5HL6A

Crystal structure of a putative gaf sensor protein from burkholderia vietnamiensis
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
158
structure length
158
Chain Sequence
b'ASKAELYATLAEQARSLVESEPDLIANAANFSALVYHSLDRLNWAGFYFFDGTELVVGPFQGKPACVRIALGKGVCGTAAQTRQTQVVRDVHAFPGHIACDAASESEIVVPLVAADGTLIGVWDVDSPVAARFDDEDRSGMEALCRVFVEHAWQKARD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative GAF sensor protein
publication title Crystal Structure of a Putative GAF sensor protein from Burkholderia vietnamiensis
rcsb
source organism Burkholderia vietnamiensis (strain g4 / lmg 22486)
molecule tags Transferase
total genus 50
structure length 158
sequence length 158
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13185 GAF_2 GAF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.40 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 5hl6A00
2XSSA 2ZMFA 4Q0IA 4Y3IA 4ME4A 4DMZA 2Y8HA 2O9BA 3LFVA 3OOVA 2B18A 3MMHA 2HGVA 1ZTUA 2O99A 3CITA 4Y5FA 5K5BA 3IBRA 4BWIA 3MF0A 2W1RA 3CI6A 3S7PA 4PAUA 5HPFA 3OBFA 4MDZA 4IUHA 2KLIA 4EUVA 3BJNA 1F5MA 1MKMA 2GX5A 3G6OA 3RFBA 3E98A 3NOTC 2KOIA 3S7QA 3TRCA 4G3KA 3O5YA 4GLQA 2W1TB 3VV4A 3ZQ5A 2VJWA 3D3OA 3KSGA 5HSQA 4RQ9A 3NOPC 2LB9A 5I5LA 4YOFA 1YKDA 2IA2A 1YSPA 2W3EA 4CQHA 4DN0A 2XRNA 4E04A 3IBJA 2M7VA 3DBAA 4Q0HA 5DFXA 4Z1WA 4G3WA 3KO6A 5TJJA 5C5KA 3NOUC 2K2NA 2K31A 4IJGA 1STZA 2G7UA 1YSQA 3EEAA 2QYBA 4ZRRA 4QPRA 2O9AA 2W3DA 2W3GA 5DFYA 4MCWA 4O01A 2XROA 3NHQA 2W3FA 5AJGA 4EU0A 2Y79A 1TF1A 3K2NA 2M7UA 3S7OA 5LBRA 1MC0A 4R6LA 3C2WA 4FOFA 3W2ZA 4ETXA 4Y2FA 5HPIA 2O0YA 4LRYC 2VEAA 4MN7A 2O9CA 4MMNA 4R70A 4GW9A 2W1TA 3KSHA 3KSIA 4G3VA 2OOLA 1TD5A 4O8GA 5L8MA 3S7NA 3HCYA 2VZWA 5HL6A 2W3HA 3R4KA 4LRXC 4LRZE 3KSFA 3E0YA 4Q0JA 1VHMA 4IUKA 4ETZA 4O0PA 3MQ0A 2LB5A 4YNRA 2VKSA
chains in the Genus database with same CATH superfamily
1TS8A 2PR6A 2PR5A 3MMHA 3V3RA 3UB8A 1W5DA 3CITA 1XJ6A 4Y5FA 4OOYA 3U4LP 4NKPA 4I5SA 3NDEA 1ZHHB 5F6AA 3DTKA 5KSCA 2KLIA 3IF6B 3MS6A 4EEPA 4XUZA 1TVFA 1IYQA 3ZHHA 3MQQA 4OH0A 1H8ZA 5M18A 3OC2A 4BBUA 4KZAA 3CWFA 2YKFA 1J9MA 4Q0HA 5TGFA 1DP6A 2PBDP 5TJJA 2WAFA 3JVUA 1KDSA 1VETA 4ZRRA 4IEDA 1PIOA 3LICA 1QMEA 4E3LA 3IQAA 3LUQA 1H8MA 3RXWA 2QWSA 5GHZA 2PT7A 3GECA 5HDSA 1LL8A 4WELA 4FH2A 1TF1A 2WZZA 4Y2FA 4LRYC 2VEAA 1H0MA 4KG5A 2E8JA 1KGFA 4O8GA 4OQ0A 2XD5A 3DAVA 3NC8A 4R0QA 2BASA 4ZDXA 1K6SA 4ETZA 2WKHA 4BQMA 3PR6A 1FIKA 5F83A 3UB5P 1SKOA 3KX0X 5EM1A 1ZC2A 4F94A 4S2IA 3BQ8A 3VP1A 3LFVA 3W4OA 3Q82A 5DF9A 4WZ5A 1HLUP 5FQIA 3RXXA 4L9FA 3TW8A 4CLCD 4GLQA 2WADA 3D4FA 5FQJA 2VJWA 1GA9A 2NUPC 2XDMA 4N9KA 2QKPA 3ITBA 2QMIA 4HBTA 3M2KA 3SH8A 2CC1A 3MSHA 2PU2A 3W8KA 4ZAMA 1STZA 5HWVA 3DWKA 2Y2IA 2ZC4B 3O87A 5TBMB 3V39A 2EFXA 2MJ6A 3LI9A 5GHXA 1K57A 2HP9A 4GS9B 2ZD8A 3S4XA 4S2MA 5CHJA 3CMZA 4R1GA 4EQ1A 3ZG8B 1MXOA 4GDBA 2HV1A 4CLCC 5EE8A 4CLCB 1ES4A 3IF6A 3W2ZA 4ETXA 4X25A 1T19A 1ZG4A 1XXMA 1V9ZA 1PFLA 1XFQA 1T1AA 2X02A 2ZC3B 2FH5A 3L7HA 4P0MA 4LLOB 3KSFA 3GVBA 4I3IA 2ZC7A 1IYSA 5F1GA 4ZJ1A 4OOLA 1ERMA 3IS2A 3MZEA 4RVAA 4E3NA 2ZMFA 2OLVA 1CF0A 3T4TA 3NJAA 3H9WA 3O86A 4E3MA 3WS0A 3MQOA 2PHYA 5FQKA 2GNXA 4PAUA 4BBTA 1PWDA 1HVBA 4E6XA 1MKMA 4OONA 1GSXA 3VOYA 2ZL1A 2VGLM 5HD5A 1MBLA 2PYPA 4G3KA 2Q9MA 4HBUA 2WGIA 2PU4A 3K3CA 2OAP1 5FI7A 5CHUA 4BMWA 3MXRA 4B88A 4EEUA 4X56A 1V9YA 3LIFA 1JWZA 2INWA 2V8FA 4WEJA 2XA7M 2J3TD 4WM9A 1DJAA 1YT4A 3F1OB 4OPQA 3OPRA 3C30A 3P09A 1K56D 5F1FA 1YLWA 3T4SA 1FR1A 1L2SA 1OTIA 1EROA 2XFSA 5CGXA 3MBZA 3UY6A 3T12B 2DNSA 1PW1A 3R7WA 1IEMA 3K2NA 5FASA 2Y4AA 4BLMA 4DJ2A 2HPBA 1KE0A 2R9WA 4RA7A 3LY3A 1Q2QA 2WGVA 3MZFA 3MR0A 2PBYA 1VQQA 4AFIA 3AGEA 1NYYA 3N7WA 5CERA 1XPBA 1YMXA 3UPPA 4PKYG 2Y59A 4Y0UA 3BFEA 2J3TC 3M2JA 3IWQA 3MQ0A 4MN5A 4YNRA 5F5YA 4BD1A 4UA9A 3TSGA 1LLBA 5F68A 3FPWA 3OPPA 3FZCA 5DKKA 2HGVA 1FCOA 1I5QA 4DXCA 1JWPA 3IBRA 5EECA 4BWIA 4MN6A 1NLYA 3VMAA 1IYOA 3ZG7B 3BFGA 1SZVA 1DY6A 5MC7A 2JKGA 4N9LA 5EFWA 3N6IA 3ULFA 1LL5A 3DTEA 4FH4A 1LT0A 4XUXA 2GZAA 1PW8A 4LV1A 4H6JA 4PPRA 3NDGA 3MFDA 5CTNA 2JCHA 5KIZA 4NXGA 5FQQA 4Z1WA 1NZUA 3CPTB 1LSXA 4II7A 3N8LA 1W63Q 5G4ZA 3TG9A 3C7UA 1YMSA 5HL1A 4WLAA 3UB6A 1TEMA 5GLDA 4JGQA 4M4XA 5DJUA 2PDRA 5DF7A 4OLGA 3UMEA 5EVIA 5HPIA 4XT2A 4B9OA 1UGUA 4QD4A 1T1BA 1YLYA 5HDCA 4LPZA 3JYIA 1F9IA 2XLNA 2BTFP 3T50A 4LCMA 3GTCA 4KG6A 3DW0A 1S0WA 1W63M 4NETA 1YPRA 3ZVWA 3EWKA 2J8YA 1K55A 2UV0E 3F1NA 4HEFA 3LIEA 4QU3A 4MEZA 2PRFA 1IFQA 2ZLYA 4EBLA 1G68A 3BLMA 3M6HA 4GD6A 4P87A 3T1SA 5FA7A 3T4QA 1FCNA 3S7QA 4JXVA 4JBFA 4WYYA 2W0NA 3D3OA 3HJIA 2ZOHA 1PZOA 4DF6A 1EWZA 4BL3A 1PWGA 2B95A 5FI6A 2WK0A 4S2OA 1LI0A 3JPUA 2XGNA 2RL3A 1KVMA 4BBVA 1TS7A 2G7UA 4KQDA 3AGFA 4BENA 2QYBA 1K25A 4I38A 3IWOA 4QY5A 3QP5A 2Y2KA 1K56A 1MPLA 3EGDC 4R3JA 3PBNA 3ZG5A 2Y91A 2DCFA 4FSFA 4JXGA 3G34A 1FSWA 4C3QA 4GJ4A 5EVEA 4GN2A 5GLCA 3E4OA 2WGWA 2Q9NA 4CJNA 3GV9A 2G2UA 3UE1A 4O7DA 2ZQ8A 2ZQ9A 2EA9A 2P74A 3R4KA 4DRTA 2ZMVA 3G2ZA 4OKPA 3IXBA 3E4QA 1PNEA 4OLDA 3CPTA 4KZ8A 3UB7A 1O7EA 3OCNA 4HQAA 4WZ5C 2EX8A 4PKYA 1ESUA 3HVFA 4MBKA 3FKWA 4PHTA 4Y17A 4E3KA 2OAQ1 3KYZA 4S2PA 3Q07A 5J8XA 4YINA 3PBQA 1FSYA 3NOTC 2ZQAA 4PMAA 3LIBA 3VV4A 4D60A 3KSGA 1H8YA 5KSHA 1MY8A 4KZ7A 1CK3A 5U47A 2A24A 4E04A 3IX3A 5KMWA 1RCJA 3Q7VA 5CHMA 1I2SA 5AQ9A 2HDSA 1AWIA 4ESPA 4EXOA 4KZ9A 3ZFZA 3QP4A 3LR5A 2P9VA 5EV0A 3OZHA 5FI2A 2Y79A 3E2KA 3IF5A 3LEQA 4DDYA 3O88A 5AQBA 3TOIA 2O9CA 1JTDA 3KSIA 5AVEA 1T18A 1BT5A 3MFXA 2WKPA 5L8MA 3LGOA 3HUOA 3UDXA 1JVJA 2VGLS 2WAEA 4LRXC 1W7FA 1ES2A 3ITAA 4WN5A 3UPNA 1MWSA 1H3QA 4X55A 5HFOA 3IXGA 3SZTA 3UMDA 1W79A 3QNBA 5L2FA 3Q81A 4ARZB 4DJ3A 2OWJA 2C5WB 3HLGA 5HD3A 5IT5A 2XA7S 4N92A 3ZVTA 5HPFA 3C7VA 4HH2A 5E2EA 3A0SA 4R38A 4GDNA 2XEPA 2ZQ7A 3EQUA 4L9EA 2D02A 2WKQA 1FILA 1J3WA 3O5YA 3BWLA 3T4KA 1TS6A 5EPHA 5EM0A 1YLZA 1YKDA 1N4OA 4DN0A 2EX2A 2HP5A 2JKTI 2Z6CA 4S2NC 5D3OA 4QPRA 1ODVA 2O9AA 1X0OA 3TE8A 3OPHA 2W3GA 2GDNA 3ICYA 3NHQA 1OTBA 1XP4A 3L9KA 5L10A 4CLCE 2EX6A 3MZDA 4GZBA 3QNCA 3SH7A 4EU0A 4KQRA 4K0XA 1KVLA 4R6LA 4EESA 5GL9A 1A0KA 2EX9A 2V1ZA 4UQIM 3M6BA 3IT9A 3AGDA 1NYMA 3KSHA 1N9BA 1TD5A 1XKZA 3QP1A 3CAXA 1C3BA 4M3KA 3VP0A 5F69A 1WA9A 3BY8A 3IX8A 3BEBA 2V0UA 3B33A 3LYXA 2XD1A 2E8IA 4I3JA 4Q0IA 3F1PB 2R9XA 3OOVA 1G6OA 2QPNA 2C6WB 3V5MA 5A93A 1S4RA 2OV5A 2ACGA 3ZG9B 5EOEA 4OPRA 5HAQA 2V9AA 4JXWA 3VFFA 3JVVA 2Y2JA 2JKRI 1NJ4A 3FWLA 3BECA 3LR0A 3CJMA 5HSQA 4HJ4A 5TFQA 2HDQA 3NOPC 3VSLA 1E3UD 1ES5A 3TJZC 3EGXC 5TR7A 1XA7A 4Z9QA 2Z6DA 3NCKA 1IKIA 4NG2A 1P0ZA 2VK3A 4JGRA 1XGJA 2XF3A 2YKHA 4MCWA 4LENA 4B4ZA 1WYBA 4KQQA 4LV3A 1G6AA 2VGJA 2OSUA 1HD8A 1KGGA 3LR3A 1Y54A 4F3LB 4ZJ2A 3RJUA 3PXPA 3VOZA 4G3VA 1LI9A 4C75A 2ZQCA 1PI5A 4EBNA 2NUTC 2L4RA 3HLCA 3QP2A 1UWNX 1HZOA 5FL3A 3ZNYA 1BSGA 1LL9A 1XJ4A 4YFMA 1VHMA 3A3IA 3KYEA 2J9OA 3N8RA 1YQSA 1K55C 2LB5A 1NLZA 3HLWA 1QMFA 3T1QB 3E4PA 3MKEA 2OLUA 3DTMA 4QJGA 2V0WA 1N9LA 3LI8A 5L09A 5GLBA 2W1RA 5A91A 3GDIA 3MXQA 2HJ9C 3N8SA 4LCLA 1BLCA 5HWTA 2X01A 3WS5A 1S4SA 3LCEA 2JKTM 2Y2PA 2Z2MB 3T4JA 5G18A 1K54A 4E3JA 1NXYA 1BYWA 3GRJA 5TBMA 3GSGA 3T1RA 2BLSA 3G31A 3CUEC 4R23A 4GS9A 3WS2A 1GSVA 3KO6A 5KZHA 4FUWA 1RGYA 3P98A 3VSKA 1RGZA 4CLCA 4DXBA 4K91A 3HL9A 4NXFA 2WYXA 4DDSA 4IBRA 2L0WA 3I7JA 3PBRA 1ACFA 1S67L 3A3EA 4HI4A 4UEYA 2W3FA 3ZGAB 4N1HA 1S1YA 1GHMA 4HHDA 1P9WA 4KZ5A 3C2WA 4RX2A 5FATA 4MLLA 1VEUB 4MN7A 4IVKA 1D06A 4LFUA 3HLBA 2Y2GA 5CTMA 4K08A 4S2LA 3PBOA 4LRZE 4DE0A 3BW6A 1SCWA 1Y28A 1FCMA 2A49A 5L07A 3K3DA 4EUZA 1E4DA 3P01A 2XSSA 4U0XA 4Q8IA 1KE4A 4JF5A 3ZYTA 5FQMA 4A5RA 3GR2A 5J4EA 3IWIA 1KE3A 1P97A 1CEGA 3LR4A 3IHAA 2Q0OA 3WWXA 1WE4A 2IWBA 3CZDA 3E98A 2ZMAA 3MJQA 3V67A 3VP2A 3SW1A 1SKFA 3F1OA 1ERQA 4R4SA 4ZTKA 2XFTA 1SDEA 3A0VA 2HF6A 5I5LA 5BOHA 2JHEA 1E3UA 4OP5A 2RCXA 3C4OA 1ESIA 1PZPA 4U3TA 2G2WA 3OCLA 1YSQA 5DTSA 4R3BA 5FSRA 4UAAA 4HH3A 4GHIB 4OVDA 1D7EA 3A0RA 4L0LA 4D2OA 5IU1A 1PRQA 2WKRA 3FYZA 1VETB 4OQIA 3G30A 4LV0A 4P85A 3PYPA 1CI8A 3EEHA 4IHQA 4WF0A 5J7EA 4E3OA 3HREA 1GSWA 1JTGA 3IHBA 4OQGA 1LHYA 1F98A 5J3WA 4K0WA 2VZWA 1YAXA 2B5RA 3H7WB 3VE4A 4Q0JA 4KUOA 4N1XA 4KZ6A 4EETB 5FEFA 3C4PA 4R4RA 4DMZA 3UNWA 4PM9A 2JBFA 1ES3A 2VGKA 2ZC5B 4NEED 4WMCD 1OT9A 4Y15A 5K5BA 1CI9A 4L9GA 1L3LA 3OBFA 5HX9A 2X71A 1BUEA 2A3UA 2VA0A 4ZJ3A 4FTXA 4X6TA 2KOIA 3TRCA 4MBHA 3W4PA 3B47A 1VEUA 3ZQ5A 2W27A 5FQ9A 1IELA 3FKVA 3SOIA 2ZC6B 4LGWA 1NRJA 3NBLA 1FOFA 2IA2A 5DKLA 3T1XA 3HLDA 2WUQA 4GKUA 1K4FA 2H5SA 4UQIS 3G4PA 3HBRA 3IXHA 5EVLA 1BZAA 2Y2NA 4JF4A 3P7NA 3NI9A 1W8YA 1MWRA 2ZBBA 3BLSA 3IH8A 4UHUA 2XROA 3A3JA 2P08A 4HESA 3UB9A 3VOLA 1S6RA 2D01A 1GHIA 1LSWA 5CGSA 1XFNA 2J7VA 3GQZA 3IXDA 3ZG0A 4X69A 1L0EA 2PD7A 1O07A 2JE5A 1K57C 1K4EA 3UO9A 4EQIA 3LIDA 3QHYA 4MNRA 3HCYA 1VM1A 4KZ3A 3BRMA 5HL6A 2Y2LA 2DMWA 4JGOA 1K38A 3IF6C 3E0YA 1DRMA 1UWPX 4X53A 2JKFA 5DTKA 4Y0OA 1OPXA 2QJ5A 2ZM2A 2HZ5A 2VKSA 2XK1A 1ONHA 1CEFA 2FZ0A 4WZ4A 4GHIA 1HTZA 4S2JA 1AXBA 1PWCA 1K6RA 3MF0A 4MDZA 4IUHA 4RYEA 3IS2B 1L0DA 3FV7A 3BJNA 3NY4A 3RFBA 2AVXA 1OTEA 4FD8A 3UPOA 1L0FA 4BL2A 1H5XA 2XQZA 2LB9A 3ZNTA 5FAOA 2W3EA 4EW7A 2ZL1B 2KX6A 3H7WA 2VV8A 5CGWA 3WRTA 3NOUC 2PD8A 3ZCZA 2M1CA 3EEAA 1NY0A 3UDFA 3CHWP 2L1MA 5IHVA 3A3FA 1XA1A 2R78A 5DJTA 2FFFB 3ZDJA 3Q7ZA 4HOIA 3VP3A 2H28A 4QY6A 3GMWA 3WS1A 4B93A 4DKIA 4P6ZM 3S7OA 5HWWA 3D9YA 4PM7A 1MC0A 3HLFA 2WZXA 2Z2LB 1Z6FA 2FFYA 2OOLA 3FC7A 2H0YA 5FAQA 4GNUA 3S7NA 3R7WB 4JPMA 5F82A 1PI4A 1W8QA 4OOMA 3ISGA 4JXSA 1N9NA 1OT6A 2V1AA 1N9OA 4WBGA 2Y2OA 4QWOA 4WMCA 3QP6A 5CECA 2Y2QA 1TDLA 3S7PA 1FQGA 2EXAA 1F5MA 5HDDA 2K7SA 3EQVA 3H82B 1YLPA 3BM6A 1K54C 5FEGA 2WKEA 5FDHA 4HY8A 4UA7A 5CEBA 4IVIA 3HLEA 1MWUA 2QHKA 5DTTA 4ID4A 4NK3A 4YOFA 5CRFA 1BLPA 1ZG6A 5CXWA 5EVID 4G3WA 2K2NA 2K31A 4KZBA 1NWZA 2W3DA 1U60A 4H6JB 1G5UA 3CLOA 4R3AA 5CEDA 1JNUA 2KDKA 3A3DA 4O01A 4KZ4A 4WEKA 3EOIA 2BG1A 1BTLA 1SHVA 2ZM0A 3RH8B 5DF8A 1OJ5A 2DRWA 5LBRA 1ZKJA 5EOOA 3V50A 4P6BA 3B3XA 4HP4A 2B02A 3UE6A 1E25A 3V3SA 4H8RA 3PAGA 3LY4A 2P04A 3PHYA 1S1ZA 4WUJA 2IWCA 1NZOA 4ARZA 5JYPA 1BLSA 1GHPA 5EVIC 1VB6A 5EVIB 3BFCA 1MWTA 4XXRA 4XT2B 4ZBEA 1NRFA 3LO7A 3IH9A 4MBFA 3UDIA 4I39A 1PYYA 2PYRA 3Q1FA 2O9BA 3SS3A 3T4LA 1P9RA 1I2WA 2EFUA 3WRZA 1IKGA 1M40A 4JGPA 4HIAA 5M19A 4Y0TA 2EWWA 4IBXA 1YM1A 2GX5A 4RX3A 3G6OA 3C5AA 3T4OA 2W1TB 3F1NB 4S2NA 2IWDA 1TS0A 4QB8A 1CJFA 3D72A 4EBPA 4KG2A 4EERA 5A90A 5FAPA 5DVAA 3PBTA 3SH9A 4IJGA 5A92A 3UE0A 2V2FF 3KYQA 1DJCA 1L0GA 1EI5A 1XGIA 2VV7A 5HW3A 4Y7PA 2Y55A 4OPYA 4WL9A 3NIAA 2A2LA 4B4XA 1XJ2A 1BULA 1FR6A 4Y13A 2M7UA 4QHCA 2QJ7A 3FPVA 3H82A 1TDGA 4MMNA 5IS1A 3QP8A 4GW9A 3CG5A 3F1PA 3OPLA 3WS4A 3PBSA 5E43A 4PM5A 2ZOIA 2CMNA 1MKIA 1DP8A 3HUMA 2PAVP 2XH9A 1DP9A 2J80A 5M1AA 3MKFA 3FG8A 4E6WA 2WGWB 2Y2MA 1ONGA 2OWHA 1OTDA 3VP4A 2HJEA 2Y8HA 1M6KA 1OMEA 1CQAA 4GB7A 5EUAA 2JC7A 4GCZA 1ZTUA 4FCFA 1IOUA 4X1LA 1GA0A 3UE3A 4PM8A 3BY9A 4HJ3A 4NXEA 1F2KA 3CI6A 3W4QA 3UN7A 3DTIA 4JKTA 1T1CA 2HDRA 2I72A 2H10A 3N4IA 1XJ3A 4X68A 2WKIA 4EV4A 3G35A 4UA6A 4KQOA 4PM6A 3S1YA 1KOUA 1KDWA 1OJGA 2JKRM 2J3WA 1RP5A 3BYDA 3OLOA 1YLTA 1WYCA 1D1JA 1YSPA 1G28A 4GOGA 4CQHA 2ZQDA 2XRNA 2VV6A 2ZJ9A 2M7VA 5I94A 2VLGA 5E2FA 4OQHA 2EWVA 5C5KA 1IYPA 1KGEA 4F3LA 3PTEA 2J9PA 4U0TA 5DFYA 3VFHA 2HP6A 2GJ3A 4OPZA 2A24B 5CX7A 5E2GA 3Q7VB 2EXBA 1XX2A 1S66L 4HJ6A 5JYOA 2V1BA 4DE3A 1Z09A 4C6YA 1JWVA 2O0YA 4I3AA 5HZHA 2V20A 4R70A 2W1TA 1OTAA 3DWZA 3O3VA 1ALQA 3NECA 4HP9A 2P9VB 2V8CA 2W3HA 2Y2HA 1GCEA 5G4YA 3E2LA 3C8CA 1K0KA 4HNBA 2HDUA 4O0PA 3LEZA 5A8BA 2VX8A 4NXBA 4BJPA 5FDSA 4JF6A 1DJBA 3G32A 4Y3IA 4ME4A 3SS4A 3BQAA 4KUKA 2B18A 3MXSA 2O99A 4GD8A 5AQAA 5GHYA 4S2KA 4EUVA 2XR0A 2QZ6A 3C38A 3NULA 4KENB 1BLHA 3S22A 3LIAA 3PAEA 3CUEA 4JLFA 1EW0A 3BFDA 3BFFA 3RTYA 1Y4OA 4DE1A 1YLJA 4RQ9A 3SS5A 4P6ZS 1LSVA 3G2YA 3IBJA 2ZM8A 4X1MA 3DBAA 5DFXA 1SKOB 5GLAA 4BD0A 2JN7A 5HARA 3HUNA 2H0TA 1SDNA 4DE2A 4EWFA 4YWZA 4E3IA 5AVFA 5AJGA 3IX4A 5HAPA 2UWXA 4LV2A 2P7JA 4FOFA 4CPKA 2I9VA 3HJKA 4OP8A 5E2HA 1Q2PA 5AQ7A 1MZUA 3U2AA 3VE3A 4IUKA 5HAIA 3B42A
chains in the Genus database with same CATH topology
1N9NA 1NLZA 1OT6A 1TS8A 2V1AA 3EWKA 1N9OA 2PR6A 3E4PA 2PR5A 3MMHA 3F1NA 3LIEA 3UB8A 3CITA 1XJ6A 4Y5FA 2V0WA 1N9LA 3LI8A 1IFQA 4NKPA 4I5SA 2W1RA 1ZHHB 3S7PA 3GDIA 3MXQA 5F6AA 2HJ9C 2KLIA 5HWTA 3T4QA 1F5MA 5HDDA 4EEPA 2K7SA 3EQVA 3H82B 1S4SA 3S7QA 2JKTM 2W0NA 3D3OA 3HJIA 2ZOHA 3MQQA 3T4JA 4HY8A 1BYWA 2QHKA 3OC2A 4BBUA 4YOFA 5TBMA 3CWFA 2YKFA 4Q0HA 3CUEC 4GS9A 1GSVA 1DP6A 3KO6A 4G3WA 5TJJA 4BBVA 2K2NA 2K31A 1TS7A 1NWZA 3JVUA 2G7UA 4KQDA 2QYBA 4ZRRA 2W3DA 4H6JB 4CLCA 3CLOA 4I38A 4R3AA 3LICA 1JNUA 2KDKA 4NXFA 4O01A 4WEKA 3EOIA 3LUQA 1H8MA 2QWSA 3EGDC 3PBNA 2L0WA 2PT7A 3GECA 3PBRA 5HDSA 1S67L 4HI4A 4UEYA 1LL8A 2W3FA 4FSFA 4WELA 1S1YA 1TF1A 3RH8B 4HHDA 1P9WA 1OJ5A 5LBRA 3C2WA 4GJ4A 4Y2FA 4HP4A 2B02A 4LRYC 2VEAA 3E4OA 4MN7A 3UE6A 2P04A 1D06A 3PHYA 4O8GA 1S1ZA 4WUJA 4K08A 2EA9A 4ARZA 3PBOA 3R4KA 2ZMVA 4LRZE 2BASA 1VB6A 3BW6A 4ETZA 1Y28A 3E4QA 3PR6A 3K3DA 4XT2B 3KX0X 3P01A 2XSSA 3UB7A 3OCNA 4I39A 2PYRA 4HQAA 3ZYTA 2O9BA 3BQ8A 3LFVA 5J4EA 3T4LA 1P9RA 4PKYA 1P97A 3LR4A 4PHTA 5DF9A 4JGPA 4HIAA 2OAQ1 3KYZA 2EWWA 3PBQA 4L9FA 2GX5A 3G6OA 3E98A 3T4OA 3NOTC 3TW8A 4CLCD 4GLQA 2W1TB 3F1NB 3MJQA 3LIBA 3V67A 3VV4A 2VJWA 3KSGA 2NUPC 3SW1A 5KSHA 1TS0A 2QKPA 3F1OA 3A0VA 2HF6A 5I5LA 3D72A 2JHEA 2A24A 4EERA 4E04A 3PBTA 3OCLA 4IJGA 1STZA 5HWVA 1YSQA 3KYQA 4HH3A 4GHIB 1D7EA 5TBMB 2VV7A 2MJ6A 3LI9A 3A0RA 4L0LA 4EXOA 4GS9B 5IU1A 4WL9A 2A2LA 1XJ2A 3LR5A 2WKRA 4EQ1A 2Y79A 2M7UA 2HV1A 3PYPA 4CLCC 4CLCB 3W2ZA 4ETXA 2QJ7A 3EEHA 4IHQA 1T19A 4WF0A 3FPVA 5J7EA 3H82A 1GSWA 2O9CA 4MMNA 5IS1A 4GW9A 3KSIA 1V9ZA 3F1PA 5AVEA 1T18A 3MFXA 1XFQA 2WKPA 1F98A 5L8MA 5J3WA 1T1AA 3PBSA 2VZWA 1YAXA 2FH5A 2VGLS 2ZOIA 2CMNA 4LRXC 3H7WB 1DP8A 3VE4A 4LLOB 3KSFA 4Q0JA 4KUOA 1DP9A 4I3IA 2J80A 4WN5A 4EETB 3FG8A 4OOLA 3IS2A 1H3QA 2ZMFA 4DMZA 2OWHA 1OTDA 3UMDA 2HJEA 2Y8HA 3T4TA 3NJAA 3H9WA 4GCZA 4ARZB 1ZTUA 4DJ3A 2OWJA 4NEED 1IOUA 1OT9A 3MQOA 2PHYA 5K5BA 3UE3A 5HD3A 5IT5A 3BY9A 4HJ3A 4NXEA 2XA7S 3CI6A 2GNXA 4L9GA 4PAUA 5HPFA 3OBFA 4HH2A 4BBTA 3A0SA 4R38A 1T1CA 2VA0A 3EQUA 4L9EA 2D02A 1MKMA 2WKQA 1GSXA 2VGLM 5HD5A 2KOIA 3TRCA 2PYPA 4G3KA 3O5YA 1XJ3A 3BWLA 3T4KA 3B47A 3ZQ5A 2W27A 4KQOA 1KOUA 1OJGA 1TS6A 2JKRM 2J3WA 3K3CA 3OLOA 1NRJA 2OAP1 1YKDA 2IA2A 5DKLA 1YSPA 4BMWA 1G28A 4CQHA 4DN0A 2XRNA 2VV6A 2M7VA 4EEUA 4UQIS 2VLGA 1V9YA 3LIFA 2EWVA 2JKTI 5C5KA 2INWA 2Z6CA 4WEJA 3P7NA 2XA7M 2J3TD 4F3LA 3F1OB 4QPRA 1ODVA 2O9AA 1X0OA 3TE8A 2W3GA 5DFYA 3C30A 2GJ3A 2ZBBA 3T4SA 2A24B 3ICYA 5CX7A 2XROA 3NHQA 1OTBA 2P08A 1OTIA 3UB9A 4CLCE 3VOLA 2D01A 1S66L 3R7WA 1LSWA 4EU0A 4HJ6A 3K2NA 2V1BA 1XFNA 4R6LA 4EESA 4DJ2A 2PD7A 2O0YA 4I3AA 5HZHA 4UQIM 4R70A 2W1TA 1OTAA 3KSHA 3MR0A 1TD5A 3LIDA 4HP9A 4AFIA 3HCYA 3CAXA 5HL6A 2DMWA 2W3HA 4JGOA 5F69A 1WA9A 3BY8A 3E0YA 4PKYG 5G4YA 2V0UA 1DRMA 3B33A 1UWPX 3C8CA 4HNBA 3LYXA 4O0PA 2J3TC 4I3JA 5A8BA 1OPXA 2VX8A 4NXBA 2QJ5A 3MQ0A 4MN5A 4YNRA 4BJPA 2VKSA 4Q0IA 3F1PB 5F5YA 4Y3IA 4ME4A 3BQAA 2FZ0A 5F68A 3OOVA 3FPWA 4KUKA 2B18A 1G6OA 5DKKA 2HGVA 4GHIA 2O99A 3IBRA 4BWIA 4MN6A 1S4RA 1NLYA 3MF0A 4MDZA 4IUHA 3IS2B 5MC7A 5EFWA 3ULFA 4EUVA 3BJNA 3C38A 2V9AA 1LT0A 3JVVA 3RFBA 3LIAA 2GZAA 1OTEA 3CUEA 2JKRI 1EW0A 3RTYA 3LR0A 5HSQA 4RQ9A 4H6JA 4HJ4A 4P6ZS 3NOPC 2LB9A 3TJZC 3EGXC 1LSVA 2W3EA 4EW7A 3IBJA 5KIZA 3DBAA 4NXGA 5DFXA 2KX6A 2Z6DA 3H7WA 4Z1WA 2VV8A 1P0ZA 1LSXA 3NOUC 2PD8A 2M1CA 4II7A 3EEAA 4JGRA 2JN7A 1W63Q 2L1MA 2YKHA 4MCWA 5G4ZA 2R78A 5DJTA 4WLAA 3UB6A 4HOIA 2H28A 4YWZA 5AVFA 4JGQA 5AJGA 4B93A 4P6ZM 4M4XA 3LR3A 5DJUA 3S7OA 2PDRA 4F3LB 5HWWA 3UMEA 1MC0A 2P7JA 3PXPA 4FOFA 2I9VA 3HJKA 5HPIA 4XT2A 4B9OA 1UGUA 1T1BA 4G3VA 5HDCA 2OOLA 3FC7A 4LPZA 1F9IA 2NUTC 2L4RA 1UWNX 3S7NA 3R7WB 3T50A 5FL3A 1MZUA 3U2AA 3VE3A 1XJ4A 1VHMA 4IUKA 4OOMA 3B42A 1W63M 2LB5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XSS A;  2ZMF A;  4Q0I A;  4Y3I A;  4ME4 A;  4DMZ A;  2Y8H A;  2O9B A;  3LFV A;  3OOV A;  2B18 A;  3MMH A;  2HGV A;  1ZTU A;  2O99 A;  3CIT A;  4Y5F A;  5K5B A;  3IBR A;  4BWI A;  3MF0 A;  2W1R A;  3CI6 A;  3S7P A;  4PAU A;  5HPF A;  3OBF A;  4MDZ A;  4IUH A;  2KLI A;  4EUV A;  3BJN A;  1F5M A;  1MKM A;  2GX5 A;  3G6O A;  3RFB A;  3E98 A;  3NOT C;  2KOI A;  3S7Q A;  3TRC A;  4G3K A;  3O5Y A;  4GLQ A;  2W1T B;  3VV4 A;  3ZQ5 A;  2VJW A;  3D3O A;  3KSG A;  5HSQ A;  4RQ9 A;  3NOP C;  2LB9 A;  5I5L A;  4YOF A;  1YKD A;  2IA2 A;  1YSP A;  2W3E A;  4CQH A;  4DN0 A;  2XRN A;  4E04 A;  3IBJ A;  2M7V A;  3DBA A;  4Q0H A;  5DFX A;  4Z1W A;  4G3W A;  3KO6 A;  5TJJ A;  5C5K A;  3NOU C;  2K2N A;  2K31 A;  4IJG A;  1STZ A;  2G7U A;  1YSQ A;  3EEA A;  2QYB A;  4ZRR A;  4QPR A;  2O9A A;  2W3D A;  2W3G A;  5DFY A;  4MCW A;  4O01 A;  2XRO A;  3NHQ A;  2W3F A;  5AJG A;  4EU0 A;  2Y79 A;  1TF1 A;  3K2N A;  2M7U A;  3S7O A;  5LBR A;  1MC0 A;  4R6L A;  3C2W A;  4FOF A;  3W2Z A;  4ETX A;  4Y2F A;  5HPI A;  2O0Y A;  4LRY C;  2VEA A;  4MN7 A;  2O9C A;  4MMN A;  4R70 A;  4GW9 A;  2W1T A;  3KSH A;  3KSI A;  4G3V A;  2OOL A;  1TD5 A;  4O8G A;  5L8M A;  3S7N A;  3HCY A;  2VZW A;  5HL6 A;  2W3H A;  3R4K A;  4LRX C;  4LRZ E;  3KSF A;  3E0Y A;  4Q0J A;  1VHM A;  4IUK A;  4ETZ A;  4O0P A;  3MQ0 A;  2LB5 A;  4YNR A;  2VKS A; 
#chains in the Genus database with same CATH topology
 1TS8 A;  2PR6 A;  2PR5 A;  3MMH A;  3V3R A;  3UB8 A;  1W5D A;  3CIT A;  1XJ6 A;  4Y5F A;  4OOY A;  3U4L P;  4NKP A;  4I5S A;  3NDE A;  1ZHH B;  5F6A A;  3DTK A;  5KSC A;  2KLI A;  3IF6 B;  3MS6 A;  4EEP A;  4XUZ A;  1TVF A;  1IYQ A;  3ZHH A;  3MQQ A;  4OH0 A;  1H8Z A;  5M18 A;  3OC2 A;  4BBU A;  4KZA A;  3CWF A;  2YKF A;  1J9M A;  4Q0H A;  5TGF A;  1DP6 A;  2PBD P;  5TJJ A;  2WAF A;  3JVU A;  1KDS A;  1VET A;  4ZRR A;  4IED A;  1PIO A;  3LIC A;  1QME A;  4E3L A;  3IQA A;  3LUQ A;  1H8M A;  3RXW A;  2QWS A;  5GHZ A;  2PT7 A;  3GEC A;  5HDS A;  1LL8 A;  4WEL A;  4FH2 A;  1TF1 A;  2WZZ A;  4Y2F A;  4LRY C;  2VEA A;  1H0M A;  4KG5 A;  2E8J A;  1KGF A;  4O8G A;  4OQ0 A;  2XD5 A;  3DAV A;  3NC8 A;  4R0Q A;  2BAS A;  4ZDX A;  1K6S A;  4ETZ A;  2WKH A;  4BQM A;  3PR6 A;  1FIK A;  5F83 A;  3UB5 P;  1SKO A;  3KX0 X;  5EM1 A;  1ZC2 A;  4F94 A;  4S2I A;  3BQ8 A;  3VP1 A;  3LFV A;  3W4O A;  3Q82 A;  5DF9 A;  4WZ5 A;  1HLU P;  5FQI A;  3RXX A;  4L9F A;  3TW8 A;  4CLC D;  4GLQ A;  2WAD A;  3D4F A;  5FQJ A;  2VJW A;  1GA9 A;  2NUP C;  2XDM A;  4N9K A;  2QKP A;  3ITB A;  2QMI A;  4HBT A;  3M2K A;  3SH8 A;  2CC1 A;  3MSH A;  2PU2 A;  3W8K A;  4ZAM A;  1STZ A;  5HWV A;  3DWK A;  2Y2I A;  2ZC4 B;  3O87 A;  5TBM B;  3V39 A;  2EFX A;  2MJ6 A;  3LI9 A;  5GHX A;  1K57 A;  2HP9 A;  4GS9 B;  2ZD8 A;  3S4X A;  4S2M A;  5CHJ A;  3CMZ A;  4R1G A;  4EQ1 A;  3ZG8 B;  1MXO A;  4GDB A;  2HV1 A;  4CLC C;  5EE8 A;  4CLC B;  1ES4 A;  3IF6 A;  3W2Z A;  4ETX A;  4X25 A;  1T19 A;  1ZG4 A;  1XXM A;  1V9Z A;  1PFL A;  1XFQ A;  1T1A A;  2X02 A;  2ZC3 B;  2FH5 A;  3L7H A;  4P0M A;  4LLO B;  3KSF A;  3GVB A;  4I3I A;  2ZC7 A;  1IYS A;  5F1G A;  4ZJ1 A;  4OOL A;  1ERM A;  3IS2 A;  3MZE A;  4RVA A;  4E3N A;  2ZMF A;  2OLV A;  1CF0 A;  3T4T A;  3NJA A;  3H9W A;  3O86 A;  4E3M A;  3WS0 A;  3MQO A;  2PHY A;  5FQK A;  2GNX A;  4PAU A;  4BBT A;  1PWD A;  1HVB A;  4E6X A;  1MKM A;  4OON A;  1GSX A;  3VOY A;  2ZL1 A;  2VGL M;  5HD5 A;  1MBL A;  2PYP A;  4G3K A;  2Q9M A;  4HBU A;  2WGI A;  2PU4 A;  3K3C A;  2OAP 1;  5FI7 A;  5CHU A;  4BMW A;  3MXR A;  4B88 A;  4EEU A;  4X56 A;  1V9Y A;  3LIF A;  1JWZ A;  2INW A;  2V8F A;  4WEJ A;  2XA7 M;  2J3T D;  4WM9 A;  1DJA A;  1YT4 A;  3F1O B;  4OPQ A;  3OPR A;  3C30 A;  3P09 A;  1K56 D;  5F1F A;  1YLW A;  3T4S A;  1FR1 A;  1L2S A;  1OTI A;  1ERO A;  2XFS A;  5CGX A;  3MBZ A;  3UY6 A;  3T12 B;  2DNS A;  1PW1 A;  3R7W A;  1IEM A;  3K2N A;  5FAS A;  2Y4A A;  4BLM A;  4DJ2 A;  2HPB A;  1KE0 A;  2R9W A;  4RA7 A;  3LY3 A;  1Q2Q A;  2WGV A;  3MZF A;  3MR0 A;  2PBY A;  1VQQ A;  4AFI A;  3AGE A;  1NYY A;  3N7W A;  5CER A;  1XPB A;  1YMX A;  3UPP A;  4PKY G;  2Y59 A;  4Y0U A;  3BFE A;  2J3T C;  3M2J A;  3IWQ A;  3MQ0 A;  4MN5 A;  4YNR A;  5F5Y A;  4BD1 A;  4UA9 A;  3TSG A;  1LLB A;  5F68 A;  3FPW A;  3OPP A;  3FZC A;  5DKK A;  2HGV A;  1FCO A;  1I5Q A;  4DXC A;  1JWP A;  3IBR A;  5EEC A;  4BWI A;  4MN6 A;  1NLY A;  3VMA A;  1IYO A;  3ZG7 B;  3BFG A;  1SZV A;  1DY6 A;  5MC7 A;  2JKG A;  4N9L A;  5EFW A;  3N6I A;  3ULF A;  1LL5 A;  3DTE A;  4FH4 A;  1LT0 A;  4XUX A;  2GZA A;  1PW8 A;  4LV1 A;  4H6J A;  4PPR A;  3NDG A;  3MFD A;  5CTN A;  2JCH A;  5KIZ A;  4NXG A;  5FQQ A;  4Z1W A;  1NZU A;  3CPT B;  1LSX A;  4II7 A;  3N8L A;  1W63 Q;  5G4Z A;  3TG9 A;  3C7U A;  1YMS A;  5HL1 A;  4WLA A;  3UB6 A;  1TEM A;  5GLD A;  4JGQ A;  4M4X A;  5DJU A;  2PDR A;  5DF7 A;  4OLG A;  3UME A;  5EVI A;  5HPI A;  4XT2 A;  4B9O A;  1UGU A;  4QD4 A;  1T1B A;  1YLY A;  5HDC A;  4LPZ A;  3JYI A;  1F9I A;  2XLN A;  2BTF P;  3T50 A;  4LCM A;  3GTC A;  4KG6 A;  3DW0 A;  1S0W A;  1W63 M;  4NET A;  1YPR A;  3ZVW A;  3EWK A;  2J8Y A;  1K55 A;  2UV0 E;  3F1N A;  4HEF A;  3LIE A;  4QU3 A;  4MEZ A;  2PRF A;  1IFQ A;  2ZLY A;  4EBL A;  1G68 A;  3BLM A;  3M6H A;  4GD6 A;  4P87 A;  3T1S A;  5FA7 A;  3T4Q A;  1FCN A;  3S7Q A;  4JXV A;  4JBF A;  4WYY A;  2W0N A;  3D3O A;  3HJI A;  2ZOH A;  1PZO A;  4DF6 A;  1EWZ A;  4BL3 A;  1PWG A;  2B95 A;  5FI6 A;  2WK0 A;  4S2O A;  1LI0 A;  3JPU A;  2XGN A;  2RL3 A;  1KVM A;  4BBV A;  1TS7 A;  2G7U A;  4KQD A;  3AGF A;  4BEN A;  2QYB A;  1K25 A;  4I38 A;  3IWO A;  4QY5 A;  3QP5 A;  2Y2K A;  1K56 A;  1MPL A;  3EGD C;  4R3J A;  3PBN A;  3ZG5 A;  2Y91 A;  2DCF A;  4FSF A;  4JXG A;  3G34 A;  1FSW A;  4C3Q A;  4GJ4 A;  5EVE A;  4GN2 A;  5GLC A;  3E4O A;  2WGW A;  2Q9N A;  4CJN A;  3GV9 A;  2G2U A;  3UE1 A;  4O7D A;  2ZQ8 A;  2ZQ9 A;  2EA9 A;  2P74 A;  3R4K A;  4DRT A;  2ZMV A;  3G2Z A;  4OKP A;  3IXB A;  3E4Q A;  1PNE A;  4OLD A;  3CPT A;  4KZ8 A;  3UB7 A;  1O7E A;  3OCN A;  4HQA A;  4WZ5 C;  2EX8 A;  4PKY A;  1ESU A;  3HVF A;  4MBK A;  3FKW A;  4PHT A;  4Y17 A;  4E3K A;  2OAQ 1;  3KYZ A;  4S2P A;  3Q07 A;  5J8X A;  4YIN A;  3PBQ A;  1FSY A;  3NOT C;  2ZQA A;  4PMA A;  3LIB A;  3VV4 A;  4D60 A;  3KSG A;  1H8Y A;  5KSH A;  1MY8 A;  4KZ7 A;  1CK3 A;  5U47 A;  2A24 A;  4E04 A;  3IX3 A;  5KMW A;  1RCJ A;  3Q7V A;  5CHM A;  1I2S A;  5AQ9 A;  2HDS A;  1AWI A;  4ESP A;  4EXO A;  4KZ9 A;  3ZFZ A;  3QP4 A;  3LR5 A;  2P9V A;  5EV0 A;  3OZH A;  5FI2 A;  2Y79 A;  3E2K A;  3IF5 A;  3LEQ A;  4DDY A;  3O88 A;  5AQB A;  3TOI A;  2O9C A;  1JTD A;  3KSI A;  5AVE A;  1T18 A;  1BT5 A;  3MFX A;  2WKP A;  5L8M A;  3LGO A;  3HUO A;  3UDX A;  1JVJ A;  2VGL S;  2WAE A;  4LRX C;  1W7F A;  1ES2 A;  3ITA A;  4WN5 A;  3UPN A;  1MWS A;  1H3Q A;  4X55 A;  5HFO A;  3IXG A;  3SZT A;  3UMD A;  1W79 A;  3QNB A;  5L2F A;  3Q81 A;  4ARZ B;  4DJ3 A;  2OWJ A;  2C5W B;  3HLG A;  5HD3 A;  5IT5 A;  2XA7 S;  4N92 A;  3ZVT A;  5HPF A;  3C7V A;  4HH2 A;  5E2E A;  3A0S A;  4R38 A;  4GDN A;  2XEP A;  2ZQ7 A;  3EQU A;  4L9E A;  2D02 A;  2WKQ A;  1FIL A;  1J3W A;  3O5Y A;  3BWL A;  3T4K A;  1TS6 A;  5EPH A;  5EM0 A;  1YLZ A;  1YKD A;  1N4O A;  4DN0 A;  2EX2 A;  2HP5 A;  2JKT I;  2Z6C A;  4S2N C;  5D3O A;  4QPR A;  1ODV A;  2O9A A;  1X0O A;  3TE8 A;  3OPH A;  2W3G A;  2GDN A;  3ICY A;  3NHQ A;  1OTB A;  1XP4 A;  3L9K A;  5L10 A;  4CLC E;  2EX6 A;  3MZD A;  4GZB A;  3QNC A;  3SH7 A;  4EU0 A;  4KQR A;  4K0X A;  1KVL A;  4R6L A;  4EES A;  5GL9 A;  1A0K A;  2EX9 A;  2V1Z A;  4UQI M;  3M6B A;  3IT9 A;  3AGD A;  1NYM A;  3KSH A;  1N9B A;  1TD5 A;  1XKZ A;  3QP1 A;  3CAX A;  1C3B A;  4M3K A;  3VP0 A;  5F69 A;  1WA9 A;  3BY8 A;  3IX8 A;  3BEB A;  2V0U A;  3B33 A;  3LYX A;  2XD1 A;  2E8I A;  4I3J A;  4Q0I A;  3F1P B;  2R9X A;  3OOV A;  1G6O A;  2QPN A;  2C6W B;  3V5M A;  5A93 A;  1S4R A;  2OV5 A;  2ACG A;  3ZG9 B;  5EOE A;  4OPR A;  5HAQ A;  2V9A A;  4JXW A;  3VFF A;  3JVV A;  2Y2J A;  2JKR I;  1NJ4 A;  3FWL A;  3BEC A;  3LR0 A;  3CJM A;  5HSQ A;  4HJ4 A;  5TFQ A;  2HDQ A;  3NOP C;  3VSL A;  1E3U D;  1ES5 A;  3TJZ C;  3EGX C;  5TR7 A;  1XA7 A;  4Z9Q A;  2Z6D A;  3NCK A;  1IKI A;  4NG2 A;  1P0Z A;  2VK3 A;  4JGR A;  1XGJ A;  2XF3 A;  2YKH A;  4MCW A;  4LEN A;  4B4Z A;  1WYB A;  4KQQ A;  4LV3 A;  1G6A A;  2VGJ A;  2OSU A;  1HD8 A;  1KGG A;  3LR3 A;  1Y54 A;  4F3L B;  4ZJ2 A;  3RJU A;  3PXP A;  3VOZ A;  4G3V A;  1LI9 A;  4C75 A;  2ZQC A;  1PI5 A;  4EBN A;  2NUT C;  2L4R A;  3HLC A;  3QP2 A;  1UWN X;  1HZO A;  5FL3 A;  3ZNY A;  1BSG A;  1LL9 A;  1XJ4 A;  4YFM A;  1VHM A;  3A3I A;  3KYE A;  2J9O A;  3N8R A;  1YQS A;  1K55 C;  2LB5 A;  1NLZ A;  3HLW A;  1QMF A;  3T1Q B;  3E4P A;  3MKE A;  2OLU A;  3DTM A;  4QJG A;  2V0W A;  1N9L A;  3LI8 A;  5L09 A;  5GLB A;  2W1R A;  5A91 A;  3GDI A;  3MXQ A;  2HJ9 C;  3N8S A;  4LCL A;  1BLC A;  5HWT A;  2X01 A;  3WS5 A;  1S4S A;  3LCE A;  2JKT M;  2Y2P A;  2Z2M B;  3T4J A;  5G18 A;  1K54 A;  4E3J A;  1NXY A;  1BYW A;  3GRJ A;  5TBM A;  3GSG A;  3T1R A;  2BLS A;  3G31 A;  3CUE C;  4R23 A;  4GS9 A;  3WS2 A;  1GSV A;  3KO6 A;  5KZH A;  4FUW A;  1RGY A;  3P98 A;  3VSK A;  1RGZ A;  4CLC A;  4DXB A;  4K91 A;  3HL9 A;  4NXF A;  2WYX A;  4DDS A;  4IBR A;  2L0W A;  3I7J A;  3PBR A;  1ACF A;  1S67 L;  3A3E A;  4HI4 A;  4UEY A;  2W3F A;  3ZGA B;  4N1H A;  1S1Y A;  1GHM A;  4HHD A;  1P9W A;  4KZ5 A;  3C2W A;  4RX2 A;  5FAT A;  4MLL A;  1VEU B;  4MN7 A;  4IVK A;  1D06 A;  4LFU A;  3HLB A;  2Y2G A;  5CTM A;  4K08 A;  4S2L A;  3PBO A;  4LRZ E;  4DE0 A;  3BW6 A;  1SCW A;  1Y28 A;  1FCM A;  2A49 A;  5L07 A;  3K3D A;  4EUZ A;  1E4D A;  3P01 A;  2XSS A;  4U0X A;  4Q8I A;  1KE4 A;  4JF5 A;  3ZYT A;  5FQM A;  4A5R A;  3GR2 A;  5J4E A;  3IWI A;  1KE3 A;  1P97 A;  1CEG A;  3LR4 A;  3IHA A;  2Q0O A;  3WWX A;  1WE4 A;  2IWB A;  3CZD A;  3E98 A;  2ZMA A;  3MJQ A;  3V67 A;  3VP2 A;  3SW1 A;  1SKF A;  3F1O A;  1ERQ A;  4R4S A;  4ZTK A;  2XFT A;  1SDE A;  3A0V A;  2HF6 A;  5I5L A;  5BOH A;  2JHE A;  1E3U A;  4OP5 A;  2RCX A;  3C4O A;  1ESI A;  1PZP A;  4U3T A;  2G2W A;  3OCL A;  1YSQ A;  5DTS A;  4R3B A;  5FSR A;  4UAA A;  4HH3 A;  4GHI B;  4OVD A;  1D7E A;  3A0R A;  4L0L A;  4D2O A;  5IU1 A;  1PRQ A;  2WKR A;  3FYZ A;  1VET B;  4OQI A;  3G30 A;  4LV0 A;  4P85 A;  3PYP A;  1CI8 A;  3EEH A;  4IHQ A;  4WF0 A;  5J7E A;  4E3O A;  3HRE A;  1GSW A;  1JTG A;  3IHB A;  4OQG A;  1LHY A;  1F98 A;  5J3W A;  4K0W A;  2VZW A;  1YAX A;  2B5R A;  3H7W B;  3VE4 A;  4Q0J A;  4KUO A;  4N1X A;  4KZ6 A;  4EET B;  5FEF A;  3C4P A;  4R4R A;  4DMZ A;  3UNW A;  4PM9 A;  2JBF A;  1ES3 A;  2VGK A;  2ZC5 B;  4NEE D;  4WMC D;  1OT9 A;  4Y15 A;  5K5B A;  1CI9 A;  4L9G A;  1L3L A;  3OBF A;  5HX9 A;  2X71 A;  1BUE A;  2A3U A;  2VA0 A;  4ZJ3 A;  4FTX A;  4X6T A;  2KOI A;  3TRC A;  4MBH A;  3W4P A;  3B47 A;  1VEU A;  3ZQ5 A;  2W27 A;  5FQ9 A;  1IEL A;  3FKV A;  3SOI A;  2ZC6 B;  4LGW A;  1NRJ A;  3NBL A;  1FOF A;  2IA2 A;  5DKL A;  3T1X A;  3HLD A;  2WUQ A;  4GKU A;  1K4F A;  2H5S A;  4UQI S;  3G4P A;  3HBR A;  3IXH A;  5EVL A;  1BZA A;  2Y2N A;  4JF4 A;  3P7N A;  3NI9 A;  1W8Y A;  1MWR A;  2ZBB A;  3BLS A;  3IH8 A;  4UHU A;  2XRO A;  3A3J A;  2P08 A;  4HES A;  3UB9 A;  3VOL A;  1S6R A;  2D01 A;  1GHI A;  1LSW A;  5CGS A;  1XFN A;  2J7V A;  3GQZ A;  3IXD A;  3ZG0 A;  4X69 A;  1L0E A;  2PD7 A;  1O07 A;  2JE5 A;  1K57 C;  1K4E A;  3UO9 A;  4EQI A;  3LID A;  3QHY A;  4MNR A;  3HCY A;  1VM1 A;  4KZ3 A;  3BRM A;  5HL6 A;  2Y2L A;  2DMW A;  4JGO A;  1K38 A;  3IF6 C;  3E0Y A;  1DRM A;  1UWP X;  4X53 A;  2JKF A;  5DTK A;  4Y0O A;  1OPX A;  2QJ5 A;  2ZM2 A;  2HZ5 A;  2VKS A;  2XK1 A;  1ONH A;  1CEF A;  2FZ0 A;  4WZ4 A;  4GHI A;  1HTZ A;  4S2J A;  1AXB A;  1PWC A;  1K6R A;  3MF0 A;  4MDZ A;  4IUH A;  4RYE A;  3IS2 B;  1L0D A;  3FV7 A;  3BJN A;  3NY4 A;  3RFB A;  2AVX A;  1OTE A;  4FD8 A;  3UPO A;  1L0F A;  4BL2 A;  1H5X A;  2XQZ A;  2LB9 A;  3ZNT A;  5FAO A;  2W3E A;  4EW7 A;  2ZL1 B;  2KX6 A;  3H7W A;  2VV8 A;  5CGW A;  3WRT A;  3NOU C;  2PD8 A;  3ZCZ A;  2M1C A;  3EEA A;  1NY0 A;  3UDF A;  3CHW P;  2L1M A;  5IHV A;  3A3F A;  1XA1 A;  2R78 A;  5DJT A;  2FFF B;  3ZDJ A;  3Q7Z A;  4HOI A;  3VP3 A;  2H28 A;  4QY6 A;  3GMW A;  3WS1 A;  4B93 A;  4DKI A;  4P6Z M;  3S7O A;  5HWW A;  3D9Y A;  4PM7 A;  1MC0 A;  3HLF A;  2WZX A;  2Z2L B;  1Z6F A;  2FFY A;  2OOL A;  3FC7 A;  2H0Y A;  5FAQ A;  4GNU A;  3S7N A;  3R7W B;  4JPM A;  5F82 A;  1PI4 A;  1W8Q A;  4OOM A;  3ISG A;  4JXS A;  1N9N A;  1OT6 A;  2V1A A;  1N9O A;  4WBG A;  2Y2O A;  4QWO A;  4WMC A;  3QP6 A;  5CEC A;  2Y2Q A;  1TDL A;  3S7P A;  1FQG A;  2EXA A;  1F5M A;  5HDD A;  2K7S A;  3EQV A;  3H82 B;  1YLP A;  3BM6 A;  1K54 C;  5FEG A;  2WKE A;  5FDH A;  4HY8 A;  4UA7 A;  5CEB A;  4IVI A;  3HLE A;  1MWU A;  2QHK A;  5DTT A;  4ID4 A;  4NK3 A;  4YOF A;  5CRF A;  1BLP A;  1ZG6 A;  5CXW A;  5EVI D;  4G3W A;  2K2N A;  2K31 A;  4KZB A;  1NWZ A;  2W3D A;  1U60 A;  4H6J B;  1G5U A;  3CLO A;  4R3A A;  5CED A;  1JNU A;  2KDK A;  3A3D A;  4O01 A;  4KZ4 A;  4WEK A;  3EOI A;  2BG1 A;  1BTL A;  1SHV A;  2ZM0 A;  3RH8 B;  5DF8 A;  1OJ5 A;  2DRW A;  5LBR A;  1ZKJ A;  5EOO A;  3V50 A;  4P6B A;  3B3X A;  4HP4 A;  2B02 A;  3UE6 A;  1E25 A;  3V3S A;  4H8R A;  3PAG A;  3LY4 A;  2P04 A;  3PHY A;  1S1Z A;  4WUJ A;  2IWC A;  1NZO A;  4ARZ A;  5JYP A;  1BLS A;  1GHP A;  5EVI C;  1VB6 A;  5EVI B;  3BFC A;  1MWT A;  4XXR A;  4XT2 B;  4ZBE A;  1NRF A;  3LO7 A;  3IH9 A;  4MBF A;  3UDI A;  4I39 A;  1PYY A;  2PYR A;  3Q1F A;  2O9B A;  3SS3 A;  3T4L A;  1P9R A;  1I2W A;  2EFU A;  3WRZ A;  1IKG A;  1M40 A;  4JGP A;  4HIA A;  5M19 A;  4Y0T A;  2EWW A;  4IBX A;  1YM1 A;  2GX5 A;  4RX3 A;  3G6O A;  3C5A A;  3T4O A;  2W1T B;  3F1N B;  4S2N A;  2IWD A;  1TS0 A;  4QB8 A;  1CJF A;  3D72 A;  4EBP A;  4KG2 A;  4EER A;  5A90 A;  5FAP A;  5DVA A;  3PBT A;  3SH9 A;  4IJG A;  5A92 A;  3UE0 A;  2V2F F;  3KYQ A;  1DJC A;  1L0G A;  1EI5 A;  1XGI A;  2VV7 A;  5HW3 A;  4Y7P A;  2Y55 A;  4OPY A;  4WL9 A;  3NIA A;  2A2L A;  4B4X A;  1XJ2 A;  1BUL A;  1FR6 A;  4Y13 A;  2M7U A;  4QHC A;  2QJ7 A;  3FPV A;  3H82 A;  1TDG A;  4MMN A;  5IS1 A;  3QP8 A;  4GW9 A;  3CG5 A;  3F1P A;  3OPL A;  3WS4 A;  3PBS A;  5E43 A;  4PM5 A;  2ZOI A;  2CMN A;  1MKI A;  1DP8 A;  3HUM A;  2PAV P;  2XH9 A;  1DP9 A;  2J80 A;  5M1A A;  3MKF A;  3FG8 A;  4E6W A;  2WGW B;  2Y2M A;  1ONG A;  2OWH A;  1OTD A;  3VP4 A;  2HJE A;  2Y8H A;  1M6K A;  1OME A;  1CQA A;  4GB7 A;  5EUA A;  2JC7 A;  4GCZ A;  1ZTU A;  4FCF A;  1IOU A;  4X1L A;  1GA0 A;  3UE3 A;  4PM8 A;  3BY9 A;  4HJ3 A;  4NXE A;  1F2K A;  3CI6 A;  3W4Q A;  3UN7 A;  3DTI A;  4JKT A;  1T1C A;  2HDR A;  2I72 A;  2H10 A;  3N4I A;  1XJ3 A;  4X68 A;  2WKI A;  4EV4 A;  3G35 A;  4UA6 A;  4KQO A;  4PM6 A;  3S1Y A;  1KOU A;  1KDW A;  1OJG A;  2JKR M;  2J3W A;  1RP5 A;  3BYD A;  3OLO A;  1YLT A;  1WYC A;  1D1J A;  1YSP A;  1G28 A;  4GOG A;  4CQH A;  2ZQD A;  2XRN A;  2VV6 A;  2ZJ9 A;  2M7V A;  5I94 A;  2VLG A;  5E2F A;  4OQH A;  2EWV A;  5C5K A;  1IYP A;  1KGE A;  4F3L A;  3PTE A;  2J9P A;  4U0T A;  5DFY A;  3VFH A;  2HP6 A;  2GJ3 A;  4OPZ A;  2A24 B;  5CX7 A;  5E2G A;  3Q7V B;  2EXB A;  1XX2 A;  1S66 L;  4HJ6 A;  5JYO A;  2V1B A;  4DE3 A;  1Z09 A;  4C6Y A;  1JWV A;  2O0Y A;  4I3A A;  5HZH A;  2V20 A;  4R70 A;  2W1T A;  1OTA A;  3DWZ A;  3O3V A;  1ALQ A;  3NEC A;  4HP9 A;  2P9V B;  2V8C A;  2W3H A;  2Y2H A;  1GCE A;  5G4Y A;  3E2L A;  3C8C A;  1K0K A;  4HNB A;  2HDU A;  4O0P A;  3LEZ A;  5A8B A;  2VX8 A;  4NXB A;  4BJP A;  5FDS A;  4JF6 A;  1DJB A;  3G32 A;  4Y3I A;  4ME4 A;  3SS4 A;  3BQA A;  4KUK A;  2B18 A;  3MXS A;  2O99 A;  4GD8 A;  5AQA A;  5GHY A;  4S2K A;  4EUV A;  2XR0 A;  2QZ6 A;  3C38 A;  3NUL A;  4KEN B;  1BLH A;  3S22 A;  3LIA A;  3PAE A;  3CUE A;  4JLF A;  1EW0 A;  3BFD A;  3BFF A;  3RTY A;  1Y4O A;  4DE1 A;  1YLJ A;  4RQ9 A;  3SS5 A;  4P6Z S;  1LSV A;  3G2Y A;  3IBJ A;  2ZM8 A;  4X1M A;  3DBA A;  5DFX A;  1SKO B;  5GLA A;  4BD0 A;  2JN7 A;  5HAR A;  3HUN A;  2H0T A;  1SDN A;  4DE2 A;  4EWF A;  4YWZ A;  4E3I A;  5AVF A;  5AJG A;  3IX4 A;  5HAP A;  2UWX A;  4LV2 A;  2P7J A;  4FOF A;  4CPK A;  2I9V A;  3HJK A;  4OP8 A;  5E2H A;  1Q2P A;  5AQ7 A;  1MZU A;  3U2A A;  3VE3 A;  4IUK A;  5HAI A;  3B42 A; 
#chains in the Genus database with same CATH homology
 1N9N A;  1NLZ A;  1OT6 A;  1TS8 A;  2V1A A;  3EWK A;  1N9O A;  2PR6 A;  3E4P A;  2PR5 A;  3MMH A;  3F1N A;  3LIE A;  3UB8 A;  3CIT A;  1XJ6 A;  4Y5F A;  2V0W A;  1N9L A;  3LI8 A;  1IFQ A;  4NKP A;  4I5S A;  2W1R A;  1ZHH B;  3S7P A;  3GDI A;  3MXQ A;  5F6A A;  2HJ9 C;  2KLI A;  5HWT A;  3T4Q A;  1F5M A;  5HDD A;  4EEP A;  2K7S A;  3EQV A;  3H82 B;  1S4S A;  3S7Q A;  2JKT M;  2W0N A;  3D3O A;  3HJI A;  2ZOH A;  3MQQ A;  3T4J A;  4HY8 A;  1BYW A;  2QHK A;  3OC2 A;  4BBU A;  4YOF A;  5TBM A;  3CWF A;  2YKF A;  4Q0H A;  3CUE C;  4GS9 A;  1GSV A;  1DP6 A;  3KO6 A;  4G3W A;  5TJJ A;  4BBV A;  2K2N A;  2K31 A;  1TS7 A;  1NWZ A;  3JVU A;  2G7U A;  4KQD A;  2QYB A;  4ZRR A;  2W3D A;  4H6J B;  4CLC A;  3CLO A;  4I38 A;  4R3A A;  3LIC A;  1JNU A;  2KDK A;  4NXF A;  4O01 A;  4WEK A;  3EOI A;  3LUQ A;  1H8M A;  2QWS A;  3EGD C;  3PBN A;  2L0W A;  2PT7 A;  3GEC A;  3PBR A;  5HDS A;  1S67 L;  4HI4 A;  4UEY A;  1LL8 A;  2W3F A;  4FSF A;  4WEL A;  1S1Y A;  1TF1 A;  3RH8 B;  4HHD A;  1P9W A;  1OJ5 A;  5LBR A;  3C2W A;  4GJ4 A;  4Y2F A;  4HP4 A;  2B02 A;  4LRY C;  2VEA A;  3E4O A;  4MN7 A;  3UE6 A;  2P04 A;  1D06 A;  3PHY A;  4O8G A;  1S1Z A;  4WUJ A;  4K08 A;  2EA9 A;  4ARZ A;  3PBO A;  3R4K A;  2ZMV A;  4LRZ E;  2BAS A;  1VB6 A;  3BW6 A;  4ETZ A;  1Y28 A;  3E4Q A;  3PR6 A;  3K3D A;  4XT2 B;  3KX0 X;  3P01 A;  2XSS A;  3UB7 A;  3OCN A;  4I39 A;  2PYR A;  4HQA A;  3ZYT A;  2O9B A;  3BQ8 A;  3LFV A;  5J4E A;  3T4L A;  1P9R A;  4PKY A;  1P97 A;  3LR4 A;  4PHT A;  5DF9 A;  4JGP A;  4HIA A;  2OAQ 1;  3KYZ A;  2EWW A;  3PBQ A;  4L9F A;  2GX5 A;  3G6O A;  3E98 A;  3T4O A;  3NOT C;  3TW8 A;  4CLC D;  4GLQ A;  2W1T B;  3F1N B;  3MJQ A;  3LIB A;  3V67 A;  3VV4 A;  2VJW A;  3KSG A;  2NUP C;  3SW1 A;  5KSH A;  1TS0 A;  2QKP A;  3F1O A;  3A0V A;  2HF6 A;  5I5L A;  3D72 A;  2JHE A;  2A24 A;  4EER A;  4E04 A;  3PBT A;  3OCL A;  4IJG A;  1STZ A;  5HWV A;  1YSQ A;  3KYQ A;  4HH3 A;  4GHI B;  1D7E A;  5TBM B;  2VV7 A;  2MJ6 A;  3LI9 A;  3A0R A;  4L0L A;  4EXO A;  4GS9 B;  5IU1 A;  4WL9 A;  2A2L A;  1XJ2 A;  3LR5 A;  2WKR A;  4EQ1 A;  2Y79 A;  2M7U A;  2HV1 A;  3PYP A;  4CLC C;  4CLC B;  3W2Z A;  4ETX A;  2QJ7 A;  3EEH A;  4IHQ A;  1T19 A;  4WF0 A;  3FPV A;  5J7E A;  3H82 A;  1GSW A;  2O9C A;  4MMN A;  5IS1 A;  4GW9 A;  3KSI A;  1V9Z A;  3F1P A;  5AVE A;  1T18 A;  3MFX A;  1XFQ A;  2WKP A;  1F98 A;  5L8M A;  5J3W A;  1T1A A;  3PBS A;  2VZW A;  1YAX A;  2FH5 A;  2VGL S;  2ZOI A;  2CMN A;  4LRX C;  3H7W B;  1DP8 A;  3VE4 A;  4LLO B;  3KSF A;  4Q0J A;  4KUO A;  1DP9 A;  4I3I A;  2J80 A;  4WN5 A;  4EET B;  3FG8 A;  4OOL A;  3IS2 A;  1H3Q A;  2ZMF A;  4DMZ A;  2OWH A;  1OTD A;  3UMD A;  2HJE A;  2Y8H A;  3T4T A;  3NJA A;  3H9W A;  4GCZ A;  4ARZ B;  1ZTU A;  4DJ3 A;  2OWJ A;  4NEE D;  1IOU A;  1OT9 A;  3MQO A;  2PHY A;  5K5B A;  3UE3 A;  5HD3 A;  5IT5 A;  3BY9 A;  4HJ3 A;  4NXE A;  2XA7 S;  3CI6 A;  2GNX A;  4L9G A;  4PAU A;  5HPF A;  3OBF A;  4HH2 A;  4BBT A;  3A0S A;  4R38 A;  1T1C A;  2VA0 A;  3EQU A;  4L9E A;  2D02 A;  1MKM A;  2WKQ A;  1GSX A;  2VGL M;  5HD5 A;  2KOI A;  3TRC A;  2PYP A;  4G3K A;  3O5Y A;  1XJ3 A;  3BWL A;  3T4K A;  3B47 A;  3ZQ5 A;  2W27 A;  4KQO A;  1KOU A;  1OJG A;  1TS6 A;  2JKR M;  2J3W A;  3K3C A;  3OLO A;  1NRJ A;  2OAP 1;  1YKD A;  2IA2 A;  5DKL A;  1YSP A;  4BMW A;  1G28 A;  4CQH A;  4DN0 A;  2XRN A;  2VV6 A;  2M7V A;  4EEU A;  4UQI S;  2VLG A;  1V9Y A;  3LIF A;  2EWV A;  2JKT I;  5C5K A;  2INW A;  2Z6C A;  4WEJ A;  3P7N A;  2XA7 M;  2J3T D;  4F3L A;  3F1O B;  4QPR A;  1ODV A;  2O9A A;  1X0O A;  3TE8 A;  2W3G A;  5DFY A;  3C30 A;  2GJ3 A;  2ZBB A;  3T4S A;  2A24 B;  3ICY A;  5CX7 A;  2XRO A;  3NHQ A;  1OTB A;  2P08 A;  1OTI A;  3UB9 A;  4CLC E;  3VOL A;  2D01 A;  1S66 L;  3R7W A;  1LSW A;  4EU0 A;  4HJ6 A;  3K2N A;  2V1B A;  1XFN A;  4R6L A;  4EES A;  4DJ2 A;  2PD7 A;  2O0Y A;  4I3A A;  5HZH A;  4UQI M;  4R70 A;  2W1T A;  1OTA A;  3KSH A;  3MR0 A;  1TD5 A;  3LID A;  4HP9 A;  4AFI A;  3HCY A;  3CAX A;  5HL6 A;  2DMW A;  2W3H A;  4JGO A;  5F69 A;  1WA9 A;  3BY8 A;  3E0Y A;  4PKY G;  5G4Y A;  2V0U A;  1DRM A;  3B33 A;  1UWP X;  3C8C A;  4HNB A;  3LYX A;  4O0P A;  2J3T C;  4I3J A;  5A8B A;  1OPX A;  2VX8 A;  4NXB A;  2QJ5 A;  3MQ0 A;  4MN5 A;  4YNR A;  4BJP A;  2VKS A;  4Q0I A;  3F1P B;  5F5Y A;  4Y3I A;  4ME4 A;  3BQA A;  2FZ0 A;  5F68 A;  3OOV A;  3FPW A;  4KUK A;  2B18 A;  1G6O A;  5DKK A;  2HGV A;  4GHI A;  2O99 A;  3IBR A;  4BWI A;  4MN6 A;  1S4R A;  1NLY A;  3MF0 A;  4MDZ A;  4IUH A;  3IS2 B;  5MC7 A;  5EFW A;  3ULF A;  4EUV A;  3BJN A;  3C38 A;  2V9A A;  1LT0 A;  3JVV A;  3RFB A;  3LIA A;  2GZA A;  1OTE A;  3CUE A;  2JKR I;  1EW0 A;  3RTY A;  3LR0 A;  5HSQ A;  4RQ9 A;  4H6J A;  4HJ4 A;  4P6Z S;  3NOP C;  2LB9 A;  3TJZ C;  3EGX C;  1LSV A;  2W3E A;  4EW7 A;  3IBJ A;  5KIZ A;  3DBA A;  4NXG A;  5DFX A;  2KX6 A;  2Z6D A;  3H7W A;  4Z1W A;  2VV8 A;  1P0Z A;  1LSX A;  3NOU C;  2PD8 A;  2M1C A;  4II7 A;  3EEA A;  4JGR A;  2JN7 A;  1W63 Q;  2L1M A;  2YKH A;  4MCW A;  5G4Z A;  2R78 A;  5DJT A;  4WLA A;  3UB6 A;  4HOI A;  2H28 A;  4YWZ A;  5AVF A;  4JGQ A;  5AJG A;  4B93 A;  4P6Z M;  4M4X A;  3LR3 A;  5DJU A;  3S7O A;  2PDR A;  4F3L B;  5HWW A;  3UME A;  1MC0 A;  2P7J A;  3PXP A;  4FOF A;  2I9V A;  3HJK A;  5HPI A;  4XT2 A;  4B9O A;  1UGU A;  1T1B A;  4G3V A;  5HDC A;  2OOL A;  3FC7 A;  4LPZ A;  1F9I A;  2NUT C;  2L4R A;  1UWN X;  3S7N A;  3R7W B;  3T50 A;  5FL3 A;  1MZU A;  3U2A A;  3VE3 A;  1XJ4 A;  1VHM A;  4IUK A;  4OOM A;  3B42 A;  1W63 M;  2LB5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...