2YKHA

Sensor region of a sensor histidine kinase
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
285
structure length
265
Chain Sequence
b'STLGDLLAEHTVLPGSAVDHLHAVVGEWQLLADLSFADYLMWVRRDDGVLVCVAQCRPNTGPTVVHTDAVGTVVAANSMPLVAATFSHSVEVSPVRFGDQVVAVLTRHQPELAARRRSGHLETAYRLCATDLLRMLAEGTFPDAGDVAMSRSSPRAGDGFIRLDVDGVVSYASPNALSAYHRMGLTTELEGVNLIDATRPLISDPFEAHEVDEHVQDLLAGDGKGMRMEVDAGGATVLLRTLPLVVAGRNVGAAILIRDVTEVKR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROBABLE SENSOR HISTIDINE KINASE PDTAS
molecule tags Transferase
source organism Mycobacterium tuberculosis
publication title The Sensor Region of the Ubiquitous Cytosolic Sensor Kinase, Pdtas, Contains Pas and Gaf Domain Sensing Modules.
pubmed doi rcsb
total genus 67
structure length 265
sequence length 285
chains with identical sequence B
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2011-05-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12282 H_kinase_N Signal transduction histidine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2ykhA02
3.30.450.280 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2ykhA01
5EFWA 3EEHA 3ICYA 2GJ3A 2W0NA 5J3WA 3IS2B 2PDRA 3NHQA 4R70A 5DJUA 1F9IA 1T1CA 2PD8A 1WA9A 2QHKA 3K3CA 4HP4A 4LRYC 3RH8B 1T1AA 3BY8A 1OTIA 3LICA 3UB8A 1V9YA 2B02A 1OTEA 1Y28A 3NOTC 4JGRA 4WUJA 1BYWA 5KIZA 3CLOA 2ZBBA 4HY8A 1F98A 2I9VA 3K3DA 4EW7A 4JGQA 1LSWA 2M1CA 3UE6A 4HHDA 4NXFA 3PYPA 4HNBA 5A8BA 2EA9A 4NXBA 1P97A 3UB7A 1MZUA 1D7EA 1GSVA 3H7WA 1S4SA 4I3AA 2P7JA 4JGPA 2VV7A 4H6JA 4WLAA 4GS9A 4HI4A 4L9FA 2INWA 3F1NB 1TS6A 2H28A 4NXGA 1JNUA 2PR6A 5HDSA 5F68A 4DJ3A 4WL9A 5G4YA 1XJ3A 2V0UA 2VV6A 3LIAA 5HWVA 1GSXA 5AVEA 4JGOA 3UMEA 4I3JA 2Z6DA 4E04A 4EESA 3C2WA 3LI9A 2V0WA 2VLGA 3EWKA 5DJTA 2QKPA 1XJ2A 3F1OB 1GSWA 2QWSA 2QJ7A 5DKLA 3IBRA 5HDDA 5HZHA 3H7WB 5J4EA 2OOLA 4I5SA 4K08A 4GHIA 4GW9A 1DRMA 2VEAA 5IU1A 4EXOA 4L9GA 4DJ2A 5HDCA 3CAXA 2A24A 1OJ5A 3HJIA 4HQAA 4HH3A 2HV1A 4HP9A 4EERA 1G28A 1TS0A 2CMNA 2KX6A 2WKPA 4I38A 2D01A 3A0VA 5I5LA 3ULFA 4LPZA 3ZQ5A 3A0RA 2PYPA 2QJ5A 2L4RA 3F1OA 1XFNA 3LIFA 1P0ZA 1DP6A 3MQQA 3UB9A 3D72A 3LUQA 2Z6CA 1S67L 2KDKA 4MN6A 5F69A 4BBUA 3P7NA 4I3IA 2WKQA 4GHIB 5AVFA 1VB6A 1T18A 1XFQA 4YWZA 3E4QA 1N9LA 4HJ6A 4F3LA 3F1NA 4R38A 3E4OA 1S4RA 2ZOIA 3GECA 1OTDA 3H9WA 3MR0A 4H6JB 4I39A 4MN5A 3VE3A 4BBTA 1ODVA 3LI8A 3GDIA 4LRZE 3SW1A 3LIDA 4HJ4A 5HD3A 5TBMB 3MJQA 3A0SA 3NOPC 4LLOB 2R78A 2J80A 4BBVA 4HOIA 4EEPA 3NOUC 3RTYA 3BY9A 1OTBA 4WF0A 2OWHA 5DKKA 4HH2A 1S66L 2BASA 3CWFA 4EETB 3HJKA 1S1ZA 2W27A 3NJAA 2D02A 4HIAA 3MXQA 2V1AA 5HWWA 3G6OA 5HSQA 3LIBA 2JHEA 2V9AA 2PYRA 3LYXA 4XT2A 2WKRA 1X0OA 1T1BA 2V1BA 3FC7A 4KUKA 4M4XA 5F5YA 3FG8A 4HJ3A 1LT0A 3C8CA 5G4ZA 3UMDA 3PHYA 4PKYG 2L1MA 2K7SA 1S1YA 4WN5A 3KX0X 4XT2B 1V9ZA 4B9OA 5TBMA 4GS9B 3LIEA 2L0WA 3E4PA 4KQDA 5J7EA 1UWPX 3BWLA 4R3AA 1OT9A 3MFXA 3MQOA 1EW0A 1LL8A 5F6AA 1KOUA 5HWTA 1N9NA 2ZOHA 2VV8A 1DP9A 3F1PB 3VE4A 3VOLA 4RQ9A 1NWZA 1TS8A 1OT6A 5HD5A 3H82B 1UWNX 4R6LA 3F1PA 5IS1A 4EEUA 1OTAA 4LRXC 1DP8A 4NXEA 1LSXA 2PD7A 1LSVA 1XJ4A 4KUOA 4EQ1A 1OJGA 2JN7A 2YKFA 3B33A 3H82A 4PKYA 1N9OA 1XJ6A 1TS7A 2OWJA 2YKHA 3IS2A 3T50A 1UGUA 2PR5A 3UB6A 4GCZA 4F3LB 1D06A 2PHYA 2A24B 1T19A 4L9EA 3OLOA
chains in the Genus database with same CATH superfamily
3UE1A 4BQMA 1KGEA 1W63M 3PR6A 3EEAA 1NLZA 1F9IA 3RH8B 5DF7A 3ITBA 1ONHA 1GCEA 3UE6A 3IQAA 5GLCA 4KZAA 3H7WA 5HPFA 3LR3A 4DXCA 5L10A 2K31A 5A91A 4OQGA 4G3WA 5CHJA 5EPHA 4A5RA 2V8FA 3LCEA 4K91A 4O01A 5DJTA 2EX6A 2H0TA 2CC1A 3S1YA 3H7WB 3BYDA 3A3JA 1K4FA 2A2LA 3LY3A 2EFXA 2C6WB 1SDNA 3MZEA 3CHWP 3VSLA 3UDIA 1IFQA 4D60A 2ZC7A 2ACGA 2C5WB 4EQIA 4Q8IA 1S4RA 4KQQA 3OZHA 3VE3A 3UE0A 3SW1A 3GDIA 3MJQA 3A0SA 2VGKA 1VEUA 1MWUA 2BASA 3HJKA 3NJAA 3OBFA 3P01A 5HSQA 1H8YA 3Q7ZA 4JXVA 3FG8A 4HJ3A 4P0MA 4OQ0A 2PT7A 4FH4A 2L0WA 1UWPX 3MFDA 4R3AA 1YAXA 4OPYA 1XKZA 1KOUA 3T4SA 5TGFA 5HD5A 4R6LA 1Q2PA 4KZ4A 2O0YA 3P98A 3IX3A 1PIOA 4QY6A 1NRFA 5L2FA 1KDSA 2QMIA 1PFLA 2V1ZA 3BJNA 4GNUA 1ZC2A 2PDRA 3NHQA 4Y13A 4IUHA 4Z1WA 1ES4A 3ZG5A 2VA0A 3A3IA 5IT5A 4JGQA 4FOFA 1P97A 3S7PA 4DKIA 3BFCA 1FSYA 4I3AA 4GS9A 1JWPA 2EX2A 3A3EA 5EVLA 3M2KA 3ZDJA 3RFBA 3MZFA 5E2GA 4JXSA 3WS1A 3C38A 4QY5A 3Q1FA 5DKLA 3IBRA 2MJ6A 2ZL1A 4GHIA 4EXOA 1A0KA 3HJIA 3N6IA 2WKPA 1RP5A 2PYPA 4RVAA 5FQMA 5FAQA 2OAP1 3IF6B 3KSHA 5CGSA 1H8ZA 1L0FA 1PNEA 3T1SA 3HCYA 2WKQA 4R4RA 2ZOIA 4I39A 4GJ4A 1MWTA 5EUAA 4C6YA 2DMWA 3LIDA 5KSHA 2WKHA 2PAVP 2ZM8A 3O88A 1FIKA 2XD5A 2OWHA 2D02A 3PAGA 3NY4A 3B42A 4GB7A 5HAIA 4IVIA 1JWVA 1MKMA 3D9YA 3ZVTA 3OPPA 4S2KA 5DFXA 4BL2A 1K56A 3G2ZA 1NWZA 4B4XA 5KZHA 4NXEA 3PBOA 2YKFA 2WGWB 2R9XA 2V2FF 3N7WA 4WM9A 2IWBA 5DTKA 1F5MA 4QJGA 3L9KA 1OTEA 1Y28A 5HFOA 2Y59A 3OCLA 2ZC5B 3CMZA 1I5QA 5A8BA 3ZYTA 4NXBA 3NULA 2JKTM 3PBTA 3FZCA 3OPRA 2Y2KA 1E3UD 5HWVA 2Q9NA 4GDNA 4DE1A 1BTLA 3OPLA 5EV0A 2DRWA 3LI9A 4DRTA 1GSWA 3HBRA 5FI7A 4DDYA 4I5SA 1XA1A 1PW1A 5HDCA 4QPRA 3UDXA 1YLZA 4CJNA 3LIFA 4MEZA 2Q9MA 3IHBA 4IEDA 4BENA 3BQ8A 1OTDA 4H6JB 1L0DA 3ZFZA 2J80A 5DKKA 4E6WA 1TDGA 3HUOA 5HWWA 2Y4AA 4WMCA 4ESPA 1XX2A 2G7UA 1NY0A 4CLCA 4KQOA 5M1AA 1KE3A 1H3QA 3BQAA 1YMSA 2ZOHA 3M6BA 1Z6FA 1W8QA 5BOHA 1OT6A 2JC7A 3QP1A 2PD7A 4PPRA 4KUOA 2ZC3B 3HL9A 3KYEA 2P74A 1N9LA 4UA6A 1YLWA 3LICA 1FR6A 4RA7A 2GNXA 4CLCE 4C75A 1BT5A 3ZVWA 1BZAA 1TD5A 1GHIA 3T1XA 2V20A 4OKPA 5A93A 4PM7A 3EQUA 1XJ3A 4YOFA 4JGOA 4MBFA 3LGOA 1HZOA 5M18A 2ZQAA 3W2ZA 3NCKA 4IBXA 2QJ7A 1NYMA 2UWXA 3QHYA 1D1JA 4HH3A 4AFIA 2L4RA 2UV0E 2FFYA 3AGFA 1DP6A 3GVBA 3BLMA 4S2NC 4PM8A 5AQ9A 3QP6A 1BULA 4OP8A 2WGVA 1IYPA 5HD3A 3HLDA 4MBKA 5GHXA 4HBTA 3KYQA 2W27A 3A3DA 3LYXA 1SKOB 5DF8A 1W7FA 3M2JA 3S22A 4XUXA 3E2KA 2Y8HA 2JKGA 3LIEA 3SH9A 1ZHHB 3KSFA 4UHUA 3VE4A 1EROA 3Q81A 3SS3A 4BLMA 5GHYA 3RJUA 4M3KA 3G2YA 3PBSA 4E3NA 1OTAA 1YKDA 4U0TA 4NEED 3T4OA 4N1HA 4EBPA 3MS6A 4BWIA 2HDQA 5DJUA 4P6ZS 1AWIA 4WELA 3BY8A 1OTIA 3E98A 5G18A 3ZG8B 3HLBA 1ZG4A 4KG2A 1NJ4A 2M1CA 3S7OA 2FFFB 1MZUA 2E8IA 1N9BA 4CLCB 5EM0A 3ZHHA 2PR6A 1FCOA 3BFEA 3JVVA 2Y2GA 3V3RA 5JYOA 1SCWA 2XDMA 4Y0UA 3HUNA 4X69A 2XA7M 3NBLA 5TR7A 3P09A 2EXBA 1ES2A 1ALQA 3LEQA 1CK3A 1YQSA 3F1OA 4FCFA 3SH7A 1WYBA 5F69A 1MBLA 1RGYA 4CPKA 4YFMA 3GECA 3FYZA 4WEJA 2WKIA 2WAEA 5EE8A 4BMWA 1QMFA 4X1LA 5TBMB 5FSRA 1DJBA 3RTYA 1MPLA 1DJAA 2R9WA 3VOZA 5A90A 5C5KA 2WK0A 1L0GA 1KE0A 2WZZA 3UMDA 1M40A 2K7SA 3W8KA 1SKOA 1WYCA 1K6SA 3D4FA 2XSSA 1CJFA 2KOIA 1K0KA 5FAPA 3MXSA 4NKPA 4S2NA 3UE3A 1IOUA 1FILA 3UPPA 1CEFA 1XJ6A 3IS2A 1W8YA 3V5MA 5DF9A 3PBNA 2WKEA 1WA9A 2QHKA 4HP4A 2Z2MB 3Q07A 4LENA 4Y5FA 2BG1A 5EOOA 4Y17A 5FQIA 4EWFA 1ERQA 3G4PA 3HUMA 4NXFA 3ZNTA 4HNBA 1IYSA 4JXWA 2ZC6B 2ZQ9A 2H28A 1PRQA 3ZG0A 3EQVA 4JLFA 4S2JA 4EESA 4OVDA 3F1OB 4X25A 4DMZA 5F82A 4DJ2A 2A24A 4HQAA 3IXGA 3TJZC 5CECA 1TS0A 3UPNA 4OQIA 4KZ6A 3HVFA 1K55C 2VGLM 4MDZA 4II7A 3NI9A 2P9VB 4UA7A 1PI5A 4I3IA 1T18A 3WRZA 3MXRA 3QNBA 1TF1A 5GHZA 1Q2QA 3NECA 1FOFA 3R7WB 2R78A 4EEPA 4HOIA 1MY8A 3G31A 2V1BA 3JPUA 2Z2LB 3B3XA 3FPWA 2ZQ7A 4PAUA 2W1RA 1V9ZA 1G6OA 4GS9B 4KG5A 3WS0A 4KQDA 1OT9A 2WZXA 4ZAMA 1BLHA 3DTIA 4H8RA 2VV8A 3VOLA 2B18A 4WEKA 1TS8A 4FUWA 1F2KA 4EEUA 3FWLA 1N9OA 2J8YA 3IWIA 4IJGA 1PW8A 3E0YA 1J3WA 4EQ1A 1K57A 2FZ0A 1M6KA 2Q0OA 2BTFP 2PBDP 2P9VA 3K3DA 3MKEA 3KYZA 3PYPA 1L3LA 3GR2A 4U3TA 5L09A 4JGPA 1K4EA 4P87A 3DAVA 2VV6A 1YLYA 5AVEA 2HP6A 3FKVA 3R7WA 2W3EA 1IYOA 3IX4A 3ITAA 1FSWA 4QWOA 5CX7A 1G28A 4MN7A 4DN0A 3UO9A 2AVXA 2Y2HA 4O0PA 4LCMA 1CI9A 1TDLA 5GLAA 3D72A 4QB8A 1E4DA 1EI5A 4OOLA 3S7NA 5E2HA 4BBTA 3LI8A 4S2OA 2Y79A 4PM9A 3PBQA 3TRCA 4HH2A 3CWFA 1VM1A 1K54A 2JKRM 3L7HA 2V9AA 3V67A 3T1RA 3WS5A 3I7JA 4PKYG 4GZBA 3C4PA 5EVIA 5FDSA 1K56D 4KQRA 1TEMA 3A3FA 4FTXA 3WRTA 4ETZA 4Y2FA 4X56A 5HL6A 3T4LA 2XEPA 4RYEA 3IWQA 4Q0HA 3LR0A 2Y2OA 3ISGA 2YKHA 5GL9A 3W4OA 4B93A 3OLOA 4WMCD 2BLSA 1KGGA 2XLNA 5CXWA 3O87A 1HVBA 1V9YA 2B02A 2WADA 4WYYA 3PAEA 4WUJA 5EVID 2J3TC 3CLOA 4CLCC 3CJMA 5HW3A 1KVLA 2EWVA 3MQ0A 1GA9A 1NXYA 3LR5A 3G32A 1GSVA 5FL3A 2EX9A 2VV7A 4H6JA 4L9FA 3IWOA 3LEZA 4R3BA 2O9BA 5F68A 2HGVA 4WL9A 4HBUA 4N9LA 1K38A 3VSKA 1LL5A 1O07A 4QD4A 5D3OA 3SOIA 2ZJ9A 3W4QA 5HDDA 3N4IA 2Y2LA 4K08A 4FD8A 3FV7A 1LHYA 5FA7A 1N4OA 4I38A 5CRFA 4ZRRA 1KGFA 4E3KA 3U4LP 2B5RA 2ZM2A 3UPOA 2JKTI 4YWZA 4O8GA 4MMNA 5HARA 4BBVA 1DY6A 4P6BA 1ES3A 4WF0A 1BSGA 3IXHA 2RCXA 4HIAA 3BFDA 4OOMA 4CLCD 4O7DA 3MF0A 5EVIC 2WKRA 3FC7A 2HDRA 1SZVA 1S1YA 5AQ7A 2WGWA 4R23A 1OMEA 4PM5A 3TOIA 1L2SA 2W3FA 3VMAA 3CUEA 1FR1A 1BUEA 3IH8A 4RQ9A 4LRXC 4F3LB 1UGUA 1IKGA 4L9EA 4ME4A 1GHMA 2JKRI 3BLSA 3DTEA 5CEDA 1MKIA 3T12B 1IYQA 3LR4A 4F94A 3RXWA 4WZ5C 5MC7A 1K25A 3MSHA 3BW6A 1S4SA 2H5SA 1YSPA 4K0XA 1H5XA 4P85A 1NYYA 5J4EA 5U47A 2RL3A 3EGXC 4E6XA 4K0WA 2XK1A 5TJJA 2HV1A 2CMNA 3S7QA 1P9RA 4LPZA 3A0RA 3C5AA 1CEGA 4PHTA 2H0YA 5FEFA 2JE5A 1XXMA 4OPQA 4F3LA 4R38A 3E4OA 2W1TA 2VKSA 1ODVA 4E3JA 4N1XA 1H0MA 4S2MA 4DF6A 5E2EA 2NUPC 2OV5A 4IVKA 1MWRA 2ZC4B 4WN5A 1WE4A 5TBMA 2M7UA 4OONA 1EW0A 1KVMA 1NRJA 1OPXA 3R4KA 4GD6A 1LI9A 1MXOA 1PI4A 2P08A 1G6AA 3VP3A 2OLUA 3UB5P 5A92A 2A24B 1FCNA 2HP5A 2WAFA 5CGWA 2W0NA 4P6ZM 4R70A 3KSGA 5E43A 4LRYC 2PBYA 4X55A 3RXXA 1JWZA 2PU4A 4MNRA 5FATA 1Y4OA 2HZ5A 5CHMA 5CHUA 2V0UA 1GA0A 3LIAA 1C3BA 2J3WA 4E3LA 1J9MA 1PZOA 4I3JA 3ZNYA 3IXBA 3OC2A 3T4TA 5FQ9A 3M6HA 3IXDA 2X71A 4NG2A 3WS4A 2E8JA 2ZMFA 5I5LA 1VETA 4E3MA 3N8RA 4JBFA 2B95A 3MQQA 3BFGA 1CF0A 2IA2A 4X1MA 4MBHA 4EUZA 3LFVA 5HAQA 2HPBA 1ZTUA 1JTGA 1AXBA 2IWCA 5IHVA 4B9OA 1KE4A 5LBRA 4ID4A 4JPMA 2ZQ8A 4L0LA 3MFXA 4LFUA 5GLDA 3MQOA 3DTKA 3Q82A 3UY6A 3CI6A 4B88A 5IS1A 1ONGA 2VJWA 1LSXA 5CEBA 1YPRA 3JVUA 4JF6A 3H82A 1T19A 2J7VA 5EFWA 1KDWA 1E25A 3LY4A 1K55A 3KO6A 1T1AA 3DW0A 3TW8A 5KIZA 1BYWA 3HLCA 4KZ9A 4ZTKA 3IF6A 3G34A 3OCNA 1YLPA 1IEMA 2INWA 2ZD8A 4NXGA 1PYYA 5G4YA 1PWCA 4JF5A 4DE0A 3UMEA 4E04A 1YT4A 1MWSA 3C2WA 4KENB 5DTSA 2JCHA 3Q7VA 4EBNA 2QKPA 4OQHA 5JYPA 4MLLA 4L9GA 4QHCA 4GD8A 2A49A 2XRNA 2ZLYA 3GQZA 3O86A 5DVAA 2JKFA 1BLCA 3QP4A 1PZPA 2OLVA 1S67L 3HLWA 5CGXA 1TVFA 4OH0A 2EX8A 3CPTB 3E4QA 2HF6A 2FH5A 4OOYA 3EGDC 4DE2A 4XXRA 3CZDA 1W5DA 1OTBA 2HDUA 1HTZA 5J8XA 5DTTA 1T1BA 3E2LA 3MKFA 1MC0A 2L1MA 4QU3A 3NDEA 1LL8A 1N9NA 3VFHA 2HJEA 3V39A 5FI2A 2PRFA 5AJGA 3H82B 3PBRA 3IBJA 1LSVA 3CG5A 2LB9A 2XF3A 3GTCA 2QZ6A 1D06A 2W3GA 2OSUA 3ICYA 2GJ3A 5J3WA 4UEYA 5EECA 4HY8A 1K6RA 2EFUA 1E3UA 4CQHA 2K2NA 2HJ9C 1PWDA 1TS6A 2XFTA 5EVIB 5HDSA 1BLSA 4DJ3A 3NC8A 1ES5A 2ZM0A 4NETA 2VX8A 3SH8A 3C7UA 1RCJA 2OOLA 5IU1A 1EWZA 1HLUP 1S6RA 5HPIA 2D01A 1ZG6A 4DE3A 4YNRA 5AQBA 5HAPA 2OAQ1 2ZL1B 4GHIB 4LGWA 4HJ6A 4LV2A 4Y0OA 3H9WA 4MN5A 4LRZE 4LV0A 3UDFA 1XP4A 3WS2A 3ZG7B 3NOUC 3LIBA 3ZCZA 4KUKA 4M4XA 5F5YA 1LT0A 2VGLS 3GSGA 4UAAA 4XT2B 4LV1A 2ZQCA 2VZWA 4UQIS 5J7EA 1SKFA 3QNCA 4KZ3A 4WBGA 3BEBA 3F1PA 4FH2A 3VP2A 1DP8A 2PU2A 1OJGA 2IWDA 4WZ4A 3T50A 2OWJA 5E2FA 2PHYA 5FEGA 4Q0JA 3DWZA 3G30A 4BL3A 1I2WA 3PTEA 3BM6A 5F1FA 3BRMA 4U0XA 3TSGA 4GDBA 1G68A 3F1NB 1VEUB 1FCMA 1GSXA 2O9CA 3MZDA 2ZMVA 3SZTA 1P9WA 3GMWA 3TG9A 3IHAA 4GW9A 2X02A 3HLEA 3VP4A 1CI8A 1CQAA 1NZUA 4N92A 4EERA 1S0WA 3NDGA 2KX6A 2VGJA 3A0VA 3FKWA 1ERMA 1XGJA 2QJ5A 1GHPA 1XFNA 1P0ZA 3UB9A 5FAOA 1L0EA 5AVFA 2XA7S 3C7VA 1FQGA 4WZ5A 5CTMA 4HJ4A 2Y91A 3IH9A 4OPRA 3VFFA 3BY9A 5AQAA 1QMEA 3T4JA 4Y0TA 2V1AA 3G6OA 1YLTA 1XGIA 3ZQ5A 3SS5A 4S2IA 3IF5A 4C3QA 1IELA 4Y15A 4HEFA 3E4PA 1I2SA 2GZAA 2Y2MA 4Y3IA 4OPZA 1UWNX 2XGNA 4LCLA 3LO7A 2W3DA 3B47A 2Y2PA 4ZJ2A 1XPBA 4B4ZA 3IS2B 1T1CA 2Y2JA 2XQZA 5KSCA 4ZBEA 3UB8A 4G3KA 1JVJA 3NOTC 4JGRA 2I9VA 5L07A 4ARZA 3C30A 4R3JA 1BLPA 1JNUA 4OLDA 3GRJA 3QP5A 2VLGA 3EWKA 1XJ2A 5M19A 5DFYA 3U2AA 4S2PA 5FASA 4BD1A 1OJ5A 5FQJA 4JKTA 2Y2IA 1LLBA 2QPNA 3VP0A 4DXBA 3CITA 1PWGA 4G3VA 2KDKA 3SS4A 1W79A 3DBAA 4BBUA 2EWWA 1XFQA 1ACFA 3F1NA 3MR0A 2QYBA 1SHVA 3AGDA 4Q0IA 4PM6A 4EETB 1Y54A 2NUTC 1S1ZA 1HD8A 4OP5A 2J9OA 3V3SA 4XT2A 5EOEA 1X0OA 1NZOA 3KX0X 3VP1A 2HDSA 4X53A 2XFSA 5F6AA 4N9KA 3F1PB 2M7VA 2JBFA 1YM1A 1YMXA 4YINA 4EV4A 2JN7A 3OPHA 1TS7A 1SDEA 1DP9A 5EM1A 5HL1A 1VHMA 5K5BA 2V8CA 1K54C 5GLBA 3EEHA 5EVEA 4LV3A 4NK3A 5CERA 4GOGA 1ESIA 2ZBBA 2EXAA 3NIAA 2WYXA 5FQKA 2EA9A 3UB7A 4KZ8A 2XROA 2P7JA 4HI4A 3IF6C 3QP8A 3O5YA 4KZBA 2X01A 3VOYA 3UN7A 1LL9A 3O3VA 3KSIA 2QWSA 4S2LA 4RX3A 5HZHA 1IKIA 3C4OA 3AGEA 3MBZA 4PMAA 1DRMA 3G35A 4KZ7A 4R1GA 3WWXA 2H10A 4BD0A 1XA7A 2LB5A 2Z6CA 3GV9A 2VK3A 1VETB 2W3HA 4GKUA 2DNSA 3K2NA 2Y55A 3HLFA 3T4QA 3UNWA 1YLJA 3QP2A 3NOPC 1K57C 5L8MA 2HP9A 4D2OA 1S66L 3OOVA 3JYIA 3HREA 4IBRA 2JHEA 2PYRA 3VV4A 1DJCA 1STZA 3PHYA 2XD1A 5FI6A 4ARZB 2ZQDA 1RGZA 4EUVA 5HWTA 2XH9A 1YSQA 3T4KA 4E3IA 3HLGA 4X68A 3CPTA 3B33A 4GN2A 2PR5A 4GCZA 3CUEC 3S4XA 4EBLA 3FPVA 2PD8A 1O7EA 3K3CA 4UA9A 4FSFA 3BFFA 3D3OA 1F98A 2O9AA 4UQIM 4EW7A 5FQQA 3T1QB 1LSWA 3TE8A 4HHDA 5FDHA 1H8MA 1ESUA 1D7EA 3PXPA 3Q7VB 4WLAA 2I72A 4ETXA 3V50A 4HESA 4R0QA 2Z6DA 2A3UA 3ZGAB 4ZJ3A 2V0WA 4BJPA 3DTMA 5F83A 2VEAA 4JF4A 4EU0A 4KZ5A 2G2UA 3N8SA 3CAXA 4HP9A 4Y7PA 2DCFA 2WGIA 4JXGA 3ULFA 2J3TD 3DWKA 4R4SA 4MCWA 5HX9A 4Z9QA 5KMWA 3EOIA 2G2WA 3LUQA 4MN6A 4XUZA 1LI0A 3P7NA 2GX5A 1VB6A 3MMHA 4GLQA 3W4PA 1VQQA 3IT9A 5CTNA 1Z09A 5F1GA 2O99A 3ZG9B 1JTDA 4LLOB 2J9PA 2Y2NA 3MXQA 5TFQA 3BECA 2W1TB 4ZJ1A 2WUQA 4RX2A 4OLGA 2KLIA 4ZDXA 3C8CA 4IHQA 5G4ZA 1G5UA 2Y2QA 1NLYA 4IUKA 3BWLA 5I94A 4DDSA 3N8LA 1U60A 4X6TA 2ZMAA 1W63Q 2GDNA 1ZKJA 3IX8A 2P04A 1XJ4A 4PKYA 3UB6A 4KG6A 4E3OA 2XR0A
chains in the Genus database with same CATH topology
1W63M 2JKRI 3PR6A 4BWIA 3EEAA 4Q0JA 5DJUA 4P6ZS 1NLZA 1F9IA 3RH8B 4WELA 3BY8A 1OTIA 3E98A 3LR4A 2M1CA 3UE6A 5MC7A 3S7OA 1MZUA 3H7WA 3BW6A 1S4SA 5HPFA 4CLCB 3F1NB 3LR3A 2PR6A 2K31A 1YSPA 1GSXA 2O9CA 4G3WA 3JVVA 2ZMVA 1P9WA 2XA7M 4O01A 5DJTA 5J4EA 3H7WB 3EGXC 2A2LA 4GW9A 5TJJA 2HV1A 4EERA 2CMNA 2KX6A 3S7QA 1P9RA 3A0VA 4LPZA 3A0RA 2QJ5A 3F1OA 4PHTA 1XFNA 1P0ZA 1IFQA 3UB9A 5F69A 5AVFA 2XA7S 4F3LA 4R38A 3E4OA 1S4RA 2W1TA 3GECA 4WEJA 2VKSA 3VE3A 3SW1A 1ODVA 3GDIA 4BMWA 4HJ4A 5TBMB 3MJQA 3A0SA 3RTYA 3BY9A 2BASA 3HJKA 3T4JA 3NJAA 2NUPC 2V1AA 3OBFA 3G6OA 3P01A 5HSQA 5C5KA 3ZQ5A 3FG8A 4HJ3A 3UMDA 2K7SA 4WN5A 2PT7A 5TBMA 2M7UA 2L0WA 3E4PA 1UWPX 4R3AA 1YAXA 1EW0A 1KOUA 2GZAA 2XSSA 1NRJA 1OPXA 3R4KA 3T4SA 2KOIA 4Y3IA 5HD5A 2P08A 1UWNX 4R6LA 2O0YA 4NKPA 3UE3A 1IOUA 1XJ6A 2W3DA 3B47A 3IS2A 3BJNA 2A24B 5DF9A 2W0NA 3IS2B 2PDRA 3NHQA 4P6ZM 3KSGA 3PBNA 4R70A 1T1CA 4LRYC 1WA9A 2QHKA 4HP4A 3UB8A 4IUHA 4Z1WA 4G3KA 4Y5FA 3NOTC 4JGRA 2VA0A 2I9VA 5IT5A 4JGQA 4ARZA 4NXFA 4HNBA 3C30A 4FOFA 1P97A 3S7PA 4I3AA 4GS9A 2H28A 1JNUA 2V0UA 3LIAA 3EQVA 2J3WA 3RFBA 4I3JA 4EESA 3C38A 2VLGA 3EWKA 1XJ2A 3F1OB 5DFYA 3U2AA 5DKLA 3IBRA 2MJ6A 3OC2A 3T4TA 4GHIA 4DMZA 4EXOA 4DJ2A 2A24A 1OJ5A 3HJIA 4HQAA 3TJZC 2ZMFA 1TS0A 2WKPA 5I5LA 2PYPA 2VGLM 4MDZA 2OAP1 4II7A 3CITA 3KSHA 3MQQA 4G3VA 2KDKA 4BBUA 3DBAA 3HCYA 4I3IA 2EWWA 2WKQA 1XFQA 1T18A 2IA2A 1TF1A 3F1NA 2ZOIA 3MR0A 4GJ4A 4I39A 2QYBA 2DMWA 3LIDA 5KSHA 3R7WB 2R78A 4Q0IA 4EEPA 3LFVA 4HOIA 4EETB 2OWHA 2NUTC 1S1ZA 2D02A 3B42A 4XT2A 1X0OA 2V1BA 1ZTUA 3FPWA 4PAUA 4B9OA 3KX0X 2W1RA 1V9ZA 5LBRA 1G6OA 4GS9B 4L0LA 1MKMA 4KQDA 1OT9A 3MFXA 3MQOA 5F6AA 2VV8A 3F1PB 3VOLA 5DFXA 2B18A 2M7VA 3CI6A 4WEKA 1NWZA 1TS8A 5IS1A 2VJWA 4EEUA 4NXEA 1LSXA 3PBOA 3JVUA 2JN7A 2YKFA 3H82A 1N9OA 1TS7A 1DP9A 1T19A 1VHMA 4IJGA 5EFWA 5K5BA 3EEHA 3E0YA 3KO6A 4EQ1A 1T1AA 2FZ0A 1F5MA 1OTEA 1Y28A 3TW8A 5KIZA 1BYWA 3OCLA 2ZBBA 3K3DA 3KYZA 3PYPA 5A8BA 3ZYTA 2EA9A 4NXBA 3OCNA 3UB7A 2JKTM 4JGPA 3PBTA 2P7JA 2XROA 4HI4A 2INWA 3O5YA 4NXGA 5HWVA 5G4YA 2VV6A 5AVEA 3UMEA 3R7WA 2W3EA 4E04A 3C2WA 3LI9A 2QKPA 3KSIA 1GSWA 2QWSA 5HZHA 4I5SA 1DRMA 4L9GA 5HDCA 2XRNA 4QPRA 5CX7A 1G28A 4MN7A 4DN0A 3LIFA 4O0PA 3D72A 2LB5A 1S67L 2Z6CA 2W3HA 3E4QA 3K2NA 2HF6A 4OOLA 3S7NA 2FH5A 3BQ8A 1OTDA 3EGDC 4H6JB 3T4QA 4BBTA 3LI8A 2Y79A 3NOPC 2J80A 3PBQA 5L8MA 3TRCA 1OTBA 5DKKA 4HH2A 1S66L 3CWFA 3OOVA 2JKRM 5HWWA 2JHEA 2V9AA 2PYRA 3V67A 3VV4A 1T1BA 1STZA 1MC0A 3PHYA 4PKYG 2L1MA 4ARZB 2G7UA 4CLCA 4KQOA 4EUVA 1H3QA 3BQAA 1LL8A 5HWTA 1N9NA 2ZOHA 1YSQA 4ETZA 2HJEA 4Y2FA 5AJGA 5HL6A 3T4KA 3T4LA 1OT6A 3H82B 4Q0HA 3PBRA 3LR0A 3IBJA 2PD7A 1LSVA 4KUOA 2LB9A 3B33A 2YKHA 2PR5A 4GCZA 4B93A 1D06A 1N9LA 3OLOA 2W3GA 3CUEC 3ICYA 2GJ3A 5J3WA 3FPVA 2PD8A 3K3CA 4UEYA 3LICA 1V9YA 2B02A 4FSFA 4WUJA 2GNXA 2J3TC 3CLOA 4HY8A 3D3OA 4CLCC 1F98A 2O9AA 4UQIM 4CLCE 4EW7A 1LSWA 2EWVA 3TE8A 4HHDA 3MQ0A 1H8MA 3LR5A 1TD5A 1D7EA 1GSVA 2K2NA 3PXPA 5FL3A 2HJ9C 4CQHA 2VV7A 4H6JA 4WLAA 4L9FA 4ETXA 1TS6A 5HDSA 4DJ3A 2O9BA 5F68A 2HGVA 3EQUA 1XJ3A 4WL9A 4YOFA 4JGOA 2Z6DA 3W2ZA 2V0WA 2VX8A 4BJPA 5HDDA 2QJ7A 2OOLA 4K08A 2VEAA 5IU1A 4EU0A 3CAXA 4HH3A 4HP9A 4I38A 3ULFA 5HPIA 2D01A 4ZRRA 4AFIA 2J3TD 2L4RA 4YNRA 4MCWA 1DP6A 3EOIA 2JKTI 3LUQA 2OAQ1 4MN6A 3P7NA 4GHIB 2GX5A 1VB6A 3MMHA 4YWZA 4HJ6A 4GLQA 3H9WA 4MN5A 2O99A 4LRZE 4O8GA 5HD3A 4MMNA 4LLOB 4BBVA 3NOUC 4WF0A 3KYQA 2W27A 4HIAA 3MXQA 2W1TB 3LIBA 4CLCD 4OOMA 3LYXA 3MF0A 2WKRA 3FC7A 2KLIA 4KUKA 4M4XA 5F5YA 1LT0A 2VGLS 3C8CA 4IHQA 5G4ZA 4XT2B 1S1YA 2Y8HA 2VZWA 3LIEA 4UQIS 1NLYA 1ZHHB 5J7EA 4IUKA 3BWLA 3KSFA 2W3FA 3CUEA 3VE4A 1W63Q 4RQ9A 3PBSA 3F1PA 2P04A 1OTAA 4LRXC 1DP8A 1YKDA 1XJ4A 4F3LB 1OJGA 4PKYA 3T50A 3UB6A 2OWJA 4NEED 3T4OA 1UGUA 2PHYA 4L9EA 4ME4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5EFW A;  3EEH A;  3ICY A;  2GJ3 A;  2W0N A;  5J3W A;  3IS2 B;  2PDR A;  3NHQ A;  4R70 A;  5DJU A;  1F9I A;  1T1C A;  2PD8 A;  1WA9 A;  2QHK A;  3K3C A;  4HP4 A;  4LRY C;  3RH8 B;  1T1A A;  3BY8 A;  1OTI A;  3LIC A;  3UB8 A;  1V9Y A;  2B02 A;  1OTE A;  1Y28 A;  3NOT C;  4JGR A;  4WUJ A;  1BYW A;  5KIZ A;  3CLO A;  2ZBB A;  4HY8 A;  1F98 A;  2I9V A;  3K3D A;  4EW7 A;  4JGQ A;  1LSW A;  2M1C A;  3UE6 A;  4HHD A;  4NXF A;  3PYP A;  4HNB A;  5A8B A;  2EA9 A;  4NXB A;  1P97 A;  3UB7 A;  1MZU A;  1D7E A;  1GSV A;  3H7W A;  1S4S A;  4I3A A;  2P7J A;  4JGP A;  2VV7 A;  4H6J A;  4WLA A;  4GS9 A;  4HI4 A;  4L9F A;  2INW A;  3F1N B;  1TS6 A;  2H28 A;  4NXG A;  1JNU A;  2PR6 A;  5HDS A;  5F68 A;  4DJ3 A;  4WL9 A;  5G4Y A;  1XJ3 A;  2V0U A;  2VV6 A;  3LIA A;  5HWV A;  1GSX A;  5AVE A;  4JGO A;  3UME A;  4I3J A;  2Z6D A;  4E04 A;  4EES A;  3C2W A;  3LI9 A;  2V0W A;  2VLG A;  3EWK A;  5DJT A;  2QKP A;  1XJ2 A;  3F1O B;  1GSW A;  2QWS A;  2QJ7 A;  5DKL A;  3IBR A;  5HDD A;  5HZH A;  3H7W B;  5J4E A;  2OOL A;  4I5S A;  4K08 A;  4GHI A;  4GW9 A;  1DRM A;  2VEA A;  5IU1 A;  4EXO A;  4L9G A;  4DJ2 A;  5HDC A;  3CAX A;  2A24 A;  1OJ5 A;  3HJI A;  4HQA A;  4HH3 A;  2HV1 A;  4HP9 A;  4EER A;  1G28 A;  1TS0 A;  2CMN A;  2KX6 A;  2WKP A;  4I38 A;  2D01 A;  3A0V A;  5I5L A;  3ULF A;  4LPZ A;  3ZQ5 A;  3A0R A;  2PYP A;  2QJ5 A;  2L4R A;  3F1O A;  1XFN A;  3LIF A;  1P0Z A;  1DP6 A;  3MQQ A;  3UB9 A;  3D72 A;  3LUQ A;  2Z6C A;  1S67 L;  2KDK A;  4MN6 A;  5F69 A;  4BBU A;  3P7N A;  4I3I A;  2WKQ A;  4GHI B;  5AVF A;  1VB6 A;  1T18 A;  1XFQ A;  4YWZ A;  3E4Q A;  1N9L A;  4HJ6 A;  4F3L A;  3F1N A;  4R38 A;  3E4O A;  1S4R A;  2ZOI A;  3GEC A;  1OTD A;  3H9W A;  3MR0 A;  4H6J B;  4I39 A;  4MN5 A;  3VE3 A;  4BBT A;  1ODV A;  3LI8 A;  3GDI A;  4LRZ E;  3SW1 A;  3LID A;  4HJ4 A;  5HD3 A;  5TBM B;  3MJQ A;  3A0S A;  3NOP C;  4LLO B;  2R78 A;  2J80 A;  4BBV A;  4HOI A;  4EEP A;  3NOU C;  3RTY A;  3BY9 A;  1OTB A;  4WF0 A;  2OWH A;  5DKK A;  4HH2 A;  1S66 L;  2BAS A;  3CWF A;  4EET B;  3HJK A;  1S1Z A;  2W27 A;  3NJA A;  2D02 A;  4HIA A;  3MXQ A;  2V1A A;  5HWW A;  3G6O A;  5HSQ A;  3LIB A;  2JHE A;  2V9A A;  2PYR A;  3LYX A;  4XT2 A;  2WKR A;  1X0O A;  1T1B A;  2V1B A;  3FC7 A;  4KUK A;  4M4X A;  5F5Y A;  3FG8 A;  4HJ3 A;  1LT0 A;  3C8C A;  5G4Z A;  3UMD A;  3PHY A;  4PKY G;  2L1M A;  2K7S A;  1S1Y A;  4WN5 A;  3KX0 X;  4XT2 B;  1V9Z A;  4B9O A;  5TBM A;  4GS9 B;  3LIE A;  2L0W A;  3E4P A;  4KQD A;  5J7E A;  1UWP X;  3BWL A;  4R3A A;  1OT9 A;  3MFX A;  3MQO A;  1EW0 A;  1LL8 A;  5F6A A;  1KOU A;  5HWT A;  1N9N A;  2ZOH A;  2VV8 A;  1DP9 A;  3F1P B;  3VE4 A;  3VOL A;  4RQ9 A;  1NWZ A;  1TS8 A;  1OT6 A;  5HD5 A;  3H82 B;  1UWN X;  4R6L A;  3F1P A;  5IS1 A;  4EEU A;  1OTA A;  4LRX C;  1DP8 A;  4NXE A;  1LSX A;  2PD7 A;  1LSV A;  1XJ4 A;  4KUO A;  4EQ1 A;  1OJG A;  2JN7 A;  2YKF A;  3B33 A;  3H82 A;  4PKY A;  1N9O A;  1XJ6 A;  1TS7 A;  2OWJ A;  2YKH A;  3IS2 A;  3T50 A;  1UGU A;  2PR5 A;  3UB6 A;  4GCZ A;  4F3L B;  1D06 A;  2PHY A;  2A24 B;  1T19 A;  4L9E A;  3OLO A; 
#chains in the Genus database with same CATH topology
 3UE1 A;  4BQM A;  1KGE A;  1W63 M;  3PR6 A;  3EEA A;  1NLZ A;  1F9I A;  3RH8 B;  5DF7 A;  3ITB A;  1ONH A;  1GCE A;  3UE6 A;  3IQA A;  5GLC A;  4KZA A;  3H7W A;  5HPF A;  3LR3 A;  4DXC A;  5L10 A;  2K31 A;  5A91 A;  4OQG A;  4G3W A;  5CHJ A;  5EPH A;  4A5R A;  2V8F A;  3LCE A;  4K91 A;  4O01 A;  5DJT A;  2EX6 A;  2H0T A;  2CC1 A;  3S1Y A;  3H7W B;  3BYD A;  3A3J A;  1K4F A;  2A2L A;  3LY3 A;  2EFX A;  2C6W B;  1SDN A;  3MZE A;  3CHW P;  3VSL A;  3UDI A;  1IFQ A;  4D60 A;  2ZC7 A;  2ACG A;  2C5W B;  4EQI A;  4Q8I A;  1S4R A;  4KQQ A;  3OZH A;  3VE3 A;  3UE0 A;  3SW1 A;  3GDI A;  3MJQ A;  3A0S A;  2VGK A;  1VEU A;  1MWU A;  2BAS A;  3HJK A;  3NJA A;  3OBF A;  3P01 A;  5HSQ A;  1H8Y A;  3Q7Z A;  4JXV A;  3FG8 A;  4HJ3 A;  4P0M A;  4OQ0 A;  2PT7 A;  4FH4 A;  2L0W A;  1UWP X;  3MFD A;  4R3A A;  1YAX A;  4OPY A;  1XKZ A;  1KOU A;  3T4S A;  5TGF A;  5HD5 A;  4R6L A;  1Q2P A;  4KZ4 A;  2O0Y A;  3P98 A;  3IX3 A;  1PIO A;  4QY6 A;  1NRF A;  5L2F A;  1KDS A;  2QMI A;  1PFL A;  2V1Z A;  3BJN A;  4GNU A;  1ZC2 A;  2PDR A;  3NHQ A;  4Y13 A;  4IUH A;  4Z1W A;  1ES4 A;  3ZG5 A;  2VA0 A;  3A3I A;  5IT5 A;  4JGQ A;  4FOF A;  1P97 A;  3S7P A;  4DKI A;  3BFC A;  1FSY A;  4I3A A;  4GS9 A;  1JWP A;  2EX2 A;  3A3E A;  5EVL A;  3M2K A;  3ZDJ A;  3RFB A;  3MZF A;  5E2G A;  4JXS A;  3WS1 A;  3C38 A;  4QY5 A;  3Q1F A;  5DKL A;  3IBR A;  2MJ6 A;  2ZL1 A;  4GHI A;  4EXO A;  1A0K A;  3HJI A;  3N6I A;  2WKP A;  1RP5 A;  2PYP A;  4RVA A;  5FQM A;  5FAQ A;  2OAP 1;  3IF6 B;  3KSH A;  5CGS A;  1H8Z A;  1L0F A;  1PNE A;  3T1S A;  3HCY A;  2WKQ A;  4R4R A;  2ZOI A;  4I39 A;  4GJ4 A;  1MWT A;  5EUA A;  4C6Y A;  2DMW A;  3LID A;  5KSH A;  2WKH A;  2PAV P;  2ZM8 A;  3O88 A;  1FIK A;  2XD5 A;  2OWH A;  2D02 A;  3PAG A;  3NY4 A;  3B42 A;  4GB7 A;  5HAI A;  4IVI A;  1JWV A;  1MKM A;  3D9Y A;  3ZVT A;  3OPP A;  4S2K A;  5DFX A;  4BL2 A;  1K56 A;  3G2Z A;  1NWZ A;  4B4X A;  5KZH A;  4NXE A;  3PBO A;  2YKF A;  2WGW B;  2R9X A;  2V2F F;  3N7W A;  4WM9 A;  2IWB A;  5DTK A;  1F5M A;  4QJG A;  3L9K A;  1OTE A;  1Y28 A;  5HFO A;  2Y59 A;  3OCL A;  2ZC5 B;  3CMZ A;  1I5Q A;  5A8B A;  3ZYT A;  4NXB A;  3NUL A;  2JKT M;  3PBT A;  3FZC A;  3OPR A;  2Y2K A;  1E3U D;  5HWV A;  2Q9N A;  4GDN A;  4DE1 A;  1BTL A;  3OPL A;  5EV0 A;  2DRW A;  3LI9 A;  4DRT A;  1GSW A;  3HBR A;  5FI7 A;  4DDY A;  4I5S A;  1XA1 A;  1PW1 A;  5HDC A;  4QPR A;  3UDX A;  1YLZ A;  4CJN A;  3LIF A;  4MEZ A;  2Q9M A;  3IHB A;  4IED A;  4BEN A;  3BQ8 A;  1OTD A;  4H6J B;  1L0D A;  3ZFZ A;  2J80 A;  5DKK A;  4E6W A;  1TDG A;  3HUO A;  5HWW A;  2Y4A A;  4WMC A;  4ESP A;  1XX2 A;  2G7U A;  1NY0 A;  4CLC A;  4KQO A;  5M1A A;  1KE3 A;  1H3Q A;  3BQA A;  1YMS A;  2ZOH A;  3M6B A;  1Z6F A;  1W8Q A;  5BOH A;  1OT6 A;  2JC7 A;  3QP1 A;  2PD7 A;  4PPR A;  4KUO A;  2ZC3 B;  3HL9 A;  3KYE A;  2P74 A;  1N9L A;  4UA6 A;  1YLW A;  3LIC A;  1FR6 A;  4RA7 A;  2GNX A;  4CLC E;  4C75 A;  1BT5 A;  3ZVW A;  1BZA A;  1TD5 A;  1GHI A;  3T1X A;  2V20 A;  4OKP A;  5A93 A;  4PM7 A;  3EQU A;  1XJ3 A;  4YOF A;  4JGO A;  4MBF A;  3LGO A;  1HZO A;  5M18 A;  2ZQA A;  3W2Z A;  3NCK A;  4IBX A;  2QJ7 A;  1NYM A;  2UWX A;  3QHY A;  1D1J A;  4HH3 A;  4AFI A;  2L4R A;  2UV0 E;  2FFY A;  3AGF A;  1DP6 A;  3GVB A;  3BLM A;  4S2N C;  4PM8 A;  5AQ9 A;  3QP6 A;  1BUL A;  4OP8 A;  2WGV A;  1IYP A;  5HD3 A;  3HLD A;  4MBK A;  5GHX A;  4HBT A;  3KYQ A;  2W27 A;  3A3D A;  3LYX A;  1SKO B;  5DF8 A;  1W7F A;  3M2J A;  3S22 A;  4XUX A;  3E2K A;  2Y8H A;  2JKG A;  3LIE A;  3SH9 A;  1ZHH B;  3KSF A;  4UHU A;  3VE4 A;  1ERO A;  3Q81 A;  3SS3 A;  4BLM A;  5GHY A;  3RJU A;  4M3K A;  3G2Y A;  3PBS A;  4E3N A;  1OTA A;  1YKD A;  4U0T A;  4NEE D;  3T4O A;  4N1H A;  4EBP A;  3MS6 A;  4BWI A;  2HDQ A;  5DJU A;  4P6Z S;  1AWI A;  4WEL A;  3BY8 A;  1OTI A;  3E98 A;  5G18 A;  3ZG8 B;  3HLB A;  1ZG4 A;  4KG2 A;  1NJ4 A;  2M1C A;  3S7O A;  2FFF B;  1MZU A;  2E8I A;  1N9B A;  4CLC B;  5EM0 A;  3ZHH A;  2PR6 A;  1FCO A;  3BFE A;  3JVV A;  2Y2G A;  3V3R A;  5JYO A;  1SCW A;  2XDM A;  4Y0U A;  3HUN A;  4X69 A;  2XA7 M;  3NBL A;  5TR7 A;  3P09 A;  2EXB A;  1ES2 A;  1ALQ A;  3LEQ A;  1CK3 A;  1YQS A;  3F1O A;  4FCF A;  3SH7 A;  1WYB A;  5F69 A;  1MBL A;  1RGY A;  4CPK A;  4YFM A;  3GEC A;  3FYZ A;  4WEJ A;  2WKI A;  2WAE A;  5EE8 A;  4BMW A;  1QMF A;  4X1L A;  5TBM B;  5FSR A;  1DJB A;  3RTY A;  1MPL A;  1DJA A;  2R9W A;  3VOZ A;  5A90 A;  5C5K A;  2WK0 A;  1L0G A;  1KE0 A;  2WZZ A;  3UMD A;  1M40 A;  2K7S A;  3W8K A;  1SKO A;  1WYC A;  1K6S A;  3D4F A;  2XSS A;  1CJF A;  2KOI A;  1K0K A;  5FAP A;  3MXS A;  4NKP A;  4S2N A;  3UE3 A;  1IOU A;  1FIL A;  3UPP A;  1CEF A;  1XJ6 A;  3IS2 A;  1W8Y A;  3V5M A;  5DF9 A;  3PBN A;  2WKE A;  1WA9 A;  2QHK A;  4HP4 A;  2Z2M B;  3Q07 A;  4LEN A;  4Y5F A;  2BG1 A;  5EOO A;  4Y17 A;  5FQI A;  4EWF A;  1ERQ A;  3G4P A;  3HUM A;  4NXF A;  3ZNT A;  4HNB A;  1IYS A;  4JXW A;  2ZC6 B;  2ZQ9 A;  2H28 A;  1PRQ A;  3ZG0 A;  3EQV A;  4JLF A;  4S2J A;  4EES A;  4OVD A;  3F1O B;  4X25 A;  4DMZ A;  5F82 A;  4DJ2 A;  2A24 A;  4HQA A;  3IXG A;  3TJZ C;  5CEC A;  1TS0 A;  3UPN A;  4OQI A;  4KZ6 A;  3HVF A;  1K55 C;  2VGL M;  4MDZ A;  4II7 A;  3NI9 A;  2P9V B;  4UA7 A;  1PI5 A;  4I3I A;  1T18 A;  3WRZ A;  3MXR A;  3QNB A;  1TF1 A;  5GHZ A;  1Q2Q A;  3NEC A;  1FOF A;  3R7W B;  2R78 A;  4EEP A;  4HOI A;  1MY8 A;  3G31 A;  2V1B A;  3JPU A;  2Z2L B;  3B3X A;  3FPW A;  2ZQ7 A;  4PAU A;  2W1R A;  1V9Z A;  1G6O A;  4GS9 B;  4KG5 A;  3WS0 A;  4KQD A;  1OT9 A;  2WZX A;  4ZAM A;  1BLH A;  3DTI A;  4H8R A;  2VV8 A;  3VOL A;  2B18 A;  4WEK A;  1TS8 A;  4FUW A;  1F2K A;  4EEU A;  3FWL A;  1N9O A;  2J8Y A;  3IWI A;  4IJG A;  1PW8 A;  3E0Y A;  1J3W A;  4EQ1 A;  1K57 A;  2FZ0 A;  1M6K A;  2Q0O A;  2BTF P;  2PBD P;  2P9V A;  3K3D A;  3MKE A;  3KYZ A;  3PYP A;  1L3L A;  3GR2 A;  4U3T A;  5L09 A;  4JGP A;  1K4E A;  4P87 A;  3DAV A;  2VV6 A;  1YLY A;  5AVE A;  2HP6 A;  3FKV A;  3R7W A;  2W3E A;  1IYO A;  3IX4 A;  3ITA A;  1FSW A;  4QWO A;  5CX7 A;  1G28 A;  4MN7 A;  4DN0 A;  3UO9 A;  2AVX A;  2Y2H A;  4O0P A;  4LCM A;  1CI9 A;  1TDL A;  5GLA A;  3D72 A;  4QB8 A;  1E4D A;  1EI5 A;  4OOL A;  3S7N A;  5E2H A;  4BBT A;  3LI8 A;  4S2O A;  2Y79 A;  4PM9 A;  3PBQ A;  3TRC A;  4HH2 A;  3CWF A;  1VM1 A;  1K54 A;  2JKR M;  3L7H A;  2V9A A;  3V67 A;  3T1R A;  3WS5 A;  3I7J A;  4PKY G;  4GZB A;  3C4P A;  5EVI A;  5FDS A;  1K56 D;  4KQR A;  1TEM A;  3A3F A;  4FTX A;  3WRT A;  4ETZ A;  4Y2F A;  4X56 A;  5HL6 A;  3T4L A;  2XEP A;  4RYE A;  3IWQ A;  4Q0H A;  3LR0 A;  2Y2O A;  3ISG A;  2YKH A;  5GL9 A;  3W4O A;  4B93 A;  3OLO A;  4WMC D;  2BLS A;  1KGG A;  2XLN A;  5CXW A;  3O87 A;  1HVB A;  1V9Y A;  2B02 A;  2WAD A;  4WYY A;  3PAE A;  4WUJ A;  5EVI D;  2J3T C;  3CLO A;  4CLC C;  3CJM A;  5HW3 A;  1KVL A;  2EWV A;  3MQ0 A;  1GA9 A;  1NXY A;  3LR5 A;  3G32 A;  1GSV A;  5FL3 A;  2EX9 A;  2VV7 A;  4H6J A;  4L9F A;  3IWO A;  3LEZ A;  4R3B A;  2O9B A;  5F68 A;  2HGV A;  4WL9 A;  4HBU A;  4N9L A;  1K38 A;  3VSK A;  1LL5 A;  1O07 A;  4QD4 A;  5D3O A;  3SOI A;  2ZJ9 A;  3W4Q A;  5HDD A;  3N4I A;  2Y2L A;  4K08 A;  4FD8 A;  3FV7 A;  1LHY A;  5FA7 A;  1N4O A;  4I38 A;  5CRF A;  4ZRR A;  1KGF A;  4E3K A;  3U4L P;  2B5R A;  2ZM2 A;  3UPO A;  2JKT I;  4YWZ A;  4O8G A;  4MMN A;  5HAR A;  4BBV A;  1DY6 A;  4P6B A;  1ES3 A;  4WF0 A;  1BSG A;  3IXH A;  2RCX A;  4HIA A;  3BFD A;  4OOM A;  4CLC D;  4O7D A;  3MF0 A;  5EVI C;  2WKR A;  3FC7 A;  2HDR A;  1SZV A;  1S1Y A;  5AQ7 A;  2WGW A;  4R23 A;  1OME A;  4PM5 A;  3TOI A;  1L2S A;  2W3F A;  3VMA A;  3CUE A;  1FR1 A;  1BUE A;  3IH8 A;  4RQ9 A;  4LRX C;  4F3L B;  1UGU A;  1IKG A;  4L9E A;  4ME4 A;  1GHM A;  2JKR I;  3BLS A;  3DTE A;  5CED A;  1MKI A;  3T12 B;  1IYQ A;  3LR4 A;  4F94 A;  3RXW A;  4WZ5 C;  5MC7 A;  1K25 A;  3MSH A;  3BW6 A;  1S4S A;  2H5S A;  1YSP A;  4K0X A;  1H5X A;  4P85 A;  1NYY A;  5J4E A;  5U47 A;  2RL3 A;  3EGX C;  4E6X A;  4K0W A;  2XK1 A;  5TJJ A;  2HV1 A;  2CMN A;  3S7Q A;  1P9R A;  4LPZ A;  3A0R A;  3C5A A;  1CEG A;  4PHT A;  2H0Y A;  5FEF A;  2JE5 A;  1XXM A;  4OPQ A;  4F3L A;  4R38 A;  3E4O A;  2W1T A;  2VKS A;  1ODV A;  4E3J A;  4N1X A;  1H0M A;  4S2M A;  4DF6 A;  5E2E A;  2NUP C;  2OV5 A;  4IVK A;  1MWR A;  2ZC4 B;  4WN5 A;  1WE4 A;  5TBM A;  2M7U A;  4OON A;  1EW0 A;  1KVM A;  1NRJ A;  1OPX A;  3R4K A;  4GD6 A;  1LI9 A;  1MXO A;  1PI4 A;  2P08 A;  1G6A A;  3VP3 A;  2OLU A;  3UB5 P;  5A92 A;  2A24 B;  1FCN A;  2HP5 A;  2WAF A;  5CGW A;  2W0N A;  4P6Z M;  4R70 A;  3KSG A;  5E43 A;  4LRY C;  2PBY A;  4X55 A;  3RXX A;  1JWZ A;  2PU4 A;  4MNR A;  5FAT A;  1Y4O A;  2HZ5 A;  5CHM A;  5CHU A;  2V0U A;  1GA0 A;  3LIA A;  1C3B A;  2J3W A;  4E3L A;  1J9M A;  1PZO A;  4I3J A;  3ZNY A;  3IXB A;  3OC2 A;  3T4T A;  5FQ9 A;  3M6H A;  3IXD A;  2X71 A;  4NG2 A;  3WS4 A;  2E8J A;  2ZMF A;  5I5L A;  1VET A;  4E3M A;  3N8R A;  4JBF A;  2B95 A;  3MQQ A;  3BFG A;  1CF0 A;  2IA2 A;  4X1M A;  4MBH A;  4EUZ A;  3LFV A;  5HAQ A;  2HPB A;  1ZTU A;  1JTG A;  1AXB A;  2IWC A;  5IHV A;  4B9O A;  1KE4 A;  5LBR A;  4ID4 A;  4JPM A;  2ZQ8 A;  4L0L A;  3MFX A;  4LFU A;  5GLD A;  3MQO A;  3DTK A;  3Q82 A;  3UY6 A;  3CI6 A;  4B88 A;  5IS1 A;  1ONG A;  2VJW A;  1LSX A;  5CEB A;  1YPR A;  3JVU A;  4JF6 A;  3H82 A;  1T19 A;  2J7V A;  5EFW A;  1KDW A;  1E25 A;  3LY4 A;  1K55 A;  3KO6 A;  1T1A A;  3DW0 A;  3TW8 A;  5KIZ A;  1BYW A;  3HLC A;  4KZ9 A;  4ZTK A;  3IF6 A;  3G34 A;  3OCN A;  1YLP A;  1IEM A;  2INW A;  2ZD8 A;  4NXG A;  1PYY A;  5G4Y A;  1PWC A;  4JF5 A;  4DE0 A;  3UME A;  4E04 A;  1YT4 A;  1MWS A;  3C2W A;  4KEN B;  5DTS A;  2JCH A;  3Q7V A;  4EBN A;  2QKP A;  4OQH A;  5JYP A;  4MLL A;  4L9G A;  4QHC A;  4GD8 A;  2A49 A;  2XRN A;  2ZLY A;  3GQZ A;  3O86 A;  5DVA A;  2JKF A;  1BLC A;  3QP4 A;  1PZP A;  2OLV A;  1S67 L;  3HLW A;  5CGX A;  1TVF A;  4OH0 A;  2EX8 A;  3CPT B;  3E4Q A;  2HF6 A;  2FH5 A;  4OOY A;  3EGD C;  4DE2 A;  4XXR A;  3CZD A;  1W5D A;  1OTB A;  2HDU A;  1HTZ A;  5J8X A;  5DTT A;  1T1B A;  3E2L A;  3MKF A;  1MC0 A;  2L1M A;  4QU3 A;  3NDE A;  1LL8 A;  1N9N A;  3VFH A;  2HJE A;  3V39 A;  5FI2 A;  2PRF A;  5AJG A;  3H82 B;  3PBR A;  3IBJ A;  1LSV A;  3CG5 A;  2LB9 A;  2XF3 A;  3GTC A;  2QZ6 A;  1D06 A;  2W3G A;  2OSU A;  3ICY A;  2GJ3 A;  5J3W A;  4UEY A;  5EEC A;  4HY8 A;  1K6R A;  2EFU A;  1E3U A;  4CQH A;  2K2N A;  2HJ9 C;  1PWD A;  1TS6 A;  2XFT A;  5EVI B;  5HDS A;  1BLS A;  4DJ3 A;  3NC8 A;  1ES5 A;  2ZM0 A;  4NET A;  2VX8 A;  3SH8 A;  3C7U A;  1RCJ A;  2OOL A;  5IU1 A;  1EWZ A;  1HLU P;  1S6R A;  5HPI A;  2D01 A;  1ZG6 A;  4DE3 A;  4YNR A;  5AQB A;  5HAP A;  2OAQ 1;  2ZL1 B;  4GHI B;  4LGW A;  4HJ6 A;  4LV2 A;  4Y0O A;  3H9W A;  4MN5 A;  4LRZ E;  4LV0 A;  3UDF A;  1XP4 A;  3WS2 A;  3ZG7 B;  3NOU C;  3LIB A;  3ZCZ A;  4KUK A;  4M4X A;  5F5Y A;  1LT0 A;  2VGL S;  3GSG A;  4UAA A;  4XT2 B;  4LV1 A;  2ZQC A;  2VZW A;  4UQI S;  5J7E A;  1SKF A;  3QNC A;  4KZ3 A;  4WBG A;  3BEB A;  3F1P A;  4FH2 A;  3VP2 A;  1DP8 A;  2PU2 A;  1OJG A;  2IWD A;  4WZ4 A;  3T50 A;  2OWJ A;  5E2F A;  2PHY A;  5FEG A;  4Q0J A;  3DWZ A;  3G30 A;  4BL3 A;  1I2W A;  3PTE A;  3BM6 A;  5F1F A;  3BRM A;  4U0X A;  3TSG A;  4GDB A;  1G68 A;  3F1N B;  1VEU B;  1FCM A;  1GSX A;  2O9C A;  3MZD A;  2ZMV A;  3SZT A;  1P9W A;  3GMW A;  3TG9 A;  3IHA A;  4GW9 A;  2X02 A;  3HLE A;  3VP4 A;  1CI8 A;  1CQA A;  1NZU A;  4N92 A;  4EER A;  1S0W A;  3NDG A;  2KX6 A;  2VGJ A;  3A0V A;  3FKW A;  1ERM A;  1XGJ A;  2QJ5 A;  1GHP A;  1XFN A;  1P0Z A;  3UB9 A;  5FAO A;  1L0E A;  5AVF A;  2XA7 S;  3C7V A;  1FQG A;  4WZ5 A;  5CTM A;  4HJ4 A;  2Y91 A;  3IH9 A;  4OPR A;  3VFF A;  3BY9 A;  5AQA A;  1QME A;  3T4J A;  4Y0T A;  2V1A A;  3G6O A;  1YLT A;  1XGI A;  3ZQ5 A;  3SS5 A;  4S2I A;  3IF5 A;  4C3Q A;  1IEL A;  4Y15 A;  4HEF A;  3E4P A;  1I2S A;  2GZA A;  2Y2M A;  4Y3I A;  4OPZ A;  1UWN X;  2XGN A;  4LCL A;  3LO7 A;  2W3D A;  3B47 A;  2Y2P A;  4ZJ2 A;  1XPB A;  4B4Z A;  3IS2 B;  1T1C A;  2Y2J A;  2XQZ A;  5KSC A;  4ZBE A;  3UB8 A;  4G3K A;  1JVJ A;  3NOT C;  4JGR A;  2I9V A;  5L07 A;  4ARZ A;  3C30 A;  4R3J A;  1BLP A;  1JNU A;  4OLD A;  3GRJ A;  3QP5 A;  2VLG A;  3EWK A;  1XJ2 A;  5M19 A;  5DFY A;  3U2A A;  4S2P A;  5FAS A;  4BD1 A;  1OJ5 A;  5FQJ A;  4JKT A;  2Y2I A;  1LLB A;  2QPN A;  3VP0 A;  4DXB A;  3CIT A;  1PWG A;  4G3V A;  2KDK A;  3SS4 A;  1W79 A;  3DBA A;  4BBU A;  2EWW A;  1XFQ A;  1ACF A;  3F1N A;  3MR0 A;  2QYB A;  1SHV A;  3AGD A;  4Q0I A;  4PM6 A;  4EET B;  1Y54 A;  2NUT C;  1S1Z A;  1HD8 A;  4OP5 A;  2J9O A;  3V3S A;  4XT2 A;  5EOE A;  1X0O A;  1NZO A;  3KX0 X;  3VP1 A;  2HDS A;  4X53 A;  2XFS A;  5F6A A;  4N9K A;  3F1P B;  2M7V A;  2JBF A;  1YM1 A;  1YMX A;  4YIN A;  4EV4 A;  2JN7 A;  3OPH A;  1TS7 A;  1SDE A;  1DP9 A;  5EM1 A;  5HL1 A;  1VHM A;  5K5B A;  2V8C A;  1K54 C;  5GLB A;  3EEH A;  5EVE A;  4LV3 A;  4NK3 A;  5CER A;  4GOG A;  1ESI A;  2ZBB A;  2EXA A;  3NIA A;  2WYX A;  5FQK A;  2EA9 A;  3UB7 A;  4KZ8 A;  2XRO A;  2P7J A;  4HI4 A;  3IF6 C;  3QP8 A;  3O5Y A;  4KZB A;  2X01 A;  3VOY A;  3UN7 A;  1LL9 A;  3O3V A;  3KSI A;  2QWS A;  4S2L A;  4RX3 A;  5HZH A;  1IKI A;  3C4O A;  3AGE A;  3MBZ A;  4PMA A;  1DRM A;  3G35 A;  4KZ7 A;  4R1G A;  3WWX A;  2H10 A;  4BD0 A;  1XA7 A;  2LB5 A;  2Z6C A;  3GV9 A;  2VK3 A;  1VET B;  2W3H A;  4GKU A;  2DNS A;  3K2N A;  2Y55 A;  3HLF A;  3T4Q A;  3UNW A;  1YLJ A;  3QP2 A;  3NOP C;  1K57 C;  5L8M A;  2HP9 A;  4D2O A;  1S66 L;  3OOV A;  3JYI A;  3HRE A;  4IBR A;  2JHE A;  2PYR A;  3VV4 A;  1DJC A;  1STZ A;  3PHY A;  2XD1 A;  5FI6 A;  4ARZ B;  2ZQD A;  1RGZ A;  4EUV A;  5HWT A;  2XH9 A;  1YSQ A;  3T4K A;  4E3I A;  3HLG A;  4X68 A;  3CPT A;  3B33 A;  4GN2 A;  2PR5 A;  4GCZ A;  3CUE C;  3S4X A;  4EBL A;  3FPV A;  2PD8 A;  1O7E A;  3K3C A;  4UA9 A;  4FSF A;  3BFF A;  3D3O A;  1F98 A;  2O9A A;  4UQI M;  4EW7 A;  5FQQ A;  3T1Q B;  1LSW A;  3TE8 A;  4HHD A;  5FDH A;  1H8M A;  1ESU A;  1D7E A;  3PXP A;  3Q7V B;  4WLA A;  2I72 A;  4ETX A;  3V50 A;  4HES A;  4R0Q A;  2Z6D A;  2A3U A;  3ZGA B;  4ZJ3 A;  2V0W A;  4BJP A;  3DTM A;  5F83 A;  2VEA A;  4JF4 A;  4EU0 A;  4KZ5 A;  2G2U A;  3N8S A;  3CAX A;  4HP9 A;  4Y7P A;  2DCF A;  2WGI A;  4JXG A;  3ULF A;  2J3T D;  3DWK A;  4R4S A;  4MCW A;  5HX9 A;  4Z9Q A;  5KMW A;  3EOI A;  2G2W A;  3LUQ A;  4MN6 A;  4XUZ A;  1LI0 A;  3P7N A;  2GX5 A;  1VB6 A;  3MMH A;  4GLQ A;  3W4P A;  1VQQ A;  3IT9 A;  5CTN A;  1Z09 A;  5F1G A;  2O99 A;  3ZG9 B;  1JTD A;  4LLO B;  2J9P A;  2Y2N A;  3MXQ A;  5TFQ A;  3BEC A;  2W1T B;  4ZJ1 A;  2WUQ A;  4RX2 A;  4OLG A;  2KLI A;  4ZDX A;  3C8C A;  4IHQ A;  5G4Z A;  1G5U A;  2Y2Q A;  1NLY A;  4IUK A;  3BWL A;  5I94 A;  4DDS A;  3N8L A;  1U60 A;  4X6T A;  2ZMA A;  1W63 Q;  2GDN A;  1ZKJ A;  3IX8 A;  2P04 A;  1XJ4 A;  4PKY A;  3UB6 A;  4KG6 A;  4E3O A;  2XR0 A; 
#chains in the Genus database with same CATH homology
 1W63 M;  2JKR I;  3PR6 A;  4BWI A;  3EEA A;  4Q0J A;  5DJU A;  4P6Z S;  1NLZ A;  1F9I A;  3RH8 B;  4WEL A;  3BY8 A;  1OTI A;  3E98 A;  3LR4 A;  2M1C A;  3UE6 A;  5MC7 A;  3S7O A;  1MZU A;  3H7W A;  3BW6 A;  1S4S A;  5HPF A;  4CLC B;  3F1N B;  3LR3 A;  2PR6 A;  2K31 A;  1YSP A;  1GSX A;  2O9C A;  4G3W A;  3JVV A;  2ZMV A;  1P9W A;  2XA7 M;  4O01 A;  5DJT A;  5J4E A;  3H7W B;  3EGX C;  2A2L A;  4GW9 A;  5TJJ A;  2HV1 A;  4EER A;  2CMN A;  2KX6 A;  3S7Q A;  1P9R A;  3A0V A;  4LPZ A;  3A0R A;  2QJ5 A;  3F1O A;  4PHT A;  1XFN A;  1P0Z A;  1IFQ A;  3UB9 A;  5F69 A;  5AVF A;  2XA7 S;  4F3L A;  4R38 A;  3E4O A;  1S4R A;  2W1T A;  3GEC A;  4WEJ A;  2VKS A;  3VE3 A;  3SW1 A;  1ODV A;  3GDI A;  4BMW A;  4HJ4 A;  5TBM B;  3MJQ A;  3A0S A;  3RTY A;  3BY9 A;  2BAS A;  3HJK A;  3T4J A;  3NJA A;  2NUP C;  2V1A A;  3OBF A;  3G6O A;  3P01 A;  5HSQ A;  5C5K A;  3ZQ5 A;  3FG8 A;  4HJ3 A;  3UMD A;  2K7S A;  4WN5 A;  2PT7 A;  5TBM A;  2M7U A;  2L0W A;  3E4P A;  1UWP X;  4R3A A;  1YAX A;  1EW0 A;  1KOU A;  2GZA A;  2XSS A;  1NRJ A;  1OPX A;  3R4K A;  3T4S A;  2KOI A;  4Y3I A;  5HD5 A;  2P08 A;  1UWN X;  4R6L A;  2O0Y A;  4NKP A;  3UE3 A;  1IOU A;  1XJ6 A;  2W3D A;  3B47 A;  3IS2 A;  3BJN A;  2A24 B;  5DF9 A;  2W0N A;  3IS2 B;  2PDR A;  3NHQ A;  4P6Z M;  3KSG A;  3PBN A;  4R70 A;  1T1C A;  4LRY C;  1WA9 A;  2QHK A;  4HP4 A;  3UB8 A;  4IUH A;  4Z1W A;  4G3K A;  4Y5F A;  3NOT C;  4JGR A;  2VA0 A;  2I9V A;  5IT5 A;  4JGQ A;  4ARZ A;  4NXF A;  4HNB A;  3C30 A;  4FOF A;  1P97 A;  3S7P A;  4I3A A;  4GS9 A;  2H28 A;  1JNU A;  2V0U A;  3LIA A;  3EQV A;  2J3W A;  3RFB A;  4I3J A;  4EES A;  3C38 A;  2VLG A;  3EWK A;  1XJ2 A;  3F1O B;  5DFY A;  3U2A A;  5DKL A;  3IBR A;  2MJ6 A;  3OC2 A;  3T4T A;  4GHI A;  4DMZ A;  4EXO A;  4DJ2 A;  2A24 A;  1OJ5 A;  3HJI A;  4HQA A;  3TJZ C;  2ZMF A;  1TS0 A;  2WKP A;  5I5L A;  2PYP A;  2VGL M;  4MDZ A;  2OAP 1;  4II7 A;  3CIT A;  3KSH A;  3MQQ A;  4G3V A;  2KDK A;  4BBU A;  3DBA A;  3HCY A;  4I3I A;  2EWW A;  2WKQ A;  1XFQ A;  1T18 A;  2IA2 A;  1TF1 A;  3F1N A;  2ZOI A;  3MR0 A;  4GJ4 A;  4I39 A;  2QYB A;  2DMW A;  3LID A;  5KSH A;  3R7W B;  2R78 A;  4Q0I A;  4EEP A;  3LFV A;  4HOI A;  4EET B;  2OWH A;  2NUT C;  1S1Z A;  2D02 A;  3B42 A;  4XT2 A;  1X0O A;  2V1B A;  1ZTU A;  3FPW A;  4PAU A;  4B9O A;  3KX0 X;  2W1R A;  1V9Z A;  5LBR A;  1G6O A;  4GS9 B;  4L0L A;  1MKM A;  4KQD A;  1OT9 A;  3MFX A;  3MQO A;  5F6A A;  2VV8 A;  3F1P B;  3VOL A;  5DFX A;  2B18 A;  2M7V A;  3CI6 A;  4WEK A;  1NWZ A;  1TS8 A;  5IS1 A;  2VJW A;  4EEU A;  4NXE A;  1LSX A;  3PBO A;  3JVU A;  2JN7 A;  2YKF A;  3H82 A;  1N9O A;  1TS7 A;  1DP9 A;  1T19 A;  1VHM A;  4IJG A;  5EFW A;  5K5B A;  3EEH A;  3E0Y A;  3KO6 A;  4EQ1 A;  1T1A A;  2FZ0 A;  1F5M A;  1OTE A;  1Y28 A;  3TW8 A;  5KIZ A;  1BYW A;  3OCL A;  2ZBB A;  3K3D A;  3KYZ A;  3PYP A;  5A8B A;  3ZYT A;  2EA9 A;  4NXB A;  3OCN A;  3UB7 A;  2JKT M;  4JGP A;  3PBT A;  2P7J A;  2XRO A;  4HI4 A;  2INW A;  3O5Y A;  4NXG A;  5HWV A;  5G4Y A;  2VV6 A;  5AVE A;  3UME A;  3R7W A;  2W3E A;  4E04 A;  3C2W A;  3LI9 A;  2QKP A;  3KSI A;  1GSW A;  2QWS A;  5HZH A;  4I5S A;  1DRM A;  4L9G A;  5HDC A;  2XRN A;  4QPR A;  5CX7 A;  1G28 A;  4MN7 A;  4DN0 A;  3LIF A;  4O0P A;  3D72 A;  2LB5 A;  1S67 L;  2Z6C A;  2W3H A;  3E4Q A;  3K2N A;  2HF6 A;  4OOL A;  3S7N A;  2FH5 A;  3BQ8 A;  1OTD A;  3EGD C;  4H6J B;  3T4Q A;  4BBT A;  3LI8 A;  2Y79 A;  3NOP C;  2J80 A;  3PBQ A;  5L8M A;  3TRC A;  1OTB A;  5DKK A;  4HH2 A;  1S66 L;  3CWF A;  3OOV A;  2JKR M;  5HWW A;  2JHE A;  2V9A A;  2PYR A;  3V67 A;  3VV4 A;  1T1B A;  1STZ A;  1MC0 A;  3PHY A;  4PKY G;  2L1M A;  4ARZ B;  2G7U A;  4CLC A;  4KQO A;  4EUV A;  1H3Q A;  3BQA A;  1LL8 A;  5HWT A;  1N9N A;  2ZOH A;  1YSQ A;  4ETZ A;  2HJE A;  4Y2F A;  5AJG A;  5HL6 A;  3T4K A;  3T4L A;  1OT6 A;  3H82 B;  4Q0H A;  3PBR A;  3LR0 A;  3IBJ A;  2PD7 A;  1LSV A;  4KUO A;  2LB9 A;  3B33 A;  2YKH A;  2PR5 A;  4GCZ A;  4B93 A;  1D06 A;  1N9L A;  3OLO A;  2W3G A;  3CUE C;  3ICY A;  2GJ3 A;  5J3W A;  3FPV A;  2PD8 A;  3K3C A;  4UEY A;  3LIC A;  1V9Y A;  2B02 A;  4FSF A;  4WUJ A;  2GNX A;  2J3T C;  3CLO A;  4HY8 A;  3D3O A;  4CLC C;  1F98 A;  2O9A A;  4UQI M;  4CLC E;  4EW7 A;  1LSW A;  2EWV A;  3TE8 A;  4HHD A;  3MQ0 A;  1H8M A;  3LR5 A;  1TD5 A;  1D7E A;  1GSV A;  2K2N A;  3PXP A;  5FL3 A;  2HJ9 C;  4CQH A;  2VV7 A;  4H6J A;  4WLA A;  4L9F A;  4ETX A;  1TS6 A;  5HDS A;  4DJ3 A;  2O9B A;  5F68 A;  2HGV A;  3EQU A;  1XJ3 A;  4WL9 A;  4YOF A;  4JGO A;  2Z6D A;  3W2Z A;  2V0W A;  2VX8 A;  4BJP A;  5HDD A;  2QJ7 A;  2OOL A;  4K08 A;  2VEA A;  5IU1 A;  4EU0 A;  3CAX A;  4HH3 A;  4HP9 A;  4I38 A;  3ULF A;  5HPI A;  2D01 A;  4ZRR A;  4AFI A;  2J3T D;  2L4R A;  4YNR A;  4MCW A;  1DP6 A;  3EOI A;  2JKT I;  3LUQ A;  2OAQ 1;  4MN6 A;  3P7N A;  4GHI B;  2GX5 A;  1VB6 A;  3MMH A;  4YWZ A;  4HJ6 A;  4GLQ A;  3H9W A;  4MN5 A;  2O99 A;  4LRZ E;  4O8G A;  5HD3 A;  4MMN A;  4LLO B;  4BBV A;  3NOU C;  4WF0 A;  3KYQ A;  2W27 A;  4HIA A;  3MXQ A;  2W1T B;  3LIB A;  4CLC D;  4OOM A;  3LYX A;  3MF0 A;  2WKR A;  3FC7 A;  2KLI A;  4KUK A;  4M4X A;  5F5Y A;  1LT0 A;  2VGL S;  3C8C A;  4IHQ A;  5G4Z A;  4XT2 B;  1S1Y A;  2Y8H A;  2VZW A;  3LIE A;  4UQI S;  1NLY A;  1ZHH B;  5J7E A;  4IUK A;  3BWL A;  3KSF A;  2W3F A;  3CUE A;  3VE4 A;  1W63 Q;  4RQ9 A;  3PBS A;  3F1P A;  2P04 A;  1OTA A;  4LRX C;  1DP8 A;  1YKD A;  1XJ4 A;  4F3L B;  1OJG A;  4PKY A;  3T50 A;  3UB6 A;  2OWJ A;  4NEE D;  3T4O A;  1UGU A;  2PHY A;  4L9E A;  4ME4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...