5HL6A

Crystal structure of a putative gaf sensor protein from burkholderia vietnamiensis
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
158
structure length
158
Chain Sequence
ASKAELYATLAEQARSLVESEPDLIANAANFSALVYHSLDRLNWAGFYFFDGTELVVGPFQGKPACVRIALGKGVCGTAAQTRQTQVVRDVHAFPGHIACDAASESEIVVPLVAADGTLIGVWDVDSPVAARFDDEDRSGMEALCRVFVEHAWQKARD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative GAF sensor protein
publication title Crystal Structure of a Putative GAF sensor protein from Burkholderia vietnamiensis
rcsb
source organism Burkholderia vietnamiensis (strain g4 / lmg 22486)
molecule tags Transferase
total genus 50
structure length 158
sequence length 158
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13185 GAF_2 GAF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.40 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 5hl6A00
2K31A 4Q0HA 3VV4A 3O5YA 5DFXA 4DMZA 4ETZA 4R6LA 3RFBA 4EUVA 3S7OA 2B18A 3NOUC 3D3OA 2GX5A 3K2NA 4RQ9A 5K5BA 4LRYC 3S7NA 4ZRRA 3CI6A 3KSFA 3KO6A 1MC0A 2M7VA 2O9CA 5C5KA 2M7UA 2W1TB 4PAUA 4R70A 5HL6A 4YOFA 5LBRA 2W3EA 4O0PA 4IUHA 3EEAA 3LFVA 2VKSA 3G6OA 3MF0A 5L8MA 2OOLA 3IBJA 5I5LA 4Y5FA 1TD5A 2LB9A 5DFYA 3S7PA 4O01A 2LB5A 1TF1A 1STZA 4Q0JA 2KOIA 4YNRA 4G3VA 3OOVA 4Y3IA 1YKDA 4MCWA 4ETXA 4IUKA 2IA2A 3NOTC 3BJNA 2W1RA 3KSHA 4LRXC 2K2NA 4G3KA 3NHQA 2G7UA 1YSQA 2XRNA 4CQHA 5HPIA 4MDZA 3OBFA 3E98A 3R4KA 5HSQA 2W3GA 5HPFA 2Y8HA 4DN0A 3E0YA 3IBRA 4GW9A 4EU0A 1F5MA 4IJGA 1VHMA 2VEAA 2W3FA 3NOPC 4Z1WA 3CITA 3KSIA 2VZWA 2W3DA 2O0YA 3C2WA 2HGVA 4ME4A 2Y79A 1ZTUA 4G3WA 4E04A 4Q0IA 4QPRA 3KSGA 2KLIA 2W3HA 4MMNA 2ZMFA 2O9AA 4Y2FA 3MMHA 2XSSA 2W1TA 3DBAA 3W2ZA 1MKMA 2VJWA 5AJGA 1YSPA 3MQ0A 2O99A 4LRZE 4FOFA 3S7QA 3HCYA 3TRCA 4BWIA 4MN7A 2QYBA 2XROA 3ZQ5A 4O8GA 4GLQA 2O9BA 5TJJA
chains in the Genus database with same CATH superfamily
3Q7VB 4QWOA 3S1YA 3ITBA 1OJ5A 1ESIA 4ETZA 3BQ8A 3GTCA 3S7OA 4E3MA 1NRJA 2Y2GA 4DE3A 1G6AA 2DMWA 3MKFA 2I9VA 1W63Q 3MBZA 1CJFA 4HJ4A 5I94A 1YMSA 4GHIA 3KO6A 1CQAA 3LICA 1KDWA 3VP1A 4E3KA 3MZFA 1YLJA 5HL6A 4OLDA 3LFVA 3HUNA 1XJ6A 2QKPA 4Y5FA 4JBFA 1G68A 2VGKA 4O01A 5HARA 2V0WA 1ZKJA 1YKDA 5AVFA 4HI4A 3QP1A 5M18A 2I72A 3VE4A 3F1NA 3UMDA 1IKGA 1HLUP 1ES3A 2JHEA 3N8RA 4Z1WA 3PTEA 3CPTA 4I5SA 1S67L 4QPRA 3ULFA 3BLMA 4NEED 3E4OA 5TBMA 3LO7A 4IHQA 5F68A 3MQQA 2MJ6A 1I2SA 4LRZE 1H0MA 4KG2A 4RVAA 4H6JB 4KQDA 4DE2A 5J3WA 3L7HA 5GHXA 3H7WA 4Q0HA 4GN2A 4EESA 1H5XA 1ALQA 3RFBA 3TOIA 2EX8A 1N9NA 5FQ9A 4II7A 3BY8A 4HNBA 5GLBA 4R4SA 3A3JA 3S7NA 5F1FA 1K55A 3LIEA 4Y7PA 1KE4A 2V1BA 1XXMA 1MC0A 2ZC4B 2NUTC 2ZMVA 4IBXA 2A3UA 2QJ5A 5FQJA 5EE8A 4CLCC 2OAQ1 1TD5A 1KVMA 4E3IA 1TF1A 4D2OA 5F1GA 3OOVA 1A0KA 2WYXA 5GLCA 3IHBA 4MNRA 1L0GA 4QD4A 4EBPA 2XRNA 3GDIA 4DJ2A 3ZG9B 2W0NA 3M6HA 1F5MA 1EI5A 3KSIA 2HGVA 1G6OA 5FAQA 1G5UA 3IXDA 1P9RA 1VETA 4MMNA 4JXSA 4L9GA 2ACGA 4OPQA 3QP6A 4JGPA 4FH4A 1MBLA 4DRTA 1TVFA 3Q81A 1WE4A 3CZDA 4S2KA 1YT4A 4E3NA 5IU1A 5CGWA 1K54A 5TR7A 3LGOA 4WN5A 5TJJA 2QPNA 3F1NB 2EXBA 1VM1A 2WZXA 4KUKA 4X25A 5AQ7A 4KQQA 2ZM8A 3IHAA 4PHTA 4QB8A 3CPTB 4PM9A 4R0QA 4PKYA 4JXWA 5HWVA 4ID4A 4KZAA 3UB8A 1XKZA 3I7JA 1JWVA 5TBMB 5HWWA 3FWLA 2C5WB 4UA9A 1H3QA 2VGLM 2Y2IA 4DE1A 1Q2PA 5I5LA 3NC8A 4FCFA 3ZDJA 3ZG5A 2LB9A 1X0OA 3H7WB 4L9FA 3LY4A 3N8SA 3IXHA 5DJTA 1DJAA 4G3KA 4U0TA 4U0XA 1I5QA 3Q7ZA 3IWQA 1ES4A 4MDZA 5AVEA 2ZQDA 3MZEA 1BLCA 2Y8HA 1IYQA 4HOIA 4HQAA 4E6XA 4DXBA 4GW9A 3T4LA 2VEAA 3NOPC 4R1GA 2VV8A 3IS2A 1M40A 2O0YA 4UA6A 4X69A 2V8FA 5FAPA 3MJQA 4QY6A 3WS1A 3S4XA 2ZMFA 3CAXA 1D7EA 3VOLA 4JXVA 4WZ5C 4FTXA 2GZAA 3HUMA 5G4ZA 5AJGA 3HLWA 1OJGA 2XFTA 4FOFA 5HX9A 2EWWA 3CJMA 2WZZA 2EFUA 4KZ8A 3ZQ5A 3OZHA 3LYXA 4JPMA 4PM6A 3O5YA 5DFXA 1W5DA 1E3UA 5HDSA 3BLSA 4EETB 1GHMA 4YWZA 4EW7A 1RGZA 3LI9A 3BWLA 3HREA 1U60A 1ODVA 4ZRRA 2Y2QA 4ZDXA 4S2NA 3CI6A 2XA7M 5HWTA 5AQ9A 1YLWA 3DTIA 1VETB 2BASA 2R78A 1T1BA 4GOGA 3QP2A 5FI7A 2BG1A 3MXSA 5L8MA 3CMZA 4GDBA 2JKTM 5HAPA 2X02A 3D4FA 2JKRM 2KOIA 4YNRA 3T4TA 5EOEA 4G3VA 3ZVTA 4OH0A 1PW8A 4XUXA 3AGEA 4LRXC 3MXRA 4Y0TA 4CPKA 4RYEA 3VP2A 1BTLA 3FC7A 1IKIA 1H8ZA 3BECA 4KZ6A 1LSXA 5KSHA 2KDKA 3VOYA 4JXGA 2PR6A 3CUEA 1NYMA 4H8RA 4HJ6A 3G34A 2ZC7A 3MZDA 3GR2A 4DE0A 4ME4A 1CI9A 3G31A 3HLGA 3KSGA 1O7EA 2HZ5A 4HH2A 4KG5A 4P0MA 1PI5A 2CMNA 2HJ9C 1NLYA 5GLAA 4KZ9A 4BL3A 1KGFA 4WLAA 3PAEA 2X71A 5CEBA 3WWXA 1PWDA 2QHKA 4MN7A 4O8GA 3T4JA 5KZHA 5EV0A 3KX0X 4ZAMA 3LIFA 3VV4A 1K6SA 3CHWP 3LEQA 1Z09A 1NLZA 4R23A 2EA9A 4P6ZM 1DRMA 4E3OA 2OAP1 3M6BA 1BZAA 1VEUA 1T1AA 3PBTA 3T4SA 5DF7A 4LRYC 1FCMA 1J3WA 1W8YA 4S2PA 4JGOA 1OTEA 1MWRA 3KSFA 2H28A 2M7VA 3UN7A 1GA9A 3IF5A 5EVIB 3LR5A 3QNBA 3AGDA 1ZG6A 2ZQCA 1WYBA 4BENA 3T4OA 3NCKA 1VB6A 1TEMA 2GNXA 5FQKA 1XPBA 2V1AA 1D1JA 4UAAA 1KGGA 2VKSA 3G6OA 4Z9QA 2P9VB 3M2JA 3RJUA 5EVLA 4C75A 5DFYA 5J7EA 2Q9MA 2RL3A 2H10A 3DWKA 3HJKA 4EEPA 4R3BA 3SOIA 4WBGA 1E3UD 4IUKA 3NOTC 3ICYA 3NHQA 1TS6A 3GMWA 3BFCA 3IX3A 3GVBA 3R4KA 2L1MA 3PAGA 5EVEA 3UPNA 5KSCA 1W79A 1KGEA 2HP5A 3C4OA 4NK3A 4S2JA 3PBNA 1BLPA 1FR1A 1T1CA 3LR3A 4JF4A 4E3JA 3WS0A 1XFQA 2HP9A 5FSRA 4OOMA 2XSSA 3BFEA 1OT6A 5KMWA 1DJCA 1YSPA 1MXOA 4UA7A 4N1HA 1FQGA 4QY5A 3BFGA 1K6RA 4GKUA 3E4QA 1SCWA 2JE5A 4OPRA 3ZYTA 3RH8B 3FG8A 1DP8A 4LCLA 3NOUC 5A90A 4N92A 4GD6A 4JGRA 3Q82A 1OPXA 3OC2A 2PU2A 3T1QB 3SH7A 4EBNA 2D01A 4B93A 5FEFA 5AQAA 4YFMA 2PYPA 3O3VA 5EM0A 5MC7A 3IF6B 4YOFA 2W3EA 3HUOA 3MF0A 4S2IA 2OOLA 1EROA 5CGXA 4KZ5A 5E2HA 1SDEA 5KIZA 3Q07A 3GV9A 3P98A 2PD8A 4D60A 1VEUB 2XR0A 3EGXC 4K0XA 3A0RA 4F3LA 1YLTA 4GJ4A 1P9WA 4KQRA 3BFFA 1JVJA 3E0YA 2JKFA 3UNWA 2ZLYA 3NI9A 1VHMA 5FAOA 3KYZA 4O7DA 2PBDP 2Y79A 2VK3A 2Y2OA 3B3XA 4DDSA 3WS4A 2W3HA 4UEYA 2XDMA 4EV4A 3FV7A 5M19A 2C6WB 3QP4A 1Y4OA 3UE3A 3MQ0A 3HLDA 3G2YA 3S7QA 5IHVA 1LLBA 1ZG4A 2WKHA 1YPRA 4I3JA 1LSVA 5GHYA 4EEUA 4LV3A 5F69A 2G2UA 5JYPA 2WGVA 2R9WA 2HDRA 1PW1A 3L9KA 1HTZA 1YMXA 2Y55A 3A3EA 3D3OA 5K5BA 3TW8A 2A2LA 1F2KA 3UDXA 5DF9A 2WADA 3MKEA 3KYQA 3VP0A 4GS9A 3TSGA 4XUZA 3HLBA 3VFFA 2LB5A 1FSWA 4Q0JA 4ESPA 3C38A 5FL3A 3BJNA 3KSHA 4RX3A 1J9MA 3PBRA 3OBFA 3E98A 3WS2A 1YM1A 1FCOA 2KX6A 4LGWA 3D9YA 4DDYA 2EWVA 4UHUA 3CITA 3ZG8B 1LSWA 4G3WA 3A0SA 2J3TD 1PYYA 1CF0A 2DCFA 1GHIA 4WMCD 4HESA 2HPBA 3IWIA 2B95A 4GHIB 4JF6A 3SH9A 5J4EA 4ZJ2A 1L0DA 2WKIA 5EVIC 3FPVA 1YLZA 1SHVA 3ZFZA 3VOZA 5A8BA 4KENB 5CTNA 4CJNA 2PD7A 3KYEA 3NECA 1OTAA 4WF0A 3QP5A 5FA7A 1K38A 3PBSA 2OSUA 3IX8A 2V9AA 4X55A 3UE0A 3B33A 1YQSA 2XF3A 4BQMA 4BJPA 4R3AA 1GA0A 3QHYA 4OOLA 4PPRA 1TS8A 4L0LA 4WUJA 2O9CA 2DNSA 2FZ0A 2VGLS 1NY0A 3O88A 2ZM2A 2Y2JA 4B4ZA 3T12B 2J80A 4HBUA 4WZ4A 2XH9A 3P09A 4U3TA 4LLOB 4BL2A 4DF6A 2W1RA 2P7JA 2G7UA 3TG9A 3IX4A 4EERA 1GSVA 5E2EA 5HSQA 2Y2HA 3MQOA 1W7FA 5BOHA 2PAVP 4DN0A 1V9YA 4YINA 3G30A 3GRJA 3IQAA 3UB6A 4DKIA 4Q8IA 1S4SA 1XA1A 2AVXA 3ITAA 3PXPA 2PT7A 2Y2KA 3F1PA 2QWSA 2EX9A 3JPUA 3C30A 3E2LA 4Y15A 3ISGA 2E8IA 4CLCA 3HVFA 1XJ2A 5D3OA 4BLMA 3IF6C 4CLCE 1FSYA 2BLSA 5M1AA 2A24A 3IT9A 3B47A 3T4QA 5IS1A 2XA7S 3GECA 4EBLA 2WGWA 4NXGA 5EUAA 3S22A 1ZC2A 4NG2A 3DWZA 1WYCA 2H5SA 3PBOA 1TS7A 5FQIA 4P87A 1PZPA 3CLOA 2HP6A 4LENA 2Z6CA 3W8KA 1PFLA 4PAUA 5E2GA 4R70A 1XGIA 1XX2A 1FOFA 2J8YA 1HZOA 2Y2LA 5EFWA 3VSKA 4HP9A 2FFFB 5L09A 1WA9A 4GZBA 4E3LA 3GSGA 3VE3A 3EQVA 2XQZA 1YLYA 4OQ0A 4K91A 1K57C 5FASA 3BY9A 2ZOHA 2PR5A 1N4OA 5HPIA 5HPFA 4X1LA 1XJ3A 1OTBA 3A0VA 3UDIA 3UPOA 2OWHA 5FQQA 1SZVA 2QZ6A 4HIAA 1CEGA 2W3DA 1NRFA 3HLFA 4B4XA 1T19A 5HAQA 5EECA 1YAXA 1IELA 2VV6A 4Y13A 1HD8A 5DVAA 2GDNA 2M1CA 4B88A 1K4EA 4S2MA 1L2SA 1Y28A 3LR0A 4L9EA 4IVKA 4BBTA 4LFUA 1SDNA 4X1MA 2O99A 1PWGA 3ZG0A 3T4KA 2P08A 4P6ZS 3MFXA 4LV0A 4LPZA 3W4QA 2ZJ9A 2JC7A 2OLUA 4C6YA 4GDNA 3A3FA 4R4RA 3O87A 3NJAA 1T18A 3SZTA 4PMAA 4JF5A 3SS4A 3C4PA 3T50A 5C5KA 2INWA 2X01A 2J7VA 3UDFA 2ZD8A 4S2OA 4BBUA 3F1PB 1ACFA 4ZJ1A 3D72A 5LBRA 4KZBA 1ONHA 4IUHA 4FUWA 3PR6A 1LHYA 3IS2B 1DP6A 2HDUA 4RA7A 4WEKA 4WZ5A 1KDSA 4CLCD 2A24B 3SH8A 5DTKA 2OWJA 1PZOA 4MCWA 5CHUA 4KZ3A 2IWDA 2IA2A 1ERMA 2HF6A 1C3BA 5DTSA 1YSQA 1YLPA 3DAVA 2J9OA 1S4RA 3IXBA 3HLCA 3G35A 2OV5A 1LL8A 4LV2A 3N8LA 4JLFA 5GHZA 4I3AA 2ZOIA 1BYWA 1QMEA 1G28A 3EWKA 4OOYA 2H0YA 1PI4A 3V39A 2ZQ7A 2ZC5B 3U2AA 4WL9A 3C8CA 3E4PA 5HFOA 3ZHHA 3T1SA 4OQIA 2B5RA 2ZL1A 2W1TA 3W2ZA 1ZHHB 1AWIA 2HDSA 3SW1A 1KOUA 3TRCA 1DY6A 2Q0OA 1FIKA 5A92A 2QJ7A 4GLQA 2HJEA 1L3LA 4N1XA 1SKOA 2VX8A 5F82A 5FI2A 1ESUA 4I39A 4I3IA 2VA0A 5DKKA 1S0WA 3BEBA 3FKWA 3SS5A 1K25A 5HDCA 4X56A 1Y54A 5GL9A 3BFDA 3C5AA 3DTMA 3HBRA 1XP4A 2D02A 4NKPA 1BT5A 3NDGA 1MWTA 4H6JA 4NXEA 3WRZA 3RXXA 3TJZC 5HW3A 2J3WA 4O0PA 3UPPA 1JNUA 4OQHA 4MEZA 4HJ3A 1NXYA 1MWUA 5F5YA 4Y3IA 2WKPA 4UQIM 1IYOA 2K2NA 1JWPA 4XXRA 4PM7A 4CQHA 3NULA 1K55C 3G32A 3EEHA 1FCNA 4WYYA 4WMCA 1NYYA 4OKPA 3ZNYA 1RCJA 1F9IA 2EXAA 2VV7A 1ZTUA 2PU4A 4M3KA 3OPHA 1XFNA 3H82A 2ZQ9A 1N9OA 2ZBBA 3A3IA 3VSLA 1PWCA 1S66L 4X53A 3G2ZA 3PBQA 3HL9A 5A91A 2EX2A 4MBHA 2Y91A 5U47A 3EQUA 4R6LA 2WAFA 3UO9A 4KZ4A 1EW0A 3VMAA 4QHCA 1ES5A 1BLHA 5CTMA 4K08A 1P97A 3N6IA 3BM6A 1LI0A 3IH8A 4BMWA 1GHPA 4I38A 2PDRA 1OTIA 1FILA 2M7UA 1DP9A 4R38A 1E25A 2ZL1B 2W1TB 1LL9A 3BYDA 3CWFA 5EM1A 3E2KA 4ZBEA 1I2WA 1KE0A 5FI6A 1K54C 1XGJA 5DJUA 5CHMA 4KQOA 4QU3A 3B42A 3NY4A 4EQ1A 1SKOB 2P74A 2WKEA 5G4YA 1ERQA 5CECA 1Q2QA 4ETXA 3UMEA 4EXOA 3N4IA 3ZVWA 1N9LA 1F98A 2JKTI 1XA7A 3WS5A 3LY3A 2JKRI 4X68A 4EU0A 4Y0UA 4QJGA 1CK3A 1AXBA 2EFXA 2HDQA 5E2FA 4ZTKA 3ZCZA 1HVBA 3FZCA 3IXGA 3LIBA 4MN5A 2O9AA 4BBVA 5EOOA 4FD8A 4NETA 4MLLA 1H8YA 5FQMA 2Y2MA 3CG5A 1UWNX 2L0WA 1K56D 4OPZA 4MBFA 1PNEA 3OPRA 3MR0A 5CX7A 2K7SA 4M4XA 1W63M 5DF8A 2GX5A 3PYPA 2FH5A 4RQ9A 3P01A 2A49A 5GLDA 2WGIA 3K3DA 4GNUA 1N9BA 1TDLA 3H82B 1DJBA 4F3LB 1IEMA 1KVLA 3Q1FA 1BLSA 1JWZA 3K3CA 2XEPA 3V3SA 3QNCA 1JTGA 1OMEA 3ZNTA 5HL1A 2J9PA 3EEAA 4NXBA 4PKYG 1FR6A 4B9OA 3P7NA 1NJ4A 3RXWA 2ZC6B 3JVUA 4DXCA 2V8CA 4JGQA 1IYPA 4OP5A 2BTFP 4HEFA 4S2NC 3OCNA 2PBYA 4Y17A 2WKRA 1LL5A 1UWPX 3C7VA 3V50A 3BRMA 4P6BA 4OPYA 3UY6A 5CEDA 2IWCA 3R7WA 4E04A 2YKFA 1MPLA 3PHYA 3UE1A 1MY8A 1H8MA 4Y2FA 3MS6A 3LCEA 4A5RA 2EX6A 3MXQA 3DTEA 3DTKA 2CC1A 1GSWA 4S2LA 4DMZA 3CUEC 5G18A 4GS9B 4EUVA 2V0UA 4OONA 2HV1A 3IH9A 1EWZA 3LIDA 3ZGAB 4K0WA 4WM9A 3K2NA 5CRFA 4IBRA 4OVDA 3UB7A 1QMFA 2WK0A 2Y4AA 4ARZA 1JTDA 2Z6DA 3JYIA 3SS3A 1BULA 4X6TA 3EOIA 3RTYA 3EGDC 4BD1A 1PRQA 4C3QA 2Q9NA 4ZJ3A 5CGSA 2P04A 5CXWA 1LI9A 2E8JA 1STZA 4RX2A 1RGYA 2ZQ8A 5E43A 4AFIA 1MWSA 3T1RA 4XT2A 1IFQA 4BD0A 5EVIA 1L0FA 4LV1A 4Y0OA 4OLGA 2W27A 2ZMAA 4HY8A 3AGFA 4GD8A 3VP3A 5L2FA 2P9VA 4DJ3A 1ONGA 2PYRA 4HH3A 3W4PA 4HBTA 1O07A 3MSHA 1K0KA 1TS0A 2XD5A 2XFSA 2H0TA 3TE8A 2Z2LB 1S1ZA 4MBKA 1MKMA 2WKQA 1L0EA 5CERA 3LUQA 2NUPC 3G4PA 5IT5A 5J8XA 3HLEA 2JN7A 4OQGA 2XGNA 4FSFA 4OP8A 2O9BA 3T1XA 1S1YA 3GQZA 4IEDA 1P0ZA 1E4DA 2IWBA 2ZQAA 1MKIA 2XD1A 2XK1A 2V20A 3OPPA 3R7WB 5FDHA 2Z2MB 1BUEA 4KG6A 2Y2NA 4HP4A 3VP4A 2WUQA 2B02A 3BW6A 3VFHA 1V9ZA 3QP8A 5DTTA 2ZC3B 2R9XA 3A3DA 1M6KA 2YKHA 1TDGA 3OLOA 1S6RA 2RCXA 1GSXA 3F1OA 5HD3A 4WELA 3S7PA 5HZHA 1SKFA 4JKTA 2JKGA 3LR4A 3Q7VA 3JVVA 1NZUA 2W3GA 1K4FA 4ARZB 1MZUA 3IF6A 3FYZA 5TGFA 2DRWA 2PHYA 4CLCB 2ZM0A 1ES2A 4FH2A 2J3TC 3NBLA 5F6AA 3C2WA 1NZOA 4N9LA 3U4LP 2Y2PA 5AQBA 3LIAA 4EUZA 3UB9A 2KLIA 2WGWB 3MMHA 5FATA 3DBAA 2UV0E 3OPLA 2VJWA 1Z6FA 3C7UA 2JBFA 4KZ7A 2FFYA 3UB5P 3HCYA 4IVIA 4XT2B 4HHDA 4BWIA 2QYBA 1RP5A 2GJ3A 3BQAA 2K31A 1IOUA 5EVID 4R3JA 4GCZA 2B18A 3V3RA 3V5MA 3W4OA 3V67A 4WEJA 1K57A 5CHJA 4F94A 5L10A 2UWXA 5L07A 2Y59A 2QMIA 3FPWA 5HAIA 1D06A 1KE3A 1PIOA 3IWOA 3HJIA 3FKVA 4PM8A 3M2KA 2V1ZA 1BSGA 3UE6A 3OCLA 1VQQA 1CI8A 1LT0A 4MN6A 4EQIA 3N7WA 2VGJA 3IBJA 3NDEA 3DW0A 5TFQA 1UGUA 4EWFA 2XLNA 4KUOA 2V2FF 4UQIS 2JCHA 5HDDA 3NIAA 1W8QA 5A93A 3ZG7B 2L4RA 4P85A 5FDSA 4NXFA 2OLVA 4PM5A 2PRFA 1OT9A 3IBRA 4N9KA 2WAEA 5HD5A 5DKLA 4IJGA 2W3FA 4LCMA 2VZWA 1OTDA 5F83A 4Q0IA 3LI8A 1K56A 3F1OB 1XJ4A 3LEZA 3MFDA 5FEGA 2G2WA 3O86A 5JYOA 1IYSA 4E6WA 2VLGA 3WRTA 1GCEA 4GB7A 3H9WA 5EPHA 1NWZA 2XROA 1CEFA
chains in the Genus database with same CATH topology
1XJ2A 3KX0X 3VV4A 3LIFA 4CLCE 1OJ5A 4ETZA 3BQ8A 2A24A 1NLZA 3B47A 3S7OA 3T4QA 2EA9A 3MR0A 5IS1A 5CX7A 2K7SA 1NRJA 4M4XA 4P6ZM 1W63M 1DRMA 2GX5A 2DMWA 2OAP1 2FH5A 3PYPA 2XA7S 1T1AA 2I9VA 3GECA 3PBTA 3T4SA 1W63Q 4RQ9A 3P01A 4LRYC 4HJ4A 4NXGA 4JGOA 1OTEA 3K3DA 3KSFA 4GHIA 2H28A 3KO6A 3PBOA 2M7VA 3LICA 1TS7A 3H82B 3LR5A 3CLOA 4F3LB 2Z6CA 4PAUA 3T4OA 4R70A 1VB6A 5HL6A 2GNXA 3K3CA 5EFWA 2V1AA 4HP9A 3EEAA 3LFVA 2VKSA 3G6OA 4NXBA 4PKYG 4B9OA 3P7NA 1WA9A 1XJ6A 3VE3A 2QKPA 4Y5FA 5DFYA 5J7EA 4O01A 2V0WA 3EQVA 3HJKA 4EEPA 1YKDA 3JVUA 5AVFA 4HI4A 4IUKA 3NOTC 4JGQA 3ICYA 3BY9A 3NHQA 1TS6A 2ZOHA 2PR5A 5HPIA 3VE4A 3F1NA 3R4KA 2L1MA 3UMDA 5HPFA 3OCNA 1OTBA 1XJ3A 2WKRA 2JHEA 3A0VA 2OWHA 1UWPX 3PBNA 4Z1WA 4HIAA 2W3DA 3R7WA 4E04A 2YKFA 3PHYA 1S67L 1T1CA 1T19A 4I5SA 3LR3A 4QPRA 3ULFA 4NEED 1YAXA 2VV6A 3E4OA 1H8MA 1XFQA 2M1CA 5TBMA 4OOMA 4Y2FA 2XSSA 1OT6A 1Y28A 4IHQA 3LR0A 4L9EA 4BBTA 5F68A 3MQQA 1YSPA 2O99A 2MJ6A 4LRZE 3MXQA 4H6JB 4KQDA 3T4KA 5J3WA 2P08A 3H7WA 4Q0HA 1GSWA 4P6ZS 3E4QA 4DMZA 4EESA 3MFXA 3CUEC 4LPZA 4GS9B 3RFBA 4EUVA 2V0UA 3ZYTA 3RH8B 1N9NA 2HV1A 3FG8A 1DP8A 4II7A 3LIDA 3NOUC 3BY8A 4HNBA 3K2NA 4JGRA 1OPXA 3NJAA 3S7NA 1T18A 3OC2A 3LIEA 3UB7A 4ARZA 2V1BA 3T50A 1MC0A 2D01A 2Z6DA 5C5KA 2INWA 4B93A 3EOIA 3RTYA 2NUTC 3EGDC 2ZMVA 2PYPA 4BBUA 3F1PB 5MC7A 2QJ5A 4YOFA 3D72A 5LBRA 2W3EA 4IUHA 3MF0A 3PR6A 2OOLA 3IS2B 4CLCC 1DP6A 2P04A 2OAQ1 1TD5A 4WEKA 1TF1A 1STZA 5KIZA 4CLCD 2A24B 3OOVA 2OWJA 4MCWA 2PD8A 2IA2A 4AFIA 2HF6A 4XT2A 1IFQA 1YSQA 2XRNA 3T4JA 3GDIA 3EGXC 1S4RA 3A0RA 4F3LA 2W27A 4DJ2A 4HY8A 2W0NA 4GJ4A 1P9WA 1LL8A 3E0YA 1F5MA 1VHMA 4I3AA 3KYZA 3KSIA 2ZOIA 4DJ3A 1BYWA 2HGVA 2Y79A 2PYRA 1G6OA 4HH3A 1G28A 3EWKA 1P9RA 3U2AA 4WL9A 1TS0A 2W3HA 3C8CA 3E4PA 4MMNA 4UEYA 4L9GA 3TE8A 4JGPA 2W1TA 1S1ZA 3W2ZA 1MKMA 1ZHHB 2WKQA 3UE3A 3MQ0A 3SW1A 1KOUA 3LUQA 2NUPC 3S7QA 5IT5A 3TRCA 2JN7A 4I3JA 5IU1A 4FSFA 1LSVA 2QJ7A 2O9BA 4GLQA 2HJEA 4WN5A 1S1YA 5TJJA 3F1NB 4EEUA 4KUKA 2VX8A 1P0ZA 5F69A 4I39A 4I3IA 2VA0A 5DKKA 3D3OA 4PHTA 5HDCA 3R7WB 5K5BA 4PKYA 3TW8A 5HWVA 2A2LA 2D02A 4NKPA 4HP4A 3UB8A 2B02A 3BW6A 5TBMB 1V9ZA 5DF9A 5HWWA 4H6JA 4NXEA 3TJZC 2J3WA 2YKHA 3KYQA 3OLOA 4O0PA 1H3QA 1GSXA 2VGLM 1JNUA 4GS9A 3F1OA 5HD3A 5I5LA 4WELA 4HJ3A 2LB9A 3S7PA 1X0OA 2LB5A 3H7WB 4Q0JA 4L9FA 5F5YA 4Y3IA 5HZHA 2WKPA 5DJTA 3C38A 4UQIM 5FL3A 3BJNA 3KSHA 2K2NA 4G3KA 4CQHA 3PBRA 4MDZA 5AVEA 3LR4A 3OBFA 3JVVA 3EEHA 3E98A 2KX6A 2W3GA 2Y8HA 4HOIA 4ARZB 1MZUA 4HQAA 4GW9A 3T4LA 2EWVA 2PHYA 4CLCB 2VEAA 3NOPC 1F9IA 2VV8A 2VV7A 3CITA 3IS2A 2J3TC 2O0YA 5F6AA 1LSWA 3C2WA 1ZTUA 4G3WA 3A0SA 3LIAA 3MJQA 2J3TD 3UB9A 2KLIA 1XFNA 3H82A 2ZMFA 3CAXA 1D7EA 3VOLA 3MMHA 2GZAA 1N9OA 3DBAA 5G4ZA 2VJWA 5AJGA 4GHIB 1OJGA 2ZBBA 5J4EA 4FOFA 3HCYA 1S66L 2EWWA 4XT2B 4HHDA 4BWIA 2QYBA 3FPVA 3PBQA 3ZQ5A 2GJ3A 5A8BA 3BQAA 2K31A 2PD7A 3LYXA 1IOUA 3O5YA 5DFXA 1OTAA 3EQUA 4WF0A 4R6LA 5HDSA 3PBSA 4GCZA 4EETB 2B18A 2V9AA 3B33A 1EW0A 4YWZA 3V67A 4WEJA 4EW7A 3LI9A 4K08A 1P97A 3BWLA 4BJPA 4R3AA 1ODVA 4ZRRA 4BMWA 4OOLA 3FPWA 4I38A 3CI6A 1D06A 2PDRA 2XA7M 5HWTA 1OTIA 1TS8A 3HJIA 4L0LA 4WUJA 2O9CA 2BASA 2R78A 1T1BA 1DP9A 2FZ0A 2M7UA 3UE6A 4R38A 2W1TB 2VGLS 3CWFA 3OCLA 1LT0A 4MN6A 5L8MA 3IBJA 5DJUA 4KQOA 1UGUA 3B42A 2JKTM 4EQ1A 4KUOA 4UQIS 2JKRM 2J80A 2KOIA 4YNRA 5HDDA 3T4TA 5G4YA 4G3VA 4LLOB 4ETXA 3UMEA 4EXOA 2W1RA 4LRXC 2P7JA 2G7UA 4EERA 3FC7A 2L4RA 1N9LA 1F98A 1GSVA 1LSXA 4NXFA 2JKTI 5HSQA 5KSHA 3MQOA 2KDKA 2JKRI 4DN0A 2PR6A 1OT9A 3CUEA 3IBRA 4EU0A 1V9YA 5HD5A 5DKLA 4IJGA 4HJ6A 2W3FA 2VZWA 1OTDA 4ME4A 4Q0IA 3LI8A 3UB6A 3KSGA 4HH2A 3F1OB 2CMNA 1S4SA 2HJ9C 3PXPA 1NLYA 1XJ4A 3LIBA 4MN5A 2PT7A 2O9AA 4BBVA 3F1PA 2QWSA 4WLAA 2VLGA 3C30A 2QHKA 3H9WA 4MN7A 1UWNX 2L0WA 1NWZA 2XROA 4O8GA 4CLCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K31 A;  4Q0H A;  3VV4 A;  3O5Y A;  5DFX A;  4DMZ A;  4ETZ A;  4R6L A;  3RFB A;  4EUV A;  3S7O A;  2B18 A;  3NOU C;  3D3O A;  2GX5 A;  3K2N A;  4RQ9 A;  5K5B A;  4LRY C;  3S7N A;  4ZRR A;  3CI6 A;  3KSF A;  3KO6 A;  1MC0 A;  2M7V A;  2O9C A;  5C5K A;  2M7U A;  2W1T B;  4PAU A;  4R70 A;  5HL6 A;  4YOF A;  5LBR A;  2W3E A;  4O0P A;  4IUH A;  3EEA A;  3LFV A;  2VKS A;  3G6O A;  3MF0 A;  5L8M A;  2OOL A;  3IBJ A;  5I5L A;  4Y5F A;  1TD5 A;  2LB9 A;  5DFY A;  3S7P A;  4O01 A;  2LB5 A;  1TF1 A;  1STZ A;  4Q0J A;  2KOI A;  4YNR A;  4G3V A;  3OOV A;  4Y3I A;  1YKD A;  4MCW A;  4ETX A;  4IUK A;  2IA2 A;  3NOT C;  3BJN A;  2W1R A;  3KSH A;  4LRX C;  2K2N A;  4G3K A;  3NHQ A;  2G7U A;  1YSQ A;  2XRN A;  4CQH A;  5HPI A;  4MDZ A;  3OBF A;  3E98 A;  3R4K A;  5HSQ A;  2W3G A;  5HPF A;  2Y8H A;  4DN0 A;  3E0Y A;  3IBR A;  4GW9 A;  4EU0 A;  1F5M A;  4IJG A;  1VHM A;  2VEA A;  2W3F A;  3NOP C;  4Z1W A;  3CIT A;  3KSI A;  2VZW A;  2W3D A;  2O0Y A;  3C2W A;  2HGV A;  4ME4 A;  2Y79 A;  1ZTU A;  4G3W A;  4E04 A;  4Q0I A;  4QPR A;  3KSG A;  2KLI A;  2W3H A;  4MMN A;  2ZMF A;  2O9A A;  4Y2F A;  3MMH A;  2XSS A;  2W1T A;  3DBA A;  3W2Z A;  1MKM A;  2VJW A;  5AJG A;  1YSP A;  3MQ0 A;  2O99 A;  4LRZ E;  4FOF A;  3S7Q A;  3HCY A;  3TRC A;  4BWI A;  4MN7 A;  2QYB A;  2XRO A;  3ZQ5 A;  4O8G A;  4GLQ A;  2O9B A;  5TJJ A; 
#chains in the Genus database with same CATH topology
 3Q7V B;  4QWO A;  3S1Y A;  3ITB A;  1OJ5 A;  1ESI A;  4ETZ A;  3BQ8 A;  3GTC A;  3S7O A;  4E3M A;  1NRJ A;  2Y2G A;  4DE3 A;  1G6A A;  2DMW A;  3MKF A;  2I9V A;  1W63 Q;  3MBZ A;  1CJF A;  4HJ4 A;  5I94 A;  1YMS A;  4GHI A;  3KO6 A;  1CQA A;  3LIC A;  1KDW A;  3VP1 A;  4E3K A;  3MZF A;  1YLJ A;  5HL6 A;  4OLD A;  3LFV A;  3HUN A;  1XJ6 A;  2QKP A;  4Y5F A;  4JBF A;  1G68 A;  2VGK A;  4O01 A;  5HAR A;  2V0W A;  1ZKJ A;  1YKD A;  5AVF A;  4HI4 A;  3QP1 A;  5M18 A;  2I72 A;  3VE4 A;  3F1N A;  3UMD A;  1IKG A;  1HLU P;  1ES3 A;  2JHE A;  3N8R A;  4Z1W A;  3PTE A;  3CPT A;  4I5S A;  1S67 L;  4QPR A;  3ULF A;  3BLM A;  4NEE D;  3E4O A;  5TBM A;  3LO7 A;  4IHQ A;  5F68 A;  3MQQ A;  2MJ6 A;  1I2S A;  4LRZ E;  1H0M A;  4KG2 A;  4RVA A;  4H6J B;  4KQD A;  4DE2 A;  5J3W A;  3L7H A;  5GHX A;  3H7W A;  4Q0H A;  4GN2 A;  4EES A;  1H5X A;  1ALQ A;  3RFB A;  3TOI A;  2EX8 A;  1N9N A;  5FQ9 A;  4II7 A;  3BY8 A;  4HNB A;  5GLB A;  4R4S A;  3A3J A;  3S7N A;  5F1F A;  1K55 A;  3LIE A;  4Y7P A;  1KE4 A;  2V1B A;  1XXM A;  1MC0 A;  2ZC4 B;  2NUT C;  2ZMV A;  4IBX A;  2A3U A;  2QJ5 A;  5FQJ A;  5EE8 A;  4CLC C;  2OAQ 1;  1TD5 A;  1KVM A;  4E3I A;  1TF1 A;  4D2O A;  5F1G A;  3OOV A;  1A0K A;  2WYX A;  5GLC A;  3IHB A;  4MNR A;  1L0G A;  4QD4 A;  4EBP A;  2XRN A;  3GDI A;  4DJ2 A;  3ZG9 B;  2W0N A;  3M6H A;  1F5M A;  1EI5 A;  3KSI A;  2HGV A;  1G6O A;  5FAQ A;  1G5U A;  3IXD A;  1P9R A;  1VET A;  4MMN A;  4JXS A;  4L9G A;  2ACG A;  4OPQ A;  3QP6 A;  4JGP A;  4FH4 A;  1MBL A;  4DRT A;  1TVF A;  3Q81 A;  1WE4 A;  3CZD A;  4S2K A;  1YT4 A;  4E3N A;  5IU1 A;  5CGW A;  1K54 A;  5TR7 A;  3LGO A;  4WN5 A;  5TJJ A;  2QPN A;  3F1N B;  2EXB A;  1VM1 A;  2WZX A;  4KUK A;  4X25 A;  5AQ7 A;  4KQQ A;  2ZM8 A;  3IHA A;  4PHT A;  4QB8 A;  3CPT B;  4PM9 A;  4R0Q A;  4PKY A;  4JXW A;  5HWV A;  4ID4 A;  4KZA A;  3UB8 A;  1XKZ A;  3I7J A;  1JWV A;  5TBM B;  5HWW A;  3FWL A;  2C5W B;  4UA9 A;  1H3Q A;  2VGL M;  2Y2I A;  4DE1 A;  1Q2P A;  5I5L A;  3NC8 A;  4FCF A;  3ZDJ A;  3ZG5 A;  2LB9 A;  1X0O A;  3H7W B;  4L9F A;  3LY4 A;  3N8S A;  3IXH A;  5DJT A;  1DJA A;  4G3K A;  4U0T A;  4U0X A;  1I5Q A;  3Q7Z A;  3IWQ A;  1ES4 A;  4MDZ A;  5AVE A;  2ZQD A;  3MZE A;  1BLC A;  2Y8H A;  1IYQ A;  4HOI A;  4HQA A;  4E6X A;  4DXB A;  4GW9 A;  3T4L A;  2VEA A;  3NOP C;  4R1G A;  2VV8 A;  3IS2 A;  1M40 A;  2O0Y A;  4UA6 A;  4X69 A;  2V8F A;  5FAP A;  3MJQ A;  4QY6 A;  3WS1 A;  3S4X A;  2ZMF A;  3CAX A;  1D7E A;  3VOL A;  4JXV A;  4WZ5 C;  4FTX A;  2GZA A;  3HUM A;  5G4Z A;  5AJG A;  3HLW A;  1OJG A;  2XFT A;  4FOF A;  5HX9 A;  2EWW A;  3CJM A;  2WZZ A;  2EFU A;  4KZ8 A;  3ZQ5 A;  3OZH A;  3LYX A;  4JPM A;  4PM6 A;  3O5Y A;  5DFX A;  1W5D A;  1E3U A;  5HDS A;  3BLS A;  4EET B;  1GHM A;  4YWZ A;  4EW7 A;  1RGZ A;  3LI9 A;  3BWL A;  3HRE A;  1U60 A;  1ODV A;  4ZRR A;  2Y2Q A;  4ZDX A;  4S2N A;  3CI6 A;  2XA7 M;  5HWT A;  5AQ9 A;  1YLW A;  3DTI A;  1VET B;  2BAS A;  2R78 A;  1T1B A;  4GOG A;  3QP2 A;  5FI7 A;  2BG1 A;  3MXS A;  5L8M A;  3CMZ A;  4GDB A;  2JKT M;  5HAP A;  2X02 A;  3D4F A;  2JKR M;  2KOI A;  4YNR A;  3T4T A;  5EOE A;  4G3V A;  3ZVT A;  4OH0 A;  1PW8 A;  4XUX A;  3AGE A;  4LRX C;  3MXR A;  4Y0T A;  4CPK A;  4RYE A;  3VP2 A;  1BTL A;  3FC7 A;  1IKI A;  1H8Z A;  3BEC A;  4KZ6 A;  1LSX A;  5KSH A;  2KDK A;  3VOY A;  4JXG A;  2PR6 A;  3CUE A;  1NYM A;  4H8R A;  4HJ6 A;  3G34 A;  2ZC7 A;  3MZD A;  3GR2 A;  4DE0 A;  4ME4 A;  1CI9 A;  3G31 A;  3HLG A;  3KSG A;  1O7E A;  2HZ5 A;  4HH2 A;  4KG5 A;  4P0M A;  1PI5 A;  2CMN A;  2HJ9 C;  1NLY A;  5GLA A;  4KZ9 A;  4BL3 A;  1KGF A;  4WLA A;  3PAE A;  2X71 A;  5CEB A;  3WWX A;  1PWD A;  2QHK A;  4MN7 A;  4O8G A;  3T4J A;  5KZH A;  5EV0 A;  3KX0 X;  4ZAM A;  3LIF A;  3VV4 A;  1K6S A;  3CHW P;  3LEQ A;  1Z09 A;  1NLZ A;  4R23 A;  2EA9 A;  4P6Z M;  1DRM A;  4E3O A;  2OAP 1;  3M6B A;  1BZA A;  1VEU A;  1T1A A;  3PBT A;  3T4S A;  5DF7 A;  4LRY C;  1FCM A;  1J3W A;  1W8Y A;  4S2P A;  4JGO A;  1OTE A;  1MWR A;  3KSF A;  2H28 A;  2M7V A;  3UN7 A;  1GA9 A;  3IF5 A;  5EVI B;  3LR5 A;  3QNB A;  3AGD A;  1ZG6 A;  2ZQC A;  1WYB A;  4BEN A;  3T4O A;  3NCK A;  1VB6 A;  1TEM A;  2GNX A;  5FQK A;  1XPB A;  2V1A A;  1D1J A;  4UAA A;  1KGG A;  2VKS A;  3G6O A;  4Z9Q A;  2P9V B;  3M2J A;  3RJU A;  5EVL A;  4C75 A;  5DFY A;  5J7E A;  2Q9M A;  2RL3 A;  2H10 A;  3DWK A;  3HJK A;  4EEP A;  4R3B A;  3SOI A;  4WBG A;  1E3U D;  4IUK A;  3NOT C;  3ICY A;  3NHQ A;  1TS6 A;  3GMW A;  3BFC A;  3IX3 A;  3GVB A;  3R4K A;  2L1M A;  3PAG A;  5EVE A;  3UPN A;  5KSC A;  1W79 A;  1KGE A;  2HP5 A;  3C4O A;  4NK3 A;  4S2J A;  3PBN A;  1BLP A;  1FR1 A;  1T1C A;  3LR3 A;  4JF4 A;  4E3J A;  3WS0 A;  1XFQ A;  2HP9 A;  5FSR A;  4OOM A;  2XSS A;  3BFE A;  1OT6 A;  5KMW A;  1DJC A;  1YSP A;  1MXO A;  4UA7 A;  4N1H A;  1FQG A;  4QY5 A;  3BFG A;  1K6R A;  4GKU A;  3E4Q A;  1SCW A;  2JE5 A;  4OPR A;  3ZYT A;  3RH8 B;  3FG8 A;  1DP8 A;  4LCL A;  3NOU C;  5A90 A;  4N92 A;  4GD6 A;  4JGR A;  3Q82 A;  1OPX A;  3OC2 A;  2PU2 A;  3T1Q B;  3SH7 A;  4EBN A;  2D01 A;  4B93 A;  5FEF A;  5AQA A;  4YFM A;  2PYP A;  3O3V A;  5EM0 A;  5MC7 A;  3IF6 B;  4YOF A;  2W3E A;  3HUO A;  3MF0 A;  4S2I A;  2OOL A;  1ERO A;  5CGX A;  4KZ5 A;  5E2H A;  1SDE A;  5KIZ A;  3Q07 A;  3GV9 A;  3P98 A;  2PD8 A;  4D60 A;  1VEU B;  2XR0 A;  3EGX C;  4K0X A;  3A0R A;  4F3L A;  1YLT A;  4GJ4 A;  1P9W A;  4KQR A;  3BFF A;  1JVJ A;  3E0Y A;  2JKF A;  3UNW A;  2ZLY A;  3NI9 A;  1VHM A;  5FAO A;  3KYZ A;  4O7D A;  2PBD P;  2Y79 A;  2VK3 A;  2Y2O A;  3B3X A;  4DDS A;  3WS4 A;  2W3H A;  4UEY A;  2XDM A;  4EV4 A;  3FV7 A;  5M19 A;  2C6W B;  3QP4 A;  1Y4O A;  3UE3 A;  3MQ0 A;  3HLD A;  3G2Y A;  3S7Q A;  5IHV A;  1LLB A;  1ZG4 A;  2WKH A;  1YPR A;  4I3J A;  1LSV A;  5GHY A;  4EEU A;  4LV3 A;  5F69 A;  2G2U A;  5JYP A;  2WGV A;  2R9W A;  2HDR A;  1PW1 A;  3L9K A;  1HTZ A;  1YMX A;  2Y55 A;  3A3E A;  3D3O A;  5K5B A;  3TW8 A;  2A2L A;  1F2K A;  3UDX A;  5DF9 A;  2WAD A;  3MKE A;  3KYQ A;  3VP0 A;  4GS9 A;  3TSG A;  4XUZ A;  3HLB A;  3VFF A;  2LB5 A;  1FSW A;  4Q0J A;  4ESP A;  3C38 A;  5FL3 A;  3BJN A;  3KSH A;  4RX3 A;  1J9M A;  3PBR A;  3OBF A;  3E98 A;  3WS2 A;  1YM1 A;  1FCO A;  2KX6 A;  4LGW A;  3D9Y A;  4DDY A;  2EWV A;  4UHU A;  3CIT A;  3ZG8 B;  1LSW A;  4G3W A;  3A0S A;  2J3T D;  1PYY A;  1CF0 A;  2DCF A;  1GHI A;  4WMC D;  4HES A;  2HPB A;  3IWI A;  2B95 A;  4GHI B;  4JF6 A;  3SH9 A;  5J4E A;  4ZJ2 A;  1L0D A;  2WKI A;  5EVI C;  3FPV A;  1YLZ A;  1SHV A;  3ZFZ A;  3VOZ A;  5A8B A;  4KEN B;  5CTN A;  4CJN A;  2PD7 A;  3KYE A;  3NEC A;  1OTA A;  4WF0 A;  3QP5 A;  5FA7 A;  1K38 A;  3PBS A;  2OSU A;  3IX8 A;  2V9A A;  4X55 A;  3UE0 A;  3B33 A;  1YQS A;  2XF3 A;  4BQM A;  4BJP A;  4R3A A;  1GA0 A;  3QHY A;  4OOL A;  4PPR A;  1TS8 A;  4L0L A;  4WUJ A;  2O9C A;  2DNS A;  2FZ0 A;  2VGL S;  1NY0 A;  3O88 A;  2ZM2 A;  2Y2J A;  4B4Z A;  3T12 B;  2J80 A;  4HBU A;  4WZ4 A;  2XH9 A;  3P09 A;  4U3T A;  4LLO B;  4BL2 A;  4DF6 A;  2W1R A;  2P7J A;  2G7U A;  3TG9 A;  3IX4 A;  4EER A;  1GSV A;  5E2E A;  5HSQ A;  2Y2H A;  3MQO A;  1W7F A;  5BOH A;  2PAV P;  4DN0 A;  1V9Y A;  4YIN A;  3G30 A;  3GRJ A;  3IQA A;  3UB6 A;  4DKI A;  4Q8I A;  1S4S A;  1XA1 A;  2AVX A;  3ITA A;  3PXP A;  2PT7 A;  2Y2K A;  3F1P A;  2QWS A;  2EX9 A;  3JPU A;  3C30 A;  3E2L A;  4Y15 A;  3ISG A;  2E8I A;  4CLC A;  3HVF A;  1XJ2 A;  5D3O A;  4BLM A;  3IF6 C;  4CLC E;  1FSY A;  2BLS A;  5M1A A;  2A24 A;  3IT9 A;  3B47 A;  3T4Q A;  5IS1 A;  2XA7 S;  3GEC A;  4EBL A;  2WGW A;  4NXG A;  5EUA A;  3S22 A;  1ZC2 A;  4NG2 A;  3DWZ A;  1WYC A;  2H5S A;  3PBO A;  1TS7 A;  5FQI A;  4P87 A;  1PZP A;  3CLO A;  2HP6 A;  4LEN A;  2Z6C A;  3W8K A;  1PFL A;  4PAU A;  5E2G A;  4R70 A;  1XGI A;  1XX2 A;  1FOF A;  2J8Y A;  1HZO A;  2Y2L A;  5EFW A;  3VSK A;  4HP9 A;  2FFF B;  5L09 A;  1WA9 A;  4GZB A;  4E3L A;  3GSG A;  3VE3 A;  3EQV A;  2XQZ A;  1YLY A;  4OQ0 A;  4K91 A;  1K57 C;  5FAS A;  3BY9 A;  2ZOH A;  2PR5 A;  1N4O A;  5HPI A;  5HPF A;  4X1L A;  1XJ3 A;  1OTB A;  3A0V A;  3UDI A;  3UPO A;  2OWH A;  5FQQ A;  1SZV A;  2QZ6 A;  4HIA A;  1CEG A;  2W3D A;  1NRF A;  3HLF A;  4B4X A;  1T19 A;  5HAQ A;  5EEC A;  1YAX A;  1IEL A;  2VV6 A;  4Y13 A;  1HD8 A;  5DVA A;  2GDN A;  2M1C A;  4B88 A;  1K4E A;  4S2M A;  1L2S A;  1Y28 A;  3LR0 A;  4L9E A;  4IVK A;  4BBT A;  4LFU A;  1SDN A;  4X1M A;  2O99 A;  1PWG A;  3ZG0 A;  3T4K A;  2P08 A;  4P6Z S;  3MFX A;  4LV0 A;  4LPZ A;  3W4Q A;  2ZJ9 A;  2JC7 A;  2OLU A;  4C6Y A;  4GDN A;  3A3F A;  4R4R A;  3O87 A;  3NJA A;  1T18 A;  3SZT A;  4PMA A;  4JF5 A;  3SS4 A;  3C4P A;  3T50 A;  5C5K A;  2INW A;  2X01 A;  2J7V A;  3UDF A;  2ZD8 A;  4S2O A;  4BBU A;  3F1P B;  1ACF A;  4ZJ1 A;  3D72 A;  5LBR A;  4KZB A;  1ONH A;  4IUH A;  4FUW A;  3PR6 A;  1LHY A;  3IS2 B;  1DP6 A;  2HDU A;  4RA7 A;  4WEK A;  4WZ5 A;  1KDS A;  4CLC D;  2A24 B;  3SH8 A;  5DTK A;  2OWJ A;  1PZO A;  4MCW A;  5CHU A;  4KZ3 A;  2IWD A;  2IA2 A;  1ERM A;  2HF6 A;  1C3B A;  5DTS A;  1YSQ A;  1YLP A;  3DAV A;  2J9O A;  1S4R A;  3IXB A;  3HLC A;  3G35 A;  2OV5 A;  1LL8 A;  4LV2 A;  3N8L A;  4JLF A;  5GHZ A;  4I3A A;  2ZOI A;  1BYW A;  1QME A;  1G28 A;  3EWK A;  4OOY A;  2H0Y A;  1PI4 A;  3V39 A;  2ZQ7 A;  2ZC5 B;  3U2A A;  4WL9 A;  3C8C A;  3E4P A;  5HFO A;  3ZHH A;  3T1S A;  4OQI A;  2B5R A;  2ZL1 A;  2W1T A;  3W2Z A;  1ZHH B;  1AWI A;  2HDS A;  3SW1 A;  1KOU A;  3TRC A;  1DY6 A;  2Q0O A;  1FIK A;  5A92 A;  2QJ7 A;  4GLQ A;  2HJE A;  1L3L A;  4N1X A;  1SKO A;  2VX8 A;  5F82 A;  5FI2 A;  1ESU A;  4I39 A;  4I3I A;  2VA0 A;  5DKK A;  1S0W A;  3BEB A;  3FKW A;  3SS5 A;  1K25 A;  5HDC A;  4X56 A;  1Y54 A;  5GL9 A;  3BFD A;  3C5A A;  3DTM A;  3HBR A;  1XP4 A;  2D02 A;  4NKP A;  1BT5 A;  3NDG A;  1MWT A;  4H6J A;  4NXE A;  3WRZ A;  3RXX A;  3TJZ C;  5HW3 A;  2J3W A;  4O0P A;  3UPP A;  1JNU A;  4OQH A;  4MEZ A;  4HJ3 A;  1NXY A;  1MWU A;  5F5Y A;  4Y3I A;  2WKP A;  4UQI M;  1IYO A;  2K2N A;  1JWP A;  4XXR A;  4PM7 A;  4CQH A;  3NUL A;  1K55 C;  3G32 A;  3EEH A;  1FCN A;  4WYY A;  4WMC A;  1NYY A;  4OKP A;  3ZNY A;  1RCJ A;  1F9I A;  2EXA A;  2VV7 A;  1ZTU A;  2PU4 A;  4M3K A;  3OPH A;  1XFN A;  3H82 A;  2ZQ9 A;  1N9O A;  2ZBB A;  3A3I A;  3VSL A;  1PWC A;  1S66 L;  4X53 A;  3G2Z A;  3PBQ A;  3HL9 A;  5A91 A;  2EX2 A;  4MBH A;  2Y91 A;  5U47 A;  3EQU A;  4R6L A;  2WAF A;  3UO9 A;  4KZ4 A;  1EW0 A;  3VMA A;  4QHC A;  1ES5 A;  1BLH A;  5CTM A;  4K08 A;  1P97 A;  3N6I A;  3BM6 A;  1LI0 A;  3IH8 A;  4BMW A;  1GHP A;  4I38 A;  2PDR A;  1OTI A;  1FIL A;  2M7U A;  1DP9 A;  4R38 A;  1E25 A;  2ZL1 B;  2W1T B;  1LL9 A;  3BYD A;  3CWF A;  5EM1 A;  3E2K A;  4ZBE A;  1I2W A;  1KE0 A;  5FI6 A;  1K54 C;  1XGJ A;  5DJU A;  5CHM A;  4KQO A;  4QU3 A;  3B42 A;  3NY4 A;  4EQ1 A;  1SKO B;  2P74 A;  2WKE A;  5G4Y A;  1ERQ A;  5CEC A;  1Q2Q A;  4ETX A;  3UME A;  4EXO A;  3N4I A;  3ZVW A;  1N9L A;  1F98 A;  2JKT I;  1XA7 A;  3WS5 A;  3LY3 A;  2JKR I;  4X68 A;  4EU0 A;  4Y0U A;  4QJG A;  1CK3 A;  1AXB A;  2EFX A;  2HDQ A;  5E2F A;  4ZTK A;  3ZCZ A;  1HVB A;  3FZC A;  3IXG A;  3LIB A;  4MN5 A;  2O9A A;  4BBV A;  5EOO A;  4FD8 A;  4NET A;  4MLL A;  1H8Y A;  5FQM A;  2Y2M A;  3CG5 A;  1UWN X;  2L0W A;  1K56 D;  4OPZ A;  4MBF A;  1PNE A;  3OPR A;  3MR0 A;  5CX7 A;  2K7S A;  4M4X A;  1W63 M;  5DF8 A;  2GX5 A;  3PYP A;  2FH5 A;  4RQ9 A;  3P01 A;  2A49 A;  5GLD A;  2WGI A;  3K3D A;  4GNU A;  1N9B A;  1TDL A;  3H82 B;  1DJB A;  4F3L B;  1IEM A;  1KVL A;  3Q1F A;  1BLS A;  1JWZ A;  3K3C A;  2XEP A;  3V3S A;  3QNC A;  1JTG A;  1OME A;  3ZNT A;  5HL1 A;  2J9P A;  3EEA A;  4NXB A;  4PKY G;  1FR6 A;  4B9O A;  3P7N A;  1NJ4 A;  3RXW A;  2ZC6 B;  3JVU A;  4DXC A;  2V8C A;  4JGQ A;  1IYP A;  4OP5 A;  2BTF P;  4HEF A;  4S2N C;  3OCN A;  2PBY A;  4Y17 A;  2WKR A;  1LL5 A;  1UWP X;  3C7V A;  3V50 A;  3BRM A;  4P6B A;  4OPY A;  3UY6 A;  5CED A;  2IWC A;  3R7W A;  4E04 A;  2YKF A;  1MPL A;  3PHY A;  3UE1 A;  1MY8 A;  1H8M A;  4Y2F A;  3MS6 A;  3LCE A;  4A5R A;  2EX6 A;  3MXQ A;  3DTE A;  3DTK A;  2CC1 A;  1GSW A;  4S2L A;  4DMZ A;  3CUE C;  5G18 A;  4GS9 B;  4EUV A;  2V0U A;  4OON A;  2HV1 A;  3IH9 A;  1EWZ A;  3LID A;  3ZGA B;  4K0W A;  4WM9 A;  3K2N A;  5CRF A;  4IBR A;  4OVD A;  3UB7 A;  1QMF A;  2WK0 A;  2Y4A A;  4ARZ A;  1JTD A;  2Z6D A;  3JYI A;  3SS3 A;  1BUL A;  4X6T A;  3EOI A;  3RTY A;  3EGD C;  4BD1 A;  1PRQ A;  4C3Q A;  2Q9N A;  4ZJ3 A;  5CGS A;  2P04 A;  5CXW A;  1LI9 A;  2E8J A;  1STZ A;  4RX2 A;  1RGY A;  2ZQ8 A;  5E43 A;  4AFI A;  1MWS A;  3T1R A;  4XT2 A;  1IFQ A;  4BD0 A;  5EVI A;  1L0F A;  4LV1 A;  4Y0O A;  4OLG A;  2W27 A;  2ZMA A;  4HY8 A;  3AGF A;  4GD8 A;  3VP3 A;  5L2F A;  2P9V A;  4DJ3 A;  1ONG A;  2PYR A;  4HH3 A;  3W4P A;  4HBT A;  1O07 A;  3MSH A;  1K0K A;  1TS0 A;  2XD5 A;  2XFS A;  2H0T A;  3TE8 A;  2Z2L B;  1S1Z A;  4MBK A;  1MKM A;  2WKQ A;  1L0E A;  5CER A;  3LUQ A;  2NUP C;  3G4P A;  5IT5 A;  5J8X A;  3HLE A;  2JN7 A;  4OQG A;  2XGN A;  4FSF A;  4OP8 A;  2O9B A;  3T1X A;  1S1Y A;  3GQZ A;  4IED A;  1P0Z A;  1E4D A;  2IWB A;  2ZQA A;  1MKI A;  2XD1 A;  2XK1 A;  2V20 A;  3OPP A;  3R7W B;  5FDH A;  2Z2M B;  1BUE A;  4KG6 A;  2Y2N A;  4HP4 A;  3VP4 A;  2WUQ A;  2B02 A;  3BW6 A;  3VFH A;  1V9Z A;  3QP8 A;  5DTT A;  2ZC3 B;  2R9X A;  3A3D A;  1M6K A;  2YKH A;  1TDG A;  3OLO A;  1S6R A;  2RCX A;  1GSX A;  3F1O A;  5HD3 A;  4WEL A;  3S7P A;  5HZH A;  1SKF A;  4JKT A;  2JKG A;  3LR4 A;  3Q7V A;  3JVV A;  1NZU A;  2W3G A;  1K4F A;  4ARZ B;  1MZU A;  3IF6 A;  3FYZ A;  5TGF A;  2DRW A;  2PHY A;  4CLC B;  2ZM0 A;  1ES2 A;  4FH2 A;  2J3T C;  3NBL A;  5F6A A;  3C2W A;  1NZO A;  4N9L A;  3U4L P;  2Y2P A;  5AQB A;  3LIA A;  4EUZ A;  3UB9 A;  2KLI A;  2WGW B;  3MMH A;  5FAT A;  3DBA A;  2UV0 E;  3OPL A;  2VJW A;  1Z6F A;  3C7U A;  2JBF A;  4KZ7 A;  2FFY A;  3UB5 P;  3HCY A;  4IVI A;  4XT2 B;  4HHD A;  4BWI A;  2QYB A;  1RP5 A;  2GJ3 A;  3BQA A;  2K31 A;  1IOU A;  5EVI D;  4R3J A;  4GCZ A;  2B18 A;  3V3R A;  3V5M A;  3W4O A;  3V67 A;  4WEJ A;  1K57 A;  5CHJ A;  4F94 A;  5L10 A;  2UWX A;  5L07 A;  2Y59 A;  2QMI A;  3FPW A;  5HAI A;  1D06 A;  1KE3 A;  1PIO A;  3IWO A;  3HJI A;  3FKV A;  4PM8 A;  3M2K A;  2V1Z A;  1BSG A;  3UE6 A;  3OCL A;  1VQQ A;  1CI8 A;  1LT0 A;  4MN6 A;  4EQI A;  3N7W A;  2VGJ A;  3IBJ A;  3NDE A;  3DW0 A;  5TFQ A;  1UGU A;  4EWF A;  2XLN A;  4KUO A;  2V2F F;  4UQI S;  2JCH A;  5HDD A;  3NIA A;  1W8Q A;  5A93 A;  3ZG7 B;  2L4R A;  4P85 A;  5FDS A;  4NXF A;  2OLV A;  4PM5 A;  2PRF A;  1OT9 A;  3IBR A;  4N9K A;  2WAE A;  5HD5 A;  5DKL A;  4IJG A;  2W3F A;  4LCM A;  2VZW A;  1OTD A;  5F83 A;  4Q0I A;  3LI8 A;  1K56 A;  3F1O B;  1XJ4 A;  3LEZ A;  3MFD A;  5FEG A;  2G2W A;  3O86 A;  5JYO A;  1IYS A;  4E6W A;  2VLG A;  3WRT A;  1GCE A;  4GB7 A;  3H9W A;  5EPH A;  1NWZ A;  2XRO A;  1CEF A; 
#chains in the Genus database with same CATH homology
 1XJ2 A;  3KX0 X;  3VV4 A;  3LIF A;  4CLC E;  1OJ5 A;  4ETZ A;  3BQ8 A;  2A24 A;  1NLZ A;  3B47 A;  3S7O A;  3T4Q A;  2EA9 A;  3MR0 A;  5IS1 A;  5CX7 A;  2K7S A;  1NRJ A;  4M4X A;  4P6Z M;  1W63 M;  1DRM A;  2GX5 A;  2DMW A;  2OAP 1;  2FH5 A;  3PYP A;  2XA7 S;  1T1A A;  2I9V A;  3GEC A;  3PBT A;  3T4S A;  1W63 Q;  4RQ9 A;  3P01 A;  4LRY C;  4HJ4 A;  4NXG A;  4JGO A;  1OTE A;  3K3D A;  3KSF A;  4GHI A;  2H28 A;  3KO6 A;  3PBO A;  2M7V A;  3LIC A;  1TS7 A;  3H82 B;  3LR5 A;  3CLO A;  4F3L B;  2Z6C A;  4PAU A;  3T4O A;  4R70 A;  1VB6 A;  5HL6 A;  2GNX A;  3K3C A;  5EFW A;  2V1A A;  4HP9 A;  3EEA A;  3LFV A;  2VKS A;  3G6O A;  4NXB A;  4PKY G;  4B9O A;  3P7N A;  1WA9 A;  1XJ6 A;  3VE3 A;  2QKP A;  4Y5F A;  5DFY A;  5J7E A;  4O01 A;  2V0W A;  3EQV A;  3HJK A;  4EEP A;  1YKD A;  3JVU A;  5AVF A;  4HI4 A;  4IUK A;  3NOT C;  4JGQ A;  3ICY A;  3BY9 A;  3NHQ A;  1TS6 A;  2ZOH A;  2PR5 A;  5HPI A;  3VE4 A;  3F1N A;  3R4K A;  2L1M A;  3UMD A;  5HPF A;  3OCN A;  1OTB A;  1XJ3 A;  2WKR A;  2JHE A;  3A0V A;  2OWH A;  1UWP X;  3PBN A;  4Z1W A;  4HIA A;  2W3D A;  3R7W A;  4E04 A;  2YKF A;  3PHY A;  1S67 L;  1T1C A;  1T19 A;  4I5S A;  3LR3 A;  4QPR A;  3ULF A;  4NEE D;  1YAX A;  2VV6 A;  3E4O A;  1H8M A;  1XFQ A;  2M1C A;  5TBM A;  4OOM A;  4Y2F A;  2XSS A;  1OT6 A;  1Y28 A;  4IHQ A;  3LR0 A;  4L9E A;  4BBT A;  5F68 A;  3MQQ A;  1YSP A;  2O99 A;  2MJ6 A;  4LRZ E;  3MXQ A;  4H6J B;  4KQD A;  3T4K A;  5J3W A;  2P08 A;  3H7W A;  4Q0H A;  1GSW A;  4P6Z S;  3E4Q A;  4DMZ A;  4EES A;  3MFX A;  3CUE C;  4LPZ A;  4GS9 B;  3RFB A;  4EUV A;  2V0U A;  3ZYT A;  3RH8 B;  1N9N A;  2HV1 A;  3FG8 A;  1DP8 A;  4II7 A;  3LID A;  3NOU C;  3BY8 A;  4HNB A;  3K2N A;  4JGR A;  1OPX A;  3NJA A;  3S7N A;  1T18 A;  3OC2 A;  3LIE A;  3UB7 A;  4ARZ A;  2V1B A;  3T50 A;  1MC0 A;  2D01 A;  2Z6D A;  5C5K A;  2INW A;  4B93 A;  3EOI A;  3RTY A;  2NUT C;  3EGD C;  2ZMV A;  2PYP A;  4BBU A;  3F1P B;  5MC7 A;  2QJ5 A;  4YOF A;  3D72 A;  5LBR A;  2W3E A;  4IUH A;  3MF0 A;  3PR6 A;  2OOL A;  3IS2 B;  4CLC C;  1DP6 A;  2P04 A;  2OAQ 1;  1TD5 A;  4WEK A;  1TF1 A;  1STZ A;  5KIZ A;  4CLC D;  2A24 B;  3OOV A;  2OWJ A;  4MCW A;  2PD8 A;  2IA2 A;  4AFI A;  2HF6 A;  4XT2 A;  1IFQ A;  1YSQ A;  2XRN A;  3T4J A;  3GDI A;  3EGX C;  1S4R A;  3A0R A;  4F3L A;  2W27 A;  4DJ2 A;  4HY8 A;  2W0N A;  4GJ4 A;  1P9W A;  1LL8 A;  3E0Y A;  1F5M A;  1VHM A;  4I3A A;  3KYZ A;  3KSI A;  2ZOI A;  4DJ3 A;  1BYW A;  2HGV A;  2Y79 A;  2PYR A;  1G6O A;  4HH3 A;  1G28 A;  3EWK A;  1P9R A;  3U2A A;  4WL9 A;  1TS0 A;  2W3H A;  3C8C A;  3E4P A;  4MMN A;  4UEY A;  4L9G A;  3TE8 A;  4JGP A;  2W1T A;  1S1Z A;  3W2Z A;  1MKM A;  1ZHH B;  2WKQ A;  3UE3 A;  3MQ0 A;  3SW1 A;  1KOU A;  3LUQ A;  2NUP C;  3S7Q A;  5IT5 A;  3TRC A;  2JN7 A;  4I3J A;  5IU1 A;  4FSF A;  1LSV A;  2QJ7 A;  2O9B A;  4GLQ A;  2HJE A;  4WN5 A;  1S1Y A;  5TJJ A;  3F1N B;  4EEU A;  4KUK A;  2VX8 A;  1P0Z A;  5F69 A;  4I39 A;  4I3I A;  2VA0 A;  5DKK A;  3D3O A;  4PHT A;  5HDC A;  3R7W B;  5K5B A;  4PKY A;  3TW8 A;  5HWV A;  2A2L A;  2D02 A;  4NKP A;  4HP4 A;  3UB8 A;  2B02 A;  3BW6 A;  5TBM B;  1V9Z A;  5DF9 A;  5HWW A;  4H6J A;  4NXE A;  3TJZ C;  2J3W A;  2YKH A;  3KYQ A;  3OLO A;  4O0P A;  1H3Q A;  1GSX A;  2VGL M;  1JNU A;  4GS9 A;  3F1O A;  5HD3 A;  5I5L A;  4WEL A;  4HJ3 A;  2LB9 A;  3S7P A;  1X0O A;  2LB5 A;  3H7W B;  4Q0J A;  4L9F A;  5F5Y A;  4Y3I A;  5HZH A;  2WKP A;  5DJT A;  3C38 A;  4UQI M;  5FL3 A;  3BJN A;  3KSH A;  2K2N A;  4G3K A;  4CQH A;  3PBR A;  4MDZ A;  5AVE A;  3LR4 A;  3OBF A;  3JVV A;  3EEH A;  3E98 A;  2KX6 A;  2W3G A;  2Y8H A;  4HOI A;  4ARZ B;  1MZU A;  4HQA A;  4GW9 A;  3T4L A;  2EWV A;  2PHY A;  4CLC B;  2VEA A;  3NOP C;  1F9I A;  2VV8 A;  2VV7 A;  3CIT A;  3IS2 A;  2J3T C;  2O0Y A;  5F6A A;  1LSW A;  3C2W A;  1ZTU A;  4G3W A;  3A0S A;  3LIA A;  3MJQ A;  2J3T D;  3UB9 A;  2KLI A;  1XFN A;  3H82 A;  2ZMF A;  3CAX A;  1D7E A;  3VOL A;  3MMH A;  2GZA A;  1N9O A;  3DBA A;  5G4Z A;  2VJW A;  5AJG A;  4GHI B;  1OJG A;  2ZBB A;  5J4E A;  4FOF A;  3HCY A;  1S66 L;  2EWW A;  4XT2 B;  4HHD A;  4BWI A;  2QYB A;  3FPV A;  3PBQ A;  3ZQ5 A;  2GJ3 A;  5A8B A;  3BQA A;  2K31 A;  2PD7 A;  3LYX A;  1IOU A;  3O5Y A;  5DFX A;  1OTA A;  3EQU A;  4WF0 A;  4R6L A;  5HDS A;  3PBS A;  4GCZ A;  4EET B;  2B18 A;  2V9A A;  3B33 A;  1EW0 A;  4YWZ A;  3V67 A;  4WEJ A;  4EW7 A;  3LI9 A;  4K08 A;  1P97 A;  3BWL A;  4BJP A;  4R3A A;  1ODV A;  4ZRR A;  4BMW A;  4OOL A;  3FPW A;  4I38 A;  3CI6 A;  1D06 A;  2PDR A;  2XA7 M;  5HWT A;  1OTI A;  1TS8 A;  3HJI A;  4L0L A;  4WUJ A;  2O9C A;  2BAS A;  2R78 A;  1T1B A;  1DP9 A;  2FZ0 A;  2M7U A;  3UE6 A;  4R38 A;  2W1T B;  2VGL S;  3CWF A;  3OCL A;  1LT0 A;  4MN6 A;  5L8M A;  3IBJ A;  5DJU A;  4KQO A;  1UGU A;  3B42 A;  2JKT M;  4EQ1 A;  4KUO A;  4UQI S;  2JKR M;  2J80 A;  2KOI A;  4YNR A;  5HDD A;  3T4T A;  5G4Y A;  4G3V A;  4LLO B;  4ETX A;  3UME A;  4EXO A;  2W1R A;  4LRX C;  2P7J A;  2G7U A;  4EER A;  3FC7 A;  2L4R A;  1N9L A;  1F98 A;  1GSV A;  1LSX A;  4NXF A;  2JKT I;  5HSQ A;  5KSH A;  3MQO A;  2KDK A;  2JKR I;  4DN0 A;  2PR6 A;  1OT9 A;  3CUE A;  3IBR A;  4EU0 A;  1V9Y A;  5HD5 A;  5DKL A;  4IJG A;  4HJ6 A;  2W3F A;  2VZW A;  1OTD A;  4ME4 A;  4Q0I A;  3LI8 A;  3UB6 A;  3KSG A;  4HH2 A;  3F1O B;  2CMN A;  1S4S A;  2HJ9 C;  3PXP A;  1NLY A;  1XJ4 A;  3LIB A;  4MN5 A;  2PT7 A;  2O9A A;  4BBV A;  3F1P A;  2QWS A;  4WLA A;  2VLG A;  3C30 A;  2QHK A;  3H9W A;  4MN7 A;  1UWN X;  2L0W A;  1NWZ A;  2XRO A;  4O8G A;  4CLC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...