5HL6A

Crystal structure of a putative gaf sensor protein from burkholderia vietnamiensis
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
158
structure length
158
Chain Sequence
ASKAELYATLAEQARSLVESEPDLIANAANFSALVYHSLDRLNWAGFYFFDGTELVVGPFQGKPACVRIALGKGVCGTAAQTRQTQVVRDVHAFPGHIACDAASESEIVVPLVAADGTLIGVWDVDSPVAARFDDEDRSGMEALCRVFVEHAWQKARD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of a Putative GAF sensor protein from Burkholderia vietnamiensis
rcsb
source organism Burkholderia vietnamiensis (strain g4 / lmg 22486)
molecule tags Transferase
molecule keywords Putative GAF sensor protein
total genus 50
structure length 158
sequence length 158
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13185 GAF_2 GAF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.40 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 5hl6A00
2VKSA 5AJGA 4Y5FA 3ZQ5A 3E98A 4G3KA 4IUHA 3CI6A 3S7NA 4ETZA 1YSPA 1VHMA 3C2WA 5K5BA 3NOUC 2M7UA 2XRNA 4MN7A 3MMHA 2Y8HA 4IUKA 4FOFA 3KSFA 4MDZA 5TJJA 4QPRA 2O9BA 2B18A 2QYBA 4GLQA 4DN0A 4ETXA 4LRYC 3RFBA 2W3GA 2VEAA 4E04A 3S7PA 3MF0A 3KSHA 2OOLA 2W1TB 3S7OA 2W3FA 2O0YA 3NOTC 2W3DA 3S7QA 4R6LA 3LFVA 3KO6A 4DMZA 4EU0A 3W2ZA 4O0PA 3KSIA 5HSQA 2K31A 2KOIA 2LB5A 2GX5A 3EEAA 1F5MA 2G7UA 4Q0JA 3O5YA 1TD5A 4MMNA 1YSQA 1ZTUA 1STZA 3CITA 3OBFA 2XROA 2W3HA 2O9CA 4GW9A 5HPIA 4G3WA 2O99A 1MC0A 4R70A 3TRCA 2ZMFA 3IBJA 4LRXC 4YNRA 2HGVA 1TF1A 5DFYA 5DFXA 5C5KA 4G3VA 4RQ9A 4Q0HA 5HPFA 3G6OA 4Q0IA 2VZWA 4PAUA 3OOVA 4CQHA 3KSGA 5HL6A 4IJGA 3R4KA 2W1RA 2VJWA 1MKMA 2XSSA 2Y79A 2W1TA 3VV4A 4ME4A 4ZRRA 4Y3IA 2K2NA 3DBAA 4MCWA 2W3EA 4YOFA 3NOPC 2IA2A 3D3OA 2O9AA 4LRZE 3IBRA 2LB9A 4Y2FA 4O8GA 3E0YA 3NHQA 3BJNA 3HCYA 3MQ0A 4O01A 2M7VA 4Z1WA 5LBRA 4BWIA 3K2NA 5L8MA 4EUVA 1YKDA 2KLIA 5I5LA
chains in the Genus database with same CATH superfamily
3CJMA 4S2NA 2V8CA 1HTZA 5FI2A 1H3QA 1YSPA 5I94A 2PU4A 2CC1A 2VK3A 1ZC2A 5JYOA 2BLSA 5TJJA 3BQ8A 4R3BA 2QPNA 5HWTA 3F1NA 3AGEA 5FL3A 5CECA 2W3FA 4FH4A 3H82B 5KSHA 4R23A 3W2ZA 2PD7A 2G2WA 3VP0A 1OTBA 1JNUA 4QD4A 4Z9QA 5FEFA 2GX5A 4KZ8A 3EEAA 2J9PA 4GZBA 2V1BA 3A3EA 5DVAA 1FSWA 3HLDA 2WGWB 2WGVA 1TS8A 4JLFA 4KZ6A 5FASA 1S1YA 4E6WA 4BQMA 4HI4A 2ZMAA 4R1GA 3N7WA 3EOIA 3E4OA 1DP6A 4BBUA 1GA0A 2BASA 4Q0IA 4HH3A 4PAUA 4GOGA 2Y91A 1V9YA 2WYXA 4DDSA 1LSXA 1Y28A 1RGYA 5F69A 3SH9A 4KG2A 3FWLA 3E2LA 4PPRA 1C3BA 1XP4A 5FA7A 3QP4A 1GA9A 1NXYA 3T4JA 1RP5A 4IHQA 2B02A 3C5AA 2WAFA 4L0LA 2KLIA 3PXPA 3HJKA 3S7NA 4LV3A 3ZYTA 3N8SA 4LV1A 1PFLA 4ARZA 2BTFP 4NXEA 3T4SA 4IUKA 2P9VA 3KSFA 2WZXA 4NXGA 4PM6A 3GV9A 3UE0A 3UMDA 3BECA 2PDRA 2Y2QA 3M2KA 1EWZA 1MWRA 4EQIA 1SDNA 3W8KA 2K31A 1ESIA 1MXOA 1MY8A 3V3SA 5F82A 3UDIA 2FFYA 5FAOA 5EOOA 4WZ5C 1ZTUA 1XJ6A 2WK0A 2D01A 3IF6C 4CLCE 3S4XA 1XA7A 4GJ4A 2OLVA 2XA7S 2H0YA 3TRCA 4LFUA 1NLZA 4C75A 2INWA 2VGLM 3ZNYA 2IWBA 3HLEA 2V0WA 5HPFA 3IH8A 4GCZA 4FCFA 3E2KA 3CUEA 4DE1A 1I2SA 2V2FF 1N9OA 3NIAA 3QP8A 3G30A 3PHYA 5E2FA 4LENA 5HAIA 5TBMA 3IWOA 3MFDA 4EBNA 3PBTA 4H6JB 1S66L 2GZAA 4LRZE 4HEFA 1FCOA 3E0YA 4KZ3A 1K57A 2I9VA 1XPBA 3T4OA 4MEZA 2QWSA 2PD8A 4WLAA 3EEHA 4G3KA 3FG8A 4X68A 3IXHA 4OQGA 3C2WA 2PYPA 2EFUA 4JXSA 3LYXA 3WS5A 4JGOA 4EV4A 5L09A 1ES5A 3BRMA 3MMHA 3IHBA 2HJEA 4FH2A 3WS4A 2L1MA 2XQZA 1AWIA 2B5RA 1KE0A 3ITAA 2OOLA 1DJCA 3M6HA 3BY9A 3VP3A 1PW8A 4DDYA 3IQAA 3IS2A 2ZQDA 1UWNX 2Y2OA 5EM1A 4NXFA 1YLPA 2XGNA 1LL8A 3H7WA 3CAXA 3P01A 4OP5A 3MQQA 4DE3A 3LO7A 1XGIA 4WZ4A 4NETA 3G35A 5FDHA 4BLMA 2W3HA 3DW0A 3LI8A 3S1YA 1DY6A 1KOUA 1ERMA 3C7UA 1FQGA 1NJ4A 2HP5A 3IBJA 3O86A 4HJ3A 1OTDA 2P9VB 4P6ZS 1E4DA 2Y2HA 4P0MA 4Y15A 2JC7A 4N9LA 5EOEA 2JKFA 2EX8A 4E3OA 1DJAA 5FI7A 2Y55A 2KX6A 4S2MA 3VSLA 2W1TA 1BUEA 5IHVA 1VEUA 1LL5A 3G32A 1IELA 2YKFA 4OOYA 3JVUA 5D3OA 2R78A 3UPOA 5EPHA 3FPVA 1IYPA 3VP4A 2WGWA 3LIDA 1T19A 2HP9A 2VV6A 4Q8IA 5HAPA 3JYIA 4JF4A 1I5QA 5JYPA 4GLQA 5AQAA 3R7WB 1BLSA 1K54A 2H5SA 1XJ2A 3PAGA 1RGZA 4MLLA 2WKRA 1S1ZA 1OMEA 2G2UA 3HUOA 4NG2A 4EU0A 4U0TA 4HH2A 4H6JA 1M40A 2WKQA 2PU2A 5IT5A 5FQQA 2HDQA 4QY6A 4ZDXA 4UA9A 4QWOA 3FYZA 3P98A 3HLGA 4JF6A 2FZ0A 1S4SA 3CITA 5DKLA 4GDBA 3DWKA 3WS1A 2VV8A 1GHMA 3V39A 3A0SA 3NI9A 5AQ7A 3BFEA 4YNRA 3GVBA 1VETA 1XFNA 2L4RA 1FOFA 2PBYA 4KUKA 5DTKA 1YAXA 3MXSA 1SKFA 4DRTA 4U0XA 2Y4AA 5F1FA 5HL6A 4DXBA 5EFWA 5CHJA 1XXMA 3C4OA 1TDLA 4MCWA 2W3EA 3H7WB 1YQSA 1AXBA 2WGIA 5DF9A 4P85A 2LB9A 5A8BA 2Y2IA 3IS2B 3LIAA 4F94A 3UPNA 2PHYA 4C6YA 3HVFA 1MWTA 4JF5A 4X53A 1EROA 5L10A 3ITBA 1DP9A 2XRNA 3SS4A 2QMIA 4P87A 1DJBA 4S2JA 4K0XA 2PAVP 5FQJA 2JKGA 2RL3A 2HP6A 1SCWA 2ZMVA 2JHEA 1A0KA 2D02A 1V9ZA 3UN7A 2W1TB 3CWFA 4QY5A 4I3JA 4IBXA 4S2IA 3LUQA 3VOYA 4E6XA 2ZQCA 1VB6A 2KOIA 3BLMA 3A3FA 4HHDA 3LR4A 1HZOA 2VA0A 1W63Q 3AGFA 2OAP1 3TOIA 3LIFA 4X55A 4ID4A 3EWKA 3Q7ZA 4NXBA 1SKOB 3C4PA 1L0FA 5FQKA 3LICA 3IF6B 4UA6A 2QZ6A 1VETB 5C5KA 1GSWA 4XXRA 3W4OA 4RQ9A 4Q0HA 3R7WA 1ES2A 3ZNTA 3G31A 1Y54A 4OOLA 1PYYA 2P04A 3G34A 3CZDA 4E3NA 1ES3A 1H8YA 5IS1A 3H82A 2OSUA 4MN6A 2Y79A 2ZD8A 4ME4A 1RCJA 4ZAMA 3OPHA 2V0UA 3NJAA 3EQVA 4ZJ3A 1OT6A 3BYDA 2W0NA 1N9BA 4KZ9A 1XJ3A 4S2NC 4BWIA 3JVVA 3D9YA 3OC2A 1XJ4A 1BLCA 4B4ZA 4EBLA 4DXCA 4QB8A 4CPKA 3BQAA 4WF0A 4GB7A 4P6ZM 4HBUA 1XGJA 2Y59A 4LV0A 5EV0A 2X02A 1GCEA 4B4XA 1G6AA 5CXWA 4D60A 4B93A 1LHYA 1N9NA 3BW6A 3WWXA 5GLDA 4DJ3A 3ICYA 3BEBA 2ZOIA 4Y0UA 4N1XA 2MJ6A 3RTYA 4GW9A 3QNBA 3EGXC 3SZTA 4G3WA 3NDGA 4M4XA 1IOUA 4OLGA 5J7EA 1KE3A 2OAQ1 3T4LA 4EBPA 5KZHA 5KMWA 3TSGA 5GLBA 4MBKA 1TF1A 4PKYG 3ZHHA 3N4IA 5E43A 2Q9MA 3GECA 5AVEA 4K08A 3LGOA 5CHUA 4R38A 3CG5A 2XSSA 1K4FA 4WBGA 1EI5A 4E3LA 1LI0A 1K25A 5L2FA 1FR1A 4LGWA 2O9AA 5HW3A 3OCNA 1X0OA 2OWJA 4ARZB 5A90A 4FTXA 1MKIA 2EA9A 1ODVA 4Y17A 5EM0A 3ZQ5A 3UDXA 4X56A 5DJTA 4MNRA 3GDIA 1PI4A 1T18A 4FOFA 1FCMA 4MDZA 4JXVA 2B18A 5HD3A 2QKPA 2WAEA 4LRYC 3HLFA 3SW1A 2VGJA 3IXGA 1NYYA 3A3DA 3W4QA 2XD5A 4PKYA 1IEMA 3UPPA 3LEZA 4U3TA 1OTAA 2E8JA 5CX7A 3HBRA 3IX8A 5A91A 2KDKA 4I38A 1K6RA 1NYMA 3V50A 5TBMB 4C3QA 2XROA 2GJ3A 3A0VA 4EQ1A 1XFQA 5HPIA 3ZVWA 4HY8A 2J7VA 3PBQA 3SS3A 3QP5A 1CK3A 3C8CA 1KVMA 5MC7A 2VGKA 4KQQA 4NEED 2EWWA 2ZL1A 2K7SA 2WKEA 2ZM8A 1FSYA 4R0QA 2NUTC 4HBTA 5CEBA 2BG1A 2VX8A 2JKTI 3IXDA 3C38A 4GHIA 3G4PA 4HNBA 1W5DA 3GR2A 3PTEA 3NOPC 2X71A 3O88A 4BMWA 5EVEA 2PR5A 3E4QA 2UWXA 2Z6CA 4UQIS 2ZBBA 3BJNA 3HCYA 1NRJA 2WZZA 3W4PA 3N6IA 4M3KA 4L9EA 1KGGA 2XLNA 4UAAA 3MZFA 4KZ7A 3TJZC 2JE5A 5G4ZA 1YLJA 5E2GA 5HWWA 5AQBA 1W63M 4DN0A 1CEGA 3NBLA 5DKKA 1LSVA 3O87A 1IYQA 3IX4A 3UDFA 1P9WA 2RCXA 3A3IA 3LFVA 5EECA 4X6TA 3NULA 1F9IA 1TS6A 3UMEA 4OONA 4R3JA 4EETB 2I72A 2H0TA 3LR3A 1N4OA 1YSQA 1PWCA 1SZVA 4EUZA 3T1RA 1O07A 2HV1A 3ZFZA 3LY4A 1NWZA 1MC0A 3OPRA 3KYZA 1K0KA 2ZMFA 4I39A 1L0GA 2PRFA 1NRFA 5AVFA 2HF6A 1JWVA 1BZAA 3V5MA 4PM7A 3NDEA 3BFFA 4IEDA 2OV5A 5A93A 1XA1A 4DE0A 4GD6A 3IHAA 1U60A 1NZOA 3ZVTA 3MSHA 3OLOA 3LEQA 4YINA 3TG9A 4KZ5A 1D1JA 5GHZA 4JGQA 4WEKA 3HUNA 3T1XA 2ZLYA 1F2KA 2M7VA 3ZG7B 5LBRA 4GS9B 3MBZA 1S6RA 1OT9A 1L0EA 4DKIA 1BULA 4RX3A 4IVIA 3CI6A 3JPUA 2JBFA 2NUPC 2Y2PA 3NOUC 4GNUA 1CJFA 4PM5A 1ZKJA 1QMEA 1W8YA 3P7NA 4WZ5A 2EX6A 4WMCA 1SDEA 2UV0E 5HDSA 2W3GA 3ISGA 4EESA 4XT2A 4OPRA 5J3WA 4OH0A 3D72A 3FC7A 1PRQA 4WMCD 5CEDA 5HSQA 3EGDC 3LIEA 4HP9A 5TGFA 1K55C 3VP2A 1F5MA 5HL1A 1K56D 1D06A 4O7DA 4RA7A 2ZJ9A 5E2HA 2ZC5B 4OLDA 1MBLA 5HARA 4HIAA 4HOIA 3IF6A 3CPTA 4N9KA 2VGLS 4QHCA 5EVIA 1TS7A 5CHMA 2HPBA 2JCHA 4GS9A 3MZDA 2P08A 4JBFA 3ULFA 3T1QB 1E3UD 2ZQAA 5A92A 3MFXA 4EXOA 3FKWA 2A24B 2Y2MA 3UB5P 1NLYA 3SH7A 4LLOB 4BENA 4OVDA 2L0WA 2WKIA 2HDRA 3DBAA 1LI9A 5F83A 4EEPA 1IFQA 1YMSA 3MZEA 1J9MA 5FAQA 5FATA 2Y2GA 4JKTA 2V1ZA 5M19A 4E3IA 4Y5FA 2OLUA 3OPPA 4X69A 3E98A 4YFMA 4IUHA 2R9XA 5J4EA 5K5BA 1OJGA 5DF7A 5GHYA 4KENB 4BJPA 1ESUA 1YT4A 4OKPA 3WS2A 1ES4A 1L3LA 2A3UA 4AFIA 1Q2QA 2A49A 3LR0A 2J9OA 4MBFA 3PBNA 5FI6A 1NZUA 4XUXA 3MXRA 3KSIA 1GSXA 3RH8B 4BL3A 3MJQA 4I3AA 4R4RA 2A24A 1E3UA 4F3LA 4KUOA 1G6OA 1K55A 3BFCA 3HREA 3QP1A 4R70A 2P74A 1HVBA 1P0ZA 2PBDP 4QU3A 3VFHA 4KG5A 4B88A 4UEYA 5U47A 3RXWA 2XA7M 3WRZA 4N1HA 1HLUP 2ZC7A 1TDGA 5HAQA 3R4KA 4EWFA 5HWVA 2VJWA 3CUEC 1YLWA 3DWZA 1SHVA 2Z2MB 3T4QA 3B47A 4WN5A 4KG6A 2IA2A 2EX9A 4FSFA 5F1GA 4OQHA 2XD1A 3E4PA 1W7FA 4O01A 3IX3A 2H10A 2XF3A 4GD8A 3Q82A 2J8YA 1G5UA 3A3JA 1IYOA 1O7EA 1VHMA 5CTNA 3DAVA 1FILA 3VE4A 5E2EA 4GHIB 1K38A 4K0WA 2O9BA 3GSGA 5CTMA 5G18A 2C6WB 3LCEA 5G4YA 3ZG9B 5DTSA 3N8RA 4KZAA 2V9AA 3NECA 1JVJA 3T4KA 2JKRI 2ZM0A 2C5WB 1T1BA 3IXBA 3N8LA 3GMWA 1P97A 4WEJA 2EXBA 2HDSA 1IKIA 3UB7A 3OPLA 2XR0A 4UQIM 4CLCA 4L9GA 3FPWA 2O9CA 3RXXA 4JPMA 2O99A 4OOMA 4Y0TA 3GQZA 4Y0OA 4CLCC 3M6BA 5DFYA 4G3VA 4GN2A 1CF0A 2J3TD 4WYYA 3DTIA 2ZM2A 3KSGA 2V1AA 4IJGA 4NKPA 3MR0A 5HDCA 4H8RA 1MKMA 3PAEA 3T4TA 3RJUA 1KGEA 4S2KA 3OCLA 4Y3IA 4QJGA 1MPLA 5IU1A 2K2NA 3UE6A 3MKEA 1ALQA 4CJNA 1LL9A 4HQAA 1PI5A 4O8GA 2ZC4B 4PMAA 5FDSA 2IWCA 1T1CA 1BYWA 4S2LA 3K3CA 2V8FA 1YKDA 1KGFA 1YM1A 2VKSA 3QNCA 5CGSA 4OPZA 4I5SA 3HL9A 4BBTA 3Q7VA 3K3DA 2M7UA 3HJIA 2Y8HA 1K6SA 3WS0A 4GDNA 5F6AA 4CLCD 5EVIB 2WKPA 1YLYA 3Q1FA 1H0MA 4E04A 4R4SA 1L2SA 2Y2KA 4ZJ2A 1ZHHB 4EERA 3KYQA 4FUWA 3S7QA 5EUAA 3IWIA 4O0PA 4D2OA 2G7UA 1T1AA 3O5YA 3HLWA 3G2YA 3OBFA 2OWHA 3SH8A 4A5RA 1Y4OA 1MWSA 2Y2NA 2ZL1B 3PBSA 4WELA 1E25A 5AQ9A 2JN7A 1KE4A 4ZBEA 4OQIA 1JWZA 4OPQA 4LRXC 2HGVA 5DFXA 2ZQ7A 3GRJA 3VE3A 3UB8A 2VZWA 3Q7VB 2IWDA 4ZTKA 1J3WA 5HD5A 1UGUA 1I2WA 4S2PA 1PZPA 3UB6A 5M1AA 2GDNA 3FKVA 1W79A 1N9LA 3B42A 2XH9A 4X25A 3PBOA 1ONGA 4HJ4A 3MQOA 2X01A 1NY0A 1H8ZA 5CGWA 2VV7A 3K2NA 4WM9A 1FR6A 4BD0A 4N92A 4OQ0A 4RX2A 3A0RA 1JTDA 4DE2A 4MN5A 2HJ9C 4QPRA 1IKGA 1CI8A 1FIKA 2QYBA 5HFOA 3BFDA 3MF0A 1LLBA 3S7OA 3TE8A 1OTIA 2QHKA 1OPXA 1K56A 2YKHA 1VQQA 4I3IA 1S0WA 5F5YA 2FFFB 4IBRA 4K91A 5TFQA 1Z09A 1GHIA 5EE8A 4LCLA 3CMZA 2R9WA 3UNWA 5EVIC 1STZA 3LY3A 2ZC6B 3MKFA 3FV7A 3SOIA 5FQMA 4XT2B 3Q07A 1ZG6A 1OJ5A 2JKTM 2ZQ9A 1TEMA 3C30A 3U4LP 4CLCB 1M6KA 4E3MA 5KIZA 1BTLA 3FZCA 1MZUA 1XX2A 3G6OA 1GSVA 4HESA 3ZDJA 3BFGA 4PM9A 2W1RA 5HX9A 4NK3A 5CERA 4BD1A 3OZHA 4JXWA 3IH9A 1DRMA 1WYCA 2J3TC 1K54C 3L7HA 4L9FA 1PNEA 5CRFA 3IBRA 3V3RA 2Z2LB 3HUMA 3NHQA 1H8MA 1YLZA 1S4RA 3U2AA 4Y13A 4RYEA 2QJ5A 4YWZA 2V20A 3P09A 5BOHA 4LCMA 5L07A 5DTTA 1Q2PA 3ZG0A 4JXGA 2AVXA 1PZOA 3ZGAB 1OTEA 1L0DA 3S7PA 3SS5A 4HP4A 5TR7A 1BLPA 2O0YA 2ZOHA 3NOTC 2W3DA 1S67L 2WKHA 3LI9A 5GL9A 4F3LB 4OP8A 4DF6A 1ONHA 1BLHA 3KYEA 2XK1A 2A2LA 4OPYA 4Q0JA 2PR6A 1TD5A 4MMNA 5EVLA 2DNSA 2XFSA 3PBRA 2VLGA 1LSWA 3T1SA 2FH5A 1H5XA 1P9RA 2EFXA 2GNXA 4LPZA 5DF8A 2ACGA 1MWUA 1YPRA 1WE4A 1G28A 1ACFA 3F1PB 4UA7A 4IVKA 1HD8A 4S2OA 1W8QA 2E8IA 4KZBA 2P7JA 3OOVA 1TVFA 1PW1A 3VP1A 4GKUA 3DTEA 1WYBA 1KDSA 4BL2A 3LIBA 2JKRM 2XDMA 3UB9A 4YOFA 3AGDA 3O3VA 3ZG5A 3MQ0A 2DCFA 5CGXA 4Z1WA 3B33A 2H28A 4E3KA 1JTGA 3S22A 4MN7A 1IYSA 2DMWA 4II7A 4PM8A 3QP2A 4ETXA 1KDWA 3RFBA 4BBVA 5GHXA 2VEAA 2PYRA 1BT5A 3B3XA 1K4EA 3KSHA 2WADA 1FCNA 4X1MA 3BLSA 2XFTA 4R6LA 4WL9A 4XUZA 4DMZA 3KO6A 1PWDA 1YLTA 2EWVA 3G2ZA 2W27A 3VOZA 2ZQ8A 5HZHA 4KQOA 1F98A 5FQ9A 5FQIA 3D4FA 3QHYA 2J80A 2Q0OA 1PWGA 4DJ2A 5F68A 3F1OA 3WRTA 3CPTB 3T12B 3C7VA 5HDDA 3UO9A 3DTMA 1TS0A 2B95A 5EVID 4B9OA 1KVLA 3L9KA 3ZCZA 1G68A 3IWQA 4X1LA 4P6BA 1CEFA 3M2JA 3VV4A 1CQAA 1VM1A 5FAPA 2HZ5A 2DRWA 4Y7PA 1CI9A 3D3OA 4R3AA 1VEUB 3VMAA 4Y2FA 1WA9A 3PR6A 4JGPA 3KX0X 4EUVA 1LT0A 5I5LA 2WUQA 5AJGA 3V67A 3IT9A 3H9WA 4ETZA 4UHUA 3GTCA 2EX2A 2HDUA 3F1PA 2QJ7A 2Y2JA 5FEGA 1JWPA 3HLCA 3NCKA 3T50A 2CMNA 2Q9NA 4LV2A 5FSRA 3I7JA 3NC8A 1DP8A 2XEPA 2LB5A 3UE1A 2Y2LA 3UY6A 4FD8A 4EEUA 3QP6A 5KSCA 3CHWP 4HJ6A 3BY8A 1YMXA 3HLBA 1PIOA 2EXAA 3TW8A 2M1CA 3LR5A 4JGRA 4MBHA 1GHPA 4ZJ1A 2Z6DA 3NY4A 4EW7A 4RVAA 3VSKA 4E3JA 5J8XA 1UWPX 2J3WA 3BM6A 1K57C 2ZC3B 1ZG4A 1Z6FA 2PT7A 5M18A 3UE3A 4PHTA 3VFFA 1QMFA 3EQUA 4CQHA 3Q81A 3PYPA 4KQRA 3VOLA 3IF5A 3DTKA 4ZRRA 1ERQA 4KZ4A 5DJUA 1EW0A 1D7EA 3BWLA 3MS6A 4KQDA 3ZG8B 3MXQA 4ESPA 1SKOA 1XKZA 5GLCA 3F1NB 5GLAA 3F1OB 4WUJA 3CLOA 1BSGA 5L8MA
chains in the Genus database with same CATH topology
3CI6A 1H3QA 1YSPA 2NUPC 3A0RA 3NOUC 1DP9A 2XRNA 4MN5A 2HJ9C 5TJJA 3P7NA 4QPRA 3BQ8A 2QYBA 5HDSA 5HWTA 2ZMVA 2JHEA 2W3GA 2D02A 3F1NA 1V9ZA 4EESA 3MF0A 5FL3A 4XT2A 5J3WA 2W1TB 3CWFA 2W3FA 3S7OA 3TE8A 1OTIA 2QHKA 3D72A 1OPXA 3FC7A 4I3JA 2YKHA 3H82B 5KSHA 3LUQA 3W2ZA 2PD7A 4I3IA 5F5YA 1VB6A 5HSQA 2KOIA 1OTBA 3EGDC 1JNUA 4HHDA 3LIEA 2GX5A 4HP9A 3EEAA 3LR4A 1F5MA 2V1BA 2VA0A 1W63Q 1D06A 2OAP1 1STZA 3LIFA 1TS8A 1S1YA 4HIAA 4HOIA 3EWKA 4XT2B 4NXBA 2VGLS 1TS7A 1OJ5A 4HI4A 3LICA 2JKTM 4GS9A 3C30A 2P08A 5C5KA 3ULFA 4CLCB 1GSWA 3EOIA 5KIZA 4RQ9A 1MZUA 4Q0HA 3E4OA 3R7WA 1DP6A 4BBUA 2BASA 3G6OA 4Q0IA 4OOLA 1GSVA 2P04A 4HH3A 4PAUA 3MFXA 5IS1A 2W1RA 3H82A 4EXOA 1V9YA 2A24B 1LSXA 4MN6A 1Y28A 1NLYA 4LLOB 2Y79A 4ME4A 5F69A 2L0WA 3DBAA 1DRMA 2J3TC 2V0UA 3NJAA 4L9FA 3EQVA 4EEPA 1OT6A 3IBRA 1IFQA 2W0NA 4IHQA 3NHQA 3T4JA 2B02A 1H8MA 1XJ3A 4BWIA 3JVVA 4L0LA 1S4RA 3OC2A 1XJ4A 3U2AA 2KLIA 3PXPA 4Y5FA 2QJ5A 3E98A 4YWZA 3HJKA 4IUHA 3S7NA 3ZYTA 5J4EA 5K5BA 1OJGA 4ARZA 3BQAA 4NXEA 4WF0A 3T4SA 4IUKA 4BJPA 3KSFA 4NXGA 4P6ZM 3UMDA 4AFIA 1OTEA 3S7PA 4HP4A 3LR0A 2PDRA 2O0YA 3PBNA 3NOTC 2ZOHA 2W3DA 1S67L 3LI9A 3KSIA 1GSXA 2K31A 3RH8B 4B93A 4F3LB 3MJQA 1N9NA 3BW6A 4I3AA 2A24A 4DJ3A 2A2LA 3ICYA 4Q0JA 2PR6A 1TD5A 4MMNA 4F3LA 1ZTUA 2ZOIA 4KUOA 1XJ6A 3PBRA 2VLGA 2D01A 1LSWA 2MJ6A 4CLCE 1G6OA 2FH5A 3RTYA 4GW9A 1P9RA 3EGXC 4G3WA 2GNXA 4M4XA 1IOUA 4GJ4A 5J7EA 2XA7S 2OAQ1 3T4LA 4R70A 3TRCA 4LPZA 1NLZA 1P0ZA 2INWA 1TF1A 2VGLM 1G28A 3F1PB 2V0WA 4PKYG 5HPFA 4UEYA 2XA7M 4GCZA 2P7JA 3GECA 3OOVA 4K08A 5AVEA 3CUEA 1N9OA 3R4KA 5HWVA 2VJWA 3PHYA 3CUEC 4R38A 2XSSA 3LIBA 5TBMA 2JKRM 3T4QA 3B47A 3UB9A 4WN5A 4YOFA 3PBTA 2IA2A 4H6JB 1S66L 2O9AA 2GZAA 4LRZE 3OCNA 4FSFA 1X0OA 3E0YA 2OWJA 3E4PA 4ARZB 4O01A 3MQ0A 2I9VA 3T4OA 2QWSA 4Z1WA 2PD8A 3B33A 2EA9A 4WLAA 3EEHA 1ODVA 3ZQ5A 4G3KA 3FG8A 2H28A 5DJTA 1VHMA 3C2WA 2PYPA 3LYXA 3VE4A 4JGOA 3GDIA 4GHIB 3MMHA 4MN7A 1T18A 2DMWA 4FOFA 2HJEA 4MDZA 2O9BA 4II7A 5HD3A 2B18A 2L1MA 2QKPA 4ETXA 4LRYC 3RFBA 4BBVA 5G4YA 3SW1A 2VEAA 2PYRA 3KSHA 2OOLA 4PKYA 3BY9A 2V9AA 1OTAA 4R6LA 4WL9A 4DMZA 3KO6A 5CX7A 2EWVA 3IS2A 2W27A 3T4KA 5HZHA 2KDKA 2JKRI 1UWNX 1T1BA 4NXFA 4I38A 4KQOA 1LL8A 3H7WA 1F98A 3CAXA 1P97A 3P01A 4WEJA 5TBMB 3MQQA 3UB7A 2J80A 2XROA 2GJ3A 4UQIM 3A0VA 4CLCA 4L9GA 4DJ2A 5F68A 2W3HA 4EQ1A 3FPWA 2O9CA 3LI8A 3F1OA 1XFQA 5HPIA 4HY8A 2O99A 1KOUA 4OOMA 3PBQA 3IBJA 5HDDA 4HJ3A 1OTDA 4P6ZS 4CLCC 1TS0A 5DFYA 3C8CA 5MC7A 4G3VA 4NEED 4B9OA 2EWWA 2K7SA 2J3TD 2NUTC 3KSGA 2V1AA 4IJGA 4NKPA 3MR0A 5HDCA 2KX6A 1MKMA 3T4TA 2VX8A 2JKTI 2W1TA 3VV4A 3OCLA 3C38A 4Y3IA 4GHIA 4HNBA 5IU1A 2K2NA 3UE6A 3NOPC 2YKFA 4HQAA 3D3OA 4R3AA 4Y2FA 4BMWA 4O8GA 1WA9A 2PR5A 3E4QA 2Z6CA 4UQIS 2ZBBA 3BJNA 3HCYA 3JVUA 3PR6A 1T1CA 1NRJA 4JGPA 1BYWA 2R78A 3K3CA 4L9EA 3KX0X 4EUVA 1LT0A 1YKDA 3FPVA 5I5LA 2VKSA 5AJGA 3V67A 3H9WA 4ETZA 4I5SA 4BBTA 3K3DA 2M7UA 3LIDA 3TJZC 1T19A 2VV6A 5G4ZA 3F1PA 3HJIA 2Y8HA 5HWWA 1W63M 2QJ7A 5F6AA 4CLCD 4GLQA 4DN0A 3R7WB 2WKPA 5DKKA 1XJ2A 3T50A 4E04A 1LSVA 2CMNA 1ZHHB 4EERA 2WKRA 3KYQA 1S1ZA 1P9WA 3S7QA 3LFVA 4EU0A 1DP8A 4O0PA 4HH2A 2LB5A 4H6JA 1F9IA 1TS6A 3UMEA 2WKQA 5IT5A 4EEUA 2G7UA 4EETB 1T1AA 4HJ6A 3LR3A 3O5YA 1YSQA 3BY8A 2FZ0A 1S4SA 3OBFA 3CITA 2OWHA 5DKLA 3TW8A 2M1CA 3LR5A 3PBSA 4WELA 2VV8A 2HV1A 4JGRA 1NWZA 1MC0A 3KYZA 2JN7A 2ZMFA 3A0SA 4I39A 2Z6DA 4EW7A 4LRXC 4YNRA 2HGVA 5AVFA 2HF6A 1UWPX 2J3WA 5DFXA 1XFNA 2L4RA 4KUKA 2PT7A 3VE3A 3UB8A 3UE3A 2VZWA 4PHTA 1YAXA 3EQUA 4CQHA 5HD5A 5HL6A 3PYPA 1UGUA 5EFWA 3VOLA 3UB6A 3OLOA 4ZRRA 1N9LA 3B42A 5DJUA 1EW0A 4MCWA 2W3EA 1D7EA 3H7WB 3BWLA 4JGQA 4WEKA 4KQDA 3PBOA 3MXQA 5DF9A 2LB9A 4HJ4A 5A8BA 3MQOA 3F1NB 3IS2B 3LIAA 2M7VA 3F1OB 4WUJA 2PHYA 2VV7A 5LBRA 3CLOA 3K2NA 5L8MA 4GS9B 1OT9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VKS A;  5AJG A;  4Y5F A;  3ZQ5 A;  3E98 A;  4G3K A;  4IUH A;  3CI6 A;  3S7N A;  4ETZ A;  1YSP A;  1VHM A;  3C2W A;  5K5B A;  3NOU C;  2M7U A;  2XRN A;  4MN7 A;  3MMH A;  2Y8H A;  4IUK A;  4FOF A;  3KSF A;  4MDZ A;  5TJJ A;  4QPR A;  2O9B A;  2B18 A;  2QYB A;  4GLQ A;  4DN0 A;  4ETX A;  4LRY C;  3RFB A;  2W3G A;  2VEA A;  4E04 A;  3S7P A;  3MF0 A;  3KSH A;  2OOL A;  2W1T B;  3S7O A;  2W3F A;  2O0Y A;  3NOT C;  2W3D A;  3S7Q A;  4R6L A;  3LFV A;  3KO6 A;  4DMZ A;  4EU0 A;  3W2Z A;  4O0P A;  3KSI A;  5HSQ A;  2K31 A;  2KOI A;  2LB5 A;  2GX5 A;  3EEA A;  1F5M A;  2G7U A;  4Q0J A;  3O5Y A;  1TD5 A;  4MMN A;  1YSQ A;  1ZTU A;  1STZ A;  3CIT A;  3OBF A;  2XRO A;  2W3H A;  2O9C A;  4GW9 A;  5HPI A;  4G3W A;  2O99 A;  1MC0 A;  4R70 A;  3TRC A;  2ZMF A;  3IBJ A;  4LRX C;  4YNR A;  2HGV A;  1TF1 A;  5DFY A;  5DFX A;  5C5K A;  4G3V A;  4RQ9 A;  4Q0H A;  5HPF A;  3G6O A;  4Q0I A;  2VZW A;  4PAU A;  3OOV A;  4CQH A;  3KSG A;  5HL6 A;  4IJG A;  3R4K A;  2W1R A;  2VJW A;  1MKM A;  2XSS A;  2Y79 A;  2W1T A;  3VV4 A;  4ME4 A;  4ZRR A;  4Y3I A;  2K2N A;  3DBA A;  4MCW A;  2W3E A;  4YOF A;  3NOP C;  2IA2 A;  3D3O A;  2O9A A;  4LRZ E;  3IBR A;  2LB9 A;  4Y2F A;  4O8G A;  3E0Y A;  3NHQ A;  3BJN A;  3HCY A;  3MQ0 A;  4O01 A;  2M7V A;  4Z1W A;  5LBR A;  4BWI A;  3K2N A;  5L8M A;  4EUV A;  1YKD A;  2KLI A;  5I5L A; 
#chains in the Genus database with same CATH topology
 3CJM A;  4S2N A;  2V8C A;  1HTZ A;  5FI2 A;  1H3Q A;  1YSP A;  5I94 A;  2PU4 A;  2CC1 A;  2VK3 A;  1ZC2 A;  5JYO A;  2BLS A;  5TJJ A;  3BQ8 A;  4R3B A;  2QPN A;  5HWT A;  3F1N A;  3AGE A;  5FL3 A;  5CEC A;  2W3F A;  4FH4 A;  3H82 B;  5KSH A;  4R23 A;  3W2Z A;  2PD7 A;  2G2W A;  3VP0 A;  1OTB A;  1JNU A;  4QD4 A;  4Z9Q A;  5FEF A;  2GX5 A;  4KZ8 A;  3EEA A;  2J9P A;  4GZB A;  2V1B A;  3A3E A;  5DVA A;  1FSW A;  3HLD A;  2WGW B;  2WGV A;  1TS8 A;  4JLF A;  4KZ6 A;  5FAS A;  1S1Y A;  4E6W A;  4BQM A;  4HI4 A;  2ZMA A;  4R1G A;  3N7W A;  3EOI A;  3E4O A;  1DP6 A;  4BBU A;  1GA0 A;  2BAS A;  4Q0I A;  4HH3 A;  4PAU A;  4GOG A;  2Y91 A;  1V9Y A;  2WYX A;  4DDS A;  1LSX A;  1Y28 A;  1RGY A;  5F69 A;  3SH9 A;  4KG2 A;  3FWL A;  3E2L A;  4PPR A;  1C3B A;  1XP4 A;  5FA7 A;  3QP4 A;  1GA9 A;  1NXY A;  3T4J A;  1RP5 A;  4IHQ A;  2B02 A;  3C5A A;  2WAF A;  4L0L A;  2KLI A;  3PXP A;  3HJK A;  3S7N A;  4LV3 A;  3ZYT A;  3N8S A;  4LV1 A;  1PFL A;  4ARZ A;  2BTF P;  4NXE A;  3T4S A;  4IUK A;  2P9V A;  3KSF A;  2WZX A;  4NXG A;  4PM6 A;  3GV9 A;  3UE0 A;  3UMD A;  3BEC A;  2PDR A;  2Y2Q A;  3M2K A;  1EWZ A;  1MWR A;  4EQI A;  1SDN A;  3W8K A;  2K31 A;  1ESI A;  1MXO A;  1MY8 A;  3V3S A;  5F82 A;  3UDI A;  2FFY A;  5FAO A;  5EOO A;  4WZ5 C;  1ZTU A;  1XJ6 A;  2WK0 A;  2D01 A;  3IF6 C;  4CLC E;  3S4X A;  1XA7 A;  4GJ4 A;  2OLV A;  2XA7 S;  2H0Y A;  3TRC A;  4LFU A;  1NLZ A;  4C75 A;  2INW A;  2VGL M;  3ZNY A;  2IWB A;  3HLE A;  2V0W A;  5HPF A;  3IH8 A;  4GCZ A;  4FCF A;  3E2K A;  3CUE A;  4DE1 A;  1I2S A;  2V2F F;  1N9O A;  3NIA A;  3QP8 A;  3G30 A;  3PHY A;  5E2F A;  4LEN A;  5HAI A;  5TBM A;  3IWO A;  3MFD A;  4EBN A;  3PBT A;  4H6J B;  1S66 L;  2GZA A;  4LRZ E;  4HEF A;  1FCO A;  3E0Y A;  4KZ3 A;  1K57 A;  2I9V A;  1XPB A;  3T4O A;  4MEZ A;  2QWS A;  2PD8 A;  4WLA A;  3EEH A;  4G3K A;  3FG8 A;  4X68 A;  3IXH A;  4OQG A;  3C2W A;  2PYP A;  2EFU A;  4JXS A;  3LYX A;  3WS5 A;  4JGO A;  4EV4 A;  5L09 A;  1ES5 A;  3BRM A;  3MMH A;  3IHB A;  2HJE A;  4FH2 A;  3WS4 A;  2L1M A;  2XQZ A;  1AWI A;  2B5R A;  1KE0 A;  3ITA A;  2OOL A;  1DJC A;  3M6H A;  3BY9 A;  3VP3 A;  1PW8 A;  4DDY A;  3IQA A;  3IS2 A;  2ZQD A;  1UWN X;  2Y2O A;  5EM1 A;  4NXF A;  1YLP A;  2XGN A;  1LL8 A;  3H7W A;  3CAX A;  3P01 A;  4OP5 A;  3MQQ A;  4DE3 A;  3LO7 A;  1XGI A;  4WZ4 A;  4NET A;  3G35 A;  5FDH A;  4BLM A;  2W3H A;  3DW0 A;  3LI8 A;  3S1Y A;  1DY6 A;  1KOU A;  1ERM A;  3C7U A;  1FQG A;  1NJ4 A;  2HP5 A;  3IBJ A;  3O86 A;  4HJ3 A;  1OTD A;  2P9V B;  4P6Z S;  1E4D A;  2Y2H A;  4P0M A;  4Y15 A;  2JC7 A;  4N9L A;  5EOE A;  2JKF A;  2EX8 A;  4E3O A;  1DJA A;  5FI7 A;  2Y55 A;  2KX6 A;  4S2M A;  3VSL A;  2W1T A;  1BUE A;  5IHV A;  1VEU A;  1LL5 A;  3G32 A;  1IEL A;  2YKF A;  4OOY A;  3JVU A;  5D3O A;  2R78 A;  3UPO A;  5EPH A;  3FPV A;  1IYP A;  3VP4 A;  2WGW A;  3LID A;  1T19 A;  2HP9 A;  2VV6 A;  4Q8I A;  5HAP A;  3JYI A;  4JF4 A;  1I5Q A;  5JYP A;  4GLQ A;  5AQA A;  3R7W B;  1BLS A;  1K54 A;  2H5S A;  1XJ2 A;  3PAG A;  1RGZ A;  4MLL A;  2WKR A;  1S1Z A;  1OME A;  2G2U A;  3HUO A;  4NG2 A;  4EU0 A;  4U0T A;  4HH2 A;  4H6J A;  1M40 A;  2WKQ A;  2PU2 A;  5IT5 A;  5FQQ A;  2HDQ A;  4QY6 A;  4ZDX A;  4UA9 A;  4QWO A;  3FYZ A;  3P98 A;  3HLG A;  4JF6 A;  2FZ0 A;  1S4S A;  3CIT A;  5DKL A;  4GDB A;  3DWK A;  3WS1 A;  2VV8 A;  1GHM A;  3V39 A;  3A0S A;  3NI9 A;  5AQ7 A;  3BFE A;  4YNR A;  3GVB A;  1VET A;  1XFN A;  2L4R A;  1FOF A;  2PBY A;  4KUK A;  5DTK A;  1YAX A;  3MXS A;  1SKF A;  4DRT A;  4U0X A;  2Y4A A;  5F1F A;  5HL6 A;  4DXB A;  5EFW A;  5CHJ A;  1XXM A;  3C4O A;  1TDL A;  4MCW A;  2W3E A;  3H7W B;  1YQS A;  1AXB A;  2WGI A;  5DF9 A;  4P85 A;  2LB9 A;  5A8B A;  2Y2I A;  3IS2 B;  3LIA A;  4F94 A;  3UPN A;  2PHY A;  4C6Y A;  3HVF A;  1MWT A;  4JF5 A;  4X53 A;  1ERO A;  5L10 A;  3ITB A;  1DP9 A;  2XRN A;  3SS4 A;  2QMI A;  4P87 A;  1DJB A;  4S2J A;  4K0X A;  2PAV P;  5FQJ A;  2JKG A;  2RL3 A;  2HP6 A;  1SCW A;  2ZMV A;  2JHE A;  1A0K A;  2D02 A;  1V9Z A;  3UN7 A;  2W1T B;  3CWF A;  4QY5 A;  4I3J A;  4IBX A;  4S2I A;  3LUQ A;  3VOY A;  4E6X A;  2ZQC A;  1VB6 A;  2KOI A;  3BLM A;  3A3F A;  4HHD A;  3LR4 A;  1HZO A;  2VA0 A;  1W63 Q;  3AGF A;  2OAP 1;  3TOI A;  3LIF A;  4X55 A;  4ID4 A;  3EWK A;  3Q7Z A;  4NXB A;  1SKO B;  3C4P A;  1L0F A;  5FQK A;  3LIC A;  3IF6 B;  4UA6 A;  2QZ6 A;  1VET B;  5C5K A;  1GSW A;  4XXR A;  3W4O A;  4RQ9 A;  4Q0H A;  3R7W A;  1ES2 A;  3ZNT A;  3G31 A;  1Y54 A;  4OOL A;  1PYY A;  2P04 A;  3G34 A;  3CZD A;  4E3N A;  1ES3 A;  1H8Y A;  5IS1 A;  3H82 A;  2OSU A;  4MN6 A;  2Y79 A;  2ZD8 A;  4ME4 A;  1RCJ A;  4ZAM A;  3OPH A;  2V0U A;  3NJA A;  3EQV A;  4ZJ3 A;  1OT6 A;  3BYD A;  2W0N A;  1N9B A;  4KZ9 A;  1XJ3 A;  4S2N C;  4BWI A;  3JVV A;  3D9Y A;  3OC2 A;  1XJ4 A;  1BLC A;  4B4Z A;  4EBL A;  4DXC A;  4QB8 A;  4CPK A;  3BQA A;  4WF0 A;  4GB7 A;  4P6Z M;  4HBU A;  1XGJ A;  2Y59 A;  4LV0 A;  5EV0 A;  2X02 A;  1GCE A;  4B4X A;  1G6A A;  5CXW A;  4D60 A;  4B93 A;  1LHY A;  1N9N A;  3BW6 A;  3WWX A;  5GLD A;  4DJ3 A;  3ICY A;  3BEB A;  2ZOI A;  4Y0U A;  4N1X A;  2MJ6 A;  3RTY A;  4GW9 A;  3QNB A;  3EGX C;  3SZT A;  4G3W A;  3NDG A;  4M4X A;  1IOU A;  4OLG A;  5J7E A;  1KE3 A;  2OAQ 1;  3T4L A;  4EBP A;  5KZH A;  5KMW A;  3TSG A;  5GLB A;  4MBK A;  1TF1 A;  4PKY G;  3ZHH A;  3N4I A;  5E43 A;  2Q9M A;  3GEC A;  5AVE A;  4K08 A;  3LGO A;  5CHU A;  4R38 A;  3CG5 A;  2XSS A;  1K4F A;  4WBG A;  1EI5 A;  4E3L A;  1LI0 A;  1K25 A;  5L2F A;  1FR1 A;  4LGW A;  2O9A A;  5HW3 A;  3OCN A;  1X0O A;  2OWJ A;  4ARZ B;  5A90 A;  4FTX A;  1MKI A;  2EA9 A;  1ODV A;  4Y17 A;  5EM0 A;  3ZQ5 A;  3UDX A;  4X56 A;  5DJT A;  4MNR A;  3GDI A;  1PI4 A;  1T18 A;  4FOF A;  1FCM A;  4MDZ A;  4JXV A;  2B18 A;  5HD3 A;  2QKP A;  2WAE A;  4LRY C;  3HLF A;  3SW1 A;  2VGJ A;  3IXG A;  1NYY A;  3A3D A;  3W4Q A;  2XD5 A;  4PKY A;  1IEM A;  3UPP A;  3LEZ A;  4U3T A;  1OTA A;  2E8J A;  5CX7 A;  3HBR A;  3IX8 A;  5A91 A;  2KDK A;  4I38 A;  1K6R A;  1NYM A;  3V50 A;  5TBM B;  4C3Q A;  2XRO A;  2GJ3 A;  3A0V A;  4EQ1 A;  1XFQ A;  5HPI A;  3ZVW A;  4HY8 A;  2J7V A;  3PBQ A;  3SS3 A;  3QP5 A;  1CK3 A;  3C8C A;  1KVM A;  5MC7 A;  2VGK A;  4KQQ A;  4NEE D;  2EWW A;  2ZL1 A;  2K7S A;  2WKE A;  2ZM8 A;  1FSY A;  4R0Q A;  2NUT C;  4HBT A;  5CEB A;  2BG1 A;  2VX8 A;  2JKT I;  3IXD A;  3C38 A;  4GHI A;  3G4P A;  4HNB A;  1W5D A;  3GR2 A;  3PTE A;  3NOP C;  2X71 A;  3O88 A;  4BMW A;  5EVE A;  2PR5 A;  3E4Q A;  2UWX A;  2Z6C A;  4UQI S;  2ZBB A;  3BJN A;  3HCY A;  1NRJ A;  2WZZ A;  3W4P A;  3N6I A;  4M3K A;  4L9E A;  1KGG A;  2XLN A;  4UAA A;  3MZF A;  4KZ7 A;  3TJZ C;  2JE5 A;  5G4Z A;  1YLJ A;  5E2G A;  5HWW A;  5AQB A;  1W63 M;  4DN0 A;  1CEG A;  3NBL A;  5DKK A;  1LSV A;  3O87 A;  1IYQ A;  3IX4 A;  3UDF A;  1P9W A;  2RCX A;  3A3I A;  3LFV A;  5EEC A;  4X6T A;  3NUL A;  1F9I A;  1TS6 A;  3UME A;  4OON A;  4R3J A;  4EET B;  2I72 A;  2H0T A;  3LR3 A;  1N4O A;  1YSQ A;  1PWC A;  1SZV A;  4EUZ A;  3T1R A;  1O07 A;  2HV1 A;  3ZFZ A;  3LY4 A;  1NWZ A;  1MC0 A;  3OPR A;  3KYZ A;  1K0K A;  2ZMF A;  4I39 A;  1L0G A;  2PRF A;  1NRF A;  5AVF A;  2HF6 A;  1JWV A;  1BZA A;  3V5M A;  4PM7 A;  3NDE A;  3BFF A;  4IED A;  2OV5 A;  5A93 A;  1XA1 A;  4DE0 A;  4GD6 A;  3IHA A;  1U60 A;  1NZO A;  3ZVT A;  3MSH A;  3OLO A;  3LEQ A;  4YIN A;  3TG9 A;  4KZ5 A;  1D1J A;  5GHZ A;  4JGQ A;  4WEK A;  3HUN A;  3T1X A;  2ZLY A;  1F2K A;  2M7V A;  3ZG7 B;  5LBR A;  4GS9 B;  3MBZ A;  1S6R A;  1OT9 A;  1L0E A;  4DKI A;  1BUL A;  4RX3 A;  4IVI A;  3CI6 A;  3JPU A;  2JBF A;  2NUP C;  2Y2P A;  3NOU C;  4GNU A;  1CJF A;  4PM5 A;  1ZKJ A;  1QME A;  1W8Y A;  3P7N A;  4WZ5 A;  2EX6 A;  4WMC A;  1SDE A;  2UV0 E;  5HDS A;  2W3G A;  3ISG A;  4EES A;  4XT2 A;  4OPR A;  5J3W A;  4OH0 A;  3D72 A;  3FC7 A;  1PRQ A;  4WMC D;  5CED A;  5HSQ A;  3EGD C;  3LIE A;  4HP9 A;  5TGF A;  1K55 C;  3VP2 A;  1F5M A;  5HL1 A;  1K56 D;  1D06 A;  4O7D A;  4RA7 A;  2ZJ9 A;  5E2H A;  2ZC5 B;  4OLD A;  1MBL A;  5HAR A;  4HIA A;  4HOI A;  3IF6 A;  3CPT A;  4N9K A;  2VGL S;  4QHC A;  5EVI A;  1TS7 A;  5CHM A;  2HPB A;  2JCH A;  4GS9 A;  3MZD A;  2P08 A;  4JBF A;  3ULF A;  3T1Q B;  1E3U D;  2ZQA A;  5A92 A;  3MFX A;  4EXO A;  3FKW A;  2A24 B;  2Y2M A;  3UB5 P;  1NLY A;  3SH7 A;  4LLO B;  4BEN A;  4OVD A;  2L0W A;  2WKI A;  2HDR A;  3DBA A;  1LI9 A;  5F83 A;  4EEP A;  1IFQ A;  1YMS A;  3MZE A;  1J9M A;  5FAQ A;  5FAT A;  2Y2G A;  4JKT A;  2V1Z A;  5M19 A;  4E3I A;  4Y5F A;  2OLU A;  3OPP A;  4X69 A;  3E98 A;  4YFM A;  4IUH A;  2R9X A;  5J4E A;  5K5B A;  1OJG A;  5DF7 A;  5GHY A;  4KEN B;  4BJP A;  1ESU A;  1YT4 A;  4OKP A;  3WS2 A;  1ES4 A;  1L3L A;  2A3U A;  4AFI A;  1Q2Q A;  2A49 A;  3LR0 A;  2J9O A;  4MBF A;  3PBN A;  5FI6 A;  1NZU A;  4XUX A;  3MXR A;  3KSI A;  1GSX A;  3RH8 B;  4BL3 A;  3MJQ A;  4I3A A;  4R4R A;  2A24 A;  1E3U A;  4F3L A;  4KUO A;  1G6O A;  1K55 A;  3BFC A;  3HRE A;  3QP1 A;  4R70 A;  2P74 A;  1HVB A;  1P0Z A;  2PBD P;  4QU3 A;  3VFH A;  4KG5 A;  4B88 A;  4UEY A;  5U47 A;  3RXW A;  2XA7 M;  3WRZ A;  4N1H A;  1HLU P;  2ZC7 A;  1TDG A;  5HAQ A;  3R4K A;  4EWF A;  5HWV A;  2VJW A;  3CUE C;  1YLW A;  3DWZ A;  1SHV A;  2Z2M B;  3T4Q A;  3B47 A;  4WN5 A;  4KG6 A;  2IA2 A;  2EX9 A;  4FSF A;  5F1G A;  4OQH A;  2XD1 A;  3E4P A;  1W7F A;  4O01 A;  3IX3 A;  2H10 A;  2XF3 A;  4GD8 A;  3Q82 A;  2J8Y A;  1G5U A;  3A3J A;  1IYO A;  1O7E A;  1VHM A;  5CTN A;  3DAV A;  1FIL A;  3VE4 A;  5E2E A;  4GHI B;  1K38 A;  4K0W A;  2O9B A;  3GSG A;  5CTM A;  5G18 A;  2C6W B;  3LCE A;  5G4Y A;  3ZG9 B;  5DTS A;  3N8R A;  4KZA A;  2V9A A;  3NEC A;  1JVJ A;  3T4K A;  2JKR I;  2ZM0 A;  2C5W B;  1T1B A;  3IXB A;  3N8L A;  3GMW A;  1P97 A;  4WEJ A;  2EXB A;  2HDS A;  1IKI A;  3UB7 A;  3OPL A;  2XR0 A;  4UQI M;  4CLC A;  4L9G A;  3FPW A;  2O9C A;  3RXX A;  4JPM A;  2O99 A;  4OOM A;  4Y0T A;  3GQZ A;  4Y0O A;  4CLC C;  3M6B A;  5DFY A;  4G3V A;  4GN2 A;  1CF0 A;  2J3T D;  4WYY A;  3DTI A;  2ZM2 A;  3KSG A;  2V1A A;  4IJG A;  4NKP A;  3MR0 A;  5HDC A;  4H8R A;  1MKM A;  3PAE A;  3T4T A;  3RJU A;  1KGE A;  4S2K A;  3OCL A;  4Y3I A;  4QJG A;  1MPL A;  5IU1 A;  2K2N A;  3UE6 A;  3MKE A;  1ALQ A;  4CJN A;  1LL9 A;  4HQA A;  1PI5 A;  4O8G A;  2ZC4 B;  4PMA A;  5FDS A;  2IWC A;  1T1C A;  1BYW A;  4S2L A;  3K3C A;  2V8F A;  1YKD A;  1KGF A;  1YM1 A;  2VKS A;  3QNC A;  5CGS A;  4OPZ A;  4I5S A;  3HL9 A;  4BBT A;  3Q7V A;  3K3D A;  2M7U A;  3HJI A;  2Y8H A;  1K6S A;  3WS0 A;  4GDN A;  5F6A A;  4CLC D;  5EVI B;  2WKP A;  1YLY A;  3Q1F A;  1H0M A;  4E04 A;  4R4S A;  1L2S A;  2Y2K A;  4ZJ2 A;  1ZHH B;  4EER A;  3KYQ A;  4FUW A;  3S7Q A;  5EUA A;  3IWI A;  4O0P A;  4D2O A;  2G7U A;  1T1A A;  3O5Y A;  3HLW A;  3G2Y A;  3OBF A;  2OWH A;  3SH8 A;  4A5R A;  1Y4O A;  1MWS A;  2Y2N A;  2ZL1 B;  3PBS A;  4WEL A;  1E25 A;  5AQ9 A;  2JN7 A;  1KE4 A;  4ZBE A;  4OQI A;  1JWZ A;  4OPQ A;  4LRX C;  2HGV A;  5DFX A;  2ZQ7 A;  3GRJ A;  3VE3 A;  3UB8 A;  2VZW A;  3Q7V B;  2IWD A;  4ZTK A;  1J3W A;  5HD5 A;  1UGU A;  1I2W A;  4S2P A;  1PZP A;  3UB6 A;  5M1A A;  2GDN A;  3FKV A;  1W79 A;  1N9L A;  3B42 A;  2XH9 A;  4X25 A;  3PBO A;  1ONG A;  4HJ4 A;  3MQO A;  2X01 A;  1NY0 A;  1H8Z A;  5CGW A;  2VV7 A;  3K2N A;  4WM9 A;  1FR6 A;  4BD0 A;  4N92 A;  4OQ0 A;  4RX2 A;  3A0R A;  1JTD A;  4DE2 A;  4MN5 A;  2HJ9 C;  4QPR A;  1IKG A;  1CI8 A;  1FIK A;  2QYB A;  5HFO A;  3BFD A;  3MF0 A;  1LLB A;  3S7O A;  3TE8 A;  1OTI A;  2QHK A;  1OPX A;  1K56 A;  2YKH A;  1VQQ A;  4I3I A;  1S0W A;  5F5Y A;  2FFF B;  4IBR A;  4K91 A;  5TFQ A;  1Z09 A;  1GHI A;  5EE8 A;  4LCL A;  3CMZ A;  2R9W A;  3UNW A;  5EVI C;  1STZ A;  3LY3 A;  2ZC6 B;  3MKF A;  3FV7 A;  3SOI A;  5FQM A;  4XT2 B;  3Q07 A;  1ZG6 A;  1OJ5 A;  2JKT M;  2ZQ9 A;  1TEM A;  3C30 A;  3U4L P;  4CLC B;  1M6K A;  4E3M A;  5KIZ A;  1BTL A;  3FZC A;  1MZU A;  1XX2 A;  3G6O A;  1GSV A;  4HES A;  3ZDJ A;  3BFG A;  4PM9 A;  2W1R A;  5HX9 A;  4NK3 A;  5CER A;  4BD1 A;  3OZH A;  4JXW A;  3IH9 A;  1DRM A;  1WYC A;  2J3T C;  1K54 C;  3L7H A;  4L9F A;  1PNE A;  5CRF A;  3IBR A;  3V3R A;  2Z2L B;  3HUM A;  3NHQ A;  1H8M A;  1YLZ A;  1S4R A;  3U2A A;  4Y13 A;  4RYE A;  2QJ5 A;  4YWZ A;  2V20 A;  3P09 A;  5BOH A;  4LCM A;  5L07 A;  5DTT A;  1Q2P A;  3ZG0 A;  4JXG A;  2AVX A;  1PZO A;  3ZGA B;  1OTE A;  1L0D A;  3S7P A;  3SS5 A;  4HP4 A;  5TR7 A;  1BLP A;  2O0Y A;  2ZOH A;  3NOT C;  2W3D A;  1S67 L;  2WKH A;  3LI9 A;  5GL9 A;  4F3L B;  4OP8 A;  4DF6 A;  1ONH A;  1BLH A;  3KYE A;  2XK1 A;  2A2L A;  4OPY A;  4Q0J A;  2PR6 A;  1TD5 A;  4MMN A;  5EVL A;  2DNS A;  2XFS A;  3PBR A;  2VLG A;  1LSW A;  3T1S A;  2FH5 A;  1H5X A;  1P9R A;  2EFX A;  2GNX A;  4LPZ A;  5DF8 A;  2ACG A;  1MWU A;  1YPR A;  1WE4 A;  1G28 A;  1ACF A;  3F1P B;  4UA7 A;  4IVK A;  1HD8 A;  4S2O A;  1W8Q A;  2E8I A;  4KZB A;  2P7J A;  3OOV A;  1TVF A;  1PW1 A;  3VP1 A;  4GKU A;  3DTE A;  1WYB A;  1KDS A;  4BL2 A;  3LIB A;  2JKR M;  2XDM A;  3UB9 A;  4YOF A;  3AGD A;  3O3V A;  3ZG5 A;  3MQ0 A;  2DCF A;  5CGX A;  4Z1W A;  3B33 A;  2H28 A;  4E3K A;  1JTG A;  3S22 A;  4MN7 A;  1IYS A;  2DMW A;  4II7 A;  4PM8 A;  3QP2 A;  4ETX A;  1KDW A;  3RFB A;  4BBV A;  5GHX A;  2VEA A;  2PYR A;  1BT5 A;  3B3X A;  1K4E A;  3KSH A;  2WAD A;  1FCN A;  4X1M A;  3BLS A;  2XFT A;  4R6L A;  4WL9 A;  4XUZ A;  4DMZ A;  3KO6 A;  1PWD A;  1YLT A;  2EWV A;  3G2Z A;  2W27 A;  3VOZ A;  2ZQ8 A;  5HZH A;  4KQO A;  1F98 A;  5FQ9 A;  5FQI A;  3D4F A;  3QHY A;  2J80 A;  2Q0O A;  1PWG A;  4DJ2 A;  5F68 A;  3F1O A;  3WRT A;  3CPT B;  3T12 B;  3C7V A;  5HDD A;  3UO9 A;  3DTM A;  1TS0 A;  2B95 A;  5EVI D;  4B9O A;  1KVL A;  3L9K A;  3ZCZ A;  1G68 A;  3IWQ A;  4X1L A;  4P6B A;  1CEF A;  3M2J A;  3VV4 A;  1CQA A;  1VM1 A;  5FAP A;  2HZ5 A;  2DRW A;  4Y7P A;  1CI9 A;  3D3O A;  4R3A A;  1VEU B;  3VMA A;  4Y2F A;  1WA9 A;  3PR6 A;  4JGP A;  3KX0 X;  4EUV A;  1LT0 A;  5I5L A;  2WUQ A;  5AJG A;  3V67 A;  3IT9 A;  3H9W A;  4ETZ A;  4UHU A;  3GTC A;  2EX2 A;  2HDU A;  3F1P A;  2QJ7 A;  2Y2J A;  5FEG A;  1JWP A;  3HLC A;  3NCK A;  3T50 A;  2CMN A;  2Q9N A;  4LV2 A;  5FSR A;  3I7J A;  3NC8 A;  1DP8 A;  2XEP A;  2LB5 A;  3UE1 A;  2Y2L A;  3UY6 A;  4FD8 A;  4EEU A;  3QP6 A;  5KSC A;  3CHW P;  4HJ6 A;  3BY8 A;  1YMX A;  3HLB A;  1PIO A;  2EXA A;  3TW8 A;  2M1C A;  3LR5 A;  4JGR A;  4MBH A;  1GHP A;  4ZJ1 A;  2Z6D A;  3NY4 A;  4EW7 A;  4RVA A;  3VSK A;  4E3J A;  5J8X A;  1UWP X;  2J3W A;  3BM6 A;  1K57 C;  2ZC3 B;  1ZG4 A;  1Z6F A;  2PT7 A;  5M18 A;  3UE3 A;  4PHT A;  3VFF A;  1QMF A;  3EQU A;  4CQH A;  3Q81 A;  3PYP A;  4KQR A;  3VOL A;  3IF5 A;  3DTK A;  4ZRR A;  1ERQ A;  4KZ4 A;  5DJU A;  1EW0 A;  1D7E A;  3BWL A;  3MS6 A;  4KQD A;  3ZG8 B;  3MXQ A;  4ESP A;  1SKO A;  1XKZ A;  5GLC A;  3F1N B;  5GLA A;  3F1O B;  4WUJ A;  3CLO A;  1BSG A;  5L8M A; 
#chains in the Genus database with same CATH homology
 3CI6 A;  1H3Q A;  1YSP A;  2NUP C;  3A0R A;  3NOU C;  1DP9 A;  2XRN A;  4MN5 A;  2HJ9 C;  5TJJ A;  3P7N A;  4QPR A;  3BQ8 A;  2QYB A;  5HDS A;  5HWT A;  2ZMV A;  2JHE A;  2W3G A;  2D02 A;  3F1N A;  1V9Z A;  4EES A;  3MF0 A;  5FL3 A;  4XT2 A;  5J3W A;  2W1T B;  3CWF A;  2W3F A;  3S7O A;  3TE8 A;  1OTI A;  2QHK A;  3D72 A;  1OPX A;  3FC7 A;  4I3J A;  2YKH A;  3H82 B;  5KSH A;  3LUQ A;  3W2Z A;  2PD7 A;  4I3I A;  5F5Y A;  1VB6 A;  5HSQ A;  2KOI A;  1OTB A;  3EGD C;  1JNU A;  4HHD A;  3LIE A;  2GX5 A;  4HP9 A;  3EEA A;  3LR4 A;  1F5M A;  2V1B A;  2VA0 A;  1W63 Q;  1D06 A;  2OAP 1;  1STZ A;  3LIF A;  1TS8 A;  1S1Y A;  4HIA A;  4HOI A;  3EWK A;  4XT2 B;  4NXB A;  2VGL S;  1TS7 A;  1OJ5 A;  4HI4 A;  3LIC A;  2JKT M;  4GS9 A;  3C30 A;  2P08 A;  5C5K A;  3ULF A;  4CLC B;  1GSW A;  3EOI A;  5KIZ A;  4RQ9 A;  1MZU A;  4Q0H A;  3E4O A;  3R7W A;  1DP6 A;  4BBU A;  2BAS A;  3G6O A;  4Q0I A;  4OOL A;  1GSV A;  2P04 A;  4HH3 A;  4PAU A;  3MFX A;  5IS1 A;  2W1R A;  3H82 A;  4EXO A;  1V9Y A;  2A24 B;  1LSX A;  4MN6 A;  1Y28 A;  1NLY A;  4LLO B;  2Y79 A;  4ME4 A;  5F69 A;  2L0W A;  3DBA A;  1DRM A;  2J3T C;  2V0U A;  3NJA A;  4L9F A;  3EQV A;  4EEP A;  1OT6 A;  3IBR A;  1IFQ A;  2W0N A;  4IHQ A;  3NHQ A;  3T4J A;  2B02 A;  1H8M A;  1XJ3 A;  4BWI A;  3JVV A;  4L0L A;  1S4R A;  3OC2 A;  1XJ4 A;  3U2A A;  2KLI A;  3PXP A;  4Y5F A;  2QJ5 A;  3E98 A;  4YWZ A;  3HJK A;  4IUH A;  3S7N A;  3ZYT A;  5J4E A;  5K5B A;  1OJG A;  4ARZ A;  3BQA A;  4NXE A;  4WF0 A;  3T4S A;  4IUK A;  4BJP A;  3KSF A;  4NXG A;  4P6Z M;  3UMD A;  4AFI A;  1OTE A;  3S7P A;  4HP4 A;  3LR0 A;  2PDR A;  2O0Y A;  3PBN A;  3NOT C;  2ZOH A;  2W3D A;  1S67 L;  3LI9 A;  3KSI A;  1GSX A;  2K31 A;  3RH8 B;  4B93 A;  4F3L B;  3MJQ A;  1N9N A;  3BW6 A;  4I3A A;  2A24 A;  4DJ3 A;  2A2L A;  3ICY A;  4Q0J A;  2PR6 A;  1TD5 A;  4MMN A;  4F3L A;  1ZTU A;  2ZOI A;  4KUO A;  1XJ6 A;  3PBR A;  2VLG A;  2D01 A;  1LSW A;  2MJ6 A;  4CLC E;  1G6O A;  2FH5 A;  3RTY A;  4GW9 A;  1P9R A;  3EGX C;  4G3W A;  2GNX A;  4M4X A;  1IOU A;  4GJ4 A;  5J7E A;  2XA7 S;  2OAQ 1;  3T4L A;  4R70 A;  3TRC A;  4LPZ A;  1NLZ A;  1P0Z A;  2INW A;  1TF1 A;  2VGL M;  1G28 A;  3F1P B;  2V0W A;  4PKY G;  5HPF A;  4UEY A;  2XA7 M;  4GCZ A;  2P7J A;  3GEC A;  3OOV A;  4K08 A;  5AVE A;  3CUE A;  1N9O A;  3R4K A;  5HWV A;  2VJW A;  3PHY A;  3CUE C;  4R38 A;  2XSS A;  3LIB A;  5TBM A;  2JKR M;  3T4Q A;  3B47 A;  3UB9 A;  4WN5 A;  4YOF A;  3PBT A;  2IA2 A;  4H6J B;  1S66 L;  2O9A A;  2GZA A;  4LRZ E;  3OCN A;  4FSF A;  1X0O A;  3E0Y A;  2OWJ A;  3E4P A;  4ARZ B;  4O01 A;  3MQ0 A;  2I9V A;  3T4O A;  2QWS A;  4Z1W A;  2PD8 A;  3B33 A;  2EA9 A;  4WLA A;  3EEH A;  1ODV A;  3ZQ5 A;  4G3K A;  3FG8 A;  2H28 A;  5DJT A;  1VHM A;  3C2W A;  2PYP A;  3LYX A;  3VE4 A;  4JGO A;  3GDI A;  4GHI B;  3MMH A;  4MN7 A;  1T18 A;  2DMW A;  4FOF A;  2HJE A;  4MDZ A;  2O9B A;  4II7 A;  5HD3 A;  2B18 A;  2L1M A;  2QKP A;  4ETX A;  4LRY C;  3RFB A;  4BBV A;  5G4Y A;  3SW1 A;  2VEA A;  2PYR A;  3KSH A;  2OOL A;  4PKY A;  3BY9 A;  2V9A A;  1OTA A;  4R6L A;  4WL9 A;  4DMZ A;  3KO6 A;  5CX7 A;  2EWV A;  3IS2 A;  2W27 A;  3T4K A;  5HZH A;  2KDK A;  2JKR I;  1UWN X;  1T1B A;  4NXF A;  4I38 A;  4KQO A;  1LL8 A;  3H7W A;  1F98 A;  3CAX A;  1P97 A;  3P01 A;  4WEJ A;  5TBM B;  3MQQ A;  3UB7 A;  2J80 A;  2XRO A;  2GJ3 A;  4UQI M;  3A0V A;  4CLC A;  4L9G A;  4DJ2 A;  5F68 A;  2W3H A;  4EQ1 A;  3FPW A;  2O9C A;  3LI8 A;  3F1O A;  1XFQ A;  5HPI A;  4HY8 A;  2O99 A;  1KOU A;  4OOM A;  3PBQ A;  3IBJ A;  5HDD A;  4HJ3 A;  1OTD A;  4P6Z S;  4CLC C;  1TS0 A;  5DFY A;  3C8C A;  5MC7 A;  4G3V A;  4NEE D;  4B9O A;  2EWW A;  2K7S A;  2J3T D;  2NUT C;  3KSG A;  2V1A A;  4IJG A;  4NKP A;  3MR0 A;  5HDC A;  2KX6 A;  1MKM A;  3T4T A;  2VX8 A;  2JKT I;  2W1T A;  3VV4 A;  3OCL A;  3C38 A;  4Y3I A;  4GHI A;  4HNB A;  5IU1 A;  2K2N A;  3UE6 A;  3NOP C;  2YKF A;  4HQA A;  3D3O A;  4R3A A;  4Y2F A;  4BMW A;  4O8G A;  1WA9 A;  2PR5 A;  3E4Q A;  2Z6C A;  4UQI S;  2ZBB A;  3BJN A;  3HCY A;  3JVU A;  3PR6 A;  1T1C A;  1NRJ A;  4JGP A;  1BYW A;  2R78 A;  3K3C A;  4L9E A;  3KX0 X;  4EUV A;  1LT0 A;  1YKD A;  3FPV A;  5I5L A;  2VKS A;  5AJG A;  3V67 A;  3H9W A;  4ETZ A;  4I5S A;  4BBT A;  3K3D A;  2M7U A;  3LID A;  3TJZ C;  1T19 A;  2VV6 A;  5G4Z A;  3F1P A;  3HJI A;  2Y8H A;  5HWW A;  1W63 M;  2QJ7 A;  5F6A A;  4CLC D;  4GLQ A;  4DN0 A;  3R7W B;  2WKP A;  5DKK A;  1XJ2 A;  3T50 A;  4E04 A;  1LSV A;  2CMN A;  1ZHH B;  4EER A;  2WKR A;  3KYQ A;  1S1Z A;  1P9W A;  3S7Q A;  3LFV A;  4EU0 A;  1DP8 A;  4O0P A;  4HH2 A;  2LB5 A;  4H6J A;  1F9I A;  1TS6 A;  3UME A;  2WKQ A;  5IT5 A;  4EEU A;  2G7U A;  4EET B;  1T1A A;  4HJ6 A;  3LR3 A;  3O5Y A;  1YSQ A;  3BY8 A;  2FZ0 A;  1S4S A;  3OBF A;  3CIT A;  2OWH A;  5DKL A;  3TW8 A;  2M1C A;  3LR5 A;  3PBS A;  4WEL A;  2VV8 A;  2HV1 A;  4JGR A;  1NWZ A;  1MC0 A;  3KYZ A;  2JN7 A;  2ZMF A;  3A0S A;  4I39 A;  2Z6D A;  4EW7 A;  4LRX C;  4YNR A;  2HGV A;  5AVF A;  2HF6 A;  1UWP X;  2J3W A;  5DFX A;  1XFN A;  2L4R A;  4KUK A;  2PT7 A;  3VE3 A;  3UB8 A;  3UE3 A;  2VZW A;  4PHT A;  1YAX A;  3EQU A;  4CQH A;  5HD5 A;  5HL6 A;  3PYP A;  1UGU A;  5EFW A;  3VOL A;  3UB6 A;  3OLO A;  4ZRR A;  1N9L A;  3B42 A;  5DJU A;  1EW0 A;  4MCW A;  2W3E A;  1D7E A;  3H7W B;  3BWL A;  4JGQ A;  4WEK A;  4KQD A;  3PBO A;  3MXQ A;  5DF9 A;  2LB9 A;  4HJ4 A;  5A8B A;  3MQO A;  3F1N B;  3IS2 B;  3LIA A;  2M7V A;  3F1O B;  4WUJ A;  2PHY A;  2VV7 A;  5LBR A;  3CLO A;  3K2N A;  5L8M A;  4GS9 B;  1OT9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...