2YKHA

Sensor region of a sensor histidine kinase
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
285
structure length
265
Chain Sequence
b'STLGDLLAEHTVLPGSAVDHLHAVVGEWQLLADLSFADYLMWVRRDDGVLVCVAQCRPNTGPTVVHTDAVGTVVAANSMPLVAATFSHSVEVSPVRFGDQVVAVLTRHQPELAARRRSGHLETAYRLCATDLLRMLAEGTFPDAGDVAMSRSSPRAGDGFIRLDVDGVVSYASPNALSAYHRMGLTTELEGVNLIDATRPLISDPFEAHEVDEHVQDLLAGDGKGMRMEVDAGGATVLLRTLPLVVAGRNVGAAILIRDVTEVKR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROBABLE SENSOR HISTIDINE KINASE PDTAS
publication title The Sensor Region of the Ubiquitous Cytosolic Sensor Kinase, Pdtas, Contains Pas and Gaf Domain Sensing Modules.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
total genus 67
structure length 265
sequence length 285
chains with identical sequence B
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2011-05-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12282 H_kinase_N Signal transduction histidine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2ykhA02
3.30.450.280 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2ykhA01
1GSWA 3NOPC 4HP9A 3GDIA 2PR5A 3UB7A 1UWNX 2P7JA 2Z6CA 3H7WA 1T1CA 3PHYA 5F69A 3MQOA 1T18A 5F6AA 2YKHA 3CLOA 3P7NA 4MN6A 3A0SA 4BBVA 4HOIA 4HP4A 1G28A 2PR6A 4LPZA 4L9FA 4R70A 3FC7A 4HJ4A 1D7EA 5DJUA 4JGQA 2H28A 2HV1A 4I39A 5HDDA 3LICA 3VE3A 2WKPA 3MFXA 3F1NB 4YWZA 4LRXC 2L4RA 4DJ3A 1S4SA 3UB6A 1OTEA 3LIFA 4GCZA 3FG8A 1VB6A 2ZOHA 1XJ6A 5HWTA 3IS2B 3VOLA 1N9NA 5AVEA 1TS8A 4B9OA 4EXOA 1Y28A 1OTDA 1S1ZA 4GHIA 1XJ3A 3E4PA 5J7EA 3F1PA 2Z6DA 5IU1A 2WKRA 2WKQA 3H9WA 1S67L 4I3IA 4HJ6A 4XT2A 2PDRA 1BYWA 5KIZA 3NJAA 4H6JA 3LIBA 1XFNA 3ICYA 4EEPA 3MXQA 1N9LA 4HHDA 2KDKA 4R6LA 4NXBA 2D02A 3OLOA 1KOUA 3CAXA 3SW1A 3RTYA 4KQDA 4JGRA 4F3LB 3UB9A 1D06A 2PD8A 4I3AA 4PKYG 4WL9A 4I3JA 2R78A 1UWPX 1XFQA 1T1BA 1X0OA 3LI8A 3H7WB 2QKPA 4K08A 2M1CA 3UMEA 5J4EA 2INWA 3K3DA 1V9YA 3HJIA 1EW0A 2VV8A 2B02A 1OT6A 4BBUA 1LSXA 3B33A 2PD7A 4R3AA 3CWFA 5DKLA 1S4RA 4GS9A 2OWJA 1LL8A 5IS1A 1T1AA 2VV7A 2W0NA 5HDCA 3H82A 2OWHA 3RH8B 5HZHA 1TS7A 1OTIA 5TBMB 1S1YA 1OJ5A 2QWSA 2L0WA 3E4QA 2ZBBA 3NOUC 5G4YA 3LUQA 4WUJA 3UE6A 2V0WA 1T19A 3ULFA 5AVFA 5EFWA 1F98A 1TS6A 1OT9A 4L9GA 4M4XA 4WN5A 1MZUA 3E4OA 1OTBA 3IS2A 4KUKA 2J80A 5F5YA 4EQ1A 4PKYA 3F1OB 3PYPA 5HWVA 2A24A 4H6JB 2EA9A 3LIEA 2YKFA 3LIDA 1NWZA 3UMDA 4JGPA 3G6OA 3LIAA 2JN7A 1P97A 3IBRA 4HIAA 1TS0A 1GSVA 2V0UA 4WLAA 4HH2A 2V9AA 3EWKA 2QJ7A 1DP6A 4HQAA 1JNUA 4MN5A 5F68A 3KX0X 4HJ3A 4I5SA 4EEUA 5DKKA 2QHKA 4LRZE 4F3LA 3C2WA 2D01A 5HD5A 4LLOB 4L9EA 1DP8A 2PYRA 3HJKA 2GJ3A 3MR0A 3LI9A 1GSXA 4GS9B 2K7SA 5I5LA 3EEHA 2VLGA 2V1BA 3K3CA 3ZQ5A 1LT0A 3H82B 4NXEA 4HI4A 2VV6A 3VE4A 3NOTC 5G4ZA 4LRYC 4E04A 4EERA 1ODVA 5HDSA 5A8BA 2BASA 1XJ4A 2PHYA 3BY8A 3F1NA 1DRMA 2ZOIA 4JGOA 5J3WA 5HD3A 5TBMA 4RQ9A 4BBTA 3BWLA 4EW7A 4GHIB 5DJTA 4R38A 3F1PB 1V9ZA 3UB8A 3C8CA 4EESA 4HH3A 1P0ZA 3T50A 5HSQA 1OJGA 1WA9A 2OOLA 4XT2B 2W27A 5HWWA 3MQQA 2L1MA 2A24B 4HY8A 3MJQA 4HNBA 4KUOA 2JHEA 1LSVA 2QJ5A 2PYPA 2CMNA 3F1OA 3LYXA 2V1AA 1S66L 3A0RA 1OTAA 2KX6A 4I38A 4NXFA 3GECA 1LSWA 1N9OA 4WF0A 4DJ2A 2I9VA 4EETB 3D72A 4NXGA 1UGUA 1DP9A 1F9IA 1XJ2A 3A0VA 3BY9A 2VEAA 3NHQA 4GW9A
chains in the Genus database with same CATH superfamily
2P9VB 4MDZA 2V8CA 3W4OA 4BWIA 2P7JA 1K38A 1NRJA 3C30A 2XEPA 2FZ0A 3ZNTA 2EWVA 5K5BA 4EV4A 5AQ9A 3ITBA 3PHYA 4S2NA 4B88A 2GNXA 1IFQA 5F6AA 3EGXC 4YOFA 2ZL1A 4BBVA 5FSRA 1BUEA 4L9FA 4QY6A 3UPOA 3CMZA 3VSLA 3NDGA 4JGQA 2X01A 5AQ7A 3E0YA 1PWDA 4X56A 4E3OA 2Z2MB 3QP5A 1IYPA 1A0KA 3OPRA 3T1XA 4F94A 2ZQDA 4JF4A 4Y5FA 1VB6A 3T4SA 2ZOHA 4BL2A 1JWPA 3ZFZA 1ZG6A 1FSYA 4GB7A 4B4ZA 3IS2B 3VOLA 1N9NA 3QP8A 5AVEA 3LGOA 1CEGA 3DWKA 3FKVA 3MZFA 2ZC3B 1S1ZA 2C6WB 2HJ9C 3E4PA 1W79A 1L0FA 2Z6DA 2WKRA 3QP1A 2RL3A 5FEFA 5FEGA 1QMEA 2UV0E 1MWTA 1TEMA 4XT2A 4WMCA 3LIBA 5CGSA 4GKUA 3GMWA 4S2MA 4KQOA 3IH8A 5TGFA 5CX7A 3TRCA 1BZAA 2EXBA 3KSHA 3IXHA 3SW1A 3E2KA 3B3XA 2JKRM 3OPPA 3W8KA 1YLTA 2X02A 1D06A 1VM1A 4PKYG 5EE8A 3PBNA 1IYOA 4KZAA 5CGXA 4OPQA 4E3IA 1XFQA 1T1BA 3H7WB 2W3EA 2Y2HA 3A3IA 1JVJA 4QJGA 4MEZA 1IEMA 3UMEA 3R7WB 4S2OA 5HL1A 3BW6A 1ZG4A 4BBUA 1LSXA 1PYYA 2XROA 2HJEA 3D3OA 4PMAA 1H5XA 3IF5A 4KZ6A 4WEJA 3T1SA 1MKIA 1S4RA 4GS9A 2OWJA 4PAUA 3V39A 4GN2A 3UY6A 5IS1A 3A3EA 3P98A 4UEYA 2B18A 3H82A 2OWHA 2PRFA 4GDNA 3ZNYA 1JTDA 1OTIA 3Q1FA 2WZZA 2HDSA 1S1YA 2ZMAA 4DN0A 1FCMA 3DTKA 2ZM0A 1HZOA 3W4PA 3E4QA 3RXXA 4ZDXA 3HVFA 4KQQA 5G4YA 5EVID 4LENA 4P6ZM 1T19A 3C7VA 5CRFA 5EFWA 4WYYA 3LEQA 3ITAA 1F98A 4Y0UA 2R9WA 1PIOA 3MZDA 2EX6A 4WZ4A 3C5AA 3A3DA 4WN5A 5JYOA 2V2FF 5I94A 4EQ1A 5F5YA 2WAEA 2JKFA 4MCWA 3PYPA 4DXBA 3C7UA 2H0YA 4H6JB 3M2JA 3MF0A 3UMDA 3LIAA 2JN7A 5HW3A 2Q9NA 1ALQA 1FR6A 3IBRA 2WYXA 3VP2A 4UQIS 5EECA 1TDGA 3CPTB 4HH2A 5EVIC 4P0MA 1K57C 2QJ7A 3TW8A 1IKGA 4R1GA 2XFSA 2WGWA 4OPYA 2AVXA 1RCJA 4ETXA 3KX0X 3SH9A 4Z9QA 4IEDA 2H0TA 4E3MA 4DE3A 3BM6A 5GHYA 3TOIA 3LY3A 1KGFA 3PBOA 4LLOB 2Y2PA 4L9EA 4JF5A 3PBTA 4C6YA 4B93A 4DMZA 2CC1A 5HX9A 1KGGA 2W1RA 4KQRA 3LI9A 5L07A 4EUZA 1L2SA 2VLGA 5F1FA 2XR0A 4MNRA 3K3CA 5L10A 1G6AA 3B47A 1LT0A 3DW0A 3NBLA 1NLZA 5FI7A 4HI4A 2W3HA 1F5MA 1ZHHB 5HAIA 4E04A 3NI9A 3S4XA 1YLYA 5IHVA 3BY8A 3HLGA 4WM9A 4G3WA 3IH9A 2Y2GA 4BBTA 3BWLA 4KZBA 4EW7A 4IHQA 1W63Q 2EXAA 4NK3A 5DJTA 2FFYA 4JXVA 4R38A 5FI2A 4ZBEA 1V9ZA 2XD5A 3WS5A 2A2LA 1YPRA 3N8RA 3T50A 3ZG7B 2Y2LA 4R23A 1HVBA 1I2SA 4FTXA 3GSGA 1Z6FA 1XKZA 4YINA 2M7VA 3SOIA 3IF6B 2OAP1 4BLMA 4DE2A 4JXGA 2WADA 1GHMA 3F1OA 2CMNA 1K4FA 4LV0A 4N1HA 5FAOA 4BMWA 3T4QA 4N92A 1OTAA 2C5WB 2KX6A 1LL5A 3M2KA 1MKMA 3GECA 4Y0OA 1FCOA 2WKHA 1N9OA 3KSGA 1XXMA 3O5YA 2I9VA 1YLJA 4EETB 3D72A 2XSSA 1XA7A 4NXGA 1UGUA 2E8IA 1K4EA 1F9IA 4KZ3A 5DVAA 4JKTA 4R0QA 5HAPA 1FR1A 5GLBA 4GW9A 3SS4A 3NOPC 4HP9A 3VSKA 1VEUA 5EVIA 5DTSA 1XGIA 4WZ5C 3WWXA 1T1CA 1LL9A 4U0TA 2UWXA 3MQOA 2QYBA 4II7A 1VQQA 5CHJA 4MN6A 4KZ5A 2ZC6B 5DFYA 4UAAA 4OOLA 4LPZA 1ZKJA 3KO6A 3TJZC 3WS4A 4OOMA 2XA7M 2Y8HA 3MQ0A 4HJ4A 4N1XA 3VOZA 1KE0A 5DJUA 3L7HA 1EROA 1W7FA 3OOVA 4Y17A 3VE3A 2JKTI 3S7NA 3QNBA 4BQMA 4DJ3A 1KDSA 1S4SA 1XP4A 2PBYA 2HDRA 4ARZB 5FASA 3WS1A 1STZA 1YSQA 5F82A 1XJ6A 5HWTA 4Z1WA 1K55A 3OC2A 3P01A 1TS8A 1O07A 4B9OA 1Y28A 4Y0TA 2VK3A 5J7EA 3P09A 2J3WA 3MFDA 3D9YA 2J7VA 3WS2A 3IXDA 1TVFA 3VMAA 3OCLA 2H5SA 2PDRA 2ZC7A 3HLCA 4S2IA 3PBRA 3FZCA 3G2ZA 3WRTA 4HHDA 2KDKA 4R6LA 5FAPA 1PZOA 1KOUA 4PM8A 1ACFA 4LCMA 4EUVA 4KQDA 3O88A 5HL6A 5CXWA 2DCFA 3S22A 3UB9A 1NXYA 4I3AA 3ZVWA 4S2JA 2XFTA 3ZG0A 1BULA 1L3LA 4O7DA 4I3JA 1UWPX 1Y4OA 2HP5A 1X0OA 1NY0A 5A90A 1MPLA 1AWIA 3UB5P 2WGVA 2P9VA 3ZVTA 5J4EA 4WBGA 2QMIA 4LGWA 3K3DA 1WE4A 1E3UD 2VV8A 1Y54A 2I72A 2B02A 2VX8A 3B33A 3CHWP 1K0KA 2O9AA 4R3AA 3S7QA 4R3BA 3CWFA 3D4FA 3CJMA 4QPRA 5EM1A 1SZVA 3N7WA 4IUKA 2K31A 2VV7A 2O0YA 3MXRA 4CLCA 5FA7A 1FQGA 4BD1A 3HLEA 2Y2MA 5TBMB 3KYZA 3LEZA 1OJ5A 5TFQA 4MMNA 1MC0A 3SZTA 3G30A 3NOUC 3LUQA 4JLFA 3IX8A 2KLIA 2V0WA 3ULFA 4CLCE 3ISGA 3ZG9B 1ONHA 4FCFA 1QMFA 5A93A 4UA6A 2VGLM 3EEAA 1WYBA 1MZUA 4WELA 1OTBA 3IS2A 4KUKA 2PU2A 2W3DA 2Y59A 3JPUA 3DTMA 4DRTA 5DF9A 5HWVA 1CK3A 5HFOA 2WGIA 4H8RA 2YKFA 2V20A 2XRNA 3HL9A 4JGPA 3G6OA 3HUOA 4EBLA 3FPWA 4RX2A 5CTMA 5M1AA 4DE0A 1CI9A 3AGEA 1YLZA 4R4RA 4D2OA 1TS0A 2V0UA 4PM5A 4X6TA 1ESIA 2G7UA 4ETZA 1ES4A 4PHTA 5FDHA 4QWOA 1JNUA 4MN5A 5GLAA 5F83A 1ES3A 4HJ3A 4MBKA 4OQGA 4NETA 5KZHA 3LR4A 3NCKA 4Y7PA 1W5DA 1TDLA 3C2WA 1TD5A 2JKGA 5HPFA 2OLUA 3G31A 1U60A 3O86A 3HJKA 1VETA 4Y13A 1BLSA 1E4DA 3JVVA 3MR0A 3M6HA 3R7WA 4GS9B 4Q0IA 2Y4AA 3EEHA 3NC8A 5L8MA 3ZQ5A 5M18A 4OQ0A 3PAGA 3QP2A 3H82B 4NXEA 5GL9A 2VV6A 2V1ZA 4LRYC 4EERA 5HDSA 1E25A 3UNWA 2W1TA 1PFLA 3BFEA 5GLCA 1CJFA 4X1LA 3F1NA 4EU0A 1DRMA 4OP8A 3T4OA 4EBNA 4X55A 3UPNA 1K6RA 3HCYA 3ZGAB 5J3WA 4BD0A 2OLVA 3DTIA 4A5RA 3V3SA 1YMXA 2ZMFA 4GHIB 2ZM2A 3F1PB 5C5KA 3BLMA 4PM7A 3IF6C 2OOLA 3OCNA 1YSPA 4FD8A 3BFFA 1W63M 2IWCA 2WZXA 3JYIA 3GVBA 3N8LA 1PNEA 4NKPA 4OONA 1H8MA 4FUWA 4GDBA 2E8JA 2XQZA 4KZ7A 3UO9A 4KENB 2JHEA 2EX9A 3VP4A 2QJ5A 2PYPA 4M3KA 4PM9A 3IBJA 1GA0A 3IX3A 4ZRRA 1MBLA 1S66L 3IHBA 3CUEC 1O7EA 4I38A 5FDSA 1K54C 4OQHA 2WGWB 2RCXA 2HDQA 4DJ2A 4K0WA 3OPHA 1NRFA 1DP9A 3PTEA 1MXOA 1KE4A 3E2LA 3CPTA 2MJ6A 3NHQA 1MY8A 3E4OA 5CERA 3MKFA 1GSWA 3AGFA 3CI6A 3GDIA 2PR5A 3UB7A 1HD8A 1Z09A 3IX4A 2M7UA 5BOHA 5E2EA 2B95A 2JKTM 2VGJA 5E2HA 2O9CA 4DF6A 3BQAA 4QD4A 1T18A 1KE3A 4ESPA 1Q2QA 3P7NA 3Q07A 5CEBA 2W3FA 4HBUA 4HOIA 4LV3A 2WKEA 2VA0A 2XA7S 3GR2A 5FQKA 4FOFA 2EFXA 3T4JA 3FC7A 4GD6A 1K56D 4MBHA 3T4TA 1D7EA 4I39A 5FQIA 2O9BA 4LRXC 5KSHA 4DXCA 1DJCA 2PU4A 2P04A 1IYQA 2P08A 1L0EA 2WKIA 4LV2A 4OKPA 4QY5A 2XGNA 2HF6A 3HLWA 4L0LA 4BJPA 5J8XA 3FYZA 5EVEA 3L9KA 4ZJ2A 1KVLA 2FH5A 3HREA 5GLDA 3Q7VB 3S7PA 3VP1A 1OTDA 5DTKA 1SKOA 4PM6A 4QB8A 3ZG8B 2WKQA 1K6SA 3H9WA 4UHUA 5GHZA 1GHIA 4HJ6A 2ZQAA 4RA7A 5L09A 4GNUA 1XX2A 3NJAA 5HARA 4EEPA 3ICYA 3HBRA 3VFHA 4JBFA 3MXQA 1N9LA 2ZJ9A 3IF6A 5DF8A 5FQJA 4NXBA 3OLOA 4MN7A 5U47A 1L0GA 3OPLA 1FIKA 3CAXA 3RTYA 1ONGA 4UQIM 4CPKA 1NYMA 2FFFB 5EOEA 4JGRA 4IVKA 4F3LB 4OP5A 4JXSA 4R4SA 4Q8IA 3EGDC 4S2NC 3Q7ZA 5JYPA 4DDSA 1RGZA 1K57A 3LI8A 2O99A 1CEFA 2XK1A 3T1QB 4GZBA 4LFUA 2INWA 4LCLA 1V9YA 3HJIA 5DFXA 2PD7A 4WMCD 2HP6A 3KYEA 3Q81A 1P9RA 1ZC2A 4GD8A 3UDFA 3V5MA 2Y79A 1LL8A 1G6OA 3HLFA 3CG5A 2W0NA 1N4OA 1BSGA 2JC7A 3BYDA 3RH8B 5HZHA 1KDWA 3C4PA 1XGJA 3R4KA 2VGKA 3VFFA 2HPBA 1Q2PA 4Y3IA 2P74A 3UPPA 2L0WA 2ZBBA 5EVLA 3UN7A 3VP3A 4EQIA 2J8YA 4RX3A 3TSGA 3UE6A 3VP0A 4OPZA 4QHCA 1OT9A 1RP5A 3O87A 2DNSA 2VGLS 4ARZA 3DBAA 1SKFA 4XXRA 4X53A 3IQAA 2ZQ7A 1IOUA 5FL3A 4DKIA 5F1GA 2NUTC 4CJNA 3BRMA 4K91A 4Q0JA 4PKYA 3V3RA 3LFVA 3S7OA 5CTNA 2A24A 2EA9A 3LIEA 1CF0A 1NWZA 5E43A 2DRWA 5FI6A 1I5QA 3UDXA 4HIAA 1VHMA 1PRQA 3KSFA 4KG2A 1XA1A 2Y2KA 2V9AA 3ZYTA 2A3UA 4ZJ3A 3EWKA 3BEBA 2HGVA 3QNCA 3IWOA 4E3LA 2Y2JA 4HQAA 2EWWA 1K56A 4OH0A 5F68A 1GCEA 4O8GA 2IWBA 1C3BA 2EFUA 3PR6A 4EEUA 1M6KA 2QHKA 4E6XA 5MC7A 1YQSA 3RJUA 4G3KA 1G68A 3OBFA 5HD5A 2XD1A 2ZL1B 2DMWA 3T12B 2PYRA 3LO7A 1D1JA 5FQ9A 1IELA 4KZ4A 2OV5A 1LI0A 3I7JA 3ZDJA 3GV9A 1LLBA 3UDIA 5I5LA 4E6WA 2J9OA 4WZ5A 2V1BA 1GHPA 3V67A 5FAQA 2Y2IA 2WUQA 3U4LP 1YLPA 1S0WA 4CLCB 4D60A 3G2YA 5EPHA 3C38A 3NOTC 1PZPA 4HBTA 4NG2A 1ERQA 3V50A 4P6ZS 2BASA 1XJ4A 2PHYA 2ZC4B 2BLSA 2Q9MA 4JGOA 3G32A 3IXBA 5TBMA 1MWRA 3CZDA 4RQ9A 5LBRA 2PAVP 2Y2OA 3RXWA 2GX5A 4S2KA 4EESA 2B5RA 3KYQA 4HH3A 1PW8A 4XT2B 2W27A 5HWWA 3MQQA 2L1MA 3UE0A 1EI5A 1JWZA 4FH4A 3WS0A 3MJQA 4U3TA 2ZM8A 4RYEA 3SS5A 1IKIA 3SH8A 3UE1A 1LSVA 2NUPC 3OZHA 5AQBA 1OPXA 4OLDA 3A0RA 5EUAA 4NXFA 2QZ6A 2XH9A 3HUNA 4JXWA 3SH7A 1H0MA 1AXBA 4AFIA 1NYYA 3A0VA 1XPBA 1SDNA 2Y55A 4U0XA 5CHMA 3FWLA 3QP4A 3U2AA 5L2FA 1UWNX 5CEDA 4S2LA 3NDEA 4YFMA 1JTGA 3ZG5A 2Z6CA 3H7WA 1VETB 5GHXA 4Y2FA 4R3JA 5F69A 1HTZA 4PPRA 4WEKA 1YM1A 2ZQ8A 2WAFA 3FKWA 2YKHA 3CLOA 3A0SA 4QU3A 2J3TD 4C3QA 1BLCA 1YAXA 5E2FA 4HP4A 4CQHA 1G28A 2PR6A 3O3VA 1LHYA 4HESA 4R70A 3BECA 4IBXA 4NEED 5KMWA 2VJWA 3AGDA 2H28A 2W1TB 4N9LA 1YLWA 2HV1A 1BLHA 5HDDA 3LICA 2WKPA 2PBDP 3EQUA 3MFXA 3F1NB 4YWZA 4ZAMA 2L4RA 2LB9A 3CITA 3UB6A 1OTEA 3LIFA 2Q0OA 4GCZA 3MZEA 5G18A 5TR7A 1W8YA 3FG8A 4C75A 4EWFA 3T1RA 5DF7A 3LY4A 3NY4A 3MMHA 3G34A 3RFBA 4EXOA 3HLDA 4YNRA 2J3TC 4GHIA 1XJ3A 5EM0A 3F1PA 4GJ4A 3QHYA 5IU1A 2ACGA 2QPNA 3PBQA 1S67L 1E3UA 4I3IA 3LR3A 3PBSA 3DWZA 3NULA 1BYWA 5KIZA 3GTCA 4P6BA 4OPRA 4H6JA 4X25A 1W8QA 3B42A 3Q82A 3TG9A 2JBFA 2Y91A 1XFNA 1J3WA 3LR5A 1EWZA 3HLBA 2D02A 3IXGA 3N8SA 2V8FA 1DY6A 4O01A 3LR0A 1YKDA 4Y15A 3GRJA 3A3JA 3MSHA 1IYSA 5CGWA 4DDYA 2BTFP 1RGYA 5HPIA 2EX2A 2PD8A 4X68A 4WL9A 5CHUA 2R78A 3DAVA 3W4QA 1BT5A 1ES2A 1WYCA 5A92A 2QKPA 4K08A 2XLNA 2H10A 4HEFA 2M1CA 3BFDA 3EOIA 2LB5A 1EW0A 4GLQA 1OT6A 1NLYA 3PXPA 5AJGA 5AQAA 3BQ8A 3EQVA 3N4IA 4LV1A 1NZUA 2GZAA 4ZJ1A 5DKLA 4GOGA 4FSFA 2JKRI 3TE8A 3BLSA 5DTTA 3FPVA 1T1AA 4JPMA 1HLUP 3M6BA 5HDCA 3T4LA 3QP6A 3NIAA 2HZ5A 2XDMA 1TS7A 1L0DA 2J9PA 1K55C 4KZ9A 2QWSA 3ZHHA 1S6RA 2W3GA 4WUJA 1SHVA 3BFCA 4K0XA 4IJGA 4ZTKA 4IUHA 2A49A 5AVFA 5EOOA 5FATA 2IWDA 1ERMA 1TS6A 4B4XA 3C4OA 1GA9A 4L9GA 3MS6A 3IT9A 4M4XA 1H3QA 4E3JA 4E3KA 1SKOB 2K2NA 4KG5A 4DE1A 2ZD8A 3JVUA 2J80A 4IBRA 4RVAA 1H8ZA 3F1OB 3SS3A 3Q7VA 5A91A 3G35A 1CQAA 3K2NA 1FSWA 1DJAA 4X69A 4Q0HA 1MWUA 2ZLYA 3LIDA 2ZC5B 4G3VA 1P97A 5FQMA 4CLCD 4KG6A 5M19A 1PI4A 4MBFA 1SDEA 1GSVA 2Y2QA 4WLAA 3MKEA 1SCWA 1DP6A 1K25A 1LI9A 4ME4A 4X1MA 4P87A 3BJNA 2G2WA 4MLLA 3GQZA 1ESUA 1VEUB 1H8YA 4XUXA 1PWCA 5EVIB 3CUEA 4I5SA 5DKKA 1K54A 1FCNA 1YT4A 4LRZE 4FH2A 4F3LA 3WRZA 1F2KA 5FQQA 5KSCA 2D01A 1BLPA 3MBZA 1P9WA 1DP8A 3IWIA 1PWGA 4XUZA 2ZMVA 3KSIA 1FOFA 2GJ3A 1MWSA 2ZQ9A 2HP9A 3VOYA 4OQIA 1N9BA 1GSXA 4CLCC 2K7SA 3LCEA 2GDNA 3W2ZA 1PI5A 2OSUA 1PW1A 4EBPA 3FV7A 1ZTUA 4UA9A 5HAQA 4N9KA 1FILA 5IT5A 2Z2LB 3VE4A 5G4ZA 2JE5A 4KZ8A 2HDUA 4BL3A 2Y2NA 1ODVA 5A8BA 3DTEA 2G2UA 2PT7A 2XF3A 1BTLA 3A3FA 3N6IA 1TF1A 2OAQ1 2ZOIA 2BG1A 5HD3A 4IVIA 1NZOA 3E98A 2IA2A 1ES5A 2R9XA 3UB8A 3IWQA 3C8CA 1NJ4A 3G4PA 1OMEA 1P0ZA 5HSQA 1OJGA 3ZCZA 1WA9A 2KOIA 2VKSA 1KVMA 4OOYA 4O0PA 4UA7A 2A24B 4HY8A 4HNBA 4KUOA 1KGEA 2WK0A 3UE3A 4BENA 3S1YA 2ZQCA 3IHAA 4OVDA 5TJJA 3PAEA 5EV0A 4P85A 1JWVA 1M40A 2VZWA 1J9MA 3LYXA 2V1AA 5E2GA 1G5UA 1I2WA 3NECA 3T4KA 3VV4A 1DJBA 4ID4A 1LSWA 2EX8A 3MXSA 2X71A 4E3NA 4JF6A 4WF0A 4S2PA 5CECA 1XJ2A 4OLGA 5D3OA 1YMSA 2JCHA 3BFGA 3HUMA 1CI8A 3BY9A 2VEAA
chains in the Genus database with same CATH topology
4MDZA 3U2AA 1GSWA 3CI6A 3NOPC 4BWIA 4HP9A 3GDIA 2PR5A 3UB7A 1UWNX 2P7JA 4GW9A 2M7UA 1NRJA 3C30A 2FZ0A 2EWVA 2JKTM 2Z6CA 3H7WA 1T1CA 5K5BA 2O9CA 4Y2FA 3PHYA 3BQAA 5F69A 3MQOA 4WEKA 1T18A 2GNXA 2QYBA 4II7A 1IFQA 5F6AA 2YKHA 3CLOA 3EGXC 3P7NA 4MN6A 3A0SA 4YOFA 4BBVA 5DFYA 2W3FA 4HOIA 2J3TD 1YAXA 4HP4A 4CQHA 1G28A 2PR6A 2VA0A 4OOLA 4LPZA 3KO6A 2XA7S 3TJZC 4L9FA 4FOFA 3T4JA 4OOMA 4R70A 2XA7M 2Y8HA 3FC7A 3MQ0A 4HJ4A 3T4TA 4NEED 1D7EA 5DJUA 2VJWA 4JGQA 2H28A 2W1TB 3E0YA 2HV1A 4I39A 3OOVA 3LICA 5HDDA 3VE3A 2WKPA 3EQUA 3MFXA 3F1NB 2JKTI 2O9BA 4YWZA 4LRXC 3S7NA 5KSHA 2L4RA 4DJ3A 2LB9A 3CITA 1S4SA 3UB6A 1OTEA 3LIFA 2P04A 2P08A 4GCZA 4ARZB 4Y5FA 3FG8A 1VB6A 1STZA 2HF6A 3T4SA 1YSQA 2ZOHA 1XJ6A 5HWTA 4Z1WA 4L0LA 4BJPA 3IS2B 3VOLA 1N9NA 3OC2A 3P01A 5AVEA 1TS8A 3MMHA 4B9OA 2FH5A 3RFBA 4EXOA 1Y28A 3S7PA 1OTDA 1S1ZA 2J3TC 4GHIA 4YNRA 2HJ9C 1XJ3A 3E4PA 5J7EA 2J3WA 3F1PA 4GJ4A 2Z6DA 5IU1A 2WKRA 2WKQA 3PBQA 3H9WA 1S67L 4I3IA 4HJ6A 3LR3A 3PBSA 3OCLA 4XT2A 2PDRA 1BYWA 5KIZA 3NJAA 4H6JA 3B42A 3LIBA 1XFNA 3ICYA 3PBRA 4EEPA 3MXQA 3LR5A 1N9LA 4KQOA 5CX7A 4HHDA 3TRCA 2KDKA 4R6LA 4NXBA 2D02A 3OLOA 4MN7A 3KSHA 1KOUA 4O01A 3LR0A 1YKDA 3CAXA 3SW1A 3RTYA 4UQIM 4EUVA 2JKRM 4KQDA 4JGRA 4F3LB 5HL6A 3UB9A 3EGDC 1D06A 5HPIA 2PD8A 4I3AA 4PKYG 4WL9A 4I3JA 3PBNA 2R78A 1UWPX 1XFQA 1T1BA 1X0OA 3LI8A 3H7WB 2W3EA 2O99A 2QKPA 4K08A 2M1CA 3UMEA 5J4EA 3R7WB 2INWA 3K3DA 1V9YA 3BW6A 3HJIA 3EOIA 2LB5A 1EW0A 4GLQA 2VV8A 2B02A 1OT6A 1NLYA 3PXPA 4BBUA 5AJGA 1LSXA 2XROA 3BQ8A 3EQVA 5DFXA 2VX8A 2HJEA 3B33A 2PD7A 3D3OA 2O9AA 4R3AA 2GZAA 1P9RA 3S7QA 3CWFA 5DKLA 4WEJA 4FSFA 2JKRI 3TE8A 1S4RA 4QPRA 4GS9A 2OWJA 4PAUA 2Y79A 3FPVA 1LL8A 5IS1A 1G6OA 4IUKA 1T1AA 2K31A 2VV7A 2W0NA 5HDCA 3T4LA 2O0YA 4UEYA 2B18A 3H82A 4CLCA 2OWHA 3RH8B 5HZHA 1TS7A 1OTIA 3R4KA 5TBMB 1S1YA 4Y3IA 3KYZA 4DN0A 1OJ5A 4MMNA 1MC0A 2QWSA 2W3GA 2L0WA 3E4QA 2ZBBA 3NOUC 5G4YA 3LUQA 4WUJA 4IJGA 4P6ZM 2KLIA 3UE6A 4IUHA 2V0WA 1T19A 3ULFA 5AVFA 5EFWA 1F98A 1TS6A 4CLCE 1OT9A 4L9GA 2VGLS 4M4XA 4ARZA 1H3QA 2VGLM 3DBAA 3EEAA 2K2NA 4WN5A 1IOUA 1MZUA 5FL3A 4WELA 3JVUA 1OTBA 3IS2A 2NUTC 4KUKA 2J80A 5F5YA 4EQ1A 2W3DA 4Q0JA 4PKYA 3LFVA 3F1OB 4MCWA 3PYPA 3S7OA 5DF9A 5HWVA 3K2NA 2A24A 4H6JB 2EA9A 3LIEA 3MF0A 4Q0HA 2YKFA 3LIDA 1NWZA 3UMDA 2XRNA 4JGPA 4G3VA 3G6OA 3LIAA 2JN7A 1P97A 3FPWA 4CLCD 3IBRA 4HIAA 1VHMA 3KSFA 4UQIS 1TS0A 1GSVA 2V0UA 4WLAA 4HH2A 2V9AA 3ZYTA 3EWKA 2QJ7A 2HGVA 3TW8A 2G7UA 1DP6A 4ETZA 4ME4A 4HQAA 4PHTA 2EWWA 3BJNA 1JNUA 4MN5A 4ETXA 5F68A 3KX0X 4O8GA 4HJ3A 3PR6A 3CUEA 4I5SA 4EEUA 5DKKA 3LR4A 2QHKA 5MC7A 4LRZE 4F3LA 3C2WA 1TD5A 4G3KA 2D01A 3OBFA 5HD5A 3PBOA 1P9WA 4LLOB 5HPFA 4L9EA 1DP8A 2DMWA 3PBTA 2PYRA 4B93A 4DMZA 2ZMVA 3HJKA 3KSIA 3JVVA 2GJ3A 2W1RA 3MR0A 3LI9A 1GSXA 3R7WA 4CLCC 4GS9B 2K7SA 5I5LA 4Q0IA 3EEHA 2VLGA 2V1BA 3W2ZA 5L8MA 3V67A 3K3CA 3B47A 3ZQ5A 1LT0A 1ZTUA 3H82B 1NLZA 4NXEA 4CLCB 4HI4A 5IT5A 2VV6A 2W3HA 3VE4A 1F5MA 3C38A 3NOTC 5G4ZA 1ZHHB 4LRYC 4E04A 4EERA 1ODVA 5HDSA 5A8BA 2W1TA 4P6ZS 2BASA 2PT7A 1XJ4A 2PHYA 3BY8A 3F1NA 4EU0A 1TF1A 2OAQ1 1DRMA 3T4OA 4G3WA 2ZOIA 4JGOA 3HCYA 5J3WA 5HD3A 5TBMA 2ZMFA 3E98A 4RQ9A 4BBTA 3BWLA 5LBRA 4EW7A 4IHQA 1W63Q 2IA2A 4GHIB 5DJTA 4R38A 3F1PB 1V9ZA 5C5KA 3UB8A 2GX5A 3C8CA 4EESA 3KYQA 4HH3A 2A2LA 1P0ZA 3T50A 5HSQA 1OJGA 1WA9A 2KOIA 2OOLA 2VKSA 2W27A 4XT2B 5HWWA 3OCNA 3MQQA 2L1MA 1YSPA 1W63M 4O0PA 2A24B 4HY8A 4NKPA 2M7VA 1H8MA 3MJQA 4HNBA 2OAP1 4KUOA 3UE3A 2JHEA 5TJJA 1LSVA 2QJ5A 2PYPA 2CMNA 3F1OA 3IBJA 2VZWA 2NUPC 3LYXA 2V1AA 4BMWA 1OPXA 4ZRRA 3T4QA 1S66L 3A0RA 1OTAA 2KX6A 3CUEC 3T4KA 4I38A 3VV4A 1MKMA 4NXFA 3GECA 1LSWA 1N9OA 3KSGA 3O5YA 4WF0A 4DJ2A 2I9VA 4EETB 3D72A 2XSSA 4NXGA 1UGUA 1DP9A 1F9IA 1XJ2A 4AFIA 3A0VA 2MJ6A 3BY9A 2VEAA 3NHQA 3E4OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GSW A;  3NOP C;  4HP9 A;  3GDI A;  2PR5 A;  3UB7 A;  1UWN X;  2P7J A;  2Z6C A;  3H7W A;  1T1C A;  3PHY A;  5F69 A;  3MQO A;  1T18 A;  5F6A A;  2YKH A;  3CLO A;  3P7N A;  4MN6 A;  3A0S A;  4BBV A;  4HOI A;  4HP4 A;  1G28 A;  2PR6 A;  4LPZ A;  4L9F A;  4R70 A;  3FC7 A;  4HJ4 A;  1D7E A;  5DJU A;  4JGQ A;  2H28 A;  2HV1 A;  4I39 A;  5HDD A;  3LIC A;  3VE3 A;  2WKP A;  3MFX A;  3F1N B;  4YWZ A;  4LRX C;  2L4R A;  4DJ3 A;  1S4S A;  3UB6 A;  1OTE A;  3LIF A;  4GCZ A;  3FG8 A;  1VB6 A;  2ZOH A;  1XJ6 A;  5HWT A;  3IS2 B;  3VOL A;  1N9N A;  5AVE A;  1TS8 A;  4B9O A;  4EXO A;  1Y28 A;  1OTD A;  1S1Z A;  4GHI A;  1XJ3 A;  3E4P A;  5J7E A;  3F1P A;  2Z6D A;  5IU1 A;  2WKR A;  2WKQ A;  3H9W A;  1S67 L;  4I3I A;  4HJ6 A;  4XT2 A;  2PDR A;  1BYW A;  5KIZ A;  3NJA A;  4H6J A;  3LIB A;  1XFN A;  3ICY A;  4EEP A;  3MXQ A;  1N9L A;  4HHD A;  2KDK A;  4R6L A;  4NXB A;  2D02 A;  3OLO A;  1KOU A;  3CAX A;  3SW1 A;  3RTY A;  4KQD A;  4JGR A;  4F3L B;  3UB9 A;  1D06 A;  2PD8 A;  4I3A A;  4PKY G;  4WL9 A;  4I3J A;  2R78 A;  1UWP X;  1XFQ A;  1T1B A;  1X0O A;  3LI8 A;  3H7W B;  2QKP A;  4K08 A;  2M1C A;  3UME A;  5J4E A;  2INW A;  3K3D A;  1V9Y A;  3HJI A;  1EW0 A;  2VV8 A;  2B02 A;  1OT6 A;  4BBU A;  1LSX A;  3B33 A;  2PD7 A;  4R3A A;  3CWF A;  5DKL A;  1S4R A;  4GS9 A;  2OWJ A;  1LL8 A;  5IS1 A;  1T1A A;  2VV7 A;  2W0N A;  5HDC A;  3H82 A;  2OWH A;  3RH8 B;  5HZH A;  1TS7 A;  1OTI A;  5TBM B;  1S1Y A;  1OJ5 A;  2QWS A;  2L0W A;  3E4Q A;  2ZBB A;  3NOU C;  5G4Y A;  3LUQ A;  4WUJ A;  3UE6 A;  2V0W A;  1T19 A;  3ULF A;  5AVF A;  5EFW A;  1F98 A;  1TS6 A;  1OT9 A;  4L9G A;  4M4X A;  4WN5 A;  1MZU A;  3E4O A;  1OTB A;  3IS2 A;  4KUK A;  2J80 A;  5F5Y A;  4EQ1 A;  4PKY A;  3F1O B;  3PYP A;  5HWV A;  2A24 A;  4H6J B;  2EA9 A;  3LIE A;  2YKF A;  3LID A;  1NWZ A;  3UMD A;  4JGP A;  3G6O A;  3LIA A;  2JN7 A;  1P97 A;  3IBR A;  4HIA A;  1TS0 A;  1GSV A;  2V0U A;  4WLA A;  4HH2 A;  2V9A A;  3EWK A;  2QJ7 A;  1DP6 A;  4HQA A;  1JNU A;  4MN5 A;  5F68 A;  3KX0 X;  4HJ3 A;  4I5S A;  4EEU A;  5DKK A;  2QHK A;  4LRZ E;  4F3L A;  3C2W A;  2D01 A;  5HD5 A;  4LLO B;  4L9E A;  1DP8 A;  2PYR A;  3HJK A;  2GJ3 A;  3MR0 A;  3LI9 A;  1GSX A;  4GS9 B;  2K7S A;  5I5L A;  3EEH A;  2VLG A;  2V1B A;  3K3C A;  3ZQ5 A;  1LT0 A;  3H82 B;  4NXE A;  4HI4 A;  2VV6 A;  3VE4 A;  3NOT C;  5G4Z A;  4LRY C;  4E04 A;  4EER A;  1ODV A;  5HDS A;  5A8B A;  2BAS A;  1XJ4 A;  2PHY A;  3BY8 A;  3F1N A;  1DRM A;  2ZOI A;  4JGO A;  5J3W A;  5HD3 A;  5TBM A;  4RQ9 A;  4BBT A;  3BWL A;  4EW7 A;  4GHI B;  5DJT A;  4R38 A;  3F1P B;  1V9Z A;  3UB8 A;  3C8C A;  4EES A;  4HH3 A;  1P0Z A;  3T50 A;  5HSQ A;  1OJG A;  1WA9 A;  2OOL A;  4XT2 B;  2W27 A;  5HWW A;  3MQQ A;  2L1M A;  2A24 B;  4HY8 A;  3MJQ A;  4HNB A;  4KUO A;  2JHE A;  1LSV A;  2QJ5 A;  2PYP A;  2CMN A;  3F1O A;  3LYX A;  2V1A A;  1S66 L;  3A0R A;  1OTA A;  2KX6 A;  4I38 A;  4NXF A;  3GEC A;  1LSW A;  1N9O A;  4WF0 A;  4DJ2 A;  2I9V A;  4EET B;  3D72 A;  4NXG A;  1UGU A;  1DP9 A;  1F9I A;  1XJ2 A;  3A0V A;  3BY9 A;  2VEA A;  3NHQ A;  4GW9 A; 
#chains in the Genus database with same CATH topology
 2P9V B;  4MDZ A;  2V8C A;  3W4O A;  4BWI A;  2P7J A;  1K38 A;  1NRJ A;  3C30 A;  2XEP A;  2FZ0 A;  3ZNT A;  2EWV A;  5K5B A;  4EV4 A;  5AQ9 A;  3ITB A;  3PHY A;  4S2N A;  4B88 A;  2GNX A;  1IFQ A;  5F6A A;  3EGX C;  4YOF A;  2ZL1 A;  4BBV A;  5FSR A;  1BUE A;  4L9F A;  4QY6 A;  3UPO A;  3CMZ A;  3VSL A;  3NDG A;  4JGQ A;  2X01 A;  5AQ7 A;  3E0Y A;  1PWD A;  4X56 A;  4E3O A;  2Z2M B;  3QP5 A;  1IYP A;  1A0K A;  3OPR A;  3T1X A;  4F94 A;  2ZQD A;  4JF4 A;  4Y5F A;  1VB6 A;  3T4S A;  2ZOH A;  4BL2 A;  1JWP A;  3ZFZ A;  1ZG6 A;  1FSY A;  4GB7 A;  4B4Z A;  3IS2 B;  3VOL A;  1N9N A;  3QP8 A;  5AVE A;  3LGO A;  1CEG A;  3DWK A;  3FKV A;  3MZF A;  2ZC3 B;  1S1Z A;  2C6W B;  2HJ9 C;  3E4P A;  1W79 A;  1L0F A;  2Z6D A;  2WKR A;  3QP1 A;  2RL3 A;  5FEF A;  5FEG A;  1QME A;  2UV0 E;  1MWT A;  1TEM A;  4XT2 A;  4WMC A;  3LIB A;  5CGS A;  4GKU A;  3GMW A;  4S2M A;  4KQO A;  3IH8 A;  5TGF A;  5CX7 A;  3TRC A;  1BZA A;  2EXB A;  3KSH A;  3IXH A;  3SW1 A;  3E2K A;  3B3X A;  2JKR M;  3OPP A;  3W8K A;  1YLT A;  2X02 A;  1D06 A;  1VM1 A;  4PKY G;  5EE8 A;  3PBN A;  1IYO A;  4KZA A;  5CGX A;  4OPQ A;  4E3I A;  1XFQ A;  1T1B A;  3H7W B;  2W3E A;  2Y2H A;  3A3I A;  1JVJ A;  4QJG A;  4MEZ A;  1IEM A;  3UME A;  3R7W B;  4S2O A;  5HL1 A;  3BW6 A;  1ZG4 A;  4BBU A;  1LSX A;  1PYY A;  2XRO A;  2HJE A;  3D3O A;  4PMA A;  1H5X A;  3IF5 A;  4KZ6 A;  4WEJ A;  3T1S A;  1MKI A;  1S4R A;  4GS9 A;  2OWJ A;  4PAU A;  3V39 A;  4GN2 A;  3UY6 A;  5IS1 A;  3A3E A;  3P98 A;  4UEY A;  2B18 A;  3H82 A;  2OWH A;  2PRF A;  4GDN A;  3ZNY A;  1JTD A;  1OTI A;  3Q1F A;  2WZZ A;  2HDS A;  1S1Y A;  2ZMA A;  4DN0 A;  1FCM A;  3DTK A;  2ZM0 A;  1HZO A;  3W4P A;  3E4Q A;  3RXX A;  4ZDX A;  3HVF A;  4KQQ A;  5G4Y A;  5EVI D;  4LEN A;  4P6Z M;  1T19 A;  3C7V A;  5CRF A;  5EFW A;  4WYY A;  3LEQ A;  3ITA A;  1F98 A;  4Y0U A;  2R9W A;  1PIO A;  3MZD A;  2EX6 A;  4WZ4 A;  3C5A A;  3A3D A;  4WN5 A;  5JYO A;  2V2F F;  5I94 A;  4EQ1 A;  5F5Y A;  2WAE A;  2JKF A;  4MCW A;  3PYP A;  4DXB A;  3C7U A;  2H0Y A;  4H6J B;  3M2J A;  3MF0 A;  3UMD A;  3LIA A;  2JN7 A;  5HW3 A;  2Q9N A;  1ALQ A;  1FR6 A;  3IBR A;  2WYX A;  3VP2 A;  4UQI S;  5EEC A;  1TDG A;  3CPT B;  4HH2 A;  5EVI C;  4P0M A;  1K57 C;  2QJ7 A;  3TW8 A;  1IKG A;  4R1G A;  2XFS A;  2WGW A;  4OPY A;  2AVX A;  1RCJ A;  4ETX A;  3KX0 X;  3SH9 A;  4Z9Q A;  4IED A;  2H0T A;  4E3M A;  4DE3 A;  3BM6 A;  5GHY A;  3TOI A;  3LY3 A;  1KGF A;  3PBO A;  4LLO B;  2Y2P A;  4L9E A;  4JF5 A;  3PBT A;  4C6Y A;  4B93 A;  4DMZ A;  2CC1 A;  5HX9 A;  1KGG A;  2W1R A;  4KQR A;  3LI9 A;  5L07 A;  4EUZ A;  1L2S A;  2VLG A;  5F1F A;  2XR0 A;  4MNR A;  3K3C A;  5L10 A;  1G6A A;  3B47 A;  1LT0 A;  3DW0 A;  3NBL A;  1NLZ A;  5FI7 A;  4HI4 A;  2W3H A;  1F5M A;  1ZHH B;  5HAI A;  4E04 A;  3NI9 A;  3S4X A;  1YLY A;  5IHV A;  3BY8 A;  3HLG A;  4WM9 A;  4G3W A;  3IH9 A;  2Y2G A;  4BBT A;  3BWL A;  4KZB A;  4EW7 A;  4IHQ A;  1W63 Q;  2EXA A;  4NK3 A;  5DJT A;  2FFY A;  4JXV A;  4R38 A;  5FI2 A;  4ZBE A;  1V9Z A;  2XD5 A;  3WS5 A;  2A2L A;  1YPR A;  3N8R A;  3T50 A;  3ZG7 B;  2Y2L A;  4R23 A;  1HVB A;  1I2S A;  4FTX A;  3GSG A;  1Z6F A;  1XKZ A;  4YIN A;  2M7V A;  3SOI A;  3IF6 B;  2OAP 1;  4BLM A;  4DE2 A;  4JXG A;  2WAD A;  1GHM A;  3F1O A;  2CMN A;  1K4F A;  4LV0 A;  4N1H A;  5FAO A;  4BMW A;  3T4Q A;  4N92 A;  1OTA A;  2C5W B;  2KX6 A;  1LL5 A;  3M2K A;  1MKM A;  3GEC A;  4Y0O A;  1FCO A;  2WKH A;  1N9O A;  3KSG A;  1XXM A;  3O5Y A;  2I9V A;  1YLJ A;  4EET B;  3D72 A;  2XSS A;  1XA7 A;  4NXG A;  1UGU A;  2E8I A;  1K4E A;  1F9I A;  4KZ3 A;  5DVA A;  4JKT A;  4R0Q A;  5HAP A;  1FR1 A;  5GLB A;  4GW9 A;  3SS4 A;  3NOP C;  4HP9 A;  3VSK A;  1VEU A;  5EVI A;  5DTS A;  1XGI A;  4WZ5 C;  3WWX A;  1T1C A;  1LL9 A;  4U0T A;  2UWX A;  3MQO A;  2QYB A;  4II7 A;  1VQQ A;  5CHJ A;  4MN6 A;  4KZ5 A;  2ZC6 B;  5DFY A;  4UAA A;  4OOL A;  4LPZ A;  1ZKJ A;  3KO6 A;  3TJZ C;  3WS4 A;  4OOM A;  2XA7 M;  2Y8H A;  3MQ0 A;  4HJ4 A;  4N1X A;  3VOZ A;  1KE0 A;  5DJU A;  3L7H A;  1ERO A;  1W7F A;  3OOV A;  4Y17 A;  3VE3 A;  2JKT I;  3S7N A;  3QNB A;  4BQM A;  4DJ3 A;  1KDS A;  1S4S A;  1XP4 A;  2PBY A;  2HDR A;  4ARZ B;  5FAS A;  3WS1 A;  1STZ A;  1YSQ A;  5F82 A;  1XJ6 A;  5HWT A;  4Z1W A;  1K55 A;  3OC2 A;  3P01 A;  1TS8 A;  1O07 A;  4B9O A;  1Y28 A;  4Y0T A;  2VK3 A;  5J7E A;  3P09 A;  2J3W A;  3MFD A;  3D9Y A;  2J7V A;  3WS2 A;  3IXD A;  1TVF A;  3VMA A;  3OCL A;  2H5S A;  2PDR A;  2ZC7 A;  3HLC A;  4S2I A;  3PBR A;  3FZC A;  3G2Z A;  3WRT A;  4HHD A;  2KDK A;  4R6L A;  5FAP A;  1PZO A;  1KOU A;  4PM8 A;  1ACF A;  4LCM A;  4EUV A;  4KQD A;  3O88 A;  5HL6 A;  5CXW A;  2DCF A;  3S22 A;  3UB9 A;  1NXY A;  4I3A A;  3ZVW A;  4S2J A;  2XFT A;  3ZG0 A;  1BUL A;  1L3L A;  4O7D A;  4I3J A;  1UWP X;  1Y4O A;  2HP5 A;  1X0O A;  1NY0 A;  5A90 A;  1MPL A;  1AWI A;  3UB5 P;  2WGV A;  2P9V A;  3ZVT A;  5J4E A;  4WBG A;  2QMI A;  4LGW A;  3K3D A;  1WE4 A;  1E3U D;  2VV8 A;  1Y54 A;  2I72 A;  2B02 A;  2VX8 A;  3B33 A;  3CHW P;  1K0K A;  2O9A A;  4R3A A;  3S7Q A;  4R3B A;  3CWF A;  3D4F A;  3CJM A;  4QPR A;  5EM1 A;  1SZV A;  3N7W A;  4IUK A;  2K31 A;  2VV7 A;  2O0Y A;  3MXR A;  4CLC A;  5FA7 A;  1FQG A;  4BD1 A;  3HLE A;  2Y2M A;  5TBM B;  3KYZ A;  3LEZ A;  1OJ5 A;  5TFQ A;  4MMN A;  1MC0 A;  3SZT A;  3G30 A;  3NOU C;  3LUQ A;  4JLF A;  3IX8 A;  2KLI A;  2V0W A;  3ULF A;  4CLC E;  3ISG A;  3ZG9 B;  1ONH A;  4FCF A;  1QMF A;  5A93 A;  4UA6 A;  2VGL M;  3EEA A;  1WYB A;  1MZU A;  4WEL A;  1OTB A;  3IS2 A;  4KUK A;  2PU2 A;  2W3D A;  2Y59 A;  3JPU A;  3DTM A;  4DRT A;  5DF9 A;  5HWV A;  1CK3 A;  5HFO A;  2WGI A;  4H8R A;  2YKF A;  2V20 A;  2XRN A;  3HL9 A;  4JGP A;  3G6O A;  3HUO A;  4EBL A;  3FPW A;  4RX2 A;  5CTM A;  5M1A A;  4DE0 A;  1CI9 A;  3AGE A;  1YLZ A;  4R4R A;  4D2O A;  1TS0 A;  2V0U A;  4PM5 A;  4X6T A;  1ESI A;  2G7U A;  4ETZ A;  1ES4 A;  4PHT A;  5FDH A;  4QWO A;  1JNU A;  4MN5 A;  5GLA A;  5F83 A;  1ES3 A;  4HJ3 A;  4MBK A;  4OQG A;  4NET A;  5KZH A;  3LR4 A;  3NCK A;  4Y7P A;  1W5D A;  1TDL A;  3C2W A;  1TD5 A;  2JKG A;  5HPF A;  2OLU A;  3G31 A;  1U60 A;  3O86 A;  3HJK A;  1VET A;  4Y13 A;  1BLS A;  1E4D A;  3JVV A;  3MR0 A;  3M6H A;  3R7W A;  4GS9 B;  4Q0I A;  2Y4A A;  3EEH A;  3NC8 A;  5L8M A;  3ZQ5 A;  5M18 A;  4OQ0 A;  3PAG A;  3QP2 A;  3H82 B;  4NXE A;  5GL9 A;  2VV6 A;  2V1Z A;  4LRY C;  4EER A;  5HDS A;  1E25 A;  3UNW A;  2W1T A;  1PFL A;  3BFE A;  5GLC A;  1CJF A;  4X1L A;  3F1N A;  4EU0 A;  1DRM A;  4OP8 A;  3T4O A;  4EBN A;  4X55 A;  3UPN A;  1K6R A;  3HCY A;  3ZGA B;  5J3W A;  4BD0 A;  2OLV A;  3DTI A;  4A5R A;  3V3S A;  1YMX A;  2ZMF A;  4GHI B;  2ZM2 A;  3F1P B;  5C5K A;  3BLM A;  4PM7 A;  3IF6 C;  2OOL A;  3OCN A;  1YSP A;  4FD8 A;  3BFF A;  1W63 M;  2IWC A;  2WZX A;  3JYI A;  3GVB A;  3N8L A;  1PNE A;  4NKP A;  4OON A;  1H8M A;  4FUW A;  4GDB A;  2E8J A;  2XQZ A;  4KZ7 A;  3UO9 A;  4KEN B;  2JHE A;  2EX9 A;  3VP4 A;  2QJ5 A;  2PYP A;  4M3K A;  4PM9 A;  3IBJ A;  1GA0 A;  3IX3 A;  4ZRR A;  1MBL A;  1S66 L;  3IHB A;  3CUE C;  1O7E A;  4I38 A;  5FDS A;  1K54 C;  4OQH A;  2WGW B;  2RCX A;  2HDQ A;  4DJ2 A;  4K0W A;  3OPH A;  1NRF A;  1DP9 A;  3PTE A;  1MXO A;  1KE4 A;  3E2L A;  3CPT A;  2MJ6 A;  3NHQ A;  1MY8 A;  3E4O A;  5CER A;  3MKF A;  1GSW A;  3AGF A;  3CI6 A;  3GDI A;  2PR5 A;  3UB7 A;  1HD8 A;  1Z09 A;  3IX4 A;  2M7U A;  5BOH A;  5E2E A;  2B95 A;  2JKT M;  2VGJ A;  5E2H A;  2O9C A;  4DF6 A;  3BQA A;  4QD4 A;  1T18 A;  1KE3 A;  4ESP A;  1Q2Q A;  3P7N A;  3Q07 A;  5CEB A;  2W3F A;  4HBU A;  4HOI A;  4LV3 A;  2WKE A;  2VA0 A;  2XA7 S;  3GR2 A;  5FQK A;  4FOF A;  2EFX A;  3T4J A;  3FC7 A;  4GD6 A;  1K56 D;  4MBH A;  3T4T A;  1D7E A;  4I39 A;  5FQI A;  2O9B A;  4LRX C;  5KSH A;  4DXC A;  1DJC A;  2PU4 A;  2P04 A;  1IYQ A;  2P08 A;  1L0E A;  2WKI A;  4LV2 A;  4OKP A;  4QY5 A;  2XGN A;  2HF6 A;  3HLW A;  4L0L A;  4BJP A;  5J8X A;  3FYZ A;  5EVE A;  3L9K A;  4ZJ2 A;  1KVL A;  2FH5 A;  3HRE A;  5GLD A;  3Q7V B;  3S7P A;  3VP1 A;  1OTD A;  5DTK A;  1SKO A;  4PM6 A;  4QB8 A;  3ZG8 B;  2WKQ A;  1K6S A;  3H9W A;  4UHU A;  5GHZ A;  1GHI A;  4HJ6 A;  2ZQA A;  4RA7 A;  5L09 A;  4GNU A;  1XX2 A;  3NJA A;  5HAR A;  4EEP A;  3ICY A;  3HBR A;  3VFH A;  4JBF A;  3MXQ A;  1N9L A;  2ZJ9 A;  3IF6 A;  5DF8 A;  5FQJ A;  4NXB A;  3OLO A;  4MN7 A;  5U47 A;  1L0G A;  3OPL A;  1FIK A;  3CAX A;  3RTY A;  1ONG A;  4UQI M;  4CPK A;  1NYM A;  2FFF B;  5EOE A;  4JGR A;  4IVK A;  4F3L B;  4OP5 A;  4JXS A;  4R4S A;  4Q8I A;  3EGD C;  4S2N C;  3Q7Z A;  5JYP A;  4DDS A;  1RGZ A;  1K57 A;  3LI8 A;  2O99 A;  1CEF A;  2XK1 A;  3T1Q B;  4GZB A;  4LFU A;  2INW A;  4LCL A;  1V9Y A;  3HJI A;  5DFX A;  2PD7 A;  4WMC D;  2HP6 A;  3KYE A;  3Q81 A;  1P9R A;  1ZC2 A;  4GD8 A;  3UDF A;  3V5M A;  2Y79 A;  1LL8 A;  1G6O A;  3HLF A;  3CG5 A;  2W0N A;  1N4O A;  1BSG A;  2JC7 A;  3BYD A;  3RH8 B;  5HZH A;  1KDW A;  3C4P A;  1XGJ A;  3R4K A;  2VGK A;  3VFF A;  2HPB A;  1Q2P A;  4Y3I A;  2P74 A;  3UPP A;  2L0W A;  2ZBB A;  5EVL A;  3UN7 A;  3VP3 A;  4EQI A;  2J8Y A;  4RX3 A;  3TSG A;  3UE6 A;  3VP0 A;  4OPZ A;  4QHC A;  1OT9 A;  1RP5 A;  3O87 A;  2DNS A;  2VGL S;  4ARZ A;  3DBA A;  1SKF A;  4XXR A;  4X53 A;  3IQA A;  2ZQ7 A;  1IOU A;  5FL3 A;  4DKI A;  5F1G A;  2NUT C;  4CJN A;  3BRM A;  4K91 A;  4Q0J A;  4PKY A;  3V3R A;  3LFV A;  3S7O A;  5CTN A;  2A24 A;  2EA9 A;  3LIE A;  1CF0 A;  1NWZ A;  5E43 A;  2DRW A;  5FI6 A;  1I5Q A;  3UDX A;  4HIA A;  1VHM A;  1PRQ A;  3KSF A;  4KG2 A;  1XA1 A;  2Y2K A;  2V9A A;  3ZYT A;  2A3U A;  4ZJ3 A;  3EWK A;  3BEB A;  2HGV A;  3QNC A;  3IWO A;  4E3L A;  2Y2J A;  4HQA A;  2EWW A;  1K56 A;  4OH0 A;  5F68 A;  1GCE A;  4O8G A;  2IWB A;  1C3B A;  2EFU A;  3PR6 A;  4EEU A;  1M6K A;  2QHK A;  4E6X A;  5MC7 A;  1YQS A;  3RJU A;  4G3K A;  1G68 A;  3OBF A;  5HD5 A;  2XD1 A;  2ZL1 B;  2DMW A;  3T12 B;  2PYR A;  3LO7 A;  1D1J A;  5FQ9 A;  1IEL A;  4KZ4 A;  2OV5 A;  1LI0 A;  3I7J A;  3ZDJ A;  3GV9 A;  1LLB A;  3UDI A;  5I5L A;  4E6W A;  2J9O A;  4WZ5 A;  2V1B A;  1GHP A;  3V67 A;  5FAQ A;  2Y2I A;  2WUQ A;  3U4L P;  1YLP A;  1S0W A;  4CLC B;  4D60 A;  3G2Y A;  5EPH A;  3C38 A;  3NOT C;  1PZP A;  4HBT A;  4NG2 A;  1ERQ A;  3V50 A;  4P6Z S;  2BAS A;  1XJ4 A;  2PHY A;  2ZC4 B;  2BLS A;  2Q9M A;  4JGO A;  3G32 A;  3IXB A;  5TBM A;  1MWR A;  3CZD A;  4RQ9 A;  5LBR A;  2PAV P;  2Y2O A;  3RXW A;  2GX5 A;  4S2K A;  4EES A;  2B5R A;  3KYQ A;  4HH3 A;  1PW8 A;  4XT2 B;  2W27 A;  5HWW A;  3MQQ A;  2L1M A;  3UE0 A;  1EI5 A;  1JWZ A;  4FH4 A;  3WS0 A;  3MJQ A;  4U3T A;  2ZM8 A;  4RYE A;  3SS5 A;  1IKI A;  3SH8 A;  3UE1 A;  1LSV A;  2NUP C;  3OZH A;  5AQB A;  1OPX A;  4OLD A;  3A0R A;  5EUA A;  4NXF A;  2QZ6 A;  2XH9 A;  3HUN A;  4JXW A;  3SH7 A;  1H0M A;  1AXB A;  4AFI A;  1NYY A;  3A0V A;  1XPB A;  1SDN A;  2Y55 A;  4U0X A;  5CHM A;  3FWL A;  3QP4 A;  3U2A A;  5L2F A;  1UWN X;  5CED A;  4S2L A;  3NDE A;  4YFM A;  1JTG A;  3ZG5 A;  2Z6C A;  3H7W A;  1VET B;  5GHX A;  4Y2F A;  4R3J A;  5F69 A;  1HTZ A;  4PPR A;  4WEK A;  1YM1 A;  2ZQ8 A;  2WAF A;  3FKW A;  2YKH A;  3CLO A;  3A0S A;  4QU3 A;  2J3T D;  4C3Q A;  1BLC A;  1YAX A;  5E2F A;  4HP4 A;  4CQH A;  1G28 A;  2PR6 A;  3O3V A;  1LHY A;  4HES A;  4R70 A;  3BEC A;  4IBX A;  4NEE D;  5KMW A;  2VJW A;  3AGD A;  2H28 A;  2W1T B;  4N9L A;  1YLW A;  2HV1 A;  1BLH A;  5HDD A;  3LIC A;  2WKP A;  2PBD P;  3EQU A;  3MFX A;  3F1N B;  4YWZ A;  4ZAM A;  2L4R A;  2LB9 A;  3CIT A;  3UB6 A;  1OTE A;  3LIF A;  2Q0O A;  4GCZ A;  3MZE A;  5G18 A;  5TR7 A;  1W8Y A;  3FG8 A;  4C75 A;  4EWF A;  3T1R A;  5DF7 A;  3LY4 A;  3NY4 A;  3MMH A;  3G34 A;  3RFB A;  4EXO A;  3HLD A;  4YNR A;  2J3T C;  4GHI A;  1XJ3 A;  5EM0 A;  3F1P A;  4GJ4 A;  3QHY A;  5IU1 A;  2ACG A;  2QPN A;  3PBQ A;  1S67 L;  1E3U A;  4I3I A;  3LR3 A;  3PBS A;  3DWZ A;  3NUL A;  1BYW A;  5KIZ A;  3GTC A;  4P6B A;  4OPR A;  4H6J A;  4X25 A;  1W8Q A;  3B42 A;  3Q82 A;  3TG9 A;  2JBF A;  2Y91 A;  1XFN A;  1J3W A;  3LR5 A;  1EWZ A;  3HLB A;  2D02 A;  3IXG A;  3N8S A;  2V8F A;  1DY6 A;  4O01 A;  3LR0 A;  1YKD A;  4Y15 A;  3GRJ A;  3A3J A;  3MSH A;  1IYS A;  5CGW A;  4DDY A;  2BTF P;  1RGY A;  5HPI A;  2EX2 A;  2PD8 A;  4X68 A;  4WL9 A;  5CHU A;  2R78 A;  3DAV A;  3W4Q A;  1BT5 A;  1ES2 A;  1WYC A;  5A92 A;  2QKP A;  4K08 A;  2XLN A;  2H10 A;  4HEF A;  2M1C A;  3BFD A;  3EOI A;  2LB5 A;  1EW0 A;  4GLQ A;  1OT6 A;  1NLY A;  3PXP A;  5AJG A;  5AQA A;  3BQ8 A;  3EQV A;  3N4I A;  4LV1 A;  1NZU A;  2GZA A;  4ZJ1 A;  5DKL A;  4GOG A;  4FSF A;  2JKR I;  3TE8 A;  3BLS A;  5DTT A;  3FPV A;  1T1A A;  4JPM A;  1HLU P;  3M6B A;  5HDC A;  3T4L A;  3QP6 A;  3NIA A;  2HZ5 A;  2XDM A;  1TS7 A;  1L0D A;  2J9P A;  1K55 C;  4KZ9 A;  2QWS A;  3ZHH A;  1S6R A;  2W3G A;  4WUJ A;  1SHV A;  3BFC A;  4K0X A;  4IJG A;  4ZTK A;  4IUH A;  2A49 A;  5AVF A;  5EOO A;  5FAT A;  2IWD A;  1ERM A;  1TS6 A;  4B4X A;  3C4O A;  1GA9 A;  4L9G A;  3MS6 A;  3IT9 A;  4M4X A;  1H3Q A;  4E3J A;  4E3K A;  1SKO B;  2K2N A;  4KG5 A;  4DE1 A;  2ZD8 A;  3JVU A;  2J80 A;  4IBR A;  4RVA A;  1H8Z A;  3F1O B;  3SS3 A;  3Q7V A;  5A91 A;  3G35 A;  1CQA A;  3K2N A;  1FSW A;  1DJA A;  4X69 A;  4Q0H A;  1MWU A;  2ZLY A;  3LID A;  2ZC5 B;  4G3V A;  1P97 A;  5FQM A;  4CLC D;  4KG6 A;  5M19 A;  1PI4 A;  4MBF A;  1SDE A;  1GSV A;  2Y2Q A;  4WLA A;  3MKE A;  1SCW A;  1DP6 A;  1K25 A;  1LI9 A;  4ME4 A;  4X1M A;  4P87 A;  3BJN A;  2G2W A;  4MLL A;  3GQZ A;  1ESU A;  1VEU B;  1H8Y A;  4XUX A;  1PWC A;  5EVI B;  3CUE A;  4I5S A;  5DKK A;  1K54 A;  1FCN A;  1YT4 A;  4LRZ E;  4FH2 A;  4F3L A;  3WRZ A;  1F2K A;  5FQQ A;  5KSC A;  2D01 A;  1BLP A;  3MBZ A;  1P9W A;  1DP8 A;  3IWI A;  1PWG A;  4XUZ A;  2ZMV A;  3KSI A;  1FOF A;  2GJ3 A;  1MWS A;  2ZQ9 A;  2HP9 A;  3VOY A;  4OQI A;  1N9B A;  1GSX A;  4CLC C;  2K7S A;  3LCE A;  2GDN A;  3W2Z A;  1PI5 A;  2OSU A;  1PW1 A;  4EBP A;  3FV7 A;  1ZTU A;  4UA9 A;  5HAQ A;  4N9K A;  1FIL A;  5IT5 A;  2Z2L B;  3VE4 A;  5G4Z A;  2JE5 A;  4KZ8 A;  2HDU A;  4BL3 A;  2Y2N A;  1ODV A;  5A8B A;  3DTE A;  2G2U A;  2PT7 A;  2XF3 A;  1BTL A;  3A3F A;  3N6I A;  1TF1 A;  2OAQ 1;  2ZOI A;  2BG1 A;  5HD3 A;  4IVI A;  1NZO A;  3E98 A;  2IA2 A;  1ES5 A;  2R9X A;  3UB8 A;  3IWQ A;  3C8C A;  1NJ4 A;  3G4P A;  1OME A;  1P0Z A;  5HSQ A;  1OJG A;  3ZCZ A;  1WA9 A;  2KOI A;  2VKS A;  1KVM A;  4OOY A;  4O0P A;  4UA7 A;  2A24 B;  4HY8 A;  4HNB A;  4KUO A;  1KGE A;  2WK0 A;  3UE3 A;  4BEN A;  3S1Y A;  2ZQC A;  3IHA A;  4OVD A;  5TJJ A;  3PAE A;  5EV0 A;  4P85 A;  1JWV A;  1M40 A;  2VZW A;  1J9M A;  3LYX A;  2V1A A;  5E2G A;  1G5U A;  1I2W A;  3NEC A;  3T4K A;  3VV4 A;  1DJB A;  4ID4 A;  1LSW A;  2EX8 A;  3MXS A;  2X71 A;  4E3N A;  4JF6 A;  4WF0 A;  4S2P A;  5CEC A;  1XJ2 A;  4OLG A;  5D3O A;  1YMS A;  2JCH A;  3BFG A;  3HUM A;  1CI8 A;  3BY9 A;  2VEA A; 
#chains in the Genus database with same CATH homology
 4MDZ A;  3U2A A;  1GSW A;  3CI6 A;  3NOP C;  4BWI A;  4HP9 A;  3GDI A;  2PR5 A;  3UB7 A;  1UWN X;  2P7J A;  4GW9 A;  2M7U A;  1NRJ A;  3C30 A;  2FZ0 A;  2EWV A;  2JKT M;  2Z6C A;  3H7W A;  1T1C A;  5K5B A;  2O9C A;  4Y2F A;  3PHY A;  3BQA A;  5F69 A;  3MQO A;  4WEK A;  1T18 A;  2GNX A;  2QYB A;  4II7 A;  1IFQ A;  5F6A A;  2YKH A;  3CLO A;  3EGX C;  3P7N A;  4MN6 A;  3A0S A;  4YOF A;  4BBV A;  5DFY A;  2W3F A;  4HOI A;  2J3T D;  1YAX A;  4HP4 A;  4CQH A;  1G28 A;  2PR6 A;  2VA0 A;  4OOL A;  4LPZ A;  3KO6 A;  2XA7 S;  3TJZ C;  4L9F A;  4FOF A;  3T4J A;  4OOM A;  4R70 A;  2XA7 M;  2Y8H A;  3FC7 A;  3MQ0 A;  4HJ4 A;  3T4T A;  4NEE D;  1D7E A;  5DJU A;  2VJW A;  4JGQ A;  2H28 A;  2W1T B;  3E0Y A;  2HV1 A;  4I39 A;  3OOV A;  3LIC A;  5HDD A;  3VE3 A;  2WKP A;  3EQU A;  3MFX A;  3F1N B;  2JKT I;  2O9B A;  4YWZ A;  4LRX C;  3S7N A;  5KSH A;  2L4R A;  4DJ3 A;  2LB9 A;  3CIT A;  1S4S A;  3UB6 A;  1OTE A;  3LIF A;  2P04 A;  2P08 A;  4GCZ A;  4ARZ B;  4Y5F A;  3FG8 A;  1VB6 A;  1STZ A;  2HF6 A;  3T4S A;  1YSQ A;  2ZOH A;  1XJ6 A;  5HWT A;  4Z1W A;  4L0L A;  4BJP A;  3IS2 B;  3VOL A;  1N9N A;  3OC2 A;  3P01 A;  5AVE A;  1TS8 A;  3MMH A;  4B9O A;  2FH5 A;  3RFB A;  4EXO A;  1Y28 A;  3S7P A;  1OTD A;  1S1Z A;  2J3T C;  4GHI A;  4YNR A;  2HJ9 C;  1XJ3 A;  3E4P A;  5J7E A;  2J3W A;  3F1P A;  4GJ4 A;  2Z6D A;  5IU1 A;  2WKR A;  2WKQ A;  3PBQ A;  3H9W A;  1S67 L;  4I3I A;  4HJ6 A;  3LR3 A;  3PBS A;  3OCL A;  4XT2 A;  2PDR A;  1BYW A;  5KIZ A;  3NJA A;  4H6J A;  3B42 A;  3LIB A;  1XFN A;  3ICY A;  3PBR A;  4EEP A;  3MXQ A;  3LR5 A;  1N9L A;  4KQO A;  5CX7 A;  4HHD A;  3TRC A;  2KDK A;  4R6L A;  4NXB A;  2D02 A;  3OLO A;  4MN7 A;  3KSH A;  1KOU A;  4O01 A;  3LR0 A;  1YKD A;  3CAX A;  3SW1 A;  3RTY A;  4UQI M;  4EUV A;  2JKR M;  4KQD A;  4JGR A;  4F3L B;  5HL6 A;  3UB9 A;  3EGD C;  1D06 A;  5HPI A;  2PD8 A;  4I3A A;  4PKY G;  4WL9 A;  4I3J A;  3PBN A;  2R78 A;  1UWP X;  1XFQ A;  1T1B A;  1X0O A;  3LI8 A;  3H7W B;  2W3E A;  2O99 A;  2QKP A;  4K08 A;  2M1C A;  3UME A;  5J4E A;  3R7W B;  2INW A;  3K3D A;  1V9Y A;  3BW6 A;  3HJI A;  3EOI A;  2LB5 A;  1EW0 A;  4GLQ A;  2VV8 A;  2B02 A;  1OT6 A;  1NLY A;  3PXP A;  4BBU A;  5AJG A;  1LSX A;  2XRO A;  3BQ8 A;  3EQV A;  5DFX A;  2VX8 A;  2HJE A;  3B33 A;  2PD7 A;  3D3O A;  2O9A A;  4R3A A;  2GZA A;  1P9R A;  3S7Q A;  3CWF A;  5DKL A;  4WEJ A;  4FSF A;  2JKR I;  3TE8 A;  1S4R A;  4QPR A;  4GS9 A;  2OWJ A;  4PAU A;  2Y79 A;  3FPV A;  1LL8 A;  5IS1 A;  1G6O A;  4IUK A;  1T1A A;  2K31 A;  2VV7 A;  2W0N A;  5HDC A;  3T4L A;  2O0Y A;  4UEY A;  2B18 A;  3H82 A;  4CLC A;  2OWH A;  3RH8 B;  5HZH A;  1TS7 A;  1OTI A;  3R4K A;  5TBM B;  1S1Y A;  4Y3I A;  3KYZ A;  4DN0 A;  1OJ5 A;  4MMN A;  1MC0 A;  2QWS A;  2W3G A;  2L0W A;  3E4Q A;  2ZBB A;  3NOU C;  5G4Y A;  3LUQ A;  4WUJ A;  4IJG A;  4P6Z M;  2KLI A;  3UE6 A;  4IUH A;  2V0W A;  1T19 A;  3ULF A;  5AVF A;  5EFW A;  1F98 A;  1TS6 A;  4CLC E;  1OT9 A;  4L9G A;  2VGL S;  4M4X A;  4ARZ A;  1H3Q A;  2VGL M;  3DBA A;  3EEA A;  2K2N A;  4WN5 A;  1IOU A;  1MZU A;  5FL3 A;  4WEL A;  3JVU A;  1OTB A;  3IS2 A;  2NUT C;  4KUK A;  2J80 A;  5F5Y A;  4EQ1 A;  2W3D A;  4Q0J A;  4PKY A;  3LFV A;  3F1O B;  4MCW A;  3PYP A;  3S7O A;  5DF9 A;  5HWV A;  3K2N A;  2A24 A;  4H6J B;  2EA9 A;  3LIE A;  3MF0 A;  4Q0H A;  2YKF A;  3LID A;  1NWZ A;  3UMD A;  2XRN A;  4JGP A;  4G3V A;  3G6O A;  3LIA A;  2JN7 A;  1P97 A;  3FPW A;  4CLC D;  3IBR A;  4HIA A;  1VHM A;  3KSF A;  4UQI S;  1TS0 A;  1GSV A;  2V0U A;  4WLA A;  4HH2 A;  2V9A A;  3ZYT A;  3EWK A;  2QJ7 A;  2HGV A;  3TW8 A;  2G7U A;  1DP6 A;  4ETZ A;  4ME4 A;  4HQA A;  4PHT A;  2EWW A;  3BJN A;  1JNU A;  4MN5 A;  4ETX A;  5F68 A;  3KX0 X;  4O8G A;  4HJ3 A;  3PR6 A;  3CUE A;  4I5S A;  4EEU A;  5DKK A;  3LR4 A;  2QHK A;  5MC7 A;  4LRZ E;  4F3L A;  3C2W A;  1TD5 A;  4G3K A;  2D01 A;  3OBF A;  5HD5 A;  3PBO A;  1P9W A;  4LLO B;  5HPF A;  4L9E A;  1DP8 A;  2DMW A;  3PBT A;  2PYR A;  4B93 A;  4DMZ A;  2ZMV A;  3HJK A;  3KSI A;  3JVV A;  2GJ3 A;  2W1R A;  3MR0 A;  3LI9 A;  1GSX A;  3R7W A;  4CLC C;  4GS9 B;  2K7S A;  5I5L A;  4Q0I A;  3EEH A;  2VLG A;  2V1B A;  3W2Z A;  5L8M A;  3V67 A;  3K3C A;  3B47 A;  3ZQ5 A;  1LT0 A;  1ZTU A;  3H82 B;  1NLZ A;  4NXE A;  4CLC B;  4HI4 A;  5IT5 A;  2VV6 A;  2W3H A;  3VE4 A;  1F5M A;  3C38 A;  3NOT C;  5G4Z A;  1ZHH B;  4LRY C;  4E04 A;  4EER A;  1ODV A;  5HDS A;  5A8B A;  2W1T A;  4P6Z S;  2BAS A;  2PT7 A;  1XJ4 A;  2PHY A;  3BY8 A;  3F1N A;  4EU0 A;  1TF1 A;  2OAQ 1;  1DRM A;  3T4O A;  4G3W A;  2ZOI A;  4JGO A;  3HCY A;  5J3W A;  5HD3 A;  5TBM A;  2ZMF A;  3E98 A;  4RQ9 A;  4BBT A;  3BWL A;  5LBR A;  4EW7 A;  4IHQ A;  1W63 Q;  2IA2 A;  4GHI B;  5DJT A;  4R38 A;  3F1P B;  1V9Z A;  5C5K A;  3UB8 A;  2GX5 A;  3C8C A;  4EES A;  3KYQ A;  4HH3 A;  2A2L A;  1P0Z A;  3T50 A;  5HSQ A;  1OJG A;  1WA9 A;  2KOI A;  2OOL A;  2VKS A;  2W27 A;  4XT2 B;  5HWW A;  3OCN A;  3MQQ A;  2L1M A;  1YSP A;  1W63 M;  4O0P A;  2A24 B;  4HY8 A;  4NKP A;  2M7V A;  1H8M A;  3MJQ A;  4HNB A;  2OAP 1;  4KUO A;  3UE3 A;  2JHE A;  5TJJ A;  1LSV A;  2QJ5 A;  2PYP A;  2CMN A;  3F1O A;  3IBJ A;  2VZW A;  2NUP C;  3LYX A;  2V1A A;  4BMW A;  1OPX A;  4ZRR A;  3T4Q A;  1S66 L;  3A0R A;  1OTA A;  2KX6 A;  3CUE C;  3T4K A;  4I38 A;  3VV4 A;  1MKM A;  4NXF A;  3GEC A;  1LSW A;  1N9O A;  3KSG A;  3O5Y A;  4WF0 A;  4DJ2 A;  2I9V A;  4EET B;  3D72 A;  2XSS A;  4NXG A;  1UGU A;  1DP9 A;  1F9I A;  1XJ2 A;  4AFI A;  3A0V A;  2MJ6 A;  3BY9 A;  2VEA A;  3NHQ A;  3E4O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...