2YKHA

Sensor region of a sensor histidine kinase
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
285
structure length
265
Chain Sequence
STLGDLLAEHTVLPGSAVDHLHAVVGEWQLLADLSFADYLMWVRRDDGVLVCVAQCRPNTGPTVVHTDAVGTVVAANSMPLVAATFSHSVEVSPVRFGDQVVAVLTRHQPELAARRRSGHLETAYRLCATDLLRMLAEGTFPDAGDVAMSRSSPRAGDGFIRLDVDGVVSYASPNALSAYHRMGLTTELEGVNLIDATRPLISDPFEAHEVDEHVQDLLAGDGKGMRMEVDAGGATVLLRTLPLVVAGRNVGAAILIRDVTEVKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords PROBABLE SENSOR HISTIDINE KINASE PDTAS
publication title The Sensor Region of the Ubiquitous Cytosolic Sensor Kinase, Pdtas, Contains Pas and Gaf Domain Sensing Modules.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
total genus 67
structure length 265
sequence length 285
chains with identical sequence B
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2011-05-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12282 H_kinase_N Signal transduction histidine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2ykhA02
3.30.450.280 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2ykhA01
4XT2B 4LRYC 4GS9B 1XJ3A 3IS2B 2VV7A 4HHDA 3LIBA 5F6AA 1T19A 4WUJA 3BWLA 5DKKA 3BY9A 2QJ5A 5J7EA 1NWZA 4MN5A 3UB7A 3HJIA 1GSWA 3BY8A 3LI9A 5TBMA 4DJ3A 4LLOB 2QJ7A 3GECA 1TS0A 4LRXC 4B9OA 5IS1A 1BYWA 2Z6CA 1ODVA 5F69A 1XFQA 3H7WB 1DP8A 4NXEA 1LL8A 3HJKA 1TS6A 3E4QA 3VOLA 4H6JB 4EEPA 3MQQA 5HD5A 2CMNA 4I5SA 5HWVA 3F1OA 4WL9A 5KIZA 5I5LA 4I38A 1OTIA 1XJ2A 4PKYA 1LSWA 2P7JA 1XFNA 4HP4A 5EFWA 3FG8A 1X0OA 5HDDA 3EEHA 3PYPA 1OTEA 4F3LA 4GHIB 3CAXA 5G4YA 2W0NA 2L0WA 4YWZA 4NXBA 2A24A 2VLGA 1UGUA 3LIDA 4NXFA 4K08A 4KQDA 1OT9A 1LT0A 3C8CA 2PYPA 1S4SA 4HNBA 4EESA 1V9YA 5J4EA 4L9EA 1P0ZA 1OTDA 3G6OA 1T1CA 1N9OA 4E04A 3VE3A 2ZOHA 3LI8A 3LICA 2PR5A 4BBVA 1DP6A 5HD3A 4GCZA 4HJ4A 3H82B 2OWHA 2QHKA 2J80A 3LIAA 4XT2A 4GS9A 2L4RA 2QKPA 3CLOA 1UWPX 2D01A 3E4OA 2YKFA 1N9NA 2B02A 2KDKA 4JGQA 3UB9A 2WKQA 3FC7A 4HI4A 1TS8A 3F1PA 3MJQA 1TS7A 4R70A 1S1YA 3NOTC 3F1OB 5DJTA 3K3DA 4I3IA 4EQ1A 2V9AA 2GJ3A 5HWTA 5HDSA 3IBRA 3ICYA 1MZUA 5A8BA 2OOLA 2VV6A 1LSXA 1KOUA 3UMDA 2PD8A 1XJ4A 2Z6DA 4I3AA 3H7WA 3MR0A 1DRMA 1OTAA 1GSXA 5HWWA 4H6JA 3NOPC 5F68A 3VE4A 2A24B 3D72A 4EW7A 2H28A 4EEUA 1T18A 4EETB 3F1NB 4KUOA 1JNUA 2D02A 3RH8B 4HH2A 4NXGA 2V0WA 4L9GA 3A0VA 2VV8A 3GDIA 4KUKA 4MN6A 4M4XA 5HSQA 2K7SA 3UB6A 4HY8A 3P7NA 2WKRA 4R38A 2V1AA 4JGPA 1T1AA 1LSVA 5F5YA 1S1ZA 1V9ZA 3A0SA 2EA9A 3MQOA 4RQ9A 3A0RA 2VEAA 1OJ5A 3KX0X 4BBTA 3NOUC 5DJUA 3ZQ5A 5TBMB 4DJ2A 4HIAA 4JGOA 1S67L 4BBUA 3IS2A 3LIFA 4L9FA 1N9LA 4LPZA 3MXQA 4HOIA 2PHYA 3SW1A 1S66L 5AVFA 3E4PA 1D7EA 4R3AA 2WKPA 3F1PB 2W27A 2QWSA 5HDCA 4WLAA 2HV1A 4HQAA 3ULFA 2V1BA 3H82A 4I3JA 4JGRA 4WN5A 1GSVA 1Y28A 4R6LA 3PHYA 2BASA 4HP9A 2L1MA 2PDRA 3LYXA 1UWNX 2PYRA 2PR6A 2I9VA 4EERA 4HJ6A 3T50A 5HZHA 5G4ZA 2YKHA 3K3CA 2ZOIA 3NJAA 1OT6A 1P97A 3CWFA 4I39A 1G28A 3OLOA 2R78A 1S4RA 1F98A 4EXOA 4F3LB 4PKYG 3NHQA 2JN7A 3EWKA 1XJ6A 3UB8A 5J3WA 5DKLA 1T1BA 3UE6A 1F9IA 4LRZE 2KX6A 3RTYA 2ZBBA 4GW9A 1DP9A 3MFXA 2M1CA 3LUQA 1EW0A 3C2WA 3LIEA 1OTBA 4HJ3A 3UMEA 3B33A 2PD7A 4GHIA 2OWJA 2INWA 1WA9A 4HH3A 5AVEA 1OJGA 3F1NA 3H9WA 1VB6A 2JHEA 1D06A 5IU1A 2V0UA 4WF0A
chains in the Genus database with same CATH superfamily
2P08A 4XT2B 5M19A 1GHPA 3MS6A 2MJ6A 1MY8A 3VOYA 3QP6A 3RXXA 3M6HA 3ZYTA 2P04A 3R4KA 1K54A 3PBTA 4G3WA 3G35A 4WUJA 2WK0A 1ZHHB 4E6XA 4OPRA 2QJ5A 3UDXA 3CITA 4GOGA 3WS4A 3DTEA 5HPIA 3T1XA 3FZCA 3HJIA 1GSWA 4LLOB 2QJ7A 5IS1A 1NLYA 1BYWA 1YLJA 4RX3A 3PR6A 2BLSA 2XA7S 3CHWP 1CJFA 4ZBEA 1DY6A 1XFQA 4KZ6A 4Q0HA 3ZG9B 2Y79A 2O0YA 3AGEA 3E4QA 3VOLA 4EEPA 5EOEA 5HD5A 3MSHA 3KSIA 2EWVA 3ZDJA 3GQZA 1E4DA 1DJAA 1G6AA 2J3TD 4FD8A 5I5LA 1TVFA 4G3VA 3ZG5A 1YLWA 5FSRA 1ZC2A 3E0YA 1LSWA 3BLSA 2BTFP 1CK3A 4U0XA 5CGXA 5G4YA 4BWIA 1Z6FA 3N8RA 2W0NA 3N4IA 3PXPA 2Q9NA 4YWZA 4PM6A 2XROA 3V3RA 5F83A 5TGFA 2A24A 1VETB 4QY5A 3IF6B 3N8SA 5C5KA 3W2ZA 5FQQA 5CTMA 4EBPA 5CX7A 3O3VA 4KQDA 1YKDA 4HNBA 2PYPA 4S2OA 3LR0A 4OLDA 2J3TC 3SS4A 1V9YA 3RJUA 4BMWA 1FIKA 1T1CA 2Y2LA 2Y59A 1KE4A 1N9OA 3WRTA 2ZOHA 3GVBA 4KZ4A 3LICA 3HVFA 4BBVA 1DP6A 1K56D 3A3EA 4DE3A 2V8FA 4MBFA 2OWHA 5M1AA 3LCEA 1Y54A 2KLIA 3LIAA 1XX2A 1W8YA 4R3BA 3HUNA 1BUEA 1UWPX 4GDBA 2D01A 4X68A 1AWIA 2YKFA 2Y2HA 2VZWA 1N9NA 1VHMA 1ZG6A 2WKQA 1NLZA 2WKHA 2PRFA 4O8GA 3IHBA 2EX2A 2IA2A 1YLPA 2ZQ9A 3G2YA 2C6WB 3S7OA 1TS7A 2FZ0A 5AQ9A 5I94A 2P9VB 5FQJA 2OAQ1 3MZDA 1IYSA 3NOTC 5FI7A 5EECA 5GL9A 4E3OA 2GJ3A 2FH5A 3Q07A 1FSWA 3UPPA 5KMWA 2Y55A 5FQMA 3CG5A 3N8LA 3U2AA 3UMDA 2ZLYA 3SS3A 5EVIB 4I3AA 3H7WA 4KQRA 4QU3A 2HDQA 3ZVWA 4MDZA 2QYBA 3MMHA 2Y2PA 1NYYA 4OVDA 5HWWA 3I7JA 1E3UD 3PBSA 4H6JA 4Y15A 4Y0UA 4EBNA 3IWQA 1PI4A 1NY0A 3SOIA 3T4TA 4EW7A 4RA7A 1T18A 4EETB 3F1NB 4LCLA 2Z2LB 3GR2A 2D02A 1K4EA 3G4PA 4DXCA 2WGWB 5A92A 3A0VA 2H0YA 4EQIA 4KUKA 4BL3A 4OQHA 3C4OA 4PAUA 4ZJ2A 2ZQ7A 5HSQA 3ZG7B 2K7SA 3K2NA 1NZUA 3VSLA 4IBRA 4WBGA 5D3OA 2V1AA 1T1AA 3CJMA 3B42A 3EEAA 4OLGA 5MC7A 1S1ZA 5FAQA 3C5AA 4D2OA 5AJGA 1XGIA 4BBTA 4AFIA 1DJBA 4DJ2A 3EGXC 4WM9A 1S67L 2VGLM 4DKIA 4OPYA 3HCYA 4B4XA 4KQOA 4P85A 2H0TA 4R3AA 3G34A 4X6TA 5HDCA 3LEZA 3RFBA 3DAVA 3VSKA 3H82A 3N6IA 2BASA 2JC7A 2JKTM 1BTLA 3OOVA 4WMCA 3ZG8B 3IX8A 2I72A 2JKTI 2PYRA 1MWUA 3IX4A 4JLFA 2V8CA 3PAGA 5HZHA 5G4ZA 2ZC5B 3K3CA 2ZOIA 3NJAA 1BSGA 3VFHA 4PM5A 3CWFA 4IEDA 3P09A 3KO6A 4JXWA 3WS2A 4FTXA 2OSUA 3MF0A 3GTCA 1KGGA 1F98A 2UV0E 4PKYG 3OZHA 4CPKA 1HVBA 1MWSA 4EUZA 3WS5A 5J3WA 1NJ4A 1LI0A 4YOFA 2ZMAA 3IF5A 3UE6A 3CPTA 4ARZB 1SKOB 4ZTKA 3E2KA 4KZ3A 2KX6A 3IWOA 3GMWA 1DP9A 2W1RA 3KSGA 4OH0A 1ESUA 1QMEA 4MMNA 4GDNA 3IF6C 1NRJA 1EW0A 3PAEA 1M40A 2ZL1A 3IH9A 3C7VA 4JF5A 4YNRA 2IWDA 1YQSA 1GHIA 3LGOA 4QJGA 4WZ5A 2WYXA 4E3KA 5L2FA 4P87A 1HTZA 1VB6A 2JHEA 1D06A 1PIOA 4WF0A 1K4FA 1YLZA 4KENB 1XJ3A 5FEFA 3UE1A 1RP5A 2Y2QA 4Q0JA 2VV7A 3ZGAB 1DJCA 2M7UA 3VP4A 2ZC6B 1BLSA 2GNXA 4LV1A 2HZ5A 4Z9QA 3OCLA 1YAXA 4GJ4A 5F6AA 1T19A 1MC0A 5KSCA 1Z09A 1PYYA 4GLQA 2FFYA 1O07A 2XFSA 4O01A 1HZOA 3G31A 3BY9A 2JKRM 4MN5A 4O7DA 2JKRI 3LI9A 5TBMA 4GNUA 4DJ3A 2J8YA 4K0XA 1KVMA 3BFCA 3GECA 1PRQA 5CXWA 4MCWA 4LRXC 4RYEA 3VOZA 1J9MA 4LGWA 5CRFA 3WRZA 2J9PA 5F69A 1TF1A 3EOIA 1KDSA 2XD5A 5FA7A 1TS6A 1H3QA 3HBRA 4EBLA 4IHQA 3EQUA 4IVKA 2KOIA 4I5SA 5EVIC 5HWVA 2O9CA 1P9RA 2QPNA 3O88A 3Q82A 4I38A 1E25A 3EGDC 3IHAA 3UDFA 5JYOA 3GRJA 2P7JA 1XFNA 3SH8A 4JXSA 5FQKA 1PNEA 4S2IA 1L0DA 3G2ZA 2A3UA 3DTMA 5K5BA 4GZBA 4GD6A 4WMCD 4NXFA 4UQIS 1VEUA 5HL1A 2EX6A 4B4ZA 1OT9A 1A0KA 4BL2A 3P98A 5F82A 2XF3A 1P0ZA 1OTDA 3G6OA 3S7QA 3B47A 2RL3A 2DCFA 4E04A 4JBFA 2PR5A 3P01A 1JTGA 4N9LA 4L0LA 3LR4A 5HFOA 1S6RA 3MKEA 5L07A 1CI8A 1NZOA 4P6ZS 2ZQAA 2QHKA 2J80A 4XT2A 3GV9A 1I2SA 3HLGA 2L4RA 4A5RA 2EWWA 3CLOA 1GA9A 5CERA 1YMXA 4E3IA 1FCMA 4HI4A 1MKMA 2OLUA 1BT5A 3MJQA 1N4OA 5EPHA 4R70A 3OCNA 1ES3A 3Q1FA 3MZFA 5FI2A 3C38A 1YM1A 4EV4A 3Q7VA 3BFFA 3T4LA 4U3TA 3ICYA 1NRFA 3NDGA 1ESIA 4GKUA 1WYCA 4KZ8A 5L8MA 1KOUA 5FL3A 3T4QA 2Z6DA 4E3MA 1N9BA 2G7UA 3UE0A 2ZQCA 2DMWA 2J3WA 1PW8A 3OPRA 4OPZA 5GHYA 1Y4OA 4UEYA 3NOPC 4QY6A 1C3BA 1PWCA 2A24B 2PT7A 4B93A 3LR5A 1K6SA 2XH9A 1FOFA 3D72A 4EEUA 4KUOA 4ZJ3A 1JNUA 1I2WA 3DTIA 1G68A 3MXSA 3CMZA 1ERMA 2VV8A 1RGZA 3KSHA 4MN6A 4PM7A 4LV3A 2WZZA 3TG9A 2R9WA 2ZC7A 3UB6A 5CEBA 2WKRA 2ZM8A 4R38A 2UWXA 2XFTA 4YINA 1VETA 1AXBA 3NY4A 1H8ZA 3BFGA 3IF6A 5EM1A 4RQ9A 2VEAA 4NKPA 4II7A 3AGDA 3M2KA 3KX0X 2CC1A 3VFFA 3IX3A 3C30A 2HP6A 3QNBA 3ISGA 5HAQA 3IS2A 3KYEA 4HOIA 5E2EA 2PHYA 3SW1A 1MWTA 1S66L 5AVFA 1OPXA 3IT9A 3FV7A 2Y2OA 3TSGA 4ME4A 1LI9A 3FWLA 3NIAA 3O5YA 3PHYA 1W63M 3IXGA 1XXMA 1NYMA 3L7HA 3LYXA 1UWNX 1ES5A 2EFUA 4N1XA 1KGFA 5L09A 1MWRA 3VP2A 1IELA 4MBHA 5DF8A 3V3SA 2E8JA 4ID4A 2HPBA 2R78A 1S4RA 2P9VA 3C7UA 4EXOA 4F3LB 5L10A 4DE1A 5JYPA 1XJ6A 4QHCA 1IYQA 1VQQA 2GZAA 1TEMA 5DKLA 1LL9A 1GHMA 3LFVA 1F9IA 3OPHA 4IUHA 3S7PA 3ITBA 3UE3A 3RTYA 1W7FA 1L2SA 2O99A 1PFLA 2NUTC 3L9KA 1KVLA 5EVIA 2W1TB 4NETA 2M1CA 3D3OA 1LHYA 3HREA 2C5WB 2HF6A 1EWZA 2Y2IA 4CLCA 3B33A 4GHIA 4D60A 1LLBA 2XGNA 4N92A 5GLBA 1FSYA 3F1NA 1K54C 1OJGA 5AVEA 5IHVA 1TDGA 4R4SA 4N1HA 2WGWA 4LRYC 4Y13A 4GS9B 1GCEA 1RCJA 3G32A 3W8KA 3NCKA 3HLEA 2VJWA 4XUXA 2AVXA 3ZG0A 2WUQA 2B95A 4FH2A 4BLMA 1K55A 3CUEA 4R23A 2HDUA 1HLUP 1CEGA 4PMAA 1XP4A 3VP1A 5J7EA 3HUOA 2ZM2A 3TW8A 3V50A 3UB7A 4N9KA 1W8QA 4B9OA 1WE4A 4DDYA 1IFQA 4RVAA 2ZD8A 2HJ9C 3T4JA 3E98A 2B18A 4Y2FA 4LCMA 2ZQ8A 4NK3A 2ZC4B 3FYZA 5EV0A 4WYYA 4NXEA 3HJKA 4MNRA 5AQ7A 2ZMVA 1BZAA 2LB5A 1PI5A 4FOFA 5HARA 3MQQA 2Y8HA 3F1OA 3JPUA 2ACGA 1LL5A 4ZJ1A 4K0WA 4WL9A 4FUWA 5KIZA 4LV0A 1FCNA 4H8RA 3SZTA 1XJ2A 2W3HA 2X71A 3T12B 3DWZA 5GLCA 4HP4A 5CHJA 4S2KA 5EFWA 3A3FA 3S22A 3R7WA 3SS5A 3PYPA 2W3DA 2OAP1 3CAXA 2HDSA 2JBFA 4NXBA 3UN7A 1H5XA 4UHUA 2X02A 2W3EA 5FDSA 3NECA 4ARZA 1SKOA 1KGEA 4C75A 2PAVP 1XGJA 2VLGA 4JKTA 4JF6A 4MLLA 3DW0A 5CECA 4K08A 1Q2QA 2W3FA 1H0MA 1LT0A 3C8CA 3KYQA 4EESA 1W63Q 3W4PA 1SZVA 1F5MA 3QNCA 4ZAMA 3NBLA 4LFUA 2PBYA 4WEJA 4WZ4A 2Z2MB 1L0GA 4PPRA 4Z1WA 3IXBA 5J8XA 3LI8A 1YSPA 4ZDXA 2WKEA 4GCZA 5FQIA 3V67A 2XA7M 2VGKA 3PTEA 2Y2KA 4ETXA 2HP5A 3QP1A 4MEZA 5U47A 3HLFA 2QKPA 1ACFA 3W4QA 4BENA 2DRWA 3BFDA 3BQAA 4JGQA 3UB9A 3HLBA 1SDNA 3FC7A 1VM1A 1G6OA 3F1PA 4UA9A 5EM0A 2JKGA 4X53A 2W3GA 4OQ0A 3O86A 4I3IA 4EQ1A 2RCXA 4R4RA 2V9AA 5HWTA 4B88A 5HDSA 4DXBA 3PBNA 2DNSA 3IBRA 1MZUA 3HLCA 2G2UA 2OOLA 2XEPA 1SDEA 3UB5P 3UNWA 2VV6A 2Y4AA 1LSXA 3MKFA 4OOYA 5EVEA 1XJ4A 1STZA 5HX9A 4Q8IA 2H10A 3M2JA 3MR0A 1K56A 4X1MA 1DRMA 1OTAA 1ZKJA 1GSXA 3BLMA 4OQIA 5EVLA 5F68A 1EI5A 4MN7A 5CTNA 3VE4A 2EX8A 4BD1A 4X69A 4IUKA 1ZTUA 4GD8A 3OC2A 2H28A 4E3NA 4CQHA 4DMZA 5AQAA 1M6KA 1FR6A 2Q9MA 5FDHA 3WWXA 2V0WA 4QB8A 3GDIA 4KZ5A 4PM8A 2GX5A 5CHUA 1IYOA 4M4XA 3Q81A 2XDMA 1XKZA 5E43A 3LY3A 4HBTA 3P7NA 3BFEA 2J9OA 3C4PA 4ETZA 2K2NA 1LSVA 2WZXA 5A91A 4G3KA 5DFXA 3SH7A 4DE2A 3A0RA 4CLCE 1OJ5A 5KSHA 2LB9A 3HLWA 4S2NC 3NOUC 2EXAA 1ALQA 4HIAA 4RX2A 1K25A 2WGVA 1KE3A 3VMAA 4LPZA 3MXQA 1S0WA 1YLYA 1E3UA 1U60A 1D7EA 3OPPA 3G30A 2WKPA 5GLDA 2W27A 5A90A 5IT5A 3LR3A 4FSFA 3LY4A 2HV1A 2XSSA 5G18A 5CGWA 1PWGA 4HQAA 5E2FA 1CEFA 3IQAA 3V5MA 4I3JA 4JGRA 4K91A 4WN5A 1GSVA 3M6BA 1Y28A 4R6LA 4HP9A 3LO7A 3Q7VB 3QHYA 4QD4A 2L1MA 2PDRA 2PR6A 3TJZC 4EERA 1ES4A 2BG1A 4XUZA 1K0KA 3T50A 3MZEA 3WS0A 1OT6A 5BOHA 3T1QB 4HBUA 4OQGA 1YT4A 1G28A 4KZ7A 3OLOA 4S2MA 4Y0TA 5KZHA 1PZPA 3Q7ZA 5DTTA 2V2FF 2JN7A 3EWKA 4EUVA 5F1GA 1FR1A 4WELA 5EE8A 3GSGA 4UA7A 4F94A 2ZC3B 3V39A 4JF4A 2OV5A 2PBDP 2ZM0A 4QPRA 2HDRA 1CQAA 4WZ5C 2Y2NA 3TE8A 2XR0A 1YLTA 3MFXA 2WAEA 1IKIA 3LUQA 2WADA 4UA6A 2ZQDA 1OTBA 3TRCA 3FPVA 1JWVA 4HJ3A 3ZNTA 5HAIA 2PD7A 3IH8A 3SH9A 1FQGA 2OWJA 3PBOA 2INWA 3D4FA 4KZ9A 1BULA 2ZMFA 4HH3A 3H9WA 3ZHHA 3T4OA 5IU1A 2V0UA 3CI6A 4KG5A 5DFYA 1JTDA 4U0TA 3PBRA 1XPBA 3IS2B 2VX8A 5FAOA 3BEBA 5CGSA 4HHDA 5AQBA 3TOIA 2IWBA 4FH4A 3LIBA 3JVVA 1ES2A 1SCWA 3BWLA 1SKFA 2Y2GA 5DKKA 4X25A 4OPQA 2VGJA 1NWZA 4R3JA 4OOLA 3IWIA 5CHMA 1K38A 4DN0A 3BY8A 4DRTA 4UAAA 3UPOA 3QP5A 1TS0A 2Z6CA 3UO9A 1XA7A 1IEMA 3NC8A 1ODVA 3HLDA 2P74A 4ESPA 5TR7A 2V20A 4R1GA 5FI6A 3H7WB 1DP8A 1LL8A 2EX9A 1K57C 4YFMA 4Y5FA 4H6JB 1KDWA 1L0FA 3DWKA 2XRNA 1FCOA 2CMNA 3T4KA 5GHZA 4JPMA 1ONHA 1OTIA 4HESA 3FPWA 5EUAA 3O87A 3LEQA 3ITAA 2Y2JA 4Y3IA 1JWZA 4PKYA 4HEFA 5GLAA 4Y7PA 2FFFB 2G2WA 3FG8A 1X0OA 3MQ0A 2O9BA 5HDDA 3EEHA 5DF7A 1OTEA 3T4SA 3MFDA 4CLCB 1CF0A 1SHVA 2JCHA 4F3LA 3S4XA 4GHIB 3S7NA 2VK3A 5EOOA 3VV4A 3BYDA 2L0WA 1J3WA 1RGYA 4BQMA 2JKFA 4E6WA 1UGUA 3RXWA 4E3LA 3LIDA 3PBQA 3AGFA 2QZ6A 3E2LA 3U4LP 1S4SA 2W1TA 3S1YA 3NULA 5J4EA 4GN2A 4L9EA 2NUPC 1H8MA 4QWOA 5DTKA 3FKWA 2Q0OA 2XLNA 3VE3A 3A3JA 5HD3A 4HJ4A 3QP8A 3H82B 2WAFA 1PW1A 5DF9A 4IBXA 4GS9A 2A49A 3OPLA 2IWCA 3WS1A 3E4OA 4IJGA 2PU4A 3UPNA 1WYBA 4JXVA 2B02A 2KDKA 5E2HA 4S2JA 2HGVA 4S2NA 4KG6A 3VP0A 1TS8A 1ONGA 4XXRA 5FQ9A 4X55A 4EWFA 3KYZA 2WKIA 2HJEA 1W5DA 1S1YA 4PM9A 1HD8A 3BW6A 3F1OB 5DJTA 3DBAA 3K3DA 3ZFZA 3HUMA 4Q0IA 5LBRA 5DVAA 1F2KA 3HL9A 3CPTB 4Y0OA 5A8BA 4S2LA 3MBZA 4C3QA 2ZJ9A 4ZRRA 2PD8A 2EXBA 4GB7A 2WGIA 4X1LA 3CZDA 4OOMA 2H5SA 4O0PA 3R7WB 2GDNA 1EROA 5GHXA 3QP2A 2XQZA 4UQIM 4OP8A 2QMIA 2ZL1B 1GA0A 4M3KA 2X01A 5FEGA 1MBLA 5HL6A 5FATA 4BJPA 4S2PA 2V1ZA 4KZBA 3KSFA 3RH8B 3ZCZA 4LENA 1TD5A 4HH2A 1IKGA 4NXGA 4L9GA 3MXRA 1ZG4A 3UDIA 4E3JA 5FAPA 3W4OA 1IOUA 3ZVTA 2A2LA 1XA1A 3NI9A 4IVIA 4HY8A 4P6ZM 1YMSA 2HP9A 5TFQA 4JGPA 5TJJA 1JWPA 4JXGA 3JYIA 1H8YA 5F5YA 1BLPA 1V9ZA 4KG2A 3A0SA 2EA9A 3DTKA 3MQOA 1L3LA 1PWDA 3BM6A 2K31A 4Y17A 3BRMA 5DJUA 3ZQ5A 4BD0A 5TBMB 4FCFA 4OKPA 4JGOA 3BJNA 3UY6A 4BBUA 3LIFA 4L9FA 1N9LA 1QMFA 5F1FA 3ZNYA 1P9WA 3BECA 3A3DA 1PZOA 2OLVA 4OP5A 3E4PA 3BQ8A 4NG2A 4C6YA 1FILA 5EVID 1I5QA 2R9XA 1YPRA 3F1PB 2QWSA 3NDEA 4WLAA 5FASA 1ERQA 2JE5A 3ULFA 1YSQA 2V1BA 4LV2A 5HPFA 1O7EA 4CLCD 1OMEA 2VGLS 3OBFA 3T1RA 1W79A 2B5RA 1MKIA 3JVUA 5A93A 1G5UA 4KQQA 2I9VA 4HJ6A 2EFXA 4R0QA 2Y2MA 4DDSA 2YKHA 1P97A 1D1JA 2J7VA 4I39A 2O9AA 1K6RA 1JVJA 1L0EA 5DTSA 2E8IA 3IBJA 3NHQA 3D9YA 3UB8A 2Y91A 1TDLA 2XK1A 1KE0A 3QP4A 4P0MA 4DF6A 1BLCA 1T1BA 3EQVA 4CLCC 5HAPA 4LRZE 1K57A 4DE0A 3IXHA 1IYPA 4X56A 2ZBBA 5M18A 1MXOA 1VEUB 3A3IA 4CJNA 3VP3A 4GW9A 4MBKA 4NEED 3B3XA 5CEDA 4P6BA 3IXDA 2VKSA 3C2WA 3LIEA 4EU0A 4OONA 5E2GA 3UMEA 1MPLA 4WEKA 3FKVA 2XD1A 3T1SA 1WA9A 2PU2A 4PHTA 1Q2PA 1K55C 3CUEC 2M7VA 5HW3A 3N7WA 4KZAA 1NXYA 2VA0A 1BLHA 1CI9A
chains in the Genus database with same CATH topology
2P08A 4XT2B 4LRYC 4GS9B 1XJ3A 3PBRA 3IS2B 2VX8A 2MJ6A 4Q0JA 2VV7A 2M7UA 4HHDA 2VJWA 3ZYTA 2GNXA 2P04A 3R4KA 3OCLA 3PBTA 3LIBA 3JVVA 1YAXA 3CUEA 4GJ4A 5F6AA 1T19A 4G3WA 1MC0A 4WUJA 4GLQA 3BWLA 4O01A 5DKKA 3BY9A 1ZHHB 2QJ5A 3CITA 5J7EA 2JKRM 1NWZA 4MN5A 5HPIA 3TW8A 4OOLA 2JKRI 3UB7A 3HJIA 1GSWA 3BY8A 3LI9A 5TBMA 4DJ3A 4LLOB 4DN0A 2QJ7A 3GECA 4MCWA 1TS0A 4LRXC 4B9OA 5IS1A 1IFQA 1BYWA 1NLYA 2Z6CA 2HJ9C 1ODVA 3PR6A 2XA7S 3E98A 3T4JA 2B18A 4Y2FA 5F69A 1TF1A 1XFQA 3H7WB 3EOIA 1DP8A 4NXEA 1LL8A 3HJKA 4Q0HA 2Y79A 2ZMVA 2LB5A 1TS6A 2O0YA 3E4QA 4Y5FA 3VOLA 1H3QA 4H6JB 4FOFA 4IHQA 3MQQA 4EEPA 2XRNA 5HD5A 2CMNA 2Y8HA 3T4KA 3EQUA 2KOIA 4I5SA 5HWVA 3F1OA 3KSIA 2EWVA 2O9CA 1P9RA 4WL9A 5KIZA 2J3TD 5I5LA 4I38A 1OTIA 4G3VA 3FPWA 3EGDC 1XJ2A 4Y3IA 2W3HA 4PKYA 3E0YA 1LSWA 2P7JA 1XFNA 4HP4A 5EFWA 3FG8A 1X0OA 3MQ0A 2O9BA 5HDDA 3R7WA 3EEHA 3PYPA 1OTEA 3T4SA 4CLCB 2W3DA 4F3LA 4GHIB 3S7NA 2OAP1 3CAXA 5G4YA 4BWIA 2W0NA 3VV4A 5K5BA 3PXPA 2L0WA 4YWZA 4NXBA 2XROA 2A24A 2W3EA 4ARZA 5C5KA 2VLGA 3W2ZA 1UGUA 3LIDA 4NXFA 3PBQA 4UQIS 4K08A 2W3FA 5CX7A 4KQDA 1OT9A 1YKDA 1LT0A 3C8CA 2PYPA 1S4SA 3KYQA 2W1TA 4HNBA 4EESA 1W63Q 3LR0A 1F5MA 2J3TC 1V9YA 4BMWA 5J4EA 4L9EA 4WEJA 1P0ZA 1OTDA 2NUPC 3G6OA 1H8MA 1T1CA 3S7QA 3B47A 1N9OA 4Z1WA 4E04A 3VE3A 2ZOHA 3LI8A 3LICA 2PR5A 3P01A 1YSPA 4BBVA 1DP6A 4L0LA 5HD3A 4GCZA 4HJ4A 3H82B 3LR4A 2OWHA 4P6ZS 5DF9A 3V67A 2XA7M 2KLIA 2QHKA 2J80A 3LIAA 4XT2A 4ETXA 4GS9A 2L4RA 2EWWA 3CLOA 1UWPX 2QKPA 2D01A 3E4OA 2YKFA 4IJGA 2VZWA 1N9NA 1VHMA 2B02A 2KDKA 3BQAA 4JGQA 3UB9A 2WKQA 3FC7A 1NLZA 2HGVA 4HI4A 1MKMA 4O8GA 1TS8A 2IA2A 1G6OA 3F1PA 3MJQA 3S7OA 1TS7A 2FZ0A 3KYZA 4R70A 2HJEA 3OCNA 1S1YA 2W3GA 2OAQ1 3BW6A 3NOTC 3F1OB 5DJTA 3DBAA 3K3DA 3C38A 4I3IA 4EQ1A 4Q0IA 2V9AA 5LBRA 2GJ3A 5HWTA 2FH5A 5HDSA 3T4LA 3PBNA 3IBRA 3ICYA 1MZUA 5A8BA 2OOLA 2VV6A 1LSXA 5L8MA 1KOUA 3U2AA 3UMDA 4ZRRA 5FL3A 2PD8A 1XJ4A 3T4QA 2Z6DA 1STZA 4I3AA 3H7WA 4O0PA 4OOMA 3R7WB 3MR0A 4MDZA 2G7UA 2QYBA 3MMHA 2DMWA 2J3WA 1DRMA 1OTAA 1GSXA 5HWWA 3PBSA 4H6JA 4UEYA 4UQIM 3NOPC 5F68A 4MN7A 3VE4A 2A24B 2PT7A 4B93A 3LR5A 4IUKA 1ZTUA 3D72A 3T4TA 3OC2A 4EW7A 2H28A 5HL6A 4EEUA 1T18A 4EETB 4CQHA 4DMZA 3F1NB 4KUOA 1JNUA 4BJPA 2D02A 3KSFA 3RH8B 1TD5A 4HH2A 4NXGA 2V0WA 4L9GA 3A0VA 2VV8A 3GDIA 4KUKA 3KSHA 4MN6A 1IOUA 2GX5A 2A2LA 4M4XA 4PAUA 5HSQA 2K7SA 3K2NA 3UB6A 4HY8A 3P7NA 2WKRA 4P6ZM 4R38A 2V1AA 4JGPA 1T1AA 5TJJA 4ETZA 2K2NA 1LSVA 3B42A 3EEAA 5MC7A 5F5YA 1S1ZA 1V9ZA 4G3KA 3A0SA 2EA9A 5DFXA 3MQOA 4RQ9A 3A0RA 4CLCE 2VEAA 4NKPA 4II7A 1OJ5A 5AJGA 3KX0X 5KSHA 2LB9A 2K31A 3C30A 4BBTA 4AFIA 3NOUC 5DJUA 3ZQ5A 5TBMB 4DJ2A 4HIAA 3EGXC 4JGOA 1S67L 3BJNA 4BBUA 3IS2A 3LIFA 4L9FA 1N9LA 2VGLM 4LPZA 3MXQA 4HOIA 2PHYA 3SW1A 3HCYA 1P9WA 4KQOA 1S66L 5AVFA 3E4PA 3BQ8A 1D7EA 1OPXA 4R3AA 2WKPA 3F1PB 2W27A 2QWSA 5HDCA 5IT5A 3LR3A 4FSFA 4WLAA 2HV1A 3RFBA 2XSSA 4HQAA 3ULFA 1YSQA 2V1BA 5HPFA 3H82A 4I3JA 4JGRA 4WN5A 1GSVA 4CLCD 4ME4A 1Y28A 4R6LA 2VGLS 3O5YA 3OBFA 3PHYA 1W63M 2BASA 4HP9A 2JKTM 3OOVA 3JVUA 2L1MA 2PDRA 3LYXA 1UWNX 2JKTI 2PYRA 2PR6A 2I9VA 3TJZC 4EERA 4HJ6A 3T50A 5HZHA 5G4ZA 2YKHA 3K3CA 2ZOIA 3NJAA 1OT6A 1P97A 3CWFA 3KO6A 4I39A 1G28A 2O9AA 3OLOA 2R78A 1S4RA 3MF0A 3IBJA 1F98A 4EXOA 4F3LB 4PKYG 3NHQA 2JN7A 3EWKA 4EUVA 1XJ6A 3UB8A 5J3WA 4WELA 2GZAA 5DKLA 1T1BA 4YOFA 3UE6A 3LFVA 1F9IA 4IUHA 4ARZB 3EQVA 4CLCC 3S7PA 4LRZE 3UE3A 2KX6A 4QPRA 3RTYA 2ZBBA 2O99A 2NUTC 4GW9A 3KSGA 1DP9A 2W1RA 3MFXA 3TE8A 4NEED 2W1TB 2M1CA 4MMNA 3LUQA 3D3OA 1NRJA 2VKSA 1EW0A 3C2WA 3LIEA 4EU0A 1OTBA 3TRCA 3FPVA 2HF6A 4HJ3A 3UMEA 4CLCA 4WEKA 3B33A 2PD7A 4GHIA 4YNRA 2OWJA 3PBOA 2INWA 1WA9A 2ZMFA 4PHTA 4HH3A 1OJGA 3F1NA 5AVEA 3H9WA 3CUEC 1VB6A 2JHEA 2M7VA 1D06A 3T4OA 5IU1A 2V0UA 3CI6A 5DFYA 2VA0A 4WF0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XT2 B;  4LRY C;  4GS9 B;  1XJ3 A;  3IS2 B;  2VV7 A;  4HHD A;  3LIB A;  5F6A A;  1T19 A;  4WUJ A;  3BWL A;  5DKK A;  3BY9 A;  2QJ5 A;  5J7E A;  1NWZ A;  4MN5 A;  3UB7 A;  3HJI A;  1GSW A;  3BY8 A;  3LI9 A;  5TBM A;  4DJ3 A;  4LLO B;  2QJ7 A;  3GEC A;  1TS0 A;  4LRX C;  4B9O A;  5IS1 A;  1BYW A;  2Z6C A;  1ODV A;  5F69 A;  1XFQ A;  3H7W B;  1DP8 A;  4NXE A;  1LL8 A;  3HJK A;  1TS6 A;  3E4Q A;  3VOL A;  4H6J B;  4EEP A;  3MQQ A;  5HD5 A;  2CMN A;  4I5S A;  5HWV A;  3F1O A;  4WL9 A;  5KIZ A;  5I5L A;  4I38 A;  1OTI A;  1XJ2 A;  4PKY A;  1LSW A;  2P7J A;  1XFN A;  4HP4 A;  5EFW A;  3FG8 A;  1X0O A;  5HDD A;  3EEH A;  3PYP A;  1OTE A;  4F3L A;  4GHI B;  3CAX A;  5G4Y A;  2W0N A;  2L0W A;  4YWZ A;  4NXB A;  2A24 A;  2VLG A;  1UGU A;  3LID A;  4NXF A;  4K08 A;  4KQD A;  1OT9 A;  1LT0 A;  3C8C A;  2PYP A;  1S4S A;  4HNB A;  4EES A;  1V9Y A;  5J4E A;  4L9E A;  1P0Z A;  1OTD A;  3G6O A;  1T1C A;  1N9O A;  4E04 A;  3VE3 A;  2ZOH A;  3LI8 A;  3LIC A;  2PR5 A;  4BBV A;  1DP6 A;  5HD3 A;  4GCZ A;  4HJ4 A;  3H82 B;  2OWH A;  2QHK A;  2J80 A;  3LIA A;  4XT2 A;  4GS9 A;  2L4R A;  2QKP A;  3CLO A;  1UWP X;  2D01 A;  3E4O A;  2YKF A;  1N9N A;  2B02 A;  2KDK A;  4JGQ A;  3UB9 A;  2WKQ A;  3FC7 A;  4HI4 A;  1TS8 A;  3F1P A;  3MJQ A;  1TS7 A;  4R70 A;  1S1Y A;  3NOT C;  3F1O B;  5DJT A;  3K3D A;  4I3I A;  4EQ1 A;  2V9A A;  2GJ3 A;  5HWT A;  5HDS A;  3IBR A;  3ICY A;  1MZU A;  5A8B A;  2OOL A;  2VV6 A;  1LSX A;  1KOU A;  3UMD A;  2PD8 A;  1XJ4 A;  2Z6D A;  4I3A A;  3H7W A;  3MR0 A;  1DRM A;  1OTA A;  1GSX A;  5HWW A;  4H6J A;  3NOP C;  5F68 A;  3VE4 A;  2A24 B;  3D72 A;  4EW7 A;  2H28 A;  4EEU A;  1T18 A;  4EET B;  3F1N B;  4KUO A;  1JNU A;  2D02 A;  3RH8 B;  4HH2 A;  4NXG A;  2V0W A;  4L9G A;  3A0V A;  2VV8 A;  3GDI A;  4KUK A;  4MN6 A;  4M4X A;  5HSQ A;  2K7S A;  3UB6 A;  4HY8 A;  3P7N A;  2WKR A;  4R38 A;  2V1A A;  4JGP A;  1T1A A;  1LSV A;  5F5Y A;  1S1Z A;  1V9Z A;  3A0S A;  2EA9 A;  3MQO A;  4RQ9 A;  3A0R A;  2VEA A;  1OJ5 A;  3KX0 X;  4BBT A;  3NOU C;  5DJU A;  3ZQ5 A;  5TBM B;  4DJ2 A;  4HIA A;  4JGO A;  1S67 L;  4BBU A;  3IS2 A;  3LIF A;  4L9F A;  1N9L A;  4LPZ A;  3MXQ A;  4HOI A;  2PHY A;  3SW1 A;  1S66 L;  5AVF A;  3E4P A;  1D7E A;  4R3A A;  2WKP A;  3F1P B;  2W27 A;  2QWS A;  5HDC A;  4WLA A;  2HV1 A;  4HQA A;  3ULF A;  2V1B A;  3H82 A;  4I3J A;  4JGR A;  4WN5 A;  1GSV A;  1Y28 A;  4R6L A;  3PHY A;  2BAS A;  4HP9 A;  2L1M A;  2PDR A;  3LYX A;  1UWN X;  2PYR A;  2PR6 A;  2I9V A;  4EER A;  4HJ6 A;  3T50 A;  5HZH A;  5G4Z A;  2YKH A;  3K3C A;  2ZOI A;  3NJA A;  1OT6 A;  1P97 A;  3CWF A;  4I39 A;  1G28 A;  3OLO A;  2R78 A;  1S4R A;  1F98 A;  4EXO A;  4F3L B;  4PKY G;  3NHQ A;  2JN7 A;  3EWK A;  1XJ6 A;  3UB8 A;  5J3W A;  5DKL A;  1T1B A;  3UE6 A;  1F9I A;  4LRZ E;  2KX6 A;  3RTY A;  2ZBB A;  4GW9 A;  1DP9 A;  3MFX A;  2M1C A;  3LUQ A;  1EW0 A;  3C2W A;  3LIE A;  1OTB A;  4HJ3 A;  3UME A;  3B33 A;  2PD7 A;  4GHI A;  2OWJ A;  2INW A;  1WA9 A;  4HH3 A;  5AVE A;  1OJG A;  3F1N A;  3H9W A;  1VB6 A;  2JHE A;  1D06 A;  5IU1 A;  2V0U A;  4WF0 A; 
#chains in the Genus database with same CATH topology
 2P08 A;  4XT2 B;  5M19 A;  1GHP A;  3MS6 A;  2MJ6 A;  1MY8 A;  3VOY A;  3QP6 A;  3RXX A;  3M6H A;  3ZYT A;  2P04 A;  3R4K A;  1K54 A;  3PBT A;  4G3W A;  3G35 A;  4WUJ A;  2WK0 A;  1ZHH B;  4E6X A;  4OPR A;  2QJ5 A;  3UDX A;  3CIT A;  4GOG A;  3WS4 A;  3DTE A;  5HPI A;  3T1X A;  3FZC A;  3HJI A;  1GSW A;  4LLO B;  2QJ7 A;  5IS1 A;  1NLY A;  1BYW A;  1YLJ A;  4RX3 A;  3PR6 A;  2BLS A;  2XA7 S;  3CHW P;  1CJF A;  4ZBE A;  1DY6 A;  1XFQ A;  4KZ6 A;  4Q0H A;  3ZG9 B;  2Y79 A;  2O0Y A;  3AGE A;  3E4Q A;  3VOL A;  4EEP A;  5EOE A;  5HD5 A;  3MSH A;  3KSI A;  2EWV A;  3ZDJ A;  3GQZ A;  1E4D A;  1DJA A;  1G6A A;  2J3T D;  4FD8 A;  5I5L A;  1TVF A;  4G3V A;  3ZG5 A;  1YLW A;  5FSR A;  1ZC2 A;  3E0Y A;  1LSW A;  3BLS A;  2BTF P;  1CK3 A;  4U0X A;  5CGX A;  5G4Y A;  4BWI A;  1Z6F A;  3N8R A;  2W0N A;  3N4I A;  3PXP A;  2Q9N A;  4YWZ A;  4PM6 A;  2XRO A;  3V3R A;  5F83 A;  5TGF A;  2A24 A;  1VET B;  4QY5 A;  3IF6 B;  3N8S A;  5C5K A;  3W2Z A;  5FQQ A;  5CTM A;  4EBP A;  5CX7 A;  3O3V A;  4KQD A;  1YKD A;  4HNB A;  2PYP A;  4S2O A;  3LR0 A;  4OLD A;  2J3T C;  3SS4 A;  1V9Y A;  3RJU A;  4BMW A;  1FIK A;  1T1C A;  2Y2L A;  2Y59 A;  1KE4 A;  1N9O A;  3WRT A;  2ZOH A;  3GVB A;  4KZ4 A;  3LIC A;  3HVF A;  4BBV A;  1DP6 A;  1K56 D;  3A3E A;  4DE3 A;  2V8F A;  4MBF A;  2OWH A;  5M1A A;  3LCE A;  1Y54 A;  2KLI A;  3LIA A;  1XX2 A;  1W8Y A;  4R3B A;  3HUN A;  1BUE A;  1UWP X;  4GDB A;  2D01 A;  4X68 A;  1AWI A;  2YKF A;  2Y2H A;  2VZW A;  1N9N A;  1VHM A;  1ZG6 A;  2WKQ A;  1NLZ A;  2WKH A;  2PRF A;  4O8G A;  3IHB A;  2EX2 A;  2IA2 A;  1YLP A;  2ZQ9 A;  3G2Y A;  2C6W B;  3S7O A;  1TS7 A;  2FZ0 A;  5AQ9 A;  5I94 A;  2P9V B;  5FQJ A;  2OAQ 1;  3MZD A;  1IYS A;  3NOT C;  5FI7 A;  5EEC A;  5GL9 A;  4E3O A;  2GJ3 A;  2FH5 A;  3Q07 A;  1FSW A;  3UPP A;  5KMW A;  2Y55 A;  5FQM A;  3CG5 A;  3N8L A;  3U2A A;  3UMD A;  2ZLY A;  3SS3 A;  5EVI B;  4I3A A;  3H7W A;  4KQR A;  4QU3 A;  2HDQ A;  3ZVW A;  4MDZ A;  2QYB A;  3MMH A;  2Y2P A;  1NYY A;  4OVD A;  5HWW A;  3I7J A;  1E3U D;  3PBS A;  4H6J A;  4Y15 A;  4Y0U A;  4EBN A;  3IWQ A;  1PI4 A;  1NY0 A;  3SOI A;  3T4T A;  4EW7 A;  4RA7 A;  1T18 A;  4EET B;  3F1N B;  4LCL A;  2Z2L B;  3GR2 A;  2D02 A;  1K4E A;  3G4P A;  4DXC A;  2WGW B;  5A92 A;  3A0V A;  2H0Y A;  4EQI A;  4KUK A;  4BL3 A;  4OQH A;  3C4O A;  4PAU A;  4ZJ2 A;  2ZQ7 A;  5HSQ A;  3ZG7 B;  2K7S A;  3K2N A;  1NZU A;  3VSL A;  4IBR A;  4WBG A;  5D3O A;  2V1A A;  1T1A A;  3CJM A;  3B42 A;  3EEA A;  4OLG A;  5MC7 A;  1S1Z A;  5FAQ A;  3C5A A;  4D2O A;  5AJG A;  1XGI A;  4BBT A;  4AFI A;  1DJB A;  4DJ2 A;  3EGX C;  4WM9 A;  1S67 L;  2VGL M;  4DKI A;  4OPY A;  3HCY A;  4B4X A;  4KQO A;  4P85 A;  2H0T A;  4R3A A;  3G34 A;  4X6T A;  5HDC A;  3LEZ A;  3RFB A;  3DAV A;  3VSK A;  3H82 A;  3N6I A;  2BAS A;  2JC7 A;  2JKT M;  1BTL A;  3OOV A;  4WMC A;  3ZG8 B;  3IX8 A;  2I72 A;  2JKT I;  2PYR A;  1MWU A;  3IX4 A;  4JLF A;  2V8C A;  3PAG A;  5HZH A;  5G4Z A;  2ZC5 B;  3K3C A;  2ZOI A;  3NJA A;  1BSG A;  3VFH A;  4PM5 A;  3CWF A;  4IED A;  3P09 A;  3KO6 A;  4JXW A;  3WS2 A;  4FTX A;  2OSU A;  3MF0 A;  3GTC A;  1KGG A;  1F98 A;  2UV0 E;  4PKY G;  3OZH A;  4CPK A;  1HVB A;  1MWS A;  4EUZ A;  3WS5 A;  5J3W A;  1NJ4 A;  1LI0 A;  4YOF A;  2ZMA A;  3IF5 A;  3UE6 A;  3CPT A;  4ARZ B;  1SKO B;  4ZTK A;  3E2K A;  4KZ3 A;  2KX6 A;  3IWO A;  3GMW A;  1DP9 A;  2W1R A;  3KSG A;  4OH0 A;  1ESU A;  1QME A;  4MMN A;  4GDN A;  3IF6 C;  1NRJ A;  1EW0 A;  3PAE A;  1M40 A;  2ZL1 A;  3IH9 A;  3C7V A;  4JF5 A;  4YNR A;  2IWD A;  1YQS A;  1GHI A;  3LGO A;  4QJG A;  4WZ5 A;  2WYX A;  4E3K A;  5L2F A;  4P87 A;  1HTZ A;  1VB6 A;  2JHE A;  1D06 A;  1PIO A;  4WF0 A;  1K4F A;  1YLZ A;  4KEN B;  1XJ3 A;  5FEF A;  3UE1 A;  1RP5 A;  2Y2Q A;  4Q0J A;  2VV7 A;  3ZGA B;  1DJC A;  2M7U A;  3VP4 A;  2ZC6 B;  1BLS A;  2GNX A;  4LV1 A;  2HZ5 A;  4Z9Q A;  3OCL A;  1YAX A;  4GJ4 A;  5F6A A;  1T19 A;  1MC0 A;  5KSC A;  1Z09 A;  1PYY A;  4GLQ A;  2FFY A;  1O07 A;  2XFS A;  4O01 A;  1HZO A;  3G31 A;  3BY9 A;  2JKR M;  4MN5 A;  4O7D A;  2JKR I;  3LI9 A;  5TBM A;  4GNU A;  4DJ3 A;  2J8Y A;  4K0X A;  1KVM A;  3BFC A;  3GEC A;  1PRQ A;  5CXW A;  4MCW A;  4LRX C;  4RYE A;  3VOZ A;  1J9M A;  4LGW A;  5CRF A;  3WRZ A;  2J9P A;  5F69 A;  1TF1 A;  3EOI A;  1KDS A;  2XD5 A;  5FA7 A;  1TS6 A;  1H3Q A;  3HBR A;  4EBL A;  4IHQ A;  3EQU A;  4IVK A;  2KOI A;  4I5S A;  5EVI C;  5HWV A;  2O9C A;  1P9R A;  2QPN A;  3O88 A;  3Q82 A;  4I38 A;  1E25 A;  3EGD C;  3IHA A;  3UDF A;  5JYO A;  3GRJ A;  2P7J A;  1XFN A;  3SH8 A;  4JXS A;  5FQK A;  1PNE A;  4S2I A;  1L0D A;  3G2Z A;  2A3U A;  3DTM A;  5K5B A;  4GZB A;  4GD6 A;  4WMC D;  4NXF A;  4UQI S;  1VEU A;  5HL1 A;  2EX6 A;  4B4Z A;  1OT9 A;  1A0K A;  4BL2 A;  3P98 A;  5F82 A;  2XF3 A;  1P0Z A;  1OTD A;  3G6O A;  3S7Q A;  3B47 A;  2RL3 A;  2DCF A;  4E04 A;  4JBF A;  2PR5 A;  3P01 A;  1JTG A;  4N9L A;  4L0L A;  3LR4 A;  5HFO A;  1S6R A;  3MKE A;  5L07 A;  1CI8 A;  1NZO A;  4P6Z S;  2ZQA A;  2QHK A;  2J80 A;  4XT2 A;  3GV9 A;  1I2S A;  3HLG A;  2L4R A;  4A5R A;  2EWW A;  3CLO A;  1GA9 A;  5CER A;  1YMX A;  4E3I A;  1FCM A;  4HI4 A;  1MKM A;  2OLU A;  1BT5 A;  3MJQ A;  1N4O A;  5EPH A;  4R70 A;  3OCN A;  1ES3 A;  3Q1F A;  3MZF A;  5FI2 A;  3C38 A;  1YM1 A;  4EV4 A;  3Q7V A;  3BFF A;  3T4L A;  4U3T A;  3ICY A;  1NRF A;  3NDG A;  1ESI A;  4GKU A;  1WYC A;  4KZ8 A;  5L8M A;  1KOU A;  5FL3 A;  3T4Q A;  2Z6D A;  4E3M A;  1N9B A;  2G7U A;  3UE0 A;  2ZQC A;  2DMW A;  2J3W A;  1PW8 A;  3OPR A;  4OPZ A;  5GHY A;  1Y4O A;  4UEY A;  3NOP C;  4QY6 A;  1C3B A;  1PWC A;  2A24 B;  2PT7 A;  4B93 A;  3LR5 A;  1K6S A;  2XH9 A;  1FOF A;  3D72 A;  4EEU A;  4KUO A;  4ZJ3 A;  1JNU A;  1I2W A;  3DTI A;  1G68 A;  3MXS A;  3CMZ A;  1ERM A;  2VV8 A;  1RGZ A;  3KSH A;  4MN6 A;  4PM7 A;  4LV3 A;  2WZZ A;  3TG9 A;  2R9W A;  2ZC7 A;  3UB6 A;  5CEB A;  2WKR A;  2ZM8 A;  4R38 A;  2UWX A;  2XFT A;  4YIN A;  1VET A;  1AXB A;  3NY4 A;  1H8Z A;  3BFG A;  3IF6 A;  5EM1 A;  4RQ9 A;  2VEA A;  4NKP A;  4II7 A;  3AGD A;  3M2K A;  3KX0 X;  2CC1 A;  3VFF A;  3IX3 A;  3C30 A;  2HP6 A;  3QNB A;  3ISG A;  5HAQ A;  3IS2 A;  3KYE A;  4HOI A;  5E2E A;  2PHY A;  3SW1 A;  1MWT A;  1S66 L;  5AVF A;  1OPX A;  3IT9 A;  3FV7 A;  2Y2O A;  3TSG A;  4ME4 A;  1LI9 A;  3FWL A;  3NIA A;  3O5Y A;  3PHY A;  1W63 M;  3IXG A;  1XXM A;  1NYM A;  3L7H A;  3LYX A;  1UWN X;  1ES5 A;  2EFU A;  4N1X A;  1KGF A;  5L09 A;  1MWR A;  3VP2 A;  1IEL A;  4MBH A;  5DF8 A;  3V3S A;  2E8J A;  4ID4 A;  2HPB A;  2R78 A;  1S4R A;  2P9V A;  3C7U A;  4EXO A;  4F3L B;  5L10 A;  4DE1 A;  5JYP A;  1XJ6 A;  4QHC A;  1IYQ A;  1VQQ A;  2GZA A;  1TEM A;  5DKL A;  1LL9 A;  1GHM A;  3LFV A;  1F9I A;  3OPH A;  4IUH A;  3S7P A;  3ITB A;  3UE3 A;  3RTY A;  1W7F A;  1L2S A;  2O99 A;  1PFL A;  2NUT C;  3L9K A;  1KVL A;  5EVI A;  2W1T B;  4NET A;  2M1C A;  3D3O A;  1LHY A;  3HRE A;  2C5W B;  2HF6 A;  1EWZ A;  2Y2I A;  4CLC A;  3B33 A;  4GHI A;  4D60 A;  1LLB A;  2XGN A;  4N92 A;  5GLB A;  1FSY A;  3F1N A;  1K54 C;  1OJG A;  5AVE A;  5IHV A;  1TDG A;  4R4S A;  4N1H A;  2WGW A;  4LRY C;  4Y13 A;  4GS9 B;  1GCE A;  1RCJ A;  3G32 A;  3W8K A;  3NCK A;  3HLE A;  2VJW A;  4XUX A;  2AVX A;  3ZG0 A;  2WUQ A;  2B95 A;  4FH2 A;  4BLM A;  1K55 A;  3CUE A;  4R23 A;  2HDU A;  1HLU P;  1CEG A;  4PMA A;  1XP4 A;  3VP1 A;  5J7E A;  3HUO A;  2ZM2 A;  3TW8 A;  3V50 A;  3UB7 A;  4N9K A;  1W8Q A;  4B9O A;  1WE4 A;  4DDY A;  1IFQ A;  4RVA A;  2ZD8 A;  2HJ9 C;  3T4J A;  3E98 A;  2B18 A;  4Y2F A;  4LCM A;  2ZQ8 A;  4NK3 A;  2ZC4 B;  3FYZ A;  5EV0 A;  4WYY A;  4NXE A;  3HJK A;  4MNR A;  5AQ7 A;  2ZMV A;  1BZA A;  2LB5 A;  1PI5 A;  4FOF A;  5HAR A;  3MQQ A;  2Y8H A;  3F1O A;  3JPU A;  2ACG A;  1LL5 A;  4ZJ1 A;  4K0W A;  4WL9 A;  4FUW A;  5KIZ A;  4LV0 A;  1FCN A;  4H8R A;  3SZT A;  1XJ2 A;  2W3H A;  2X71 A;  3T12 B;  3DWZ A;  5GLC A;  4HP4 A;  5CHJ A;  4S2K A;  5EFW A;  3A3F A;  3S22 A;  3R7W A;  3SS5 A;  3PYP A;  2W3D A;  2OAP 1;  3CAX A;  2HDS A;  2JBF A;  4NXB A;  3UN7 A;  1H5X A;  4UHU A;  2X02 A;  2W3E A;  5FDS A;  3NEC A;  4ARZ A;  1SKO A;  1KGE A;  4C75 A;  2PAV P;  1XGJ A;  2VLG A;  4JKT A;  4JF6 A;  4MLL A;  3DW0 A;  5CEC A;  4K08 A;  1Q2Q A;  2W3F A;  1H0M A;  1LT0 A;  3C8C A;  3KYQ A;  4EES A;  1W63 Q;  3W4P A;  1SZV A;  1F5M A;  3QNC A;  4ZAM A;  3NBL A;  4LFU A;  2PBY A;  4WEJ A;  4WZ4 A;  2Z2M B;  1L0G A;  4PPR A;  4Z1W A;  3IXB A;  5J8X A;  3LI8 A;  1YSP A;  4ZDX A;  2WKE A;  4GCZ A;  5FQI A;  3V67 A;  2XA7 M;  2VGK A;  3PTE A;  2Y2K A;  4ETX A;  2HP5 A;  3QP1 A;  4MEZ A;  5U47 A;  3HLF A;  2QKP A;  1ACF A;  3W4Q A;  4BEN A;  2DRW A;  3BFD A;  3BQA A;  4JGQ A;  3UB9 A;  3HLB A;  1SDN A;  3FC7 A;  1VM1 A;  1G6O A;  3F1P A;  4UA9 A;  5EM0 A;  2JKG A;  4X53 A;  2W3G A;  4OQ0 A;  3O86 A;  4I3I A;  4EQ1 A;  2RCX A;  4R4R A;  2V9A A;  5HWT A;  4B88 A;  5HDS A;  4DXB A;  3PBN A;  2DNS A;  3IBR A;  1MZU A;  3HLC A;  2G2U A;  2OOL A;  2XEP A;  1SDE A;  3UB5 P;  3UNW A;  2VV6 A;  2Y4A A;  1LSX A;  3MKF A;  4OOY A;  5EVE A;  1XJ4 A;  1STZ A;  5HX9 A;  4Q8I A;  2H10 A;  3M2J A;  3MR0 A;  1K56 A;  4X1M A;  1DRM A;  1OTA A;  1ZKJ A;  1GSX A;  3BLM A;  4OQI A;  5EVL A;  5F68 A;  1EI5 A;  4MN7 A;  5CTN A;  3VE4 A;  2EX8 A;  4BD1 A;  4X69 A;  4IUK A;  1ZTU A;  4GD8 A;  3OC2 A;  2H28 A;  4E3N A;  4CQH A;  4DMZ A;  5AQA A;  1M6K A;  1FR6 A;  2Q9M A;  5FDH A;  3WWX A;  2V0W A;  4QB8 A;  3GDI A;  4KZ5 A;  4PM8 A;  2GX5 A;  5CHU A;  1IYO A;  4M4X A;  3Q81 A;  2XDM A;  1XKZ A;  5E43 A;  3LY3 A;  4HBT A;  3P7N A;  3BFE A;  2J9O A;  3C4P A;  4ETZ A;  2K2N A;  1LSV A;  2WZX A;  5A91 A;  4G3K A;  5DFX A;  3SH7 A;  4DE2 A;  3A0R A;  4CLC E;  1OJ5 A;  5KSH A;  2LB9 A;  3HLW A;  4S2N C;  3NOU C;  2EXA A;  1ALQ A;  4HIA A;  4RX2 A;  1K25 A;  2WGV A;  1KE3 A;  3VMA A;  4LPZ A;  3MXQ A;  1S0W A;  1YLY A;  1E3U A;  1U60 A;  1D7E A;  3OPP A;  3G30 A;  2WKP A;  5GLD A;  2W27 A;  5A90 A;  5IT5 A;  3LR3 A;  4FSF A;  3LY4 A;  2HV1 A;  2XSS A;  5G18 A;  5CGW A;  1PWG A;  4HQA A;  5E2F A;  1CEF A;  3IQA A;  3V5M A;  4I3J A;  4JGR A;  4K91 A;  4WN5 A;  1GSV A;  3M6B A;  1Y28 A;  4R6L A;  4HP9 A;  3LO7 A;  3Q7V B;  3QHY A;  4QD4 A;  2L1M A;  2PDR A;  2PR6 A;  3TJZ C;  4EER A;  1ES4 A;  2BG1 A;  4XUZ A;  1K0K A;  3T50 A;  3MZE A;  3WS0 A;  1OT6 A;  5BOH A;  3T1Q B;  4HBU A;  4OQG A;  1YT4 A;  1G28 A;  4KZ7 A;  3OLO A;  4S2M A;  4Y0T A;  5KZH A;  1PZP A;  3Q7Z A;  5DTT A;  2V2F F;  2JN7 A;  3EWK A;  4EUV A;  5F1G A;  1FR1 A;  4WEL A;  5EE8 A;  3GSG A;  4UA7 A;  4F94 A;  2ZC3 B;  3V39 A;  4JF4 A;  2OV5 A;  2PBD P;  2ZM0 A;  4QPR A;  2HDR A;  1CQA A;  4WZ5 C;  2Y2N A;  3TE8 A;  2XR0 A;  1YLT A;  3MFX A;  2WAE A;  1IKI A;  3LUQ A;  2WAD A;  4UA6 A;  2ZQD A;  1OTB A;  3TRC A;  3FPV A;  1JWV A;  4HJ3 A;  3ZNT A;  5HAI A;  2PD7 A;  3IH8 A;  3SH9 A;  1FQG A;  2OWJ A;  3PBO A;  2INW A;  3D4F A;  4KZ9 A;  1BUL A;  2ZMF A;  4HH3 A;  3H9W A;  3ZHH A;  3T4O A;  5IU1 A;  2V0U A;  3CI6 A;  4KG5 A;  5DFY A;  1JTD A;  4U0T A;  3PBR A;  1XPB A;  3IS2 B;  2VX8 A;  5FAO A;  3BEB A;  5CGS A;  4HHD A;  5AQB A;  3TOI A;  2IWB A;  4FH4 A;  3LIB A;  3JVV A;  1ES2 A;  1SCW A;  3BWL A;  1SKF A;  2Y2G A;  5DKK A;  4X25 A;  4OPQ A;  2VGJ A;  1NWZ A;  4R3J A;  4OOL A;  3IWI A;  5CHM A;  1K38 A;  4DN0 A;  3BY8 A;  4DRT A;  4UAA A;  3UPO A;  3QP5 A;  1TS0 A;  2Z6C A;  3UO9 A;  1XA7 A;  1IEM A;  3NC8 A;  1ODV A;  3HLD A;  2P74 A;  4ESP A;  5TR7 A;  2V20 A;  4R1G A;  5FI6 A;  3H7W B;  1DP8 A;  1LL8 A;  2EX9 A;  1K57 C;  4YFM A;  4Y5F A;  4H6J B;  1KDW A;  1L0F A;  3DWK A;  2XRN A;  1FCO A;  2CMN A;  3T4K A;  5GHZ A;  4JPM A;  1ONH A;  1OTI A;  4HES A;  3FPW A;  5EUA A;  3O87 A;  3LEQ A;  3ITA A;  2Y2J A;  4Y3I A;  1JWZ A;  4PKY A;  4HEF A;  5GLA A;  4Y7P A;  2FFF B;  2G2W A;  3FG8 A;  1X0O A;  3MQ0 A;  2O9B A;  5HDD A;  3EEH A;  5DF7 A;  1OTE A;  3T4S A;  3MFD A;  4CLC B;  1CF0 A;  1SHV A;  2JCH A;  4F3L A;  3S4X A;  4GHI B;  3S7N A;  2VK3 A;  5EOO A;  3VV4 A;  3BYD A;  2L0W A;  1J3W A;  1RGY A;  4BQM A;  2JKF A;  4E6W A;  1UGU A;  3RXW A;  4E3L A;  3LID A;  3PBQ A;  3AGF A;  2QZ6 A;  3E2L A;  3U4L P;  1S4S A;  2W1T A;  3S1Y A;  3NUL A;  5J4E A;  4GN2 A;  4L9E A;  2NUP C;  1H8M A;  4QWO A;  5DTK A;  3FKW A;  2Q0O A;  2XLN A;  3VE3 A;  3A3J A;  5HD3 A;  4HJ4 A;  3QP8 A;  3H82 B;  2WAF A;  1PW1 A;  5DF9 A;  4IBX A;  4GS9 A;  2A49 A;  3OPL A;  2IWC A;  3WS1 A;  3E4O A;  4IJG A;  2PU4 A;  3UPN A;  1WYB A;  4JXV A;  2B02 A;  2KDK A;  5E2H A;  4S2J A;  2HGV A;  4S2N A;  4KG6 A;  3VP0 A;  1TS8 A;  1ONG A;  4XXR A;  5FQ9 A;  4X55 A;  4EWF A;  3KYZ A;  2WKI A;  2HJE A;  1W5D A;  1S1Y A;  4PM9 A;  1HD8 A;  3BW6 A;  3F1O B;  5DJT A;  3DBA A;  3K3D A;  3ZFZ A;  3HUM A;  4Q0I A;  5LBR A;  5DVA A;  1F2K A;  3HL9 A;  3CPT B;  4Y0O A;  5A8B A;  4S2L A;  3MBZ A;  4C3Q A;  2ZJ9 A;  4ZRR A;  2PD8 A;  2EXB A;  4GB7 A;  2WGI A;  4X1L A;  3CZD A;  4OOM A;  2H5S A;  4O0P A;  3R7W B;  2GDN A;  1ERO A;  5GHX A;  3QP2 A;  2XQZ A;  4UQI M;  4OP8 A;  2QMI A;  2ZL1 B;  1GA0 A;  4M3K A;  2X01 A;  5FEG A;  1MBL A;  5HL6 A;  5FAT A;  4BJP A;  4S2P A;  2V1Z A;  4KZB A;  3KSF A;  3RH8 B;  3ZCZ A;  4LEN A;  1TD5 A;  4HH2 A;  1IKG A;  4NXG A;  4L9G A;  3MXR A;  1ZG4 A;  3UDI A;  4E3J A;  5FAP A;  3W4O A;  1IOU A;  3ZVT A;  2A2L A;  1XA1 A;  3NI9 A;  4IVI A;  4HY8 A;  4P6Z M;  1YMS A;  2HP9 A;  5TFQ A;  4JGP A;  5TJJ A;  1JWP A;  4JXG A;  3JYI A;  1H8Y A;  5F5Y A;  1BLP A;  1V9Z A;  4KG2 A;  3A0S A;  2EA9 A;  3DTK A;  3MQO A;  1L3L A;  1PWD A;  3BM6 A;  2K31 A;  4Y17 A;  3BRM A;  5DJU A;  3ZQ5 A;  4BD0 A;  5TBM B;  4FCF A;  4OKP A;  4JGO A;  3BJN A;  3UY6 A;  4BBU A;  3LIF A;  4L9F A;  1N9L A;  1QMF A;  5F1F A;  3ZNY A;  1P9W A;  3BEC A;  3A3D A;  1PZO A;  2OLV A;  4OP5 A;  3E4P A;  3BQ8 A;  4NG2 A;  4C6Y A;  1FIL A;  5EVI D;  1I5Q A;  2R9X A;  1YPR A;  3F1P B;  2QWS A;  3NDE A;  4WLA A;  5FAS A;  1ERQ A;  2JE5 A;  3ULF A;  1YSQ A;  2V1B A;  4LV2 A;  5HPF A;  1O7E A;  4CLC D;  1OME A;  2VGL S;  3OBF A;  3T1R A;  1W79 A;  2B5R A;  1MKI A;  3JVU A;  5A93 A;  1G5U A;  4KQQ A;  2I9V A;  4HJ6 A;  2EFX A;  4R0Q A;  2Y2M A;  4DDS A;  2YKH A;  1P97 A;  1D1J A;  2J7V A;  4I39 A;  2O9A A;  1K6R A;  1JVJ A;  1L0E A;  5DTS A;  2E8I A;  3IBJ A;  3NHQ A;  3D9Y A;  3UB8 A;  2Y91 A;  1TDL A;  2XK1 A;  1KE0 A;  3QP4 A;  4P0M A;  4DF6 A;  1BLC A;  1T1B A;  3EQV A;  4CLC C;  5HAP A;  4LRZ E;  1K57 A;  4DE0 A;  3IXH A;  1IYP A;  4X56 A;  2ZBB A;  5M18 A;  1MXO A;  1VEU B;  3A3I A;  4CJN A;  3VP3 A;  4GW9 A;  4MBK A;  4NEE D;  3B3X A;  5CED A;  4P6B A;  3IXD A;  2VKS A;  3C2W A;  3LIE A;  4EU0 A;  4OON A;  5E2G A;  3UME A;  1MPL A;  4WEK A;  3FKV A;  2XD1 A;  3T1S A;  1WA9 A;  2PU2 A;  4PHT A;  1Q2P A;  1K55 C;  3CUE C;  2M7V A;  5HW3 A;  3N7W A;  4KZA A;  1NXY A;  2VA0 A;  1BLH A;  1CI9 A; 
#chains in the Genus database with same CATH homology
 2P08 A;  4XT2 B;  4LRY C;  4GS9 B;  1XJ3 A;  3PBR A;  3IS2 B;  2VX8 A;  2MJ6 A;  4Q0J A;  2VV7 A;  2M7U A;  4HHD A;  2VJW A;  3ZYT A;  2GNX A;  2P04 A;  3R4K A;  3OCL A;  3PBT A;  3LIB A;  3JVV A;  1YAX A;  3CUE A;  4GJ4 A;  5F6A A;  1T19 A;  4G3W A;  1MC0 A;  4WUJ A;  4GLQ A;  3BWL A;  4O01 A;  5DKK A;  3BY9 A;  1ZHH B;  2QJ5 A;  3CIT A;  5J7E A;  2JKR M;  1NWZ A;  4MN5 A;  5HPI A;  3TW8 A;  4OOL A;  2JKR I;  3UB7 A;  3HJI A;  1GSW A;  3BY8 A;  3LI9 A;  5TBM A;  4DJ3 A;  4LLO B;  4DN0 A;  2QJ7 A;  3GEC A;  4MCW A;  1TS0 A;  4LRX C;  4B9O A;  5IS1 A;  1IFQ A;  1BYW A;  1NLY A;  2Z6C A;  2HJ9 C;  1ODV A;  3PR6 A;  2XA7 S;  3E98 A;  3T4J A;  2B18 A;  4Y2F A;  5F69 A;  1TF1 A;  1XFQ A;  3H7W B;  3EOI A;  1DP8 A;  4NXE A;  1LL8 A;  3HJK A;  4Q0H A;  2Y79 A;  2ZMV A;  2LB5 A;  1TS6 A;  2O0Y A;  3E4Q A;  4Y5F A;  3VOL A;  1H3Q A;  4H6J B;  4FOF A;  4IHQ A;  3MQQ A;  4EEP A;  2XRN A;  5HD5 A;  2CMN A;  2Y8H A;  3T4K A;  3EQU A;  2KOI A;  4I5S A;  5HWV A;  3F1O A;  3KSI A;  2EWV A;  2O9C A;  1P9R A;  4WL9 A;  5KIZ A;  2J3T D;  5I5L A;  4I38 A;  1OTI A;  4G3V A;  3FPW A;  3EGD C;  1XJ2 A;  4Y3I A;  2W3H A;  4PKY A;  3E0Y A;  1LSW A;  2P7J A;  1XFN A;  4HP4 A;  5EFW A;  3FG8 A;  1X0O A;  3MQ0 A;  2O9B A;  5HDD A;  3R7W A;  3EEH A;  3PYP A;  1OTE A;  3T4S A;  4CLC B;  2W3D A;  4F3L A;  4GHI B;  3S7N A;  2OAP 1;  3CAX A;  5G4Y A;  4BWI A;  2W0N A;  3VV4 A;  5K5B A;  3PXP A;  2L0W A;  4YWZ A;  4NXB A;  2XRO A;  2A24 A;  2W3E A;  4ARZ A;  5C5K A;  2VLG A;  3W2Z A;  1UGU A;  3LID A;  4NXF A;  3PBQ A;  4UQI S;  4K08 A;  2W3F A;  5CX7 A;  4KQD A;  1OT9 A;  1YKD A;  1LT0 A;  3C8C A;  2PYP A;  1S4S A;  3KYQ A;  2W1T A;  4HNB A;  4EES A;  1W63 Q;  3LR0 A;  1F5M A;  2J3T C;  1V9Y A;  4BMW A;  5J4E A;  4L9E A;  4WEJ A;  1P0Z A;  1OTD A;  2NUP C;  3G6O A;  1H8M A;  1T1C A;  3S7Q A;  3B47 A;  1N9O A;  4Z1W A;  4E04 A;  3VE3 A;  2ZOH A;  3LI8 A;  3LIC A;  2PR5 A;  3P01 A;  1YSP A;  4BBV A;  1DP6 A;  4L0L A;  5HD3 A;  4GCZ A;  4HJ4 A;  3H82 B;  3LR4 A;  2OWH A;  4P6Z S;  5DF9 A;  3V67 A;  2XA7 M;  2KLI A;  2QHK A;  2J80 A;  3LIA A;  4XT2 A;  4ETX A;  4GS9 A;  2L4R A;  2EWW A;  3CLO A;  1UWP X;  2QKP A;  2D01 A;  3E4O A;  2YKF A;  4IJG A;  2VZW A;  1N9N A;  1VHM A;  2B02 A;  2KDK A;  3BQA A;  4JGQ A;  3UB9 A;  2WKQ A;  3FC7 A;  1NLZ A;  2HGV A;  4HI4 A;  1MKM A;  4O8G A;  1TS8 A;  2IA2 A;  1G6O A;  3F1P A;  3MJQ A;  3S7O A;  1TS7 A;  2FZ0 A;  3KYZ A;  4R70 A;  2HJE A;  3OCN A;  1S1Y A;  2W3G A;  2OAQ 1;  3BW6 A;  3NOT C;  3F1O B;  5DJT A;  3DBA A;  3K3D A;  3C38 A;  4I3I A;  4EQ1 A;  4Q0I A;  2V9A A;  5LBR A;  2GJ3 A;  5HWT A;  2FH5 A;  5HDS A;  3T4L A;  3PBN A;  3IBR A;  3ICY A;  1MZU A;  5A8B A;  2OOL A;  2VV6 A;  1LSX A;  5L8M A;  1KOU A;  3U2A A;  3UMD A;  4ZRR A;  5FL3 A;  2PD8 A;  1XJ4 A;  3T4Q A;  2Z6D A;  1STZ A;  4I3A A;  3H7W A;  4O0P A;  4OOM A;  3R7W B;  3MR0 A;  4MDZ A;  2G7U A;  2QYB A;  3MMH A;  2DMW A;  2J3W A;  1DRM A;  1OTA A;  1GSX A;  5HWW A;  3PBS A;  4H6J A;  4UEY A;  4UQI M;  3NOP C;  5F68 A;  4MN7 A;  3VE4 A;  2A24 B;  2PT7 A;  4B93 A;  3LR5 A;  4IUK A;  1ZTU A;  3D72 A;  3T4T A;  3OC2 A;  4EW7 A;  2H28 A;  5HL6 A;  4EEU A;  1T18 A;  4EET B;  4CQH A;  4DMZ A;  3F1N B;  4KUO A;  1JNU A;  4BJP A;  2D02 A;  3KSF A;  3RH8 B;  1TD5 A;  4HH2 A;  4NXG A;  2V0W A;  4L9G A;  3A0V A;  2VV8 A;  3GDI A;  4KUK A;  3KSH A;  4MN6 A;  1IOU A;  2GX5 A;  2A2L A;  4M4X A;  4PAU A;  5HSQ A;  2K7S A;  3K2N A;  3UB6 A;  4HY8 A;  3P7N A;  2WKR A;  4P6Z M;  4R38 A;  2V1A A;  4JGP A;  1T1A A;  5TJJ A;  4ETZ A;  2K2N A;  1LSV A;  3B42 A;  3EEA A;  5MC7 A;  5F5Y A;  1S1Z A;  1V9Z A;  4G3K A;  3A0S A;  2EA9 A;  5DFX A;  3MQO A;  4RQ9 A;  3A0R A;  4CLC E;  2VEA A;  4NKP A;  4II7 A;  1OJ5 A;  5AJG A;  3KX0 X;  5KSH A;  2LB9 A;  2K31 A;  3C30 A;  4BBT A;  4AFI A;  3NOU C;  5DJU A;  3ZQ5 A;  5TBM B;  4DJ2 A;  4HIA A;  3EGX C;  4JGO A;  1S67 L;  3BJN A;  4BBU A;  3IS2 A;  3LIF A;  4L9F A;  1N9L A;  2VGL M;  4LPZ A;  3MXQ A;  4HOI A;  2PHY A;  3SW1 A;  3HCY A;  1P9W A;  4KQO A;  1S66 L;  5AVF A;  3E4P A;  3BQ8 A;  1D7E A;  1OPX A;  4R3A A;  2WKP A;  3F1P B;  2W27 A;  2QWS A;  5HDC A;  5IT5 A;  3LR3 A;  4FSF A;  4WLA A;  2HV1 A;  3RFB A;  2XSS A;  4HQA A;  3ULF A;  1YSQ A;  2V1B A;  5HPF A;  3H82 A;  4I3J A;  4JGR A;  4WN5 A;  1GSV A;  4CLC D;  4ME4 A;  1Y28 A;  4R6L A;  2VGL S;  3O5Y A;  3OBF A;  3PHY A;  1W63 M;  2BAS A;  4HP9 A;  2JKT M;  3OOV A;  3JVU A;  2L1M A;  2PDR A;  3LYX A;  1UWN X;  2JKT I;  2PYR A;  2PR6 A;  2I9V A;  3TJZ C;  4EER A;  4HJ6 A;  3T50 A;  5HZH A;  5G4Z A;  2YKH A;  3K3C A;  2ZOI A;  3NJA A;  1OT6 A;  1P97 A;  3CWF A;  3KO6 A;  4I39 A;  1G28 A;  2O9A A;  3OLO A;  2R78 A;  1S4R A;  3MF0 A;  3IBJ A;  1F98 A;  4EXO A;  4F3L B;  4PKY G;  3NHQ A;  2JN7 A;  3EWK A;  4EUV A;  1XJ6 A;  3UB8 A;  5J3W A;  4WEL A;  2GZA A;  5DKL A;  1T1B A;  4YOF A;  3UE6 A;  3LFV A;  1F9I A;  4IUH A;  4ARZ B;  3EQV A;  4CLC C;  3S7P A;  4LRZ E;  3UE3 A;  2KX6 A;  4QPR A;  3RTY A;  2ZBB A;  2O99 A;  2NUT C;  4GW9 A;  3KSG A;  1DP9 A;  2W1R A;  3MFX A;  3TE8 A;  4NEE D;  2W1T B;  2M1C A;  4MMN A;  3LUQ A;  3D3O A;  1NRJ A;  2VKS A;  1EW0 A;  3C2W A;  3LIE A;  4EU0 A;  1OTB A;  3TRC A;  3FPV A;  2HF6 A;  4HJ3 A;  3UME A;  4CLC A;  4WEK A;  3B33 A;  2PD7 A;  4GHI A;  4YNR A;  2OWJ A;  3PBO A;  2INW A;  1WA9 A;  2ZMF A;  4PHT A;  4HH3 A;  1OJG A;  3F1N A;  5AVE A;  3H9W A;  3CUE C;  1VB6 A;  2JHE A;  2M7V A;  1D06 A;  3T4O A;  5IU1 A;  2V0U A;  3CI6 A;  5DFY A;  2VA0 A;  4WF0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...