5HL6A

Crystal structure of a putative gaf sensor protein from burkholderia vietnamiensis
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
158
structure length
158
Chain Sequence
ASKAELYATLAEQARSLVESEPDLIANAANFSALVYHSLDRLNWAGFYFFDGTELVVGPFQGKPACVRIALGKGVCGTAAQTRQTQVVRDVHAFPGHIACDAASESEIVVPLVAADGTLIGVWDVDSPVAARFDDEDRSGMEALCRVFVEHAWQKARD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative GAF sensor protein
publication title Crystal Structure of a Putative GAF sensor protein from Burkholderia vietnamiensis
rcsb
source organism Burkholderia vietnamiensis (strain g4 / lmg 22486)
molecule tags Transferase
total genus 50
structure length 158
sequence length 158
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13185 GAF_2 GAF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.40 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 5hl6A00
3NOTC 2K31A 4LRXC 4GLQA 3S7QA 4ME4A 4IJGA 4Y2FA 4BWIA 5C5KA 2W1RA 4IUHA 3MF0A 3KSHA 4QPRA 2O9AA 3KSGA 4ETXA 3NOUC 4R70A 2W3HA 4Q0IA 2XROA 2QYBA 3NOPC 4Y5FA 3RFBA 2K2NA 2M7UA 4Q0JA 1STZA 1YSQA 2W1TB 4Q0HA 4EU0A 2W1TA 5LBRA 4DN0A 2LB9A 3D3OA 3BJNA 2M7VA 4CQHA 3MMHA 3HCYA 4G3KA 4LRYC 2Y8HA 1VHMA 2VJWA 3G6OA 2OOLA 2B18A 2O9BA 3OBFA 3C2WA 2KLIA 1MC0A 5HPFA 3DBAA 5HPIA 4ETZA 3LFVA 1TD5A 2O0YA 4E04A 3CITA 1YSPA 3MQ0A 3EEAA 3OOVA 2IA2A 3W2ZA 1MKMA 4YNRA 3E98A 5DFXA 4GW9A 3O5YA 2W3EA 3IBRA 3KSFA 4FOFA 3CI6A 4ZRRA 2LB5A 4LRZE 5HL6A 2ZMFA 4RQ9A 4O01A 2KOIA 4DMZA 3IBJA 3KSIA 5HSQA 2VZWA 2HGVA 4Z1WA 4MMNA 1F5MA 4YOFA 5AJGA 4MCWA 4R6LA 4Y3IA 3K2NA 3KO6A 3R4KA 2W3DA 1TF1A 2XSSA 4IUKA 5TJJA 2VEAA 4G3VA 1YKDA 2O9CA 1ZTUA 5I5LA 2O99A 4MDZA 4EUVA 3E0YA 3NHQA 5K5BA 3S7OA 4MN7A 2XRNA 3S7PA 3ZQ5A 4G3WA 5L8MA 2GX5A 2W3FA 2Y79A 2G7UA 2VKSA 3S7NA 4O8GA 2W3GA 4O0PA 3VV4A 5DFYA 3TRCA 4PAUA
chains in the Genus database with same CATH superfamily
1WE4A 1L0DA 3T12B 2INWA 4HNBA 1KDSA 5CGSA 2ZQ8A 5CERA 3R7WA 2XH9A 1K55C 2Q9NA 4HEFA 3D72A 5J7EA 3UPOA 1SHVA 3CHWP 2BG1A 5HDDA 2HDQA 4H8RA 2B95A 1FR1A 2XA7M 1PFLA 4PMAA 4P6ZM 3VOZA 2IWDA 4HY8A 4LRYC 3UE3A 5L09A 5CGWA 3CWFA 3T4SA 4EQ1A 1BYWA 2O9BA 3A3FA 1ES3A 3ZVWA 4L9FA 2Z2LB 4UAAA 4RX3A 3CG5A 3BM6A 3OOVA 3W2ZA 4YNRA 1K6SA 3LI9A 4OONA 3B47A 1K4EA 2JE5A 2Z6DA 2VGKA 2Y55A 4FUWA 4EBNA 4R0QA 5EPHA 1MWRA 2HDRA 1YMXA 3NCKA 1K4FA 3VFHA 4C6YA 1OTEA 2D02A 4PM5A 3F1PB 1K56A 4LCMA 2PAVP 1DJCA 3MFXA 4AFIA 1JNUA 4O8GA 1N4OA 4E3OA 3NULA 2ACGA 2QPNA 4U0TA 4IJGA 3ZG5A 5EV0A 3PR6A 1ALQA 3HLFA 2H10A 3QP8A 3N8LA 2EWVA 4KZ8A 1LT0A 4UQIS 3FPWA 5HARA 1ACFA 4EUZA 4YFMA 4HOIA 4WEJA 5TGFA 4OQHA 2WGWB 2P7JA 4QY6A 4KQQA 3T4OA 5FI7A 4D60A 5KMWA 3CUEC 3OPLA 4JGOA 3EEHA 2GZAA 5CHMA 3CLOA 4OVDA 3T1XA 1PZOA 3UB8A 3LEZA 1E25A 3BFFA 2OWJA 3U2AA 3ZNYA 1FR6A 3BRMA 4IHQA 3FYZA 3UB9A 4ETZA 2HZ5A 1NYYA 1TD5A 1TS6A 3SOIA 3G34A 1D1JA 3E4QA 1MKMA 1EW0A 2W27A 1BLCA 3P98A 2EX2A 4KZ4A 2Q0OA 1NRFA 3O3VA 3KSFA 3Q07A 4WN5A 1VEUB 2HP9A 2ZJ9A 3T1RA 1F5MA 1LSWA 3NBLA 4MCWA 4R6LA 5FDSA 5I94A 4I3AA 4NXEA 2XSSA 3NDGA 4K0WA 4LLOB 1YKDA 1GA9A 2O9CA 2PRFA 5I5LA 1VQQA 3P7NA 3C8CA 3QP4A 3IWIA 3ZVTA 1PW1A 4X25A 5IHVA 3PBNA 5CTNA 3LYXA 4OQIA 4ME4A 2ZL1B 1ZHHB 2P08A 1GHIA 4XT2A 4DRTA 4WZ5C 2VGLM 3KSGA 5IT5A 2J7VA 4GKUA 1DJBA 4JF5A 2K2NA 5GHXA 2M7UA 1JTDA 1F98A 1BUEA 5E2EA 3OC2A 4NXBA 4R38A 1W8QA 3TW8A 4PM6A 4NETA 3FWLA 3W4QA 2Y2NA 2EXAA 5AQ7A 2JKTM 2QZ6A 4GZBA 3SS5A 4NXGA 3BY9A 4BBVA 4E3KA 5HPIA 2XK1A 3T4QA 4IBRA 2BTFP 3WS5A 2Q9MA 3CITA 3CPTA 1D06A 3MSHA 3PAEA 3UB7A 1PNEA 3DTEA 1SKOB 4Y0OA 2WKPA 2A3UA 4ZRRA 2ZMFA 3F1OA 2QKPA 4O01A 3T1SA 1KGFA 4EESA 1CI9A 2HGVA 4Z1WA 3B3XA 5AJGA 4PKYG 4DXCA 1WYCA 3C7UA 1Y28A 1C3BA 4IUKA 5HX9A 3H9WA 5G4YA 3VP0A 4MDZA 2FZ0A 2WGVA 2EFXA 3FZCA 5L8MA 3QNCA 3RH8B 2W3GA 1AWIA 2ZBBA 2EA9A 1BULA 4LV3A 4H6JB 3HLEA 4GDBA 5G4ZA 4FD8A 1L3LA 4QPRA 4EWFA 1PYYA 3BQAA 3M6HA 4JGQA 4CLCA 4KZ9A 5CXWA 4HIAA 5F69A 1GCEA 4X68A 3DAVA 3G31A 2C5WB 5A92A 2I9VA 3DWKA 1XJ3A 1WA9A 4RVAA 5HD3A 1XJ4A 4G3KA 3SZTA 4OP8A 2Y91A 3LGOA 4LFUA 1T1AA 1KOUA 3BYDA 5GHYA 2KLIA 1HLUP 3SH7A 4Q8IA 4EBPA 1BLHA 4RA7A 4Y17A 3VFFA 1JVJA 1DP9A 2ZC3B 3Q7VA 5IS1A 3DW0A 2PHYA 2KOIA 2V2FF 1KGEA 4XUXA 3T4TA 2H28A 4HI4A 2JKTI 5CECA 1TEMA 5DF8A 2V20A 1KVMA 4BLMA 1L0FA 4HJ4A 2XRNA 2V8FA 5J3WA 5L2FA 5GLDA 3ISGA 1PI4A 2VKSA 2C6WB 4HH2A 2PD7A 3TRCA 3UE0A 5FL3A 1ERMA 4DJ2A 5GL9A 2W0NA 3DTMA 4PKYA 2P9VA 2ZD8A 5GLCA 4DF6A 4HP9A 3AGFA 1XJ2A 4HH3A 3IT9A 2J3WA 3JPUA 4OP5A 3C30A 4OPYA 1YMSA 1K0KA 4I3JA 3WS0A 3MJQA 3VOLA 2V0WA 3ITAA 4A5RA 4KZ7A 3HUMA 3MZEA 1N9BA 2B18A 2G2UA 2VV8A 4BENA 5FATA 1YSPA 3OCLA 3QP6A 3F1NA 5DFXA 4GW9A 3IX3A 1W5DA 5M19A 2E8JA 4JF4A 5HWVA 2HPBA 3V39A 4Y13A 4YINA 4GCZA 1IYQA 2PR6A 1EI5A 5A91A 4YOFA 4YWZA 4B9OA 4MN5A 3ZG0A 1JWVA 4Y3IA 3TJZC 3H7WB 2W3DA 1U60A 3F1PA 5IU1A 5EOOA 4N92A 1YLTA 4OOLA 1P97A 4GD6A 3ZQ5A 1PW8A 4WEKA 4X1MA 2ZC4B 3UPNA 2QHKA 3NC8A 3VV4A 1P9RA 4FH2A 2Z2MB 1PZPA 5GLBA 4GLQA 3K3CA 4KG6A 1K38A 1T18A 3IS2A 3MF0A 4B4XA 1OPXA 4ETXA 3S22A 5HW3A 4JPMA 3RXXA 3NDEA 1GSVA 4CLCE 3K3DA 3AGEA 2J3TC 3LIFA 3D3OA 1XP4A 2M7VA 3ZYTA 4LPZA 4PHTA 2OAQ1 2WK0A 1HD8A 4OQGA 3HLWA 1FIKA 3LIEA 5DKKA 4FCFA 3HLDA 2ZC6B 1UWPX 5FQJA 1ODVA 3IHAA 3IF5A 4ARZB 3IXGA 2Y2IA 4L0LA 1W63M 3IBJA 1O07A 4JXSA 5EVID 4MMNA 1KVLA 4KZ6A 2CC1A 4P6BA 5DKLA 2V0UA 3IXHA 1KE0A 4WBGA 4P87A 5DTSA 1O7EA 5TJJA 1CJFA 3FG8A 1FSWA 4HQAA 2PDRA 3E0YA 2L0WA 3RTYA 3BQ8A 4KZAA 4KENB 4OPRA 1MWTA 4BD0A 2DCFA 2PBYA 5JYOA 4QD4A 3BECA 3IF6C 4LRXC 4MN6A 4QWOA 5GLAA 1NJ4A 3G30A 2VLGA 2HP6A 3IH9A 3C5AA 1MY8A 3BFGA 4RX2A 1Z09A 5A90A 4R70A 2QJ7A 4LGWA 1MWUA 1IEMA 1DP8A 4NXFA 3L9KA 2K7SA 5DJUA 4HBTA 4NEED 4K08A 2ZMAA 3UPPA 2M1CA 4DN0A 3IX4A 1PIOA 4LV2A 1LI0A 3LY4A 4JKTA 1RGYA 2WAEA 2VX8A 5FAPA 1QMEA 3M2KA 2YKFA 2ZQ9A 3TOIA 3CAXA 3MXSA 1UGUA 5HWTA 3MQ0A 2IA2A 1D7EA 1K56D 2Y2QA 1XFQA 4BQMA 4X53A 3QP5A 3IBRA 4O7DA 4ZTKA 4RQ9A 1RGZA 1E3UA 1BT5A 2WYXA 1MKIA 3BLSA 2WKRA 1V9YA 2X01A 1YT4A 1H8YA 3MXRA 2V8CA 2VEAA 3V3RA 1X0OA 5DF9A 3VMAA 3R7WB 4ESPA 1CK3A 3HJIA 1MBLA 4CJNA 5JYPA 3KX0X 3MXQA 2IWCA 2J3TD 3LICA 4E3IA 3UMEA 3ZGAB 4WLAA 2Y79A 4DE3A 3A0RA 5CEBA 4NK3A 3LR3A 3IH8A 4PAUA 1FOFA 4IEDA 4KZBA 3VP2A 3NOTC 4KQRA 2K31A 2IWBA 4MBKA 4M3KA 4L9EA 2ZC7A 4FH4A 1I2WA 3T50A 2O9AA 1KGGA 5CRFA 1HTZA 3C4PA 5F68A 2QYBA 2DRWA 2L1MA 1BLSA 3V3SA 3T4JA 2D01A 4Q0JA 1IKIA 1I5QA 3T1QB 1Q2PA 5D3OA 4MBFA 1P0ZA 1SDNA 2W1TB 3ULFA 2XR0A 4CLCC 3MMHA 2HP5A 5HDCA 3LR0A 3N8SA 3Q1FA 4BL3A 5F83A 1MWSA 5HPFA 2Y2JA 3LFVA 5A8BA 1IYPA 2EWWA 1L0EA 1CI8A 3IXBA 4C3QA 3KYZA 5AQBA 1K25A 2GJ3A 5DJTA 3LO7A 3G4PA 4HBUA 4DDYA 5EECA 3O88A 5CHJA 3UDFA 5HL6A 2EX6A 2VV7A 1TS0A 2PBDP 1YLPA 4E3LA 3NECA 3VE4A 4LV0A 3Q82A 1YPRA 5E2HA 4WF0A 3KO6A 4GHIB 2NUTC 5FAOA 2JBFA 2OSUA 2R78A 4BJPA 3MQQA 2EX9A 3JVUA 2HJEA 2WKHA 3S7PA 3CUEA 3I7JA 4R4SA 3S7NA 3BY8A 1LL8A 3A3IA 3VP3A 4ZJ3A 5J4EA 5HD5A 3MKEA 3N7WA 5C5KA 5HWWA 1IFQA 3LIBA 2XA7S 4JXWA 3SS4A 4X6TA 3UDXA 4Q0IA 5HDSA 4X69A 3KYQA 4HJ3A 4S2NA 2Y2KA 4P6ZS 5FAQA 2KX6A 4GJ4A 2JKRM 4GNUA 4QY5A 3V50A 5U47A 1S67L 3UO9A 4DE1A 3LCEA 4BBTA 4QB8A 3BFDA 2B5RA 3C2WA 3JYIA 3PHYA 1HVBA 4GD8A 1VETA 3GDIA 3IWQA 5F1FA 4GS9B 3AGDA 2Y2LA 3HLGA 4B88A 1ESUA 1W7FA 1WYBA 1L0GA 3E98A 3E2KA 3IF6B 1MPLA 3VP4A 4FOFA 2LB5A 3CJMA 1YLYA 4GN2A 2WUQA 5BOHA 2Y59A 4KG2A 3O86A 3MBZA 5G18A 2EXBA 3W4PA 3EWKA 4WMCA 3BWLA 5A93A 1S1YA 3FKWA 5HL1A 5CHUA 5L10A 3PBTA 3DWZA 2PU2A 3D4FA 1XA1A 4DDSA 1QMFA 2JKGA 4Y0UA 2XDMA 5TBMA 3NJAA 1ES5A 4CLCD 1FCOA 4K0XA 2X71A 3BLMA 1K57A 3BFCA 4Z9QA 1G68A 1TDLA 4Y2FA 4BWIA 4KG5A 4KUKA 2A24A 4QJGA 4LCLA 2WGIA 1F2KA 2XROA 4Y5FA 1Q2QA 1STZA 3CPTB 3ZG9B 5CX7A 1N9OA 4JXGA 2AVXA 1G28A 5HAQA 3EOIA 1IYSA 5LBRA 2DMWA 4UQIM 5EVIC 1S66L 2H0YA 3BEBA 3F1OB 1LHYA 1KE4A 3G6OA 4EXOA 2H0TA 3MZFA 1ERQA 2UV0E 1G5UA 3DBAA 4OLGA 4UHUA 5KSHA 1FCMA 2O0YA 2ZM8A 4E04A 3Q81A 1PWDA 4UA6A 3HUNA 5EM1A 2XQZA 1XXMA 2W3EA 1PRQA 3CI6A 4ARZA 4OPZA 1S4SA 1SZVA 2PT7A 2JKRI 1ZG6A 3RJUA 3GVBA 4ZJ1A 3DTKA 3K2NA 3R4KA 2WZXA 5EE8A 4G3VA 4FTXA 4JLFA 3IX8A 3EGXC 3W4OA 2O99A 3MZDA 2ZC5B 1N9LA 1OTIA 4MN7A 4P85A 4CLCB 4N9KA 2EX8A 3G2YA 2W3FA 3IWOA 2VGLS 4O0PA 3MFDA 1PWGA 1FILA 4GB7A 3S7QA 3W8KA 4S2LA 5HFOA 1IKGA 1LSVA 2GNXA 2B02A 2A49A 4KZ3A 2HDUA 1N9NA 1ONGA 1SKFA 3FPVA 1FCNA 3HLCA 2OV5A 3JVVA 2WKEA 5FQMA 3EGDC 3WS4A 3Q7VB 3C4OA 3UNWA 5DF7A 2VJWA 3UDIA 4HP4A 3UMDA 2FFFB 4DE2A 4MBHA 4R23A 1NYMA 2UWXA 1PI5A 3PBRA 2WADA 3TE8A 3ZCZA 4OPQA 2E8IA 3SH8A 3E4OA 1K54A 4LV1A 5HZHA 1GHPA 4NG2A 2WGWA 4R3BA 1GA0A 2RCXA 1OJGA 1OTDA 4U0XA 1G6AA 2ZOHA 4EV4A 3H82B 4LRZE 4JGRA 3LR5A 4WELA 1ESIA 2JCHA 3UB5P 3A3EA 5HSQA 2WZZA 4WM9A 3TG9A 4R1GA 1E4DA 4ID4A 2V1BA 2XEPA 1DY6A 3ZG7B 3GMWA 1TF1A 2P9VB 1BLPA 3PAGA 3QP2A 1ZTUA 3A3DA 2XLNA 2BASA 2QWSA 5KSCA 3WRTA 2CMNA 5AQAA 1XA7A 2Y2PA 1VEUA 1JTGA 2G2WA 1TS8A 1XPBA 5DVAA 2R9XA 2XGNA 1RCJA 4UA7A 1T1CA 3NI9A 4MEZA 2XF3A 3B33A 3OCNA 1NZOA 3PXPA 2OWHA 3FV7A 2HV1A 3M2JA 3SS3A 1XGIA 5FQ9A 3VOYA 2XD1A 4F3LB 1KDWA 4IVIA 1M6KA 3F1NB 4WUJA 4EU0A 1V9ZA 2W1TA 4EBLA 3O87A 2Y2MA 1KE3A 2ZL1A 1LLBA 1J9MA 3HREA 2NUPC 3C7VA 1SCWA 2V9AA 1UWNX 4I38A 1LL9A 1LL5A 2FH5A 2WKIA 5DTTA 1LSXA 1DRMA 1MC0A 1YAXA 1S0WA 3UE6A 3UN7A 1W79A 3OPPA 4BD1A 3EEAA 1XKZA 1H0MA 2V1ZA 1CQAA 1Y4OA 3B42A 4ZAMA 3FKVA 1S1ZA 3O5YA 3PBOA 1FSYA 4Y0TA 2J8YA 3PBQA 3E2LA 2ZQ7A 2Y2GA 4X1LA 3NY4A 4DXBA 1K6RA 1W63Q 3OZHA 2VZWA 4JXVA 1S4RA 4R3JA 4X56A 3VSKA 4E6WA 4EEUA 3PTEA 3IS2B 3OPHA 4S2OA 4N9LA 4GHIA 5HAIA 3NIAA 5E2GA 5FEGA 1RP5A 3C38A 1SKOA 5EVIB 3S7OA 5MC7A 2HF6A 5FA7A 2V1AA 1PWCA 5DFYA 1K55A 3T4KA 2Y2OA 3IQAA 2JC7A 2HDSA 4WL9A 3L7HA 3QP1A 1G6OA 1BZAA 1YLJA 4I3IA 1F9IA 4EETB 4Y15A 3NOPC 3RFBA 3GSGA 3EQVA 4OQ0A 1YSQA 4EERA 4BMWA 3LY3A 2VV6A 1EROA 1M40A 3LI8A 3KYEA 4HJ6A 4RYEA 3BJNA 4S2NC 4H6JA 4EQIA 3LR4A 1NLYA 3A0SA 5EM0A 5AVEA 3OPRA 1DP6A 3HL9A 3GTCA 1I2SA 3MKFA 4E3JA 2VA0A 4HHDA 1E3UD 1EWZA 3IXDA 4GS9A 5EVLA 5FEFA 5CGXA 2Z6CA 3ZDJA 3HUOA 1P9WA 3PYPA 4B93A 3M6BA 3IF6A 1Y54A 2ZQDA 4PM9A 3P09A 5L07A 2VK3A 4CPKA 2J9PA 3Q7ZA 2XFSA 1JWZA 1NY0A 2BLSA 2ZQCA 2MJ6A 2PU4A 1TDGA 4XUZA 4JF6A 3NHQA 1YLZA 2A2LA 5K5BA 3ICYA 3G2ZA 2GDNA 4G3WA 3MR0A 3V5MA 1AXBA 2J80A 4JGPA 1ZG4A 3LEQA 5DTKA 3GECA 2X02A 4QHCA 3EQUA 1MXOA 4JBFA 3KSHA 1NWZA 3ITBA 1GSWA 5EUAA 3LIDA 5F6AA 3VE3A 1K57C 3GRJA 1YQSA 2W3HA 3SH9A 4WZ4A 1YM1A 2YKHA 5FQIA 1OT9A 1W8YA 1MZUA 1H3QA 1ZC2A 4KQOA 3ZNTA 2LB9A 5F82A 2ZLYA 3E4PA 4CQHA 2JKFA 2Y8HA 5F5YA 1ES4A 2OOLA 3HJKA 1T1BA 4B4ZA 4GDNA 4F94A 1OTAA 5GHZA 2P04A 3BW6A 3GV9A 4ZDXA 2JHEA 4E3MA 2QMIA 5TR7A 4N1XA 3CZDA 2WKQA 5AQ9A 3CMZA 4OKPA 1ONHA 4PM8A 3A0VA 4Y7PA 5EOEA 3GQZA 1BTLA 3IHBA 4GOGA 1H8ZA 4E3NA 4E6XA 4XXRA 1XFNA 3SW1A 2PR5A 3A3JA 3MQOA 4DE0A 3LUQA 4U3TA 4P0MA 4S2KA 5HAPA 2JN7A 4WYYA 2GX5A 4K91A 4D2OA 4WZ5A 4IVKA 3D9YA 4I39A 1IOUA 2EFUA 3DTIA 3MS6A 1IYOA 4XT2B 2QJ5A 2I72A 2W1RA 3H7WA 1BSGA 3NOUC 4ZBEA 1A0KA 5J8XA 1XGJA 4KZ5A 3UY6A 3VP1A 4EEPA 3G35A 3ZHHA 1ZKJA 3ZFZA 3OLOA 4MLLA 5FASA 3VSLA 4Q0HA 1XJ6A 4OOYA 2J9OA 3HCYA 5FQQA 2OAP1 3N4IA 2VGJA 5CTMA 2XFTA 2PYRA 1TS7A 2ZQAA 4PM7A 4M4XA 3T4LA 5E2FA 1SDEA 2ZMVA 2Y4AA 4WMCD 2PYPA 4R4RA 1FQGA 1K54C 3WS2A 4BL2A 1CEFA 3P01A 1DJAA 3H82A 4DMZA 1H5XA 2XD5A 3KSIA 2KDKA 3U4LP 1JWPA 1OJ5A 2ZOIA 4OOMA 2FFYA 1VM1A 1YLWA 5FSRA 4PPRA 5AVFA 1NLZA 5FI2A 3HVFA 2ZM0A 1Z6FA 5KZHA 3LIAA 4IBXA 2ZM2A 3RXWA 2OLVA 4FSFA 5M1AA 4HESA 5FI6A 4I5SA 1NXYA 1GSXA 1T19A 1H8MA 2R9WA 3G32A 1ES2A 4IUHA 2WAFA 3WWXA 4QU3A 3S4XA 2H5SA 3N6IA 1HZOA 4UA9A 1OT6A 4OLDA 4EW7A 5F1GA 3ZG8B 1NZUA 5CEDA 4X55A 1IELA 1VETB 2HJ9C 1NRJA 2Y2HA 4N1HA 2PD8A 4F3LA 1S6RA 4UEYA 4DJ3A 3N8RA 1TVFA 1VHMA 5FDHA 2P74A 3OBFA 1OMEA 1OTBA 1L2SA 4C75A 4II7A 3HBRA 3UE1A 3QHYA 4ZJ2A 4S2MA 3WRZA 4S2JA 5TFQA 4S2PA 2RL3A 3QNBA 5KIZA 1CF0A 4R3AA 4BBUA 4KUOA 2L4RA 1J3WA 4S2IA 5TBMB 3V67A 3WS1A 2OLUA 1LI9A 1XX2A 3FC7A 3PBSA 2DNSA 3BFEA 3HLBA 2A24B 5FQKA 4LENA 4OH0A 5EVEA 1GHMA 4L9GA 5E43A 4EUVA 3TSGA 5M18A 1VB6A 4MNRA 4KQDA 3UB6A 1CEGA 5EVIA 4NKPA 2G7UA 3GR2A 3S1YA 5EFWA 4DKIA
chains in the Genus database with same CATH topology
1LL8A 3T4KA 5J4EA 5HD5A 5FL3A 5C5KA 2INWA 4HNBA 4WL9A 4DJ2A 1IFQA 5HWWA 3LIBA 2W0NA 4PKYA 1G6OA 2XA7S 4I3IA 3R7WA 3D72A 1F9IA 5J7EA 4HP9A 4Q0IA 4EETB 5HDSA 1XJ2A 3KYQA 4HH3A 4HJ3A 3NOPC 4P6ZS 3RFBA 2KX6A 2J3WA 3EQVA 3C30A 4GJ4A 5HDDA 2JKRM 1YSQA 4EERA 4I3JA 3MJQA 4BMWA 2XA7M 3VOLA 2V0WA 2VV6A 1S67L 3LI8A 4HJ6A 3BJNA 4P6ZM 4H6JA 4HY8A 4LRYC 3UE3A 3LR4A 4BBTA 1NLYA 3CWFA 3A0SA 3T4SA 2B18A 4EQ1A 1BYWA 2O9BA 5AVEA 3C2WA 2VV8A 3PHYA 1DP6A 4L9FA 3GDIA 4GS9B 2VA0A 4HHDA 4GS9A 1YSPA 3OOVA 3W2ZA 2Z6CA 3OCLA 4YNRA 3F1NA 3E98A 3LI9A 5DFXA 4GW9A 3B47A 1P9WA 3PYPA 4B93A 4FOFA 2Z6DA 2LB5A 5HWVA 4GCZA 2PR6A 4YOFA 4YWZA 3EWKA 4B9OA 4MN5A 4Y3IA 3BWLA 1OTEA 2D02A 3TJZC 3F1PB 1S1YA 3H7WB 2W3DA 2MJ6A 3F1PA 5IU1A 3MFXA 3PBTA 1P97A 4OOLA 3NHQA 2A2LA 5K5BA 3ICYA 4AFIA 3ZQ5A 4G3WA 1JNUA 3MR0A 4WEKA 2J80A 4JGPA 2QHKA 3NJAA 4O8GA 5TBMA 4CLCD 3VV4A 1P9RA 3GECA 4GLQA 3K3CA 3EQUA 4IJGA 4Y2FA 1T18A 4BWIA 3PR6A 4KUKA 3IS2A 2A24A 3MF0A 3KSHA 1OPXA 1NWZA 1GSWA 2EWVA 4ETXA 3LIDA 5F6AA 1LT0A 3VE3A 4UQIS 2XROA 2W3HA 3FPWA 1GSVA 4Y5FA 4CLCE 2YKHA 4HOIA 3K3DA 4WEJA 1STZA 1OT9A 2J3TC 1N9OA 5CX7A 1MZUA 2P7JA 1H3QA 4KQOA 3LIFA 1G28A 3EOIA 3T4OA 5LBRA 2DMWA 4UQIM 2LB9A 3D3OA 3CUEC 4JGOA 3EEHA 2M7VA 2GZAA 3E4PA 4CQHA 1S66L 3ZYTA 2Y8HA 3CLOA 3F1OB 5F5YA 3G6OA 3HJKA 2OOLA 3UB8A 1T1BA 2OWJA 4LPZA 3U2AA 4EXOA 4PHTA 2OAQ1 1OTAA 2P04A 3DBAA 3BW6A 4IHQA 3UB9A 4ETZA 5KSHA 3LIEA 5DKKA 1TD5A 1TS6A 2O0YA 4E04A 2JHEA 1UWPX 3E4QA 1MKMA 1EW0A 1ODVA 2W27A 2WKQA 4ARZB 2W3EA 3KSFA 3CI6A 4ARZA 4WN5A 1S4SA 4L0LA 1W63M 3IBJA 2PT7A 3A0VA 4MMNA 2JKRI 1F5MA 1LSWA 5DKLA 4MCWA 2V0UA 4R6LA 3K2NA 1XFNA 3SW1A 2PR5A 3R4KA 3MQOA 3LUQA 4I3AA 2XSSA 4NXEA 5TJJA 4G3VA 3FG8A 4LLOB 1YKDA 2O9CA 3EGXC 4HQAA 5I5LA 2PDRA 2O99A 3E0YA 2L0WA 3P7NA 3RTYA 1N9LA 3C8CA 3BQ8A 1OTIA 4MN7A 4CLCB 2JN7A 2GX5A 2W3FA 2VGLS 4O0PA 4LRXC 3PBNA 4MN6A 3LYXA 4I39A 1IOUA 3S7QA 4ME4A 1ZHHB 2VLGA 4XT2B 1LSVA 2QJ5A 2P08A 2W1RA 2GNXA 3H7WA 4XT2A 2B02A 2VGLM 3KSGA 3NOUC 1N9NA 3FPVA 5IT5A 4R70A 2QJ7A 2K2NA 4EEPA 2M7UA 1DP8A 1F98A 4NXFA 2K7SA 3OC2A 3JVVA 3OLOA 4NXBA 5DJUA 3EGDC 4R38A 4Q0HA 4NEED 4K08A 3TW8A 2M1CA 4DN0A 1XJ6A 3HCYA 2OAP1 2VJWA 2JKTM 4HP4A 3UMDA 2VX8A 2PYRA 1TS7A 3PBRA 4NXGA 3TE8A 3BY9A 4BBVA 2YKFA 3E4OA 4M4XA 5HPIA 3CAXA 3T4QA 1UGUA 5HZHA 3T4LA 5HWTA 3CITA 2ZMVA 3MQ0A 1D06A 2IA2A 3UB7A 1D7EA 2PYPA 1OJGA 1XFQA 1OTDA 2WKPA 3IBRA 2ZOHA 4ZRRA 3P01A 3H82B 4LRZE 2ZMFA 3F1OA 2QKPA 3LR5A 4JGRA 4RQ9A 4WELA 4O01A 3H82A 4DMZA 4EESA 3KSIA 2KDKA 5HSQA 2HGVA 4Z1WA 1OJ5A 2ZOIA 5AJGA 4OOMA 4PKYG 2V1BA 2WKRA 1V9YA 1Y28A 1TF1A 4IUKA 3H9WA 2VEAA 1X0OA 5DF9A 5G4YA 5AVFA 3R7WB 1ZTUA 3HJIA 4MDZA 1NLZA 2BASA 2FZ0A 2QWSA 3KX0X 2CMNA 3MXQA 2J3TD 3LICA 3LIAA 3UMEA 5L8MA 3RH8B 4WLAA 2Y79A 3A0RA 2W3GA 3LR3A 4FSFA 4PAUA 1TS8A 3NOTC 2ZBBA 2K31A 2EA9A 4I5SA 1GSXA 1T19A 1H8MA 1T1CA 4H6JB 4L9EA 4IUHA 5G4ZA 3B33A 3OCNA 4QPRA 3PXPA 3T50A 2OWHA 2O9AA 1OT6A 4EW7A 2HV1A 5F68A 2QYBA 2L1MA 3BQAA 4JGQA 4CLCA 3T4JA 2D01A 2HJ9C 1NRJA 4Q0JA 4HIAA 5F69A 4F3LB 1P0ZA 2PD8A 4F3LA 2W1TB 3F1NB 4WUJA 2I9VA 4EU0A 3ULFA 4UEYA 1V9ZA 1WA9A 1XJ3A 2W1TA 4DJ3A 4CLCC 3MMHA 5HD3A 1XJ4A 4G3KA 1VHMA 5HDCA 2NUPC 1T1AA 3LR0A 2V9AA 1KOUA 3OBFA 1UWNX 1OTBA 4I38A 2FH5A 4II7A 1LSXA 2KLIA 1DRMA 1MC0A 1YAXA 5HPFA 3UE6A 3LFVA 5A8BA 2EWWA 3EEAA 1DP9A 3B42A 3TRCA 5KIZA 3KYZA 4R3AA 4BBUA 2GJ3A 5IS1A 5DJTA 1S1ZA 4KUOA 2L4RA 3O5YA 3PBOA 3PBQA 5HL6A 2PHYA 1W63Q 2KOIA 5TBMB 3V67A 2VV7A 1TS0A 2VZWA 1S4RA 3VE4A 3FC7A 3PBSA 4EEUA 4WF0A 3KO6A 4GHIB 3T4TA 2NUTC 2H28A 3IS2B 2A24B 4GHIA 2R78A 4HI4A 4BJPA 3MQQA 2JKTI 4L9GA 3C38A 4EUVA 1VB6A 3JVUA 3S7OA 5MC7A 2HF6A 2HJEA 2XRNA 4HJ4A 4KQDA 3S7PA 3CUEA 5J3WA 3UB6A 2V1AA 4NKPA 2G7UA 2VKSA 3S7NA 4HH2A 2PD7A 3BY8A 5DFYA 5EFWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NOT C;  2K31 A;  4LRX C;  4GLQ A;  3S7Q A;  4ME4 A;  4IJG A;  4Y2F A;  4BWI A;  5C5K A;  2W1R A;  4IUH A;  3MF0 A;  3KSH A;  4QPR A;  2O9A A;  3KSG A;  4ETX A;  3NOU C;  4R70 A;  2W3H A;  4Q0I A;  2XRO A;  2QYB A;  3NOP C;  4Y5F A;  3RFB A;  2K2N A;  2M7U A;  4Q0J A;  1STZ A;  1YSQ A;  2W1T B;  4Q0H A;  4EU0 A;  2W1T A;  5LBR A;  4DN0 A;  2LB9 A;  3D3O A;  3BJN A;  2M7V A;  4CQH A;  3MMH A;  3HCY A;  4G3K A;  4LRY C;  2Y8H A;  1VHM A;  2VJW A;  3G6O A;  2OOL A;  2B18 A;  2O9B A;  3OBF A;  3C2W A;  2KLI A;  1MC0 A;  5HPF A;  3DBA A;  5HPI A;  4ETZ A;  3LFV A;  1TD5 A;  2O0Y A;  4E04 A;  3CIT A;  1YSP A;  3MQ0 A;  3EEA A;  3OOV A;  2IA2 A;  3W2Z A;  1MKM A;  4YNR A;  3E98 A;  5DFX A;  4GW9 A;  3O5Y A;  2W3E A;  3IBR A;  3KSF A;  4FOF A;  3CI6 A;  4ZRR A;  2LB5 A;  4LRZ E;  5HL6 A;  2ZMF A;  4RQ9 A;  4O01 A;  2KOI A;  4DMZ A;  3IBJ A;  3KSI A;  5HSQ A;  2VZW A;  2HGV A;  4Z1W A;  4MMN A;  1F5M A;  4YOF A;  5AJG A;  4MCW A;  4R6L A;  4Y3I A;  3K2N A;  3KO6 A;  3R4K A;  2W3D A;  1TF1 A;  2XSS A;  4IUK A;  5TJJ A;  2VEA A;  4G3V A;  1YKD A;  2O9C A;  1ZTU A;  5I5L A;  2O99 A;  4MDZ A;  4EUV A;  3E0Y A;  3NHQ A;  5K5B A;  3S7O A;  4MN7 A;  2XRN A;  3S7P A;  3ZQ5 A;  4G3W A;  5L8M A;  2GX5 A;  2W3F A;  2Y79 A;  2G7U A;  2VKS A;  3S7N A;  4O8G A;  2W3G A;  4O0P A;  3VV4 A;  5DFY A;  3TRC A;  4PAU A; 
#chains in the Genus database with same CATH topology
 1WE4 A;  1L0D A;  3T12 B;  2INW A;  4HNB A;  1KDS A;  5CGS A;  2ZQ8 A;  5CER A;  3R7W A;  2XH9 A;  1K55 C;  2Q9N A;  4HEF A;  3D72 A;  5J7E A;  3UPO A;  1SHV A;  3CHW P;  2BG1 A;  5HDD A;  2HDQ A;  4H8R A;  2B95 A;  1FR1 A;  2XA7 M;  1PFL A;  4PMA A;  4P6Z M;  3VOZ A;  2IWD A;  4HY8 A;  4LRY C;  3UE3 A;  5L09 A;  5CGW A;  3CWF A;  3T4S A;  4EQ1 A;  1BYW A;  2O9B A;  3A3F A;  1ES3 A;  3ZVW A;  4L9F A;  2Z2L B;  4UAA A;  4RX3 A;  3CG5 A;  3BM6 A;  3OOV A;  3W2Z A;  4YNR A;  1K6S A;  3LI9 A;  4OON A;  3B47 A;  1K4E A;  2JE5 A;  2Z6D A;  2VGK A;  2Y55 A;  4FUW A;  4EBN A;  4R0Q A;  5EPH A;  1MWR A;  2HDR A;  1YMX A;  3NCK A;  1K4F A;  3VFH A;  4C6Y A;  1OTE A;  2D02 A;  4PM5 A;  3F1P B;  1K56 A;  4LCM A;  2PAV P;  1DJC A;  3MFX A;  4AFI A;  1JNU A;  4O8G A;  1N4O A;  4E3O A;  3NUL A;  2ACG A;  2QPN A;  4U0T A;  4IJG A;  3ZG5 A;  5EV0 A;  3PR6 A;  1ALQ A;  3HLF A;  2H10 A;  3QP8 A;  3N8L A;  2EWV A;  4KZ8 A;  1LT0 A;  4UQI S;  3FPW A;  5HAR A;  1ACF A;  4EUZ A;  4YFM A;  4HOI A;  4WEJ A;  5TGF A;  4OQH A;  2WGW B;  2P7J A;  4QY6 A;  4KQQ A;  3T4O A;  5FI7 A;  4D60 A;  5KMW A;  3CUE C;  3OPL A;  4JGO A;  3EEH A;  2GZA A;  5CHM A;  3CLO A;  4OVD A;  3T1X A;  1PZO A;  3UB8 A;  3LEZ A;  1E25 A;  3BFF A;  2OWJ A;  3U2A A;  3ZNY A;  1FR6 A;  3BRM A;  4IHQ A;  3FYZ A;  3UB9 A;  4ETZ A;  2HZ5 A;  1NYY A;  1TD5 A;  1TS6 A;  3SOI A;  3G34 A;  1D1J A;  3E4Q A;  1MKM A;  1EW0 A;  2W27 A;  1BLC A;  3P98 A;  2EX2 A;  4KZ4 A;  2Q0O A;  1NRF A;  3O3V A;  3KSF A;  3Q07 A;  4WN5 A;  1VEU B;  2HP9 A;  2ZJ9 A;  3T1R A;  1F5M A;  1LSW A;  3NBL A;  4MCW A;  4R6L A;  5FDS A;  5I94 A;  4I3A A;  4NXE A;  2XSS A;  3NDG A;  4K0W A;  4LLO B;  1YKD A;  1GA9 A;  2O9C A;  2PRF A;  5I5L A;  1VQQ A;  3P7N A;  3C8C A;  3QP4 A;  3IWI A;  3ZVT A;  1PW1 A;  4X25 A;  5IHV A;  3PBN A;  5CTN A;  3LYX A;  4OQI A;  4ME4 A;  2ZL1 B;  1ZHH B;  2P08 A;  1GHI A;  4XT2 A;  4DRT A;  4WZ5 C;  2VGL M;  3KSG A;  5IT5 A;  2J7V A;  4GKU A;  1DJB A;  4JF5 A;  2K2N A;  5GHX A;  2M7U A;  1JTD A;  1F98 A;  1BUE A;  5E2E A;  3OC2 A;  4NXB A;  4R38 A;  1W8Q A;  3TW8 A;  4PM6 A;  4NET A;  3FWL A;  3W4Q A;  2Y2N A;  2EXA A;  5AQ7 A;  2JKT M;  2QZ6 A;  4GZB A;  3SS5 A;  4NXG A;  3BY9 A;  4BBV A;  4E3K A;  5HPI A;  2XK1 A;  3T4Q A;  4IBR A;  2BTF P;  3WS5 A;  2Q9M A;  3CIT A;  3CPT A;  1D06 A;  3MSH A;  3PAE A;  3UB7 A;  1PNE A;  3DTE A;  1SKO B;  4Y0O A;  2WKP A;  2A3U A;  4ZRR A;  2ZMF A;  3F1O A;  2QKP A;  4O01 A;  3T1S A;  1KGF A;  4EES A;  1CI9 A;  2HGV A;  4Z1W A;  3B3X A;  5AJG A;  4PKY G;  4DXC A;  1WYC A;  3C7U A;  1Y28 A;  1C3B A;  4IUK A;  5HX9 A;  3H9W A;  5G4Y A;  3VP0 A;  4MDZ A;  2FZ0 A;  2WGV A;  2EFX A;  3FZC A;  5L8M A;  3QNC A;  3RH8 B;  2W3G A;  1AWI A;  2ZBB A;  2EA9 A;  1BUL A;  4LV3 A;  4H6J B;  3HLE A;  4GDB A;  5G4Z A;  4FD8 A;  1L3L A;  4QPR A;  4EWF A;  1PYY A;  3BQA A;  3M6H A;  4JGQ A;  4CLC A;  4KZ9 A;  5CXW A;  4HIA A;  5F69 A;  1GCE A;  4X68 A;  3DAV A;  3G31 A;  2C5W B;  5A92 A;  2I9V A;  3DWK A;  1XJ3 A;  1WA9 A;  4RVA A;  5HD3 A;  1XJ4 A;  4G3K A;  3SZT A;  4OP8 A;  2Y91 A;  3LGO A;  4LFU A;  1T1A A;  1KOU A;  3BYD A;  5GHY A;  2KLI A;  1HLU P;  3SH7 A;  4Q8I A;  4EBP A;  1BLH A;  4RA7 A;  4Y17 A;  3VFF A;  1JVJ A;  1DP9 A;  2ZC3 B;  3Q7V A;  5IS1 A;  3DW0 A;  2PHY A;  2KOI A;  2V2F F;  1KGE A;  4XUX A;  3T4T A;  2H28 A;  4HI4 A;  2JKT I;  5CEC A;  1TEM A;  5DF8 A;  2V20 A;  1KVM A;  4BLM A;  1L0F A;  4HJ4 A;  2XRN A;  2V8F A;  5J3W A;  5L2F A;  5GLD A;  3ISG A;  1PI4 A;  2VKS A;  2C6W B;  4HH2 A;  2PD7 A;  3TRC A;  3UE0 A;  5FL3 A;  1ERM A;  4DJ2 A;  5GL9 A;  2W0N A;  3DTM A;  4PKY A;  2P9V A;  2ZD8 A;  5GLC A;  4DF6 A;  4HP9 A;  3AGF A;  1XJ2 A;  4HH3 A;  3IT9 A;  2J3W A;  3JPU A;  4OP5 A;  3C30 A;  4OPY A;  1YMS A;  1K0K A;  4I3J A;  3WS0 A;  3MJQ A;  3VOL A;  2V0W A;  3ITA A;  4A5R A;  4KZ7 A;  3HUM A;  3MZE A;  1N9B A;  2B18 A;  2G2U A;  2VV8 A;  4BEN A;  5FAT A;  1YSP A;  3OCL A;  3QP6 A;  3F1N A;  5DFX A;  4GW9 A;  3IX3 A;  1W5D A;  5M19 A;  2E8J A;  4JF4 A;  5HWV A;  2HPB A;  3V39 A;  4Y13 A;  4YIN A;  4GCZ A;  1IYQ A;  2PR6 A;  1EI5 A;  5A91 A;  4YOF A;  4YWZ A;  4B9O A;  4MN5 A;  3ZG0 A;  1JWV A;  4Y3I A;  3TJZ C;  3H7W B;  2W3D A;  1U60 A;  3F1P A;  5IU1 A;  5EOO A;  4N92 A;  1YLT A;  4OOL A;  1P97 A;  4GD6 A;  3ZQ5 A;  1PW8 A;  4WEK A;  4X1M A;  2ZC4 B;  3UPN A;  2QHK A;  3NC8 A;  3VV4 A;  1P9R A;  4FH2 A;  2Z2M B;  1PZP A;  5GLB A;  4GLQ A;  3K3C A;  4KG6 A;  1K38 A;  1T18 A;  3IS2 A;  3MF0 A;  4B4X A;  1OPX A;  4ETX A;  3S22 A;  5HW3 A;  4JPM A;  3RXX A;  3NDE A;  1GSV A;  4CLC E;  3K3D A;  3AGE A;  2J3T C;  3LIF A;  3D3O A;  1XP4 A;  2M7V A;  3ZYT A;  4LPZ A;  4PHT A;  2OAQ 1;  2WK0 A;  1HD8 A;  4OQG A;  3HLW A;  1FIK A;  3LIE A;  5DKK A;  4FCF A;  3HLD A;  2ZC6 B;  1UWP X;  5FQJ A;  1ODV A;  3IHA A;  3IF5 A;  4ARZ B;  3IXG A;  2Y2I A;  4L0L A;  1W63 M;  3IBJ A;  1O07 A;  4JXS A;  5EVI D;  4MMN A;  1KVL A;  4KZ6 A;  2CC1 A;  4P6B A;  5DKL A;  2V0U A;  3IXH A;  1KE0 A;  4WBG A;  4P87 A;  5DTS A;  1O7E A;  5TJJ A;  1CJF A;  3FG8 A;  1FSW A;  4HQA A;  2PDR A;  3E0Y A;  2L0W A;  3RTY A;  3BQ8 A;  4KZA A;  4KEN B;  4OPR A;  1MWT A;  4BD0 A;  2DCF A;  2PBY A;  5JYO A;  4QD4 A;  3BEC A;  3IF6 C;  4LRX C;  4MN6 A;  4QWO A;  5GLA A;  1NJ4 A;  3G30 A;  2VLG A;  2HP6 A;  3IH9 A;  3C5A A;  1MY8 A;  3BFG A;  4RX2 A;  1Z09 A;  5A90 A;  4R70 A;  2QJ7 A;  4LGW A;  1MWU A;  1IEM A;  1DP8 A;  4NXF A;  3L9K A;  2K7S A;  5DJU A;  4HBT A;  4NEE D;  4K08 A;  2ZMA A;  3UPP A;  2M1C A;  4DN0 A;  3IX4 A;  1PIO A;  4LV2 A;  1LI0 A;  3LY4 A;  4JKT A;  1RGY A;  2WAE A;  2VX8 A;  5FAP A;  1QME A;  3M2K A;  2YKF A;  2ZQ9 A;  3TOI A;  3CAX A;  3MXS A;  1UGU A;  5HWT A;  3MQ0 A;  2IA2 A;  1D7E A;  1K56 D;  2Y2Q A;  1XFQ A;  4BQM A;  4X53 A;  3QP5 A;  3IBR A;  4O7D A;  4ZTK A;  4RQ9 A;  1RGZ A;  1E3U A;  1BT5 A;  2WYX A;  1MKI A;  3BLS A;  2WKR A;  1V9Y A;  2X01 A;  1YT4 A;  1H8Y A;  3MXR A;  2V8C A;  2VEA A;  3V3R A;  1X0O A;  5DF9 A;  3VMA A;  3R7W B;  4ESP A;  1CK3 A;  3HJI A;  1MBL A;  4CJN A;  5JYP A;  3KX0 X;  3MXQ A;  2IWC A;  2J3T D;  3LIC A;  4E3I A;  3UME A;  3ZGA B;  4WLA A;  2Y79 A;  4DE3 A;  3A0R A;  5CEB A;  4NK3 A;  3LR3 A;  3IH8 A;  4PAU A;  1FOF A;  4IED A;  4KZB A;  3VP2 A;  3NOT C;  4KQR A;  2K31 A;  2IWB A;  4MBK A;  4M3K A;  4L9E A;  2ZC7 A;  4FH4 A;  1I2W A;  3T50 A;  2O9A A;  1KGG A;  5CRF A;  1HTZ A;  3C4P A;  5F68 A;  2QYB A;  2DRW A;  2L1M A;  1BLS A;  3V3S A;  3T4J A;  2D01 A;  4Q0J A;  1IKI A;  1I5Q A;  3T1Q B;  1Q2P A;  5D3O A;  4MBF A;  1P0Z A;  1SDN A;  2W1T B;  3ULF A;  2XR0 A;  4CLC C;  3MMH A;  2HP5 A;  5HDC A;  3LR0 A;  3N8S A;  3Q1F A;  4BL3 A;  5F83 A;  1MWS A;  5HPF A;  2Y2J A;  3LFV A;  5A8B A;  1IYP A;  2EWW A;  1L0E A;  1CI8 A;  3IXB A;  4C3Q A;  3KYZ A;  5AQB A;  1K25 A;  2GJ3 A;  5DJT A;  3LO7 A;  3G4P A;  4HBU A;  4DDY A;  5EEC A;  3O88 A;  5CHJ A;  3UDF A;  5HL6 A;  2EX6 A;  2VV7 A;  1TS0 A;  2PBD P;  1YLP A;  4E3L A;  3NEC A;  3VE4 A;  4LV0 A;  3Q82 A;  1YPR A;  5E2H A;  4WF0 A;  3KO6 A;  4GHI B;  2NUT C;  5FAO A;  2JBF A;  2OSU A;  2R78 A;  4BJP A;  3MQQ A;  2EX9 A;  3JVU A;  2HJE A;  2WKH A;  3S7P A;  3CUE A;  3I7J A;  4R4S A;  3S7N A;  3BY8 A;  1LL8 A;  3A3I A;  3VP3 A;  4ZJ3 A;  5J4E A;  5HD5 A;  3MKE A;  3N7W A;  5C5K A;  5HWW A;  1IFQ A;  3LIB A;  2XA7 S;  4JXW A;  3SS4 A;  4X6T A;  3UDX A;  4Q0I A;  5HDS A;  4X69 A;  3KYQ A;  4HJ3 A;  4S2N A;  2Y2K A;  4P6Z S;  5FAQ A;  2KX6 A;  4GJ4 A;  2JKR M;  4GNU A;  4QY5 A;  3V50 A;  5U47 A;  1S67 L;  3UO9 A;  4DE1 A;  3LCE A;  4BBT A;  4QB8 A;  3BFD A;  2B5R A;  3C2W A;  3JYI A;  3PHY A;  1HVB A;  4GD8 A;  1VET A;  3GDI A;  3IWQ A;  5F1F A;  4GS9 B;  3AGD A;  2Y2L A;  3HLG A;  4B88 A;  1ESU A;  1W7F A;  1WYB A;  1L0G A;  3E98 A;  3E2K A;  3IF6 B;  1MPL A;  3VP4 A;  4FOF A;  2LB5 A;  3CJM A;  1YLY A;  4GN2 A;  2WUQ A;  5BOH A;  2Y59 A;  4KG2 A;  3O86 A;  3MBZ A;  5G18 A;  2EXB A;  3W4P A;  3EWK A;  4WMC A;  3BWL A;  5A93 A;  1S1Y A;  3FKW A;  5HL1 A;  5CHU A;  5L10 A;  3PBT A;  3DWZ A;  2PU2 A;  3D4F A;  1XA1 A;  4DDS A;  1QMF A;  2JKG A;  4Y0U A;  2XDM A;  5TBM A;  3NJA A;  1ES5 A;  4CLC D;  1FCO A;  4K0X A;  2X71 A;  3BLM A;  1K57 A;  3BFC A;  4Z9Q A;  1G68 A;  1TDL A;  4Y2F A;  4BWI A;  4KG5 A;  4KUK A;  2A24 A;  4QJG A;  4LCL A;  2WGI A;  1F2K A;  2XRO A;  4Y5F A;  1Q2Q A;  1STZ A;  3CPT B;  3ZG9 B;  5CX7 A;  1N9O A;  4JXG A;  2AVX A;  1G28 A;  5HAQ A;  3EOI A;  1IYS A;  5LBR A;  2DMW A;  4UQI M;  5EVI C;  1S66 L;  2H0Y A;  3BEB A;  3F1O B;  1LHY A;  1KE4 A;  3G6O A;  4EXO A;  2H0T A;  3MZF A;  1ERQ A;  2UV0 E;  1G5U A;  3DBA A;  4OLG A;  4UHU A;  5KSH A;  1FCM A;  2O0Y A;  2ZM8 A;  4E04 A;  3Q81 A;  1PWD A;  4UA6 A;  3HUN A;  5EM1 A;  2XQZ A;  1XXM A;  2W3E A;  1PRQ A;  3CI6 A;  4ARZ A;  4OPZ A;  1S4S A;  1SZV A;  2PT7 A;  2JKR I;  1ZG6 A;  3RJU A;  3GVB A;  4ZJ1 A;  3DTK A;  3K2N A;  3R4K A;  2WZX A;  5EE8 A;  4G3V A;  4FTX A;  4JLF A;  3IX8 A;  3EGX C;  3W4O A;  2O99 A;  3MZD A;  2ZC5 B;  1N9L A;  1OTI A;  4MN7 A;  4P85 A;  4CLC B;  4N9K A;  2EX8 A;  3G2Y A;  2W3F A;  3IWO A;  2VGL S;  4O0P A;  3MFD A;  1PWG A;  1FIL A;  4GB7 A;  3S7Q A;  3W8K A;  4S2L A;  5HFO A;  1IKG A;  1LSV A;  2GNX A;  2B02 A;  2A49 A;  4KZ3 A;  2HDU A;  1N9N A;  1ONG A;  1SKF A;  3FPV A;  1FCN A;  3HLC A;  2OV5 A;  3JVV A;  2WKE A;  5FQM A;  3EGD C;  3WS4 A;  3Q7V B;  3C4O A;  3UNW A;  5DF7 A;  2VJW A;  3UDI A;  4HP4 A;  3UMD A;  2FFF B;  4DE2 A;  4MBH A;  4R23 A;  1NYM A;  2UWX A;  1PI5 A;  3PBR A;  2WAD A;  3TE8 A;  3ZCZ A;  4OPQ A;  2E8I A;  3SH8 A;  3E4O A;  1K54 A;  4LV1 A;  5HZH A;  1GHP A;  4NG2 A;  2WGW A;  4R3B A;  1GA0 A;  2RCX A;  1OJG A;  1OTD A;  4U0X A;  1G6A A;  2ZOH A;  4EV4 A;  3H82 B;  4LRZ E;  4JGR A;  3LR5 A;  4WEL A;  1ESI A;  2JCH A;  3UB5 P;  3A3E A;  5HSQ A;  2WZZ A;  4WM9 A;  3TG9 A;  4R1G A;  1E4D A;  4ID4 A;  2V1B A;  2XEP A;  1DY6 A;  3ZG7 B;  3GMW A;  1TF1 A;  2P9V B;  1BLP A;  3PAG A;  3QP2 A;  1ZTU A;  3A3D A;  2XLN A;  2BAS A;  2QWS A;  5KSC A;  3WRT A;  2CMN A;  5AQA A;  1XA7 A;  2Y2P A;  1VEU A;  1JTG A;  2G2W A;  1TS8 A;  1XPB A;  5DVA A;  2R9X A;  2XGN A;  1RCJ A;  4UA7 A;  1T1C A;  3NI9 A;  4MEZ A;  2XF3 A;  3B33 A;  3OCN A;  1NZO A;  3PXP A;  2OWH A;  3FV7 A;  2HV1 A;  3M2J A;  3SS3 A;  1XGI A;  5FQ9 A;  3VOY A;  2XD1 A;  4F3L B;  1KDW A;  4IVI A;  1M6K A;  3F1N B;  4WUJ A;  4EU0 A;  1V9Z A;  2W1T A;  4EBL A;  3O87 A;  2Y2M A;  1KE3 A;  2ZL1 A;  1LLB A;  1J9M A;  3HRE A;  2NUP C;  3C7V A;  1SCW A;  2V9A A;  1UWN X;  4I38 A;  1LL9 A;  1LL5 A;  2FH5 A;  2WKI A;  5DTT A;  1LSX A;  1DRM A;  1MC0 A;  1YAX A;  1S0W A;  3UE6 A;  3UN7 A;  1W79 A;  3OPP A;  4BD1 A;  3EEA A;  1XKZ A;  1H0M A;  2V1Z A;  1CQA A;  1Y4O A;  3B42 A;  4ZAM A;  3FKV A;  1S1Z A;  3O5Y A;  3PBO A;  1FSY A;  4Y0T A;  2J8Y A;  3PBQ A;  3E2L A;  2ZQ7 A;  2Y2G A;  4X1L A;  3NY4 A;  4DXB A;  1K6R A;  1W63 Q;  3OZH A;  2VZW A;  4JXV A;  1S4R A;  4R3J A;  4X56 A;  3VSK A;  4E6W A;  4EEU A;  3PTE A;  3IS2 B;  3OPH A;  4S2O A;  4N9L A;  4GHI A;  5HAI A;  3NIA A;  5E2G A;  5FEG A;  1RP5 A;  3C38 A;  1SKO A;  5EVI B;  3S7O A;  5MC7 A;  2HF6 A;  5FA7 A;  2V1A A;  1PWC A;  5DFY A;  1K55 A;  3T4K A;  2Y2O A;  3IQA A;  2JC7 A;  2HDS A;  4WL9 A;  3L7H A;  3QP1 A;  1G6O A;  1BZA A;  1YLJ A;  4I3I A;  1F9I A;  4EET B;  4Y15 A;  3NOP C;  3RFB A;  3GSG A;  3EQV A;  4OQ0 A;  1YSQ A;  4EER A;  4BMW A;  3LY3 A;  2VV6 A;  1ERO A;  1M40 A;  3LI8 A;  3KYE A;  4HJ6 A;  4RYE A;  3BJN A;  4S2N C;  4H6J A;  4EQI A;  3LR4 A;  1NLY A;  3A0S A;  5EM0 A;  5AVE A;  3OPR A;  1DP6 A;  3HL9 A;  3GTC A;  1I2S A;  3MKF A;  4E3J A;  2VA0 A;  4HHD A;  1E3U D;  1EWZ A;  3IXD A;  4GS9 A;  5EVL A;  5FEF A;  5CGX A;  2Z6C A;  3ZDJ A;  3HUO A;  1P9W A;  3PYP A;  4B93 A;  3M6B A;  3IF6 A;  1Y54 A;  2ZQD A;  4PM9 A;  3P09 A;  5L07 A;  2VK3 A;  4CPK A;  2J9P A;  3Q7Z A;  2XFS A;  1JWZ A;  1NY0 A;  2BLS A;  2ZQC A;  2MJ6 A;  2PU4 A;  1TDG A;  4XUZ A;  4JF6 A;  3NHQ A;  1YLZ A;  2A2L A;  5K5B A;  3ICY A;  3G2Z A;  2GDN A;  4G3W A;  3MR0 A;  3V5M A;  1AXB A;  2J80 A;  4JGP A;  1ZG4 A;  3LEQ A;  5DTK A;  3GEC A;  2X02 A;  4QHC A;  3EQU A;  1MXO A;  4JBF A;  3KSH A;  1NWZ A;  3ITB A;  1GSW A;  5EUA A;  3LID A;  5F6A A;  3VE3 A;  1K57 C;  3GRJ A;  1YQS A;  2W3H A;  3SH9 A;  4WZ4 A;  1YM1 A;  2YKH A;  5FQI A;  1OT9 A;  1W8Y A;  1MZU A;  1H3Q A;  1ZC2 A;  4KQO A;  3ZNT A;  2LB9 A;  5F82 A;  2ZLY A;  3E4P A;  4CQH A;  2JKF A;  2Y8H A;  5F5Y A;  1ES4 A;  2OOL A;  3HJK A;  1T1B A;  4B4Z A;  4GDN A;  4F94 A;  1OTA A;  5GHZ A;  2P04 A;  3BW6 A;  3GV9 A;  4ZDX A;  2JHE A;  4E3M A;  2QMI A;  5TR7 A;  4N1X A;  3CZD A;  2WKQ A;  5AQ9 A;  3CMZ A;  4OKP A;  1ONH A;  4PM8 A;  3A0V A;  4Y7P A;  5EOE A;  3GQZ A;  1BTL A;  3IHB A;  4GOG A;  1H8Z A;  4E3N A;  4E6X A;  4XXR A;  1XFN A;  3SW1 A;  2PR5 A;  3A3J A;  3MQO A;  4DE0 A;  3LUQ A;  4U3T A;  4P0M A;  4S2K A;  5HAP A;  2JN7 A;  4WYY A;  2GX5 A;  4K91 A;  4D2O A;  4WZ5 A;  4IVK A;  3D9Y A;  4I39 A;  1IOU A;  2EFU A;  3DTI A;  3MS6 A;  1IYO A;  4XT2 B;  2QJ5 A;  2I72 A;  2W1R A;  3H7W A;  1BSG A;  3NOU C;  4ZBE A;  1A0K A;  5J8X A;  1XGJ A;  4KZ5 A;  3UY6 A;  3VP1 A;  4EEP A;  3G35 A;  3ZHH A;  1ZKJ A;  3ZFZ A;  3OLO A;  4MLL A;  5FAS A;  3VSL A;  4Q0H A;  1XJ6 A;  4OOY A;  2J9O A;  3HCY A;  5FQQ A;  2OAP 1;  3N4I A;  2VGJ A;  5CTM A;  2XFT A;  2PYR A;  1TS7 A;  2ZQA A;  4PM7 A;  4M4X A;  3T4L A;  5E2F A;  1SDE A;  2ZMV A;  2Y4A A;  4WMC D;  2PYP A;  4R4R A;  1FQG A;  1K54 C;  3WS2 A;  4BL2 A;  1CEF A;  3P01 A;  1DJA A;  3H82 A;  4DMZ A;  1H5X A;  2XD5 A;  3KSI A;  2KDK A;  3U4L P;  1JWP A;  1OJ5 A;  2ZOI A;  4OOM A;  2FFY A;  1VM1 A;  1YLW A;  5FSR A;  4PPR A;  5AVF A;  1NLZ A;  5FI2 A;  3HVF A;  2ZM0 A;  1Z6F A;  5KZH A;  3LIA A;  4IBX A;  2ZM2 A;  3RXW A;  2OLV A;  4FSF A;  5M1A A;  4HES A;  5FI6 A;  4I5S A;  1NXY A;  1GSX A;  1T19 A;  1H8M A;  2R9W A;  3G32 A;  1ES2 A;  4IUH A;  2WAF A;  3WWX A;  4QU3 A;  3S4X A;  2H5S A;  3N6I A;  1HZO A;  4UA9 A;  1OT6 A;  4OLD A;  4EW7 A;  5F1G A;  3ZG8 B;  1NZU A;  5CED A;  4X55 A;  1IEL A;  1VET B;  2HJ9 C;  1NRJ A;  2Y2H A;  4N1H A;  2PD8 A;  4F3L A;  1S6R A;  4UEY A;  4DJ3 A;  3N8R A;  1TVF A;  1VHM A;  5FDH A;  2P74 A;  3OBF A;  1OME A;  1OTB A;  1L2S A;  4C75 A;  4II7 A;  3HBR A;  3UE1 A;  3QHY A;  4ZJ2 A;  4S2M A;  3WRZ A;  4S2J A;  5TFQ A;  4S2P A;  2RL3 A;  3QNB A;  5KIZ A;  1CF0 A;  4R3A A;  4BBU A;  4KUO A;  2L4R A;  1J3W A;  4S2I A;  5TBM B;  3V67 A;  3WS1 A;  2OLU A;  1LI9 A;  1XX2 A;  3FC7 A;  3PBS A;  2DNS A;  3BFE A;  3HLB A;  2A24 B;  5FQK A;  4LEN A;  4OH0 A;  5EVE A;  1GHM A;  4L9G A;  5E43 A;  4EUV A;  3TSG A;  5M18 A;  1VB6 A;  4MNR A;  4KQD A;  3UB6 A;  1CEG A;  5EVI A;  4NKP A;  2G7U A;  3GR2 A;  3S1Y A;  5EFW A;  4DKI A; 
#chains in the Genus database with same CATH homology
 1LL8 A;  3T4K A;  5J4E A;  5HD5 A;  5FL3 A;  5C5K A;  2INW A;  4HNB A;  4WL9 A;  4DJ2 A;  1IFQ A;  5HWW A;  3LIB A;  2W0N A;  4PKY A;  1G6O A;  2XA7 S;  4I3I A;  3R7W A;  3D72 A;  1F9I A;  5J7E A;  4HP9 A;  4Q0I A;  4EET B;  5HDS A;  1XJ2 A;  3KYQ A;  4HH3 A;  4HJ3 A;  3NOP C;  4P6Z S;  3RFB A;  2KX6 A;  2J3W A;  3EQV A;  3C30 A;  4GJ4 A;  5HDD A;  2JKR M;  1YSQ A;  4EER A;  4I3J A;  3MJQ A;  4BMW A;  2XA7 M;  3VOL A;  2V0W A;  2VV6 A;  1S67 L;  3LI8 A;  4HJ6 A;  3BJN A;  4P6Z M;  4H6J A;  4HY8 A;  4LRY C;  3UE3 A;  3LR4 A;  4BBT A;  1NLY A;  3CWF A;  3A0S A;  3T4S A;  2B18 A;  4EQ1 A;  1BYW A;  2O9B A;  5AVE A;  3C2W A;  2VV8 A;  3PHY A;  1DP6 A;  4L9F A;  3GDI A;  4GS9 B;  2VA0 A;  4HHD A;  4GS9 A;  1YSP A;  3OOV A;  3W2Z A;  2Z6C A;  3OCL A;  4YNR A;  3F1N A;  3E98 A;  3LI9 A;  5DFX A;  4GW9 A;  3B47 A;  1P9W A;  3PYP A;  4B93 A;  4FOF A;  2Z6D A;  2LB5 A;  5HWV A;  4GCZ A;  2PR6 A;  4YOF A;  4YWZ A;  3EWK A;  4B9O A;  4MN5 A;  4Y3I A;  3BWL A;  1OTE A;  2D02 A;  3TJZ C;  3F1P B;  1S1Y A;  3H7W B;  2W3D A;  2MJ6 A;  3F1P A;  5IU1 A;  3MFX A;  3PBT A;  1P97 A;  4OOL A;  3NHQ A;  2A2L A;  5K5B A;  3ICY A;  4AFI A;  3ZQ5 A;  4G3W A;  1JNU A;  3MR0 A;  4WEK A;  2J80 A;  4JGP A;  2QHK A;  3NJA A;  4O8G A;  5TBM A;  4CLC D;  3VV4 A;  1P9R A;  3GEC A;  4GLQ A;  3K3C A;  3EQU A;  4IJG A;  4Y2F A;  1T18 A;  4BWI A;  3PR6 A;  4KUK A;  3IS2 A;  2A24 A;  3MF0 A;  3KSH A;  1OPX A;  1NWZ A;  1GSW A;  2EWV A;  4ETX A;  3LID A;  5F6A A;  1LT0 A;  3VE3 A;  4UQI S;  2XRO A;  2W3H A;  3FPW A;  1GSV A;  4Y5F A;  4CLC E;  2YKH A;  4HOI A;  3K3D A;  4WEJ A;  1STZ A;  1OT9 A;  2J3T C;  1N9O A;  5CX7 A;  1MZU A;  2P7J A;  1H3Q A;  4KQO A;  3LIF A;  1G28 A;  3EOI A;  3T4O A;  5LBR A;  2DMW A;  4UQI M;  2LB9 A;  3D3O A;  3CUE C;  4JGO A;  3EEH A;  2M7V A;  2GZA A;  3E4P A;  4CQH A;  1S66 L;  3ZYT A;  2Y8H A;  3CLO A;  3F1O B;  5F5Y A;  3G6O A;  3HJK A;  2OOL A;  3UB8 A;  1T1B A;  2OWJ A;  4LPZ A;  3U2A A;  4EXO A;  4PHT A;  2OAQ 1;  1OTA A;  2P04 A;  3DBA A;  3BW6 A;  4IHQ A;  3UB9 A;  4ETZ A;  5KSH A;  3LIE A;  5DKK A;  1TD5 A;  1TS6 A;  2O0Y A;  4E04 A;  2JHE A;  1UWP X;  3E4Q A;  1MKM A;  1EW0 A;  1ODV A;  2W27 A;  2WKQ A;  4ARZ B;  2W3E A;  3KSF A;  3CI6 A;  4ARZ A;  4WN5 A;  1S4S A;  4L0L A;  1W63 M;  3IBJ A;  2PT7 A;  3A0V A;  4MMN A;  2JKR I;  1F5M A;  1LSW A;  5DKL A;  4MCW A;  2V0U A;  4R6L A;  3K2N A;  1XFN A;  3SW1 A;  2PR5 A;  3R4K A;  3MQO A;  3LUQ A;  4I3A A;  2XSS A;  4NXE A;  5TJJ A;  4G3V A;  3FG8 A;  4LLO B;  1YKD A;  2O9C A;  3EGX C;  4HQA A;  5I5L A;  2PDR A;  2O99 A;  3E0Y A;  2L0W A;  3P7N A;  3RTY A;  1N9L A;  3C8C A;  3BQ8 A;  1OTI A;  4MN7 A;  4CLC B;  2JN7 A;  2GX5 A;  2W3F A;  2VGL S;  4O0P A;  4LRX C;  3PBN A;  4MN6 A;  3LYX A;  4I39 A;  1IOU A;  3S7Q A;  4ME4 A;  1ZHH B;  2VLG A;  4XT2 B;  1LSV A;  2QJ5 A;  2P08 A;  2W1R A;  2GNX A;  3H7W A;  4XT2 A;  2B02 A;  2VGL M;  3KSG A;  3NOU C;  1N9N A;  3FPV A;  5IT5 A;  4R70 A;  2QJ7 A;  2K2N A;  4EEP A;  2M7U A;  1DP8 A;  1F98 A;  4NXF A;  2K7S A;  3OC2 A;  3JVV A;  3OLO A;  4NXB A;  5DJU A;  3EGD C;  4R38 A;  4Q0H A;  4NEE D;  4K08 A;  3TW8 A;  2M1C A;  4DN0 A;  1XJ6 A;  3HCY A;  2OAP 1;  2VJW A;  2JKT M;  4HP4 A;  3UMD A;  2VX8 A;  2PYR A;  1TS7 A;  3PBR A;  4NXG A;  3TE8 A;  3BY9 A;  4BBV A;  2YKF A;  3E4O A;  4M4X A;  5HPI A;  3CAX A;  3T4Q A;  1UGU A;  5HZH A;  3T4L A;  5HWT A;  3CIT A;  2ZMV A;  3MQ0 A;  1D06 A;  2IA2 A;  3UB7 A;  1D7E A;  2PYP A;  1OJG A;  1XFQ A;  1OTD A;  2WKP A;  3IBR A;  2ZOH A;  4ZRR A;  3P01 A;  3H82 B;  4LRZ E;  2ZMF A;  3F1O A;  2QKP A;  3LR5 A;  4JGR A;  4RQ9 A;  4WEL A;  4O01 A;  3H82 A;  4DMZ A;  4EES A;  3KSI A;  2KDK A;  5HSQ A;  2HGV A;  4Z1W A;  1OJ5 A;  2ZOI A;  5AJG A;  4OOM A;  4PKY G;  2V1B A;  2WKR A;  1V9Y A;  1Y28 A;  1TF1 A;  4IUK A;  3H9W A;  2VEA A;  1X0O A;  5DF9 A;  5G4Y A;  5AVF A;  3R7W B;  1ZTU A;  3HJI A;  4MDZ A;  1NLZ A;  2BAS A;  2FZ0 A;  2QWS A;  3KX0 X;  2CMN A;  3MXQ A;  2J3T D;  3LIC A;  3LIA A;  3UME A;  5L8M A;  3RH8 B;  4WLA A;  2Y79 A;  3A0R A;  2W3G A;  3LR3 A;  4FSF A;  4PAU A;  1TS8 A;  3NOT C;  2ZBB A;  2K31 A;  2EA9 A;  4I5S A;  1GSX A;  1T19 A;  1H8M A;  1T1C A;  4H6J B;  4L9E A;  4IUH A;  5G4Z A;  3B33 A;  3OCN A;  4QPR A;  3PXP A;  3T50 A;  2OWH A;  2O9A A;  1OT6 A;  4EW7 A;  2HV1 A;  5F68 A;  2QYB A;  2L1M A;  3BQA A;  4JGQ A;  4CLC A;  3T4J A;  2D01 A;  2HJ9 C;  1NRJ A;  4Q0J A;  4HIA A;  5F69 A;  4F3L B;  1P0Z A;  2PD8 A;  4F3L A;  2W1T B;  3F1N B;  4WUJ A;  2I9V A;  4EU0 A;  3ULF A;  4UEY A;  1V9Z A;  1WA9 A;  1XJ3 A;  2W1T A;  4DJ3 A;  4CLC C;  3MMH A;  5HD3 A;  1XJ4 A;  4G3K A;  1VHM A;  5HDC A;  2NUP C;  1T1A A;  3LR0 A;  2V9A A;  1KOU A;  3OBF A;  1UWN X;  1OTB A;  4I38 A;  2FH5 A;  4II7 A;  1LSX A;  2KLI A;  1DRM A;  1MC0 A;  1YAX A;  5HPF A;  3UE6 A;  3LFV A;  5A8B A;  2EWW A;  3EEA A;  1DP9 A;  3B42 A;  3TRC A;  5KIZ A;  3KYZ A;  4R3A A;  4BBU A;  2GJ3 A;  5IS1 A;  5DJT A;  1S1Z A;  4KUO A;  2L4R A;  3O5Y A;  3PBO A;  3PBQ A;  5HL6 A;  2PHY A;  1W63 Q;  2KOI A;  5TBM B;  3V67 A;  2VV7 A;  1TS0 A;  2VZW A;  1S4R A;  3VE4 A;  3FC7 A;  3PBS A;  4EEU A;  4WF0 A;  3KO6 A;  4GHI B;  3T4T A;  2NUT C;  2H28 A;  3IS2 B;  2A24 B;  4GHI A;  2R78 A;  4HI4 A;  4BJP A;  3MQQ A;  2JKT I;  4L9G A;  3C38 A;  4EUV A;  1VB6 A;  3JVU A;  3S7O A;  5MC7 A;  2HF6 A;  2HJE A;  2XRN A;  4HJ4 A;  4KQD A;  3S7P A;  3CUE A;  5J3W A;  3UB6 A;  2V1A A;  4NKP A;  2G7U A;  2VKS A;  3S7N A;  4HH2 A;  2PD7 A;  3BY8 A;  5DFY A;  5EFW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...