUZA 3ITAA 5AQ9A 3G30A 1CEGA 4JPMA 3BLSA 4H8RA 1Q2QA 4JXGA 5GLAA 3EQUA 4KZ3A 3FKVA 4S2OA 4LV0A 1XPBA 3V50A 4KZ8A 4YINA 3G2YA 3ZCZA 1Y54A 2EX8A 5M18A 4JXVA 4GN2A 2UWXA 4X68A 4GNUA 3IHBA 3G4PA 4PM9A 1O07A 3NI9A 5GHYA 3UDFA 1WYBA 5EVIA 3GQZA 1K55C 5EPHA 2ZQAA 5FQKA 5FATA 1I2SA 4MBKA 2Y2QA 4P87A 2WYXA 4KQRA 1GA9A 3WS1A 1K6RA 3DTMA 3RXXA 5L2FA 1E3UA 2GDNA 4FH4A 3LEZA 1E4DA 3M2JA 1HD8A 4NK3A 3WS5A 5IHVA 4EBPA 3MKFA 1CI9A 5JYOA 1YMSA 2Y2IA 2Q9NA 3Q07A 1TDGA 5KZHA 5DVAA 4QHCA 1GHMA 4RX2A 4DKIA 3VSLA 5FI7A 3ZG8B 4OVDA 3OC2A 1YMXA 2A3UA 3BLMA 3C5AA 5FQJA 3PBRA 3IF5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HES A;  1OME A;  3SH9 A;  2Q9M A;  4GD8 A;  1DJA A;  5KSH A;  1XP4 A;  2XFS A;  5CEC A;  5EVI B;  5EVI C;  1W5D A;  3HLC A;  2WGW A;  1IYS A;  1EWZ A;  4LV1 A;  1XGI A;  1M6K A;  3HLW A;  2OLU A;  2ZJ9 A;  3A3J A;  4U3T A;  5AQA A;  4BEN A;  4YFM A;  2WGV A;  1I5Q A;  3BFD A;  4BL3 A;  3A3F A;  4GZB A;  3M2K A;  2IWB A;  1FSW A;  3FV7 A;  2E8I A;  4WEK A;  3ZVW A;  4BJP A;  1JWP A;  4NET A;  1ONG A;  4RVA A;  1XA7 A;  2IWC A;  3CMZ A;  4LEN A;  3WWX A;  4C3Q A;  4KZ5 A;  2HDS A;  2Y2M A;  4QD4 A;  3UE3 A;  5M19 A;  1QME A;  3ZNY A;  4EBL A;  5EVI D;  3MKE A;  3BEB A;  5E43 A;  2WZZ A;  2V2F F;  3Q1F A;  4UA6 A;  4WEL A;  1W79 A;  2ZC5 B;  2JCH A;  5TFQ A;  4IBR A;  2BG1 A;  1N9B A;  2QZ6 A;  3HVF A;  2EFX A;  1EI5 A;  2Y55 A;  1E3U D;  1K6S A;  2WGW B;  3BFE A;  4DE2 A;  3NCK A;  1MWR A;  3BFF A;  3P09 A;  4EV4 A;  3RJU A;  4OPQ A;  4LV3 A;  3UE0 A;  1SKF A;  2Y2O A;  4Y0U A;  4ZJ3 A;  3BM6 A;  1YLJ A;  1GCE A;  1GHI A;  1K4F A;  2Z2L B;  3IHA A;  3CZD A;  3E2K A;  3PBS A;  2B5R A;  5E2F A;  5AQ7 A;  3NBL A;  3IQA A;  3ISG A;  1LL5 A;  1PZP A;  4UAA A;  3W4O A;  2HPB A;  3UN7 A;  1JWZ A;  1RP5 A;  2ZLY A;  3WRZ A;  2WK0 A;  1ES5 A;  4EQI A;  3AGD A;  1K38 A;  3Q82 A;  3HRE A;  5D3O A;  3FKW A;  4RYE A;  1KVL A;  4Y0O A;  4Q8I A;  2WKI A;  4WZ5 C;  3HUN A;  1LI9 A;  4N9K A;  4KQO A;  2X01 A;  4PPR A;  4E3J A;  5FAP A;  1PWC A;  5HFO A;  1H8Y A;  5GHX A;  5DF8 A;  1G68 A;  4IBX A;  4X6T A;  4KZB A;  2DNS A;  3BFC A;  1C3B A;  1IYO A;  4DDY A;  4R3J A;  3N8S A;  3N7W A;  1PIO A;  3C4O A;  5CGW A;  5JYP A;  2Y2N A;  4UHU A;  5EE8 A;  4PM6 A;  4F94 A;  4BD1 A;  5U47 A;  5FAQ A;  1DY6 A;  1YT4 A;  5FQ9 A;  4EUZ A;  1PYY A;  4GD6 A;  4OQG A;  4E3I A;  3QNB A;  4R23 A;  4OPY A;  1H8Z A;  1YLY A;  1JTD A;  3ZFZ A;  3FWL A;  1MY8 A;  1ALQ A;  4OON A;  2EX9 A;  1H5X A;  3GSG A;  3PAE A;  4Z9Q A;  4EWF A;  3M6B A;  2XEP A;  4Y0T A;  1ERQ A;  3NC8 A;  2V1Z A;  3O3V A;  1FR6 A;  1ERO A;  4UA7 A;  5KSC A;  1SCW A;  4E3N A;  5CHM A;  1WYC A;  2Y4A A;  4DRT A;  1E25 A;  4OPR A;  5FQQ A;  1FR1 A;  3IT9 A;  2HP6 A;  3HLD A;  4MNR A;  1BLS A;  2XGN A;  5FI2 A;  3C7V A;  1L2S A;  1ZG4 A;  3N8L A;  2OLV A;  5EEC A;  1ES3 A;  4JF4 A;  5DF7 A;  3AGF A;  3PBT A;  4OPZ A;  1HZO A;  5DTS A;  1LLB A;  2RL3 A;  3UPP A;  2FFF B;  3SS5 A;  3OCL A;  3UDI A;  2ZC3 B;  2HP9 A;  1Q2P A;  2ZQ7 A;  5HL1 A;  3DWK A;  1PWG A;  3G32 A;  1BSG A;  1NY0 A;  3SS3 A;  2DCF A;  2R9W A;  4ID4 A;  3CJM A;  5HAP A;  3ZG5 A;  5FAO A;  4WBG A;  1LL9 A;  3UY6 A;  3WS0 A;  5J8X A;  3OCN A;  3UNW A;  3SH8 A;  4C6Y A;  2Y91 A;  4MBH A;  2WKH A;  1RCJ A;  1KE4 A;  1L0D A;  3V5M A;  2XD1 A;  1ES2 A;  3ZNT A;  5TGF A;  5EOO A;  3SOI A;  3QNC A;  3E2L A;  2EXB A;  3UPO A;  3HUM A;  1PI5 A;  3IXB A;  3OPH A;  2ZC6 B;  3W8K A;  2RCX A;  4DE3 A;  3D4F A;  5CHJ A;  5CTN A;  3VP0 A;  4JXS A;  1PWD A;  3VP2 A;  5E2H A;  3TOI A;  5M1A A;  1RGZ A;  1YQS A;  3WS2 A;  2H0T A;  2PU2 A;  4DE0 A;  1K54 A;  4FD8 A;  3LO7 A;  2WKE A;  4DXB A;  3DW0 A;  4LCM A;  4U0X A;  3SH7 A;  1ERM A;  3MFD A;  2X02 A;  1XA1 A;  2J8Y A;  4WM9 A;  4U0T A;  4C75 A;  1NYM A;  1SDE A;  3OPL A;  4LCL A;  2IWD A;  1GA0 A;  2DRW A;  3FZC A;  3C7U A;  2WZX A;  4Y7P A;  5FSR A;  5FDH A;  4GOG A;  1RGY A;  2XQZ A;  3GR2 A;  4S2I A;  1LHY A;  1XKZ A;  4WZ5 A;  2XR0 A;  4QB8 A;  3VFF A;  3V3R A;  3MBZ A;  2J7V A;  2J9O A;  5E2E A;  5I94 A;  2Y2L A;  2ZQD A;  3QHY A;  3G2Z A;  2G2U A;  4BLM A;  4GKU A;  4KG6 A;  5DF9 A;  2XF3 A;  3HL9 A;  4KEN B;  1K54 C;  1ESI A;  3LY3 A;  2C6W B;  4PM7 A;  2WAD A;  1KDS A;  2ZM0 A;  4R0Q A;  4S2K A;  1ZC2 A;  1K56 A;  4QY5 A;  2I72 A;  3O86 A;  4X53 A;  1HTZ A;  3VOZ A;  5HW3 A;  4RA7 A;  2VGK A;  2PU4 A;  4OQ0 A;  4R4S A;  1IKG A;  1KGE A;  4PMA A;  1ZKJ A;  5CER A;  1NXY A;  4P0M A;  5FI6 A;  5FQI A;  1BUE A;  4FCF A;  4ZTK A;  4ZAM A;  3CG5 A;  3C4P A;  1TDL A;  5EUA A;  3NDE A;  4JKT A;  1YLW A;  5G18 A;  5FAS A;  5CTM A;  4E3O A;  4ZJ2 A;  3W4P A;  4R1G A;  1NRF A;  3O88 A;  2Y2G A;  4R4R A;  1JVJ A;  4KZ7 A;  2XFT A;  1XXM A;  2P9V A;  3NY4 A;  4L0L A;  1MXO A;  4DXC A;  4DF6 A;  4JLF A;  4R3B A;  2EXA A;  3IH9 A;  1NZU A;  5CXW A;  4B4X A;  3S1Y A;  4OLG A;  3RXW A;  3BYD A;  4KZ9 A;  1YM1 A;  4E6W A;  4IED A;  1L0E A;  4X69 A;  3VP3 A;  3WS4 A;  5CGS A;  1KGG A;  3B3X A;  1DJB A;  3O87 A;  5CEB A;  4N1X A;  1O7E A;  3HBR A;  4GDB A;  4WEJ A;  3IWO A;  3Q7V A;  4X56 A;  3SS4 A;  4CPK A;  4B4Z A;  1BLH A;  2C5W B;  4P85 A;  1PZO A;  5HAR A;  1MWT A;  2VGJ A;  4ZJ1 A;  5A91 A;  3HLF A;  4BL2 A;  4UA9 A;  1BUL A;  3S4X A;  1XGJ A;  1IKI A;  3G31 A;  4M3K A;  3UE1 A;  5F1G A;  3ZG9 B;  2P9V B;  3GVB A;  5A90 A;  3TG9 A;  1ES4 A;  3UDX A;  1MKI A;  3PAG A;  4P6B A;  3ZGA B;  5CED A;  4BQM A;  4O7D A;  1TEM A;  5FQM A;  1L0F A;  1VQQ A;  4OKP A;  3IF6 A;  3VOY A;  5HAI A;  2FFY A;  4GB7 A;  5BOH A;  1I2W A;  1FCM A;  5F83 A;  2QMI A;  3Q7V B;  4KZ6 A;  1W8Y A;  1K57 A;  2EX6 A;  3HLG A;  5GLB A;  2P74 A;  1MWS A;  2PBY A;  1G6A A;  1HVB A;  1LI0 A;  3P98 A;  1W8Q A;  3BEC A;  1K25 A;  2EFU A;  4OQH A;  1J9M A;  4GDN A;  3A3I A;  1ZG6 A;  3N8R A;  2XK1 A;  4KQQ A;  4QY6 A;  3MXR A;  5TR7 A;  3GRJ A;  2OV5 A;  4S2N A;  3IWQ A;  3UPN A;  4JF6 A;  3IH8 A;  4K91 A;  2HDU A;  4PM8 A;  4LV2 A;  5CRF A;  3LCE A;  1IYQ A;  1KGF A;  4KZA A;  3IF6 B;  1MWU A;  3IF6 C;  5CHU A;  1YLZ A;  3NDG A;  4D2O A;  4PM5 A;  3VMA A;  4S2L A;  5F1F A;  4XUX A;  3PTE A;  2V20 A;  1N4O A;  3HUO A;  1K57 C;  2ZC4 B;  3MZD A;  3ZHH A;  4MLL A;  4S2M A;  3IXD A;  2CC1 A;  4OH0 A;  1BZA A;  1IEL A;  4OLD A;  4EBN A;  4N92 A;  3A3E A;  2Y2H A;  3BRM A;  1VM1 A;  1FSY A;  3JYI A;  4OOM A;  4RX3 A;  2H0Y A;  2JC7 A;  3N4I A;  1KE3 A;  3TSG A;  3OZH A;  4S2N C;  2XLN A;  1CK3 A;  1NYY A;  3MZE A;  1S6R A;  3UO9 A;  3LY4 A;  2A49 A;  4OP5 A;  4KG2 A;  1NJ4 A;  2Y2J A;  4JF5 A;  2BLS A;  2ZMA A;  3ZG0 A;  4B88 A;  1CI8 A;  4WMC A;  5GLC A;  4WZ4 A;  3IXG A;  3GMW A;  4JXW A;  4DDS A;  4HEF A;  4E3K A;  4QJG A;  5GL9 A;  4MBF A;  3WRT A;  4N1H A;  2ZC7 A;  3I7J A;  2JE5 A;  2WAE A;  2Y2K A;  2XDM A;  1KE0 A;  1NZO A;  1U60 A;  5EVL A;  3VSK A;  4CJN A;  2R9X A;  2H10 A;  1JTG A;  1KVM A;  2Y2P A;  5CGX A;  5GLD A;  4DE1 A;  1SHV A;  2H5S A;  4HBT A;  3S22 A;  4K0X A;  4E3L A;  2HDQ A;  1YLP A;  4QU3 A;  4A5R A;  4FSF A;  1W7F A;  1Z6F A;  3PBN A;  1ONH A;  3OPP A;  3MXS A;  2EX2 A;  2ZQ9 A;  1PW1 A;  3Q7Z A;  3ITB A;  3ZVT A;  1AXB A;  1ESU A;  4X55 A;  3G34 A;  1XX2 A;  4BD0 A;  3GV9 A;  1FOF A;  2XD5 A;  2OSU A;  3AGE A;  1TVF A;  2Z2M B;  4ZDX A;  4IVI A;  2HP5 A;  4E6X A;  4OQI A;  1PI4 A;  3EQV A;  5DTK A;  1SDN A;  1IYP A;  1FCN A;  4N9L A;  3BFG A;  5DTT A;  1GHP A;  1DJC A;  4S2P A;  4FH2 A;  4OOL A;  1FQG A;  3DWZ A;  4KG5 A;  4WYY A;  1K4E A;  3FYZ A;  4S2J A;  4XXR A;  3IWI A;  3VP1 A;  5AQB A;  1BT5 A;  3VP4 A;  1BLP A;  3MZF A;  1IEM A;  3N6I A;  4WMC D;  3Q81 A;  3GTC A;  1WE4 A;  4OP8 A;  3M6H A;  5EOE A;  1KDW A;  1BTL A;  2WGI A;  2HDR A;  2ZD8 A;  4HBU A;  4IVK A;  2ZQ8 A;  2J9P A;  2ZQC A;  1L0G A;  3V3S A;  4KZ4 A;  1MBL A;  3PBO A;  1YLT A;  1QMF A;  2ZM8 A;  3A3D A;  5F82 A;  3ZG7 B;  2QPN A;  3ZDJ A;  2WAF A;  1S0W A;  2ZM2 A;  1CEF A;  1PW8 A;  4E3M A;  1M40 A;  2JBF A;  3NIA A;  4OOY A;  1K56 D;  1JWV A;  4K0W A;  2Y59 A;  5A93 A;  3V39 A;  1MPL A;  2G2W A;  3VFH A;  3HLE A;  3G35 A;  5A92 A;  2XH9 A;  4ZBE A;  2X71 A;  3OPR A;  1K55 A;  3HLB A;  5KMW A;  3W4Q A;  1FCO A;  5HX9 A;  5FA7 A;  5HAQ A;  4MEZ A;  3PBQ A;  5GHZ A;  2WUQ A;  3IXH A;  5E2G A;  1BLC A;  4JBF A;  4XUZ A;  3ITA A;  5AQ9 A;  3G30 A;  1CEG A;  4JPM A;  3BLS A;  4H8R A;  1Q2Q A;  4JXG A;  5GLA A;  3EQU A;  4KZ3 A;  3FKV A;  4S2O A;  4LV0 A;  1XPB A;  3V50 A;  4KZ8 A;  4YIN A;  3G2Y A;  3ZCZ A;  1Y54 A;  2EX8 A;  5M18 A;  4JXV A;  4GN2 A;  2UWX A;  4X68 A;  4GNU A;  3IHB A;  3G4P A;  4PM9 A;  1O07 A;  3NI9 A;  5GHY A;  3UDF A;  1WYB A;  5EVI A;  3GQZ A;  1K55 C;  5EPH A;  2ZQA A;  5FQK A;  5FAT A;  1I2S A;  4MBK A;  2Y2Q A;  4P87 A;  2WYX A;  4KQR A;  1GA9 A;  3WS1 A;  1K6R A;  3DTM A;  3RXX A;  5L2F A;  1E3U A;  2GDN A;  4FH4 A;  3LEZ A;  1E4D A;  3M2J A;  1HD8 A;  4NK3 A;  3WS5 A;  5IHV A;  4EBP A;  3MKF A;  1CI9 A;  5JYO A;  1YMS A;  2Y2I A;  2Q9N A;  3Q07 A;  1TDG A;  5KZH A;  5DVA A;  4QHC A;  1GHM A;  4RX2 A;  4DKI A;  3VSL A;  5FI7 A;  3ZG8 B;  4OVD A;  3OC2 A;  1YMX A;  2A3U A;  3BLM A;  3C5A A;  5FQJ A;  3PBR A;  3IF5 A; 
#chains in the Genus database with same CATH topology
 1OME A;  3SH9 A;  2Q9M A;  1XP4 A;  2INW A;  1W5D A;  1IYS A;  4P6Z M;  3HLW A;  2M7U A;  4U3T A;  5AQA A;  3QP6 A;  4F3L A;  4BL3 A;  3NHQ A;  4WEK A;  3ZVW A;  4I3A A;  4BJP A;  1LSV A;  1ONG A;  3WWX A;  3CMZ A;  4KZ5 A;  2Y2M A;  1L3L A;  3BQ8 A;  3ZNY A;  4EBL A;  3MKE A;  2V2F F;  3Q1F A;  4WEL A;  3LFV A;  2JCH A;  2W3F A;  3VV4 A;  1TS6 A;  4DE2 A;  1MWR A;  3P09 A;  4R6L A;  4EV4 A;  3QP4 A;  2Y2O A;  3JVV A;  4Y0U A;  1YLJ A;  1GCE A;  1GHI A;  2Z2L B;  3CZD A;  3E2K A;  5IT5 A;  3S7N A;  3ISG A;  4UAA A;  3TE8 A;  2ZLY A;  1D06 A;  1ES5 A;  1K38 A;  5D3O A;  4Y0O A;  4Q8I A;  4WZ5 C;  2X01 A;  2ZBB A;  5FAP A;  2V8F A;  3KYQ A;  5GHX A;  4X6T A;  4KZB A;  4DDY A;  3K2N A;  3N7W A;  1EW0 A;  4PM6 A;  1YT4 A;  4OQG A;  4OPY A;  1H8Z A;  1JTD A;  4UQI S;  1ALQ A;  2EX9 A;  4LFU A;  4EWF A;  3O3V A;  2V1Z A;  1FR6 A;  1ERO A;  1LT0 A;  4BBT A;  1SCW A;  5CHM A;  1WYC A;  2Y4A A;  4DRT A;  3TJZ C;  5FQQ A;  1FR1 A;  2HP6 A;  3CAX A;  2XGN A;  4R3A A;  5FI2 A;  1L2S A;  1ZG4 A;  1ES3 A;  5DFY A;  1HZO A;  2RL3 A;  4BBU A;  3MQO A;  1Q2P A;  1PWG A;  2R9W A;  5HAP A;  5FAO A;  4WBG A;  5J8X A;  3EEH A;  3UNW A;  4C6Y A;  1DP9 A;  1KE4 A;  1L0D A;  4XT2 A;  2BAS A;  1NRJ A;  4MN6 A;  5EOO A;  2KDK A;  2Y79 A;  3QNC A;  2EXB A;  2VV6 A;  3HUM A;  1LL8 A;  2RCX A;  1XJ4 A;  5CTN A;  2WKP A;  1KOU A;  2VLG A;  2QHK A;  2VKS A;  1GSX A;  4LCM A;  3SH7 A;  1NLY A;  2X02 A;  4U0T A;  4XT2 B;  5IS1 A;  1SDE A;  3C2W A;  2VGL S;  3LIE A;  2WZX A;  4Y7P A;  2XQZ A;  1HLU P;  2XR0 A;  3V3R A;  4I39 A;  5I94 A;  3G2Z A;  2G2U A;  2O9C A;  4KG6 A;  2C6W B;  4O8G A;  4PM7 A;  3DTK A;  4S2K A;  1FIK A;  2I72 A;  3VOZ A;  3D9Y A;  2VGK A;  4BWI A;  1IKG A;  1ZKJ A;  5CER A;  1PFL A;  2CMN A;  3QP5 A;  5FQI A;  4ZAM A;  3T4J A;  2VX8 A;  5IU1 A;  1YLW A;  4E3O A;  3T1X A;  4R4R A;  1JVJ A;  4KZ7 A;  3HCY A;  2P9V A;  4L0L A;  4DXC A;  4JGP A;  4JLF A;  2QJ5 A;  3IH9 A;  4B4X A;  1MC0 A;  1Y28 A;  1VET A;  2HJ9 C;  4KZ9 A;  2Z6C A;  4L9E A;  2HZ5 A;  5DKK A;  3HBR A;  3SS4 A;  4RQ9 A;  1PZO A;  1MWT A;  1V9Y A;  2VGJ A;  3H9W A;  2FH5 A;  2KLI A;  5F1G A;  2P9V B;  4Q0H A;  3LGO A;  3UDX A;  1XJ3 A;  3PAG A;  1VET B;  1L0F A;  3VOY A;  2FFY A;  3C38 A;  3PYP A;  1K57 A;  4UEY A;  4LRZ E;  5GLB A;  3LIF A;  1HVB A;  3HJI A;  5FDS A;  4Z1W A;  5MC7 A;  1SKO A;  5TR7 A;  2OV5 A;  4S2N A;  3BW6 A;  2PD8 A;  2HDU A;  3RTY A;  1IYQ A;  4KZA A;  3T4O A;  3P7N A;  5CHU A;  1YLZ A;  1G6O A;  5F1F A;  4FUW A;  3HUO A;  2PBD P;  1K57 C;  1ODV A;  1A0K A;  4MLL A;  2QYB A;  1IEL A;  4N92 A;  2Y2H A;  1VM1 A;  1FSY A;  4PKY G;  1CJF A;  3O5Y A;  1G28 A;  1KE3 A;  3TSG A;  4S2N C;  3B33 A;  3UO9 A;  4OP5 A;  3UME A;  1NJ4 A;  1CQA A;  4HEF A;  5GL9 A;  4HY8 A;  2Y2K A;  3VSK A;  2Y2P A;  1JTG A;  4DE1 A;  3S22 A;  3BY9 A;  4A5R A;  3MR0 A;  1W7F A;  2XRN A;  3PBN A;  1ONH A;  3ITB A;  4Y15 A;  1ESU A;  5EM0 A;  4LLO B;  1YAX A;  4YWZ A;  3AGE A;  1PI4 A;  3EQV A;  5DTK A;  1SDN A;  1FCN A;  4ETX A;  3BFG A;  1GHP A;  1DJC A;  3IS2 A;  3IWI A;  1BT5 A;  1BLP A;  4M4X A;  3TRC A;  4OP8 A;  3M6H A;  5EOE A;  2ZD8 A;  4HP4 A;  4HBU A;  2J9P A;  1L0G A;  3T12 B;  3A3D A;  2O0Y A;  3ZG7 B;  2QPN A;  3ZDJ A;  3KSF A;  2ZM2 A;  4HJ3 A;  1CEF A;  4EET B;  1M40 A;  4OOY A;  1P97 A;  2NUP C;  1K56 D;  1JWV A;  2Y59 A;  3IS2 B;  3F1P A;  1MPL A;  2G2W A;  3ICY A;  3V67 A;  4O0P A;  5A92 A;  3C30 A;  2X71 A;  1FCO A;  3L9K A;  3UE6 A;  3IXH A;  4DMZ A;  4HH2 A;  3G30 A;  1CEG A;  4EEP A;  3BLS A;  1GSW A;  3EQU A;  2W3E A;  3V50 A;  1S1Y A;  4WL9 A;  2W3G A;  4GN2 A;  4GNU A;  3G4P A;  3F1P B;  1O07 A;  5GHY A;  5EVI A;  4NXB A;  5EVE A;  2ZQA A;  4MBK A;  2Y2Q A;  2J3T C;  5L2F A;  2GDN A;  4FH4 A;  5G4Z A;  1E4D A;  3BY8 A;  5IHV A;  1TD5 A;  3WS5 A;  4EBP A;  2QJ7 A;  2ZOI A;  1F5M A;  3BLM A;  4B4Z A;  3IF5 A;  1UGU A;  1DJA A;  2XFS A;  3T1Q B;  5EVI B;  5EVI C;  4HIA A;  2WGW A;  1LSW A;  1ACF A;  4LV1 A;  1OPX A;  1XGI A;  4R70 A;  4YFM A;  4PAU A;  2WGV A;  3BFD A;  3A3F A;  1N9L A;  3HJK A;  1P0Z A;  3T4Q A;  2E8I A;  1JWP A;  4C3Q A;  3UE3 A;  2HDS A;  4UA6 A;  1W79 A;  2ZC5 B;  5TFQ A;  2EFX A;  2Y55 A;  1E3U D;  3T4S A;  2WGW B;  3KYE A;  2O9B A;  2XA7 M;  3DBA A;  4LV3 A;  2W1T A;  3IHA A;  2IA2 A;  2B5R A;  5AQ7 A;  3NBL A;  4JGQ A;  5F6A A;  5HDS A;  4KQD A;  2Q0O A;  1JWZ A;  1RP5 A;  4EW7 A;  2XSS A;  3AGD A;  3MFX A;  3FKW A;  4RYE A;  2WKI A;  4N9K A;  4KQO A;  5F69 A;  1PWC A;  1G68 A;  2DNS A;  3BFC A;  1IYO A;  3F1O A;  3PR6 A;  3LR4 A;  4EES A;  5CGW A;  2W1T B;  1F9I A;  2Y2N A;  5EE8 A;  4BD1 A;  3VE4 A;  1PYY A;  2W3H A;  2HGV A;  1WA9 A;  3GSG A;  4Z9Q A;  3H82 A;  1UWP X;  3NC8 A;  3F1N A;  4UA7 A;  5HWV A;  4FOF A;  2M7V A;  3CLO A;  4OPR A;  3F1O B;  3HLD A;  4HH3 A;  3GDI A;  3DTI A;  1S66 L;  2VA0 A;  5DF7 A;  4OPZ A;  3PBT A;  5DTS A;  1LLB A;  2FFF B;  1YSQ A;  3OCL A;  3UDI A;  3DWK A;  1STZ A;  3SS3 A;  3H82 B;  3CJM A;  1BYW A;  3ZG5 A;  3F1N B;  2ZMF A;  3SH8 A;  2Y91 A;  2PD7 A;  3V5M A;  3ZNT A;  5TGF A;  3KSI A;  3SOI A;  3UPO A;  1PI5 A;  4E04 A;  3IXB A;  3W8K A;  3VP0 A;  1PWD A;  3VP2 A;  5E2H A;  2PYR A;  1G5U A;  3KO6 A;  1MZU A;  1OTE A;  1NLZ A;  3LO7 A;  3LIB A;  3U2A A;  4U0X A;  2J8Y A;  4I38 A;  4LCL A;  3C7U A;  5FDH A;  4GOG A;  3CI6 A;  2VEA A;  1XKZ A;  2Z6D A;  4WZ5 A;  3VFF A;  3MBZ A;  2J7V A;  2J9O A;  1YSP A;  2ZQD A;  3QHY A;  4BLM A;  4GKU A;  2P7J A;  3IBJ A;  5DF9 A;  2XF3 A;  3HL9 A;  5L07 A;  3EWK A;  4WN5 A;  1ZC2 A;  1HTZ A;  5HW3 A;  3CWF A;  4P6Z S;  1NXY A;  1OT6 A;  4PKY A;  4ZTK A;  4QWO A;  3CG5 A;  3OOV A;  3C4P A;  1TDL A;  2G7U A;  5EUA A;  3BJN A;  5CTM A;  1NRF A;  4GW9 A;  3O88 A;  1XXM A;  4Q0I A;  3NY4 A;  4R3B A;  2EXA A;  4OLG A;  1YM1 A;  3EEA A;  2A2L A;  1KGG A;  2PHY A;  1O7E A;  3JPU A;  4GDB A;  4WEJ A;  4X56 A;  1BLH A;  3B42 A;  4P85 A;  4ZJ1 A;  1GSV A;  3HLF A;  4UA9 A;  3FG8 A;  4NXE A;  3GEC A;  3G31 A;  4M3K A;  3NUL A;  2B95 A;  3ZG9 B;  3GVB A;  3R7W A;  5A90 A;  1YPR A;  1ES4 A;  3ZGA B;  4O7D A;  1TEM A;  4KUK A;  2WKQ A;  2V0W A;  4II7 A;  1FCM A;  5F83 A;  4KZ6 A;  2EX6 A;  2D02 A;  2P74 A;  2ACG A;  2PBY A;  3P98 A;  1W8Q A;  4OQH A;  1J9M A;  3A3I A;  4HJ4 A;  3N8R A;  3T4K A;  1S1Z A;  4QY6 A;  3GRJ A;  3R7W B;  1AWI A;  3IH8 A;  4K91 A;  4LV2 A;  5CRF A;  3LCE A;  2GJ3 A;  1MWU A;  3NDG A;  3VMA A;  3DTE A;  4XUX A;  3MZD A;  4S2M A;  3NOT C;  3A3E A;  2W0N A;  4GHI A;  3JYI A;  2H0Y A;  1NYY A;  3MZE A;  2A49 A;  3ZG0 A;  2Y2J A;  1CI8 A;  4WMC A;  4E3K A;  4DDS A;  4QJG A;  1W63 Q;  1S4S A;  2JE5 A;  1JNU A;  4CJN A;  1N9O A;  2R9X A;  5GLD A;  1KVM A;  1D1J A;  3IX4 A;  3LID A;  4GHI B;  4E3L A;  2HDQ A;  4QU3 A;  3KSG A;  2ZQ9 A;  1PW1 A;  2KX6 A;  3G34 A;  4BD0 A;  2XD5 A;  4EU0 A;  5TJJ A;  1T1A A;  3FPV A;  5DTT A;  1FIL A;  4WYY A;  3FYZ A;  3LIA A;  1IEM A;  3NOP C;  2HV1 A;  3N6I A;  3Q81 A;  1WE4 A;  1BTL A;  3CPT A;  2HDR A;  2XRO A;  2ZQ8 A;  3PBO A;  3LR3 A;  5F82 A;  5HPF A;  4CLC E;  2JBF A;  4K0W A;  3V39 A;  1IFQ A;  3HLE A;  4G3W A;  4ZBE A;  5I5L A;  3C8C A;  3W4Q A;  5HAQ A;  4MEZ A;  3CPT B;  2WUQ A;  1OTA A;  5HD3 A;  5E2G A;  4GJ4 A;  2K2N A;  4JBF A;  1TS8 A;  2QKP A;  2L4R A;  4JPM A;  4I5S A;  4H8R A;  4KZ3 A;  3FKV A;  1XPB A;  2O99 A;  3G2Y A;  3ZCZ A;  5M18 A;  4JXV A;  3IHB A;  4PM9 A;  3MQ0 A;  5FQK A;  4HQA A;  5FAT A;  3WS1 A;  4CQH A;  1K6R A;  2JKR I;  2OAP 1;  2ZOH A;  3RXX A;  1K0K A;  1T18 A;  3M2J A;  1HD8 A;  3MKF A;  2FZ0 A;  1YMS A;  2Y2I A;  4Y13 A;  1TDG A;  5A8B A;  4QHC A;  4DKI A;  5HDD A;  4EER A;  4IUH A;  1TS7 A;  3OC2 A;  3C5A A;  2J3T D;  4HES A;  5CEC A;  2HF6 A;  5F68 A;  2QWS A;  1M6K A;  2OLU A;  1I5Q A;  2IWB A;  4Y3I A;  1FSW A;  4Y2F A;  4NET A;  1XA7 A;  2IWC A;  4LEN A;  5M19 A;  3MSH A;  5LBR A;  1QME A;  5EVI D;  4EXO A;  3BEB A;  5E43 A;  4I3J A;  2WZZ A;  4ESP A;  2BG1 A;  1N9B A;  1EI5 A;  5HWT A;  1X0O A;  1T19 A;  3BFE A;  3NCK A;  1OTB A;  3RJU A;  4OPQ A;  1SKF A;  3MS6 A;  5HL6 A;  4ZJ3 A;  3T1R A;  4CLC A;  3K3D A;  2P08 A;  1OT9 A;  5E2F A;  3IQA A;  2HPB A;  4HP9 A;  3WRZ A;  3OBF A;  3Q82 A;  3HRE A;  1KVL A;  1P9R A;  2OWJ A;  3E0Y A;  1H8Y A;  5DF8 A;  1C3B A;  2NUT C;  1PRQ A;  3N8S A;  1PIO A;  2PT7 A;  4F94 A;  5U47 A;  4CLC B;  4CLC C;  1DY6 A;  5FQ9 A;  4GD6 A;  4YNR A;  4R23 A;  1D7E A;  1MY8 A;  4G3V A;  4OON A;  1H5X A;  3PAE A;  1OTI A;  1Z09 A;  3M6B A;  2XEP A;  1ERQ A;  2W3D A;  1ZHH B;  4E3N A;  1E25 A;  2VV8 A;  4NXF A;  1PNE A;  1J3W A;  3EGX C;  3N8L A;  2OLV A;  2OWH A;  4JF4 A;  3AGF A;  3SS5 A;  2ZC3 B;  2HP9 A;  3G32 A;  1NY0 A;  4ID4 A;  3UY6 A;  1H3Q A;  1Y4O A;  4B93 A;  4MBH A;  2PAV P;  2WKH A;  5KIZ A;  2R78 A;  3E2L A;  2OAQ 1;  3CUE A;  2ZC6 B;  2JKG A;  2L1M A;  4JXS A;  4X25 A;  2VK3 A;  4DN0 A;  1RGZ A;  1YQS A;  2H0T A;  2P04 A;  4DE0 A;  3MXQ A;  4DXB A;  4ARZ A;  1T1C A;  3MFD A;  1XA1 A;  4WM9 A;  3G6O A;  1GA0 A;  2DRW A;  1N9N A;  3CUE C;  4BMW A;  4QPR A;  4QB8 A;  5E2E A;  3U4L P;  2Y2L A;  2W27 A;  4ME4 A;  2E8J A;  4KEN B;  5FEF A;  2WAD A;  1KDS A;  2LB9 A;  4ARZ B;  5K5B A;  3ZQ5 A;  1K56 A;  4QY5 A;  4X53 A;  3W2Z A;  2PU4 A;  4R4S A;  2JN7 A;  1KGE A;  4PMA A;  4P0M A;  4DJ3 A;  1BUE A;  4FCF A;  1V9Z A;  3NDE A;  4JKT A;  4ZJ2 A;  3W4P A;  4R1G A;  2Y2G A;  3MMH A;  4DF6 A;  1NZU A;  5CXW A;  3S1Y A;  3BYD A;  1VHM A;  4E6W A;  4IED A;  1L0E A;  4GS9 A;  4X69 A;  4HI4 A;  1DJB A;  2XA7 S;  2B18 A;  3O87 A;  5CEB A;  3IWO A;  4WLA A;  4CPK A;  2C5W B;  4JGO A;  2LB5 A;  3FC7 A;  4JGR A;  4BL2 A;  3BWL A;  3S4X A;  2PR6 A;  1XGJ A;  2V0U A;  3CHW P;  2PYP A;  3TG9 A;  2JKT I;  1MKI A;  4LPZ A;  5F5Y A;  5FQM A;  4OKP A;  3IF6 A;  3LI9 A;  4GLQ A;  4GS9 B;  5BOH A;  1F2K A;  5AVE A;  3A0V A;  4HJ6 A;  4X1L A;  3HLG A;  2WKR A;  1MWS A;  1G6A A;  2J80 A;  1LI0 A;  2EFU A;  4WUJ A;  4GDN A;  3BQA A;  4KQQ A;  3IWQ A;  3D72 A;  3UPN A;  4JF6 A;  3B47 A;  4PM8 A;  3IF6 B;  3IF6 C;  5HPI A;  2H28 A;  4LRX C;  4PM5 A;  3CIT A;  4NXG A;  4S2L A;  3PTE A;  3T50 A;  1N4O A;  4NG2 A;  2OOL A;  1TF1 A;  1NWZ A;  5J3W A;  4OH0 A;  4OLD A;  3BRM A;  3PHY A;  3SW1 A;  1CK3 A;  1S6R A;  3LY4 A;  4KG2 A;  4B88 A;  2ZMA A;  3E98 A;  5GLC A;  2V1B A;  4WZ4 A;  3GMW A;  2ZC7 A;  3I7J A;  1KE0 A;  2XDM A;  1U60 A;  5EVL A;  3S7O A;  2H10 A;  1SHV A;  1T1B A;  4K0X A;  2EWW A;  1Z6F A;  5G4Y A;  3Q7Z A;  3ZVT A;  4X55 A;  1XX2 A;  3NJA A;  2OSU A;  1TVF A;  4ZDX A;  4UQI M;  2HP5 A;  2YKH A;  4F3L B;  5HD5 A;  2UV0 E;  3TW8 A;  4S2P A;  1FQG A;  4KG5 A;  2AVX A;  1K4E A;  3VP1 A;  4XXR A;  5AQB A;  3MZF A;  1DP8 A;  4WMC D;  3GTC A;  3V3S A;  4KZ4 A;  4BBV A;  2ZM8 A;  3UB6 A;  5DJT A;  2WAF A;  1S0W A;  1PW8 A;  3NIA A;  5HSQ A;  2K31 A;  5A93 A;  3G35 A;  4MN7 A;  4G3K A;  1K55 A;  5KMW A;  5HX9 A;  3EGD C;  3PBQ A;  5AQ9 A;  4D60 A;  1Q2Q A;  1OJ5 A;  1DRM A;  4S2O A;  3S7Q A;  1Y54 A;  2EX8 A;  1ZTU A;  2UWX A;  4X68 A;  3NI9 A;  3UDF A;  3MQQ A;  3GQZ A;  1K55 C;  5EPH A;  3L7H A;  2WYX A;  2VGL M;  3SZT A;  4EUV A;  2ZL1 A;  1P9W A;  3UB9 A;  2A24 A;  2GZA A;  4NK3 A;  5DVA A;  4RX2 A;  3VSL A;  3ZG8 B;  5FQJ A;  3PBR A;  5HWW A;  4MCW A;  4GD8 A;  3UB5 P;  5KSH A;  3KYZ A;  3H7W A;  3E4P A;  3HLC A;  5TBM A;  1EWZ A;  3A3J A;  2ZJ9 A;  5EV0 A;  4BEN A;  1OTD A;  4GZB A;  3M2K A;  3NOU C;  2ZL1 B;  3FV7 A;  2A24 B;  4RVA A;  1CF0 A;  4QD4 A;  3E4Q A;  2Y8H A;  4IBR A;  2QZ6 A;  3HVF A;  5FEG A;  3IX8 A;  3H7W B;  4HHD A;  1K6S A;  3QP2 A;  4AFI A;  5TBM B;  1F98 A;  3BFF A;  3RFB A;  1TS0 A;  4IHQ A;  2PDR A;  3UE0 A;  2JKR M;  3BM6 A;  1K4F A;  1S67 L;  1XFN A;  3PBS A;  1LL5 A;  1PZP A;  3W4O A;  3UN7 A;  1MKM A;  2WK0 A;  4Y5F A;  4EQI A;  4R38 A;  3HUN A;  1LI9 A;  4E3J A;  4PPR A;  5HFO A;  4ZRR A;  4IBX A;  4X1M A;  5L09 A;  3DAV A;  4R3J A;  5JYP A;  3C4O A;  4UHU A;  5FAQ A;  4EUZ A;  4E3I A;  3QNB A;  1YLY A;  2I9V A;  3ZFZ A;  3FWL A;  2V8C A;  2V1A A;  4Y0T A;  4B9O A;  5KSC A;  4CLC D;  3S7P A;  3IT9 A;  4MNR A;  1BLS A;  3C7V A;  5HDC A;  5EEC A;  5L8M A;  2MJ6 A;  5HZH A;  1H0M A;  3UPP A;  1DP6 A;  2ZQ7 A;  5HL1 A;  1BSG A;  2DCF A;  3E4O A;  3A0R A;  1LL9 A;  3WS0 A;  5CX7 A;  3OCN A;  1W63 M;  1RCJ A;  2JKF A;  2XD1 A;  1ES2 A;  3MJQ A;  3OPH A;  4DE3 A;  4IJG A;  3D4F A;  3KSH A;  5CHJ A;  4O01 A;  3LI8 A;  3TOI A;  1S4R A;  5M1A A;  1IOU A;  5EFW A;  3WS2 A;  2PU2 A;  1K54 A;  3UB8 A;  4FD8 A;  1SKO B;  3LIC A;  3PXP A;  2WKE A;  5J4E A;  3DW0 A;  1ERM A;  2ZMV A;  4C75 A;  1NYM A;  4MMN A;  1H8M A;  3OPL A;  2IWD A;  3FZC A;  5FSR A;  1RGY A;  3GR2 A;  4S2I A;  1LHY A;  5DJU A;  4H6J A;  2EWV A;  3LUQ A;  1K54 C;  1ESI A;  3LY3 A;  2YKF A;  2ZM0 A;  4R0Q A;  2W1R A;  3O86 A;  4DJ2 A;  4RA7 A;  4OQ0 A;  5FI6 A;  4NKP A;  4GCZ A;  4H6J B;  5FAS A;  5G18 A;  5FL3 A;  1VEU A;  4NEE D;  2XFT A;  1MXO A;  4FTX A;  3NEC A;  3OLO A;  3RXW A;  3VP3 A;  3WS4 A;  5CGS A;  3B3X A;  4KUO A;  2VV7 A;  4N1X A;  3P01 A;  2M1C A;  3Q7V A;  5HAR A;  5A91 A;  2GX5 A;  2V9A A;  1BUL A;  1IKI A;  1VEU B;  3UE1 A;  5AJG A;  1LSX A;  4EQ1 A;  4L9F A;  5AVF A;  2VJW A;  4P6B A;  5CED A;  4BQM A;  1XJ6 A;  4MDZ A;  1VQQ A;  5HAI A;  4GB7 A;  1I2W A;  3K3C A;  2B02 A;  4Q0J A;  4LRY C;  2QMI A;  3Q7V B;  1W8Y A;  3LEQ A;  1OJG A;  1SZV A;  4WF0 A;  1XFQ A;  3BEC A;  1K25 A;  2EA9 A;  1ZG6 A;  2XK1 A;  3MXR A;  4L9G A;  2PRF A;  4ETZ A;  1KGF A;  4D2O A;  3EOI A;  2V20 A;  2ZC4 B;  3ZHH A;  3IXD A;  2CC1 A;  1BZA A;  1YKD A;  4EBN A;  1UWN X;  4OOM A;  4RX3 A;  2JC7 A;  3N4I A;  3OZH A;  4YOF A;  2XLN A;  4K08 A;  2JHE A;  2BTF P;  4MN5 A;  2JKT M;  4JF5 A;  2BLS A;  4HOI A;  3VE3 A;  3LR0 A;  3IXG A;  5DFX A;  4JXW A;  3T4L A;  3WRT A;  4MBF A;  4N1H A;  2WAE A;  3QP8 A;  1NZO A;  5CGX A;  2H5S A;  3IBR A;  4HBT A;  4IUK A;  4LGW A;  1YLP A;  4FSF A;  2DMW A;  3OPP A;  2EX2 A;  1AXB A;  3ZYT A;  3R4K A;  3GV9 A;  1FOF A;  2Z2M B;  5EM1 A;  4IVI A;  2KOI A;  3LR5 A;  4E6X A;  4EEU A;  2K7S A;  4OQI A;  4N9L A;  1IYP A;  4HNB A;  3JVU A;  4FH2 A;  4OOL A;  3DWZ A;  4S2J A;  2D01 A;  3VP4 A;  3IX3 A;  2O9A A;  1XJ2 A;  1KDW A;  2WGI A;  4IVK A;  3UB7 A;  2ZQC A;  2GNX A;  4Y17 A;  1MBL A;  1YLT A;  1QMF A;  3A0S A;  2J3W A;  5L10 A;  4E3M A;  4PHT A;  3T4T A;  2VZW A;  5DKL A;  3VFH A;  4I3I A;  2XH9 A;  3OPR A;  3HLB A;  3VOL A;  5FA7 A;  5GHZ A;  2PR5 A;  1BLC A;  4XUZ A;  3ITA A;  3D3O A;  4JXG A;  5GLA A;  1VB6 A;  4LV0 A;  3RH8 B;  5C5K A;  4KZ8 A;  4YIN A;  2L0W A;  3ULF A;  1WYB A;  3LYX A;  3MF0 A;  3FPW A;  3T1S A;  1I2S A;  4P87 A;  4KQR A;  1GA9 A;  3DTM A;  1E3U A;  5J7E A;  3LEZ A;  1CI9 A;  5JYO A;  3QP1 A;  2Q9N A;  2HJE A;  3Q07 A;  5KZH A;  1GHM A;  5FI7 A;  4OVD A;  1YMX A;  2A3U A;  3UMD A;  3KX0 X;  3MXS A; 
#chains in the Genus database with same CATH homology
 4HES A;  1OME A;  3SH9 A;  2Q9M A;  4GD8 A;  1DJA A;  5KSH A;  1XP4 A;  2XFS A;  5CEC A;  5EVI B;  5EVI C;  1W5D A;  3HLC A;  2WGW A;  1IYS A;  1EWZ A;  4LV1 A;  1XGI A;  1M6K A;  3HLW A;  2OLU A;  2ZJ9 A;  3A3J A;  4U3T A;  5AQA A;  4BEN A;  4YFM A;  2WGV A;  1I5Q A;  3BFD A;  4BL3 A;  3A3F A;  4GZB A;  3M2K A;  2IWB A;  1FSW A;  3FV7 A;  2E8I A;  4WEK A;  3ZVW A;  4BJP A;  1JWP A;  4NET A;  1ONG A;  4RVA A;  1XA7 A;  2IWC A;  3CMZ A;  4LEN A;  3WWX A;  4C3Q A;  4KZ5 A;  2HDS A;  2Y2M A;  4QD4 A;  3UE3 A;  5M19 A;  1QME A;  3ZNY A;  4EBL A;  5EVI D;  3MKE A;  3BEB A;  5E43 A;  2WZZ A;  2V2F F;  3Q1F A;  4UA6 A;  4WEL A;  1W79 A;  2ZC5 B;  2JCH A;  5TFQ A;  4IBR A;  2BG1 A;  1N9B A;  2QZ6 A;  3HVF A;  2EFX A;  1EI5 A;  2Y55 A;  1E3U D;  1K6S A;  2WGW B;  3BFE A;  4DE2 A;  3NCK A;  1MWR A;  3BFF A;  3P09 A;  4EV4 A;  3RJU A;  4OPQ A;  4LV3 A;  3UE0 A;  1SKF A;  2Y2O A;  4Y0U A;  4ZJ3 A;  3BM6 A;  1YLJ A;  1GCE A;  1GHI A;  1K4F A;  2Z2L B;  3IHA A;  3CZD A;  3E2K A;  3PBS A;  2B5R A;  5E2F A;  5AQ7 A;  3NBL A;  3IQA A;  3ISG A;  1LL5 A;  1PZP A;  4UAA A;  3W4O A;  2HPB A;  3UN7 A;  1JWZ A;  1RP5 A;  2ZLY A;  3WRZ A;  2WK0 A;  1ES5 A;  4EQI A;  3AGD A;  1K38 A;  3Q82 A;  3HRE A;  5D3O A;  3FKW A;  4RYE A;  1KVL A;  4Y0O A;  4Q8I A;  2WKI A;  4WZ5 C;  3HUN A;  1LI9 A;  4N9K A;  4KQO A;  2X01 A;  4PPR A;  4E3J A;  5FAP A;  1PWC A;  5HFO A;  1H8Y A;  5GHX A;  5DF8 A;  1G68 A;  4IBX A;  4X6T A;  4KZB A;  2DNS A;  3BFC A;  1C3B A;  1IYO A;  4DDY A;  4R3J A;  3N8S A;  3N7W A;  1PIO A;  3C4O A;  5CGW A;  5JYP A;  2Y2N A;  4UHU A;  5EE8 A;  4PM6 A;  4F94 A;  4BD1 A;  5U47 A;  5FAQ A;  1DY6 A;  1YT4 A;  5FQ9 A;  4EUZ A;  1PYY A;  4GD6 A;  4OQG A;  4E3I A;  3QNB A;  4R23 A;  4OPY A;  1H8Z A;  1YLY A;  1JTD A;  3ZFZ A;  3FWL A;  1MY8 A;  1ALQ A;  4OON A;  2EX9 A;  1H5X A;  3GSG A;  3PAE A;  4Z9Q A;  4EWF A;  3M6B A;  2XEP A;  4Y0T A;  1ERQ A;  3NC8 A;  2V1Z A;  3O3V A;  1FR6 A;  1ERO A;  4UA7 A;  5KSC A;  1SCW A;  4E3N A;  5CHM A;  1WYC A;  2Y4A A;  4DRT A;  1E25 A;  4OPR A;  5FQQ A;  1FR1 A;  3IT9 A;  2HP6 A;  3HLD A;  4MNR A;  1BLS A;  2XGN A;  5FI2 A;  3C7V A;  1L2S A;  1ZG4 A;  3N8L A;  2OLV A;  5EEC A;  1ES3 A;  4JF4 A;  5DF7 A;  3AGF A;  3PBT A;  4OPZ A;  1HZO A;  5DTS A;  1LLB A;  2RL3 A;  3UPP A;  2FFF B;  3SS5 A;  3OCL A;  3UDI A;  2ZC3 B;  2HP9 A;  1Q2P A;  2ZQ7 A;  5HL1 A;  3DWK A;  1PWG A;  3G32 A;  1BSG A;  1NY0 A;  3SS3 A;  2DCF A;  2R9W A;  4ID4 A;  3CJM A;  5HAP A;  3ZG5 A;  5FAO A;  4WBG A;  1LL9 A;  3UY6 A;  3WS0 A;  5J8X A;  3OCN A;  3UNW A;  3SH8 A;  4C6Y A;  2Y91 A;  4MBH A;  2WKH A;  1RCJ A;  1KE4 A;  1L0D A;  3V5M A;  2XD1 A;  1ES2 A;  3ZNT A;  5TGF A;  5EOO A;  3SOI A;  3QNC A;  3E2L A;  2EXB A;  3UPO A;  3HUM A;  1PI5 A;  3IXB A;  3OPH A;  2ZC6 B;  3W8K A;  2RCX A;  4DE3 A;  3D4F A;  5CHJ A;  5CTN A;  3VP0 A;  4JXS A;  1PWD A;  3VP2 A;  5E2H A;  3TOI A;  5M1A A;  1RGZ A;  1YQS A;  3WS2 A;  2H0T A;  2PU2 A;  4DE0 A;  1K54 A;  4FD8 A;  3LO7 A;  2WKE A;  4DXB A;  3DW0 A;  4LCM A;  4U0X A;  3SH7 A;  1ERM A;  3MFD A;  2X02 A;  1XA1 A;  2J8Y A;  4WM9 A;  4U0T A;  4C75 A;  1NYM A;  1SDE A;  3OPL A;  4LCL A;  2IWD A;  1GA0 A;  2DRW A;  3FZC A;  3C7U A;  2WZX A;  4Y7P A;  5FSR A;  5FDH A;  4GOG A;  1RGY A;  2XQZ A;  3GR2 A;  4S2I A;  1LHY A;  1XKZ A;  4WZ5 A;  2XR0 A;  4QB8 A;  3VFF A;  3V3R A;  3MBZ A;  2J7V A;  2J9O A;  5E2E A;  5I94 A;  2Y2L A;  2ZQD A;  3QHY A;  3G2Z A;  2G2U A;  4BLM A;  4GKU A;  4KG6 A;  5DF9 A;  2XF3 A;  3HL9 A;  4KEN B;  1K54 C;  1ESI A;  3LY3 A;  2C6W B;  4PM7 A;  2WAD A;  1KDS A;  2ZM0 A;  4R0Q A;  4S2K A;  1ZC2 A;  1K56 A;  4QY5 A;  2I72 A;  3O86 A;  4X53 A;  1HTZ A;  3VOZ A;  5HW3 A;  4RA7 A;  2VGK A;  2PU4 A;  4OQ0 A;  4R4S A;  1IKG A;  1KGE A;  4PMA A;  1ZKJ A;  5CER A;  1NXY A;  4P0M A;  5FI6 A;  5FQI A;  1BUE A;  4FCF A;  4ZTK A;  4ZAM A;  3CG5 A;  3C4P A;  1TDL A;  5EUA A;  3NDE A;  4JKT A;  1YLW A;  5G18 A;  5FAS A;  5CTM A;  4E3O A;  4ZJ2 A;  3W4P A;  4R1G A;  1NRF A;  3O88 A;  2Y2G A;  4R4R A;  1JVJ A;  4KZ7 A;  2XFT A;  1XXM A;  2P9V A;  3NY4 A;  4L0L A;  1MXO A;  4DXC A;  4DF6 A;  4JLF A;  4R3B A;  2EXA A;  3IH9 A;  1NZU A;  5CXW A;  4B4X A;  3S1Y A;  4OLG A;  3RXW A;  3BYD A;  4KZ9 A;  1YM1 A;  4E6W A;  4IED A;  1L0E A;  4X69 A;  3VP3 A;  3WS4 A;  5CGS A;  1KGG A;  3B3X A;  1DJB A;  3O87 A;  5CEB A;  4N1X A;  1O7E A;  3HBR A;  4GDB A;  4WEJ A;  3IWO A;  3Q7V A;  4X56 A;  3SS4 A;  4CPK A;  4B4Z A;  1BLH A;  2C5W B;  4P85 A;  1PZO A;  5HAR A;  1MWT A;  2VGJ A;  4ZJ1 A;  5A91 A;  3HLF A;  4BL2 A;  4UA9 A;  1BUL A;  3S4X A;  1XGJ A;  1IKI A;  3G31 A;  4M3K A;  3UE1 A;  5F1G A;  3ZG9 B;  2P9V B;  3GVB A;  5A90 A;  3TG9 A;  1ES4 A;  3UDX A;  1MKI A;  3PAG A;  4P6B A;  3ZGA B;  5CED A;  4BQM A;  4O7D A;  1TEM A;  5FQM A;  1L0F A;  1VQQ A;  4OKP A;  3IF6 A;  3VOY A;  5HAI A;  2FFY A;  4GB7 A;  5BOH A;  1I2W A;  1FCM A;  5F83 A;  2QMI A;  3Q7V B;  4KZ6 A;  1W8Y A;  1K57 A;  2EX6 A;  3HLG A;  5GLB A;  2P74 A;  1MWS A;  2PBY A;  1G6A A;  1HVB A;  1LI0 A;  3P98 A;  1W8Q A;  3BEC A;  1K25 A;  2EFU A;  4OQH A;  1J9M A;  4GDN A;  3A3I A;  1ZG6 A;  3N8R A;  2XK1 A;  4KQQ A;  4QY6 A;  3MXR A;  5TR7 A;  3GRJ A;  2OV5 A;  4S2N A;  3IWQ A;  3UPN A;  4JF6 A;  3IH8 A;  4K91 A;  2HDU A;  4PM8 A;  4LV2 A;  5CRF A;  3LCE A;  1IYQ A;  1KGF A;  4KZA A;  3IF6 B;  1MWU A;  3IF6 C;  5CHU A;  1YLZ A;  3NDG A;  4D2O A;  4PM5 A;  3VMA A;  4S2L A;  5F1F A;  4XUX A;  3PTE A;  2V20 A;  1N4O A;  3HUO A;  1K57 C;  2ZC4 B;  3MZD A;  3ZHH A;  4MLL A;  4S2M A;  3IXD A;  2CC1 A;  4OH0 A;  1BZA A;  1IEL A;  4OLD A;  4EBN A;  4N92 A;  3A3E A;  2Y2H A;  3BRM A;  1VM1 A;  1FSY A;  3JYI A;  4OOM A;  4RX3 A;  2H0Y A;  2JC7 A;  3N4I A;  1KE3 A;  3TSG A;  3OZH A;  4S2N C;  2XLN A;  1CK3 A;  1NYY A;  3MZE A;  1S6R A;  3UO9 A;  3LY4 A;  2A49 A;  4OP5 A;  4KG2 A;  1NJ4 A;  2Y2J A;  4JF5 A;  2BLS A;  2ZMA A;  3ZG0 A;  4B88 A;  1CI8 A;  4WMC A;  5GLC A;  4WZ4 A;  3IXG A;  3GMW A;  4JXW A;  4DDS A;  4HEF A;  4E3K A;  4QJG A;  5GL9 A;  4MBF A;  3WRT A;  4N1H A;  2ZC7 A;  3I7J A;  2JE5 A;  2WAE A;  2Y2K A;  2XDM A;  1KE0 A;  1NZO A;  1U60 A;  5EVL A;  3VSK A;  4CJN A;  2R9X A;  2H10 A;  1JTG A;  1KVM A;  2Y2P A;  5CGX A;  5GLD A;  4DE1 A;  1SHV A;  2H5S A;  4HBT A;  3S22 A;  4K0X A;  4E3L A;  2HDQ A;  1YLP A;  4QU3 A;  4A5R A;  4FSF A;  1W7F A;  1Z6F A;  3PBN A;  1ONH A;  3OPP A;  3MXS A;  2EX2 A;  2ZQ9 A;  1PW1 A;  3Q7Z A;  3ITB A;  3ZVT A;  1AXB A;  1ESU A;  4X55 A;  3G34 A;  1XX2 A;  4BD0 A;  3GV9 A;  1FOF A;  2XD5 A;  2OSU A;  3AGE A;  1TVF A;  2Z2M B;  4ZDX A;  4IVI A;  2HP5 A;  4E6X A;  4OQI A;  1PI4 A;  3EQV A;  5DTK A;  1SDN A;  1IYP A;  1FCN A;  4N9L A;  3BFG A;  5DTT A;  1GHP A;  1DJC A;  4S2P A;  4FH2 A;  4OOL A;  1FQG A;  3DWZ A;  4KG5 A;  4WYY A;  1K4E A;  3FYZ A;  4S2J A;  4XXR A;  3IWI A;  3VP1 A;  5AQB A;  1BT5 A;  3VP4 A;  1BLP A;  3MZF A;  1IEM A;  3N6I A;  4WMC D;  3Q81 A;  3GTC A;  1WE4 A;  4OP8 A;  3M6H A;  5EOE A;  1KDW A;  1BTL A;  2WGI A;  2HDR A;  2ZD8 A;  4HBU A;  4IVK A;  2ZQ8 A;  2J9P A;  2ZQC A;  1L0G A;  3V3S A;  4KZ4 A;  1MBL A;  3PBO A;  1YLT A;  1QMF A;  2ZM8 A;  3A3D A;  5F82 A;  3ZG7 B;  2QPN A;  3ZDJ A;  2WAF A;  1S0W A;  2ZM2 A;  1CEF A;  1PW8 A;  4E3M A;  1M40 A;  2JBF A;  3NIA A;  4OOY A;  1K56 D;  1JWV A;  4K0W A;  2Y59 A;  5A93 A;  3V39 A;  1MPL A;  2G2W A;  3VFH A;  3HLE A;  3G35 A;  5A92 A;  2XH9 A;  4ZBE A;  2X71 A;  3OPR A;  1K55 A;  3HLB A;  5KMW A;  3W4Q A;  1FCO A;  5HX9 A;  5FA7 A;  5HAQ A;  4MEZ A;  3PBQ A;  5GHZ A;  2WUQ A;  3IXH A;  5E2G A;  1BLC A;  4JBF A;  4XUZ A;  3ITA A;  5AQ9 A;  3G30 A;  1CEG A;  4JPM A;  3BLS A;  4H8R A;  1Q2Q A;  4JXG A;  5GLA A;  3EQU A;  4KZ3 A;  3FKV A;  4S2O A;  4LV0 A;  1XPB A;  3V50 A;  4KZ8 A;  4YIN A;  3G2Y A;  3ZCZ A;  1Y54 A;  2EX8 A;  5M18 A;  4JXV A;  4GN2 A;  2UWX A;  4X68 A;  4GNU A;  3IHB A;  3G4P A;  4PM9 A;  1O07 A;  3NI9 A;  5GHY A;  3UDF A;  1WYB A;  5EVI A;  3GQZ A;  1K55 C;  5EPH A;  2ZQA A;  5FQK A;  5FAT A;  1I2S A;  4MBK A;  2Y2Q A;  4P87 A;  2WYX A;  4KQR A;  1GA9 A;  3WS1 A;  1K6R A;  3DTM A;  3RXX A;  5L2F A;  1E3U A;  2GDN A;  4FH4 A;  3LEZ A;  1E4D A;  3M2J A;  1HD8 A;  4NK3 A;  3WS5 A;  5IHV A;  4EBP A;  3MKF A;  1CI9 A;  5JYO A;  1YMS A;  2Y2I A;  2Q9N A;  3Q07 A;  1TDG A;  5KZH A;  5DVA A;  4QHC A;  1GHM A;  4RX2 A;  4DKI A;  3VSL A;  5FI7 A;  3ZG8 B;  4OVD A;  3OC2 A;  1YMX A;  2A3U A;  3BLM A;  3C5A A;  5FQJ A;  3PBR A;  3IF5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...