4GDNA

Structure of fmta-like protein
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
336
structure length
336
Chain Sequence
RLTNDSQQQIDKIIEHDLQKGHIPGASILIVKNGKVFLNKGYGYQDVDKKVKASPTTKYEIASNTKAFTGLAILKLAQEGRLNLNDDVSKHVPHFKMNYNGQNETITIKQLLAQTSGIPSDITSEDAVTNKNNRLNDVTRAIMGDELHHKPGEEFEYSNMNYDLLGLIIQNVTKQSYTKYITNSWLKPLHMTHTSFKQTNNKSKHDAIGYELQGSTPVVSKPEFNLWDTPSAYMMTSTEDLEHWIKFQLNPPDKYKSLVQQSHKNLSSTIGEPNANAYASGWFTNNDEHLVFHSGTLDNFSSFILLNPKQNYGIVVLANLNSEYVPKLVEHLNTQI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein flp
publication title Analysis of Structure-Function Relationships in the Colibactin-Maturating Enzyme ClbP.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 90
structure length 336
sequence length 336
chains with identical sequence B, C, D
ec nomenclature ec 3.5.-.-:
pdb deposition date 2012-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00144 Beta-lactamase Beta-lactamase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 4gdnA00
1XXMA 1MXOA 4QB8A 1CK3A 5L2FA 4MBKA 4RX3A 3BFEA 4HBTA 4OPQA 4OLGA 4KZ6A 3LEZA 1IYPA 2XH9A 4M3KA 4WYYA 1L0EA 4QJGA 1G68A 1GHIA 5EVIC 5TR7A 1EWZA 3G4PA 3LO7A 3TG9A 2WGVA 4DE0A 5I94A 5JYPA 5KSHA 4GKUA 1KE0A 4R1GA 4BLMA 4DE2A 3V3SA 5CTNA 1PZPA 3VOZA 4EBNA 1BT5A 3G2ZA 1L0GA 4KZ4A 3E2LA 1ZC2A 3VSLA 4GZBA 3MZDA 2Y2KA 4DDSA 1PI4A 2IWCA 3D4FA 5JYOA 3RJUA 2HDQA 4IBRA 2WGWB 4L0LA 4P0MA 1WE4A 4LCMA 1MWSA 1ONHA 3MKFA 1TEMA 3ZCZA 2H0TA 4X68A 1Y54A 1GA9A 2WADA 4DE3A 3WS5A 4KZ5A 2Y2NA 3W4PA 3O87A 2ZM8A 1NYMA 5FATA 2WAFA 2Y2HA 2CC1A 3WS2A 1U60A 2WKEA 1CEFA 4OPRA 4XUXA 5F83A 2VGJA 1H5XA 1ZG4A 4MBFA 4N9LA 1IEMA 5A93A 1NXYA 5F82A 1KVMA 4EBPA 4WBGA 4XXRA 2WZXA 1MWRA 2XD1A 1TDLA 1HVBA 1M6KA 3ZHHA 1E4DA 4KZAA 5CGSA 1NZOA 3HLCA 3UDFA 5KSCA 5CGXA 1FCOA 1MY8A 5E2FA 3AGEA 5E2EA 1AXBA 4S2PA 2VGKA 4DRTA 3PAGA 5HW3A 3ZDJA 4GN2A 4X6TA 3G34A 3IXBA 4OQGA 4PM7A 2RL3A 5EOEA 3W4QA 2WGIA 3BEBA 1XP4A 2FFYA 1YLTA 3Q07A 2EFXA 3LCEA 4BL2A 3PTEA 4KENB 2H10A 2JC7A 2Y91A 3IHBA 1JWPA 1LI0A 1LL5A 3FZCA 5CGWA 1IKIA 1G6AA 3IWQA 2Z2LB 4A5RA 4BJPA 5GLDA 4R23A 5FQMA 3ZG8B 3LY3A 4UA7A 4E6WA 2WAEA 3IF6B 2ZQDA 2I72A 3BM6A 3I7JA 3BFCA 1K56D 1IKGA 3SH8A 2FFFB 1I2WA 1PIOA 4GD8A 1Q2QA 5G18A 3SS5A 1K56A 3OPPA 4JXVA 3AGFA 4H8RA 3UE3A 1KE4A 3DW0A 1LL9A 3N4IA 4EUZA 1XPBA 1CI9A 3A3JA 5FAPA 1YT4A 4BQMA 5FQIA 4FD8A 4IEDA 1VM1A 4GOGA 2X01A 3VFHA 3S4XA 4JXSA 4QD4A 2WUQA 3HLEA 1H8ZA 5EECA 5FA7A 4LV0A 1YQSA 3ZVTA 1ZG6A 1SHVA 3A3EA 5CTMA 1LLBA 1FQGA 3UNWA 1RGYA 2X71A 2XFSA 1IYQA 5GL9A 1I2SA 2P9VB 2A3UA 3IF5A 5FSRA 3S22A 1NRFA 1LI9A 1YMXA 1K6SA 3BRMA 3ZNTA 4E3MA 2E8IA 2Q9NA 5EE8A 2XDMA 3MXSA 1KGFA 3MZFA 4WELA 3VP3A 4OH0A 1K55A 4YFMA 3OPRA 5DVAA 3GTCA 5DF7A 3G35A 2C5WB 4E3OA 3N7WA 4KZ7A 1BTLA 1W5DA 4OOLA 1YLJA 2BG1A 4YINA 3ZG9B 2EFUA 4UA6A 3HLGA 5KZHA 4JXGA 1TDGA 1XA7A 3GMWA 4S2MA 3Q82A 2ZQCA 2PU2A 3BFGA 3M6BA 1Z6FA 1SDEA 4KQQA 2WKHA 4U3TA 4Z9QA 3VP2A 2WYXA 1CI8A 2ZLYA 4R4RA 1J9MA 3Q7ZA 4HESA 2JE5A 4PM6A 3O86A 2JCHA 3CJMA 3MXRA 5FDHA 4JXWA 1QMFA 5CHMA 3VFFA 5D3OA 2XGNA 3E2KA 2HDRA 2Y2IA 1L0FA 4IVKA 5AQAA 4OQIA 5DTSA 4WZ4A 1SKFA 4JF4A 1PWCA 3OCNA 3FYZA 5EPHA 5AQ9A 3P98A 4E3JA 3WRTA 3P09A 3V3RA 4JKTA 1JWVA 4GD6A 4R0QA 4BENA 1ES3A 2QPNA 3PBRA 2XR0A 4EQIA 3UPOA 3PBNA 3HLWA 4PM5A 5BOHA 3OZHA 1FSYA 3AGDA 3FWLA 1ES4A 4DKIA 4WZ5A 3SS3A 1TVFA 2ZJ9A 1MWTA 2ZQAA 1ERMA 4OVDA 2PBYA 3NCKA 2XFTA 4RA7A 5FAQA 2EX8A 1FCMA 4LCLA 1K54A 1VQQA 3HLBA 4KQRA 2WKIA 2HPBA 5FI6A 1ESUA 2WGWA 3BFFA 5FQKA 3SH9A 1FR6A 4E6XA 2DNSA 2ZM2A 4X55A 2ZQ9A 4OLDA 5FI7A 3G32A 3NDEA 4K0XA 4QY6A 2QZ6A 2Y2GA 5CHUA 4KG2A 4KZBA 4E3IA 1ES5A 4LV1A 1KVLA 3UN7A 5EVIB 2ZM0A 3SOIA 5HAQA 5CEDA 2OLVA 5GLCA 4OKPA 2DRWA 3PAEA 3IF6C 1K57A 4JF6A 3V39A 1XKZA 3VMAA 2ZQ7A 2OV5A 3WWXA 4FCFA 3O88A 3UPPA 4PM8A 3UDIA 4DXCA 1CEGA 4S2OA 4KQOA 2H0YA 3MBZA 3GR2A 3VOYA 4GB7A 3HUMA 4C75A 3OPHA 4E3KA 1DJBA 4P87A 3RXXA 4WM9A 1XA1A 1QMEA 2P74A 4B4XA 1H8YA 1YLWA 3ZGAB 2ZC3B 1MKIA 2V1ZA 1K55C 1S0WA 2XF3A 4X56A 3N6IA 4B88A 1FSWA 2R9WA 5GHXA 3FKWA 3NBLA 4R4SA 2ZC5B 4E3NA 5CEBA 1E25A 4N1XA 5HFOA 3ZG5A 3PBTA 3WS4A 4P85A 2ZQ8A 3IWOA 3G30A 4S2IA 1BLSA 5TFQA 5F1FA 3ZG7B 3IF6A 5AQ7A 1O7EA 2HP5A 1NZUA 4ZJ3A 3GSGA 2H5SA 1JWZA 1BULA 4C3QA 1DJAA 3C4OA 3IWIA 5FQJA 1KDWA 4JBFA 4PPRA 4O7DA 3CMZA 1EROA 4S2NA 1FR1A 2J9OA 3VP1A 3IT9A 4N1HA 1YLPA 3HUOA 4S2JA 3ITAA 4Q8IA 3HVFA 5M19A 4WMCD 3Q7VB 1GHMA 3OC2A 4JLFA 4N92A 3TOIA 5J8XA 4GDNA 2HDUA 3MZEA 3NDGA 3QNBA 4WMCA 2G2UA 1IYSA 1E3UD 1W7FA 3IXHA 4U0TA 1ESIA 4ZDXA 3BFDA 3N8LA 5HAPA 1ZKJA 4GNUA 1E3UA 2XK1A 4GDBA 2P9VA 1XGIA 4WZ5C 2EXBA 4FH4A 4B4ZA 1IELA 2V20A 4ZTKA 3C5AA 2HP9A 3UE1A 4CPKA 5GHYA 4JPMA 1NYYA 3PBOA 4BD1A 3OCLA 1K4FA 5E2HA 1K54C 3W4OA 4R3BA 1PW1A 3A3FA 4Y0UA 1PWDA 4UAAA 1DY6A 3FKVA 1KDSA 3JYIA 5M18A 3HBRA 5CECA 1GCEA 5U47A 2EX2A 3HREA 4F94A 1JTGA 3WS0A 2Y59A 3EQUA 2IWDA 4FH2A 5DF9A 3UPNA 1PYYA 5CERA 4OQ0A 1LHYA 2WK0A 5FASA 4MNRA 2Y2JA 4XUZA 1RCJA 5E2GA 3GV9A 3EQVA 3ZFZA 4HBUA 1SDNA 1K57C 3C7VA 3NIAA 4LV3A 5GLBA 4NK3A 2R9XA 3BECA 1O07A 3BLMA 5FAOA 3ITBA 1W8YA 3LY4A 4MLLA 3BYDA 3IH9A 3A3DA 3VP0A 4UA9A 2Y2LA 3WS1A 4IBXA 3ZVWA 3Q1FA 4OP5A 3IXGA 2XLNA 4BD0A 2UWXA 1ERQA 3C7UA 3MKEA 1PZOA 3QHYA 5EVLA 1S6RA 4N9KA 1M40A 4KZ3A 2IWBA 4ZBEA 5A92A 3MFDA 5HL1A 4MBHA 3ISGA 4UHUA 4RVAA 5HAIA 3V50A 3G2YA 3V5MA 1W79A 5DF8A 4BL3A 1MBLA 3O3VA 1YMSA 4PMAA 5HARA 2Y2OA 3TSGA 5CHJA 1Q2PA 4MEZA 4OPYA 3BLSA 3M6HA 4CJNA 5A90A 3UDXA 3IH8A 3SS4A 3G31A 1NY0A 3B3XA 1BLCA 3GVBA 1N4OA 4RYEA 1JVJA 2J7VA 4DE1A 3IHAA 2EX6A 4OPZA 2Z2MB 1GHPA 4OOMA 3WRZA 1PWGA 1PI5A 2HDSA 3M2KA 4C6YA 2RCXA 3NC8A 3NI9A 4RX2A 4E3LA 1WYCA 5EVID 3HL9A 3VSKA 1L2SA 2Y2PA 3N8SA 4JF5A 5EVIA 4D2OA 2G2WA 2V2FF 1PW8A 1K38A 4KZ8A 3GRJA 1K25A 4S2NC 4X69A 2J8YA 4IVIA 1HTZA 3UO9A 2Y55A 4P6BA 4PM9A 4WEKA 4K91A 1BLHA 3VP4A 1EI5A 2DCFA 1I5QA 5GHZA 4KZ9A 2ZD8A 1IYOA 3W8KA 4U0XA 2BLSA 1DJCA 3HLFA 5EUAA 3IXDA 1MPLA 2PU4A 2XQZA 5GLAA 5CXWA 1ES2A 1ONGA 3Q81A 4R3JA 4X53A 3N8RA 5TGFA 2GDNA 1JTDA 4ZAMA 4ZJ1A 3DWKA 4HEFA 3M2JA 3DTMA 2EXAA 1MWUA 4DDYA 4ID4A 3IQAA 5M1AA 4ZJ2A 3C4PA 2ZMAA 1ALQA 2OLUA 3GQZA 1C3BA 4OONA 1RP5A 2Y2QA 4EWFA 3CZDA 5E43A 4EBLA 4FSFA 3ZG0A 2HP6A 2XD5A 3HUNA 5IHVA 2A49A 2Y4AA 3NY4A 2OSUA 5HX9A 1HD8A 1L0DA 5FQ9A 2X02A 2ZC7A 3PBSA 5CRFA 3S1YA 1FCNA 4OP8A 1YM1A 2EX9A 1RGZA 4NETA 3DWZA 2ZC6B 1K6RA 3QNCA 5DTTA 2C6WB 3ZNYA 2QMIA 1HZOA 2ZC4B 5F1GA 4Y0TA 1KGGA 4WEJA 5DTKA 1WYBA 4OQHA 3A3IA 2WZZA 1N9BA 3SH7A 4Y7PA 1BSGA 1SCWA 1XX2A 4QU3A 3OPLA 5FQQA 3CG5A 1K4EA 1BZAA 2J9PA 2Q9MA 3Q7VA 1XGJA 4Y0OA 4EV4A 3PBQA 3FV7A 3HLDA 4KG5A 1BLPA 4K0WA 4DF6A 4S2KA 5FI2A 1W8QA 2Y2MA 1KGEA 5KMWA 2XEPA 1KE3A 4LV2A 1OMEA 1YLZA 2JBFA 5A91A 1NJ4A 3UE0A 2B5RA 1GA0A 3UY6A 4LENA 5AQBA 4QHCA 4QY5A 4OOYA 4DXBA 4S2LA 4KG6A 5EOOA 3RXWA 1YLYA 1BUEA 1FOFA
chains in the Genus database with same CATH superfamily
1XXMA 1MXOA 4QB8A 4OPQA 4LRZE 4HIAA 3LEZA 1IYPA 2XH9A 3R4KA 4WYYA 4QJGA 3DAVA 3G4PA 3TG9A 4CLCB 1LSWA 2ZMVA 5CTNA 3T4SA 3MF0A 5C5KA 1TS8A 3LFVA 4ZRRA 4DDSA 1PI4A 2IWCA 5JYOA 3RJUA 2HDQA 4IBRA 4LCMA 3MQ0A 1TEMA 2P04A 1H8MA 2Y2NA 3BY8A 2WAFA 2MJ6A 4DMZA 2CC1A 4EETB 1CEFA 4XUXA 3VE4A 2VGJA 4MBFA 4HQAA 3CITA 3W2ZA 1TDLA 2XD1A 1HVBA 3ZHHA 3UDFA 5CGXA 1MY8A 3AGEA 5E2EA 2VGKA 4G3WA 3TJZC 4GN2A 3G34A 4OQGA 4PM7A 3BEBA 1T1CA 2KOIA 3Q07A 4JGOA 3F1PA 3FPWA 1LI0A 4EERA 2W1RA 5CGWA 3KYEA 4BJPA 5FQMA 3ZG8B 1UGUA 4UA7A 4E6WA 3T4JA 2I72A 3I7JA 1IKGA 3HJIA 2FFFB 5G18A 1PIOA 4GD8A 1TS6A 3DW0A 3LR4A 4HNBA 4EUZA 1X0OA 1F98A 1XFQA 4BBVA 1P0ZA 1YT4A 4IEDA 1VM1A 3VFHA 1VHMA 4GHIB 4L9EA 5EECA 4LV0A 4EXOA 1DP8A 3A3EA 4AFIA 2Q0OA 3C2WA 1LLBA 2X71A 4BBTA 1IYQA 3BJNA 1GSWA 3IF5A 5FSRA 3S22A 3BRMA 3A0SA 2XDMA 3FC7A 5EE8A 2PRFA 4CLCC 3NHQA 1K55A 3CLOA 5DVAA 4YINA 2EFUA 2OAP1 5KZHA 1YKDA 3LUQA 3GMWA 3Q82A 1D1JA 3VP2A 4U3TA 2WKHA 2ZLYA 4R4RA 4IUKA 1J9MA 1PFLA 2O0YA 3O86A 4PM6A 1MKMA 3VOLA 2HDRA 2Y2IA 5TBMB 4II7A 3OCNA 5EPHA 5AQ9A 3WRTA 3P09A 3D72A 3HLWA 1VB6A 3IX8A 3EGDC 1FSYA 3AGDA 5IU1A 4WZ5A 2ZJ9A 1MWTA 2ZQAA 2PBYA 3K3DA 1FCMA 1VQQA 4KQRA 1FR6A 4X55A 3UB6A 3T1RA 3NDEA 4QY6A 5CHUA 2HJEA 3UN7A 3B47A 5EVIB 2OLVA 4OKPA 5KIZA 1K57A 1Z09A 4JF6A 2OV5A 4FCFA 4DXCA 1OT9A 3GR2A 4GB7A 3HUMA 3CUEA 2J80A 3OPHA 1DJBA 3RXXA 1XA1A 2P74A 4B4XA 3KSGA 1H8YA 1YLWA 1MKIA 2DMWA 5FEGA 3FKWA 1E25A 3F1NA 3T4OA 4H6JB 1TD5A 4S2IA 4BMWA 5FL3A 3ZQ5A 4I3AA 4ZJ3A 2H5SA 2VA0A 1KDWA 3NECA 4O7DA 1EROA 1FR1A 1EW0A 1YLPA 3HUOA 4Q8IA 5M19A 2PD8A 3TOIA 3OC2A 4N92A 4GHIA 1IYSA 1E3UD 1NRJA 4G3VA 3BFDA 2W3GA 2V20A 3CHWP 3C5AA 4JPMA 3PBOA 3KYZA 5E2HA 3W4OA 4Y0UA 2A24A 3FKVA 1KDSA 1XJ3A 3HREA 1P9RA 2QJ7A 3EQUA 2IWDA 2EWVA 1PYYA 5CERA 1S4RA 4KUKA 2WK0A 5FASA 2K2NA 4MN6A 4MNRA 2V0UA 4LV3A 2PT7A 1O07A 5TBMA 3GECA 3BYDA 1F2KA 3IH9A 3VP0A 4UA9A 2Y2LA 3T12B 3WS1A 3ZVWA 2XLNA 1T1AA 4BD0A 1ERQA 3QHYA 3MJQA 3EEAA 4KZ3A 4R38A 5EM1A 2IWBA 3D9YA 5A92A 2L4RA 1W79A 3O3VA 1YMSA 1ODVA 4OPYA 1DP9A 3UDXA 2O9AA 4Q0JA 2J7VA 2Z2MB 4OOMA 3DTEA 4C6YA 2RCXA 4LRYC 3VSKA 1ZTUA 5EVIA 4D2OA 2V2FF 4X69A 2Y55A 4K91A 2VV8A 3IXDA 2PU4A 2PD7A 2XQZA 5DFYA 2OAQ1 3Q81A 5A8BA 3N8RA 5TGFA 3ICYA 4K08A 4HEFA 2ZBBA 4LGWA 1LSVA 3S7QA 3DTMA 1MWUA 2W0NA 5M1AA 4ZJ2A 3GQZA 2Y2QA 4EWFA 4H6JA 1NWZA 2XD5A 2EWWA 4OP8A 3LIBA 4EQ1A 3RFBA 3QNCA 1HZOA 2JKTI 2ZC4B 1KGGA 4I5SA 2VX8A 3A3IA 2WZZA 4Y7PA 1XX2A 5FQQA 1K4EA 2J9PA 5G4YA 4M4XA 1MZUA 4IJGA 3HLDA 3E98A 2VK3A 2Y2MA 5AJGA 2XEPA 4LV2A 1OMEA 1YLZA 1GSXA 4HJ4A 1GA0A 2W3HA 4QY5A 4S2LA 4PKYA 1CK3A 4MBKA 3BFEA 3EWKA 5J3WA 5F6AA 2M1CA 3B42A 1TF1A 1EWZA 4DE0A 5JYPA 4I39A 5KSHA 3S7OA 4YOFA 4BLMA 2I9VA 3T50A 1BT5A 3ZYTA 5EM0A 3E2LA 3VSLA 3MZDA 2Y2KA 3QP5A 3SZTA 4L0LA 4P0MA 1WE4A 1MWSA 5HD5A 3K2NA 2J3TC 3ZCZA 5HDCA 1Y54A 2WADA 3WS5A 3W4PA 1NYMA 4LLOB 5HWTA 2GX5A 4HH2A 4OPRA 1H5XA 4N9LA 1IEMA 1LL8A 4XXRA 2WZXA 5EFWA 1NZOA 1Y28A 3F1PB 3MQQA 1FCOA 5E2FA 4YNRA 2QKPA 4Z1WA 1AXBA 2VEAA 3ZDJA 3NOTC 5F5YA 2HGVA 4LPZA 1V9ZA 2VJWA 1YLTA 3LCEA 2Y91A 3IHBA 1LL5A 2LB9A 2BASA 1XJ2A 2H28A 2WAEA 1VETB 2V8FA 4EEPA 4D60A 4WL9A 1Q2QA 1K56A 4JXVA 2K31A 2KLIA 4NEED 1V9YA 3N4IA 4JGQA 3LYXA 5FAPA 4BQMA 5FQIA 2X01A 5FA7A 4IUHA 4DN0A 4WUJA 1NRFA 1YMXA 1K6SA 3BWLA 3ZNTA 3RH8B 1KGFA 4WELA 3VP3A 3T1XA 2Y79A 2PR5A 2JKRI 4GW9A 3OPRA 3G35A 2C5WB 3TE8A 1YLJA 4UA6A 5F69A 1CJFA 4Y17A 4S2MA 2ZQCA 3ULFA 5J7EA 1CI8A 3QP8A 5AVEA 3Q7ZA 2JE5A 2JCHA 3CJMA 3MXRA 4JXWA 3E2KA 1FIKA 4WZ4A 4RQ9A 1PWCA 3P98A 4E3JA 2V0WA 4GD6A 4R0QA 4EQIA 3LR5A 3PBNA 5BOHA 5L10A 3C8CA 3T4TA 3GDIA 4OVDA 3NCKA 1VEUB 2XFTA 4LCLA 1K54A 3HLBA 2WKIA 1ESUA 4BBUA 5FDSA 3DTIA 3KSHA 2ZQ9A 3HJKA 4OLDA 2GNXA 3HCYA 5FI7A 3G32A 2QZ6A 2Y2GA 4KZBA 1ES5A 4GLQA 2ZM0A 5CEDA 5GLCA 2DRWA 3A0RA 3PAEA 1G6OA 2ZQ7A 2IA2A 3EOIA 3UPPA 3UDIA 4S2OA 4KQOA 3MBZA 1YSPA 4E3KA 2CMNA 3F1NB 1TS0A 3ZGAB 1K55C 1S0WA 3N6IA 2O9CA 4B88A 3KX0X 3NBLA 2PYRA 1F5MA 3DBAA 2GJ3A 2WKQA 2ZQ8A 4Y13A 3C30A 1VETA 3ZG7B 5AQ7A 4HJ3A 4CLCE 5HDSA 1JWZA 4C3QA 3C4OA 3IWIA 4KQDA 1STZA 4PPRA 3CMZA 4S2NA 1ACFA 2J9OA 5HDDA 4ETZA 4S2JA 3ITAA 4WMCD 5J8XA 4JLFA 3SW1A 4GDNA 2HDUA 3NDGA 3N8LA 2A24B 4GDBA 4WZ5C 2EXBA 4FH4A 4ZTKA 3UE1A 1NYYA 3UB7A 4BD1A 3VV4A 1DY6A 3JYIA 3HBRA 3IX3A 4MDZA 1GCEA 3T4LA 2ZOHA 1JTGA 5DF9A 2Y8HA 5E2GA 3EQVA 1K57C 4NK3A 3IS2A 5FAOA 4LRXC 2QHKA 3CUEC 4OP5A 3NOUC 1PZOA 2YKHA 1M40A 4ZBEA 3MFDA 5HL1A 3ISGA 4UHUA 3G2YA 4BL3A 1Q2PA 3UB9A 1VEUA 3M6HA 5A90A 3IH8A 5EV0A 3SS4A 3G31A 3GVBA 1P9WA 2FH5A 4HY8A 2EX6A 1G28A 1YAXA 4KUOA 2WKRA 1PWGA 1IOUA 1OTIA 1SKOA 3PR6A 3HL9A 1L2SA 2Y2PA 4JF5A 2L0WA 2NUTC 1PW8A 4KZ8A 3GRJA 1JNUA 1HTZA 3UO9A 4PM9A 2DCFA 5GHZA 5HD3A 3KO6A 2BLSA 3HLFA 1MPLA 5DFXA 4EEUA 4X53A 2GDNA 2J3TD 1JTDA 1OT6A 4ZJ1A 3M2JA 2EXAA 2FZ0A 2KDKA 1ALQA 2ZOIA 1RP5A 2OOLA 3KSFA 3HUNA 5IHVA 1L0DA 3PBSA 3KSIA 3H82B 2EX9A 4NETA 3DWZA 2C6WB 3ZNYA 2QMIA 5DTKA 1WYBA 3E4QA 5HPIA 4B9OA 3CG5A 2JKTM 1XGJA 2W27A 4Y0OA 3PBQA 2AVXA 4KG5A 4K0WA 4ARZB 5FI2A 1KGEA 1OTDA 4EW7A 2J3WA 1KE3A 2JBFA 5FEFA 4NKPA 5EOOA 2JKFA 3RXWA 1YLYA 1BUEA 1FOFA 1T19A 4R70A 4RX3A 4HBTA 4ME4A 1OTBA 4M3KA 1L0EA 1G68A 1GHIA 5EVIC 3LEQA 5TR7A 3LIEA 2WGVA 5I94A 3B33A 4GKUA 4DE2A 3V3SA 1PZPA 4E04A 3VOZA 5I5LA 1L0GA 4KZ4A 2PHYA 4GZBA 4XT2A 3D4FA 1CQAA 5AVFA 3DTKA 3MKFA 2H0TA 3CWFA 4DE3A 3JVUA 1PNEA 2ZM8A 2Y2HA 3WS2A 2WKEA 2PBDP 5A93A 1NXYA 5F82A 1KVMA 4EBPA 4WBGA 1E4DA 4KZAA 5CGSA 5KSCA 5K5BA 4DRTA 3PAGA 5HW3A 3G6OA 2VV7A 4X6TA 3IXBA 4F3LA 2WGIA 1DP6A 2FFYA 2EFXA 4BL2A 3PTEA 2H10A 1JWPA 3FZCA 5MC7A 1IKIA 3P7NA 2Z6DA 4A5RA 4QPRA 3LY3A 3BFCA 5G4ZA 1H0MA 3AGFA 3UE3A 1KE4A 1LL9A 1XPBA 3LI9A 3LICA 3H7WB 2V1BA 5DKKA 3HLEA 1ZG6A 3H82A 1SHVA 5CTMA 1RGYA 2XFSA 2ZL1B 5GL9A 1I2SA 2A3UA 4PKYG 3LR3A 1ZHHB 3MXSA 3MZFA 2M7UA 1S67L 4OH0A 2LB5A 4WN5A 4QWOA 4KZ7A 1BTLA 4OOLA 2BG1A 3ZG9B 4ARZA 2QWSA 3LR0A 3HLGA 2JKRM 3M6BA 1Z6FA 1SDEA 4KQQA 4Z9QA 3V67A 2WYXA 3BQ8A 3R7WB 5L09A 5LBRA 2XA7M 4HESA 2Z6CA 1H3QA 5D3OA 2HV1A 5AQAA 5DTSA 3V3RA 4CLCD 2UV0E 5HWVA 4BENA 1ES3A 2QPNA 4PHTA 2XR0A 3MQOA 3VE3A 1ERMA 4RA7A 2EX8A 2L1MA 2HPBA 3FG8A 3BFFA 2BTFP 4FUWA 5FQKA 3SH9A 2DNSA 1XFNA 4K0XA 2O99A 2A2LA 4KG2A 2E8JA 4LV1A 4BWIA 2M7VA 3NULA 2OWHA 1XKZA 2WKPA 3VMAA 4I3IA 3O88A 1NLZA 1J3WA 3CAXA 4FOFA 3C38A 1CEGA 1P97A 4B93A 4C75A 5HL6A 4P87A 4Y2FA 3LIAA 2ZC3B 2V1ZA 3BQAA 4X56A 3QP2A 2P08A 2R9WA 5GHXA 4HJ6A 4G3KA 2HJ9C 5CEBA 1YPRA 4N1XA 5HFOA 2PR6A 4HI4A 3PBTA 3WS4A 4P85A 3E4OA 3UE6A 3IWOA 3G30A 1BLSA 5TFQA 5F1FA 1NZUA 2ZMFA 4GJ4A 1DJAA 5FQJA 4HP9A 2W3DA 3IT9A 3H7WA 5TJJA 1GHMA 4O01A 1W7FA 4U0TA 1ESIA 3IBRA 1ZKJA 3MSHA 2ZL1A 1E3UA 5L07A 5J4EA 1XGIA 2XSSA 4CPKA 5GHYA 3OCLA 1K54C 4R3BA 1PW1A 3A3FA 5IS1A 1PWDA 4UAAA 3NJAA 5CECA 4JGPA 2EX2A 4F94A 2ACGA 3WS0A 4Q0HA 3IS2B 4FH2A 3UB8A 4O8GA 3UPNA 3E0YA 4L9GA 3R7WA 1XJ6A 2Y2JA 4XUZA 3GV9A 4GCZA 3BLMA 2QJ5A 4MLLA 5HWWA 2PAVP 3IXGA 3MKEA 5EVLA 1S6RA 3MMHA 3T4QA 4MBHA 5HAIA 3UMEA 5HARA 2Y2OA 3TSGA 3BLSA 3OLOA 4CJNA 1SKOB 4X25A 1D06A 1NY0A 3B3XA 1BLCA 1N4OA 1OTEA 4DE1A 1GHPA 3WRZA 3M2KA 2B95A 3H9WA 3NI9A 4E3LA 5EVID 2HF6A 3N8SA 4IHQA 4MCWA 2G2WA 4S2NC 1SZVA 4IVIA 4WEKA 3CPTB 1LSXA 4NXBA 4KZ9A 3T4KA 2ZD8A 1S1ZA 1K0KA 3PXPA 2P7JA 4U0XA 2VGLM 5EUAA 5CXWA 1ES2A 4R3JA 2JN7A 4ZAMA 3DWKA 4R6LA 5HZHA 4DDYA 3IQAA 2O9BA 3C4PA 2ZMAA 2OLUA 4OONA 3CZDA 5E43A 1N9OA 2G7UA 4X1LA 1T18A 2VKSA 5HX9A 2OSUA 4FTXA 5CRFA 1YM1A 1LT0A 1K6RA 4HH3A 4Y0TA 1MC0A 4WEJA 5CX7A 3SH7A 1SCWA 2Q9MA 4EV4A 1BLPA 4CQHA 1NLYA 5A91A 2VLGA 2B5RA 3UY6A 4LENA 5AQBA 4QHCA 4OOYA 3NOPC 1HLUP 1KOUA 4DJ3A 5L2FA 2V1AA 4OLGA 4KZ6A 4XT2B 3U2AA 3LO7A 1KE0A 3P01A 4JGRA 4R1GA 4EBNA 3G2ZA 1ZC2A 4MN7A 2XRNA 4Q0IA 3LGOA 4CLCA 2NUPC 2WGWB 1ONHA 3S7PA 2D01A 4X68A 1GA9A 4KZ5A 3O87A 1L3LA 2W3EA 5FATA 1IFQA 1U60A 1OPXA 3RTYA 2VGLS 5F83A 1ZG4A 4F3LB 2VV6A 1MWRA 3EEHA 1M6KA 5HSQA 3HLCA 4P6ZM 2JHEA 4S2PA 5F68A 4EU0A 2RL3A 5EOEA 3W4QA 4L9FA 2B02A 3BW6A 3CPTA 1XP4A 2R78A 2YKFA 1TS7A 3F1OB 4KENB 1D7EA 2JC7A 4NXGA 1T1BA 4GS9B 1G6AA 3IWQA 4UEYA 2Z2LB 4HOIA 5GLDA 5DKLA 4R23A 2PYPA 3JPUA 5HPFA 3IF6B 2ZQDA 3BM6A 1K56D 3SH8A 1I2WA 3SS5A 3OPPA 4H8RA 3PHYA 2EA9A 1CI9A 3A3JA 1OTAA 4FD8A 4GOGA 3S4XA 4JXSA 4QD4A 2WUQA 1G5UA 1H8ZA 1YQSA 3ZVTA 1UWNX 1FQGA 3UNWA 3LIDA 2P9VB 1LI9A 4E3MA 2E8IA 2Q9NA 3IX4A 1W63M 4YFMA 5IT5A 3GTCA 5DF7A 3K3CA 4E3OA 3N7WA 3BY9A 1W5DA 4MMNA 4ESPA 4O0PA 4JXGA 1S4SA 4I38A 1TDGA 1XA7A 3MS6A 2PU2A 3BFGA 2INWA 5FDHA 2JKGA 1QMFA 5CHMA 3VFFA 2XGNA 1L0FA 4IVKA 4OQIA 1SKFA 4JF4A 4UQIM 2VZWA 4JKTA 1JWVA 3PBRA 3UPOA 4PM5A 1UWPX 3OZHA 3OOVA 3FWLA 1ES4A 4DKIA 3SS3A 1TVFA 4WF0A 1A0KA 5EVEA 4HP4A 5FAQA 3D3OA 4P6ZS 2V8CA 4Y15A 5FI6A 2WGWA 4ETXA 2KX6A 1S66L 4E6XA 2ZM2A 2GZAA 2V9AA 4E3IA 1KVLA 3SOIA 5HAQA 3IF6C 3V39A 3QP4A 3WWXA 1PRQA 4PM8A 1Y4OA 3S7NA 2H0YA 3VOYA 1W63Q 4WM9A 1QMEA 4NXEA 4NXFA 5L8MA 3EGXC 5DJTA 2XF3A 3A0VA 1FSWA 3F1OA 4R4SA 2ZC5B 4E3NA 4GS9A 3ZG5A 3OBFA 4Y3IA 2QYBA 3IF6A 1O7EA 2HP5A 3TW8A 3GSGA 1BULA 2OWJA 4JBFA 3VP1A 1YSQA 4N1HA 2W1TB 3HVFA 3Q7VB 3MZEA 3QNBA 4WMCA 2G2UA 3IXHA 4ZDXA 5HAPA 4GNUA 4WLAA 2XK1A 3KYQA 2P9VA 3MR0A 4B4ZA 1IELA 2HP9A 4EUVA 4EESA 3PYPA 1AWIA 1K4FA 4UQIS 1OJGA 5M18A 3JVVA 5U47A 1F9IA 3LIFA 2Y59A 3UMDA 1XJ4A 2PDRA 3FPVA 4OQ0A 1LHYA 4I3JA 3ZFZA 1RCJA 2XROA 4HBUA 1SDNA 3C7VA 5GLBA 3NIAA 1N9NA 2R9XA 3T1SA 3BECA 3ITBA 1W8YA 2HZ5A 3LY4A 4NG2A 4HHDA 3A3DA 5DJUA 4IBXA 3Q1FA 1OJ5A 2UWXA 3C7UA 4N9KA 3L9KA 1WA9A 4RVAA 3LI8A 3V50A 3V5MA 4Y5FA 5DF8A 1MBLA 4PMAA 5CHJA 1CF0A 4MEZA 3CI6A 1GSVA 1N9LA 4RYEA 1JVJA 3E4PA 4MN5A 3IHAA 4OPZA 3MFXA 1PI5A 2HDSA 3NC8A 4RX2A 1WYCA 3O5YA 2D02A 4X1MA 1K38A 4LFUA 1K25A 2J8YA 4P6BA 1BLHA 3VP4A 1EI5A 1I5QA 4DJ2A 1IYOA 3W8KA 3L7HA 3U4LP 1DJCA 5GLAA 1ONGA 2K7SA 1DRMA 4ID4A 4PAUA 1C3BA 1BYWA 4EBLA 4FSFA 3ZG0A 2HP6A 2A49A 2Y4AA 3MXQA 3NY4A 1HD8A 3TRCA 5FQ9A 2X02A 2ZC7A 3S1YA 1FCNA 1RGZA 3UB5P 1FILA 2ZC6B 5DTTA 4YWZA 5F1GA 2W3FA 4OQHA 1N9BA 2XA7S 3QP1A 1BSGA 4QU3A 3OPLA 2W1TA 1BZAA 3Q7VA 3FV7A 3T1QB 4DF6A 4S2KA 1W8QA 3IBJA 5KMWA 1S1YA 3UE0A 1NJ4A 4DXBA 4R3AA 4KG6A 3QP6A 2B18A 3FYZA
chains in the Genus database with same CATH topology
1XXMA 1MXOA 4QB8A 1CK3A 5L2FA 4MBKA 4RX3A 3BFEA 4HBTA 4OPQA 4OLGA 4KZ6A 3LEZA 1IYPA 2XH9A 4M3KA 4WYYA 1L0EA 4QJGA 1G68A 1GHIA 5EVIC 5TR7A 1EWZA 3G4PA 3LO7A 3TG9A 2WGVA 4DE0A 5I94A 5JYPA 5KSHA 4GKUA 1KE0A 4R1GA 4BLMA 4DE2A 3V3SA 5CTNA 1PZPA 3VOZA 4EBNA 1BT5A 3G2ZA 1L0GA 4KZ4A 3E2LA 1ZC2A 3VSLA 4GZBA 3MZDA 2Y2KA 4DDSA 1PI4A 2IWCA 3D4FA 5JYOA 3RJUA 2HDQA 4IBRA 2WGWB 4L0LA 4P0MA 1WE4A 4LCMA 1MWSA 1ONHA 3MKFA 1TEMA 3ZCZA 2H0TA 4X68A 1Y54A 1GA9A 2WADA 4DE3A 3WS5A 4KZ5A 2Y2NA 3W4PA 3O87A 2ZM8A 1NYMA 5FATA 2WAFA 2Y2HA 2CC1A 3WS2A 1U60A 2WKEA 1CEFA 4OPRA 4XUXA 5F83A 2VGJA 1H5XA 1ZG4A 4MBFA 4N9LA 1IEMA 5A93A 1NXYA 5F82A 1KVMA 4EBPA 4WBGA 4XXRA 2WZXA 1MWRA 2XD1A 1TDLA 1HVBA 1M6KA 3ZHHA 1E4DA 4KZAA 5CGSA 1NZOA 3HLCA 3UDFA 5KSCA 5CGXA 1FCOA 1MY8A 5E2FA 3AGEA 5E2EA 1AXBA 4S2PA 2VGKA 4DRTA 3PAGA 5HW3A 3ZDJA 4GN2A 4X6TA 3G34A 3IXBA 4OQGA 4PM7A 2RL3A 5EOEA 3W4QA 2WGIA 3BEBA 1XP4A 2FFYA 1YLTA 3Q07A 2EFXA 3LCEA 4BL2A 3PTEA 4KENB 2H10A 2JC7A 2Y91A 3IHBA 1JWPA 1LI0A 1LL5A 3FZCA 5CGWA 1IKIA 1G6AA 3IWQA 2Z2LB 4A5RA 4BJPA 5GLDA 4R23A 5FQMA 3ZG8B 3LY3A 4UA7A 4E6WA 2WAEA 3IF6B 2ZQDA 2I72A 3BM6A 3I7JA 3BFCA 1K56D 1IKGA 3SH8A 2FFFB 1I2WA 1PIOA 4GD8A 1Q2QA 5G18A 3SS5A 1K56A 3OPPA 4JXVA 3AGFA 4H8RA 3UE3A 1KE4A 3DW0A 1LL9A 3N4IA 4EUZA 1XPBA 1CI9A 3A3JA 5FAPA 1YT4A 4BQMA 5FQIA 4FD8A 4IEDA 1VM1A 4GOGA 2X01A 3VFHA 3S4XA 4JXSA 4QD4A 2WUQA 3HLEA 1H8ZA 5EECA 5FA7A 4LV0A 1YQSA 3ZVTA 1ZG6A 1SHVA 3A3EA 5CTMA 1LLBA 1FQGA 3UNWA 1RGYA 2X71A 2XFSA 1IYQA 5GL9A 1I2SA 2P9VB 2A3UA 3IF5A 5FSRA 3S22A 1NRFA 1LI9A 1YMXA 1K6SA 3BRMA 3ZNTA 4E3MA 2E8IA 2Q9NA 5EE8A 2XDMA 3MXSA 1KGFA 3MZFA 4WELA 3VP3A 4OH0A 1K55A 4YFMA 3OPRA 5DVAA 3GTCA 5DF7A 3G35A 2C5WB 4E3OA 3N7WA 4KZ7A 1BTLA 1W5DA 4OOLA 1YLJA 2BG1A 4YINA 3ZG9B 2EFUA 4UA6A 3HLGA 5KZHA 4JXGA 1TDGA 1XA7A 3GMWA 4S2MA 3Q82A 2ZQCA 2PU2A 3BFGA 3M6BA 1Z6FA 1SDEA 4KQQA 2WKHA 4U3TA 4Z9QA 3VP2A 2WYXA 1CI8A 2ZLYA 4R4RA 1J9MA 3Q7ZA 4HESA 2JE5A 4PM6A 3O86A 2JCHA 3CJMA 3MXRA 5FDHA 4JXWA 1QMFA 5CHMA 3VFFA 5D3OA 2XGNA 3E2KA 2HDRA 2Y2IA 1L0FA 4IVKA 5AQAA 4OQIA 5DTSA 4WZ4A 1SKFA 4JF4A 1PWCA 3OCNA 3FYZA 5EPHA 5AQ9A 3P98A 4E3JA 3WRTA 3P09A 3V3RA 4JKTA 1JWVA 4GD6A 4R0QA 4BENA 1ES3A 2QPNA 3PBRA 2XR0A 4EQIA 3UPOA 3PBNA 3HLWA 4PM5A 5BOHA 3OZHA 1FSYA 3AGDA 3FWLA 1ES4A 4DKIA 4WZ5A 3SS3A 1TVFA 2ZJ9A 1MWTA 2ZQAA 1ERMA 4OVDA 2PBYA 3NCKA 2XFTA 4RA7A 5FAQA 2EX8A 1FCMA 4LCLA 1K54A 1VQQA 3HLBA 4KQRA 2WKIA 2HPBA 5FI6A 1ESUA 2WGWA 3BFFA 5FQKA 3SH9A 1FR6A 4E6XA 2DNSA 2ZM2A 4X55A 2ZQ9A 4OLDA 5FI7A 3G32A 3NDEA 4K0XA 4QY6A 2QZ6A 2Y2GA 5CHUA 4KG2A 4KZBA 4E3IA 1ES5A 4LV1A 1KVLA 3UN7A 5EVIB 2ZM0A 3SOIA 5HAQA 5CEDA 2OLVA 5GLCA 4OKPA 2DRWA 3PAEA 3IF6C 1K57A 4JF6A 3V39A 1XKZA 3VMAA 2ZQ7A 2OV5A 3WWXA 4FCFA 3O88A 3UPPA 4PM8A 3UDIA 4DXCA 1CEGA 4S2OA 4KQOA 2H0YA 3MBZA 3GR2A 3VOYA 4GB7A 3HUMA 4C75A 3OPHA 4E3KA 1DJBA 4P87A 3RXXA 4WM9A 1XA1A 1QMEA 2P74A 4B4XA 1H8YA 1YLWA 3ZGAB 2ZC3B 1MKIA 2V1ZA 1K55C 1S0WA 2XF3A 4X56A 3N6IA 4B88A 1FSWA 2R9WA 5GHXA 3FKWA 3NBLA 4R4SA 2ZC5B 4E3NA 5CEBA 1E25A 4N1XA 5HFOA 3ZG5A 3PBTA 3WS4A 4P85A 2ZQ8A 3IWOA 3G30A 4S2IA 1BLSA 5TFQA 5F1FA 3ZG7B 3IF6A 5AQ7A 1O7EA 2HP5A 1NZUA 4ZJ3A 3GSGA 2H5SA 1JWZA 1BULA 4C3QA 1DJAA 3C4OA 3IWIA 5FQJA 1KDWA 4JBFA 4PPRA 4O7DA 3CMZA 1EROA 4S2NA 1FR1A 2J9OA 3VP1A 3IT9A 4N1HA 1YLPA 3HUOA 4S2JA 3ITAA 4Q8IA 3HVFA 5M19A 4WMCD 3Q7VB 1GHMA 3OC2A 4JLFA 4N92A 3TOIA 5J8XA 4GDNA 2HDUA 3MZEA 3NDGA 3QNBA 4WMCA 2G2UA 1IYSA 1E3UD 1W7FA 3IXHA 4U0TA 1ESIA 4ZDXA 3BFDA 3N8LA 5HAPA 1ZKJA 4GNUA 1E3UA 2XK1A 4GDBA 2P9VA 1XGIA 4WZ5C 2EXBA 4FH4A 4B4ZA 1IELA 2V20A 4ZTKA 3C5AA 2HP9A 3UE1A 4CPKA 5GHYA 4JPMA 1NYYA 3PBOA 4BD1A 3OCLA 1K4FA 5E2HA 1K54C 3W4OA 4R3BA 1PW1A 3A3FA 4Y0UA 1PWDA 4UAAA 1DY6A 3FKVA 1KDSA 3JYIA 5M18A 3HBRA 5CECA 1GCEA 5U47A 2EX2A 3HREA 4F94A 1JTGA 3WS0A 2Y59A 3EQUA 2IWDA 4FH2A 5DF9A 3UPNA 1PYYA 5CERA 4OQ0A 1LHYA 2WK0A 5FASA 4MNRA 2Y2JA 4XUZA 1RCJA 5E2GA 3GV9A 3EQVA 3ZFZA 4HBUA 1SDNA 1K57C 3C7VA 3NIAA 4LV3A 5GLBA 4NK3A 2R9XA 3BECA 1O07A 3BLMA 5FAOA 3ITBA 1W8YA 3LY4A 4MLLA 3BYDA 3IH9A 3A3DA 3VP0A 4UA9A 2Y2LA 3WS1A 4IBXA 3ZVWA 3Q1FA 4OP5A 3IXGA 2XLNA 4BD0A 2UWXA 1ERQA 3C7UA 3MKEA 1PZOA 3QHYA 5EVLA 1S6RA 4N9KA 1M40A 4KZ3A 2IWBA 4ZBEA 5A92A 3MFDA 5HL1A 4MBHA 3ISGA 4UHUA 4RVAA 5HAIA 3V50A 3G2YA 3V5MA 1W79A 5DF8A 4BL3A 1MBLA 3O3VA 1YMSA 4PMAA 5HARA 2Y2OA 3TSGA 5CHJA 1Q2PA 4MEZA 4OPYA 3BLSA 3M6HA 4CJNA 5A90A 3UDXA 3IH8A 3SS4A 3G31A 1NY0A 3B3XA 1BLCA 3GVBA 1N4OA 4RYEA 1JVJA 2J7VA 4DE1A 3IHAA 2EX6A 4OPZA 2Z2MB 1GHPA 4OOMA 3WRZA 1PWGA 1PI5A 2HDSA 3M2KA 4C6YA 2RCXA 3NC8A 3NI9A 4RX2A 4E3LA 1WYCA 5EVID 3HL9A 3VSKA 1L2SA 2Y2PA 3N8SA 4JF5A 5EVIA 4D2OA 2G2WA 2V2FF 1PW8A 1K38A 4KZ8A 3GRJA 1K25A 4S2NC 4X69A 2J8YA 4IVIA 1HTZA 3UO9A 2Y55A 4P6BA 4PM9A 4WEKA 4K91A 1BLHA 3VP4A 1EI5A 2DCFA 1I5QA 5GHZA 4KZ9A 2ZD8A 1IYOA 3W8KA 4U0XA 2BLSA 1DJCA 3HLFA 5EUAA 3IXDA 1MPLA 2PU4A 2XQZA 5GLAA 5CXWA 1ES2A 1ONGA 3Q81A 4R3JA 4X53A 3N8RA 5TGFA 2GDNA 1JTDA 4ZAMA 4ZJ1A 3DWKA 4HEFA 3M2JA 3DTMA 2EXAA 1MWUA 4DDYA 4ID4A 3IQAA 5M1AA 4ZJ2A 3C4PA 2ZMAA 1ALQA 2OLUA 3GQZA 1C3BA 4OONA 1RP5A 2Y2QA 4EWFA 3CZDA 5E43A 4EBLA 4FSFA 3ZG0A 2HP6A 2XD5A 3HUNA 5IHVA 2A49A 2Y4AA 3NY4A 2OSUA 5HX9A 1HD8A 1L0DA 5FQ9A 2X02A 2ZC7A 3PBSA 5CRFA 3S1YA 1FCNA 4OP8A 1YM1A 2EX9A 1RGZA 4NETA 3DWZA 2ZC6B 1K6RA 3QNCA 5DTTA 2C6WB 3ZNYA 2QMIA 1HZOA 2ZC4B 5F1GA 4Y0TA 1KGGA 4WEJA 5DTKA 1WYBA 4OQHA 3A3IA 2WZZA 1N9BA 3SH7A 4Y7PA 1BSGA 1SCWA 1XX2A 4QU3A 3OPLA 5FQQA 3CG5A 1K4EA 1BZAA 2J9PA 2Q9MA 3Q7VA 1XGJA 4Y0OA 4EV4A 3PBQA 3FV7A 3HLDA 4KG5A 1BLPA 4K0WA 4DF6A 4S2KA 5FI2A 1W8QA 2Y2MA 1KGEA 5KMWA 2XEPA 1KE3A 4LV2A 1OMEA 1YLZA 2JBFA 5A91A 1NJ4A 3UE0A 2B5RA 1GA0A 3UY6A 4LENA 5AQBA 4QHCA 4QY5A 4OOYA 4DXBA 4S2LA 4KG6A 5EOOA 3RXWA 1YLYA 1BUEA 1FOFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XXM A;  1MXO A;  4QB8 A;  1CK3 A;  5L2F A;  4MBK A;  4RX3 A;  3BFE A;  4HBT A;  4OPQ A;  4OLG A;  4KZ6 A;  3LEZ A;  1IYP A;  2XH9 A;  4M3K A;  4WYY A;  1L0E A;  4QJG A;  1G68 A;  1GHI A;  5EVI C;  5TR7 A;  1EWZ A;  3G4P A;  3LO7 A;  3TG9 A;  2WGV A;  4DE0 A;  5I94 A;  5JYP A;  5KSH A;  4GKU A;  1KE0 A;  4R1G A;  4BLM A;  4DE2 A;  3V3S A;  5CTN A;  1PZP A;  3VOZ A;  4EBN A;  1BT5 A;  3G2Z A;  1L0G A;  4KZ4 A;  3E2L A;  1ZC2 A;  3VSL A;  4GZB A;  3MZD A;  2Y2K A;  4DDS A;  1PI4 A;  2IWC A;  3D4F A;  5JYO A;  3RJU A;  2HDQ A;  4IBR A;  2WGW B;  4L0L A;  4P0M A;  1WE4 A;  4LCM A;  1MWS A;  1ONH A;  3MKF A;  1TEM A;  3ZCZ A;  2H0T A;  4X68 A;  1Y54 A;  1GA9 A;  2WAD A;  4DE3 A;  3WS5 A;  4KZ5 A;  2Y2N A;  3W4P A;  3O87 A;  2ZM8 A;  1NYM A;  5FAT A;  2WAF A;  2Y2H A;  2CC1 A;  3WS2 A;  1U60 A;  2WKE A;  1CEF A;  4OPR A;  4XUX A;  5F83 A;  2VGJ A;  1H5X A;  1ZG4 A;  4MBF A;  4N9L A;  1IEM A;  5A93 A;  1NXY A;  5F82 A;  1KVM A;  4EBP A;  4WBG A;  4XXR A;  2WZX A;  1MWR A;  2XD1 A;  1TDL A;  1HVB A;  1M6K A;  3ZHH A;  1E4D A;  4KZA A;  5CGS A;  1NZO A;  3HLC A;  3UDF A;  5KSC A;  5CGX A;  1FCO A;  1MY8 A;  5E2F A;  3AGE A;  5E2E A;  1AXB A;  4S2P A;  2VGK A;  4DRT A;  3PAG A;  5HW3 A;  3ZDJ A;  4GN2 A;  4X6T A;  3G34 A;  3IXB A;  4OQG A;  4PM7 A;  2RL3 A;  5EOE A;  3W4Q A;  2WGI A;  3BEB A;  1XP4 A;  2FFY A;  1YLT A;  3Q07 A;  2EFX A;  3LCE A;  4BL2 A;  3PTE A;  4KEN B;  2H10 A;  2JC7 A;  2Y91 A;  3IHB A;  1JWP A;  1LI0 A;  1LL5 A;  3FZC A;  5CGW A;  1IKI A;  1G6A A;  3IWQ A;  2Z2L B;  4A5R A;  4BJP A;  5GLD A;  4R23 A;  5FQM A;  3ZG8 B;  3LY3 A;  4UA7 A;  4E6W A;  2WAE A;  3IF6 B;  2ZQD A;  2I72 A;  3BM6 A;  3I7J A;  3BFC A;  1K56 D;  1IKG A;  3SH8 A;  2FFF B;  1I2W A;  1PIO A;  4GD8 A;  1Q2Q A;  5G18 A;  3SS5 A;  1K56 A;  3OPP A;  4JXV A;  3AGF A;  4H8R A;  3UE3 A;  1KE4 A;  3DW0 A;  1LL9 A;  3N4I A;  4EUZ A;  1XPB A;  1CI9 A;  3A3J A;  5FAP A;  1YT4 A;  4BQM A;  5FQI A;  4FD8 A;  4IED A;  1VM1 A;  4GOG A;  2X01 A;  3VFH A;  3S4X A;  4JXS A;  4QD4 A;  2WUQ A;  3HLE A;  1H8Z A;  5EEC A;  5FA7 A;  4LV0 A;  1YQS A;  3ZVT A;  1ZG6 A;  1SHV A;  3A3E A;  5CTM A;  1LLB A;  1FQG A;  3UNW A;  1RGY A;  2X71 A;  2XFS A;  1IYQ A;  5GL9 A;  1I2S A;  2P9V B;  2A3U A;  3IF5 A;  5FSR A;  3S22 A;  1NRF A;  1LI9 A;  1YMX A;  1K6S A;  3BRM A;  3ZNT A;  4E3M A;  2E8I A;  2Q9N A;  5EE8 A;  2XDM A;  3MXS A;  1KGF A;  3MZF A;  4WEL A;  3VP3 A;  4OH0 A;  1K55 A;  4YFM A;  3OPR A;  5DVA A;  3GTC A;  5DF7 A;  3G35 A;  2C5W B;  4E3O A;  3N7W A;  4KZ7 A;  1BTL A;  1W5D A;  4OOL A;  1YLJ A;  2BG1 A;  4YIN A;  3ZG9 B;  2EFU A;  4UA6 A;  3HLG A;  5KZH A;  4JXG A;  1TDG A;  1XA7 A;  3GMW A;  4S2M A;  3Q82 A;  2ZQC A;  2PU2 A;  3BFG A;  3M6B A;  1Z6F A;  1SDE A;  4KQQ A;  2WKH A;  4U3T A;  4Z9Q A;  3VP2 A;  2WYX A;  1CI8 A;  2ZLY A;  4R4R A;  1J9M A;  3Q7Z A;  4HES A;  2JE5 A;  4PM6 A;  3O86 A;  2JCH A;  3CJM A;  3MXR A;  5FDH A;  4JXW A;  1QMF A;  5CHM A;  3VFF A;  5D3O A;  2XGN A;  3E2K A;  2HDR A;  2Y2I A;  1L0F A;  4IVK A;  5AQA A;  4OQI A;  5DTS A;  4WZ4 A;  1SKF A;  4JF4 A;  1PWC A;  3OCN A;  3FYZ A;  5EPH A;  5AQ9 A;  3P98 A;  4E3J A;  3WRT A;  3P09 A;  3V3R A;  4JKT A;  1JWV A;  4GD6 A;  4R0Q A;  4BEN A;  1ES3 A;  2QPN A;  3PBR A;  2XR0 A;  4EQI A;  3UPO A;  3PBN A;  3HLW A;  4PM5 A;  5BOH A;  3OZH A;  1FSY A;  3AGD A;  3FWL A;  1ES4 A;  4DKI A;  4WZ5 A;  3SS3 A;  1TVF A;  2ZJ9 A;  1MWT A;  2ZQA A;  1ERM A;  4OVD A;  2PBY A;  3NCK A;  2XFT A;  4RA7 A;  5FAQ A;  2EX8 A;  1FCM A;  4LCL A;  1K54 A;  1VQQ A;  3HLB A;  4KQR A;  2WKI A;  2HPB A;  5FI6 A;  1ESU A;  2WGW A;  3BFF A;  5FQK A;  3SH9 A;  1FR6 A;  4E6X A;  2DNS A;  2ZM2 A;  4X55 A;  2ZQ9 A;  4OLD A;  5FI7 A;  3G32 A;  3NDE A;  4K0X A;  4QY6 A;  2QZ6 A;  2Y2G A;  5CHU A;  4KG2 A;  4KZB A;  4E3I A;  1ES5 A;  4LV1 A;  1KVL A;  3UN7 A;  5EVI B;  2ZM0 A;  3SOI A;  5HAQ A;  5CED A;  2OLV A;  5GLC A;  4OKP A;  2DRW A;  3PAE A;  3IF6 C;  1K57 A;  4JF6 A;  3V39 A;  1XKZ A;  3VMA A;  2ZQ7 A;  2OV5 A;  3WWX A;  4FCF A;  3O88 A;  3UPP A;  4PM8 A;  3UDI A;  4DXC A;  1CEG A;  4S2O A;  4KQO A;  2H0Y A;  3MBZ A;  3GR2 A;  3VOY A;  4GB7 A;  3HUM A;  4C75 A;  3OPH A;  4E3K A;  1DJB A;  4P87 A;  3RXX A;  4WM9 A;  1XA1 A;  1QME A;  2P74 A;  4B4X A;  1H8Y A;  1YLW A;  3ZGA B;  2ZC3 B;  1MKI A;  2V1Z A;  1K55 C;  1S0W A;  2XF3 A;  4X56 A;  3N6I A;  4B88 A;  1FSW A;  2R9W A;  5GHX A;  3FKW A;  3NBL A;  4R4S A;  2ZC5 B;  4E3N A;  5CEB A;  1E25 A;  4N1X A;  5HFO A;  3ZG5 A;  3PBT A;  3WS4 A;  4P85 A;  2ZQ8 A;  3IWO A;  3G30 A;  4S2I A;  1BLS A;  5TFQ A;  5F1F A;  3ZG7 B;  3IF6 A;  5AQ7 A;  1O7E A;  2HP5 A;  1NZU A;  4ZJ3 A;  3GSG A;  2H5S A;  1JWZ A;  1BUL A;  4C3Q A;  1DJA A;  3C4O A;  3IWI A;  5FQJ A;  1KDW A;  4JBF A;  4PPR A;  4O7D A;  3CMZ A;  1ERO A;  4S2N A;  1FR1 A;  2J9O A;  3VP1 A;  3IT9 A;  4N1H A;  1YLP A;  3HUO A;  4S2J A;  3ITA A;  4Q8I A;  3HVF A;  5M19 A;  4WMC D;  3Q7V B;  1GHM A;  3OC2 A;  4JLF A;  4N92 A;  3TOI A;  5J8X A;  4GDN A;  2HDU A;  3MZE A;  3NDG A;  3QNB A;  4WMC A;  2G2U A;  1IYS A;  1E3U D;  1W7F A;  3IXH A;  4U0T A;  1ESI A;  4ZDX A;  3BFD A;  3N8L A;  5HAP A;  1ZKJ A;  4GNU A;  1E3U A;  2XK1 A;  4GDB A;  2P9V A;  1XGI A;  4WZ5 C;  2EXB A;  4FH4 A;  4B4Z A;  1IEL A;  2V20 A;  4ZTK A;  3C5A A;  2HP9 A;  3UE1 A;  4CPK A;  5GHY A;  4JPM A;  1NYY A;  3PBO A;  4BD1 A;  3OCL A;  1K4F A;  5E2H A;  1K54 C;  3W4O A;  4R3B A;  1PW1 A;  3A3F A;  4Y0U A;  1PWD A;  4UAA A;  1DY6 A;  3FKV A;  1KDS A;  3JYI A;  5M18 A;  3HBR A;  5CEC A;  1GCE A;  5U47 A;  2EX2 A;  3HRE A;  4F94 A;  1JTG A;  3WS0 A;  2Y59 A;  3EQU A;  2IWD A;  4FH2 A;  5DF9 A;  3UPN A;  1PYY A;  5CER A;  4OQ0 A;  1LHY A;  2WK0 A;  5FAS A;  4MNR A;  2Y2J A;  4XUZ A;  1RCJ A;  5E2G A;  3GV9 A;  3EQV A;  3ZFZ A;  4HBU A;  1SDN A;  1K57 C;  3C7V A;  3NIA A;  4LV3 A;  5GLB A;  4NK3 A;  2R9X A;  3BEC A;  1O07 A;  3BLM A;  5FAO A;  3ITB A;  1W8Y A;  3LY4 A;  4MLL A;  3BYD A;  3IH9 A;  3A3D A;  3VP0 A;  4UA9 A;  2Y2L A;  3WS1 A;  4IBX A;  3ZVW A;  3Q1F A;  4OP5 A;  3IXG A;  2XLN A;  4BD0 A;  2UWX A;  1ERQ A;  3C7U A;  3MKE A;  1PZO A;  3QHY A;  5EVL A;  1S6R A;  4N9K A;  1M40 A;  4KZ3 A;  2IWB A;  4ZBE A;  5A92 A;  3MFD A;  5HL1 A;  4MBH A;  3ISG A;  4UHU A;  4RVA A;  5HAI A;  3V50 A;  3G2Y A;  3V5M A;  1W79 A;  5DF8 A;  4BL3 A;  1MBL A;  3O3V A;  1YMS A;  4PMA A;  5HAR A;  2Y2O A;  3TSG A;  5CHJ A;  1Q2P A;  4MEZ A;  4OPY A;  3BLS A;  3M6H A;  4CJN A;  5A90 A;  3UDX A;  3IH8 A;  3SS4 A;  3G31 A;  1NY0 A;  3B3X A;  1BLC A;  3GVB A;  1N4O A;  4RYE A;  1JVJ A;  2J7V A;  4DE1 A;  3IHA A;  2EX6 A;  4OPZ A;  2Z2M B;  1GHP A;  4OOM A;  3WRZ A;  1PWG A;  1PI5 A;  2HDS A;  3M2K A;  4C6Y A;  2RCX A;  3NC8 A;  3NI9 A;  4RX2 A;  4E3L A;  1WYC A;  5EVI D;  3HL9 A;  3VSK A;  1L2S A;  2Y2P A;  3N8S A;  4JF5 A;  5EVI A;  4D2O A;  2G2W A;  2V2F F;  1PW8 A;  1K38 A;  4KZ8 A;  3GRJ A;  1K25 A;  4S2N C;  4X69 A;  2J8Y A;  4IVI A;  1HTZ A;  3UO9 A;  2Y55 A;  4P6B A;  4PM9 A;  4WEK A;  4K91 A;  1BLH A;  3VP4 A;  1EI5 A;  2DCF A;  1I5Q A;  5GHZ A;  4KZ9 A;  2ZD8 A;  1IYO A;  3W8K A;  4U0X A;  2BLS A;  1DJC A;  3HLF A;  5EUA A;  3IXD A;  1MPL A;  2PU4 A;  2XQZ A;  5GLA A;  5CXW A;  1ES2 A;  1ONG A;  3Q81 A;  4R3J A;  4X53 A;  3N8R A;  5TGF A;  2GDN A;  1JTD A;  4ZAM A;  4ZJ1 A;  3DWK A;  4HEF A;  3M2J A;  3DTM A;  2EXA A;  1MWU A;  4DDY A;  4ID4 A;  3IQA A;  5M1A A;  4ZJ2 A;  3C4P A;  2ZMA A;  1ALQ A;  2OLU A;  3GQZ A;  1C3B A;  4OON A;  1RP5 A;  2Y2Q A;  4EWF A;  3CZD A;  5E43 A;  4EBL A;  4FSF A;  3ZG0 A;  2HP6 A;  2XD5 A;  3HUN A;  5IHV A;  2A49 A;  2Y4A A;  3NY4 A;  2OSU A;  5HX9 A;  1HD8 A;  1L0D A;  5FQ9 A;  2X02 A;  2ZC7 A;  3PBS A;  5CRF A;  3S1Y A;  1FCN A;  4OP8 A;  1YM1 A;  2EX9 A;  1RGZ A;  4NET A;  3DWZ A;  2ZC6 B;  1K6R A;  3QNC A;  5DTT A;  2C6W B;  3ZNY A;  2QMI A;  1HZO A;  2ZC4 B;  5F1G A;  4Y0T A;  1KGG A;  4WEJ A;  5DTK A;  1WYB A;  4OQH A;  3A3I A;  2WZZ A;  1N9B A;  3SH7 A;  4Y7P A;  1BSG A;  1SCW A;  1XX2 A;  4QU3 A;  3OPL A;  5FQQ A;  3CG5 A;  1K4E A;  1BZA A;  2J9P A;  2Q9M A;  3Q7V A;  1XGJ A;  4Y0O A;  4EV4 A;  3PBQ A;  3FV7 A;  3HLD A;  4KG5 A;  1BLP A;  4K0W A;  4DF6 A;  4S2K A;  5FI2 A;  1W8Q A;  2Y2M A;  1KGE A;  5KMW A;  2XEP A;  1KE3 A;  4LV2 A;  1OME A;  1YLZ A;  2JBF A;  5A91 A;  1NJ4 A;  3UE0 A;  2B5R A;  1GA0 A;  3UY6 A;  4LEN A;  5AQB A;  4QHC A;  4QY5 A;  4OOY A;  4DXB A;  4S2L A;  4KG6 A;  5EOO A;  3RXW A;  1YLY A;  1BUE A;  1FOF A; 
#chains in the Genus database with same CATH topology
 1XXM A;  1MXO A;  4QB8 A;  4OPQ A;  4LRZ E;  4HIA A;  3LEZ A;  1IYP A;  2XH9 A;  3R4K A;  4WYY A;  4QJG A;  3DAV A;  3G4P A;  3TG9 A;  4CLC B;  1LSW A;  2ZMV A;  5CTN A;  3T4S A;  3MF0 A;  5C5K A;  1TS8 A;  3LFV A;  4ZRR A;  4DDS A;  1PI4 A;  2IWC A;  5JYO A;  3RJU A;  2HDQ A;  4IBR A;  4LCM A;  3MQ0 A;  1TEM A;  2P04 A;  1H8M A;  2Y2N A;  3BY8 A;  2WAF A;  2MJ6 A;  4DMZ A;  2CC1 A;  4EET B;  1CEF A;  4XUX A;  3VE4 A;  2VGJ A;  4MBF A;  4HQA A;  3CIT A;  3W2Z A;  1TDL A;  2XD1 A;  1HVB A;  3ZHH A;  3UDF A;  5CGX A;  1MY8 A;  3AGE A;  5E2E A;  2VGK A;  4G3W A;  3TJZ C;  4GN2 A;  3G34 A;  4OQG A;  4PM7 A;  3BEB A;  1T1C A;  2KOI A;  3Q07 A;  4JGO A;  3F1P A;  3FPW A;  1LI0 A;  4EER A;  2W1R A;  5CGW A;  3KYE A;  4BJP A;  5FQM A;  3ZG8 B;  1UGU A;  4UA7 A;  4E6W A;  3T4J A;  2I72 A;  3I7J A;  1IKG A;  3HJI A;  2FFF B;  5G18 A;  1PIO A;  4GD8 A;  1TS6 A;  3DW0 A;  3LR4 A;  4HNB A;  4EUZ A;  1X0O A;  1F98 A;  1XFQ A;  4BBV A;  1P0Z A;  1YT4 A;  4IED A;  1VM1 A;  3VFH A;  1VHM A;  4GHI B;  4L9E A;  5EEC A;  4LV0 A;  4EXO A;  1DP8 A;  3A3E A;  4AFI A;  2Q0O A;  3C2W A;  1LLB A;  2X71 A;  4BBT A;  1IYQ A;  3BJN A;  1GSW A;  3IF5 A;  5FSR A;  3S22 A;  3BRM A;  3A0S A;  2XDM A;  3FC7 A;  5EE8 A;  2PRF A;  4CLC C;  3NHQ A;  1K55 A;  3CLO A;  5DVA A;  4YIN A;  2EFU A;  2OAP 1;  5KZH A;  1YKD A;  3LUQ A;  3GMW A;  3Q82 A;  1D1J A;  3VP2 A;  4U3T A;  2WKH A;  2ZLY A;  4R4R A;  4IUK A;  1J9M A;  1PFL A;  2O0Y A;  3O86 A;  4PM6 A;  1MKM A;  3VOL A;  2HDR A;  2Y2I A;  5TBM B;  4II7 A;  3OCN A;  5EPH A;  5AQ9 A;  3WRT A;  3P09 A;  3D72 A;  3HLW A;  1VB6 A;  3IX8 A;  3EGD C;  1FSY A;  3AGD A;  5IU1 A;  4WZ5 A;  2ZJ9 A;  1MWT A;  2ZQA A;  2PBY A;  3K3D A;  1FCM A;  1VQQ A;  4KQR A;  1FR6 A;  4X55 A;  3UB6 A;  3T1R A;  3NDE A;  4QY6 A;  5CHU A;  2HJE A;  3UN7 A;  3B47 A;  5EVI B;  2OLV A;  4OKP A;  5KIZ A;  1K57 A;  1Z09 A;  4JF6 A;  2OV5 A;  4FCF A;  4DXC A;  1OT9 A;  3GR2 A;  4GB7 A;  3HUM A;  3CUE A;  2J80 A;  3OPH A;  1DJB A;  3RXX A;  1XA1 A;  2P74 A;  4B4X A;  3KSG A;  1H8Y A;  1YLW A;  1MKI A;  2DMW A;  5FEG A;  3FKW A;  1E25 A;  3F1N A;  3T4O A;  4H6J B;  1TD5 A;  4S2I A;  4BMW A;  5FL3 A;  3ZQ5 A;  4I3A A;  4ZJ3 A;  2H5S A;  2VA0 A;  1KDW A;  3NEC A;  4O7D A;  1ERO A;  1FR1 A;  1EW0 A;  1YLP A;  3HUO A;  4Q8I A;  5M19 A;  2PD8 A;  3TOI A;  3OC2 A;  4N92 A;  4GHI A;  1IYS A;  1E3U D;  1NRJ A;  4G3V A;  3BFD A;  2W3G A;  2V20 A;  3CHW P;  3C5A A;  4JPM A;  3PBO A;  3KYZ A;  5E2H A;  3W4O A;  4Y0U A;  2A24 A;  3FKV A;  1KDS A;  1XJ3 A;  3HRE A;  1P9R A;  2QJ7 A;  3EQU A;  2IWD A;  2EWV A;  1PYY A;  5CER A;  1S4R A;  4KUK A;  2WK0 A;  5FAS A;  2K2N A;  4MN6 A;  4MNR A;  2V0U A;  4LV3 A;  2PT7 A;  1O07 A;  5TBM A;  3GEC A;  3BYD A;  1F2K A;  3IH9 A;  3VP0 A;  4UA9 A;  2Y2L A;  3T12 B;  3WS1 A;  3ZVW A;  2XLN A;  1T1A A;  4BD0 A;  1ERQ A;  3QHY A;  3MJQ A;  3EEA A;  4KZ3 A;  4R38 A;  5EM1 A;  2IWB A;  3D9Y A;  5A92 A;  2L4R A;  1W79 A;  3O3V A;  1YMS A;  1ODV A;  4OPY A;  1DP9 A;  3UDX A;  2O9A A;  4Q0J A;  2J7V A;  2Z2M B;  4OOM A;  3DTE A;  4C6Y A;  2RCX A;  4LRY C;  3VSK A;  1ZTU A;  5EVI A;  4D2O A;  2V2F F;  4X69 A;  2Y55 A;  4K91 A;  2VV8 A;  3IXD A;  2PU4 A;  2PD7 A;  2XQZ A;  5DFY A;  2OAQ 1;  3Q81 A;  5A8B A;  3N8R A;  5TGF A;  3ICY A;  4K08 A;  4HEF A;  2ZBB A;  4LGW A;  1LSV A;  3S7Q A;  3DTM A;  1MWU A;  2W0N A;  5M1A A;  4ZJ2 A;  3GQZ A;  2Y2Q A;  4EWF A;  4H6J A;  1NWZ A;  2XD5 A;  2EWW A;  4OP8 A;  3LIB A;  4EQ1 A;  3RFB A;  3QNC A;  1HZO A;  2JKT I;  2ZC4 B;  1KGG A;  4I5S A;  2VX8 A;  3A3I A;  2WZZ A;  4Y7P A;  1XX2 A;  5FQQ A;  1K4E A;  2J9P A;  5G4Y A;  4M4X A;  1MZU A;  4IJG A;  3HLD A;  3E98 A;  2VK3 A;  2Y2M A;  5AJG A;  2XEP A;  4LV2 A;  1OME A;  1YLZ A;  1GSX A;  4HJ4 A;  1GA0 A;  2W3H A;  4QY5 A;  4S2L A;  4PKY A;  1CK3 A;  4MBK A;  3BFE A;  3EWK A;  5J3W A;  5F6A A;  2M1C A;  3B42 A;  1TF1 A;  1EWZ A;  4DE0 A;  5JYP A;  4I39 A;  5KSH A;  3S7O A;  4YOF A;  4BLM A;  2I9V A;  3T50 A;  1BT5 A;  3ZYT A;  5EM0 A;  3E2L A;  3VSL A;  3MZD A;  2Y2K A;  3QP5 A;  3SZT A;  4L0L A;  4P0M A;  1WE4 A;  1MWS A;  5HD5 A;  3K2N A;  2J3T C;  3ZCZ A;  5HDC A;  1Y54 A;  2WAD A;  3WS5 A;  3W4P A;  1NYM A;  4LLO B;  5HWT A;  2GX5 A;  4HH2 A;  4OPR A;  1H5X A;  4N9L A;  1IEM A;  1LL8 A;  4XXR A;  2WZX A;  5EFW A;  1NZO A;  1Y28 A;  3F1P B;  3MQQ A;  1FCO A;  5E2F A;  4YNR A;  2QKP A;  4Z1W A;  1AXB A;  2VEA A;  3ZDJ A;  3NOT C;  5F5Y A;  2HGV A;  4LPZ A;  1V9Z A;  2VJW A;  1YLT A;  3LCE A;  2Y91 A;  3IHB A;  1LL5 A;  2LB9 A;  2BAS A;  1XJ2 A;  2H28 A;  2WAE A;  1VET B;  2V8F A;  4EEP A;  4D60 A;  4WL9 A;  1Q2Q A;  1K56 A;  4JXV A;  2K31 A;  2KLI A;  4NEE D;  1V9Y A;  3N4I A;  4JGQ A;  3LYX A;  5FAP A;  4BQM A;  5FQI A;  2X01 A;  5FA7 A;  4IUH A;  4DN0 A;  4WUJ A;  1NRF A;  1YMX A;  1K6S A;  3BWL A;  3ZNT A;  3RH8 B;  1KGF A;  4WEL A;  3VP3 A;  3T1X A;  2Y79 A;  2PR5 A;  2JKR I;  4GW9 A;  3OPR A;  3G35 A;  2C5W B;  3TE8 A;  1YLJ A;  4UA6 A;  5F69 A;  1CJF A;  4Y17 A;  4S2M A;  2ZQC A;  3ULF A;  5J7E A;  1CI8 A;  3QP8 A;  5AVE A;  3Q7Z A;  2JE5 A;  2JCH A;  3CJM A;  3MXR A;  4JXW A;  3E2K A;  1FIK A;  4WZ4 A;  4RQ9 A;  1PWC A;  3P98 A;  4E3J A;  2V0W A;  4GD6 A;  4R0Q A;  4EQI A;  3LR5 A;  3PBN A;  5BOH A;  5L10 A;  3C8C A;  3T4T A;  3GDI A;  4OVD A;  3NCK A;  1VEU B;  2XFT A;  4LCL A;  1K54 A;  3HLB A;  2WKI A;  1ESU A;  4BBU A;  5FDS A;  3DTI A;  3KSH A;  2ZQ9 A;  3HJK A;  4OLD A;  2GNX A;  3HCY A;  5FI7 A;  3G32 A;  2QZ6 A;  2Y2G A;  4KZB A;  1ES5 A;  4GLQ A;  2ZM0 A;  5CED A;  5GLC A;  2DRW A;  3A0R A;  3PAE A;  1G6O A;  2ZQ7 A;  2IA2 A;  3EOI A;  3UPP A;  3UDI A;  4S2O A;  4KQO A;  3MBZ A;  1YSP A;  4E3K A;  2CMN A;  3F1N B;  1TS0 A;  3ZGA B;  1K55 C;  1S0W A;  3N6I A;  2O9C A;  4B88 A;  3KX0 X;  3NBL A;  2PYR A;  1F5M A;  3DBA A;  2GJ3 A;  2WKQ A;  2ZQ8 A;  4Y13 A;  3C30 A;  1VET A;  3ZG7 B;  5AQ7 A;  4HJ3 A;  4CLC E;  5HDS A;  1JWZ A;  4C3Q A;  3C4O A;  3IWI A;  4KQD A;  1STZ A;  4PPR A;  3CMZ A;  4S2N A;  1ACF A;  2J9O A;  5HDD A;  4ETZ A;  4S2J A;  3ITA A;  4WMC D;  5J8X A;  4JLF A;  3SW1 A;  4GDN A;  2HDU A;  3NDG A;  3N8L A;  2A24 B;  4GDB A;  4WZ5 C;  2EXB A;  4FH4 A;  4ZTK A;  3UE1 A;  1NYY A;  3UB7 A;  4BD1 A;  3VV4 A;  1DY6 A;  3JYI A;  3HBR A;  3IX3 A;  4MDZ A;  1GCE A;  3T4L A;  2ZOH A;  1JTG A;  5DF9 A;  2Y8H A;  5E2G A;  3EQV A;  1K57 C;  4NK3 A;  3IS2 A;  5FAO A;  4LRX C;  2QHK A;  3CUE C;  4OP5 A;  3NOU C;  1PZO A;  2YKH A;  1M40 A;  4ZBE A;  3MFD A;  5HL1 A;  3ISG A;  4UHU A;  3G2Y A;  4BL3 A;  1Q2P A;  3UB9 A;  1VEU A;  3M6H A;  5A90 A;  3IH8 A;  5EV0 A;  3SS4 A;  3G31 A;  3GVB A;  1P9W A;  2FH5 A;  4HY8 A;  2EX6 A;  1G28 A;  1YAX A;  4KUO A;  2WKR A;  1PWG A;  1IOU A;  1OTI A;  1SKO A;  3PR6 A;  3HL9 A;  1L2S A;  2Y2P A;  4JF5 A;  2L0W A;  2NUT C;  1PW8 A;  4KZ8 A;  3GRJ A;  1JNU A;  1HTZ A;  3UO9 A;  4PM9 A;  2DCF A;  5GHZ A;  5HD3 A;  3KO6 A;  2BLS A;  3HLF A;  1MPL A;  5DFX A;  4EEU A;  4X53 A;  2GDN A;  2J3T D;  1JTD A;  1OT6 A;  4ZJ1 A;  3M2J A;  2EXA A;  2FZ0 A;  2KDK A;  1ALQ A;  2ZOI A;  1RP5 A;  2OOL A;  3KSF A;  3HUN A;  5IHV A;  1L0D A;  3PBS A;  3KSI A;  3H82 B;  2EX9 A;  4NET A;  3DWZ A;  2C6W B;  3ZNY A;  2QMI A;  5DTK A;  1WYB A;  3E4Q A;  5HPI A;  4B9O A;  3CG5 A;  2JKT M;  1XGJ A;  2W27 A;  4Y0O A;  3PBQ A;  2AVX A;  4KG5 A;  4K0W A;  4ARZ B;  5FI2 A;  1KGE A;  1OTD A;  4EW7 A;  2J3W A;  1KE3 A;  2JBF A;  5FEF A;  4NKP A;  5EOO A;  2JKF A;  3RXW A;  1YLY A;  1BUE A;  1FOF A;  1T19 A;  4R70 A;  4RX3 A;  4HBT A;  4ME4 A;  1OTB A;  4M3K A;  1L0E A;  1G68 A;  1GHI A;  5EVI C;  3LEQ A;  5TR7 A;  3LIE A;  2WGV A;  5I94 A;  3B33 A;  4GKU A;  4DE2 A;  3V3S A;  1PZP A;  4E04 A;  3VOZ A;  5I5L A;  1L0G A;  4KZ4 A;  2PHY A;  4GZB A;  4XT2 A;  3D4F A;  1CQA A;  5AVF A;  3DTK A;  3MKF A;  2H0T A;  3CWF A;  4DE3 A;  3JVU A;  1PNE A;  2ZM8 A;  2Y2H A;  3WS2 A;  2WKE A;  2PBD P;  5A93 A;  1NXY A;  5F82 A;  1KVM A;  4EBP A;  4WBG A;  1E4D A;  4KZA A;  5CGS A;  5KSC A;  5K5B A;  4DRT A;  3PAG A;  5HW3 A;  3G6O A;  2VV7 A;  4X6T A;  3IXB A;  4F3L A;  2WGI A;  1DP6 A;  2FFY A;  2EFX A;  4BL2 A;  3PTE A;  2H10 A;  1JWP A;  3FZC A;  5MC7 A;  1IKI A;  3P7N A;  2Z6D A;  4A5R A;  4QPR A;  3LY3 A;  3BFC A;  5G4Z A;  1H0M A;  3AGF A;  3UE3 A;  1KE4 A;  1LL9 A;  1XPB A;  3LI9 A;  3LIC A;  3H7W B;  2V1B A;  5DKK A;  3HLE A;  1ZG6 A;  3H82 A;  1SHV A;  5CTM A;  1RGY A;  2XFS A;  2ZL1 B;  5GL9 A;  1I2S A;  2A3U A;  4PKY G;  3LR3 A;  1ZHH B;  3MXS A;  3MZF A;  2M7U A;  1S67 L;  4OH0 A;  2LB5 A;  4WN5 A;  4QWO A;  4KZ7 A;  1BTL A;  4OOL A;  2BG1 A;  3ZG9 B;  4ARZ A;  2QWS A;  3LR0 A;  3HLG A;  2JKR M;  3M6B A;  1Z6F A;  1SDE A;  4KQQ A;  4Z9Q A;  3V67 A;  2WYX A;  3BQ8 A;  3R7W B;  5L09 A;  5LBR A;  2XA7 M;  4HES A;  2Z6C A;  1H3Q A;  5D3O A;  2HV1 A;  5AQA A;  5DTS A;  3V3R A;  4CLC D;  2UV0 E;  5HWV A;  4BEN A;  1ES3 A;  2QPN A;  4PHT A;  2XR0 A;  3MQO A;  3VE3 A;  1ERM A;  4RA7 A;  2EX8 A;  2L1M A;  2HPB A;  3FG8 A;  3BFF A;  2BTF P;  4FUW A;  5FQK A;  3SH9 A;  2DNS A;  1XFN A;  4K0X A;  2O99 A;  2A2L A;  4KG2 A;  2E8J A;  4LV1 A;  4BWI A;  2M7V A;  3NUL A;  2OWH A;  1XKZ A;  2WKP A;  3VMA A;  4I3I A;  3O88 A;  1NLZ A;  1J3W A;  3CAX A;  4FOF A;  3C38 A;  1CEG A;  1P97 A;  4B93 A;  4C75 A;  5HL6 A;  4P87 A;  4Y2F A;  3LIA A;  2ZC3 B;  2V1Z A;  3BQA A;  4X56 A;  3QP2 A;  2P08 A;  2R9W A;  5GHX A;  4HJ6 A;  4G3K A;  2HJ9 C;  5CEB A;  1YPR A;  4N1X A;  5HFO A;  2PR6 A;  4HI4 A;  3PBT A;  3WS4 A;  4P85 A;  3E4O A;  3UE6 A;  3IWO A;  3G30 A;  1BLS A;  5TFQ A;  5F1F A;  1NZU A;  2ZMF A;  4GJ4 A;  1DJA A;  5FQJ A;  4HP9 A;  2W3D A;  3IT9 A;  3H7W A;  5TJJ A;  1GHM A;  4O01 A;  1W7F A;  4U0T A;  1ESI A;  3IBR A;  1ZKJ A;  3MSH A;  2ZL1 A;  1E3U A;  5L07 A;  5J4E A;  1XGI A;  2XSS A;  4CPK A;  5GHY A;  3OCL A;  1K54 C;  4R3B A;  1PW1 A;  3A3F A;  5IS1 A;  1PWD A;  4UAA A;  3NJA A;  5CEC A;  4JGP A;  2EX2 A;  4F94 A;  2ACG A;  3WS0 A;  4Q0H A;  3IS2 B;  4FH2 A;  3UB8 A;  4O8G A;  3UPN A;  3E0Y A;  4L9G A;  3R7W A;  1XJ6 A;  2Y2J A;  4XUZ A;  3GV9 A;  4GCZ A;  3BLM A;  2QJ5 A;  4MLL A;  5HWW A;  2PAV P;  3IXG A;  3MKE A;  5EVL A;  1S6R A;  3MMH A;  3T4Q A;  4MBH A;  5HAI A;  3UME A;  5HAR A;  2Y2O A;  3TSG A;  3BLS A;  3OLO A;  4CJN A;  1SKO B;  4X25 A;  1D06 A;  1NY0 A;  3B3X A;  1BLC A;  1N4O A;  1OTE A;  4DE1 A;  1GHP A;  3WRZ A;  3M2K A;  2B95 A;  3H9W A;  3NI9 A;  4E3L A;  5EVI D;  2HF6 A;  3N8S A;  4IHQ A;  4MCW A;  2G2W A;  4S2N C;  1SZV A;  4IVI A;  4WEK A;  3CPT B;  1LSX A;  4NXB A;  4KZ9 A;  3T4K A;  2ZD8 A;  1S1Z A;  1K0K A;  3PXP A;  2P7J A;  4U0X A;  2VGL M;  5EUA A;  5CXW A;  1ES2 A;  4R3J A;  2JN7 A;  4ZAM A;  3DWK A;  4R6L A;  5HZH A;  4DDY A;  3IQA A;  2O9B A;  3C4P A;  2ZMA A;  2OLU A;  4OON A;  3CZD A;  5E43 A;  1N9O A;  2G7U A;  4X1L A;  1T18 A;  2VKS A;  5HX9 A;  2OSU A;  4FTX A;  5CRF A;  1YM1 A;  1LT0 A;  1K6R A;  4HH3 A;  4Y0T A;  1MC0 A;  4WEJ A;  5CX7 A;  3SH7 A;  1SCW A;  2Q9M A;  4EV4 A;  1BLP A;  4CQH A;  1NLY A;  5A91 A;  2VLG A;  2B5R A;  3UY6 A;  4LEN A;  5AQB A;  4QHC A;  4OOY A;  3NOP C;  1HLU P;  1KOU A;  4DJ3 A;  5L2F A;  2V1A A;  4OLG A;  4KZ6 A;  4XT2 B;  3U2A A;  3LO7 A;  1KE0 A;  3P01 A;  4JGR A;  4R1G A;  4EBN A;  3G2Z A;  1ZC2 A;  4MN7 A;  2XRN A;  4Q0I A;  3LGO A;  4CLC A;  2NUP C;  2WGW B;  1ONH A;  3S7P A;  2D01 A;  4X68 A;  1GA9 A;  4KZ5 A;  3O87 A;  1L3L A;  2W3E A;  5FAT A;  1IFQ A;  1U60 A;  1OPX A;  3RTY A;  2VGL S;  5F83 A;  1ZG4 A;  4F3L B;  2VV6 A;  1MWR A;  3EEH A;  1M6K A;  5HSQ A;  3HLC A;  4P6Z M;  2JHE A;  4S2P A;  5F68 A;  4EU0 A;  2RL3 A;  5EOE A;  3W4Q A;  4L9F A;  2B02 A;  3BW6 A;  3CPT A;  1XP4 A;  2R78 A;  2YKF A;  1TS7 A;  3F1O B;  4KEN B;  1D7E A;  2JC7 A;  4NXG A;  1T1B A;  4GS9 B;  1G6A A;  3IWQ A;  4UEY A;  2Z2L B;  4HOI A;  5GLD A;  5DKL A;  4R23 A;  2PYP A;  3JPU A;  5HPF A;  3IF6 B;  2ZQD A;  3BM6 A;  1K56 D;  3SH8 A;  1I2W A;  3SS5 A;  3OPP A;  4H8R A;  3PHY A;  2EA9 A;  1CI9 A;  3A3J A;  1OTA A;  4FD8 A;  4GOG A;  3S4X A;  4JXS A;  4QD4 A;  2WUQ A;  1G5U A;  1H8Z A;  1YQS A;  3ZVT A;  1UWN X;  1FQG A;  3UNW A;  3LID A;  2P9V B;  1LI9 A;  4E3M A;  2E8I A;  2Q9N A;  3IX4 A;  1W63 M;  4YFM A;  5IT5 A;  3GTC A;  5DF7 A;  3K3C A;  4E3O A;  3N7W A;  3BY9 A;  1W5D A;  4MMN A;  4ESP A;  4O0P A;  4JXG A;  1S4S A;  4I38 A;  1TDG A;  1XA7 A;  3MS6 A;  2PU2 A;  3BFG A;  2INW A;  5FDH A;  2JKG A;  1QMF A;  5CHM A;  3VFF A;  2XGN A;  1L0F A;  4IVK A;  4OQI A;  1SKF A;  4JF4 A;  4UQI M;  2VZW A;  4JKT A;  1JWV A;  3PBR A;  3UPO A;  4PM5 A;  1UWP X;  3OZH A;  3OOV A;  3FWL A;  1ES4 A;  4DKI A;  3SS3 A;  1TVF A;  4WF0 A;  1A0K A;  5EVE A;  4HP4 A;  5FAQ A;  3D3O A;  4P6Z S;  2V8C A;  4Y15 A;  5FI6 A;  2WGW A;  4ETX A;  2KX6 A;  1S66 L;  4E6X A;  2ZM2 A;  2GZA A;  2V9A A;  4E3I A;  1KVL A;  3SOI A;  5HAQ A;  3IF6 C;  3V39 A;  3QP4 A;  3WWX A;  1PRQ A;  4PM8 A;  1Y4O A;  3S7N A;  2H0Y A;  3VOY A;  1W63 Q;  4WM9 A;  1QME A;  4NXE A;  4NXF A;  5L8M A;  3EGX C;  5DJT A;  2XF3 A;  3A0V A;  1FSW A;  3F1O A;  4R4S A;  2ZC5 B;  4E3N A;  4GS9 A;  3ZG5 A;  3OBF A;  4Y3I A;  2QYB A;  3IF6 A;  1O7E A;  2HP5 A;  3TW8 A;  3GSG A;  1BUL A;  2OWJ A;  4JBF A;  3VP1 A;  1YSQ A;  4N1H A;  2W1T B;  3HVF A;  3Q7V B;  3MZE A;  3QNB A;  4WMC A;  2G2U A;  3IXH A;  4ZDX A;  5HAP A;  4GNU A;  4WLA A;  2XK1 A;  3KYQ A;  2P9V A;  3MR0 A;  4B4Z A;  1IEL A;  2HP9 A;  4EUV A;  4EES A;  3PYP A;  1AWI A;  1K4F A;  4UQI S;  1OJG A;  5M18 A;  3JVV A;  5U47 A;  1F9I A;  3LIF A;  2Y59 A;  3UMD A;  1XJ4 A;  2PDR A;  3FPV A;  4OQ0 A;  1LHY A;  4I3J A;  3ZFZ A;  1RCJ A;  2XRO A;  4HBU A;  1SDN A;  3C7V A;  5GLB A;  3NIA A;  1N9N A;  2R9X A;  3T1S A;  3BEC A;  3ITB A;  1W8Y A;  2HZ5 A;  3LY4 A;  4NG2 A;  4HHD A;  3A3D A;  5DJU A;  4IBX A;  3Q1F A;  1OJ5 A;  2UWX A;  3C7U A;  4N9K A;  3L9K A;  1WA9 A;  4RVA A;  3LI8 A;  3V50 A;  3V5M A;  4Y5F A;  5DF8 A;  1MBL A;  4PMA A;  5CHJ A;  1CF0 A;  4MEZ A;  3CI6 A;  1GSV A;  1N9L A;  4RYE A;  1JVJ A;  3E4P A;  4MN5 A;  3IHA A;  4OPZ A;  3MFX A;  1PI5 A;  2HDS A;  3NC8 A;  4RX2 A;  1WYC A;  3O5Y A;  2D02 A;  4X1M A;  1K38 A;  4LFU A;  1K25 A;  2J8Y A;  4P6B A;  1BLH A;  3VP4 A;  1EI5 A;  1I5Q A;  4DJ2 A;  1IYO A;  3W8K A;  3L7H A;  3U4L P;  1DJC A;  5GLA A;  1ONG A;  2K7S A;  1DRM A;  4ID4 A;  4PAU A;  1C3B A;  1BYW A;  4EBL A;  4FSF A;  3ZG0 A;  2HP6 A;  2A49 A;  2Y4A A;  3MXQ A;  3NY4 A;  1HD8 A;  3TRC A;  5FQ9 A;  2X02 A;  2ZC7 A;  3S1Y A;  1FCN A;  1RGZ A;  3UB5 P;  1FIL A;  2ZC6 B;  5DTT A;  4YWZ A;  5F1G A;  2W3F A;  4OQH A;  1N9B A;  2XA7 S;  3QP1 A;  1BSG A;  4QU3 A;  3OPL A;  2W1T A;  1BZA A;  3Q7V A;  3FV7 A;  3T1Q B;  4DF6 A;  4S2K A;  1W8Q A;  3IBJ A;  5KMW A;  1S1Y A;  3UE0 A;  1NJ4 A;  4DXB A;  4R3A A;  4KG6 A;  3QP6 A;  2B18 A;  3FYZ A; 
#chains in the Genus database with same CATH homology
 1XXM A;  1MXO A;  4QB8 A;  1CK3 A;  5L2F A;  4MBK A;  4RX3 A;  3BFE A;  4HBT A;  4OPQ A;  4OLG A;  4KZ6 A;  3LEZ A;  1IYP A;  2XH9 A;  4M3K A;  4WYY A;  1L0E A;  4QJG A;  1G68 A;  1GHI A;  5EVI C;  5TR7 A;  1EWZ A;  3G4P A;  3LO7 A;  3TG9 A;  2WGV A;  4DE0 A;  5I94 A;  5JYP A;  5KSH A;  4GKU A;  1KE0 A;  4R1G A;  4BLM A;  4DE2 A;  3V3S A;  5CTN A;  1PZP A;  3VOZ A;  4EBN A;  1BT5 A;  3G2Z A;  1L0G A;  4KZ4 A;  3E2L A;  1ZC2 A;  3VSL A;  4GZB A;  3MZD A;  2Y2K A;  4DDS A;  1PI4 A;  2IWC A;  3D4F A;  5JYO A;  3RJU A;  2HDQ A;  4IBR A;  2WGW B;  4L0L A;  4P0M A;  1WE4 A;  4LCM A;  1MWS A;  1ONH A;  3MKF A;  1TEM A;  3ZCZ A;  2H0T A;  4X68 A;  1Y54 A;  1GA9 A;  2WAD A;  4DE3 A;  3WS5 A;  4KZ5 A;  2Y2N A;  3W4P A;  3O87 A;  2ZM8 A;  1NYM A;  5FAT A;  2WAF A;  2Y2H A;  2CC1 A;  3WS2 A;  1U60 A;  2WKE A;  1CEF A;  4OPR A;  4XUX A;  5F83 A;  2VGJ A;  1H5X A;  1ZG4 A;  4MBF A;  4N9L A;  1IEM A;  5A93 A;  1NXY A;  5F82 A;  1KVM A;  4EBP A;  4WBG A;  4XXR A;  2WZX A;  1MWR A;  2XD1 A;  1TDL A;  1HVB A;  1M6K A;  3ZHH A;  1E4D A;  4KZA A;  5CGS A;  1NZO A;  3HLC A;  3UDF A;  5KSC A;  5CGX A;  1FCO A;  1MY8 A;  5E2F A;  3AGE A;  5E2E A;  1AXB A;  4S2P A;  2VGK A;  4DRT A;  3PAG A;  5HW3 A;  3ZDJ A;  4GN2 A;  4X6T A;  3G34 A;  3IXB A;  4OQG A;  4PM7 A;  2RL3 A;  5EOE A;  3W4Q A;  2WGI A;  3BEB A;  1XP4 A;  2FFY A;  1YLT A;  3Q07 A;  2EFX A;  3LCE A;  4BL2 A;  3PTE A;  4KEN B;  2H10 A;  2JC7 A;  2Y91 A;  3IHB A;  1JWP A;  1LI0 A;  1LL5 A;  3FZC A;  5CGW A;  1IKI A;  1G6A A;  3IWQ A;  2Z2L B;  4A5R A;  4BJP A;  5GLD A;  4R23 A;  5FQM A;  3ZG8 B;  3LY3 A;  4UA7 A;  4E6W A;  2WAE A;  3IF6 B;  2ZQD A;  2I72 A;  3BM6 A;  3I7J A;  3BFC A;  1K56 D;  1IKG A;  3SH8 A;  2FFF B;  1I2W A;  1PIO A;  4GD8 A;  1Q2Q A;  5G18 A;  3SS5 A;  1K56 A;  3OPP A;  4JXV A;  3AGF A;  4H8R A;  3UE3 A;  1KE4 A;  3DW0 A;  1LL9 A;  3N4I A;  4EUZ A;  1XPB A;  1CI9 A;  3A3J A;  5FAP A;  1YT4 A;  4BQM A;  5FQI A;  4FD8 A;  4IED A;  1VM1 A;  4GOG A;  2X01 A;  3VFH A;  3S4X A;  4JXS A;  4QD4 A;  2WUQ A;  3HLE A;  1H8Z A;  5EEC A;  5FA7 A;  4LV0 A;  1YQS A;  3ZVT A;  1ZG6 A;  1SHV A;  3A3E A;  5CTM A;  1LLB A;  1FQG A;  3UNW A;  1RGY A;  2X71 A;  2XFS A;  1IYQ A;  5GL9 A;  1I2S A;  2P9V B;  2A3U A;  3IF5 A;  5FSR A;  3S22 A;  1NRF A;  1LI9 A;  1YMX A;  1K6S A;  3BRM A;  3ZNT A;  4E3M A;  2E8I A;  2Q9N A;  5EE8 A;  2XDM A;  3MXS A;  1KGF A;  3MZF A;  4WEL A;  3VP3 A;  4OH0 A;  1K55 A;  4YFM A;  3OPR A;  5DVA A;  3GTC A;  5DF7 A;  3G35 A;  2C5W B;  4E3O A;  3N7W A;  4KZ7 A;  1BTL A;  1W5D A;  4OOL A;  1YLJ A;  2BG1 A;  4YIN A;  3ZG9 B;  2EFU A;  4UA6 A;  3HLG A;  5KZH A;  4JXG A;  1TDG A;  1XA7 A;  3GMW A;  4S2M A;  3Q82 A;  2ZQC A;  2PU2 A;  3BFG A;  3M6B A;  1Z6F A;  1SDE A;  4KQQ A;  2WKH A;  4U3T A;  4Z9Q A;  3VP2 A;  2WYX A;  1CI8 A;  2ZLY A;  4R4R A;  1J9M A;  3Q7Z A;  4HES A;  2JE5 A;  4PM6 A;  3O86 A;  2JCH A;  3CJM A;  3MXR A;  5FDH A;  4JXW A;  1QMF A;  5CHM A;  3VFF A;  5D3O A;  2XGN A;  3E2K A;  2HDR A;  2Y2I A;  1L0F A;  4IVK A;  5AQA A;  4OQI A;  5DTS A;  4WZ4 A;  1SKF A;  4JF4 A;  1PWC A;  3OCN A;  3FYZ A;  5EPH A;  5AQ9 A;  3P98 A;  4E3J A;  3WRT A;  3P09 A;  3V3R A;  4JKT A;  1JWV A;  4GD6 A;  4R0Q A;  4BEN A;  1ES3 A;  2QPN A;  3PBR A;  2XR0 A;  4EQI A;  3UPO A;  3PBN A;  3HLW A;  4PM5 A;  5BOH A;  3OZH A;  1FSY A;  3AGD A;  3FWL A;  1ES4 A;  4DKI A;  4WZ5 A;  3SS3 A;  1TVF A;  2ZJ9 A;  1MWT A;  2ZQA A;  1ERM A;  4OVD A;  2PBY A;  3NCK A;  2XFT A;  4RA7 A;  5FAQ A;  2EX8 A;  1FCM A;  4LCL A;  1K54 A;  1VQQ A;  3HLB A;  4KQR A;  2WKI A;  2HPB A;  5FI6 A;  1ESU A;  2WGW A;  3BFF A;  5FQK A;  3SH9 A;  1FR6 A;  4E6X A;  2DNS A;  2ZM2 A;  4X55 A;  2ZQ9 A;  4OLD A;  5FI7 A;  3G32 A;  3NDE A;  4K0X A;  4QY6 A;  2QZ6 A;  2Y2G A;  5CHU A;  4KG2 A;  4KZB A;  4E3I A;  1ES5 A;  4LV1 A;  1KVL A;  3UN7 A;  5EVI B;  2ZM0 A;  3SOI A;  5HAQ A;  5CED A;  2OLV A;  5GLC A;  4OKP A;  2DRW A;  3PAE A;  3IF6 C;  1K57 A;  4JF6 A;  3V39 A;  1XKZ A;  3VMA A;  2ZQ7 A;  2OV5 A;  3WWX A;  4FCF A;  3O88 A;  3UPP A;  4PM8 A;  3UDI A;  4DXC A;  1CEG A;  4S2O A;  4KQO A;  2H0Y A;  3MBZ A;  3GR2 A;  3VOY A;  4GB7 A;  3HUM A;  4C75 A;  3OPH A;  4E3K A;  1DJB A;  4P87 A;  3RXX A;  4WM9 A;  1XA1 A;  1QME A;  2P74 A;  4B4X A;  1H8Y A;  1YLW A;  3ZGA B;  2ZC3 B;  1MKI A;  2V1Z A;  1K55 C;  1S0W A;  2XF3 A;  4X56 A;  3N6I A;  4B88 A;  1FSW A;  2R9W A;  5GHX A;  3FKW A;  3NBL A;  4R4S A;  2ZC5 B;  4E3N A;  5CEB A;  1E25 A;  4N1X A;  5HFO A;  3ZG5 A;  3PBT A;  3WS4 A;  4P85 A;  2ZQ8 A;  3IWO A;  3G30 A;  4S2I A;  1BLS A;  5TFQ A;  5F1F A;  3ZG7 B;  3IF6 A;  5AQ7 A;  1O7E A;  2HP5 A;  1NZU A;  4ZJ3 A;  3GSG A;  2H5S A;  1JWZ A;  1BUL A;  4C3Q A;  1DJA A;  3C4O A;  3IWI A;  5FQJ A;  1KDW A;  4JBF A;  4PPR A;  4O7D A;  3CMZ A;  1ERO A;  4S2N A;  1FR1 A;  2J9O A;  3VP1 A;  3IT9 A;  4N1H A;  1YLP A;  3HUO A;  4S2J A;  3ITA A;  4Q8I A;  3HVF A;  5M19 A;  4WMC D;  3Q7V B;  1GHM A;  3OC2 A;  4JLF A;  4N92 A;  3TOI A;  5J8X A;  4GDN A;  2HDU A;  3MZE A;  3NDG A;  3QNB A;  4WMC A;  2G2U A;  1IYS A;  1E3U D;  1W7F A;  3IXH A;  4U0T A;  1ESI A;  4ZDX A;  3BFD A;  3N8L A;  5HAP A;  1ZKJ A;  4GNU A;  1E3U A;  2XK1 A;  4GDB A;  2P9V A;  1XGI A;  4WZ5 C;  2EXB A;  4FH4 A;  4B4Z A;  1IEL A;  2V20 A;  4ZTK A;  3C5A A;  2HP9 A;  3UE1 A;  4CPK A;  5GHY A;  4JPM A;  1NYY A;  3PBO A;  4BD1 A;  3OCL A;  1K4F A;  5E2H A;  1K54 C;  3W4O A;  4R3B A;  1PW1 A;  3A3F A;  4Y0U A;  1PWD A;  4UAA A;  1DY6 A;  3FKV A;  1KDS A;  3JYI A;  5M18 A;  3HBR A;  5CEC A;  1GCE A;  5U47 A;  2EX2 A;  3HRE A;  4F94 A;  1JTG A;  3WS0 A;  2Y59 A;  3EQU A;  2IWD A;  4FH2 A;  5DF9 A;  3UPN A;  1PYY A;  5CER A;  4OQ0 A;  1LHY A;  2WK0 A;  5FAS A;  4MNR A;  2Y2J A;  4XUZ A;  1RCJ A;  5E2G A;  3GV9 A;  3EQV A;  3ZFZ A;  4HBU A;  1SDN A;  1K57 C;  3C7V A;  3NIA A;  4LV3 A;  5GLB A;  4NK3 A;  2R9X A;  3BEC A;  1O07 A;  3BLM A;  5FAO A;  3ITB A;  1W8Y A;  3LY4 A;  4MLL A;  3BYD A;  3IH9 A;  3A3D A;  3VP0 A;  4UA9 A;  2Y2L A;  3WS1 A;  4IBX A;  3ZVW A;  3Q1F A;  4OP5 A;  3IXG A;  2XLN A;  4BD0 A;  2UWX A;  1ERQ A;  3C7U A;  3MKE A;  1PZO A;  3QHY A;  5EVL A;  1S6R A;  4N9K A;  1M40 A;  4KZ3 A;  2IWB A;  4ZBE A;  5A92 A;  3MFD A;  5HL1 A;  4MBH A;  3ISG A;  4UHU A;  4RVA A;  5HAI A;  3V50 A;  3G2Y A;  3V5M A;  1W79 A;  5DF8 A;  4BL3 A;  1MBL A;  3O3V A;  1YMS A;  4PMA A;  5HAR A;  2Y2O A;  3TSG A;  5CHJ A;  1Q2P A;  4MEZ A;  4OPY A;  3BLS A;  3M6H A;  4CJN A;  5A90 A;  3UDX A;  3IH8 A;  3SS4 A;  3G31 A;  1NY0 A;  3B3X A;  1BLC A;  3GVB A;  1N4O A;  4RYE A;  1JVJ A;  2J7V A;  4DE1 A;  3IHA A;  2EX6 A;  4OPZ A;  2Z2M B;  1GHP A;  4OOM A;  3WRZ A;  1PWG A;  1PI5 A;  2HDS A;  3M2K A;  4C6Y A;  2RCX A;  3NC8 A;  3NI9 A;  4RX2 A;  4E3L A;  1WYC A;  5EVI D;  3HL9 A;  3VSK A;  1L2S A;  2Y2P A;  3N8S A;  4JF5 A;  5EVI A;  4D2O A;  2G2W A;  2V2F F;  1PW8 A;  1K38 A;  4KZ8 A;  3GRJ A;  1K25 A;  4S2N C;  4X69 A;  2J8Y A;  4IVI A;  1HTZ A;  3UO9 A;  2Y55 A;  4P6B A;  4PM9 A;  4WEK A;  4K91 A;  1BLH A;  3VP4 A;  1EI5 A;  2DCF A;  1I5Q A;  5GHZ A;  4KZ9 A;  2ZD8 A;  1IYO A;  3W8K A;  4U0X A;  2BLS A;  1DJC A;  3HLF A;  5EUA A;  3IXD A;  1MPL A;  2PU4 A;  2XQZ A;  5GLA A;  5CXW A;  1ES2 A;  1ONG A;  3Q81 A;  4R3J A;  4X53 A;  3N8R A;  5TGF A;  2GDN A;  1JTD A;  4ZAM A;  4ZJ1 A;  3DWK A;  4HEF A;  3M2J A;  3DTM A;  2EXA A;  1MWU A;  4DDY A;  4ID4 A;  3IQA A;  5M1A A;  4ZJ2 A;  3C4P A;  2ZMA A;  1ALQ A;  2OLU A;  3GQZ A;  1C3B A;  4OON A;  1RP5 A;  2Y2Q A;  4EWF A;  3CZD A;  5E43 A;  4EBL A;  4FSF A;  3ZG0 A;  2HP6 A;  2XD5 A;  3HUN A;  5IHV A;  2A49 A;  2Y4A A;  3NY4 A;  2OSU A;  5HX9 A;  1HD8 A;  1L0D A;  5FQ9 A;  2X02 A;  2ZC7 A;  3PBS A;  5CRF A;  3S1Y A;  1FCN A;  4OP8 A;  1YM1 A;  2EX9 A;  1RGZ A;  4NET A;  3DWZ A;  2ZC6 B;  1K6R A;  3QNC A;  5DTT A;  2C6W B;  3ZNY A;  2QMI A;  1HZO A;  2ZC4 B;  5F1G A;  4Y0T A;  1KGG A;  4WEJ A;  5DTK A;  1WYB A;  4OQH A;  3A3I A;  2WZZ A;  1N9B A;  3SH7 A;  4Y7P A;  1BSG A;  1SCW A;  1XX2 A;  4QU3 A;  3OPL A;  5FQQ A;  3CG5 A;  1K4E A;  1BZA A;  2J9P A;  2Q9M A;  3Q7V A;  1XGJ A;  4Y0O A;  4EV4 A;  3PBQ A;  3FV7 A;  3HLD A;  4KG5 A;  1BLP A;  4K0W A;  4DF6 A;  4S2K A;  5FI2 A;  1W8Q A;  2Y2M A;  1KGE A;  5KMW A;  2XEP A;  1KE3 A;  4LV2 A;  1OME A;  1YLZ A;  2JBF A;  5A91 A;  1NJ4 A;  3UE0 A;  2B5R A;  1GA0 A;  3UY6 A;  4LEN A;  5AQB A;  4QHC A;  4QY5 A;  4OOY A;  4DXB A;  4S2L A;  4KG6 A;  5EOO A;  3RXW A;  1YLY A;  1BUE A;  1FOF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...