5HL6A

Crystal structure of a putative gaf sensor protein from burkholderia vietnamiensis
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
158
structure length
158
Chain Sequence
ASKAELYATLAEQARSLVESEPDLIANAANFSALVYHSLDRLNWAGFYFFDGTELVVGPFQGKPACVRIALGKGVCGTAAQTRQTQVVRDVHAFPGHIACDAASESEIVVPLVAADGTLIGVWDVDSPVAARFDDEDRSGMEALCRVFVEHAWQKARD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Putative GAF sensor protein
publication title Crystal Structure of a Putative GAF sensor protein from Burkholderia vietnamiensis
rcsb
source organism Burkholderia vietnamiensis (strain g4 / lmg 22486)
total genus 50
structure length 158
sequence length 158
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13185 GAF_2 GAF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.40 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 5hl6A00
3MMHA 2W3FA 3VV4A 3G6OA 3RFBA 3NHQA 4MN7A 2O9AA 2VZWA 1YKDA 2K2NA 4GW9A 4DN0A 1TD5A 2B18A 4MCWA 3MQ0A 4O0PA 2VJWA 3R4KA 4DMZA 1YSPA 1STZA 1MC0A 2W3GA 3IBJA 2KOIA 4IJGA 4EUVA 3S7OA 2VKSA 3BJNA 3NOPC 4ETXA 3ZQ5A 4G3WA 5K5BA 3KO6A 4E04A 2LB5A 3E0YA 5AJGA 5TJJA 2W1RA 5HPIA 4LRZE 4ZRRA 3IBRA 2HGVA 4G3KA 4MMNA 4QPRA 2M7VA 2LB9A 4MDZA 2G7UA 2IA2A 3O5YA 3S7PA 4CQHA 2OOLA 2XSSA 4RQ9A 4Q0IA 4R70A 2O0YA 4Z1WA 4ETZA 2VEAA 4Y5FA 4R6LA 4ME4A 3S7QA 4LRYC 4IUKA 2XRNA 4YNRA 5HPFA 2O9BA 2M7UA 4Q0HA 3NOUC 3OBFA 4EU0A 4LRXC 2W3DA 3W2ZA 5HSQA 3KSIA 2W1TA 3S7NA 3E98A 1MKMA 4PAUA 2O9CA 3LFVA 4Y3IA 2W3EA 3C2WA 4G3VA 4YOFA 4GLQA 1F5MA 2Y8HA 3OOVA 1YSQA 4O8GA 3EEAA 1TF1A 2W1TB 3D3OA 2Y79A 5DFYA 3NOTC 2K31A 2QYBA 5HL6A 2GX5A 4Y2FA 3TRCA 3KSFA 3CITA 3KSHA 3HCYA 2KLIA 1ZTUA 3K2NA 3MF0A 3DBAA 5DFXA 4Q0JA 2O99A 5I5LA 2W3HA 2ZMFA 1VHMA 3CI6A 5L8MA 2XROA 4BWIA 3KSGA 4FOFA 5C5KA 4O01A 5LBRA 4IUHA
chains in the Genus database with same CATH superfamily
3MMHA 1TVFA 4U0TA 1YM1A 2WGWB 3Q07A 2HDRA 2JKGA 3FPWA 3SH9A 2B18A 3MZDA 2ZC6B 3MQ0A 3W8KA 3L7HA 4DDYA 3G2ZA 3VSKA 1STZA 1V9YA 2KOIA 3F1PA 4XXRA 1PWGA 4GJ4A 2GJ3A 4GDBA 3BLMA 4BQMA 2OSUA 4E04A 4P6ZS 2XF3A 5CX7A 3UDFA 3IX8A 5FI6A 2H5SA 3NJAA 4PM7A 1K38A 4BD1A 3S7PA 4KQOA 2OOLA 1TS6A 1MWRA 1GA9A 3MJQA 2EX2A 1GA0A 2G2WA 4R3AA 2H10A 3CPTA 5HW3A 4WEKA 3O87A 1PYYA 5KZHA 1TEMA 3PHYA 4F94A 4JKTA 4WLAA 4PAUA 4DXCA 4B9OA 2HZ5A 4HJ3A 1F5MA 4JF5A 4HIAA 1OPXA 4LV1A 5J8XA 1RP5A 3EEAA 3HLBA 3P09A 3MXQA 4PM8A 4GOGA 4D2OA 1EW0A 2ZJ9A 3OZHA 3MF0A 3KX0X 1LL5A 3HLDA 4FCFA 4R3JA 1ES4A 1G68A 4H6JA 2JKRI 4IVIA 4PKYG 1CI8A 5FQMA 5CGXA 3UB5P 3VSLA 3V39A 3PAGA 4IHQA 2I9VA 1BLHA 2JKFA 2IWDA 3IS2B 1PFLA 4OPZA 3VE3A 2H28A 1N9BA 3E4PA 2VKSA 2OAQ1 3QP5A 2NUTC 3C7VA 4ARZB 1K25A 3M6HA 4WF0A 2W1RA 1VETB 5F83A 1H8MA 1MWSA 4U3TA 1KGGA 3SW1A 3CAXA 1ALQA 4CPKA 3MQQA 2ZMAA 1YLTA 2P9VA 4OPYA 4NXBA 1SKFA 1CF0A 3I7JA 4R6LA 4KZ4A 5HAPA 3C7UA 5HPFA 5FAPA 3ZG5A 2W3DA 4XUZA 1AXBA 2PHYA 2V8FA 1KE4A 2O9CA 1ACFA 3PXPA 3T4SA 4HEFA 5HDDA 4JBFA 1I2SA 1IKIA 1KDSA 1SKOB 4BENA 2ZBBA 3F1NA 3D3OA 4E3MA 1S6RA 2A24A 3T50A 2DMWA 2DRWA 4LV0A 5HL6A 3RXWA 3U2AA 2V20A 4EWFA 3VOYA 3IX3A 3BEBA 1HD8A 2ZMFA 3UDXA 3WS0A 2W3FA 4JXWA 4B88A 4DKIA 3BLSA 4MN7A 1P9WA 1TD5A 4RA7A 1N9NA 5DJTA 4GD8A 3MFXA 3HLGA 1VM1A 3IHBA 2WKIA 3CUEC 3GMWA 5EVIC 3UB6A 1XX2A 3KO6A 1KVMA 5CXWA 3ZNYA 3PTEA 3E2KA 4NEED 4NK3A 1NRFA 5CTNA 4ZRRA 3FYZA 2WAFA 1CJFA 1IFQA 4GCZA 5TFQA 5DKKA 4BBUA 4MDZA 4HQAA 5GLBA 4KUKA 5HD3A 2ZQ7A 4LV2A 4E3KA 1N9LA 3WWXA 4F3LA 4Q0HA 1CEGA 4EU0A 3Q7ZA 2W1TA 2VGJA 4LPZA 2J9OA 4EV4A 3ULFA 5G4YA 4R38A 4DE2A 5CEBA 1S1ZA 4GKUA 1F9IA 1DP6A 3DTKA 1YMSA 2L0WA 4ZTKA 1PW8A 4KENB 4RVAA 1Y4OA 1ZKJA 2E8IA 3T4OA 4KQRA 3MXRA 3DBAA 3IF6C 4Q0JA 5D3OA 3A3IA 5CGWA 2QPNA 1K4FA 4S2KA 4FOFA 5GLCA 4JXGA 3GRJA 1OTAA 4X69A 3VV4A 3UB7A 1K55C 5L10A 1KDWA 3ITAA 4P85A 4N9KA 4DF6A 4ZJ2A 1T1AA 2RL3A 3F1PB 1AWIA 3R4KA 3QNBA 3IH8A 1VQQA 2ZMVA 3WS1A 1MY8A 3UB8A 2Y2PA 2CC1A 2JC7A 5EVIB 1PZPA 4PM9A 2W0NA 3WS2A 4IVKA 4ZBEA 3N7WA 4X56A 5FL3A 3JVVA 2G2UA 2ZQCA 4CQHA 5F82A 4E6WA 4LLOB 1FQGA 2B5RA 3S7QA 3WS5A 1HLUP 3ZCZA 2X01A 1SDEA 1WYBA 5FAQA 1P0ZA 4OP8A 4L9FA 3FZCA 3QP2A 4E3OA 3T1SA 1PNEA 5TBMB 1L0EA 4NKPA 3FV7A 4R4RA 3IF5A 3M2KA 4PMAA 2Y2NA 1HTZA 5MC7A 1C3BA 3QP8A 5KIZA 4II7A 2OWHA 3C30A 1FILA 3OPPA 2GDNA 1N4OA 4RX2A 3UPPA 4WUJA 4I38A 4H6JB 5HAQA 1N9OA 3DAVA 1XA7A 2E8JA 2O99A 5I5LA 3N6IA 3R7WA 1NLYA 4N1XA 4BWIA 3IF6B 3IHAA 5HARA 3RJUA 3T4LA 1W8YA 4S2LA 2WK0A 3G6OA 2Y2JA 1LHYA 4NXEA 3T12B 4EXOA 3K3CA 5A92A 1QMFA 2YKHA 4IBXA 3ZG0A 4I5SA 1IELA 2PD7A 4XT2A 2ZM2A 1PWDA 4PHTA 2Q0OA 2XGNA 4GN2A 1JWVA 3E0YA 5TJJA 3EOIA 1W79A 4OQIA 3S1YA 5L2FA 3Q7VA 2IA2A 3W4PA 3T4QA 4HJ6A 2O0YA 4ETZA 4HHDA 3IXHA 3TJZC 4Y5FA 4HOIA 3WS4A 3BRMA 5GHXA 4Y0UA 1JTGA 4UQIM 4WZ4A 4KZ7A 2XDMA 4K91A 2QJ7A 1UGUA 3HLEA 4P0MA 3EWKA 3ZDJA 4LCLA 3MFDA 2P04A 4HBTA 3F1NB 3C2WA 4Y0TA 3SZTA 1Y54A 1YSQA 5IT5A 3UO9A 3NI9A 3F1OA 4B93A 2XH9A 4LGWA 1XJ6A 3OPLA 3VP1A 1FCNA 4ZDXA 3SH8A 4WZ5A 1NY0A 3TW8A 4BBVA 3HJKA 3DWKA 1NZOA 2A3UA 1KVLA 1V9ZA 2W3HA 3FPVA 3IT9A 1D06A 3BQAA 4CLCC 3LIAA 5DTSA 3T4JA 4OOYA 4YINA 3HLFA 3EGDC 2J80A 2AVXA 3AGDA 3V50A 1IYQA 1MPLA 2I72A 4I3AA 1TDLA 3PYPA 1UWPX 2H0YA 3PR6A 3BQ8A 4ETXA 4OPQA 5CTMA 4ESPA 3GVBA 3LR5A 1YLZA 1BLCA 5CEDA 1SCWA 2WZXA 4Q0IA 2DCFA 4Y15A 2IWBA 4HI4A 2R9XA 2DNSA 3MZEA 5FA7A 1YLPA 3W2ZA 4E3JA 1YPRA 5AQ7A 3NDEA 3UY6A 5HWVA 5AVFA 5TGFA 3D4FA 2Y2QA 5FI7A 1K6RA 5FEFA 3ISGA 2VV6A 1K54C 4Y7PA 5F6AA 4Y13A 4MN6A 3G30A 4HH3A 3G32A 2QYBA 4I3JA 2FFYA 1OTDA 4Y2FA 2XR0A 3VMAA 2J3TC 2ZL1A 1H0MA 2KLIA 1L0GA 2JCHA 1LSVA 3UE6A 3GTCA 4KG6A 4GHIB 4KQQA 4CLCB 5DKLA 4HP4A 5FQIA 5J4EA 3HLWA 1H3QA 3RH8B 1VEUA 2A49A 3IWOA 1H8YA 1ZG6A 3A3DA 4C3QA 4S2NC 4ZJ3A 3V5MA 5AQ9A 2HGVA 4X53A 4LFUA 4L0LA 5GHZA 3ZG8B 4OQ0A 3HBRA 2HF6A 4E3LA 2XD5A 4Z1WA 2VEAA 3TSGA 2UV0E 3OPHA 1M40A 3EGXC 4LV3A 3KYQA 1PWCA 2BASA 1FCMA 3HJIA 3RXXA 4R0QA 4KZ6A 3D72A 3BWLA 4DE3A 5EVID 1DJAA 4R3BA 4E3IA 5F1FA 5A8BA 4Y3IA 1T19A 3VP2A 4GLQA 4EW7A 1ESIA 2EWWA 2L1MA 2WYXA 3PBNA 5HDCA 2ZOHA 3ZFZA 1RCJA 1OJGA 4N1HA 4WMCA 1L2SA 4WYYA 3R7WB 1OTBA 1PRQA 3K2NA 1KOUA 3ICYA 2ZM8A 1S4SA 1NYMA 2PR5A 3CI6A 3NECA 1BSGA 3LR3A 2WKEA 1Q2PA 3OCNA 3S4XA 1F2KA 2XK1A 3A0SA 3RTYA 2ZC7A 3FKVA 3BM6A 2WGVA 5KSHA 4JXSA 3E4QA 5FI2A 2B02A 3DWZA 1P97A 4IJGA 4EUVA 4EESA 1E4DA 4DRTA 2JKTI 5AQAA 5AJGA 5HX9A 2V0UA 1BT5A 4KG2A 1ONGA 4LRZE 3IBRA 2J8YA 2QWSA 5EECA 1IKGA 2GNXA 3LIFA 3CMZA 4PM5A 1CQAA 1K57A 2W27A 3C4PA 3Q82A 1JVJA 2WKRA 3M2JA 1O7EA 1FR1A 1G5UA 4LRYC 4FH2A 3ZVWA 2XRNA 4MNRA 5E2GA 4X1MA 3NOUC 4S2JA 4WMCD 3MXSA 2PYRA 5IHVA 4EEPA 4UQIS 4C6YA 1YAXA 1W63M 2EA9A 4GS9A 4Z9QA 5KMWA 2JKRM 1S67L 4KUOA 2OWJA 4KQDA 4PM6A 2EX8A 3QHYA 4YFMA 1DP8A 4P6BA 3H7WB 4IEDA 1HZOA 2HJEA 3UDIA 3NULA 4HNBA 5A91A 4A5RA 1YT4A 2VA0A 3ZHHA 1LSWA 2WGWA 4HJ4A 5G4ZA 1L0FA 4E3NA 3LO7A 5HFOA 1ODVA 2MJ6A 2EX6A 3MKFA 3U4LP 2BLSA 3LY3A 3HL9A 5DF9A 3A3FA 5JYPA 2Q9NA 5CHMA 3NHQA 1NWZA 2EXAA 2Y59A 4S2IA 4C75A 2JHEA 3OC2A 1BLPA 2YKFA 5HWTA 3A3JA 2OV5A 1P9RA 1G6AA 5A93A 1O07A 2WKPA 3A0VA 3HUOA 1LLBA 3ZQ5A 4M3KA 1OMEA 5K5BA 3NC8A 2PU4A 2V1BA 4KG5A 1G28A 1BLSA 4R4SA 3ZNTA 4GDNA 5CGSA 4QPRA 1K56D 2G7UA 2VX8A 1EROA 4RX3A 3UMEA 2P08A 1QMEA 2PDRA 3QP4A 3FWLA 1X0OA 2K7SA 2M1CA 1FSWA 4IUKA 3BYDA 2OLUA 5HAIA 2PYPA 4K0WA 3W4QA 2KX6A 1SHVA 3E98A 3P7NA 4BD0A 3UE0A 1S1YA 2XD1A 3LFVA 2VV7A 4I39A 1MBLA 3CPTB 1GHPA 1KGFA 3VOZA 3NDGA 5DTKA 1IYSA 1IYOA 4K0XA 5EPHA 2D02A 1FSYA 3LIDA 5FQQA 1NYYA 3N4IA 4B4XA 3CITA 5EV0A 3JYIA 2OAP1 2XA7M 1Y28A 3IS2A 4FD8A 1PW1A 3G31A 5FASA 2XQZA 2QKPA 4JPMA 2O9AA 4H8RA 2VZWA 4ARZA 2PBDP 4JF6A 1YKDA 1TDGA 4WELA 1VETA 5EVLA 3G4PA 2HP6A 3C5AA 3VOLA 1XP4A 5EVEA 3NOPC 2JE5A 1YLWA 3DW0A 1E25A 2Y2MA 4L9EA 4CLCD 2VGKA 1ES5A 2Y2KA 2ZD8A 5IS1A 1LT0A 1J3WA 3W4OA 3IQAA 2GZAA 3DTEA 4K08A 1W5DA 5CRFA 1SKOA 1GHIA 2P9VB 3TG9A 4JGQA 1XFQA 1MWTA 2WGIA 1ES2A 4EEUA 4PKYA 3O88A 4EBLA 1WE4A 1TS7A 2BG1A 1J9MA 5EM0A 1GSWA 2Y55A 2QMIA 2VGLM 2INWA 2Z6CA 3IWIA 3MKEA 2HDQA 1OJ5A 3MZFA 2PAVP 1JNUA 4MLLA 1U60A 5DFXA 3T1QB 2ACGA 1XGJA 1VHMA 2A24B 3MSHA 3JVUA 3LR4A 3SS4A 4N92A 2A2LA 2V9AA 1H5XA 3NY4A 2HJ9C 1HVBA 1T18A 4HESA 2HDSA 3A0RA 3PAEA 2Y91A 3VP3A 1YSPA 1MC0A 1XJ3A 2HPBA 3IBJA 5DF7A 2NUPC 4ZAMA 3S7OA 2HV1A 3CLOA 2J3TD 4MEZA 4M4XA 4EBPA 4WM9A 3LEQA 1XXMA 4MBKA 4MBHA 4OQHA 1NRJA 4NXFA 4G3KA 1OTIA 4QY5A 2Z2MB 4MN5A 1Z6FA 4RQ9A 3PBOA 1IOUA 3LUQA 4KZAA 1FR6A 2Y2GA 3C38A 4EETB 3A3EA 1TS8A 4ME4A 3MBZA 1EWZA 1NJ4A 1T1BA 3H82A 4YNRA 2XFSA 2PD8A 4OOLA 3HREA 2Z2LB 4QU3A 2XLNA 2EFUA 3B33A 3GSGA 4GD6A 2XFTA 5E2HA 2WKQA 2Q9MA 5DF8A 4F3LB 2WKHA 2XEPA 5JYOA 3GR2A 3C8CA 1S66L 3G35A 4X68A 2W1TB 3BY8A 1GCEA 1K6SA 1NZUA 1MWUA 2V2FF 3KSHA 3MQOA 1Z09A 4OLDA 4NG2A 1JTDA 2XROA 3IXDA 3LGOA 4QWOA 4BMWA 3KSGA 4CLCE 3PBTA 3G34A 5LBRA 3BFFA 4IUHA 1PZOA 1DRMA 1GSVA 4OKPA 3EEHA 3QP1A 5AQBA 4GW9A 3CUEA 5EVIA 2FFFB 5CHUA 2UWXA 4HH2A 2W3GA 3NCKA 3LI9A 4R23A 4BJPA 5I94A 4G3WA 3OLOA 4R1GA 5GLDA 1CK3A 1I5QA 5EOEA 1F98A 4WN5A 3UPNA 4MMNA 5HD5A 2P7JA 4QHCA 2XSSA 1M6KA 1IYPA 4FH4A 3FG8A 5HL1A 2X02A 5TBMA 2WAEA 3SS3A 2ZLYA 4AFIA 2KDKA 1LSXA 2M7UA 5F68A 2EXBA 4LRXC 4X55A 2J7VA 3KSIA 1TS0A 1A0KA 3BFGA 3FKWA 4B4ZA 5FEGA 1ZC2A 5F69A 1UWNX 4FTXA 5GL9A 3UE1A 4KZ8A 4OVDA 1ONHA 4WEJA 2V1AA 3IF6A 4DDSA 2Y2IA 4S2MA 3B42A 4WL9A 4DE0A 2ZQ9A 5EFWA 3LIBA 2CMNA 4UA7A 1XKZA 3SH7A 5EOOA 5BOHA 4DJ3A 1K55A 4WZ5C 5L8MA 3NBLA 3AGEA 2Y2LA 2XA7S 2PR6A 4RYEA 4OH0A 5FAOA 3RFBA 2IWCA 3CJMA 3WRZA 1WA9A 4LCMA 1D1JA 2ZQAA 3ZYTA 3MS6A 2FH5A 4QY6A 5EUAA 1KE0A 3ZG9B 1YLJA 5FDSA 2PBYA 5FATA 1FIKA 3BFDA 5CERA 5CECA 5FQKA 2L4RA 4LENA 1ESUA 3KYZA 4XT2B 1PI5A 1XJ4A 3FC7A 3T4TA 1L3LA 5J3WA 2H0TA 4R70A 4JGPA 2J3WA 4WBGA 1XFNA 2WADA 3V3RA 3LICA 3LR0A 2O9BA 1Q2QA 4P87A 3Q7VB 5CHJA 1LI9A 5TR7A 5DTTA 1JWPA 3SOIA 4GB7A 1W8QA 4JLFA 1I2WA 2HP9A 4S2PA 1XPBA 4BLMA 4KZBA 3V3SA 4YOFA 3OOVA 1EI5A 4O8GA 3HUNA 1TF1A 3M6BA 3BFEA 1PI4A 3IX4A 3WRTA 5KSCA 4OQGA 4X1LA 2VGLS 5U47A 3UN7A 5M18A 2ZM0A 1K56A 4EERA 2ZOIA 3DTMA 3F1OB 5G18A 3VE4A 2EWVA 4I3IA 4NETA 3IXBA 3Q81A 1XJ2A 3E2LA 5C5KA 5HZHA 4L9GA 4UHUA 1ZG4A 1T1CA 4ID4A 2FZ0A 3ITBA 4DN0A 2V0WA 4MCWA 3CZDA 1DY6A 1WYCA 2X71A 4D60A 3LI8A 4GZBA 1DP9A 3IXGA 4BBTA 3O3VA 4P6ZM 2Y2HA 3P98A 4OONA 3SS5A 3IH9A 3BW6A 4N9LA 2JBFA 3T4KA 5HPIA 4X6TA 4OOMA 2M7VA 2EX9A 4JXVA 3P01A 3O5YA 2J9PA 3LY4A 3H82B 4IBRA 4Q8IA 4S2OA 1XA1A 1W7FA 5EE8A 1KE3A 2P74A 2Z6DA 3G2YA 4EQIA 5DVAA 1W63Q 2Y2OA 1S0WA 4MBFA 5GLAA 3IWQA 3T1XA 4DJ2A 4G3VA 3O86A 2C5WB 2ZC4B 4GNUA 2ZC3B 2EFXA 1S4RA 1LI0A 1BZAA 4GHIA 1ERQA 1ZHHB 3EQUA 3HCYA 4CLCA 1JWZA 1SZVA 2QJ5A 3QNCA 1ES3A 2JKTM 3VFHA 3ZG7B 4JF4A 4EUZA 1BTLA 3CG5A 3PBQA 4HBUA 2ZC5B 1NXYA 3GQZA 2ZL1B 2PT7A 4EQ1A 1IEMA 1LL8A 3N8RA 3GDIA 2B95A 1MXOA 2VK3A 1OTEA 5E2EA 3TE8A 1MKIA 3HLCA 1DJCA 5FQJA 2ZQDA 2R9WA 2QHKA 1BYWA 5F5YA 3UMDA 4BL3A 2LB5A 3VFFA 3LCEA 3UPOA 1E3UA 3CHWP 1XGIA 4U0XA 1PIOA 2PRFA 1K0KA 2WZZA 4FUWA 4CJNA 2VLGA 3AGFA 2LB9A 1VEUB 3B3XA 3BFCA 2D01A 3VP0A 5M1AA 3H9WA 1FOFA 1BULA 4Y17A 5IU1A 3BY9A 3MR0A 3LIEA 1K57C 3QP6A 1KGEA 1K4EA 3NIAA 4KZ5A 4UA9A 4QB8A 5E43A 5A90A 4KZ3A 5L09A 2Y4AA 1K54A 4DXBA 2W3EA 4OPRA 3N8LA 1DJBA 3L9KA 2Y8HA 2RCXA 4QJGA 1NLZA 3S22A 5FQ9A 3LEZA 3UNWA 2Y79A 4BL2A 5DFYA 4QD4A 3NOTC 1OT6A 2V1ZA 2K31A 3TOIA 3UB9A 3ZGAB 2V8CA 3LYXA 1G6OA 2WUQA 3C4OA 3T1RA 3CWFA 1LL9A 1D7EA 1E3UD 5E2FA 4HY8A 1GHMA 3OCLA 3BECA 4X25A 2K2NA 3Q1FA 1SDNA 1GSXA 4O0PA 1ERMA 2VJWA 5HWWA 3ZVTA 3HVFA 4JGRA 4DMZA 5DJUA 4S2NA 2PU2A 3BJNA 1L0DA 4OP5A 1OT9A 3OPRA 1CI9A 4Y0OA 4OLGA 1MZUA 2HDUA 2JN7A 2VV8A 3DTIA 3PBRA 5FDHA 4O7DA 3PBSA 4PPRA 4XUXA 4YWZA 3UE3A 4EBNA 1H8ZA 3JPUA 5EM1A 2R78A 5L07A 4UA6A 2BTFP 3K3DA 2QZ6A 3OBFA 5M19A 5HSQA 3D9YA 4NXGA 3S7NA 1MKMA 1YMXA 3H7WA 4DE1A 1FCOA 4ZJ1A 2ZQ8A 1CEFA 2C6WB 1YLYA 4UAAA 5GHYA 5J7EA 1BUEA 4JGOA 1RGZA 4GS9B 4FSFA 5AVEA 1VB6A 4HP9A 3N8SA 2GX5A 5F1GA 2OLVA 3TRCA 3V67A 3HUMA 3KSFA 1RGYA 3E4OA 1ZTUA 4KZ9A 5FSRA 5HDSA 3VP4A 3B47A 3EQVA 3GECA 3KYEA 4E6XA 4O01A 1YQSA 3GV9A 2HP5A 4UEYA
chains in the Genus database with same CATH topology
3MMHA 5DF9A 2PR6A 3G6OA 3RFBA 3NHQA 1NWZA 4NXEA 4EXOA 1WA9A 2JHEA 3FPWA 3K3CA 2YKHA 2B18A 3OC2A 3MQ0A 2YKFA 5HWTA 3ZYTA 1P9RA 4I5SA 2PD7A 4XT2A 1STZA 2FH5A 1V9YA 2KOIA 2WKPA 3A0VA 3F1PA 3ZQ5A 4GJ4A 2GJ3A 5K5BA 4PHTA 4E04A 3E0YA 4P6ZS 5CX7A 5TJJA 2V1BA 3EOIA 2L4RA 1G28A 3NJAA 3KYZA 4XT2B 4QPRA 1XJ4A 2G7UA 2IA2A 2VX8A 3FC7A 4KQOA 3S7PA 3T4TA 3UMEA 2OOLA 2P08A 1TS6A 5J3WA 4HJ6A 3T4QA 2PDRA 4R70A 2O0YA 4ETZA 4HHDA 1X0OA 3MJQA 4JGPA 3TJZC 2J3WA 4Y5FA 2K7SA 4HOIA 1XFNA 2M1CA 4R3AA 4WEKA 4IUKA 3LICA 3LR0A 2O9BA 4UQIM 2QJ7A 1UGUA 3PHYA 3EWKA 2PYPA 4WLAA 2KX6A 3E98A 3P7NA 4PAUA 1S1YA 3LFVA 2VV7A 4I39A 2P04A 3F1NB 4B9OA 3C2WA 4YOFA 4HJ3A 1F5MA 3OOVA 4HIAA 1OPXA 1YSQA 4O8GA 3EEAA 5IT5A 1TF1A 3F1OA 3MXQA 4B93A 2D02A 3LIDA 1XJ6A 2VGLS 1EW0A 3CITA 3TW8A 4BBVA 3HJKA 3MF0A 3KX0X 4EERA 2ZOIA 3F1OB 1V9ZA 2W3HA 2OAP1 3VE4A 3FPVA 2XA7M 2EWVA 1D06A 4I3IA 4H6JA 1Y28A 2JKRI 3BQAA 1XJ2A 4CLCC 3IS2A 5C5KA 3LIAA 4PKYG 5HZHA 4L9GA 3T4JA 2QKPA 3EGDC 2J80A 2O9AA 2VZWA 4ARZA 4IHQA 1YKDA 1T1CA 2FZ0A 2I9VA 4DN0A 2V0WA 4MCWA 4WELA 4I3AA 3IS2B 3LI8A 3VE3A 1DP9A 3PYPA 4BBTA 1UWPX 2H28A 3VOLA 4P6ZM 3PR6A 3E4PA 2VKSA 2OAQ1 3BQ8A 2NUTC 3NOPC 4ETXA 4ARZB 3BW6A 4WF0A 2W1RA 3T4KA 5HPIA 1H8MA 3SW1A 3LR5A 3CAXA 4OOMA 4L9EA 4CLCD 2M7VA 3MQQA 3P01A 3O5YA 4Q0IA 3H82B 4NXBA 5IS1A 1LT0A 4R6LA 4HI4A 2Z6DA 2GZAA 4UEYA 5HPFA 1W63Q 4K08A 2W3DA 3W2ZA 2PHYA 4JGQA 1XFQA 2O9CA 4EEUA 5HWVA 3PXPA 5AVFA 3T4SA 4PKYA 4DJ2A 4G3VA 5HDDA 1TS7A 1GSWA 2VV6A 2ZBBA 3F1NA 3D3OA 2VGLM 2INWA 2Z6CA 5F6AA 1S4RA 3T50A 2A24A 4MN6A 4GHIA 1OJ5A 4HH3A 2QYBA 2DMWA 4I3JA 1ZHHB 5HL6A 1OTDA 4Y2FA 3EQUA 1JNUA 3HCYA 3U2AA 4CLCA 2J3TC 2KLIA 2QJ5A 5DFXA 2JKTM 1LSVA 2ZMFA 3UE6A 1VHMA 2A24B 3JVUA 4GHIB 3LR4A 3PBQA 2W3FA 2A2LA 2V9AA 4CLCB 4MN7A 2PT7A 4HP4A 5DKLA 4EQ1A 1P9WA 1LL8A 2HJ9C 5J4EA 1TD5A 1T18A 3GDIA 1N9NA 5DJTA 1H3QA 1OTEA 3A0RA 3TE8A 3MFXA 3RH8B 1YSPA 1MC0A 1XJ3A 3IBJA 2NUPC 2QHKA 3CUEC 3S7OA 1BYWA 3UB6A 5F5YA 3UMDA 2HV1A 3KO6A 3CLOA 2LB5A 4NEED 2J3TD 4M4XA 4ZRRA 1IFQA 2HGVA 4GCZA 1NRJA 4NXFA 4G3KA 1OTIA 4L0LA 5DKKA 4BBUA 4MN5A 2VLGA 2LB9A 4MDZA 4HQAA 2D01A 4RQ9A 3PBOA 2HF6A 4KUKA 1IOUA 3LUQA 5HD3A 4Z1WA 3H9WA 2VEAA 3C38A 5IU1A 4EETB 1TS8A 3BY9A 3EGXC 3MR0A 4ME4A 3LIEA 1T1BA 3KYQA 3H82A 2BASA 4YNRA 1N9LA 4F3LA 2PD8A 3HJIA 4Q0HA 4OOLA 3D72A 3BWLA 4EU0A 3B33A 2W1TA 4LPZA 5A8BA 4Y3IA 1T19A 2W3EA 5G4YA 3ULFA 4R38A 1S1ZA 2WKQA 4GLQA 1F9IA 4EW7A 1DP6A 2Y8HA 4F3LB 1NLZA 2EWWA 2L1MA 3PBNA 5HDCA 2ZOHA 3C8CA 1S66L 2W1TB 2L0WA 3BY8A 2Y79A 5DFYA 3NOTC 1OT6A 1OJGA 2K31A 3R7WB 3UB9A 3LYXA 3KSHA 1G6OA 3T4OA 1OTBA 3MQOA 3K2NA 1KOUA 3DBAA 3ICYA 4Q0JA 1S4SA 2PR5A 3CI6A 2XROA 4BMWA 3KSGA 4CLCE 4FOFA 3PBTA 5LBRA 3LR3A 3CWFA 3OCNA 1D7EA 1OTAA 4IUHA 4HY8A 3VV4A 3UB7A 1DRMA 1GSVA 3OCLA 3A0SA 3RTYA 3EEHA 2K2NA 4GW9A 1T1AA 3F1PB 3CUEA 1GSXA 4O0PA 2VJWA 3R4KA 5HWWA 5KSHA 4JGRA 4DMZA 3E4QA 2B02A 4HH2A 2W3GA 1P97A 2ZMVA 4IJGA 5DJUA 4EUVA 3LI9A 4EESA 3BJNA 4BJPA 1OT9A 3UB8A 4G3WA 3OLOA 2JKTI 5AJGA 2V0UA 1MZUA 2W0NA 4LRZE 3IBRA 1F98A 2JN7A 2VV8A 4WN5A 2QWSA 4MMNA 3PBRA 5HD5A 2P7JA 5FL3A 3JVVA 2GNXA 3LIFA 4CQHA 2XSSA 3PBSA 3FG8A 4YWZA 4LLOB 5TBMA 3UE3A 2W27A 2WKRA 3S7QA 4LRYC 2R78A 4AFIA 2XRNA 2KDKA 1LSXA 2M7UA 1P0ZA 4L9FA 3K3DA 3NOUC 5F68A 3OBFA 2PYRA 4LRXC 5HSQA 4NXGA 3KSIA 3S7NA 5TBMB 1TS0A 1MKMA 4EEPA 4UQIS 3H7WA 1YAXA 4NKPA 1W63M 2EA9A 4GS9A 2JKRM 1S67L 4KUOA 2OWJA 4KQDA 5MC7A 5F69A 5KIZA 4II7A 1UWNX 2OWHA 1DP8A 5J7EA 3C30A 4JGOA 3H7WB 4WEJA 4GS9B 2HJEA 2V1AA 4FSFA 5AVEA 1VB6A 4HNBA 4HP9A 2GX5A 4WUJA 4I38A 3B42A 4WL9A 3TRCA 3V67A 4H6JB 3KSFA 2VA0A 1N9OA 5EFWA 3E4OA 3LIBA 1ZTUA 2CMNA 1LSWA 5HDSA 4HJ4A 2O99A 5I5LA 5G4ZA 3R7WA 4DJ3A 3B47A 3EQVA 5L8MA 1NLYA 3GECA 1ODVA 4BWIA 2MJ6A 4O01A 3T4LA 2XA7S
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MMH A;  2W3F A;  3VV4 A;  3G6O A;  3RFB A;  3NHQ A;  4MN7 A;  2O9A A;  2VZW A;  1YKD A;  2K2N A;  4GW9 A;  4DN0 A;  1TD5 A;  2B18 A;  4MCW A;  3MQ0 A;  4O0P A;  2VJW A;  3R4K A;  4DMZ A;  1YSP A;  1STZ A;  1MC0 A;  2W3G A;  3IBJ A;  2KOI A;  4IJG A;  4EUV A;  3S7O A;  2VKS A;  3BJN A;  3NOP C;  4ETX A;  3ZQ5 A;  4G3W A;  5K5B A;  3KO6 A;  4E04 A;  2LB5 A;  3E0Y A;  5AJG A;  5TJJ A;  2W1R A;  5HPI A;  4LRZ E;  4ZRR A;  3IBR A;  2HGV A;  4G3K A;  4MMN A;  4QPR A;  2M7V A;  2LB9 A;  4MDZ A;  2G7U A;  2IA2 A;  3O5Y A;  3S7P A;  4CQH A;  2OOL A;  2XSS A;  4RQ9 A;  4Q0I A;  4R70 A;  2O0Y A;  4Z1W A;  4ETZ A;  2VEA A;  4Y5F A;  4R6L A;  4ME4 A;  3S7Q A;  4LRY C;  4IUK A;  2XRN A;  4YNR A;  5HPF A;  2O9B A;  2M7U A;  4Q0H A;  3NOU C;  3OBF A;  4EU0 A;  4LRX C;  2W3D A;  3W2Z A;  5HSQ A;  3KSI A;  2W1T A;  3S7N A;  3E98 A;  1MKM A;  4PAU A;  2O9C A;  3LFV A;  4Y3I A;  2W3E A;  3C2W A;  4G3V A;  4YOF A;  4GLQ A;  1F5M A;  2Y8H A;  3OOV A;  1YSQ A;  4O8G A;  3EEA A;  1TF1 A;  2W1T B;  3D3O A;  2Y79 A;  5DFY A;  3NOT C;  2K31 A;  2QYB A;  5HL6 A;  2GX5 A;  4Y2F A;  3TRC A;  3KSF A;  3CIT A;  3KSH A;  3HCY A;  2KLI A;  1ZTU A;  3K2N A;  3MF0 A;  3DBA A;  5DFX A;  4Q0J A;  2O99 A;  5I5L A;  2W3H A;  2ZMF A;  1VHM A;  3CI6 A;  5L8M A;  2XRO A;  4BWI A;  3KSG A;  4FOF A;  5C5K A;  4O01 A;  5LBR A;  4IUH A; 
#chains in the Genus database with same CATH topology
 3MMH A;  1TVF A;  4U0T A;  1YM1 A;  2WGW B;  3Q07 A;  2HDR A;  2JKG A;  3FPW A;  3SH9 A;  2B18 A;  3MZD A;  2ZC6 B;  3MQ0 A;  3W8K A;  3L7H A;  4DDY A;  3G2Z A;  3VSK A;  1STZ A;  1V9Y A;  2KOI A;  3F1P A;  4XXR A;  1PWG A;  4GJ4 A;  2GJ3 A;  4GDB A;  3BLM A;  4BQM A;  2OSU A;  4E04 A;  4P6Z S;  2XF3 A;  5CX7 A;  3UDF A;  3IX8 A;  5FI6 A;  2H5S A;  3NJA A;  4PM7 A;  1K38 A;  4BD1 A;  3S7P A;  4KQO A;  2OOL A;  1TS6 A;  1MWR A;  1GA9 A;  3MJQ A;  2EX2 A;  1GA0 A;  2G2W A;  4R3A A;  2H10 A;  3CPT A;  5HW3 A;  4WEK A;  3O87 A;  1PYY A;  5KZH A;  1TEM A;  3PHY A;  4F94 A;  4JKT A;  4WLA A;  4PAU A;  4DXC A;  4B9O A;  2HZ5 A;  4HJ3 A;  1F5M A;  4JF5 A;  4HIA A;  1OPX A;  4LV1 A;  5J8X A;  1RP5 A;  3EEA A;  3HLB A;  3P09 A;  3MXQ A;  4PM8 A;  4GOG A;  4D2O A;  1EW0 A;  2ZJ9 A;  3OZH A;  3MF0 A;  3KX0 X;  1LL5 A;  3HLD A;  4FCF A;  4R3J A;  1ES4 A;  1G68 A;  4H6J A;  2JKR I;  4IVI A;  4PKY G;  1CI8 A;  5FQM A;  5CGX A;  3UB5 P;  3VSL A;  3V39 A;  3PAG A;  4IHQ A;  2I9V A;  1BLH A;  2JKF A;  2IWD A;  3IS2 B;  1PFL A;  4OPZ A;  3VE3 A;  2H28 A;  1N9B A;  3E4P A;  2VKS A;  2OAQ 1;  3QP5 A;  2NUT C;  3C7V A;  4ARZ B;  1K25 A;  3M6H A;  4WF0 A;  2W1R A;  1VET B;  5F83 A;  1H8M A;  1MWS A;  4U3T A;  1KGG A;  3SW1 A;  3CAX A;  1ALQ A;  4CPK A;  3MQQ A;  2ZMA A;  1YLT A;  2P9V A;  4OPY A;  4NXB A;  1SKF A;  1CF0 A;  3I7J A;  4R6L A;  4KZ4 A;  5HAP A;  3C7U A;  5HPF A;  5FAP A;  3ZG5 A;  2W3D A;  4XUZ A;  1AXB A;  2PHY A;  2V8F A;  1KE4 A;  2O9C A;  1ACF A;  3PXP A;  3T4S A;  4HEF A;  5HDD A;  4JBF A;  1I2S A;  1IKI A;  1KDS A;  1SKO B;  4BEN A;  2ZBB A;  3F1N A;  3D3O A;  4E3M A;  1S6R A;  2A24 A;  3T50 A;  2DMW A;  2DRW A;  4LV0 A;  5HL6 A;  3RXW A;  3U2A A;  2V20 A;  4EWF A;  3VOY A;  3IX3 A;  3BEB A;  1HD8 A;  2ZMF A;  3UDX A;  3WS0 A;  2W3F A;  4JXW A;  4B88 A;  4DKI A;  3BLS A;  4MN7 A;  1P9W A;  1TD5 A;  4RA7 A;  1N9N A;  5DJT A;  4GD8 A;  3MFX A;  3HLG A;  1VM1 A;  3IHB A;  2WKI A;  3CUE C;  3GMW A;  5EVI C;  3UB6 A;  1XX2 A;  3KO6 A;  1KVM A;  5CXW A;  3ZNY A;  3PTE A;  3E2K A;  4NEE D;  4NK3 A;  1NRF A;  5CTN A;  4ZRR A;  3FYZ A;  2WAF A;  1CJF A;  1IFQ A;  4GCZ A;  5TFQ A;  5DKK A;  4BBU A;  4MDZ A;  4HQA A;  5GLB A;  4KUK A;  5HD3 A;  2ZQ7 A;  4LV2 A;  4E3K A;  1N9L A;  3WWX A;  4F3L A;  4Q0H A;  1CEG A;  4EU0 A;  3Q7Z A;  2W1T A;  2VGJ A;  4LPZ A;  2J9O A;  4EV4 A;  3ULF A;  5G4Y A;  4R38 A;  4DE2 A;  5CEB A;  1S1Z A;  4GKU A;  1F9I A;  1DP6 A;  3DTK A;  1YMS A;  2L0W A;  4ZTK A;  1PW8 A;  4KEN B;  4RVA A;  1Y4O A;  1ZKJ A;  2E8I A;  3T4O A;  4KQR A;  3MXR A;  3DBA A;  3IF6 C;  4Q0J A;  5D3O A;  3A3I A;  5CGW A;  2QPN A;  1K4F A;  4S2K A;  4FOF A;  5GLC A;  4JXG A;  3GRJ A;  1OTA A;  4X69 A;  3VV4 A;  3UB7 A;  1K55 C;  5L10 A;  1KDW A;  3ITA A;  4P85 A;  4N9K A;  4DF6 A;  4ZJ2 A;  1T1A A;  2RL3 A;  3F1P B;  1AWI A;  3R4K A;  3QNB A;  3IH8 A;  1VQQ A;  2ZMV A;  3WS1 A;  1MY8 A;  3UB8 A;  2Y2P A;  2CC1 A;  2JC7 A;  5EVI B;  1PZP A;  4PM9 A;  2W0N A;  3WS2 A;  4IVK A;  4ZBE A;  3N7W A;  4X56 A;  5FL3 A;  3JVV A;  2G2U A;  2ZQC A;  4CQH A;  5F82 A;  4E6W A;  4LLO B;  1FQG A;  2B5R A;  3S7Q A;  3WS5 A;  1HLU P;  3ZCZ A;  2X01 A;  1SDE A;  1WYB A;  5FAQ A;  1P0Z A;  4OP8 A;  4L9F A;  3FZC A;  3QP2 A;  4E3O A;  3T1S A;  1PNE A;  5TBM B;  1L0E A;  4NKP A;  3FV7 A;  4R4R A;  3IF5 A;  3M2K A;  4PMA A;  2Y2N A;  1HTZ A;  5MC7 A;  1C3B A;  3QP8 A;  5KIZ A;  4II7 A;  2OWH A;  3C30 A;  1FIL A;  3OPP A;  2GDN A;  1N4O A;  4RX2 A;  3UPP A;  4WUJ A;  4I38 A;  4H6J B;  5HAQ A;  1N9O A;  3DAV A;  1XA7 A;  2E8J A;  2O99 A;  5I5L A;  3N6I A;  3R7W A;  1NLY A;  4N1X A;  4BWI A;  3IF6 B;  3IHA A;  5HAR A;  3RJU A;  3T4L A;  1W8Y A;  4S2L A;  2WK0 A;  3G6O A;  2Y2J A;  1LHY A;  4NXE A;  3T12 B;  4EXO A;  3K3C A;  5A92 A;  1QMF A;  2YKH A;  4IBX A;  3ZG0 A;  4I5S A;  1IEL A;  2PD7 A;  4XT2 A;  2ZM2 A;  1PWD A;  4PHT A;  2Q0O A;  2XGN A;  4GN2 A;  1JWV A;  3E0Y A;  5TJJ A;  3EOI A;  1W79 A;  4OQI A;  3S1Y A;  5L2F A;  3Q7V A;  2IA2 A;  3W4P A;  3T4Q A;  4HJ6 A;  2O0Y A;  4ETZ A;  4HHD A;  3IXH A;  3TJZ C;  4Y5F A;  4HOI A;  3WS4 A;  3BRM A;  5GHX A;  4Y0U A;  1JTG A;  4UQI M;  4WZ4 A;  4KZ7 A;  2XDM A;  4K91 A;  2QJ7 A;  1UGU A;  3HLE A;  4P0M A;  3EWK A;  3ZDJ A;  4LCL A;  3MFD A;  2P04 A;  4HBT A;  3F1N B;  3C2W A;  4Y0T A;  3SZT A;  1Y54 A;  1YSQ A;  5IT5 A;  3UO9 A;  3NI9 A;  3F1O A;  4B93 A;  2XH9 A;  4LGW A;  1XJ6 A;  3OPL A;  3VP1 A;  1FCN A;  4ZDX A;  3SH8 A;  4WZ5 A;  1NY0 A;  3TW8 A;  4BBV A;  3HJK A;  3DWK A;  1NZO A;  2A3U A;  1KVL A;  1V9Z A;  2W3H A;  3FPV A;  3IT9 A;  1D06 A;  3BQA A;  4CLC C;  3LIA A;  5DTS A;  3T4J A;  4OOY A;  4YIN A;  3HLF A;  3EGD C;  2J80 A;  2AVX A;  3AGD A;  3V50 A;  1IYQ A;  1MPL A;  2I72 A;  4I3A A;  1TDL A;  3PYP A;  1UWP X;  2H0Y A;  3PR6 A;  3BQ8 A;  4ETX A;  4OPQ A;  5CTM A;  4ESP A;  3GVB A;  3LR5 A;  1YLZ A;  1BLC A;  5CED A;  1SCW A;  2WZX A;  4Q0I A;  2DCF A;  4Y15 A;  2IWB A;  4HI4 A;  2R9X A;  2DNS A;  3MZE A;  5FA7 A;  1YLP A;  3W2Z A;  4E3J A;  1YPR A;  5AQ7 A;  3NDE A;  3UY6 A;  5HWV A;  5AVF A;  5TGF A;  3D4F A;  2Y2Q A;  5FI7 A;  1K6R A;  5FEF A;  3ISG A;  2VV6 A;  1K54 C;  4Y7P A;  5F6A A;  4Y13 A;  4MN6 A;  3G30 A;  4HH3 A;  3G32 A;  2QYB A;  4I3J A;  2FFY A;  1OTD A;  4Y2F A;  2XR0 A;  3VMA A;  2J3T C;  2ZL1 A;  1H0M A;  2KLI A;  1L0G A;  2JCH A;  1LSV A;  3UE6 A;  3GTC A;  4KG6 A;  4GHI B;  4KQQ A;  4CLC B;  5DKL A;  4HP4 A;  5FQI A;  5J4E A;  3HLW A;  1H3Q A;  3RH8 B;  1VEU A;  2A49 A;  3IWO A;  1H8Y A;  1ZG6 A;  3A3D A;  4C3Q A;  4S2N C;  4ZJ3 A;  3V5M A;  5AQ9 A;  2HGV A;  4X53 A;  4LFU A;  4L0L A;  5GHZ A;  3ZG8 B;  4OQ0 A;  3HBR A;  2HF6 A;  4E3L A;  2XD5 A;  4Z1W A;  2VEA A;  3TSG A;  2UV0 E;  3OPH A;  1M40 A;  3EGX C;  4LV3 A;  3KYQ A;  1PWC A;  2BAS A;  1FCM A;  3HJI A;  3RXX A;  4R0Q A;  4KZ6 A;  3D72 A;  3BWL A;  4DE3 A;  5EVI D;  1DJA A;  4R3B A;  4E3I A;  5F1F A;  5A8B A;  4Y3I A;  1T19 A;  3VP2 A;  4GLQ A;  4EW7 A;  1ESI A;  2EWW A;  2L1M A;  2WYX A;  3PBN A;  5HDC A;  2ZOH A;  3ZFZ A;  1RCJ A;  1OJG A;  4N1H A;  4WMC A;  1L2S A;  4WYY A;  3R7W B;  1OTB A;  1PRQ A;  3K2N A;  1KOU A;  3ICY A;  2ZM8 A;  1S4S A;  1NYM A;  2PR5 A;  3CI6 A;  3NEC A;  1BSG A;  3LR3 A;  2WKE A;  1Q2P A;  3OCN A;  3S4X A;  1F2K A;  2XK1 A;  3A0S A;  3RTY A;  2ZC7 A;  3FKV A;  3BM6 A;  2WGV A;  5KSH A;  4JXS A;  3E4Q A;  5FI2 A;  2B02 A;  3DWZ A;  1P97 A;  4IJG A;  4EUV A;  4EES A;  1E4D A;  4DRT A;  2JKT I;  5AQA A;  5AJG A;  5HX9 A;  2V0U A;  1BT5 A;  4KG2 A;  1ONG A;  4LRZ E;  3IBR A;  2J8Y A;  2QWS A;  5EEC A;  1IKG A;  2GNX A;  3LIF A;  3CMZ A;  4PM5 A;  1CQA A;  1K57 A;  2W27 A;  3C4P A;  3Q82 A;  1JVJ A;  2WKR A;  3M2J A;  1O7E A;  1FR1 A;  1G5U A;  4LRY C;  4FH2 A;  3ZVW A;  2XRN A;  4MNR A;  5E2G A;  4X1M A;  3NOU C;  4S2J A;  4WMC D;  3MXS A;  2PYR A;  5IHV A;  4EEP A;  4UQI S;  4C6Y A;  1YAX A;  1W63 M;  2EA9 A;  4GS9 A;  4Z9Q A;  5KMW A;  2JKR M;  1S67 L;  4KUO A;  2OWJ A;  4KQD A;  4PM6 A;  2EX8 A;  3QHY A;  4YFM A;  1DP8 A;  4P6B A;  3H7W B;  4IED A;  1HZO A;  2HJE A;  3UDI A;  3NUL A;  4HNB A;  5A91 A;  4A5R A;  1YT4 A;  2VA0 A;  3ZHH A;  1LSW A;  2WGW A;  4HJ4 A;  5G4Z A;  1L0F A;  4E3N A;  3LO7 A;  5HFO A;  1ODV A;  2MJ6 A;  2EX6 A;  3MKF A;  3U4L P;  2BLS A;  3LY3 A;  3HL9 A;  5DF9 A;  3A3F A;  5JYP A;  2Q9N A;  5CHM A;  3NHQ A;  1NWZ A;  2EXA A;  2Y59 A;  4S2I A;  4C75 A;  2JHE A;  3OC2 A;  1BLP A;  2YKF A;  5HWT A;  3A3J A;  2OV5 A;  1P9R A;  1G6A A;  5A93 A;  1O07 A;  2WKP A;  3A0V A;  3HUO A;  1LLB A;  3ZQ5 A;  4M3K A;  1OME A;  5K5B A;  3NC8 A;  2PU4 A;  2V1B A;  4KG5 A;  1G28 A;  1BLS A;  4R4S A;  3ZNT A;  4GDN A;  5CGS A;  4QPR A;  1K56 D;  2G7U A;  2VX8 A;  1ERO A;  4RX3 A;  3UME A;  2P08 A;  1QME A;  2PDR A;  3QP4 A;  3FWL A;  1X0O A;  2K7S A;  2M1C A;  1FSW A;  4IUK A;  3BYD A;  2OLU A;  5HAI A;  2PYP A;  4K0W A;  3W4Q A;  2KX6 A;  1SHV A;  3E98 A;  3P7N A;  4BD0 A;  3UE0 A;  1S1Y A;  2XD1 A;  3LFV A;  2VV7 A;  4I39 A;  1MBL A;  3CPT B;  1GHP A;  1KGF A;  3VOZ A;  3NDG A;  5DTK A;  1IYS A;  1IYO A;  4K0X A;  5EPH A;  2D02 A;  1FSY A;  3LID A;  5FQQ A;  1NYY A;  3N4I A;  4B4X A;  3CIT A;  5EV0 A;  3JYI A;  2OAP 1;  2XA7 M;  1Y28 A;  3IS2 A;  4FD8 A;  1PW1 A;  3G31 A;  5FAS A;  2XQZ A;  2QKP A;  4JPM A;  2O9A A;  4H8R A;  2VZW A;  4ARZ A;  2PBD P;  4JF6 A;  1YKD A;  1TDG A;  4WEL A;  1VET A;  5EVL A;  3G4P A;  2HP6 A;  3C5A A;  3VOL A;  1XP4 A;  5EVE A;  3NOP C;  2JE5 A;  1YLW A;  3DW0 A;  1E25 A;  2Y2M A;  4L9E A;  4CLC D;  2VGK A;  1ES5 A;  2Y2K A;  2ZD8 A;  5IS1 A;  1LT0 A;  1J3W A;  3W4O A;  3IQA A;  2GZA A;  3DTE A;  4K08 A;  1W5D A;  5CRF A;  1SKO A;  1GHI A;  2P9V B;  3TG9 A;  4JGQ A;  1XFQ A;  1MWT A;  2WGI A;  1ES2 A;  4EEU A;  4PKY A;  3O88 A;  4EBL A;  1WE4 A;  1TS7 A;  2BG1 A;  1J9M A;  5EM0 A;  1GSW A;  2Y55 A;  2QMI A;  2VGL M;  2INW A;  2Z6C A;  3IWI A;  3MKE A;  2HDQ A;  1OJ5 A;  3MZF A;  2PAV P;  1JNU A;  4MLL A;  1U60 A;  5DFX A;  3T1Q B;  2ACG A;  1XGJ A;  1VHM A;  2A24 B;  3MSH A;  3JVU A;  3LR4 A;  3SS4 A;  4N92 A;  2A2L A;  2V9A A;  1H5X A;  3NY4 A;  2HJ9 C;  1HVB A;  1T18 A;  4HES A;  2HDS A;  3A0R A;  3PAE A;  2Y91 A;  3VP3 A;  1YSP A;  1MC0 A;  1XJ3 A;  2HPB A;  3IBJ A;  5DF7 A;  2NUP C;  4ZAM A;  3S7O A;  2HV1 A;  3CLO A;  2J3T D;  4MEZ A;  4M4X A;  4EBP A;  4WM9 A;  3LEQ A;  1XXM A;  4MBK A;  4MBH A;  4OQH A;  1NRJ A;  4NXF A;  4G3K A;  1OTI A;  4QY5 A;  2Z2M B;  4MN5 A;  1Z6F A;  4RQ9 A;  3PBO A;  1IOU A;  3LUQ A;  4KZA A;  1FR6 A;  2Y2G A;  3C38 A;  4EET B;  3A3E A;  1TS8 A;  4ME4 A;  3MBZ A;  1EWZ A;  1NJ4 A;  1T1B A;  3H82 A;  4YNR A;  2XFS A;  2PD8 A;  4OOL A;  3HRE A;  2Z2L B;  4QU3 A;  2XLN A;  2EFU A;  3B33 A;  3GSG A;  4GD6 A;  2XFT A;  5E2H A;  2WKQ A;  2Q9M A;  5DF8 A;  4F3L B;  2WKH A;  2XEP A;  5JYO A;  3GR2 A;  3C8C A;  1S66 L;  3G35 A;  4X68 A;  2W1T B;  3BY8 A;  1GCE A;  1K6S A;  1NZU A;  1MWU A;  2V2F F;  3KSH A;  3MQO A;  1Z09 A;  4OLD A;  4NG2 A;  1JTD A;  2XRO A;  3IXD A;  3LGO A;  4QWO A;  4BMW A;  3KSG A;  4CLC E;  3PBT A;  3G34 A;  5LBR A;  3BFF A;  4IUH A;  1PZO A;  1DRM A;  1GSV A;  4OKP A;  3EEH A;  3QP1 A;  5AQB A;  4GW9 A;  3CUE A;  5EVI A;  2FFF B;  5CHU A;  2UWX A;  4HH2 A;  2W3G A;  3NCK A;  3LI9 A;  4R23 A;  4BJP A;  5I94 A;  4G3W A;  3OLO A;  4R1G A;  5GLD A;  1CK3 A;  1I5Q A;  5EOE A;  1F98 A;  4WN5 A;  3UPN A;  4MMN A;  5HD5 A;  2P7J A;  4QHC A;  2XSS A;  1M6K A;  1IYP A;  4FH4 A;  3FG8 A;  5HL1 A;  2X02 A;  5TBM A;  2WAE A;  3SS3 A;  2ZLY A;  4AFI A;  2KDK A;  1LSX A;  2M7U A;  5F68 A;  2EXB A;  4LRX C;  4X55 A;  2J7V A;  3KSI A;  1TS0 A;  1A0K A;  3BFG A;  3FKW A;  4B4Z A;  5FEG A;  1ZC2 A;  5F69 A;  1UWN X;  4FTX A;  5GL9 A;  3UE1 A;  4KZ8 A;  4OVD A;  1ONH A;  4WEJ A;  2V1A A;  3IF6 A;  4DDS A;  2Y2I A;  4S2M A;  3B42 A;  4WL9 A;  4DE0 A;  2ZQ9 A;  5EFW A;  3LIB A;  2CMN A;  4UA7 A;  1XKZ A;  3SH7 A;  5EOO A;  5BOH A;  4DJ3 A;  1K55 A;  4WZ5 C;  5L8M A;  3NBL A;  3AGE A;  2Y2L A;  2XA7 S;  2PR6 A;  4RYE A;  4OH0 A;  5FAO A;  3RFB A;  2IWC A;  3CJM A;  3WRZ A;  1WA9 A;  4LCM A;  1D1J A;  2ZQA A;  3ZYT A;  3MS6 A;  2FH5 A;  4QY6 A;  5EUA A;  1KE0 A;  3ZG9 B;  1YLJ A;  5FDS A;  2PBY A;  5FAT A;  1FIK A;  3BFD A;  5CER A;  5CEC A;  5FQK A;  2L4R A;  4LEN A;  1ESU A;  3KYZ A;  4XT2 B;  1PI5 A;  1XJ4 A;  3FC7 A;  3T4T A;  1L3L A;  5J3W A;  2H0T A;  4R70 A;  4JGP A;  2J3W A;  4WBG A;  1XFN A;  2WAD A;  3V3R A;  3LIC A;  3LR0 A;  2O9B A;  1Q2Q A;  4P87 A;  3Q7V B;  5CHJ A;  1LI9 A;  5TR7 A;  5DTT A;  1JWP A;  3SOI A;  4GB7 A;  1W8Q A;  4JLF A;  1I2W A;  2HP9 A;  4S2P A;  1XPB A;  4BLM A;  4KZB A;  3V3S A;  4YOF A;  3OOV A;  1EI5 A;  4O8G A;  3HUN A;  1TF1 A;  3M6B A;  3BFE A;  1PI4 A;  3IX4 A;  3WRT A;  5KSC A;  4OQG A;  4X1L A;  2VGL S;  5U47 A;  3UN7 A;  5M18 A;  2ZM0 A;  1K56 A;  4EER A;  2ZOI A;  3DTM A;  3F1O B;  5G18 A;  3VE4 A;  2EWV A;  4I3I A;  4NET A;  3IXB A;  3Q81 A;  1XJ2 A;  3E2L A;  5C5K A;  5HZH A;  4L9G A;  4UHU A;  1ZG4 A;  1T1C A;  4ID4 A;  2FZ0 A;  3ITB A;  4DN0 A;  2V0W A;  4MCW A;  3CZD A;  1DY6 A;  1WYC A;  2X71 A;  4D60 A;  3LI8 A;  4GZB A;  1DP9 A;  3IXG A;  4BBT A;  3O3V A;  4P6Z M;  2Y2H A;  3P98 A;  4OON A;  3SS5 A;  3IH9 A;  3BW6 A;  4N9L A;  2JBF A;  3T4K A;  5HPI A;  4X6T A;  4OOM A;  2M7V A;  2EX9 A;  4JXV A;  3P01 A;  3O5Y A;  2J9P A;  3LY4 A;  3H82 B;  4IBR A;  4Q8I A;  4S2O A;  1XA1 A;  1W7F A;  5EE8 A;  1KE3 A;  2P74 A;  2Z6D A;  3G2Y A;  4EQI A;  5DVA A;  1W63 Q;  2Y2O A;  1S0W A;  4MBF A;  5GLA A;  3IWQ A;  3T1X A;  4DJ2 A;  4G3V A;  3O86 A;  2C5W B;  2ZC4 B;  4GNU A;  2ZC3 B;  2EFX A;  1S4R A;  1LI0 A;  1BZA A;  4GHI A;  1ERQ A;  1ZHH B;  3EQU A;  3HCY A;  4CLC A;  1JWZ A;  1SZV A;  2QJ5 A;  3QNC A;  1ES3 A;  2JKT M;  3VFH A;  3ZG7 B;  4JF4 A;  4EUZ A;  1BTL A;  3CG5 A;  3PBQ A;  4HBU A;  2ZC5 B;  1NXY A;  3GQZ A;  2ZL1 B;  2PT7 A;  4EQ1 A;  1IEM A;  1LL8 A;  3N8R A;  3GDI A;  2B95 A;  1MXO A;  2VK3 A;  1OTE A;  5E2E A;  3TE8 A;  1MKI A;  3HLC A;  1DJC A;  5FQJ A;  2ZQD A;  2R9W A;  2QHK A;  1BYW A;  5F5Y A;  3UMD A;  4BL3 A;  2LB5 A;  3VFF A;  3LCE A;  3UPO A;  1E3U A;  3CHW P;  1XGI A;  4U0X A;  1PIO A;  2PRF A;  1K0K A;  2WZZ A;  4FUW A;  4CJN A;  2VLG A;  3AGF A;  2LB9 A;  1VEU B;  3B3X A;  3BFC A;  2D01 A;  3VP0 A;  5M1A A;  3H9W A;  1FOF A;  1BUL A;  4Y17 A;  5IU1 A;  3BY9 A;  3MR0 A;  3LIE A;  1K57 C;  3QP6 A;  1KGE A;  1K4E A;  3NIA A;  4KZ5 A;  4UA9 A;  4QB8 A;  5E43 A;  5A90 A;  4KZ3 A;  5L09 A;  2Y4A A;  1K54 A;  4DXB A;  2W3E A;  4OPR A;  3N8L A;  1DJB A;  3L9K A;  2Y8H A;  2RCX A;  4QJG A;  1NLZ A;  3S22 A;  5FQ9 A;  3LEZ A;  3UNW A;  2Y79 A;  4BL2 A;  5DFY A;  4QD4 A;  3NOT C;  1OT6 A;  2V1Z A;  2K31 A;  3TOI A;  3UB9 A;  3ZGA B;  2V8C A;  3LYX A;  1G6O A;  2WUQ A;  3C4O A;  3T1R A;  3CWF A;  1LL9 A;  1D7E A;  1E3U D;  5E2F A;  4HY8 A;  1GHM A;  3OCL A;  3BEC A;  4X25 A;  2K2N A;  3Q1F A;  1SDN A;  1GSX A;  4O0P A;  1ERM A;  2VJW A;  5HWW A;  3ZVT A;  3HVF A;  4JGR A;  4DMZ A;  5DJU A;  4S2N A;  2PU2 A;  3BJN A;  1L0D A;  4OP5 A;  1OT9 A;  3OPR A;  1CI9 A;  4Y0O A;  4OLG A;  1MZU A;  2HDU A;  2JN7 A;  2VV8 A;  3DTI A;  3PBR A;  5FDH A;  4O7D A;  3PBS A;  4PPR A;  4XUX A;  4YWZ A;  3UE3 A;  4EBN A;  1H8Z A;  3JPU A;  5EM1 A;  2R78 A;  5L07 A;  4UA6 A;  2BTF P;  3K3D A;  2QZ6 A;  3OBF A;  5M19 A;  5HSQ A;  3D9Y A;  4NXG A;  3S7N A;  1MKM A;  1YMX A;  3H7W A;  4DE1 A;  1FCO A;  4ZJ1 A;  2ZQ8 A;  1CEF A;  2C6W B;  1YLY A;  4UAA A;  5GHY A;  5J7E A;  1BUE A;  4JGO A;  1RGZ A;  4GS9 B;  4FSF A;  5AVE A;  1VB6 A;  4HP9 A;  3N8S A;  2GX5 A;  5F1G A;  2OLV A;  3TRC A;  3V67 A;  3HUM A;  3KSF A;  1RGY A;  3E4O A;  1ZTU A;  4KZ9 A;  5FSR A;  5HDS A;  3VP4 A;  3B47 A;  3EQV A;  3GEC A;  3KYE A;  4E6X A;  4O01 A;  1YQS A;  3GV9 A;  2HP5 A;  4UEY A; 
#chains in the Genus database with same CATH homology
 3MMH A;  5DF9 A;  2PR6 A;  3G6O A;  3RFB A;  3NHQ A;  1NWZ A;  4NXE A;  4EXO A;  1WA9 A;  2JHE A;  3FPW A;  3K3C A;  2YKH A;  2B18 A;  3OC2 A;  3MQ0 A;  2YKF A;  5HWT A;  3ZYT A;  1P9R A;  4I5S A;  2PD7 A;  4XT2 A;  1STZ A;  2FH5 A;  1V9Y A;  2KOI A;  2WKP A;  3A0V A;  3F1P A;  3ZQ5 A;  4GJ4 A;  2GJ3 A;  5K5B A;  4PHT A;  4E04 A;  3E0Y A;  4P6Z S;  5CX7 A;  5TJJ A;  2V1B A;  3EOI A;  2L4R A;  1G28 A;  3NJA A;  3KYZ A;  4XT2 B;  4QPR A;  1XJ4 A;  2G7U A;  2IA2 A;  2VX8 A;  3FC7 A;  4KQO A;  3S7P A;  3T4T A;  3UME A;  2OOL A;  2P08 A;  1TS6 A;  5J3W A;  4HJ6 A;  3T4Q A;  2PDR A;  4R70 A;  2O0Y A;  4ETZ A;  4HHD A;  1X0O A;  3MJQ A;  4JGP A;  3TJZ C;  2J3W A;  4Y5F A;  2K7S A;  4HOI A;  1XFN A;  2M1C A;  4R3A A;  4WEK A;  4IUK A;  3LIC A;  3LR0 A;  2O9B A;  4UQI M;  2QJ7 A;  1UGU A;  3PHY A;  3EWK A;  2PYP A;  4WLA A;  2KX6 A;  3E98 A;  3P7N A;  4PAU A;  1S1Y A;  3LFV A;  2VV7 A;  4I39 A;  2P04 A;  3F1N B;  4B9O A;  3C2W A;  4YOF A;  4HJ3 A;  1F5M A;  3OOV A;  4HIA A;  1OPX A;  1YSQ A;  4O8G A;  3EEA A;  5IT5 A;  1TF1 A;  3F1O A;  3MXQ A;  4B93 A;  2D02 A;  3LID A;  1XJ6 A;  2VGL S;  1EW0 A;  3CIT A;  3TW8 A;  4BBV A;  3HJK A;  3MF0 A;  3KX0 X;  4EER A;  2ZOI A;  3F1O B;  1V9Z A;  2W3H A;  2OAP 1;  3VE4 A;  3FPV A;  2XA7 M;  2EWV A;  1D06 A;  4I3I A;  4H6J A;  1Y28 A;  2JKR I;  3BQA A;  1XJ2 A;  4CLC C;  3IS2 A;  5C5K A;  3LIA A;  4PKY G;  5HZH A;  4L9G A;  3T4J A;  2QKP A;  3EGD C;  2J80 A;  2O9A A;  2VZW A;  4ARZ A;  4IHQ A;  1YKD A;  1T1C A;  2FZ0 A;  2I9V A;  4DN0 A;  2V0W A;  4MCW A;  4WEL A;  4I3A A;  3IS2 B;  3LI8 A;  3VE3 A;  1DP9 A;  3PYP A;  4BBT A;  1UWP X;  2H28 A;  3VOL A;  4P6Z M;  3PR6 A;  3E4P A;  2VKS A;  2OAQ 1;  3BQ8 A;  2NUT C;  3NOP C;  4ETX A;  4ARZ B;  3BW6 A;  4WF0 A;  2W1R A;  3T4K A;  5HPI A;  1H8M A;  3SW1 A;  3LR5 A;  3CAX A;  4OOM A;  4L9E A;  4CLC D;  2M7V A;  3MQQ A;  3P01 A;  3O5Y A;  4Q0I A;  3H82 B;  4NXB A;  5IS1 A;  1LT0 A;  4R6L A;  4HI4 A;  2Z6D A;  2GZA A;  4UEY A;  5HPF A;  1W63 Q;  4K08 A;  2W3D A;  3W2Z A;  2PHY A;  4JGQ A;  1XFQ A;  2O9C A;  4EEU A;  5HWV A;  3PXP A;  5AVF A;  3T4S A;  4PKY A;  4DJ2 A;  4G3V A;  5HDD A;  1TS7 A;  1GSW A;  2VV6 A;  2ZBB A;  3F1N A;  3D3O A;  2VGL M;  2INW A;  2Z6C A;  5F6A A;  1S4R A;  3T50 A;  2A24 A;  4MN6 A;  4GHI A;  1OJ5 A;  4HH3 A;  2QYB A;  2DMW A;  4I3J A;  1ZHH B;  5HL6 A;  1OTD A;  4Y2F A;  3EQU A;  1JNU A;  3HCY A;  3U2A A;  4CLC A;  2J3T C;  2KLI A;  2QJ5 A;  5DFX A;  2JKT M;  1LSV A;  2ZMF A;  3UE6 A;  1VHM A;  2A24 B;  3JVU A;  4GHI B;  3LR4 A;  3PBQ A;  2W3F A;  2A2L A;  2V9A A;  4CLC B;  4MN7 A;  2PT7 A;  4HP4 A;  5DKL A;  4EQ1 A;  1P9W A;  1LL8 A;  2HJ9 C;  5J4E A;  1TD5 A;  1T18 A;  3GDI A;  1N9N A;  5DJT A;  1H3Q A;  1OTE A;  3A0R A;  3TE8 A;  3MFX A;  3RH8 B;  1YSP A;  1MC0 A;  1XJ3 A;  3IBJ A;  2NUP C;  2QHK A;  3CUE C;  3S7O A;  1BYW A;  3UB6 A;  5F5Y A;  3UMD A;  2HV1 A;  3KO6 A;  3CLO A;  2LB5 A;  4NEE D;  2J3T D;  4M4X A;  4ZRR A;  1IFQ A;  2HGV A;  4GCZ A;  1NRJ A;  4NXF A;  4G3K A;  1OTI A;  4L0L A;  5DKK A;  4BBU A;  4MN5 A;  2VLG A;  2LB9 A;  4MDZ A;  4HQA A;  2D01 A;  4RQ9 A;  3PBO A;  2HF6 A;  4KUK A;  1IOU A;  3LUQ A;  5HD3 A;  4Z1W A;  3H9W A;  2VEA A;  3C38 A;  5IU1 A;  4EET B;  1TS8 A;  3BY9 A;  3EGX C;  3MR0 A;  4ME4 A;  3LIE A;  1T1B A;  3KYQ A;  3H82 A;  2BAS A;  4YNR A;  1N9L A;  4F3L A;  2PD8 A;  3HJI A;  4Q0H A;  4OOL A;  3D72 A;  3BWL A;  4EU0 A;  3B33 A;  2W1T A;  4LPZ A;  5A8B A;  4Y3I A;  1T19 A;  2W3E A;  5G4Y A;  3ULF A;  4R38 A;  1S1Z A;  2WKQ A;  4GLQ A;  1F9I A;  4EW7 A;  1DP6 A;  2Y8H A;  4F3L B;  1NLZ A;  2EWW A;  2L1M A;  3PBN A;  5HDC A;  2ZOH A;  3C8C A;  1S66 L;  2W1T B;  2L0W A;  3BY8 A;  2Y79 A;  5DFY A;  3NOT C;  1OT6 A;  1OJG A;  2K31 A;  3R7W B;  3UB9 A;  3LYX A;  3KSH A;  1G6O A;  3T4O A;  1OTB A;  3MQO A;  3K2N A;  1KOU A;  3DBA A;  3ICY A;  4Q0J A;  1S4S A;  2PR5 A;  3CI6 A;  2XRO A;  4BMW A;  3KSG A;  4CLC E;  4FOF A;  3PBT A;  5LBR A;  3LR3 A;  3CWF A;  3OCN A;  1D7E A;  1OTA A;  4IUH A;  4HY8 A;  3VV4 A;  3UB7 A;  1DRM A;  1GSV A;  3OCL A;  3A0S A;  3RTY A;  3EEH A;  2K2N A;  4GW9 A;  1T1A A;  3F1P B;  3CUE A;  1GSX A;  4O0P A;  2VJW A;  3R4K A;  5HWW A;  5KSH A;  4JGR A;  4DMZ A;  3E4Q A;  2B02 A;  4HH2 A;  2W3G A;  1P97 A;  2ZMV A;  4IJG A;  5DJU A;  4EUV A;  3LI9 A;  4EES A;  3BJN A;  4BJP A;  1OT9 A;  3UB8 A;  4G3W A;  3OLO A;  2JKT I;  5AJG A;  2V0U A;  1MZU A;  2W0N A;  4LRZ E;  3IBR A;  1F98 A;  2JN7 A;  2VV8 A;  4WN5 A;  2QWS A;  4MMN A;  3PBR A;  5HD5 A;  2P7J A;  5FL3 A;  3JVV A;  2GNX A;  3LIF A;  4CQH A;  2XSS A;  3PBS A;  3FG8 A;  4YWZ A;  4LLO B;  5TBM A;  3UE3 A;  2W27 A;  2WKR A;  3S7Q A;  4LRY C;  2R78 A;  4AFI A;  2XRN A;  2KDK A;  1LSX A;  2M7U A;  1P0Z A;  4L9F A;  3K3D A;  3NOU C;  5F68 A;  3OBF A;  2PYR A;  4LRX C;  5HSQ A;  4NXG A;  3KSI A;  3S7N A;  5TBM B;  1TS0 A;  1MKM A;  4EEP A;  4UQI S;  3H7W A;  1YAX A;  4NKP A;  1W63 M;  2EA9 A;  4GS9 A;  2JKR M;  1S67 L;  4KUO A;  2OWJ A;  4KQD A;  5MC7 A;  5F69 A;  5KIZ A;  4II7 A;  1UWN X;  2OWH A;  1DP8 A;  5J7E A;  3C30 A;  4JGO A;  3H7W B;  4WEJ A;  4GS9 B;  2HJE A;  2V1A A;  4FSF A;  5AVE A;  1VB6 A;  4HNB A;  4HP9 A;  2GX5 A;  4WUJ A;  4I38 A;  3B42 A;  4WL9 A;  3TRC A;  3V67 A;  4H6J B;  3KSF A;  2VA0 A;  1N9O A;  5EFW A;  3E4O A;  3LIB A;  1ZTU A;  2CMN A;  1LSW A;  5HDS A;  4HJ4 A;  2O99 A;  5I5L A;  5G4Z A;  3R7W A;  4DJ3 A;  3B47 A;  3EQV A;  5L8M A;  1NLY A;  3GEC A;  1ODV A;  4BWI A;  2MJ6 A;  4O01 A;  3T4L A;  2XA7 S; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...