2YKHA

Sensor region of a sensor histidine kinase
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
285
structure length
265
Chain Sequence
STLGDLLAEHTVLPGSAVDHLHAVVGEWQLLADLSFADYLMWVRRDDGVLVCVAQCRPNTGPTVVHTDAVGTVVAANSMPLVAATFSHSVEVSPVRFGDQVVAVLTRHQPELAARRRSGHLETAYRLCATDLLRMLAEGTFPDAGDVAMSRSSPRAGDGFIRLDVDGVVSYASPNALSAYHRMGLTTELEGVNLIDATRPLISDPFEAHEVDEHVQDLLAGDGKGMRMEVDAGGATVLLRTLPLVVAGRNVGAAILIRDVTEVKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROBABLE SENSOR HISTIDINE KINASE PDTAS
publication title The Sensor Region of the Ubiquitous Cytosolic Sensor Kinase, Pdtas, Contains Pas and Gaf Domain Sensing Modules.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
total genus 67
structure length 265
sequence length 285
chains with identical sequence B
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2011-05-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12282 H_kinase_N Signal transduction histidine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2ykhA02
3.30.450.280 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2ykhA01
5TBMB 4JGOA 2K7SA 4HP4A 2A24A 3LIDA 4KUOA 3UE6A 2D02A 2BASA 2PDRA 5F5YA 2OWHA 4MN6A 4WL9A 3C8CA 1S1ZA 2QJ7A 3IS2B 3UB9A 3VOLA 5HWVA 3LIAA 5G4YA 4NXBA 5J7EA 3MFXA 3LIEA 1S67L 3F1PB 4YWZA 2VV8A 3K3DA 4GHIA 1OTBA 4DJ3A 2D01A 1WA9A 2GJ3A 3D72A 3B33A 1GSXA 4L9GA 4EW7A 2OOLA 3CLOA 4JGQA 4KQDA 5F69A 3H82B 3OLOA 2QJ5A 5TBMA 4B9OA 2R78A 5HD5A 4HOIA 1OT6A 4HP9A 1JNUA 1DRMA 4R38A 3EWKA 3LYXA 4PKYG 2JN7A 4M4XA 1S4SA 4BBVA 1XJ6A 2M1CA 5HZHA 3H7WB 3ZQ5A 1D06A 3BY8A 4NXFA 3IS2A 3SW1A 3MQOA 3NOPC 2WKPA 5F6AA 4I5SA 3HJIA 1OJ5A 4EEPA 3UB7A 2YKHA 2PHYA 3FG8A 3F1PA 1UWNX 4HIAA 4LRZE 2HV1A 3KX0X 2EA9A 1D7EA 5HDCA 3F1NB 3MR0A 2V0UA 2J80A 3UB6A 1V9YA 1NWZA 3H82A 1XFQA 1XJ2A 1LT0A 1S66L 5HWTA 2VEAA 3MQQA 4HHDA 1OTAA 2L0WA 1N9OA 2ZBBA 1UWPX 5AVFA 1G28A 3H7WA 3RH8B 4XT2B 3MJQA 2V0WA 2QKPA 4WF0A 4I3JA 3GDIA 2P7JA 2VV7A 4GS9B 4LPZA 3CAXA 4MN5A 4WLAA 1DP6A 3BWLA 2OWJA 5IU1A 4R3AA 4HH2A 3F1NA 1F98A 2INWA 5KIZA 4HJ6A 3GECA 1EW0A 4R6LA 5A8BA 1KOUA 4K08A 1DP8A 1X0OA 1LSXA 4JGPA 3A0SA 3LUQA 2CMNA 4XT2A 4L9FA 4NXGA 3F1OB 4HI4A 2QHKA 4GS9A 1OT9A 3A0RA 4EESA 1P97A 4F3LB 4HJ4A 2VLGA 4EERA 3NOTC 1S4RA 1OTEA 2KX6A 1LSVA 4HQAA 2PD8A 3E4QA 1XJ4A 4EEUA 4L9EA 2ZOIA 1T19A 3P7NA 3H9WA 3ICYA 1T1BA 4I39A 2PR5A 1UGUA 3BY9A 2JHEA 4I3IA 4GW9A 3LI9A 5G4ZA 1OTDA 1XJ3A 3ULFA 2W27A 3LIBA 4I3AA 1S1YA 3A0VA 4EETB 1ODVA 1OTIA 4BBUA 2V1AA 5DJUA 3E4OA 1TS8A 1T1CA 1TS7A 1LSWA 3F1OA 1OJGA 4HJ3A 2PYPA 5HD3A 3UMEA 5DKLA 4RQ9A 4EQ1A 5HDSA 3HJKA 1BYWA 3C2WA 5HDDA 2PD7A 4F3LA 2YKFA 4R70A 1T1AA 2QWSA 2Z6CA 4E04A 3NHQA 4NXEA 4EXOA 4BBTA 3NOUC 4WUJA 3RTYA 2V1BA 3CWFA 1TS6A 3UB8A 5I5LA 1GSWA 1LL8A 3VE4A 2Z6DA 1N9LA 4LRXC 3LIFA 1P0ZA 3T50A 2WKRA 4I38A 2VV6A 5DKKA 5DJTA 5J3WA 3IBRA 4HNBA 3PYPA 3E4PA 1MZUA 5HSQA 3G6OA 2KDKA 2W0NA 2ZOHA 1VB6A 4DJ2A 3NJAA 3PHYA 4HH3A 1V9ZA 3LICA 2L4RA 3MXQA 4H6JB 4JGRA 3UMDA 2V9AA 5F68A 2L1MA 4GCZA 2A24B 2I9VA 1TS0A 5J4EA 4KUKA 3EEHA 5EFWA 1GSVA 2B02A 4WN5A 2PYRA 5IS1A 4PKYA 1DP9A 1N9NA 4HY8A 1XFNA 3FC7A 3VE3A 1T18A 2PR6A 2H28A 4LLOB 4LRYC 1F9IA 5HWWA 2WKQA 4GHIB 3K3CA 4H6JA 5AVEA 1Y28A 3LI8A
chains in the Genus database with same CATH superfamily
4HP4A 3LIDA 3IWIA 4KUOA 2XFTA 3T4SA 4E6XA 3IHAA 3SS4A 4KQQA 2D02A 2BASA 2XGNA 4N9KA 5F5YA 3SH8A 1RGYA 2FFFB 4CPKA 1IKGA 5CX7A 2OWHA 4MN6A 3HCYA 1PWDA 2V2FF 3VOLA 3Q7VB 3LIAA 3BYDA 2H0TA 2V8CA 1S67L 1N9BA 3M6BA 3R4KA 3K3DA 3PBOA 1OTBA 2D01A 1WA9A 3K2NA 2GJ3A 3IX4A 3SH7A 1GSXA 2OOLA 4GD8A 3PBTA 3VSKA 2K31A 3UE3A 3CLOA 3H82B 3N7WA 3CUEC 2QJ5A 1CI8A 4X6TA 1G5UA 2HJEA 4HOIA 4HP9A 4G3KA 2HPBA 2M7UA 1FCOA 1M40A 4M4XA 3T1XA 2EXBA 1S4SA 4KQOA 4QHCA 5FDSA 3JPUA 2HGVA 4PM6A 3S7QA 3H7WB 4CLCC 3MS6A 3BY8A 3E0YA 1NZOA 3W4OA 4ETXA 3Q7VA 5HARA 3MQOA 2XQZA 3FZCA 2VZWA 5FQMA 3UDXA 4E3LA 2IWCA 2J3TD 4QY6A 5GHXA 1STZA 1OJ5A 2DRWA 1LL9A 2PHYA 3GMWA 4KZ4A 4S2IA 1VQQA 3NBLA 2WUQA 4U3TA 1IEMA 2H0YA 2EA9A 2ZJ9A 4RX3A 1TD5A 2V0UA 3DWZA 5DFXA 3H82A 3M2KA 4UEYA 3FKVA 4B4XA 1KDWA 5F1FA 4WMCA 3OOVA 2ZBBA 2JKTM 1UWPX 3QNCA 1BULA 1CJFA 3BQ8A 3PBRA 4Y5FA 5FA7A 3H7WA 2FZ0A 1WYBA 2JKRI 3PAEA 3RH8B 5FASA 2V0WA 1I2SA 4WF0A 3UNWA 2IA2A 1HTZA 3V39A 2Y2LA 3GDIA 4JBFA 2IWDA 2P7JA 2WGWB 3ITAA 2E8IA 1LL5A 3LY3A 1JVJA 4JF4A 1JWPA 4MN5A 4JF6A 2XA7S 3BWLA 1W79A 1F2KA 4IBRA 3QP2A 5HAQA 3I7JA 2H5SA 3NY4A 1L0GA 4R4SA 3MQ0A 4MN7A 1EW0A 5E2GA 3LR3A 4K08A 4EU0A 2Z2MB 2ZQ8A 4JGPA 3WS1A 3A0SA 3LUQA 2XRNA 1BZAA 4C6YA 3IWQA 3T12B 4L9FA 2FH5A 3ISGA 4S2JA 4KZ8A 4OOLA 1IYSA 1LHYA 1MWTA 1PFLA 1XXMA 2WGWA 3W8KA 3MXRA 4XUZA 2VLGA 3D4FA 4OLDA 3NOTC 5F82A 2KX6A 4HQAA 4ZDXA 2PD8A 4N92A 1XJ4A 4L9EA 2ZOIA 1FILA 4A5RA 1NZUA 4LCLA 4GDNA 1VM1A 4X53A 3H9WA 1T1BA 2PR5A 2ZL1B 1UGUA 4BWIA 4KZ3A 3LI9A 1HVBA 3P01A 4OQIA 3MKFA 3FV7A 1XJ3A 4S2LA 2W27A 4DXBA 4S2PA 1ZG4A 4D2OA 4KZ9A 4LV1A 2XSSA 4BBUA 4K0WA 5IHVA 1T1CA 1LSWA 1ERMA 4HJ3A 1MKMA 4S2NA 5HD3A 3UMEA 4EQ1A 2HZ5A 1PZOA 1GHIA 3BECA 2A49A 3NI9A 2FFYA 4E3JA 5EVEA 3UDIA 4EBNA 2JKRM 4O0PA 3IBJA 5HW3A 3HVFA 2V8FA 3DWKA 2PU2A 3CWFA 4WZ5C 1TS6A 5FI2A 2Q0OA 3OPRA 4BENA 3N8LA 1LL8A 3BQAA 1N9LA 1P0ZA 2HJ9C 3IT9A 3IQAA 2WKRA 4FSFA 4KZ5A 5GL9A 3OPHA 2WAEA 3ZVWA 3E4PA 5HSQA 1LLBA 1TEMA 2BTFP 1VB6A 4PMAA 4UA6A 4DJ2A 3NJAA 2R9WA 1ONGA 3PHYA 3ZNTA 4BQMA 3ZFZA 1V9ZA 3LICA 4LENA 2PU4A 3MXQA 3FYZA 2VGLM 2PBYA 2EWVA 3KYZA 2PT7A 4CLCE 4JGRA 4O01A 1MPLA 1SZVA 2V9AA 4GCZA 2A24B 4Z9QA 1TS0A 2WK0A 4GZBA 3KSGA 3W4QA 4UA7A 2B02A 4G3WA 3LEQA 1PWGA 5DF8A 4S2MA 1MWRA 3UDFA 1DP9A 5FSRA 4KQRA 5CERA 1W7FA 4HY8A 4GJ4A 4R23A 2RL3A 1XFNA 3O5YA 1K54A 2PR6A 4R0QA 3IF6B 3DAVA 1W63M 4OOMA 3VP3A 2ZQ9A 4L0LA 4GKUA 1SDNA 3T4TA 3AGDA 5F83A 1NRJA 4JXGA 3IXGA 1Y28A 3G2ZA 3LI8A 2M7VA 1XGIA 2JC7A 4Y2FA 5TBMB 2K7SA 2A24A 2ZM2A 3BW6A 4Y13A 4NKPA 3FPVA 2PRFA 2UWXA 4RA7A 4UQIM 1GHMA 2WKEA 3A3JA 3O88A 5EOEA 4E3MA 5M18A 5L07A 5BOHA 3PBQA 5AJGA 3Q81A 4BL3A 1S1ZA 3IS2B 5IT5A 5HWVA 4B88A 3U2AA 1K4FA 5EM1A 4QD4A 5DF7A 4X68A 3N8SA 2Y91A 3IF6A 4DDSA 3LIEA 5GLDA 1ZKJA 3BFCA 2E8JA 1ALQA 2QMIA 2Y2JA 4IEDA 1RCJA 3QP1A 2IWBA 3UY6A 3VV4A 3B33A 4Q0IA 3O3VA 4EW7A 4JGQA 3OLOA 1KE3A 5TBMA 4QWOA 4B9OA 2EFUA 1JNUA 2JBFA 3OPPA 1W5DA 4Y17A 2XDMA 3HL9A 4HESA 3CI6A 5HZHA 2XH9A 5TR7A 3HLFA 3IS2A 1LI0A 5CHJA 1BTLA 3NOPC 2WKHA 3Q7ZA 5F6AA 3HJIA 3DTEA 5KSCA 1K57C 1ZTUA 5EVIB 5CHUA 3T4JA 1IFQA 2CC1A 3LGOA 5F1GA 1MWUA 2O99A 5CTNA 1FR6A 3RFBA 3FG8A 2GNXA 5U47A 1EROA 4HIAA 4LRZE 2HV1A 1S6RA 1D7EA 1MY8A 4Y0OA 2QYBA 3MR0A 2J80A 3UPNA 1V9YA 2AVXA 4QPRA 2Y59A 3GRJA 5DTTA 5CXWA 1L0EA 5LBRA 1MC0A 1YSQA 4E3IA 1LT0A 4Y3IA 3MQQA 5FL3A 4IUHA 4QB8A 2W3GA 3TW8A 5E43A 5FQIA 3EGDC 1G28A 3C38A 2Q9MA 2EX8A 2WZZA 2ZM8A 4GOGA 4XT2B 4LV0A 4DN0A 1ESIA 3A3DA 3WS5A 4I3JA 1VEUB 4S2OA 3ZYTA 5EVIA 1BSGA 4LPZA 3ZG8B 4EV4A 1KDSA 1YPRA 1SCWA 1SKFA 3OBFA 1KVLA 1PWCA 1DP6A 1ES2A 3S4XA 2ZC7A 5HPFA 3GTCA 4R3AA 3QP8A 4EUVA 1YLZA 3CITA 3T1QB 2C6WB 1H5XA 4LFUA 2INWA 2ZC5B 1BT5A 4HJ6A 3QNBA 2J3WA 4UAAA 4QJGA 5A8BA 1NYMA 5DVAA 1K6RA 3BFFA 3V3SA 1L0DA 2CMNA 4XT2A 1CI9A 4HEFA 3F1OB 1K56A 1XKZA 2OLUA 2WYXA 1VEUA 4WELA 2VGLS 2Y2IA 3TJZC 5M19A 4DE1A 5E2HA 1PI5A 3B3XA 3TOIA 1L3LA 2G7UA 4Y7PA 1LSVA 3R7WB 4IVKA 3LEZA 2LB9A 2WKIA 3GV9A 1BUEA 5EUAA 4BLMA 2X02A 3P7NA 4I39A 3EGXC 3RJUA 2Y2GA 4GW9A 3IXDA 5C5KA 3PR6A 1OTDA 2W1TA 3N4IA 2HDUA 2B18A 4PHTA 4X25A 1RP5A 4DXCA 4WM9A 4EETB 1D1JA 4XXRA 5DJUA 1TS8A 4XUXA 1TS7A 3F1OA 1TF1A 4RVAA 3ZCZA 3DW0A 4P6BA 3CMZA 5J8XA 5HDSA 2W3EA 4Y15A 2RCXA 4KZ7A 2ACGA 1LI9A 4KG5A 2YKFA 3N8RA 4R70A 1IYPA 1T1AA 3MZFA 4OPYA 2UV0E 2Z6CA 3R7WA 3NHQA 1K6SA 4EXOA 3NOUC 3ZGAB 2EFXA 1MWSA 1YSPA 4OVDA 5EPHA 1KE4A 3RTYA 1KGEA 1GA0A 2Q9NA 4BD1A 4IJGA 3BLMA 1GSWA 2ZQ7A 1Y4OA 3WS4A 3PAGA 3A3FA 4RX2A 2VV6A 3CHWP 5DJTA 4ZAMA 1FCMA 2LB5A 4QU3A 2KDKA 2ZOHA 1XPBA 1Q2PA 3IX3A 3ZG5A 3LO7A 4X1MA 4BD0A 2OSUA 2NUPC 2DNSA 2K2NA 3KSIA 1NJ4A 1NRFA 1ACFA 4NG2A 5AQ7A 4DDYA 4JXVA 4P6ZM 5FDHA 3QHYA 2L1MA 5J4EA 2XR0A 4YFMA 4MBKA 3Q82A 4GN2A 4KG6A 3JVUA 4PPRA 1N9NA 3LY4A 3ZDJA 5A90A 1S0WA 5JYOA 3VFFA 2KOIA 5KZHA 1ERQA 3TG9A 2EWWA 4PM7A 5CECA 1PIOA 4OLGA 3FC7A 1T18A 3OCNA 4YINA 4LRYC 1IKIA 1W8QA 2Y2MA 4C75A 3T4QA 1CEGA 4Q8IA 1IELA 2OAQ1 4WYYA 2XROA 3B42A 3W4PA 3L9KA 1F5MA 1MXOA 2G2WA 4JGOA 1KE0A 3NDGA 2O9BA 1E3UA 2A3UA 4MMNA 1E25A 5CEBA 2Y2OA 1P9WA 3UO9A 3VP4A 1ZC2A 4WL9A 2C5WB 5FEGA 3C8CA 1PRQA 2HP6A 2QJ7A 1YLPA 2X01A 5HPIA 4OQGA 3C30A 2W3HA 2QPNA 2P9VB 3BFEA 3NULA 4NXBA 5HAIA 5J7EA 3MFXA 1ONHA 2V20A 4P85A 1DJAA 4LGWA 3ZNYA 2JE5A 4DJ3A 3CZDA 4QY5A 3IHBA 1SKOB 3D72A 4OKPA 3WWXA 1H0MA 2WGIA 5FAOA 1I2WA 3MBZA 4KQDA 3GR2A 5F69A 4X55A 3S1YA 5HD5A 3T4KA 1EI5A 1K55A 1DRMA 5TGFA 5CRFA 3EWKA 2ZQCA 3Q1FA 2B95A 3IXBA 3LYXA 3LR0A 3HLDA 4JPMA 4GNUA 4BBVA 1I5QA 4OP8A 4II7A 3NCKA 1MKIA 2M1CA 3G31A 1D06A 2O0YA 2ZC4B 3KYEA 3DTIA 3T1RA 3ZG7B 3VP2A 2WKPA 4S2NC 2P9VA 4H8RA 4EQIA 3PBNA 2ZC6B 3KSHA 3N6IA 3G35A 1SHVA 3MXSA 5GLCA 5D3OA 2YKHA 1UWNX 1SKOA 2VJWA 4ZRRA 3KX0X 3BEBA 2Y2NA 4FUWA 3UB6A 3IF5A 3SZTA 1NWZA 3JVVA 3V3RA 3S7NA 4X1LA 1XFQA 2W1RA 2GX5A 5FI7A 3O86A 2VEAA 1ZG6A 4ESPA 1N9OA 3E2LA 5AVFA 4C3QA 3MKEA 4ZJ2A 1YLYA 5HX9A 3KO6A 1YM1A 1DJCA 5GHYA 3OCLA 1K56D 1YT4A 3E2KA 2VV7A 3IX8A 5EM0A 1C3BA 2O9AA 3CAXA 2W3FA 2WADA 3GVBA 2XA7M 2MJ6A 4ZTKA 3FKWA 4P87A 2OWJA 1O07A 5IU1A 2Y2KA 3C5AA 5I94A 2EX9A 4PAUA 1WYCA 4X56A 3G32A 5FATA 3G30A 5FEFA 1KOUA 1DP8A 2XF3A 4O7DA 1X0OA 1LSXA 5FQKA 3GSGA 5A91A 4X69A 1HD8A 4LCMA 4CLCB 1K54C 3HUOA 3UB5P 4NXGA 1FIKA 4WMCD 5FQ9A 3MSHA 4HI4A 3ITBA 2Z2LB 1CEFA 1ES4A 2QHKA 3TE8A 3A0RA 1GCEA 3NIAA 2V1ZA 1P97A 4DMZA 4HJ4A 4EERA 4Y0TA 3NECA 3RXWA 5JYPA 3E4QA 1QMFA 1FR1A 3G34A 4JXSA 3KSFA 5AQBA 1T19A 2Y79A 3G4PA 1PNEA 3CUEA 2JHEA 4I3IA 3ZHHA 5G18A 4F94A 2R9XA 1Y54A 5G4ZA 3UE1A 1XGJA 1IYOA 3LR5A 3ULFA 3T4LA 3LIBA 2JKFA 3OZHA 4I3AA 1S1YA 1XA7A 3A0VA 3DTKA 4CLCA 3E4OA 4BJPA 4N9LA 5AQAA 3V50A 3MFDA 1OJGA 3IF6C 4RQ9A 4G3VA 1BLHA 3E98A 3HJKA 4DF6A 4KZBA 4MBFA 3U4LP 1BYWA 5DTKA 4E3NA 1ES3A 2BLSA 2HF6A 1FSWA 3BLSA 1L0FA 2QWSA 1KGFA 2OLVA 5A93A 4Q0HA 4NXEA 2OV5A 4BBTA 1ES5A 3C7VA 4WUJA 4B93A 4KZ6A 2V1BA 5I5LA 2EX2A 3A3IA 1TDLA 3HREA 4LRXC 5GLAA 3UPOA 1BLSA 4Q0JA 3QP5A 2VKSA 4I38A 4PM8A 5CGWA 4BL2A 2O9CA 2W1TB 3RXXA 3IBRA 4HNBA 3CJMA 3LCEA 3PYPA 1MZUA 2HDRA 4AFIA 3CG5A 1HLUP 1E4DA 1TDGA 4OPZA 5MC7A 3SS3A 5M1AA 3S7PA 1TVFA 1H8ZA 1BLPA 4R3BA 2L4RA 3BM6A 5CHMA 2Y2QA 4MNRA 3PBSA 1AWIA 4MDZA 3G2YA 1YLJA 2JKGA 1J9MA 3TSGA 1VETB 2ZLYA 4B4ZA 2HDQA 2WZXA 5HL1A 2I9VA 5TFQA 4EBLA 3BFGA 2XFSA 3HBRA 4MLLA 5EFWA 1GSVA 2QZ6A 2PYRA 2XD1A 1E3UD 2J7VA 4PKYA 4FTXA 1BLCA 1NYYA 4FH2A 4PM5A 3MZDA 3VP1A 1KVMA 2P08A 2ZMFA 3OPLA 5A92A 1VHMA 5EOOA 2XD5A 3WRTA 4D60A 2H28A 4LLOB 4FOFA 5EVIC 4Z1WA 3S7OA 1Z6FA 2WKQA 4UA9A 2P74A 4WEJA 1JWZA 4GHIB 2ZMVA 4K0XA 2HP9A 3MF0A 5L10A 5AVEA 5CGXA 4DE3A 5KSHA 1VETA 2XLNA 4WBGA 1YMSA 4GB7A 4FH4A 4MCWA 3UE6A 4UQIS 3A3EA 2PDRA 3Q07A 2EX6A 2PBDP 3PTEA 5EVLA 1PW8A 4JLFA 3FPWA 4U0TA 3UB9A 3KYQA 3MZEA 3SOIA 5G4YA 1N4OA 5EV0A 2W3DA 2Y2HA 4HBTA 1K4EA 4GDBA 4ZJ3A 5GLBA 4R4RA 2J9OA 3F1PB 4YWZA 4IVIA 2VV8A 4GHIA 5E2FA 1YKDA 1G68A 1G6OA 1NLZA 4L9GA 1H8MA 5FI6A 3D9YA 4NK3A 3NC8A 2R78A 1CQAA 1OT6A 3WS2A 4R38A 4WZ5A 4KZAA 1KGGA 4PKYG 1RGZA 2JN7A 2I72A 1XJ6A 4O8GA 4R1GA 3ZQ5A 4GD6A 5GHZA 1L2SA 4PM9A 4NXFA 3SW1A 4U0XA 3PXPA 3EEAA 4I5SA 2X71A 1K0KA 5FQJA 4ZBEA 3ZVTA 1JTDA 1SDEA 4EEPA 4OOYA 1WE4A 3UB7A 1FSYA 1PYYA 1Q2QA 3F1PA 1IYQA 1ESUA 4OH0A 1XA1A 4JF5A 4Y0UA 5HDCA 3F1NB 3VP0A 1M6KA 5HAPA 3AGFA 2J8YA 3T4OA 1YAXA 4FD8A 3C7UA 1XJ2A 3W2ZA 1H8YA 1S66L 4ETZA 4E3OA 5HWTA 4DKIA 4HHDA 1OTAA 2L0WA 1K25A 3DTMA 3IH8A 4N1XA 4OONA 3UPPA 4GLQA 5E2EA 5TJJA 3WS0A 3V67A 2VGJA 4RYEA 4KG2A 3SS5A 3MJQA 3EOIA 2QKPA 3HUMA 1IOUA 2G2UA 4GS9B 1JTGA 2ZQAA 1CF0A 3LFVA 3EQUA 4WLAA 3D3OA 2ZL1A 5FAQA 2WAFA 3VFHA 1XX2A 1Z09A 4HH2A 1FOFA 3UN7A 3F1NA 1F98A 4ME4A 2KLIA 4EBPA 4WZ4A 1JWVA 1H3QA 5KIZA 1PW1A 5FQQA 3GECA 1O7EA 3SH9A 1K38A 4R6LA 1NXYA 2NUTC 3FWLA 5L09A 4UHUA 3DBAA 4MBHA 2ZMAA 4S2KA 1EWZA 3WRZA 4EWFA 4CLCD 2XEPA 5EECA 3VOZA 1W63Q 4MEZA 1P9RA 2BG1A 4GS9A 3MMHA 1OT9A 2ZM0A 1J3WA 4EESA 3TRCA 4F3LB 2OAP1 4LV3A 5CEDA 1S4RA 1OTEA 3O87A 1W8YA 3CPTB 5CTMA 4EEUA 5EVID 3VSLA 2Y8HA 4JKTA 3ICYA 3IXHA 2DCFA 1OMEA 3S22A 4E6WA 3AGEA 3BY9A 3EQVA 4OQ0A 2GZAA 2VK3A 1GHPA 3BJNA 5DFYA 2J9PA 1U60A 4KENB 4N1HA 4DE2A 2HDSA 3HLWA 2J3TC 3HLGA 3UE0A 4BMWA 3B47A 4IUKA 3ZG9B 2VA0A 1ODVA 1OTIA 1A0KA 2V1AA 1YQSA 5CGSA 4IBXA 3JYIA 3ZG0A 1QMEA 5KMWA 4CJNA 1XP4A 2PYPA 1AXBA 4M3KA 5DKLA 2PAVP 3QP6A 1K57A 3IH9A 4ARZB 4OQHA 1PI4A 3C2WA 3HUNA 5HDDA 2PD7A 1DY6A 4F3LA 1YLTA 2VX8A 4ID4A 1NLYA 5HL6A 1YMXA 4E04A 5K5BA 3CPTA 3V5MA 4CQHA 5L8MA 1G6AA 1K55C 3UB8A 4OPRA 4NETA 3VE4A 2Z6DA 3L7HA 4HBUA 1YLWA 3LIFA 4OPQA 3HLEA 3T50A 1ZHHB 3P09A 5DKKA 4LV2A 5J3WA 4YNRA 2JCHA 3T1SA 4EUZA 1FCNA 3G6OA 2GDNA 2A2LA 2W0NA 2ZQDA 2ZC3B 4DRTA 4DE0A 3HLBA 2B5RA 1GA9A 4WEKA 5HFOA 4P0MA 4HH3A 3LR4A 4ARZA 5DF9A 2EXAA 5L2FA 4OP5A 4JXWA 3M2JA 4H6JB 3BFDA 1FQGA 2VGKA 4P6ZS 2Y55A 3UMDA 5F68A 3OC2A 2WGVA 2Y2PA 4KUKA 3QP4A 2XK1A 4YOFA 5FAPA 3EEHA 3GQZA 4NEED 3VMAA 4WN5A 5IS1A 4R3JA 4E3KA 1DJBA 2DMWA 3HLCA 2HP5A 5EE8A 4ZJ1A 3NDEA 5DTSA 2H10A 3IWOA 5AQ9A 3VE3A 4FCFA 3P98A 1OPXA 3C4OA 1CK3A 3VOYA 1F9IA 2Y4AA 5HWWA 1HZOA 1MBLA 3M6HA 1NY0A 3K3CA 2JKTI 4H6JA 4K91A 4IHQA 3C4PA 1PZPA 3BRMA 2ZD8A 2P04A
chains in the Genus database with same CATH topology
4Y2FA 5TBMB 4JGOA 2K7SA 4HP4A 4MCWA 2A24A 3LIDA 3BW6A 4KUOA 4NKPA 3FPVA 3T4SA 3UE6A 4UQIM 4UQIS 2O9BA 2D02A 2BASA 4MMNA 2PDRA 5F5YA 1P9WA 5CX7A 2OWHA 3PBQA 4MN6A 4WL9A 3HCYA 5AJGA 3FPWA 3C8CA 1S1ZA 2QJ7A 3IS2B 5IT5A 3UB9A 3KYQA 5HPIA 3VOLA 5HWVA 3U2AA 3C30A 2W3HA 3LIAA 5G4YA 4NXBA 5J7EA 3MFXA 2W3DA 3LIEA 1S67L 3F1PB 4YWZA 2VV8A 3R4KA 3K3DA 3PBOA 1OTBA 4GHIA 4DJ3A 2D01A 1WA9A 3K2NA 2GJ3A 3D72A 1YKDA 3VV4A 3B33A 1G6OA 1GSXA 1NLZA 4L9GA 4Q0IA 4EW7A 2OOLA 3PBTA 2K31A 1H8MA 3UE3A 3CLOA 4JGQA 4KQDA 5F69A 3H82B 3OLOA 3CUEC 2QJ5A 5TBMA 4B9OA 2R78A 5HD5A 2HJEA 4HOIA 1OT6A 4HP9A 1JNUA 3T4KA 1DRMA 4R38A 4G3KA 3EWKA 2M7UA 3LYXA 3LR0A 4PKYG 2JN7A 4M4XA 1S4SA 4BBVA 4KQOA 1XJ6A 4II7A 3CI6A 4O8GA 2HGVA 2M1CA 5HZHA 3S7QA 3H7WB 3ZQ5A 1D06A 4CLCC 2O0YA 3BY8A 3E0YA 4NXFA 3IS2A 4ETXA 3SW1A 3MQOA 3NOPC 2VZWA 2WKPA 3PXPA 5F6AA 3EEAA 4I5SA 3HJIA 1ZTUA 2J3TD 3PBNA 1STZA 3KSHA 1OJ5A 3T4JA 1IFQA 4EEPA 2O99A 3RFBA 3UB7A 2YKHA 2PHYA 3FG8A 3F1PA 2GNXA 1UWNX 4HIAA 4LRZE 2VJWA 2HV1A 4ZRRA 3KX0X 2EA9A 1D7EA 5HDCA 3F1NB 1TD5A 2QYBA 3MR0A 2V0UA 2J80A 5DFXA 3UB6A 1V9YA 3T4OA 1NWZA 3H82A 3JVVA 4QPRA 1YAXA 3S7NA 4UEYA 1XFQA 1XJ2A 5LBRA 1MC0A 1YSQA 3W2ZA 2W1RA 2GX5A 1LT0A 1S66L 4ETZA 5HWTA 4Y3IA 2VEAA 3MQQA 4HHDA 5FL3A 1OTAA 4IUHA 2L0WA 1N9OA 3OOVA 2W3GA 2JKTM 1UWPX 2ZBBA 4GLQA 5TJJA 3TW8A 5AVFA 3EGDC 3BQ8A 1G28A 3PBRA 3C38A 4Y5FA 3H7WA 2FZ0A 3V67A 3KO6A 2JKRI 3RH8B 4XT2B 4DN0A 3MJQA 3OCLA 2V0WA 3EOIA 2QKPA 4WF0A 2IA2A 4I3JA 1IOUA 3GDIA 2P7JA 2VV7A 3ZYTA 4GS9B 2O9AA 4LPZA 3CAXA 2W3FA 3LFVA 3EQUA 4MN5A 3OBFA 4WLAA 1DP6A 3D3OA 2XA7M 2XA7S 2MJ6A 3BWLA 2OWJA 5HPFA 5IU1A 4R3AA 4HH2A 3F1NA 1F98A 4ME4A 4EUVA 2KLIA 3CITA 4PAUA 2INWA 1H3QA 5KIZA 3MQ0A 4HJ6A 4MN7A 3GECA 1EW0A 2J3WA 4R6LA 5A8BA 1KOUA 3LR3A 4K08A 4EU0A 1DP8A 2NUTC 1X0OA 3DBAA 1LSXA 4JGPA 3A0SA 3LUQA 4CLCB 2XRNA 2CMNA 4XT2A 4L9FA 4NXGA 2FH5A 4CLCD 3F1OB 4HI4A 4OOLA 1W63Q 4WELA 2VGLS 3TJZC 2QHKA 1P9RA 4GS9A 3TE8A 3MMHA 1OT9A 3A0RA 4EESA 3TRCA 1P97A 4F3LB 2OAP1 4HJ4A 4DMZA 2VLGA 4EERA 2G7UA 1S4RA 3NOTC 1OTEA 2KX6A 1LSVA 4HQAA 3R7WB 2PD8A 3E4QA 1XJ4A 4EEUA 4L9EA 2ZOIA 2LB9A 3KSFA 1T19A 3P7NA 2Y79A 2Y8HA 3H9WA 3ICYA 1T1BA 4I39A 2PR5A 1UGUA 3BY9A 3EQVA 3EGXC 3CUEA 2JHEA 4I3IA 4BWIA 4GW9A 3LI9A 2GZAA 5C5KA 3BJNA 3P01A 3PR6A 5DFYA 5G4ZA 1OTDA 1XJ3A 2W1TA 2B18A 3LR5A 4PHTA 3ULFA 3T4LA 2W27A 3LIBA 4I3AA 2J3TC 1S1YA 4BMWA 3A0VA 3B47A 4EETB 4IUKA 2VA0A 1ODVA 1OTIA 2XSSA 2V1AA 5DJUA 4BBUA 4CLCA 3E4OA 4BJPA 1TS8A 1T1CA 1TS7A 1LSWA 3F1OA 1OJGA 1TF1A 4HJ3A 2PYPA 1MKMA 5HD3A 3UMEA 5DKLA 4RQ9A 4EQ1A 5HDSA 4G3VA 3E98A 3HJKA 4ARZB 2W3EA 1BYWA 3C2WA 5HDDA 2PD7A 4F3LA 2YKFA 2HF6A 4R70A 2VX8A 1T1AA 2QWSA 1NLYA 2Z6CA 5HL6A 2JKRM 3R7WA 4O0PA 4E04A 3NHQA 5K5BA 4Q0HA 4NXEA 4EXOA 4BBTA 3IBJA 3NOUC 1YSPA 4WUJA 4CQHA 4B93A 3RTYA 5L8MA 2V1BA 3CWFA 1TS6A 3UB8A 5I5LA 4IJGA 1GSWA 1LL8A 3BQAA 3VE4A 2Z6DA 1N9LA 3LIFA 4LRXC 1P0ZA 4Q0JA 2HJ9C 3T50A 2WKRA 2VKSA 4I38A 1ZHHB 4FSFA 2VV6A 5DKKA 5DJTA 2O9CA 2W1TB 5J3WA 3IBRA 4HNBA 4YNRA 3PYPA 3E4PA 1MZUA 4AFIA 2LB5A 5HSQA 3G6OA 2A2LA 2KDKA 2W0NA 2ZOHA 1VB6A 5MC7A 4WEKA 3NJAA 4DJ2A 3S7PA 3PHYA 2NUPC 4HH3A 1V9ZA 3LICA 3LR4A 4ARZA 2K2NA 2L4RA 3MXQA 5DF9A 3KSIA 3PBSA 2VGLM 4MDZA 4H6JB 2EWVA 3KYZA 4P6ZM 2PT7A 4P6ZS 4CLCE 4JGRA 4O01A 3UMDA 2V9AA 5F68A 2L1MA 4GCZA 2A24B 2I9VA 1TS0A 3OC2A 5J4EA 4KUKA 4YOFA 3EEHA 3KSGA 5EFWA 1GSVA 4NEED 2B02A 4WN5A 4G3WA 2PYRA 5IS1A 3JVUA 4PKYA 1DP9A 2DMWA 1N9NA 2KOIA 4HY8A 4GJ4A 2EWWA 2P08A 2ZMFA 1VHMA 1XFNA 3FC7A 3VE3A 1T18A 3O5YA 3OCNA 1OPXA 2PR6A 2H28A 4LLOB 4LRYC 4FOFA 1F9IA 4Z1WA 3T4QA 1W63M 4OOMA 3S7OA 5HWWA 4L0LA 2OAQ1 2WKQA 3T4TA 4WEJA 4GHIB 2ZMVA 1NRJA 3K3CA 2JKTI 4H6JA 3MF0A 2XROA 3B42A 5AVEA 1Y28A 4IHQA 1F5MA 5KSHA 3LI8A 2M7VA 2P04A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5TBM B;  4JGO A;  2K7S A;  4HP4 A;  2A24 A;  3LID A;  4KUO A;  3UE6 A;  2D02 A;  2BAS A;  2PDR A;  5F5Y A;  2OWH A;  4MN6 A;  4WL9 A;  3C8C A;  1S1Z A;  2QJ7 A;  3IS2 B;  3UB9 A;  3VOL A;  5HWV A;  3LIA A;  5G4Y A;  4NXB A;  5J7E A;  3MFX A;  3LIE A;  1S67 L;  3F1P B;  4YWZ A;  2VV8 A;  3K3D A;  4GHI A;  1OTB A;  4DJ3 A;  2D01 A;  1WA9 A;  2GJ3 A;  3D72 A;  3B33 A;  1GSX A;  4L9G A;  4EW7 A;  2OOL A;  3CLO A;  4JGQ A;  4KQD A;  5F69 A;  3H82 B;  3OLO A;  2QJ5 A;  5TBM A;  4B9O A;  2R78 A;  5HD5 A;  4HOI A;  1OT6 A;  4HP9 A;  1JNU A;  1DRM A;  4R38 A;  3EWK A;  3LYX A;  4PKY G;  2JN7 A;  4M4X A;  1S4S A;  4BBV A;  1XJ6 A;  2M1C A;  5HZH A;  3H7W B;  3ZQ5 A;  1D06 A;  3BY8 A;  4NXF A;  3IS2 A;  3SW1 A;  3MQO A;  3NOP C;  2WKP A;  5F6A A;  4I5S A;  3HJI A;  1OJ5 A;  4EEP A;  3UB7 A;  2YKH A;  2PHY A;  3FG8 A;  3F1P A;  1UWN X;  4HIA A;  4LRZ E;  2HV1 A;  3KX0 X;  2EA9 A;  1D7E A;  5HDC A;  3F1N B;  3MR0 A;  2V0U A;  2J80 A;  3UB6 A;  1V9Y A;  1NWZ A;  3H82 A;  1XFQ A;  1XJ2 A;  1LT0 A;  1S66 L;  5HWT A;  2VEA A;  3MQQ A;  4HHD A;  1OTA A;  2L0W A;  1N9O A;  2ZBB A;  1UWP X;  5AVF A;  1G28 A;  3H7W A;  3RH8 B;  4XT2 B;  3MJQ A;  2V0W A;  2QKP A;  4WF0 A;  4I3J A;  3GDI A;  2P7J A;  2VV7 A;  4GS9 B;  4LPZ A;  3CAX A;  4MN5 A;  4WLA A;  1DP6 A;  3BWL A;  2OWJ A;  5IU1 A;  4R3A A;  4HH2 A;  3F1N A;  1F98 A;  2INW A;  5KIZ A;  4HJ6 A;  3GEC A;  1EW0 A;  4R6L A;  5A8B A;  1KOU A;  4K08 A;  1DP8 A;  1X0O A;  1LSX A;  4JGP A;  3A0S A;  3LUQ A;  2CMN A;  4XT2 A;  4L9F A;  4NXG A;  3F1O B;  4HI4 A;  2QHK A;  4GS9 A;  1OT9 A;  3A0R A;  4EES A;  1P97 A;  4F3L B;  4HJ4 A;  2VLG A;  4EER A;  3NOT C;  1S4R A;  1OTE A;  2KX6 A;  1LSV A;  4HQA A;  2PD8 A;  3E4Q A;  1XJ4 A;  4EEU A;  4L9E A;  2ZOI A;  1T19 A;  3P7N A;  3H9W A;  3ICY A;  1T1B A;  4I39 A;  2PR5 A;  1UGU A;  3BY9 A;  2JHE A;  4I3I A;  4GW9 A;  3LI9 A;  5G4Z A;  1OTD A;  1XJ3 A;  3ULF A;  2W27 A;  3LIB A;  4I3A A;  1S1Y A;  3A0V A;  4EET B;  1ODV A;  1OTI A;  4BBU A;  2V1A A;  5DJU A;  3E4O A;  1TS8 A;  1T1C A;  1TS7 A;  1LSW A;  3F1O A;  1OJG A;  4HJ3 A;  2PYP A;  5HD3 A;  3UME A;  5DKL A;  4RQ9 A;  4EQ1 A;  5HDS A;  3HJK A;  1BYW A;  3C2W A;  5HDD A;  2PD7 A;  4F3L A;  2YKF A;  4R70 A;  1T1A A;  2QWS A;  2Z6C A;  4E04 A;  3NHQ A;  4NXE A;  4EXO A;  4BBT A;  3NOU C;  4WUJ A;  3RTY A;  2V1B A;  3CWF A;  1TS6 A;  3UB8 A;  5I5L A;  1GSW A;  1LL8 A;  3VE4 A;  2Z6D A;  1N9L A;  4LRX C;  3LIF A;  1P0Z A;  3T50 A;  2WKR A;  4I38 A;  2VV6 A;  5DKK A;  5DJT A;  5J3W A;  3IBR A;  4HNB A;  3PYP A;  3E4P A;  1MZU A;  5HSQ A;  3G6O A;  2KDK A;  2W0N A;  2ZOH A;  1VB6 A;  4DJ2 A;  3NJA A;  3PHY A;  4HH3 A;  1V9Z A;  3LIC A;  2L4R A;  3MXQ A;  4H6J B;  4JGR A;  3UMD A;  2V9A A;  5F68 A;  2L1M A;  4GCZ A;  2A24 B;  2I9V A;  1TS0 A;  5J4E A;  4KUK A;  3EEH A;  5EFW A;  1GSV A;  2B02 A;  4WN5 A;  2PYR A;  5IS1 A;  4PKY A;  1DP9 A;  1N9N A;  4HY8 A;  1XFN A;  3FC7 A;  3VE3 A;  1T18 A;  2PR6 A;  2H28 A;  4LLO B;  4LRY C;  1F9I A;  5HWW A;  2WKQ A;  4GHI B;  3K3C A;  4H6J A;  5AVE A;  1Y28 A;  3LI8 A; 
#chains in the Genus database with same CATH topology
 4HP4 A;  3LID A;  3IWI A;  4KUO A;  2XFT A;  3T4S A;  4E6X A;  3IHA A;  3SS4 A;  4KQQ A;  2D02 A;  2BAS A;  2XGN A;  4N9K A;  5F5Y A;  3SH8 A;  1RGY A;  2FFF B;  4CPK A;  1IKG A;  5CX7 A;  2OWH A;  4MN6 A;  3HCY A;  1PWD A;  2V2F F;  3VOL A;  3Q7V B;  3LIA A;  3BYD A;  2H0T A;  2V8C A;  1S67 L;  1N9B A;  3M6B A;  3R4K A;  3K3D A;  3PBO A;  1OTB A;  2D01 A;  1WA9 A;  3K2N A;  2GJ3 A;  3IX4 A;  3SH7 A;  1GSX A;  2OOL A;  4GD8 A;  3PBT A;  3VSK A;  2K31 A;  3UE3 A;  3CLO A;  3H82 B;  3N7W A;  3CUE C;  2QJ5 A;  1CI8 A;  4X6T A;  1G5U A;  2HJE A;  4HOI A;  4HP9 A;  4G3K A;  2HPB A;  2M7U A;  1FCO A;  1M40 A;  4M4X A;  3T1X A;  2EXB A;  1S4S A;  4KQO A;  4QHC A;  5FDS A;  3JPU A;  2HGV A;  4PM6 A;  3S7Q A;  3H7W B;  4CLC C;  3MS6 A;  3BY8 A;  3E0Y A;  1NZO A;  3W4O A;  4ETX A;  3Q7V A;  5HAR A;  3MQO A;  2XQZ A;  3FZC A;  2VZW A;  5FQM A;  3UDX A;  4E3L A;  2IWC A;  2J3T D;  4QY6 A;  5GHX A;  1STZ A;  1OJ5 A;  2DRW A;  1LL9 A;  2PHY A;  3GMW A;  4KZ4 A;  4S2I A;  1VQQ A;  3NBL A;  2WUQ A;  4U3T A;  1IEM A;  2H0Y A;  2EA9 A;  2ZJ9 A;  4RX3 A;  1TD5 A;  2V0U A;  3DWZ A;  5DFX A;  3H82 A;  3M2K A;  4UEY A;  3FKV A;  4B4X A;  1KDW A;  5F1F A;  4WMC A;  3OOV A;  2ZBB A;  2JKT M;  1UWP X;  3QNC A;  1BUL A;  1CJF A;  3BQ8 A;  3PBR A;  4Y5F A;  5FA7 A;  3H7W A;  2FZ0 A;  1WYB A;  2JKR I;  3PAE A;  3RH8 B;  5FAS A;  2V0W A;  1I2S A;  4WF0 A;  3UNW A;  2IA2 A;  1HTZ A;  3V39 A;  2Y2L A;  3GDI A;  4JBF A;  2IWD A;  2P7J A;  2WGW B;  3ITA A;  2E8I A;  1LL5 A;  3LY3 A;  1JVJ A;  4JF4 A;  1JWP A;  4MN5 A;  4JF6 A;  2XA7 S;  3BWL A;  1W79 A;  1F2K A;  4IBR A;  3QP2 A;  5HAQ A;  3I7J A;  2H5S A;  3NY4 A;  1L0G A;  4R4S A;  3MQ0 A;  4MN7 A;  1EW0 A;  5E2G A;  3LR3 A;  4K08 A;  4EU0 A;  2Z2M B;  2ZQ8 A;  4JGP A;  3WS1 A;  3A0S A;  3LUQ A;  2XRN A;  1BZA A;  4C6Y A;  3IWQ A;  3T12 B;  4L9F A;  2FH5 A;  3ISG A;  4S2J A;  4KZ8 A;  4OOL A;  1IYS A;  1LHY A;  1MWT A;  1PFL A;  1XXM A;  2WGW A;  3W8K A;  3MXR A;  4XUZ A;  2VLG A;  3D4F A;  4OLD A;  3NOT C;  5F82 A;  2KX6 A;  4HQA A;  4ZDX A;  2PD8 A;  4N92 A;  1XJ4 A;  4L9E A;  2ZOI A;  1FIL A;  4A5R A;  1NZU A;  4LCL A;  4GDN A;  1VM1 A;  4X53 A;  3H9W A;  1T1B A;  2PR5 A;  2ZL1 B;  1UGU A;  4BWI A;  4KZ3 A;  3LI9 A;  1HVB A;  3P01 A;  4OQI A;  3MKF A;  3FV7 A;  1XJ3 A;  4S2L A;  2W27 A;  4DXB A;  4S2P A;  1ZG4 A;  4D2O A;  4KZ9 A;  4LV1 A;  2XSS A;  4BBU A;  4K0W A;  5IHV A;  1T1C A;  1LSW A;  1ERM A;  4HJ3 A;  1MKM A;  4S2N A;  5HD3 A;  3UME A;  4EQ1 A;  2HZ5 A;  1PZO A;  1GHI A;  3BEC A;  2A49 A;  3NI9 A;  2FFY A;  4E3J A;  5EVE A;  3UDI A;  4EBN A;  2JKR M;  4O0P A;  3IBJ A;  5HW3 A;  3HVF A;  2V8F A;  3DWK A;  2PU2 A;  3CWF A;  4WZ5 C;  1TS6 A;  5FI2 A;  2Q0O A;  3OPR A;  4BEN A;  3N8L A;  1LL8 A;  3BQA A;  1N9L A;  1P0Z A;  2HJ9 C;  3IT9 A;  3IQA A;  2WKR A;  4FSF A;  4KZ5 A;  5GL9 A;  3OPH A;  2WAE A;  3ZVW A;  3E4P A;  5HSQ A;  1LLB A;  1TEM A;  2BTF P;  1VB6 A;  4PMA A;  4UA6 A;  4DJ2 A;  3NJA A;  2R9W A;  1ONG A;  3PHY A;  3ZNT A;  4BQM A;  3ZFZ A;  1V9Z A;  3LIC A;  4LEN A;  2PU4 A;  3MXQ A;  3FYZ A;  2VGL M;  2PBY A;  2EWV A;  3KYZ A;  2PT7 A;  4CLC E;  4JGR A;  4O01 A;  1MPL A;  1SZV A;  2V9A A;  4GCZ A;  2A24 B;  4Z9Q A;  1TS0 A;  2WK0 A;  4GZB A;  3KSG A;  3W4Q A;  4UA7 A;  2B02 A;  4G3W A;  3LEQ A;  1PWG A;  5DF8 A;  4S2M A;  1MWR A;  3UDF A;  1DP9 A;  5FSR A;  4KQR A;  5CER A;  1W7F A;  4HY8 A;  4GJ4 A;  4R23 A;  2RL3 A;  1XFN A;  3O5Y A;  1K54 A;  2PR6 A;  4R0Q A;  3IF6 B;  3DAV A;  1W63 M;  4OOM A;  3VP3 A;  2ZQ9 A;  4L0L A;  4GKU A;  1SDN A;  3T4T A;  3AGD A;  5F83 A;  1NRJ A;  4JXG A;  3IXG A;  1Y28 A;  3G2Z A;  3LI8 A;  2M7V A;  1XGI A;  2JC7 A;  4Y2F A;  5TBM B;  2K7S A;  2A24 A;  2ZM2 A;  3BW6 A;  4Y13 A;  4NKP A;  3FPV A;  2PRF A;  2UWX A;  4RA7 A;  4UQI M;  1GHM A;  2WKE A;  3A3J A;  3O88 A;  5EOE A;  4E3M A;  5M18 A;  5L07 A;  5BOH A;  3PBQ A;  5AJG A;  3Q81 A;  4BL3 A;  1S1Z A;  3IS2 B;  5IT5 A;  5HWV A;  4B88 A;  3U2A A;  1K4F A;  5EM1 A;  4QD4 A;  5DF7 A;  4X68 A;  3N8S A;  2Y91 A;  3IF6 A;  4DDS A;  3LIE A;  5GLD A;  1ZKJ A;  3BFC A;  2E8J A;  1ALQ A;  2QMI A;  2Y2J A;  4IED A;  1RCJ A;  3QP1 A;  2IWB A;  3UY6 A;  3VV4 A;  3B33 A;  4Q0I A;  3O3V A;  4EW7 A;  4JGQ A;  3OLO A;  1KE3 A;  5TBM A;  4QWO A;  4B9O A;  2EFU A;  1JNU A;  2JBF A;  3OPP A;  1W5D A;  4Y17 A;  2XDM A;  3HL9 A;  4HES A;  3CI6 A;  5HZH A;  2XH9 A;  5TR7 A;  3HLF A;  3IS2 A;  1LI0 A;  5CHJ A;  1BTL A;  3NOP C;  2WKH A;  3Q7Z A;  5F6A A;  3HJI A;  3DTE A;  5KSC A;  1K57 C;  1ZTU A;  5EVI B;  5CHU A;  3T4J A;  1IFQ A;  2CC1 A;  3LGO A;  5F1G A;  1MWU A;  2O99 A;  5CTN A;  1FR6 A;  3RFB A;  3FG8 A;  2GNX A;  5U47 A;  1ERO A;  4HIA A;  4LRZ E;  2HV1 A;  1S6R A;  1D7E A;  1MY8 A;  4Y0O A;  2QYB A;  3MR0 A;  2J80 A;  3UPN A;  1V9Y A;  2AVX A;  4QPR A;  2Y59 A;  3GRJ A;  5DTT A;  5CXW A;  1L0E A;  5LBR A;  1MC0 A;  1YSQ A;  4E3I A;  1LT0 A;  4Y3I A;  3MQQ A;  5FL3 A;  4IUH A;  4QB8 A;  2W3G A;  3TW8 A;  5E43 A;  5FQI A;  3EGD C;  1G28 A;  3C38 A;  2Q9M A;  2EX8 A;  2WZZ A;  2ZM8 A;  4GOG A;  4XT2 B;  4LV0 A;  4DN0 A;  1ESI A;  3A3D A;  3WS5 A;  4I3J A;  1VEU B;  4S2O A;  3ZYT A;  5EVI A;  1BSG A;  4LPZ A;  3ZG8 B;  4EV4 A;  1KDS A;  1YPR A;  1SCW A;  1SKF A;  3OBF A;  1KVL A;  1PWC A;  1DP6 A;  1ES2 A;  3S4X A;  2ZC7 A;  5HPF A;  3GTC A;  4R3A A;  3QP8 A;  4EUV A;  1YLZ A;  3CIT A;  3T1Q B;  2C6W B;  1H5X A;  4LFU A;  2INW A;  2ZC5 B;  1BT5 A;  4HJ6 A;  3QNB A;  2J3W A;  4UAA A;  4QJG A;  5A8B A;  1NYM A;  5DVA A;  1K6R A;  3BFF A;  3V3S A;  1L0D A;  2CMN A;  4XT2 A;  1CI9 A;  4HEF A;  3F1O B;  1K56 A;  1XKZ A;  2OLU A;  2WYX A;  1VEU A;  4WEL A;  2VGL S;  2Y2I A;  3TJZ C;  5M19 A;  4DE1 A;  5E2H A;  1PI5 A;  3B3X A;  3TOI A;  1L3L A;  2G7U A;  4Y7P A;  1LSV A;  3R7W B;  4IVK A;  3LEZ A;  2LB9 A;  2WKI A;  3GV9 A;  1BUE A;  5EUA A;  4BLM A;  2X02 A;  3P7N A;  4I39 A;  3EGX C;  3RJU A;  2Y2G A;  4GW9 A;  3IXD A;  5C5K A;  3PR6 A;  1OTD A;  2W1T A;  3N4I A;  2HDU A;  2B18 A;  4PHT A;  4X25 A;  1RP5 A;  4DXC A;  4WM9 A;  4EET B;  1D1J A;  4XXR A;  5DJU A;  1TS8 A;  4XUX A;  1TS7 A;  3F1O A;  1TF1 A;  4RVA A;  3ZCZ A;  3DW0 A;  4P6B A;  3CMZ A;  5J8X A;  5HDS A;  2W3E A;  4Y15 A;  2RCX A;  4KZ7 A;  2ACG A;  1LI9 A;  4KG5 A;  2YKF A;  3N8R A;  4R70 A;  1IYP A;  1T1A A;  3MZF A;  4OPY A;  2UV0 E;  2Z6C A;  3R7W A;  3NHQ A;  1K6S A;  4EXO A;  3NOU C;  3ZGA B;  2EFX A;  1MWS A;  1YSP A;  4OVD A;  5EPH A;  1KE4 A;  3RTY A;  1KGE A;  1GA0 A;  2Q9N A;  4BD1 A;  4IJG A;  3BLM A;  1GSW A;  2ZQ7 A;  1Y4O A;  3WS4 A;  3PAG A;  3A3F A;  4RX2 A;  2VV6 A;  3CHW P;  5DJT A;  4ZAM A;  1FCM A;  2LB5 A;  4QU3 A;  2KDK A;  2ZOH A;  1XPB A;  1Q2P A;  3IX3 A;  3ZG5 A;  3LO7 A;  4X1M A;  4BD0 A;  2OSU A;  2NUP C;  2DNS A;  2K2N A;  3KSI A;  1NJ4 A;  1NRF A;  1ACF A;  4NG2 A;  5AQ7 A;  4DDY A;  4JXV A;  4P6Z M;  5FDH A;  3QHY A;  2L1M A;  5J4E A;  2XR0 A;  4YFM A;  4MBK A;  3Q82 A;  4GN2 A;  4KG6 A;  3JVU A;  4PPR A;  1N9N A;  3LY4 A;  3ZDJ A;  5A90 A;  1S0W A;  5JYO A;  3VFF A;  2KOI A;  5KZH A;  1ERQ A;  3TG9 A;  2EWW A;  4PM7 A;  5CEC A;  1PIO A;  4OLG A;  3FC7 A;  1T18 A;  3OCN A;  4YIN A;  4LRY C;  1IKI A;  1W8Q A;  2Y2M A;  4C75 A;  3T4Q A;  1CEG A;  4Q8I A;  1IEL A;  2OAQ 1;  4WYY A;  2XRO A;  3B42 A;  3W4P A;  3L9K A;  1F5M A;  1MXO A;  2G2W A;  4JGO A;  1KE0 A;  3NDG A;  2O9B A;  1E3U A;  2A3U A;  4MMN A;  1E25 A;  5CEB A;  2Y2O A;  1P9W A;  3UO9 A;  3VP4 A;  1ZC2 A;  4WL9 A;  2C5W B;  5FEG A;  3C8C A;  1PRQ A;  2HP6 A;  2QJ7 A;  1YLP A;  2X01 A;  5HPI A;  4OQG A;  3C30 A;  2W3H A;  2QPN A;  2P9V B;  3BFE A;  3NUL A;  4NXB A;  5HAI A;  5J7E A;  3MFX A;  1ONH A;  2V20 A;  4P85 A;  1DJA A;  4LGW A;  3ZNY A;  2JE5 A;  4DJ3 A;  3CZD A;  4QY5 A;  3IHB A;  1SKO B;  3D72 A;  4OKP A;  3WWX A;  1H0M A;  2WGI A;  5FAO A;  1I2W A;  3MBZ A;  4KQD A;  3GR2 A;  5F69 A;  4X55 A;  3S1Y A;  5HD5 A;  3T4K A;  1EI5 A;  1K55 A;  1DRM A;  5TGF A;  5CRF A;  3EWK A;  2ZQC A;  3Q1F A;  2B95 A;  3IXB A;  3LYX A;  3LR0 A;  3HLD A;  4JPM A;  4GNU A;  4BBV A;  1I5Q A;  4OP8 A;  4II7 A;  3NCK A;  1MKI A;  2M1C A;  3G31 A;  1D06 A;  2O0Y A;  2ZC4 B;  3KYE A;  3DTI A;  3T1R A;  3ZG7 B;  3VP2 A;  2WKP A;  4S2N C;  2P9V A;  4H8R A;  4EQI A;  3PBN A;  2ZC6 B;  3KSH A;  3N6I A;  3G35 A;  1SHV A;  3MXS A;  5GLC A;  5D3O A;  2YKH A;  1UWN X;  1SKO A;  2VJW A;  4ZRR A;  3KX0 X;  3BEB A;  2Y2N A;  4FUW A;  3UB6 A;  3IF5 A;  3SZT A;  1NWZ A;  3JVV A;  3V3R A;  3S7N A;  4X1L A;  1XFQ A;  2W1R A;  2GX5 A;  5FI7 A;  3O86 A;  2VEA A;  1ZG6 A;  4ESP A;  1N9O A;  3E2L A;  5AVF A;  4C3Q A;  3MKE A;  4ZJ2 A;  1YLY A;  5HX9 A;  3KO6 A;  1YM1 A;  1DJC A;  5GHY A;  3OCL A;  1K56 D;  1YT4 A;  3E2K A;  2VV7 A;  3IX8 A;  5EM0 A;  1C3B A;  2O9A A;  3CAX A;  2W3F A;  2WAD A;  3GVB A;  2XA7 M;  2MJ6 A;  4ZTK A;  3FKW A;  4P87 A;  2OWJ A;  1O07 A;  5IU1 A;  2Y2K A;  3C5A A;  5I94 A;  2EX9 A;  4PAU A;  1WYC A;  4X56 A;  3G32 A;  5FAT A;  3G30 A;  5FEF A;  1KOU A;  1DP8 A;  2XF3 A;  4O7D A;  1X0O A;  1LSX A;  5FQK A;  3GSG A;  5A91 A;  4X69 A;  1HD8 A;  4LCM A;  4CLC B;  1K54 C;  3HUO A;  3UB5 P;  4NXG A;  1FIK A;  4WMC D;  5FQ9 A;  3MSH A;  4HI4 A;  3ITB A;  2Z2L B;  1CEF A;  1ES4 A;  2QHK A;  3TE8 A;  3A0R A;  1GCE A;  3NIA A;  2V1Z A;  1P97 A;  4DMZ A;  4HJ4 A;  4EER A;  4Y0T A;  3NEC A;  3RXW A;  5JYP A;  3E4Q A;  1QMF A;  1FR1 A;  3G34 A;  4JXS A;  3KSF A;  5AQB A;  1T19 A;  2Y79 A;  3G4P A;  1PNE A;  3CUE A;  2JHE A;  4I3I A;  3ZHH A;  5G18 A;  4F94 A;  2R9X A;  1Y54 A;  5G4Z A;  3UE1 A;  1XGJ A;  1IYO A;  3LR5 A;  3ULF A;  3T4L A;  3LIB A;  2JKF A;  3OZH A;  4I3A A;  1S1Y A;  1XA7 A;  3A0V A;  3DTK A;  4CLC A;  3E4O A;  4BJP A;  4N9L A;  5AQA A;  3V50 A;  3MFD A;  1OJG A;  3IF6 C;  4RQ9 A;  4G3V A;  1BLH A;  3E98 A;  3HJK A;  4DF6 A;  4KZB A;  4MBF A;  3U4L P;  1BYW A;  5DTK A;  4E3N A;  1ES3 A;  2BLS A;  2HF6 A;  1FSW A;  3BLS A;  1L0F A;  2QWS A;  1KGF A;  2OLV A;  5A93 A;  4Q0H A;  4NXE A;  2OV5 A;  4BBT A;  1ES5 A;  3C7V A;  4WUJ A;  4B93 A;  4KZ6 A;  2V1B A;  5I5L A;  2EX2 A;  3A3I A;  1TDL A;  3HRE A;  4LRX C;  5GLA A;  3UPO A;  1BLS A;  4Q0J A;  3QP5 A;  2VKS A;  4I38 A;  4PM8 A;  5CGW A;  4BL2 A;  2O9C A;  2W1T B;  3RXX A;  3IBR A;  4HNB A;  3CJM A;  3LCE A;  3PYP A;  1MZU A;  2HDR A;  4AFI A;  3CG5 A;  1HLU P;  1E4D A;  1TDG A;  4OPZ A;  5MC7 A;  3SS3 A;  5M1A A;  3S7P A;  1TVF A;  1H8Z A;  1BLP A;  4R3B A;  2L4R A;  3BM6 A;  5CHM A;  2Y2Q A;  4MNR A;  3PBS A;  1AWI A;  4MDZ A;  3G2Y A;  1YLJ A;  2JKG A;  1J9M A;  3TSG A;  1VET B;  2ZLY A;  4B4Z A;  2HDQ A;  2WZX A;  5HL1 A;  2I9V A;  5TFQ A;  4EBL A;  3BFG A;  2XFS A;  3HBR A;  4MLL A;  5EFW A;  1GSV A;  2QZ6 A;  2PYR A;  2XD1 A;  1E3U D;  2J7V A;  4PKY A;  4FTX A;  1BLC A;  1NYY A;  4FH2 A;  4PM5 A;  3MZD A;  3VP1 A;  1KVM A;  2P08 A;  2ZMF A;  3OPL A;  5A92 A;  1VHM A;  5EOO A;  2XD5 A;  3WRT A;  4D60 A;  2H28 A;  4LLO B;  4FOF A;  5EVI C;  4Z1W A;  3S7O A;  1Z6F A;  2WKQ A;  4UA9 A;  2P74 A;  4WEJ A;  1JWZ A;  4GHI B;  2ZMV A;  4K0X A;  2HP9 A;  3MF0 A;  5L10 A;  5AVE A;  5CGX A;  4DE3 A;  5KSH A;  1VET A;  2XLN A;  4WBG A;  1YMS A;  4GB7 A;  4FH4 A;  4MCW A;  3UE6 A;  4UQI S;  3A3E A;  2PDR A;  3Q07 A;  2EX6 A;  2PBD P;  3PTE A;  5EVL A;  1PW8 A;  4JLF A;  3FPW A;  4U0T A;  3UB9 A;  3KYQ A;  3MZE A;  3SOI A;  5G4Y A;  1N4O A;  5EV0 A;  2W3D A;  2Y2H A;  4HBT A;  1K4E A;  4GDB A;  4ZJ3 A;  5GLB A;  4R4R A;  2J9O A;  3F1P B;  4YWZ A;  4IVI A;  2VV8 A;  4GHI A;  5E2F A;  1YKD A;  1G68 A;  1G6O A;  1NLZ A;  4L9G A;  1H8M A;  5FI6 A;  3D9Y A;  4NK3 A;  3NC8 A;  2R78 A;  1CQA A;  1OT6 A;  3WS2 A;  4R38 A;  4WZ5 A;  4KZA A;  1KGG A;  4PKY G;  1RGZ A;  2JN7 A;  2I72 A;  1XJ6 A;  4O8G A;  4R1G A;  3ZQ5 A;  4GD6 A;  5GHZ A;  1L2S A;  4PM9 A;  4NXF A;  3SW1 A;  4U0X A;  3PXP A;  3EEA A;  4I5S A;  2X71 A;  1K0K A;  5FQJ A;  4ZBE A;  3ZVT A;  1JTD A;  1SDE A;  4EEP A;  4OOY A;  1WE4 A;  3UB7 A;  1FSY A;  1PYY A;  1Q2Q A;  3F1P A;  1IYQ A;  1ESU A;  4OH0 A;  1XA1 A;  4JF5 A;  4Y0U A;  5HDC A;  3F1N B;  3VP0 A;  1M6K A;  5HAP A;  3AGF A;  2J8Y A;  3T4O A;  1YAX A;  4FD8 A;  3C7U A;  1XJ2 A;  3W2Z A;  1H8Y A;  1S66 L;  4ETZ A;  4E3O A;  5HWT A;  4DKI A;  4HHD A;  1OTA A;  2L0W A;  1K25 A;  3DTM A;  3IH8 A;  4N1X A;  4OON A;  3UPP A;  4GLQ A;  5E2E A;  5TJJ A;  3WS0 A;  3V67 A;  2VGJ A;  4RYE A;  4KG2 A;  3SS5 A;  3MJQ A;  3EOI A;  2QKP A;  3HUM A;  1IOU A;  2G2U A;  4GS9 B;  1JTG A;  2ZQA A;  1CF0 A;  3LFV A;  3EQU A;  4WLA A;  3D3O A;  2ZL1 A;  5FAQ A;  2WAF A;  3VFH A;  1XX2 A;  1Z09 A;  4HH2 A;  1FOF A;  3UN7 A;  3F1N A;  1F98 A;  4ME4 A;  2KLI A;  4EBP A;  4WZ4 A;  1JWV A;  1H3Q A;  5KIZ A;  1PW1 A;  5FQQ A;  3GEC A;  1O7E A;  3SH9 A;  1K38 A;  4R6L A;  1NXY A;  2NUT C;  3FWL A;  5L09 A;  4UHU A;  3DBA A;  4MBH A;  2ZMA A;  4S2K A;  1EWZ A;  3WRZ A;  4EWF A;  4CLC D;  2XEP A;  5EEC A;  3VOZ A;  1W63 Q;  4MEZ A;  1P9R A;  2BG1 A;  4GS9 A;  3MMH A;  1OT9 A;  2ZM0 A;  1J3W A;  4EES A;  3TRC A;  4F3L B;  2OAP 1;  4LV3 A;  5CED A;  1S4R A;  1OTE A;  3O87 A;  1W8Y A;  3CPT B;  5CTM A;  4EEU A;  5EVI D;  3VSL A;  2Y8H A;  4JKT A;  3ICY A;  3IXH A;  2DCF A;  1OME A;  3S22 A;  4E6W A;  3AGE A;  3BY9 A;  3EQV A;  4OQ0 A;  2GZA A;  2VK3 A;  1GHP A;  3BJN A;  5DFY A;  2J9P A;  1U60 A;  4KEN B;  4N1H A;  4DE2 A;  2HDS A;  3HLW A;  2J3T C;  3HLG A;  3UE0 A;  4BMW A;  3B47 A;  4IUK A;  3ZG9 B;  2VA0 A;  1ODV A;  1OTI A;  1A0K A;  2V1A A;  1YQS A;  5CGS A;  4IBX A;  3JYI A;  3ZG0 A;  1QME A;  5KMW A;  4CJN A;  1XP4 A;  2PYP A;  1AXB A;  4M3K A;  5DKL A;  2PAV P;  3QP6 A;  1K57 A;  3IH9 A;  4ARZ B;  4OQH A;  1PI4 A;  3C2W A;  3HUN A;  5HDD A;  2PD7 A;  1DY6 A;  4F3L A;  1YLT A;  2VX8 A;  4ID4 A;  1NLY A;  5HL6 A;  1YMX A;  4E04 A;  5K5B A;  3CPT A;  3V5M A;  4CQH A;  5L8M A;  1G6A A;  1K55 C;  3UB8 A;  4OPR A;  4NET A;  3VE4 A;  2Z6D A;  3L7H A;  4HBU A;  1YLW A;  3LIF A;  4OPQ A;  3HLE A;  3T50 A;  1ZHH B;  3P09 A;  5DKK A;  4LV2 A;  5J3W A;  4YNR A;  2JCH A;  3T1S A;  4EUZ A;  1FCN A;  3G6O A;  2GDN A;  2A2L A;  2W0N A;  2ZQD A;  2ZC3 B;  4DRT A;  4DE0 A;  3HLB A;  2B5R A;  1GA9 A;  4WEK A;  5HFO A;  4P0M A;  4HH3 A;  3LR4 A;  4ARZ A;  5DF9 A;  2EXA A;  5L2F A;  4OP5 A;  4JXW A;  3M2J A;  4H6J B;  3BFD A;  1FQG A;  2VGK A;  4P6Z S;  2Y55 A;  3UMD A;  5F68 A;  3OC2 A;  2WGV A;  2Y2P A;  4KUK A;  3QP4 A;  2XK1 A;  4YOF A;  5FAP A;  3EEH A;  3GQZ A;  4NEE D;  3VMA A;  4WN5 A;  5IS1 A;  4R3J A;  4E3K A;  1DJB A;  2DMW A;  3HLC A;  2HP5 A;  5EE8 A;  4ZJ1 A;  3NDE A;  5DTS A;  2H10 A;  3IWO A;  5AQ9 A;  3VE3 A;  4FCF A;  3P98 A;  1OPX A;  3C4O A;  1CK3 A;  3VOY A;  1F9I A;  2Y4A A;  5HWW A;  1HZO A;  1MBL A;  3M6H A;  1NY0 A;  3K3C A;  2JKT I;  4H6J A;  4K91 A;  4IHQ A;  3C4P A;  1PZP A;  3BRM A;  2ZD8 A;  2P04 A; 
#chains in the Genus database with same CATH homology
 4Y2F A;  5TBM B;  4JGO A;  2K7S A;  4HP4 A;  4MCW A;  2A24 A;  3LID A;  3BW6 A;  4KUO A;  4NKP A;  3FPV A;  3T4S A;  3UE6 A;  4UQI M;  4UQI S;  2O9B A;  2D02 A;  2BAS A;  4MMN A;  2PDR A;  5F5Y A;  1P9W A;  5CX7 A;  2OWH A;  3PBQ A;  4MN6 A;  4WL9 A;  3HCY A;  5AJG A;  3FPW A;  3C8C A;  1S1Z A;  2QJ7 A;  3IS2 B;  5IT5 A;  3UB9 A;  3KYQ A;  5HPI A;  3VOL A;  5HWV A;  3U2A A;  3C30 A;  2W3H A;  3LIA A;  5G4Y A;  4NXB A;  5J7E A;  3MFX A;  2W3D A;  3LIE A;  1S67 L;  3F1P B;  4YWZ A;  2VV8 A;  3R4K A;  3K3D A;  3PBO A;  1OTB A;  4GHI A;  4DJ3 A;  2D01 A;  1WA9 A;  3K2N A;  2GJ3 A;  3D72 A;  1YKD A;  3VV4 A;  3B33 A;  1G6O A;  1GSX A;  1NLZ A;  4L9G A;  4Q0I A;  4EW7 A;  2OOL A;  3PBT A;  2K31 A;  1H8M A;  3UE3 A;  3CLO A;  4JGQ A;  4KQD A;  5F69 A;  3H82 B;  3OLO A;  3CUE C;  2QJ5 A;  5TBM A;  4B9O A;  2R78 A;  5HD5 A;  2HJE A;  4HOI A;  1OT6 A;  4HP9 A;  1JNU A;  3T4K A;  1DRM A;  4R38 A;  4G3K A;  3EWK A;  2M7U A;  3LYX A;  3LR0 A;  4PKY G;  2JN7 A;  4M4X A;  1S4S A;  4BBV A;  4KQO A;  1XJ6 A;  4II7 A;  3CI6 A;  4O8G A;  2HGV A;  2M1C A;  5HZH A;  3S7Q A;  3H7W B;  3ZQ5 A;  1D06 A;  4CLC C;  2O0Y A;  3BY8 A;  3E0Y A;  4NXF A;  3IS2 A;  4ETX A;  3SW1 A;  3MQO A;  3NOP C;  2VZW A;  2WKP A;  3PXP A;  5F6A A;  3EEA A;  4I5S A;  3HJI A;  1ZTU A;  2J3T D;  3PBN A;  1STZ A;  3KSH A;  1OJ5 A;  3T4J A;  1IFQ A;  4EEP A;  2O99 A;  3RFB A;  3UB7 A;  2YKH A;  2PHY A;  3FG8 A;  3F1P A;  2GNX A;  1UWN X;  4HIA A;  4LRZ E;  2VJW A;  2HV1 A;  4ZRR A;  3KX0 X;  2EA9 A;  1D7E A;  5HDC A;  3F1N B;  1TD5 A;  2QYB A;  3MR0 A;  2V0U A;  2J80 A;  5DFX A;  3UB6 A;  1V9Y A;  3T4O A;  1NWZ A;  3H82 A;  3JVV A;  4QPR A;  1YAX A;  3S7N A;  4UEY A;  1XFQ A;  1XJ2 A;  5LBR A;  1MC0 A;  1YSQ A;  3W2Z A;  2W1R A;  2GX5 A;  1LT0 A;  1S66 L;  4ETZ A;  5HWT A;  4Y3I A;  2VEA A;  3MQQ A;  4HHD A;  5FL3 A;  1OTA A;  4IUH A;  2L0W A;  1N9O A;  3OOV A;  2W3G A;  2JKT M;  1UWP X;  2ZBB A;  4GLQ A;  5TJJ A;  3TW8 A;  5AVF A;  3EGD C;  3BQ8 A;  1G28 A;  3PBR A;  3C38 A;  4Y5F A;  3H7W A;  2FZ0 A;  3V67 A;  3KO6 A;  2JKR I;  3RH8 B;  4XT2 B;  4DN0 A;  3MJQ A;  3OCL A;  2V0W A;  3EOI A;  2QKP A;  4WF0 A;  2IA2 A;  4I3J A;  1IOU A;  3GDI A;  2P7J A;  2VV7 A;  3ZYT A;  4GS9 B;  2O9A A;  4LPZ A;  3CAX A;  2W3F A;  3LFV A;  3EQU A;  4MN5 A;  3OBF A;  4WLA A;  1DP6 A;  3D3O A;  2XA7 M;  2XA7 S;  2MJ6 A;  3BWL A;  2OWJ A;  5HPF A;  5IU1 A;  4R3A A;  4HH2 A;  3F1N A;  1F98 A;  4ME4 A;  4EUV A;  2KLI A;  3CIT A;  4PAU A;  2INW A;  1H3Q A;  5KIZ A;  3MQ0 A;  4HJ6 A;  4MN7 A;  3GEC A;  1EW0 A;  2J3W A;  4R6L A;  5A8B A;  1KOU A;  3LR3 A;  4K08 A;  4EU0 A;  1DP8 A;  2NUT C;  1X0O A;  3DBA A;  1LSX A;  4JGP A;  3A0S A;  3LUQ A;  4CLC B;  2XRN A;  2CMN A;  4XT2 A;  4L9F A;  4NXG A;  2FH5 A;  4CLC D;  3F1O B;  4HI4 A;  4OOL A;  1W63 Q;  4WEL A;  2VGL S;  3TJZ C;  2QHK A;  1P9R A;  4GS9 A;  3TE8 A;  3MMH A;  1OT9 A;  3A0R A;  4EES A;  3TRC A;  1P97 A;  4F3L B;  2OAP 1;  4HJ4 A;  4DMZ A;  2VLG A;  4EER A;  2G7U A;  1S4R A;  3NOT C;  1OTE A;  2KX6 A;  1LSV A;  4HQA A;  3R7W B;  2PD8 A;  3E4Q A;  1XJ4 A;  4EEU A;  4L9E A;  2ZOI A;  2LB9 A;  3KSF A;  1T19 A;  3P7N A;  2Y79 A;  2Y8H A;  3H9W A;  3ICY A;  1T1B A;  4I39 A;  2PR5 A;  1UGU A;  3BY9 A;  3EQV A;  3EGX C;  3CUE A;  2JHE A;  4I3I A;  4BWI A;  4GW9 A;  3LI9 A;  2GZA A;  5C5K A;  3BJN A;  3P01 A;  3PR6 A;  5DFY A;  5G4Z A;  1OTD A;  1XJ3 A;  2W1T A;  2B18 A;  3LR5 A;  4PHT A;  3ULF A;  3T4L A;  2W27 A;  3LIB A;  4I3A A;  2J3T C;  1S1Y A;  4BMW A;  3A0V A;  3B47 A;  4EET B;  4IUK A;  2VA0 A;  1ODV A;  1OTI A;  2XSS A;  2V1A A;  5DJU A;  4BBU A;  4CLC A;  3E4O A;  4BJP A;  1TS8 A;  1T1C A;  1TS7 A;  1LSW A;  3F1O A;  1OJG A;  1TF1 A;  4HJ3 A;  2PYP A;  1MKM A;  5HD3 A;  3UME A;  5DKL A;  4RQ9 A;  4EQ1 A;  5HDS A;  4G3V A;  3E98 A;  3HJK A;  4ARZ B;  2W3E A;  1BYW A;  3C2W A;  5HDD A;  2PD7 A;  4F3L A;  2YKF A;  2HF6 A;  4R70 A;  2VX8 A;  1T1A A;  2QWS A;  1NLY A;  2Z6C A;  5HL6 A;  2JKR M;  3R7W A;  4O0P A;  4E04 A;  3NHQ A;  5K5B A;  4Q0H A;  4NXE A;  4EXO A;  4BBT A;  3IBJ A;  3NOU C;  1YSP A;  4WUJ A;  4CQH A;  4B93 A;  3RTY A;  5L8M A;  2V1B A;  3CWF A;  1TS6 A;  3UB8 A;  5I5L A;  4IJG A;  1GSW A;  1LL8 A;  3BQA A;  3VE4 A;  2Z6D A;  1N9L A;  3LIF A;  4LRX C;  1P0Z A;  4Q0J A;  2HJ9 C;  3T50 A;  2WKR A;  2VKS A;  4I38 A;  1ZHH B;  4FSF A;  2VV6 A;  5DKK A;  5DJT A;  2O9C A;  2W1T B;  5J3W A;  3IBR A;  4HNB A;  4YNR A;  3PYP A;  3E4P A;  1MZU A;  4AFI A;  2LB5 A;  5HSQ A;  3G6O A;  2A2L A;  2KDK A;  2W0N A;  2ZOH A;  1VB6 A;  5MC7 A;  4WEK A;  3NJA A;  4DJ2 A;  3S7P A;  3PHY A;  2NUP C;  4HH3 A;  1V9Z A;  3LIC A;  3LR4 A;  4ARZ A;  2K2N A;  2L4R A;  3MXQ A;  5DF9 A;  3KSI A;  3PBS A;  2VGL M;  4MDZ A;  4H6J B;  2EWV A;  3KYZ A;  4P6Z M;  2PT7 A;  4P6Z S;  4CLC E;  4JGR A;  4O01 A;  3UMD A;  2V9A A;  5F68 A;  2L1M A;  4GCZ A;  2A24 B;  2I9V A;  1TS0 A;  3OC2 A;  5J4E A;  4KUK A;  4YOF A;  3EEH A;  3KSG A;  5EFW A;  1GSV A;  4NEE D;  2B02 A;  4WN5 A;  4G3W A;  2PYR A;  5IS1 A;  3JVU A;  4PKY A;  1DP9 A;  2DMW A;  1N9N A;  2KOI A;  4HY8 A;  4GJ4 A;  2EWW A;  2P08 A;  2ZMF A;  1VHM A;  1XFN A;  3FC7 A;  3VE3 A;  1T18 A;  3O5Y A;  3OCN A;  1OPX A;  2PR6 A;  2H28 A;  4LLO B;  4LRY C;  4FOF A;  1F9I A;  4Z1W A;  3T4Q A;  1W63 M;  4OOM A;  3S7O A;  5HWW A;  4L0L A;  2OAQ 1;  2WKQ A;  3T4T A;  4WEJ A;  4GHI B;  2ZMV A;  1NRJ A;  3K3C A;  2JKT I;  4H6J A;  3MF0 A;  2XRO A;  3B42 A;  5AVE A;  1Y28 A;  4IHQ A;  1F5M A;  5KSH A;  3LI8 A;  2M7V A;  2P04 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...