2YKHA

Sensor region of a sensor histidine kinase
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
285
structure length
265
Chain Sequence
STLGDLLAEHTVLPGSAVDHLHAVVGEWQLLADLSFADYLMWVRRDDGVLVCVAQCRPNTGPTVVHTDAVGTVVAANSMPLVAATFSHSVEVSPVRFGDQVVAVLTRHQPELAARRRSGHLETAYRLCATDLLRMLAEGTFPDAGDVAMSRSSPRAGDGFIRLDVDGVVSYASPNALSAYHRMGLTTELEGVNLIDATRPLISDPFEAHEVDEHVQDLLAGDGKGMRMEVDAGGATVLLRTLPLVVAGRNVGAAILIRDVTEVKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Sensor Region of the Ubiquitous Cytosolic Sensor Kinase, Pdtas, Contains Pas and Gaf Domain Sensing Modules.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
molecule keywords PROBABLE SENSOR HISTIDINE KINASE PDTAS
total genus 67
structure length 265
sequence length 285
chains with identical sequence B
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2011-05-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12282 H_kinase_N Signal transduction histidine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2ykhA02
3.30.450.280 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2ykhA01
3E4PA 3E4QA 4PKYG 4EXOA 3GECA 3T50A 1LSXA 3A0VA 1S1YA 1BYWA 4I3JA 1S1ZA 4HHDA 3UB7A 4MN6A 4LRXC 1V9ZA 4NXBA 3MXQA 5F6AA 2KDKA 5DKKA 3UE6A 1GSXA 1S66L 3LIEA 1XJ2A 4GS9A 1GSVA 1OTIA 1N9NA 4H6JA 2QWSA 4H6JB 2L0WA 4HNBA 4JGOA 3B33A 3ZQ5A 3PYPA 2H28A 2JHEA 3F1OA 2VLGA 3MJQA 4GCZA 1G28A 5IU1A 4EEUA 3UB6A 4LRYC 1LSVA 1DP8A 2QHKA 3A0SA 3A0RA 4GHIB 2ZOIA 3IS2B 3IS2A 5F5YA 3MR0A 3K3DA 5HDDA 4DJ3A 1UWPX 3C8CA 4MN5A 4LLOB 5F68A 4EERA 1S4SA 2A24B 3F1NA 2PYRA 3F1NB 3MQOA 2R78A 3OLOA 4XT2B 5AVEA 4BBVA 2BASA 1MZUA 4DJ2A 1VB6A 3KX0X 1OTDA 1WA9A 3EEHA 3LIFA 3F1OB 5HZHA 2P7JA 1D06A 2VV6A 2ZOHA 5J4EA 4L9EA 4HJ4A 4HOIA 3ULFA 1XFNA 4GHIA 4HH2A 4HQAA 3MQQA 4R6LA 4L9GA 2PR6A 4XT2A 3NOUC 4JGQA 2PHYA 1XJ6A 3C2WA 3IBRA 4JGPA 3CWFA 4I3IA 4R38A 4KQDA 4F3LB 2V1AA 5G4YA 1XFQA 2Z6DA 3NJAA 3E4OA 2EA9A 2J80A 3LUQA 3P7NA 5A8BA 1OTBA 1TS0A 2PD7A 1UWNX 4EETB 1N9LA 5HSQA 4HP9A 5EFWA 1T1AA 1TS7A 3H9WA 3UB8A 4NXGA 2PYPA 4HH3A 4NXEA 4LPZA 3H7WB 2QJ5A 1TS8A 3K3CA 3MFXA 4JGRA 4KUKA 4PKYA 5DJUA 4EQ1A 2V0UA 2VV7A 3LIDA 2INWA 4WUJA 3PHYA 5HWTA 2QJ7A 3UB9A 4WL9A 3VE4A 5HD5A 4WN5A 3LYXA 1XJ3A 4YWZA 1GSWA 1Y28A 4R3AA 3SW1A 1P0ZA 4HJ6A 4WF0A 3RTYA 3UMDA 1LT0A 3GDIA 1XJ4A 3LIBA 3LIAA 2V1BA 2V0WA 4HI4A 1DP9A 3LICA 4I38A 3BY8A 2VEAA 2WKRA 3HJIA 5HD3A 3VOLA 2B02A 2PDRA 1F9IA 5HDCA 4HJ3A 2D02A 2K7SA 4I5SA 1UGUA 1ODVA 4HIAA 1DRMA 3G6OA 4NXFA 5HDSA 5HWWA 1OTAA 3F1PA 2I9VA 4KUOA 1P97A 1D7EA 1TS6A 2YKHA 1F98A 3HJKA 3NHQA 4WLAA 2WKPA 3BY9A 4F3LA 2YKFA 5DJTA 1JNUA 3ICYA 4B9OA 3CLOA 1S4RA 3LI9A 4GW9A 4HY8A 5G4ZA 1NWZA 4M4XA 3RH8B 4EESA 5F69A 1OJ5A 1T1BA 2PR5A 5TBMA 5J7EA 2OWJA 2D01A 5TBMB 2VV8A 2W27A 2V9AA 4BBUA 1EW0A 2CMNA 2L1MA 2OWHA 4EEPA 3FG8A 1OTEA 4EW7A 1LL8A 1LSWA 5J3WA 1N9OA 1V9YA 2HV1A 5I5LA 4BBTA 1OJGA 2A24A 2GJ3A 2Z6CA 3VE3A 3CAXA 3FC7A 3F1PB 4HP4A 4R70A 4K08A 1T18A 4I39A 1X0OA 5IS1A 3LI8A 1T1CA 3UMEA 2PD8A 2W0NA 2WKQA 3H82B 2QKPA 3NOPC 4I3AA 2JN7A 2KX6A 3NOTC 4L9FA 4LRZE 5HWVA 1S67L 1OT9A 1T19A 2OOLA 1KOUA 4RQ9A 4GS9B 2ZBBA 2L4RA 5AVFA 5DKLA 4E04A 1DP6A 3D72A 2M1CA 3H82A 3H7WA 5KIZA 3BWLA 3EWKA 1OT6A
chains in the Genus database with same CATH superfamily
4JKTA 3LY3A 4Y5FA 4S2NC 5HAQA 4MN6A 1W63M 3LIEA 4CLCB 1GSVA 2O9BA 2QWSA 3C7UA 1YMXA 5DF9A 3TOIA 4UHUA 1QMEA 3EEAA 2Y2PA 5E2EA 5EUAA 4GJ4A 4Y3IA 3W4QA 1D06A 5EVIA 1EROA 4BMWA 1MBLA 1MWUA 1CK3A 3OPPA 4EWFA 2JKRI 2Y91A 2PRFA 3S7OA 4D2OA 1MKIA 4JGRA 4PAUA 3ZCZA 3UB9A 2R9XA 3IF5A 1MKMA 2HPBA 5L10A 4YFMA 2FZ0A 3QP4A 3VSLA 2HP9A 5KSCA 1ERMA 5FQJA 3PBTA 4NETA 5AQAA 3TG9A 5I94A 5HWWA 1ESIA 3GRJA 1O7EA 4GD8A 1IELA 2YKFA 3CLOA 4OVDA 2BG1A 3CI6A 4M4XA 4ARZB 3ZVWA 3O5YA 4WELA 1LSWA 3V5MA 3G2ZA 2Z6CA 1H0MA 3CAXA 3F1PB 3D9YA 2KX6A 1K57A 4KZ5A 1OT9A 3T1RA 2WAEA 1LL9A 1P9WA 1BZAA 4R3JA 4DF6A 1DJBA 3UE3A 2NUPC 2XF3A 4MCWA 1L3LA 1LI0A 1OTIA 1JVJA 3GMWA 4H6JA 1BSGA 4H6JB 3WS5A 3MJQA 4QWOA 5IU1A 4EEUA 4XUXA 4MBHA 4G3KA 3T4JA 3IF6C 3UPOA 1G6OA 1MZUA 5EM0A 5DTKA 3EEHA 2P7JA 1BLHA 1Z6FA 1HLUP 3ITBA 4GHIA 4MDZA 3MZDA 1ZHHB 1YSPA 1L2SA 3FWLA 1LL5A 3LUQA 2UV0E 2ZQDA 5A8BA 2JKTI 5EECA 4PMAA 4EETB 5EFWA 2DMWA 3FZCA 5FQ9A 2Z2MB 2P74A 1L0EA 3OCLA 3UY6A 2ZD8A 4R3AA 4EV4A 2A2LA 3D3OA 4HI4A 2WZXA 4MBKA 2D02A 2C6WB 2XK1A 1ODVA 4OP8A 3EGDC 5CTNA 2EX8A 2EWVA 3B42A 1BLPA 2D01A 4X1MA 3Q81A 2L1MA 1LL8A 1V9YA 4PM7A 3T1QB 3CHWP 2J7VA 3NDGA 3Q07A 4Q0IA 2P9VB 4K08A 1X0OA 3GV9A 2JC7A 4OPZA 2PBDP 2ZQCA 4NKPA 2M1CA 4H8RA 5KIZA 1YSQA 3ITAA 1GHMA 3E4QA 1CI8A 3NULA 3MFDA 4JXGA 1VETB 2E8JA 4OOLA 4FUWA 3V50A 2FH5A 2Q9NA 3CMZA 3IF6A 4FOFA 5F83A 1GHIA 4GN2A 2H28A 4Z1WA 3QP1A 4PM6A 3BLMA 4DE1A 2HZ5A 3JVVA 3A0RA 1E3UA 2PBYA 3C8CA 2XGNA 3OC2A 4E3LA 3VV4A 3VP0A 3PBRA 3LIFA 5HAIA 1KGEA 4KZ9A 3ZVTA 1TEMA 4R6LA 5HL6A 4S2JA 5A93A 2IWCA 2UWXA 4I3IA 4KQDA 3AGDA 5G4YA 3NJAA 4HBUA 4S2PA 4KQQA 4OLGA 3Q1FA 1H8MA 1PI4A 3Q7VB 4PHTA 2EFUA 2V8CA 3A3IA 3NBLA 4G3VA 1VM1A 3BRMA 1BULA 4N92A 1LHYA 5G18A 1ES3A 2XA7M 5F1FA 4HESA 2VGLM 1KVMA 1SKOA 4DKIA 3BFFA 4X6TA 1D7EA 1NJ4A 3A3DA 4QU3A 1ALQA 2Q0OA 1YKDA 1NWZA 3FPVA 1OJ5A 1K54C 3R7WA 4EXOA 1NLZA 5JYOA 3OCNA 1BTLA 1H8ZA 5DF8A 1T18A 1FIKA 2HF6A 3BECA 3DTIA 3EQVA 3CITA 1A0KA 2VZWA 4ZJ3A 3NOTC 2HDSA 2X71A 5CHMA 1T19A 2B18A 4ZRRA 4LCLA 3D72A 3IHBA 2HGVA 1D1JA 3S7PA 2Y2MA 2OLVA 5FDHA 4BENA 2ZM2A 5F1GA 1MPLA 5EM1A 4HNBA 4MLLA 4OPRA 4L0LA 1DP8A 4GHIB 1ES5A 4LLOB 4C75A 1K57C 3K2NA 3DWKA 5AVEA 3TSGA 2IWBA 4KG6A 3B47A 1RGZA 4R3BA 3MSHA 3U2AA 3KSGA 1XP4A 1XFNA 4QY6A 2PR6A 3QNBA 1K4EA 2DNSA 3E4OA 1VHMA 3P7NA 3LFVA 3S22A 3LCEA 4NXGA 1EI5A 4EQ1A 4KUKA 3T4LA 3T1SA 1GHPA 1XGJA 3IX8A 4DXCA 2CC1A 4BJPA 4JBFA 4K91A 5CEBA 3GDIA 1PFLA 2V0WA 5HD3A 2WKRA 4FH2A 4FH4A 1PZPA 2PU2A 1W79A 1HD8A 2EXAA 4B9OA 3LI9A 1K6RA 2ZC6B 4YNRA 4EEPA 5E2GA 4GLQA 1WYBA 4N1HA 1FR6A 1MY8A 3UMEA 2RL3A 4X1LA 1Q2QA 4LV1A 4KZ8A 3H82A 4ME4A 5TFQA 3PTEA 3GECA 4FSFA 5EV0A 4D60A 3BW6A 5DKKA 4GS9A 3LY4A 4QY5A 4RX2A 3ZYTA 1FILA 1NRJA 4NK3A 4P6BA 4QD4A 1GCEA 1C3BA 3FKVA 3QHYA 2DRWA 4E6XA 2ZC5B 5FQIA 2Y2QA 1QMFA 2HP6A 3LR4A 2PAVP 2J3TC 2XH9A 4KZ6A 4S2IA 4HQAA 1XJ6A 3C5AA 5E2FA 3BEBA 1OTBA 1N9LA 1TS7A 5U47A 4JLFA 2VV7A 1CI9A 3AGEA 1W63Q 4DXBA 3IBJA 2WGWB 3ZG9B 1G6AA 3LYXA 4YWZA 4WZ5C 4IVIA 4R4RA 1XJ4A 1IFQA 3LIAA 1NXYA 4X68A 3HJIA 3VOLA 1YLPA 4B93A 2B02A 4ETZA 3SH7A 1XA1A 3NDEA 3W4OA 2G2UA 3B3XA 3F1PA 4IVKA 1F98A 1NY0A 2RCXA 2Y2HA 4PM9A 2O99A 4IJGA 1SDEA 1L0DA 4JF6A 5DFYA 1MC0A 3IH9A 5J3WA 2VGKA 3KSFA 3UO9A 3HLDA 2W0NA 4Y13A 3HUOA 4CLCC 2VK3A 1IYPA 3DWZA 1LSXA 5CHUA 1HTZA 4X69A 4B4ZA 4O0PA 4BL2A 4ZJ1A 2GDNA 5GL9A 3ZQ5A 1NYMA 4GCZA 1G28A 4E3NA 3EQUA 4F3LA 1S4SA 4Y15A 3MQOA 2EWWA 2G2WA 3C38A 1VB6A 4YOFA 2ZJ9A 3DTKA 3G34A 3MZEA 4HJ4A 3KYEA 2EFXA 1K55A 4XT2A 4JXVA 5CX7A 4U3TA 2HJ9C 4OPYA 4NXEA 3PBOA 2ZQ9A 4QB8A 2VA0A 3TJZC 1IEMA 1Z09A 2J9PA 5IHVA 5DFXA 3VSKA 1GSWA 2ZM8A 3RTYA 2XEPA 3BLSA 5FEFA 1PWGA 4HJ3A 2K7SA 1ONHA 1FCNA 1H3QA 3R7WB 1W8YA 3KSIA 3QP8A 5G4ZA 3N8SA 4EESA 1T1BA 5TBMA 3WS4A 5TBMB 4JXWA 2EX6A 3FG8A 3S4XA 3WS0A 1JWPA 1S0WA 2ACGA 3RFBA 4KENB 4ETXA 3CG5A 2ZMAA 2HDQA 1PIOA 3N4IA 4RQ9A 2Q9MA 1JWZA 3S7NA 3GQZA 2P08A 5GLAA 1SKFA 3TE8A 2JE5A 1ACFA 3L9KA 3GSGA 4NXBA 3OPRA 5A90A 5FAQA 4EBPA 3B33A 4P6ZM 4LRYC 1CJFA 5DF7A 3LEZA 4JXSA 2ZQ8A 3RJUA 4EERA 3OLOA 4EW7A 4XT2B 1BT5A 5GLBA 2Y2NA 1VETA 3ZG7B 3A3EA 4KZ7A 4P87A 3DBAA 2R9WA 3IBRA 4F3LB 3CWFA 5FA7A 3T4TA 1GA9A 1K4FA 3H9WA 5EVEA 5AQ9A 5F82A 4U0TA 1ZC2A 3VE4A 3HBRA 4OOMA 1S6RA 5DTSA 2X01A 4DE3A 4DE0A 4C3QA 4P0MA 1KVLA 2ZC3B 1PNEA 4CQHA 2XSSA 3C4OA 4RYEA 1N9BA 2PR5A 3HL9A 2Y2IA 1TF1A 3IHAA 1NYYA 2GJ3A 3SZTA 3VE3A 3UDFA 3O88A 3O87A 5IS1A 2PD8A 4EBLA 4QJGA 3N6IA 4L9FA 4MMNA 5FI6A 4II7A 1ES2A 4LCMA 4S2OA 4BL3A 4UA9A 2QMIA 2Y2OA 5EOOA 5EVID 1K56D 1S66L 3A3JA 3DTEA 4UAAA 3KO6A 1IOUA 5FQKA 3MXSA 5F5YA 4DJ3A 1UWPX 1I2WA 2WK0A 5AQBA 5F68A 5FSRA 5FL3A 3RXWA 3KYQA 4Q8IA 1IKIA 3UPPA 2Z2LB 5LBRA 4LENA 4B4XA 4M3KA 3C2WA 3CZDA 3MKFA 5FQQA 5FEGA 5CXWA 3HLGA 3HLEA 3VP1A 3H7WB 4PKYA 1XKZA 1YLWA 4KQOA 3WS1A 5CEDA 1XJ3A 3BFCA 2Y4AA 3M6HA 1JTDA 1PRQA 1KDSA 3IH8A 2ZL1A 3U4LP 4DRTA 2Y55A 2VEAA 3IQAA 3N8LA 3P09A 2PDRA 1KE3A 3UB5P 4I5SA 2BTFP 4E6WA 1H5XA 3HJKA 2OLUA 3IXDA 1O07A 4ZDXA 2OWJA 2CMNA 2JKRM 4GKUA 1VEUA 1N9OA 2G7UA 3DW0A 4WM9A 5KSHA 4GNUA 1K6SA 2H10A 1T1CA 2WKQA 2QKPA 1ERQA 4X53A 3VFHA 3P98A 3HLWA 5HPIA 2ZBBA 2ZM0A 1H8YA 3EWKA 4N9KA 4PKYG 1BLSA 4OLDA 3CPTB 3MMHA 5F6AA 3MXQA 4Y0UA 3UE6A 4CPKA 4QPRA 5E43A 1JTGA 3E98A 3UB6A 2QHKA 4S2NA 3G4PA 1CQAA 3MR0A 3K3DA 5HDDA 3UN7A 4CLCA 4HBTA 2A24B 3KYZA 4E3MA 2WYXA 3BFDA 3L7HA 2WKEA 3DTMA 2JKGA 4OH0A 4E3JA 2XA7S 1KGFA 4R23A 3WWXA 2W1TA 4HP9A 4DDYA 4WEKA 2VKSA 3K3CA 3N7WA 2INWA 2HP5A 5HX9A 3NECA 2W1TB 3SW1A 5M18A 4QHCA 1DP9A 3LICA 2V2FF 4R4SA 4EBNA 3UPNA 3PR6A 4IHQA 4X25A 2HV1A 1OJGA 4Y0OA 4LV2A 3SH8A 4S2LA 2J3WA 5EPHA 1VEUB 4GDNA 2WKIA 4GS9B 3G30A 4FCFA 1OT6A 3HREA 1S1YA 3IWOA 4LRXC 1V9ZA 5HPFA 1W8QA 3S1YA 3Q7ZA 5AQ7A 2W3FA 5AJGA 4JGOA 2JHEA 3M2KA 3MF0A 4FD8A 1NRFA 2Y2LA 3SOIA 1U60A 4UQIS 2R78A 4DJ2A 5EVLA 1OTDA 1WA9A 3F1OB 5HZHA 3HUNA 5MC7A 1K55C 3GR2A 1KE0A 2ZMFA 3NI9A 1BUEA 4LFUA 4Q0HA 2EA9A 4CLCD 1UWNX 5GLDA 3T4OA 4KG2A 1JWVA 2V0UA 3LIDA 4IBRA 3BYDA 1XX2A 2QJ7A 4LGWA 4RA7A 5A91A 5KZHA 2A3UA 1XPBA 3BY8A 4RVAA 5CTMA 1KDWA 3QP6A 1NZOA 1LLBA 2X02A 3NHQA 1JNUA 3GTCA 4N1XA 5CRFA 1AXBA 3T1XA 4XUZA 2JKFA 5E2HA 3FKWA 3LI8A 2VX8A 3LGOA 2P04A 2L4RA 4E3IA 4CLCE 3PBNA 3ZNTA 2PU4A 1XA7A 4BQMA 3P01A 3GVBA 2WGIA 2KDKA 1F2KA 5TJJA 4BD0A 1IYOA 4GDBA 1M6KA 3MQ0A 2J9OA 4ZTKA 1Y54A 4NEED 3IS2B 4S2MA 4MN5A 2HDUA 3QP5A 2WADA 2PYRA 4MEZA 5JYPA 4KZAA 4ESPA 5GLCA 3ZGAB 3VP3A 4Y2FA 3S7QA 1L0FA 2H0TA 1WE4A 3TW8A 1W5DA 4JGQA 2PHYA 3W4PA 5TGFA 2P9VA 3CUEA 2H0YA 1TD5A 5GHZA 2B95A 3UB8A 2PYPA 3RXXA 4LPZA 2QJ5A 2FFFB 3Q7VA 4Y7PA 1YLJA 4WUJA 4XXRA 1E25A 2V8FA 1P0ZA 3BM6A 3DAVA 3SS5A 4U0XA 5DTTA 5L07A 5L8MA 1LT0A 1Y4OA 5FAOA 1TDGA 1EWZA 4ID4A 5HDCA 1NZUA 1Q2PA 1OTAA 4C6YA 4KUOA 3V3SA 2XROA 2YKHA 3BY9A 4UQIM 3EGXC 1PI5A 3QNCA 4LV3A 2VV8A 2GX5A 2W27A 2ZMVA 3CJMA 1SCWA 1G68A 4IUHA 2Y2JA 3OPLA 4I3AA 4OQHA 1MWTA 2OOLA 1FSYA 5DKLA 1DP6A 5HFOA 3H7WA 4Y17A 2XRNA 5CHJA 3E4PA 2GNXA 2XLNA 3BQ8A 1ESUA 5K5BA 3HUMA 2L0WA 3F1OA 3BJNA 2J3TD 4UA6A 3IS2A 5FAPA 2WZZA 5CGWA 1L0GA 5FI2A 5DVAA 1CEFA 1W7FA 4HOIA 3ISGA 3MQQA 1J3WA 2ZQAA 1P9RA 3N8RA 4OP5A 3QP2A 2ZQ7A 3NC8A 1K56A 5C5KA 3MBZA 2WKHA 3FYZA 4BD1A 4HH3A 1GA0A 4HEFA 5HWTA 4WL9A 5HD5A 1YMSA 3G31A 1Y28A 5EVIC 3C4PA 4DMZA 5KMWA 3O86A 3ZFZA 2Y8HA 2ZC4B 2W3GA 4KZ4A 1TDLA 3SS3A 4PM5A 3C7VA 5FATA 4NXFA 4WBGA 1P97A 3UNWA 4EU0A 1LI9A 2WKPA 1ZG6A 3ZG0A 2Y59A 3RH8B 5F69A 5GHXA 3EOIA 1AWIA 2WGVA 3G35A 2EX9A 2NUTC 2JN7A 1S67L 2DCFA 2XDMA 4E04A 2M7VA 3OOVA 3BWLA 4ZJ2A 4K0WA 4AFIA 3A0VA 1BYWA 4OKPA 1G5UA 3VFFA 3UB7A 4IEDA 2W3DA 3ZG5A 1VQQA 2OAP1 4IUKA 3ZG8B 1N9NA 3T4KA 1FCMA 3HVFA 1LSVA 2ZOIA 1XXMA 3F1NA 3F1NB 4BBVA 3UE1A 2FFYA 4O7DA 3LR0A 4EQIA 5J4EA 1MWRA 4ARZA 2O0YA 3BQAA 3O3VA 3ZHHA 2WUQA 2WGWA 2JCHA 3IF6B 2Z6DA 2Y79A 1DY6A 3MKEA 1T1AA 4O8GA 1DJCA 5FDSA 3T12B 2HJEA 2Y2GA 4JF4A 2EXBA 2V1ZA 3BFGA 5HAPA 3ZDJA 1HVBA 3CPTA 5HW3A 3W8KA 3VOZA 1ZKJA 5FI7A 4OPQA 3LIBA 4OONA 4OQ0A 2V1BA 1K0KA 3JVUA 4RX3A 5TR7A 1SHVA 3E2KA 3MXRA 4HIAA 2EX2A 3G6OA 4WLAA 5DJTA 4GW9A 4GZBA 3UDXA 5EVIB 1RP5A 4B88A 4BBUA 2OWHA 1STZA 1OTEA 4R70A 3V67A 2W3EA 3JYIA 4BLMA 4OQIA 2QPNA 3H82B 3IT9A 3NOPC 4GOGA 1PZOA 1FOFA 3LEQA 5M1AA 4PPRA 3KSHA 5L2FA 4DE2A 5EE8A 3WRTA 4P6ZS 2WAFA 4YINA 2LB5A 3HCYA 4I3JA 4P85A 4HHDA 2AVXA 2HDRA 3IXHA 4N9LA 1SZVA 1ES4A 3LR5A 2V20A 1YLZA 1RCJA 5A92A 3MS6A 2VGLS 4HH2A 3OBFA 1FCOA 4O01A 3UE0A 3LR3A 3ZNYA 2K31A 1RGYA 4R0QA 3T4QA 1TS0A 5HSQA 1ONGA 1CEGA 5FASA 5CGSA 2H5SA 4OQGA 3IX4A 4WN5A 2J8YA 1I2SA 4WF0A 1WYCA 4JF5A 4I38A 2JKTM 1TVFA 4BWIA 3NIAA 2IA2A 5HDSA 2K2NA 4F94A 5HARA 2O9CA 3BFEA 1S4RA 3G2YA 4KZ3A 2V9AA 1YM1A 1EW0A 4EUZA 2W1RA 2KLIA 4HP4A 3W2ZA 4KZBA 4ZBEA 3PAEA 1XGIA 1KOUA 1FSWA 3PBQA 3AGFA 3T50A 3VP2A 4UEYA 3FV7A 1E4DA 1S1ZA 4CJNA 1MWSA 3E0YA 5L09A 1GSXA 4WZ5A 4UA7A 4X55A 3PYPA 1YQSA 2VLGA 3A0SA 2VGJA 3SH9A 3I7JA 4ZAMA 2LB9A 3KX0X 3IXGA 4FTXA 1SKOB 1F5MA 2VV6A 5J8XA 2PT7A 2XD5A 3ULFA 4L9GA 3UDIA 3NOUC 1K38A 3D4FA 4JGPA 2XD1A 2V1AA 2Y2KA 3FPWA 1YLTA 1SDNA 2BLSA 2E8IA 2J80A 5HL1A 2XQZA 2PD7A 2OSUA 4A5RA 3TRCA 3OZHA 3MFXA 1TS8A 5DJUA 1M40A 3VP4A 2JBFA 4WYYA 3PXPA 4HJ6A 2MJ6A 2XFSA 3UMDA 1PWCA 3M2JA 5CGXA 4GD6A 1N4OA 2W3HA 3HLFA 4KQRA 4PM8A 4E3OA 1FR1A 1UGUA 3C30A 1DRMA 3VMAA 1ZG4A 3VOYA 4G3WA 5GHYA 2I72A 4WMCA 2B5RA 3WS2A 3IX3A 3PBSA 3ICYA 2XR0A 3HLBA 4HY8A 4DN0A 1PYYA 1MXOA 2XFTA 3IXBA 1PW8A 4BBTA 2A49A 5I5LA 3V3RA 2A24A 3LO7A 4IBXA 5IT5A 1OMEA 1YAXA 3IWIA 4LRZE 3NY4A 1YPRA 3JPUA 2O9AA 4Q0JA 5AVFA 3HLCA 2QZ6A 4GB7A 4MBFA 3WRZA 1ZTUA 1XJ2A 4Z9QA 1CF0A 4WEJA 1DJAA 2ZC7A 2M7UA 1I5QA 5D3OA 4WMCD 5M19A 4NG2A 2BASA 2ZLYA 1HZOA 1K54A 4S2KA 2OAQ1 2ZOHA 4L9EA 4JPMA 1PWDA 1FQGA 5FQMA 3OPHA 4MNRA 4R38A 2ZL1B 1XFQA 1NLYA 3NCKA 1IKGA 1YT4A 4X56A 5CECA 3G32A 4R1GA 2IWDA 3M6BA 1K25A 3R4KA 3MZFA 3PHYA 4MN7A 3Q82A 1IYQA 1J9MA 4DDSA 2VJWA 5CERA 4EUVA 4WZ4A 4E3KA 3IWQA 1F9IA 1KE4A 2OV5A 4LV0A 1PW1A 4K0XA 2I9VA 3SS4A 1TS6A 5EOEA 3E2LA 3A3FA 2GZAA 1E3UD 1IYSA 2QYBA 3T4SA 5J7EA 5BOHA 4Y0TA 3FC7A 3PAGA 4I39A 1YLYA 1OPXA 1BLCA 3V39A 5HWVA 3CUEC 4OOYA 2C5WB 2KOIA 4KG5A 1KGGA
chains in the Genus database with same CATH topology
4PKYG 3GECA 4AFIA 4Y5FA 4FSFA 3A0VA 1BYWA 3UB7A 4MN6A 3BW6A 2W3DA 3MMHA 1W63M 3MXQA 5F6AA 2OAP1 4IUKA 5DKKA 3UE6A 4QPRA 3LIEA 4CLCB 4GS9A 1GSVA 2O9BA 1N9NA 2QWSA 3T4KA 3ZYTA 1NRJA 5DF9A 3E98A 3UB6A 1LSVA 2QHKA 2ZOIA 3EEAA 3MR0A 3K3DA 5HDDA 4GJ4A 4CLCA 2A24B 3F1NA 3KYZA 3F1NB 4BBVA 4Y3IA 3LR4A 2J3TC 3LR0A 1D06A 5J4EA 4ARZA 4BMWA 2O0YA 3BQAA 4HQAA 1XJ6A 2XA7S 2JKRI 2Z6DA 2Y79A 1OTBA 3S7OA 1N9LA 2W1TA 4HP9A 1T1AA 1TS7A 4O8GA 4WEKA 2VKSA 3K3CA 2HJEA 4JGRA 2VV7A 1W63Q 2INWA 4PAUA 3IBJA 3UB9A 2W1TB 3LYXA 4YWZA 3SW1A 1MKMA 3LIBA 1XJ4A 1IFQA 3LIAA 2FZ0A 2V1BA 1DP9A 3LICA 3JVUA 3VOLA 3HJIA 4B93A 2B02A 4ETZA 3PBTA 3PR6A 4IHQA 4HIAA 3G6OA 5HWWA 3F1PA 1F98A 4WLAA 2YKFA 5DJTA 3CLOA 4GW9A 2O99A 4IJGA 3CI6A 4M4XA 4ARZB 4BBUA 2OWHA 3O5YA 1STZA 1OTEA 4WELA 5DFYA 1LSWA 1MC0A 5J3WA 2HV1A 1OJGA 3KSFA 2Z6CA 3CAXA 3F1PB 4R70A 3V67A 2W3EA 3H82B 2W0NA 3NOPC 2KX6A 2J3WA 1OT9A 4CLCC 4GS9B 1P9WA 3KSHA 1OT6A 3UE3A 4P6ZS 2LB5A 1LSXA 3HCYA 1S1YA 4I3JA 2NUPC 4HHDA 4O0PA 4LRXC 1V9ZA 5HPFA 4MCWA 1OTIA 2W3FA 4H6JA 4H6JB 5AJGA 3ZQ5A 4JGOA 2JHEA 3LR5A 3MJQA 4GCZA 1G28A 3MF0A 5IU1A 4EEUA 3EQUA 4G3KA 3T4JA 4F3LA 1S4SA 1G6OA 3MQOA 2R78A 4UQIS 2EWWA 1MZUA 4DJ2A 3C38A 1VB6A 1OTDA 1WA9A 4YOFA 3EEHA 3F1OB 5HZHA 2P7JA 2VGLS 4HJ4A 4HH2A 4GHIA 3OBFA 4MDZA 5MC7A 4XT2A 1ZHHB 4O01A 1YSPA 2ZMFA 5CX7A 3LR3A 2K31A 4Q0HA 2EA9A 3LUQA 5A8BA 2JKTI 3T4QA 1TS0A 4CLCD 1UWNX 4EETB 2HJ9C 5HSQA 5EFWA 3T4OA 4NXEA 3PBOA 2DMWA 2VA0A 2V0UA 3LIDA 3TJZC 2QJ7A 3OCLA 4WN5A 5DFXA 1GSWA 4R3AA 4WF0A 3RTYA 2A2LA 3D3OA 4HI4A 4I38A 2JKTM 3BY8A 4HJ3A 2D02A 2K7SA 3R7WB 1H3QA 2IA2A 4BWIA 3KSIA 1ODVA 5HDSA 2K2NA 3NHQA 3EGDC 2O9CA 1JNUA 1S4RA 2EWVA 3B42A 5G4ZA 4EESA 1T1BA 5TBMA 5TBMB 2D01A 2V9AA 1EW0A 2L1MA 3FG8A 2W1RA 1LL8A 2KLIA 1V9YA 4HP4A 4Q0IA 3RFBA 4K08A 3W2ZA 1X0OA 4ETXA 3LI8A 2VX8A 2P04A 4RQ9A 1KOUA 2L4RA 3S7NA 3PBNA 2M1CA 4NKPA 4CLCE 3PBQA 5KIZA 2P08A 1YSQA 3E4QA 3TE8A 3T50A 4UEYA 3P01A 1S1ZA 4OOLA 4NXBA 2KDKA 2FH5A 3E0YA 1GSXA 5TJJA 4FOFA 3MQ0A 3B33A 3PYPA 2H28A 4Z1WA 2VLGA 4P6ZM 4LRYC 3A0SA 3JVVA 3A0RA 4NEED 3IS2B 3C8CA 4MN5A 3OC2A 4EERA 2PYRA 3OLOA 4EW7A 4XT2B 3VV4A 2LB9A 3KX0X 3PBRA 3LIFA 4Y2FA 2VV6A 1F5MA 3S7QA 2PT7A 3ULFA 3DBAA 4R6LA 3TW8A 5HL6A 4L9GA 3NOUC 4JGQA 2PHYA 3IBRA 4JGPA 4F3LB 3CWFA 4I3IA 4KQDA 2V1AA 3FPWA 5G4YA 3NJAA 2J80A 3T4TA 3CUEA 2PD7A 1TD5A 3H9WA 3TRCA 3UB8A 2PYPA 1H8MA 4LPZA 2QJ5A 1TS8A 3MFXA 4PHTA 5DJUA 4WUJA 3VE4A 4G3VA 4OOMA 1P0ZA 3PXPA 4HJ6A 2MJ6A 5L8MA 1LT0A 3UMDA 2XA7M 2W3HA 5HDCA 2VGLM 4CQHA 1UGUA 3C30A 1DRMA 1OTAA 2XSSA 4KUOA 4G3WA 2XROA 1D7EA 2YKHA 3BY9A 3PBSA 3ICYA 4UQIM 3EGXC 4HY8A 1YKDA 1NWZA 3FPVA 1OJ5A 2PR5A 4DN0A 2VV8A 2GX5A 1NLZA 2W27A 3R7WA 4EXOA 2ZMVA 1TF1A 3OCNA 4BBTA 5I5LA 2A24A 2GJ3A 3VE3A 4IUHA 1T18A 5IS1A 2HF6A 3EQVA 2PD8A 4I3AA 5IT5A 3CITA 2VZWA 1YAXA 3NOTC 4L9FA 4LRZE 4MMNA 4II7A 1T19A 2B18A 2OOLA 4ZRRA 5DKLA 1DP6A 3D72A 2HGVA 2O9AA 3H7WA 4Q0JA 3S7PA 2XRNA 5AVFA 3E4PA 2GNXA 3BQ8A 1ZTUA 5K5BA 4ME4A 1S66L 1XJ2A 4HNBA 2L0WA 3KO6A 4L0LA 4WEJA 3F1OA 1IOUA 3BJNA 1DP8A 2M7UA 2J3TD 4GHIB 3IS2A 5F5YA 4DJ3A 1UWPX 4LLOB 5F68A 5FL3A 3K2NA 3KYQA 2BASA 5AVEA 3B47A 3U2AA 2OAQ1 3KSGA 2ZOHA 4L9EA 4HOIA 1XFNA 5LBRA 3MQQA 1P9RA 2PR6A 4R38A 3C2WA 1XFQA 1NLYA 3E4OA 1VHMA 3P7NA 3LFVA 5C5KA 4NXGA 4HH3A 3H7WB 4PKYA 4EQ1A 4KUKA 3R4KA 4KQOA 3T4LA 3PHYA 5HWTA 4WL9A 4MN7A 5HD5A 1XJ3A 1Y28A 4BJPA 2VJWA 4DMZA 4EUVA 2Y8HA 3GDIA 2W3GA 2V0WA 5HD3A 2VEAA 2WKRA 2PDRA 1F9IA 4I5SA 4NXFA 2I9VA 1P97A 1TS6A 3HJKA 4EU0A 2GZAA 2WKPA 4B9OA 3LI9A 2QYBA 3RH8B 5F69A 3T4SA 5J7EA 2OWJA 3EOIA 4YNRA 4EEPA 2CMNA 2JKRM 1N9OA 2G7UA 4GLQA 5KSHA 3FC7A 4I39A 1T1CA 3UMEA 2NUTC 2WKQA 1OPXA 2QKPA 2JN7A 5HWVA 1S67L 3CUEC 5HPIA 2ZBBA 4E04A 2KOIA 3H82A 2M7VA 3OOVA 3BWLA 3EWKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3E4P A;  3E4Q A;  4PKY G;  4EXO A;  3GEC A;  3T50 A;  1LSX A;  3A0V A;  1S1Y A;  1BYW A;  4I3J A;  1S1Z A;  4HHD A;  3UB7 A;  4MN6 A;  4LRX C;  1V9Z A;  4NXB A;  3MXQ A;  5F6A A;  2KDK A;  5DKK A;  3UE6 A;  1GSX A;  1S66 L;  3LIE A;  1XJ2 A;  4GS9 A;  1GSV A;  1OTI A;  1N9N A;  4H6J A;  2QWS A;  4H6J B;  2L0W A;  4HNB A;  4JGO A;  3B33 A;  3ZQ5 A;  3PYP A;  2H28 A;  2JHE A;  3F1O A;  2VLG A;  3MJQ A;  4GCZ A;  1G28 A;  5IU1 A;  4EEU A;  3UB6 A;  4LRY C;  1LSV A;  1DP8 A;  2QHK A;  3A0S A;  3A0R A;  4GHI B;  2ZOI A;  3IS2 B;  3IS2 A;  5F5Y A;  3MR0 A;  3K3D A;  5HDD A;  4DJ3 A;  1UWP X;  3C8C A;  4MN5 A;  4LLO B;  5F68 A;  4EER A;  1S4S A;  2A24 B;  3F1N A;  2PYR A;  3F1N B;  3MQO A;  2R78 A;  3OLO A;  4XT2 B;  5AVE A;  4BBV A;  2BAS A;  1MZU A;  4DJ2 A;  1VB6 A;  3KX0 X;  1OTD A;  1WA9 A;  3EEH A;  3LIF A;  3F1O B;  5HZH A;  2P7J A;  1D06 A;  2VV6 A;  2ZOH A;  5J4E A;  4L9E A;  4HJ4 A;  4HOI A;  3ULF A;  1XFN A;  4GHI A;  4HH2 A;  4HQA A;  3MQQ A;  4R6L A;  4L9G A;  2PR6 A;  4XT2 A;  3NOU C;  4JGQ A;  2PHY A;  1XJ6 A;  3C2W A;  3IBR A;  4JGP A;  3CWF A;  4I3I A;  4R38 A;  4KQD A;  4F3L B;  2V1A A;  5G4Y A;  1XFQ A;  2Z6D A;  3NJA A;  3E4O A;  2EA9 A;  2J80 A;  3LUQ A;  3P7N A;  5A8B A;  1OTB A;  1TS0 A;  2PD7 A;  1UWN X;  4EET B;  1N9L A;  5HSQ A;  4HP9 A;  5EFW A;  1T1A A;  1TS7 A;  3H9W A;  3UB8 A;  4NXG A;  2PYP A;  4HH3 A;  4NXE A;  4LPZ A;  3H7W B;  2QJ5 A;  1TS8 A;  3K3C A;  3MFX A;  4JGR A;  4KUK A;  4PKY A;  5DJU A;  4EQ1 A;  2V0U A;  2VV7 A;  3LID A;  2INW A;  4WUJ A;  3PHY A;  5HWT A;  2QJ7 A;  3UB9 A;  4WL9 A;  3VE4 A;  5HD5 A;  4WN5 A;  3LYX A;  1XJ3 A;  4YWZ A;  1GSW A;  1Y28 A;  4R3A A;  3SW1 A;  1P0Z A;  4HJ6 A;  4WF0 A;  3RTY A;  3UMD A;  1LT0 A;  3GDI A;  1XJ4 A;  3LIB A;  3LIA A;  2V1B A;  2V0W A;  4HI4 A;  1DP9 A;  3LIC A;  4I38 A;  3BY8 A;  2VEA A;  2WKR A;  3HJI A;  5HD3 A;  3VOL A;  2B02 A;  2PDR A;  1F9I A;  5HDC A;  4HJ3 A;  2D02 A;  2K7S A;  4I5S A;  1UGU A;  1ODV A;  4HIA A;  1DRM A;  3G6O A;  4NXF A;  5HDS A;  5HWW A;  1OTA A;  3F1P A;  2I9V A;  4KUO A;  1P97 A;  1D7E A;  1TS6 A;  2YKH A;  1F98 A;  3HJK A;  3NHQ A;  4WLA A;  2WKP A;  3BY9 A;  4F3L A;  2YKF A;  5DJT A;  1JNU A;  3ICY A;  4B9O A;  3CLO A;  1S4R A;  3LI9 A;  4GW9 A;  4HY8 A;  5G4Z A;  1NWZ A;  4M4X A;  3RH8 B;  4EES A;  5F69 A;  1OJ5 A;  1T1B A;  2PR5 A;  5TBM A;  5J7E A;  2OWJ A;  2D01 A;  5TBM B;  2VV8 A;  2W27 A;  2V9A A;  4BBU A;  1EW0 A;  2CMN A;  2L1M A;  2OWH A;  4EEP A;  3FG8 A;  1OTE A;  4EW7 A;  1LL8 A;  1LSW A;  5J3W A;  1N9O A;  1V9Y A;  2HV1 A;  5I5L A;  4BBT A;  1OJG A;  2A24 A;  2GJ3 A;  2Z6C A;  3VE3 A;  3CAX A;  3FC7 A;  3F1P B;  4HP4 A;  4R70 A;  4K08 A;  1T18 A;  4I39 A;  1X0O A;  5IS1 A;  3LI8 A;  1T1C A;  3UME A;  2PD8 A;  2W0N A;  2WKQ A;  3H82 B;  2QKP A;  3NOP C;  4I3A A;  2JN7 A;  2KX6 A;  3NOT C;  4L9F A;  4LRZ E;  5HWV A;  1S67 L;  1OT9 A;  1T19 A;  2OOL A;  1KOU A;  4RQ9 A;  4GS9 B;  2ZBB A;  2L4R A;  5AVF A;  5DKL A;  4E04 A;  1DP6 A;  3D72 A;  2M1C A;  3H82 A;  3H7W A;  5KIZ A;  3BWL A;  3EWK A;  1OT6 A; 
#chains in the Genus database with same CATH topology
 4JKT A;  3LY3 A;  4Y5F A;  4S2N C;  5HAQ A;  4MN6 A;  1W63 M;  3LIE A;  4CLC B;  1GSV A;  2O9B A;  2QWS A;  3C7U A;  1YMX A;  5DF9 A;  3TOI A;  4UHU A;  1QME A;  3EEA A;  2Y2P A;  5E2E A;  5EUA A;  4GJ4 A;  4Y3I A;  3W4Q A;  1D06 A;  5EVI A;  1ERO A;  4BMW A;  1MBL A;  1MWU A;  1CK3 A;  3OPP A;  4EWF A;  2JKR I;  2Y91 A;  2PRF A;  3S7O A;  4D2O A;  1MKI A;  4JGR A;  4PAU A;  3ZCZ A;  3UB9 A;  2R9X A;  3IF5 A;  1MKM A;  2HPB A;  5L10 A;  4YFM A;  2FZ0 A;  3QP4 A;  3VSL A;  2HP9 A;  5KSC A;  1ERM A;  5FQJ A;  3PBT A;  4NET A;  5AQA A;  3TG9 A;  5I94 A;  5HWW A;  1ESI A;  3GRJ A;  1O7E A;  4GD8 A;  1IEL A;  2YKF A;  3CLO A;  4OVD A;  2BG1 A;  3CI6 A;  4M4X A;  4ARZ B;  3ZVW A;  3O5Y A;  4WEL A;  1LSW A;  3V5M A;  3G2Z A;  2Z6C A;  1H0M A;  3CAX A;  3F1P B;  3D9Y A;  2KX6 A;  1K57 A;  4KZ5 A;  1OT9 A;  3T1R A;  2WAE A;  1LL9 A;  1P9W A;  1BZA A;  4R3J A;  4DF6 A;  1DJB A;  3UE3 A;  2NUP C;  2XF3 A;  4MCW A;  1L3L A;  1LI0 A;  1OTI A;  1JVJ A;  3GMW A;  4H6J A;  1BSG A;  4H6J B;  3WS5 A;  3MJQ A;  4QWO A;  5IU1 A;  4EEU A;  4XUX A;  4MBH A;  4G3K A;  3T4J A;  3IF6 C;  3UPO A;  1G6O A;  1MZU A;  5EM0 A;  5DTK A;  3EEH A;  2P7J A;  1BLH A;  1Z6F A;  1HLU P;  3ITB A;  4GHI A;  4MDZ A;  3MZD A;  1ZHH B;  1YSP A;  1L2S A;  3FWL A;  1LL5 A;  3LUQ A;  2UV0 E;  2ZQD A;  5A8B A;  2JKT I;  5EEC A;  4PMA A;  4EET B;  5EFW A;  2DMW A;  3FZC A;  5FQ9 A;  2Z2M B;  2P74 A;  1L0E A;  3OCL A;  3UY6 A;  2ZD8 A;  4R3A A;  4EV4 A;  2A2L A;  3D3O A;  4HI4 A;  2WZX A;  4MBK A;  2D02 A;  2C6W B;  2XK1 A;  1ODV A;  4OP8 A;  3EGD C;  5CTN A;  2EX8 A;  2EWV A;  3B42 A;  1BLP A;  2D01 A;  4X1M A;  3Q81 A;  2L1M A;  1LL8 A;  1V9Y A;  4PM7 A;  3T1Q B;  3CHW P;  2J7V A;  3NDG A;  3Q07 A;  4Q0I A;  2P9V B;  4K08 A;  1X0O A;  3GV9 A;  2JC7 A;  4OPZ A;  2PBD P;  2ZQC A;  4NKP A;  2M1C A;  4H8R A;  5KIZ A;  1YSQ A;  3ITA A;  1GHM A;  3E4Q A;  1CI8 A;  3NUL A;  3MFD A;  4JXG A;  1VET B;  2E8J A;  4OOL A;  4FUW A;  3V50 A;  2FH5 A;  2Q9N A;  3CMZ A;  3IF6 A;  4FOF A;  5F83 A;  1GHI A;  4GN2 A;  2H28 A;  4Z1W A;  3QP1 A;  4PM6 A;  3BLM A;  4DE1 A;  2HZ5 A;  3JVV A;  3A0R A;  1E3U A;  2PBY A;  3C8C A;  2XGN A;  3OC2 A;  4E3L A;  3VV4 A;  3VP0 A;  3PBR A;  3LIF A;  5HAI A;  1KGE A;  4KZ9 A;  3ZVT A;  1TEM A;  4R6L A;  5HL6 A;  4S2J A;  5A93 A;  2IWC A;  2UWX A;  4I3I A;  4KQD A;  3AGD A;  5G4Y A;  3NJA A;  4HBU A;  4S2P A;  4KQQ A;  4OLG A;  3Q1F A;  1H8M A;  1PI4 A;  3Q7V B;  4PHT A;  2EFU A;  2V8C A;  3A3I A;  3NBL A;  4G3V A;  1VM1 A;  3BRM A;  1BUL A;  4N92 A;  1LHY A;  5G18 A;  1ES3 A;  2XA7 M;  5F1F A;  4HES A;  2VGL M;  1KVM A;  1SKO A;  4DKI A;  3BFF A;  4X6T A;  1D7E A;  1NJ4 A;  3A3D A;  4QU3 A;  1ALQ A;  2Q0O A;  1YKD A;  1NWZ A;  3FPV A;  1OJ5 A;  1K54 C;  3R7W A;  4EXO A;  1NLZ A;  5JYO A;  3OCN A;  1BTL A;  1H8Z A;  5DF8 A;  1T18 A;  1FIK A;  2HF6 A;  3BEC A;  3DTI A;  3EQV A;  3CIT A;  1A0K A;  2VZW A;  4ZJ3 A;  3NOT C;  2HDS A;  2X71 A;  5CHM A;  1T19 A;  2B18 A;  4ZRR A;  4LCL A;  3D72 A;  3IHB A;  2HGV A;  1D1J A;  3S7P A;  2Y2M A;  2OLV A;  5FDH A;  4BEN A;  2ZM2 A;  5F1G A;  1MPL A;  5EM1 A;  4HNB A;  4MLL A;  4OPR A;  4L0L A;  1DP8 A;  4GHI B;  1ES5 A;  4LLO B;  4C75 A;  1K57 C;  3K2N A;  3DWK A;  5AVE A;  3TSG A;  2IWB A;  4KG6 A;  3B47 A;  1RGZ A;  4R3B A;  3MSH A;  3U2A A;  3KSG A;  1XP4 A;  1XFN A;  4QY6 A;  2PR6 A;  3QNB A;  1K4E A;  2DNS A;  3E4O A;  1VHM A;  3P7N A;  3LFV A;  3S22 A;  3LCE A;  4NXG A;  1EI5 A;  4EQ1 A;  4KUK A;  3T4L A;  3T1S A;  1GHP A;  1XGJ A;  3IX8 A;  4DXC A;  2CC1 A;  4BJP A;  4JBF A;  4K91 A;  5CEB A;  3GDI A;  1PFL A;  2V0W A;  5HD3 A;  2WKR A;  4FH2 A;  4FH4 A;  1PZP A;  2PU2 A;  1W79 A;  1HD8 A;  2EXA A;  4B9O A;  3LI9 A;  1K6R A;  2ZC6 B;  4YNR A;  4EEP A;  5E2G A;  4GLQ A;  1WYB A;  4N1H A;  1FR6 A;  1MY8 A;  3UME A;  2RL3 A;  4X1L A;  1Q2Q A;  4LV1 A;  4KZ8 A;  3H82 A;  4ME4 A;  5TFQ A;  3PTE A;  3GEC A;  4FSF A;  5EV0 A;  4D60 A;  3BW6 A;  5DKK A;  4GS9 A;  3LY4 A;  4QY5 A;  4RX2 A;  3ZYT A;  1FIL A;  1NRJ A;  4NK3 A;  4P6B A;  4QD4 A;  1GCE A;  1C3B A;  3FKV A;  3QHY A;  2DRW A;  4E6X A;  2ZC5 B;  5FQI A;  2Y2Q A;  1QMF A;  2HP6 A;  3LR4 A;  2PAV P;  2J3T C;  2XH9 A;  4KZ6 A;  4S2I A;  4HQA A;  1XJ6 A;  3C5A A;  5E2F A;  3BEB A;  1OTB A;  1N9L A;  1TS7 A;  5U47 A;  4JLF A;  2VV7 A;  1CI9 A;  3AGE A;  1W63 Q;  4DXB A;  3IBJ A;  2WGW B;  3ZG9 B;  1G6A A;  3LYX A;  4YWZ A;  4WZ5 C;  4IVI A;  4R4R A;  1XJ4 A;  1IFQ A;  3LIA A;  1NXY A;  4X68 A;  3HJI A;  3VOL A;  1YLP A;  4B93 A;  2B02 A;  4ETZ A;  3SH7 A;  1XA1 A;  3NDE A;  3W4O A;  2G2U A;  3B3X A;  3F1P A;  4IVK A;  1F98 A;  1NY0 A;  2RCX A;  2Y2H A;  4PM9 A;  2O99 A;  4IJG A;  1SDE A;  1L0D A;  4JF6 A;  5DFY A;  1MC0 A;  3IH9 A;  5J3W A;  2VGK A;  3KSF A;  3UO9 A;  3HLD A;  2W0N A;  4Y13 A;  3HUO A;  4CLC C;  2VK3 A;  1IYP A;  3DWZ A;  1LSX A;  5CHU A;  1HTZ A;  4X69 A;  4B4Z A;  4O0P A;  4BL2 A;  4ZJ1 A;  2GDN A;  5GL9 A;  3ZQ5 A;  1NYM A;  4GCZ A;  1G28 A;  4E3N A;  3EQU A;  4F3L A;  1S4S A;  4Y15 A;  3MQO A;  2EWW A;  2G2W A;  3C38 A;  1VB6 A;  4YOF A;  2ZJ9 A;  3DTK A;  3G34 A;  3MZE A;  4HJ4 A;  3KYE A;  2EFX A;  1K55 A;  4XT2 A;  4JXV A;  5CX7 A;  4U3T A;  2HJ9 C;  4OPY A;  4NXE A;  3PBO A;  2ZQ9 A;  4QB8 A;  2VA0 A;  3TJZ C;  1IEM A;  1Z09 A;  2J9P A;  5IHV A;  5DFX A;  3VSK A;  1GSW A;  2ZM8 A;  3RTY A;  2XEP A;  3BLS A;  5FEF A;  1PWG A;  4HJ3 A;  2K7S A;  1ONH A;  1FCN A;  1H3Q A;  3R7W B;  1W8Y A;  3KSI A;  3QP8 A;  5G4Z A;  3N8S A;  4EES A;  1T1B A;  5TBM A;  3WS4 A;  5TBM B;  4JXW A;  2EX6 A;  3FG8 A;  3S4X A;  3WS0 A;  1JWP A;  1S0W A;  2ACG A;  3RFB A;  4KEN B;  4ETX A;  3CG5 A;  2ZMA A;  2HDQ A;  1PIO A;  3N4I A;  4RQ9 A;  2Q9M A;  1JWZ A;  3S7N A;  3GQZ A;  2P08 A;  5GLA A;  1SKF A;  3TE8 A;  2JE5 A;  1ACF A;  3L9K A;  3GSG A;  4NXB A;  3OPR A;  5A90 A;  5FAQ A;  4EBP A;  3B33 A;  4P6Z M;  4LRY C;  1CJF A;  5DF7 A;  3LEZ A;  4JXS A;  2ZQ8 A;  3RJU A;  4EER A;  3OLO A;  4EW7 A;  4XT2 B;  1BT5 A;  5GLB A;  2Y2N A;  1VET A;  3ZG7 B;  3A3E A;  4KZ7 A;  4P87 A;  3DBA A;  2R9W A;  3IBR A;  4F3L B;  3CWF A;  5FA7 A;  3T4T A;  1GA9 A;  1K4F A;  3H9W A;  5EVE A;  5AQ9 A;  5F82 A;  4U0T A;  1ZC2 A;  3VE4 A;  3HBR A;  4OOM A;  1S6R A;  5DTS A;  2X01 A;  4DE3 A;  4DE0 A;  4C3Q A;  4P0M A;  1KVL A;  2ZC3 B;  1PNE A;  4CQH A;  2XSS A;  3C4O A;  4RYE A;  1N9B A;  2PR5 A;  3HL9 A;  2Y2I A;  1TF1 A;  3IHA A;  1NYY A;  2GJ3 A;  3SZT A;  3VE3 A;  3UDF A;  3O88 A;  3O87 A;  5IS1 A;  2PD8 A;  4EBL A;  4QJG A;  3N6I A;  4L9F A;  4MMN A;  5FI6 A;  4II7 A;  1ES2 A;  4LCM A;  4S2O A;  4BL3 A;  4UA9 A;  2QMI A;  2Y2O A;  5EOO A;  5EVI D;  1K56 D;  1S66 L;  3A3J A;  3DTE A;  4UAA A;  3KO6 A;  1IOU A;  5FQK A;  3MXS A;  5F5Y A;  4DJ3 A;  1UWP X;  1I2W A;  2WK0 A;  5AQB A;  5F68 A;  5FSR A;  5FL3 A;  3RXW A;  3KYQ A;  4Q8I A;  1IKI A;  3UPP A;  2Z2L B;  5LBR A;  4LEN A;  4B4X A;  4M3K A;  3C2W A;  3CZD A;  3MKF A;  5FQQ A;  5FEG A;  5CXW A;  3HLG A;  3HLE A;  3VP1 A;  3H7W B;  4PKY A;  1XKZ A;  1YLW A;  4KQO A;  3WS1 A;  5CED A;  1XJ3 A;  3BFC A;  2Y4A A;  3M6H A;  1JTD A;  1PRQ A;  1KDS A;  3IH8 A;  2ZL1 A;  3U4L P;  4DRT A;  2Y55 A;  2VEA A;  3IQA A;  3N8L A;  3P09 A;  2PDR A;  1KE3 A;  3UB5 P;  4I5S A;  2BTF P;  4E6W A;  1H5X A;  3HJK A;  2OLU A;  3IXD A;  1O07 A;  4ZDX A;  2OWJ A;  2CMN A;  2JKR M;  4GKU A;  1VEU A;  1N9O A;  2G7U A;  3DW0 A;  4WM9 A;  5KSH A;  4GNU A;  1K6S A;  2H10 A;  1T1C A;  2WKQ A;  2QKP A;  1ERQ A;  4X53 A;  3VFH A;  3P98 A;  3HLW A;  5HPI A;  2ZBB A;  2ZM0 A;  1H8Y A;  3EWK A;  4N9K A;  4PKY G;  1BLS A;  4OLD A;  3CPT B;  3MMH A;  5F6A A;  3MXQ A;  4Y0U A;  3UE6 A;  4CPK A;  4QPR A;  5E43 A;  1JTG A;  3E98 A;  3UB6 A;  2QHK A;  4S2N A;  3G4P A;  1CQA A;  3MR0 A;  3K3D A;  5HDD A;  3UN7 A;  4CLC A;  4HBT A;  2A24 B;  3KYZ A;  4E3M A;  2WYX A;  3BFD A;  3L7H A;  2WKE A;  3DTM A;  2JKG A;  4OH0 A;  4E3J A;  2XA7 S;  1KGF A;  4R23 A;  3WWX A;  2W1T A;  4HP9 A;  4DDY A;  4WEK A;  2VKS A;  3K3C A;  3N7W A;  2INW A;  2HP5 A;  5HX9 A;  3NEC A;  2W1T B;  3SW1 A;  5M18 A;  4QHC A;  1DP9 A;  3LIC A;  2V2F F;  4R4S A;  4EBN A;  3UPN A;  3PR6 A;  4IHQ A;  4X25 A;  2HV1 A;  1OJG A;  4Y0O A;  4LV2 A;  3SH8 A;  4S2L A;  2J3W A;  5EPH A;  1VEU B;  4GDN A;  2WKI A;  4GS9 B;  3G30 A;  4FCF A;  1OT6 A;  3HRE A;  1S1Y A;  3IWO A;  4LRX C;  1V9Z A;  5HPF A;  1W8Q A;  3S1Y A;  3Q7Z A;  5AQ7 A;  2W3F A;  5AJG A;  4JGO A;  2JHE A;  3M2K A;  3MF0 A;  4FD8 A;  1NRF A;  2Y2L A;  3SOI A;  1U60 A;  4UQI S;  2R78 A;  4DJ2 A;  5EVL A;  1OTD A;  1WA9 A;  3F1O B;  5HZH A;  3HUN A;  5MC7 A;  1K55 C;  3GR2 A;  1KE0 A;  2ZMF A;  3NI9 A;  1BUE A;  4LFU A;  4Q0H A;  2EA9 A;  4CLC D;  1UWN X;  5GLD A;  3T4O A;  4KG2 A;  1JWV A;  2V0U A;  3LID A;  4IBR A;  3BYD A;  1XX2 A;  2QJ7 A;  4LGW A;  4RA7 A;  5A91 A;  5KZH A;  2A3U A;  1XPB A;  3BY8 A;  4RVA A;  5CTM A;  1KDW A;  3QP6 A;  1NZO A;  1LLB A;  2X02 A;  3NHQ A;  1JNU A;  3GTC A;  4N1X A;  5CRF A;  1AXB A;  3T1X A;  4XUZ A;  2JKF A;  5E2H A;  3FKW A;  3LI8 A;  2VX8 A;  3LGO A;  2P04 A;  2L4R A;  4E3I A;  4CLC E;  3PBN A;  3ZNT A;  2PU4 A;  1XA7 A;  4BQM A;  3P01 A;  3GVB A;  2WGI A;  2KDK A;  1F2K A;  5TJJ A;  4BD0 A;  1IYO A;  4GDB A;  1M6K A;  3MQ0 A;  2J9O A;  4ZTK A;  1Y54 A;  4NEE D;  3IS2 B;  4S2M A;  4MN5 A;  2HDU A;  3QP5 A;  2WAD A;  2PYR A;  4MEZ A;  5JYP A;  4KZA A;  4ESP A;  5GLC A;  3ZGA B;  3VP3 A;  4Y2F A;  3S7Q A;  1L0F A;  2H0T A;  1WE4 A;  3TW8 A;  1W5D A;  4JGQ A;  2PHY A;  3W4P A;  5TGF A;  2P9V A;  3CUE A;  2H0Y A;  1TD5 A;  5GHZ A;  2B95 A;  3UB8 A;  2PYP A;  3RXX A;  4LPZ A;  2QJ5 A;  2FFF B;  3Q7V A;  4Y7P A;  1YLJ A;  4WUJ A;  4XXR A;  1E25 A;  2V8F A;  1P0Z A;  3BM6 A;  3DAV A;  3SS5 A;  4U0X A;  5DTT A;  5L07 A;  5L8M A;  1LT0 A;  1Y4O A;  5FAO A;  1TDG A;  1EWZ A;  4ID4 A;  5HDC A;  1NZU A;  1Q2P A;  1OTA A;  4C6Y A;  4KUO A;  3V3S A;  2XRO A;  2YKH A;  3BY9 A;  4UQI M;  3EGX C;  1PI5 A;  3QNC A;  4LV3 A;  2VV8 A;  2GX5 A;  2W27 A;  2ZMV A;  3CJM A;  1SCW A;  1G68 A;  4IUH A;  2Y2J A;  3OPL A;  4I3A A;  4OQH A;  1MWT A;  2OOL A;  1FSY A;  5DKL A;  1DP6 A;  5HFO A;  3H7W A;  4Y17 A;  2XRN A;  5CHJ A;  3E4P A;  2GNX A;  2XLN A;  3BQ8 A;  1ESU A;  5K5B A;  3HUM A;  2L0W A;  3F1O A;  3BJN A;  2J3T D;  4UA6 A;  3IS2 A;  5FAP A;  2WZZ A;  5CGW A;  1L0G A;  5FI2 A;  5DVA A;  1CEF A;  1W7F A;  4HOI A;  3ISG A;  3MQQ A;  1J3W A;  2ZQA A;  1P9R A;  3N8R A;  4OP5 A;  3QP2 A;  2ZQ7 A;  3NC8 A;  1K56 A;  5C5K A;  3MBZ A;  2WKH A;  3FYZ A;  4BD1 A;  4HH3 A;  1GA0 A;  4HEF A;  5HWT A;  4WL9 A;  5HD5 A;  1YMS A;  3G31 A;  1Y28 A;  5EVI C;  3C4P A;  4DMZ A;  5KMW A;  3O86 A;  3ZFZ A;  2Y8H A;  2ZC4 B;  2W3G A;  4KZ4 A;  1TDL A;  3SS3 A;  4PM5 A;  3C7V A;  5FAT A;  4NXF A;  4WBG A;  1P97 A;  3UNW A;  4EU0 A;  1LI9 A;  2WKP A;  1ZG6 A;  3ZG0 A;  2Y59 A;  3RH8 B;  5F69 A;  5GHX A;  3EOI A;  1AWI A;  2WGV A;  3G35 A;  2EX9 A;  2NUT C;  2JN7 A;  1S67 L;  2DCF A;  2XDM A;  4E04 A;  2M7V A;  3OOV A;  3BWL A;  4ZJ2 A;  4K0W A;  4AFI A;  3A0V A;  1BYW A;  4OKP A;  1G5U A;  3VFF A;  3UB7 A;  4IED A;  2W3D A;  3ZG5 A;  1VQQ A;  2OAP 1;  4IUK A;  3ZG8 B;  1N9N A;  3T4K A;  1FCM A;  3HVF A;  1LSV A;  2ZOI A;  1XXM A;  3F1N A;  3F1N B;  4BBV A;  3UE1 A;  2FFY A;  4O7D A;  3LR0 A;  4EQI A;  5J4E A;  1MWR A;  4ARZ A;  2O0Y A;  3BQA A;  3O3V A;  3ZHH A;  2WUQ A;  2WGW A;  2JCH A;  3IF6 B;  2Z6D A;  2Y79 A;  1DY6 A;  3MKE A;  1T1A A;  4O8G A;  1DJC A;  5FDS A;  3T12 B;  2HJE A;  2Y2G A;  4JF4 A;  2EXB A;  2V1Z A;  3BFG A;  5HAP A;  3ZDJ A;  1HVB A;  3CPT A;  5HW3 A;  3W8K A;  3VOZ A;  1ZKJ A;  5FI7 A;  4OPQ A;  3LIB A;  4OON A;  4OQ0 A;  2V1B A;  1K0K A;  3JVU A;  4RX3 A;  5TR7 A;  1SHV A;  3E2K A;  3MXR A;  4HIA A;  2EX2 A;  3G6O A;  4WLA A;  5DJT A;  4GW9 A;  4GZB A;  3UDX A;  5EVI B;  1RP5 A;  4B88 A;  4BBU A;  2OWH A;  1STZ A;  1OTE A;  4R70 A;  3V67 A;  2W3E A;  3JYI A;  4BLM A;  4OQI A;  2QPN A;  3H82 B;  3IT9 A;  3NOP C;  4GOG A;  1PZO A;  1FOF A;  3LEQ A;  5M1A A;  4PPR A;  3KSH A;  5L2F A;  4DE2 A;  5EE8 A;  3WRT A;  4P6Z S;  2WAF A;  4YIN A;  2LB5 A;  3HCY A;  4I3J A;  4P85 A;  4HHD A;  2AVX A;  2HDR A;  3IXH A;  4N9L A;  1SZV A;  1ES4 A;  3LR5 A;  2V20 A;  1YLZ A;  1RCJ A;  5A92 A;  3MS6 A;  2VGL S;  4HH2 A;  3OBF A;  1FCO A;  4O01 A;  3UE0 A;  3LR3 A;  3ZNY A;  2K31 A;  1RGY A;  4R0Q A;  3T4Q A;  1TS0 A;  5HSQ A;  1ONG A;  1CEG A;  5FAS A;  5CGS A;  2H5S A;  4OQG A;  3IX4 A;  4WN5 A;  2J8Y A;  1I2S A;  4WF0 A;  1WYC A;  4JF5 A;  4I38 A;  2JKT M;  1TVF A;  4BWI A;  3NIA A;  2IA2 A;  5HDS A;  2K2N A;  4F94 A;  5HAR A;  2O9C A;  3BFE A;  1S4R A;  3G2Y A;  4KZ3 A;  2V9A A;  1YM1 A;  1EW0 A;  4EUZ A;  2W1R A;  2KLI A;  4HP4 A;  3W2Z A;  4KZB A;  4ZBE A;  3PAE A;  1XGI A;  1KOU A;  1FSW A;  3PBQ A;  3AGF A;  3T50 A;  3VP2 A;  4UEY A;  3FV7 A;  1E4D A;  1S1Z A;  4CJN A;  1MWS A;  3E0Y A;  5L09 A;  1GSX A;  4WZ5 A;  4UA7 A;  4X55 A;  3PYP A;  1YQS A;  2VLG A;  3A0S A;  2VGJ A;  3SH9 A;  3I7J A;  4ZAM A;  2LB9 A;  3KX0 X;  3IXG A;  4FTX A;  1SKO B;  1F5M A;  2VV6 A;  5J8X A;  2PT7 A;  2XD5 A;  3ULF A;  4L9G A;  3UDI A;  3NOU C;  1K38 A;  3D4F A;  4JGP A;  2XD1 A;  2V1A A;  2Y2K A;  3FPW A;  1YLT A;  1SDN A;  2BLS A;  2E8I A;  2J80 A;  5HL1 A;  2XQZ A;  2PD7 A;  2OSU A;  4A5R A;  3TRC A;  3OZH A;  3MFX A;  1TS8 A;  5DJU A;  1M40 A;  3VP4 A;  2JBF A;  4WYY A;  3PXP A;  4HJ6 A;  2MJ6 A;  2XFS A;  3UMD A;  1PWC A;  3M2J A;  5CGX A;  4GD6 A;  1N4O A;  2W3H A;  3HLF A;  4KQR A;  4PM8 A;  4E3O A;  1FR1 A;  1UGU A;  3C30 A;  1DRM A;  3VMA A;  1ZG4 A;  3VOY A;  4G3W A;  5GHY A;  2I72 A;  4WMC A;  2B5R A;  3WS2 A;  3IX3 A;  3PBS A;  3ICY A;  2XR0 A;  3HLB A;  4HY8 A;  4DN0 A;  1PYY A;  1MXO A;  2XFT A;  3IXB A;  1PW8 A;  4BBT A;  2A49 A;  5I5L A;  3V3R A;  2A24 A;  3LO7 A;  4IBX A;  5IT5 A;  1OME A;  1YAX A;  3IWI A;  4LRZ E;  3NY4 A;  1YPR A;  3JPU A;  2O9A A;  4Q0J A;  5AVF A;  3HLC A;  2QZ6 A;  4GB7 A;  4MBF A;  3WRZ A;  1ZTU A;  1XJ2 A;  4Z9Q A;  1CF0 A;  4WEJ A;  1DJA A;  2ZC7 A;  2M7U A;  1I5Q A;  5D3O A;  4WMC D;  5M19 A;  4NG2 A;  2BAS A;  2ZLY A;  1HZO A;  1K54 A;  4S2K A;  2OAQ 1;  2ZOH A;  4L9E A;  4JPM A;  1PWD A;  1FQG A;  5FQM A;  3OPH A;  4MNR A;  4R38 A;  2ZL1 B;  1XFQ A;  1NLY A;  3NCK A;  1IKG A;  1YT4 A;  4X56 A;  5CEC A;  3G32 A;  4R1G A;  2IWD A;  3M6B A;  1K25 A;  3R4K A;  3MZF A;  3PHY A;  4MN7 A;  3Q82 A;  1IYQ A;  1J9M A;  4DDS A;  2VJW A;  5CER A;  4EUV A;  4WZ4 A;  4E3K A;  3IWQ A;  1F9I A;  1KE4 A;  2OV5 A;  4LV0 A;  1PW1 A;  4K0X A;  2I9V A;  3SS4 A;  1TS6 A;  5EOE A;  3E2L A;  3A3F A;  2GZA A;  1E3U D;  1IYS A;  2QYB A;  3T4S A;  5J7E A;  5BOH A;  4Y0T A;  3FC7 A;  3PAG A;  4I39 A;  1YLY A;  1OPX A;  1BLC A;  3V39 A;  5HWV A;  3CUE C;  4OOY A;  2C5W B;  2KOI A;  4KG5 A;  1KGG A; 
#chains in the Genus database with same CATH homology
 4PKY G;  3GEC A;  4AFI A;  4Y5F A;  4FSF A;  3A0V A;  1BYW A;  3UB7 A;  4MN6 A;  3BW6 A;  2W3D A;  3MMH A;  1W63 M;  3MXQ A;  5F6A A;  2OAP 1;  4IUK A;  5DKK A;  3UE6 A;  4QPR A;  3LIE A;  4CLC B;  4GS9 A;  1GSV A;  2O9B A;  1N9N A;  2QWS A;  3T4K A;  3ZYT A;  1NRJ A;  5DF9 A;  3E98 A;  3UB6 A;  1LSV A;  2QHK A;  2ZOI A;  3EEA A;  3MR0 A;  3K3D A;  5HDD A;  4GJ4 A;  4CLC A;  2A24 B;  3F1N A;  3KYZ A;  3F1N B;  4BBV A;  4Y3I A;  3LR4 A;  2J3T C;  3LR0 A;  1D06 A;  5J4E A;  4ARZ A;  4BMW A;  2O0Y A;  3BQA A;  4HQA A;  1XJ6 A;  2XA7 S;  2JKR I;  2Z6D A;  2Y79 A;  1OTB A;  3S7O A;  1N9L A;  2W1T A;  4HP9 A;  1T1A A;  1TS7 A;  4O8G A;  4WEK A;  2VKS A;  3K3C A;  2HJE A;  4JGR A;  2VV7 A;  1W63 Q;  2INW A;  4PAU A;  3IBJ A;  3UB9 A;  2W1T B;  3LYX A;  4YWZ A;  3SW1 A;  1MKM A;  3LIB A;  1XJ4 A;  1IFQ A;  3LIA A;  2FZ0 A;  2V1B A;  1DP9 A;  3LIC A;  3JVU A;  3VOL A;  3HJI A;  4B93 A;  2B02 A;  4ETZ A;  3PBT A;  3PR6 A;  4IHQ A;  4HIA A;  3G6O A;  5HWW A;  3F1P A;  1F98 A;  4WLA A;  2YKF A;  5DJT A;  3CLO A;  4GW9 A;  2O99 A;  4IJG A;  3CI6 A;  4M4X A;  4ARZ B;  4BBU A;  2OWH A;  3O5Y A;  1STZ A;  1OTE A;  4WEL A;  5DFY A;  1LSW A;  1MC0 A;  5J3W A;  2HV1 A;  1OJG A;  3KSF A;  2Z6C A;  3CAX A;  3F1P B;  4R70 A;  3V67 A;  2W3E A;  3H82 B;  2W0N A;  3NOP C;  2KX6 A;  2J3W A;  1OT9 A;  4CLC C;  4GS9 B;  1P9W A;  3KSH A;  1OT6 A;  3UE3 A;  4P6Z S;  2LB5 A;  1LSX A;  3HCY A;  1S1Y A;  4I3J A;  2NUP C;  4HHD A;  4O0P A;  4LRX C;  1V9Z A;  5HPF A;  4MCW A;  1OTI A;  2W3F A;  4H6J A;  4H6J B;  5AJG A;  3ZQ5 A;  4JGO A;  2JHE A;  3LR5 A;  3MJQ A;  4GCZ A;  1G28 A;  3MF0 A;  5IU1 A;  4EEU A;  3EQU A;  4G3K A;  3T4J A;  4F3L A;  1S4S A;  1G6O A;  3MQO A;  2R78 A;  4UQI S;  2EWW A;  1MZU A;  4DJ2 A;  3C38 A;  1VB6 A;  1OTD A;  1WA9 A;  4YOF A;  3EEH A;  3F1O B;  5HZH A;  2P7J A;  2VGL S;  4HJ4 A;  4HH2 A;  4GHI A;  3OBF A;  4MDZ A;  5MC7 A;  4XT2 A;  1ZHH B;  4O01 A;  1YSP A;  2ZMF A;  5CX7 A;  3LR3 A;  2K31 A;  4Q0H A;  2EA9 A;  3LUQ A;  5A8B A;  2JKT I;  3T4Q A;  1TS0 A;  4CLC D;  1UWN X;  4EET B;  2HJ9 C;  5HSQ A;  5EFW A;  3T4O A;  4NXE A;  3PBO A;  2DMW A;  2VA0 A;  2V0U A;  3LID A;  3TJZ C;  2QJ7 A;  3OCL A;  4WN5 A;  5DFX A;  1GSW A;  4R3A A;  4WF0 A;  3RTY A;  2A2L A;  3D3O A;  4HI4 A;  4I38 A;  2JKT M;  3BY8 A;  4HJ3 A;  2D02 A;  2K7S A;  3R7W B;  1H3Q A;  2IA2 A;  4BWI A;  3KSI A;  1ODV A;  5HDS A;  2K2N A;  3NHQ A;  3EGD C;  2O9C A;  1JNU A;  1S4R A;  2EWV A;  3B42 A;  5G4Z A;  4EES A;  1T1B A;  5TBM A;  5TBM B;  2D01 A;  2V9A A;  1EW0 A;  2L1M A;  3FG8 A;  2W1R A;  1LL8 A;  2KLI A;  1V9Y A;  4HP4 A;  4Q0I A;  3RFB A;  4K08 A;  3W2Z A;  1X0O A;  4ETX A;  3LI8 A;  2VX8 A;  2P04 A;  4RQ9 A;  1KOU A;  2L4R A;  3S7N A;  3PBN A;  2M1C A;  4NKP A;  4CLC E;  3PBQ A;  5KIZ A;  2P08 A;  1YSQ A;  3E4Q A;  3TE8 A;  3T50 A;  4UEY A;  3P01 A;  1S1Z A;  4OOL A;  4NXB A;  2KDK A;  2FH5 A;  3E0Y A;  1GSX A;  5TJJ A;  4FOF A;  3MQ0 A;  3B33 A;  3PYP A;  2H28 A;  4Z1W A;  2VLG A;  4P6Z M;  4LRY C;  3A0S A;  3JVV A;  3A0R A;  4NEE D;  3IS2 B;  3C8C A;  4MN5 A;  3OC2 A;  4EER A;  2PYR A;  3OLO A;  4EW7 A;  4XT2 B;  3VV4 A;  2LB9 A;  3KX0 X;  3PBR A;  3LIF A;  4Y2F A;  2VV6 A;  1F5M A;  3S7Q A;  2PT7 A;  3ULF A;  3DBA A;  4R6L A;  3TW8 A;  5HL6 A;  4L9G A;  3NOU C;  4JGQ A;  2PHY A;  3IBR A;  4JGP A;  4F3L B;  3CWF A;  4I3I A;  4KQD A;  2V1A A;  3FPW A;  5G4Y A;  3NJA A;  2J80 A;  3T4T A;  3CUE A;  2PD7 A;  1TD5 A;  3H9W A;  3TRC A;  3UB8 A;  2PYP A;  1H8M A;  4LPZ A;  2QJ5 A;  1TS8 A;  3MFX A;  4PHT A;  5DJU A;  4WUJ A;  3VE4 A;  4G3V A;  4OOM A;  1P0Z A;  3PXP A;  4HJ6 A;  2MJ6 A;  5L8M A;  1LT0 A;  3UMD A;  2XA7 M;  2W3H A;  5HDC A;  2VGL M;  4CQH A;  1UGU A;  3C30 A;  1DRM A;  1OTA A;  2XSS A;  4KUO A;  4G3W A;  2XRO A;  1D7E A;  2YKH A;  3BY9 A;  3PBS A;  3ICY A;  4UQI M;  3EGX C;  4HY8 A;  1YKD A;  1NWZ A;  3FPV A;  1OJ5 A;  2PR5 A;  4DN0 A;  2VV8 A;  2GX5 A;  1NLZ A;  2W27 A;  3R7W A;  4EXO A;  2ZMV A;  1TF1 A;  3OCN A;  4BBT A;  5I5L A;  2A24 A;  2GJ3 A;  3VE3 A;  4IUH A;  1T18 A;  5IS1 A;  2HF6 A;  3EQV A;  2PD8 A;  4I3A A;  5IT5 A;  3CIT A;  2VZW A;  1YAX A;  3NOT C;  4L9F A;  4LRZ E;  4MMN A;  4II7 A;  1T19 A;  2B18 A;  2OOL A;  4ZRR A;  5DKL A;  1DP6 A;  3D72 A;  2HGV A;  2O9A A;  3H7W A;  4Q0J A;  3S7P A;  2XRN A;  5AVF A;  3E4P A;  2GNX A;  3BQ8 A;  1ZTU A;  5K5B A;  4ME4 A;  1S66 L;  1XJ2 A;  4HNB A;  2L0W A;  3KO6 A;  4L0L A;  4WEJ A;  3F1O A;  1IOU A;  3BJN A;  1DP8 A;  2M7U A;  2J3T D;  4GHI B;  3IS2 A;  5F5Y A;  4DJ3 A;  1UWP X;  4LLO B;  5F68 A;  5FL3 A;  3K2N A;  3KYQ A;  2BAS A;  5AVE A;  3B47 A;  3U2A A;  2OAQ 1;  3KSG A;  2ZOH A;  4L9E A;  4HOI A;  1XFN A;  5LBR A;  3MQQ A;  1P9R A;  2PR6 A;  4R38 A;  3C2W A;  1XFQ A;  1NLY A;  3E4O A;  1VHM A;  3P7N A;  3LFV A;  5C5K A;  4NXG A;  4HH3 A;  3H7W B;  4PKY A;  4EQ1 A;  4KUK A;  3R4K A;  4KQO A;  3T4L A;  3PHY A;  5HWT A;  4WL9 A;  4MN7 A;  5HD5 A;  1XJ3 A;  1Y28 A;  4BJP A;  2VJW A;  4DMZ A;  4EUV A;  2Y8H A;  3GDI A;  2W3G A;  2V0W A;  5HD3 A;  2VEA A;  2WKR A;  2PDR A;  1F9I A;  4I5S A;  4NXF A;  2I9V A;  1P97 A;  1TS6 A;  3HJK A;  4EU0 A;  2GZA A;  2WKP A;  4B9O A;  3LI9 A;  2QYB A;  3RH8 B;  5F69 A;  3T4S A;  5J7E A;  2OWJ A;  3EOI A;  4YNR A;  4EEP A;  2CMN A;  2JKR M;  1N9O A;  2G7U A;  4GLQ A;  5KSH A;  3FC7 A;  4I39 A;  1T1C A;  3UME A;  2NUT C;  2WKQ A;  1OPX A;  2QKP A;  2JN7 A;  5HWV A;  1S67 L;  3CUE C;  5HPI A;  2ZBB A;  4E04 A;  2KOI A;  3H82 A;  2M7V A;  3OOV A;  3BWL A;  3EWK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...